3K1KC

Green fluorescent protein bound to enhancer nanobody
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
QVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green Fluorescent Protein
publication title Modulation of protein properties in living cells using nanobodies
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein/immune system
total genus 26
structure length 114
sequence length 114
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k1kC00
4PY8J 3MRCA 5CIPH 4JRXA 4KRPC 4MD0A 3TIEB 4L3EA 1H3GA 2IAMB 4OLXL 4YPJA 2CLRB 4LRNH 1IGCL 2QSCH 5FECA 3V4VL 4Y1AB 5SWQA 1MI5E 3RJDA 1MJUL 4Q7DA 4UILH 4FQHA 4U1MB 3HI5L 1K4CA 1KSRA 3ZDZF 3HB3D 2YD8A 5D9SB 3HG1E 5IMKB 3FFCD 1FFPB 5E8DL 5FOJA 2EXWD 1EFXA 4LF3B 1Z0MA 3RWFB 4LSVL 1BQUA 3QCTH 3QRGH 2IFFL 2F53A 2W9LA 4Z7UF 3BPNB 5I1AA 2NY5H 3MBEC 2DI8A 3UZEA 1J5OH 4XPTL 5E6ID 1TZIA 1BFVL 4X6EA 2CK0H 4X4ME 5CINL 4Z7OF 3ZO0A 1YEHH 4HT1H 4AH2A 3PDDA 5DEFB 5HGDA 3RZCB 4NZTL 3CMOL 3GSRB 5E2VH 7FABL 2DQFB 1OVZA 4MJIB 3WD5H 4JFEA 4M1CD 4NQED 1AGDB 4BM7A 2F5AL 3GHBL 3UJIH 3FQRB 1C5DA 3RPIB 1WWAX 2EICA 2YEZA 4OCYL 3TN0A 5I8CA 2R9HD 3C5SB 5T3ZE 1WIOA 5I76B 1CICB 3M1BB 1QR1B 2AK4B 3PWJA 4XHJD 1JE6A 1P4BH 2V7NB 4NKDB 2VL4A 1QSFD 1RULL 1OSZA 1OAXL 1LNUB 1C5BL 4HS8L 3PABB 4R26H 1D9KD 1TENA 1TVHA 3QXUA 2YSSA 1A1NA 4K3DH 1FPTL 4I18B 4J3OC 2GCYB 2GK0B 4QYOB 3FT4B 4S2SA 1HINL 5D1ZB 4KU1A 1ERNA 3MLXH 1CL7L 1VFOA 3WIHH 1JTTA 2CGRH 1AGBA 3TV3H 5INDB 1X44A 4RAVB 1CZ8H 4WCYH 5EZIL 1I9JL 4M1DH 3O45B 3WNKA 3Q1SL 4CKVX 1S7VA 1D5ZA 2VH5H 5JDSB 4Z7QE 1MEXH 4OLYL 3I2CL 1BZ9B 1G7QB 1U8PA 4JM2D 2D7TL 2P46B 2FB4H 4OI9A 3S4SG 3VFMB 2E7HA 3VFSB 2R1XB 1YY9C 4WFHD 2R2BB 3QUMH 1CU4H 2A2QT 1RUPH 1VFAA 4PRAB 1NBVH 4JFYB 2ADFH 3C9NB 5K59F 5LQBH 3OB0K 4CU6A 2DTSA 1BQHA 1P6AB 2B8OT 4PS4L 5LGKA 3BZEA 1JHKH 5JZ7D 3STBA 3T77A 5D7LE 1XF3A 1EEUA 5FO7B 4P2RE 2P5EA 1W8NA 4UDUA 3VXNB 4AMKH 3UTZA 1TJIH 4WO4D 1XH3B 1HQRA 5DF0A 4V1DB 1FL5A 3WBDA 5IB3B 3BVNB 5LAXB 2DTML 3P4LA 3W11C 3SE4C 3HPJB 4P59L 3K0WA 3P40A 4ORGB 43CAB 2QSQA 2LTQB 3HMXH 2PTTB 1T1XA 3QAZC 4JPWL 2HMIC 1FL3A 4LKCA 4F7MA 2AJUL 5D2LA 2NYYD 3IKCB 2NXYB 3IJSB 3DVNA 3S3SA 4ODWA 4OZFA 2NY6B 5BOZG 3P9LA 5KZCD 2UUDK 2HA1A 1MY7A 5HI4C 3ZYIA 4KRPD 2PCPA 4UT9L 5FCUL 3S4SB 2H2SD 3RGVB 3UYRL 4JFOA 1QG3A 1NEUA 2V7HB 3PQYE 4J2XA 1C08A 3CLEL 5AG9A 1RV6X 1I7UB 3CZFB 1ZSDB 3QUXC 1AIFB 3MGTB 3D2UA 2GSGB 4OIIL 4TUKL 1AQKL 1ZA3A 3MA9H 4XAWH 1ACYL 4P23D 3CVIH 4GW1B 3X14A 4KPHL 4UT6H 3BGFC 4G7VL 2X4RA 3TVMD 4X6CE 3MRLA 4HUVB 3MRHB 3C60D 5D7SH 1FZOB 2HJFB 3IDYC 4QRSB 4AK1A 1TQBC 1ZKAA 2OSLB 4JLRB 4MB4A 5HI3D 4HCRL 2K3TA 4WDIB 4HMDA 1PG7X 1Y0LA 4NO3A 4FQQB 4XCYA 1CGUA 4RWYH 3RWEB 3KLSA 3RFZC 5DQ9A 3OAYH 1DBAL 3L3HA 3VJ6A 4AG4H 4NC1E 1A2YB 4GXUM 1H5BA 1C12A 1DBJL 3HPLB 3IYLW 4AL8H 4M7LL 4OQ1A 3BE1H 4U05A 1YNTA 1Y6NR 2Z31B 1QZ1A 4ZFFB 2QHRL 1LEIA 2FEDC 4F9PA 1DQTA 3A67L 4X7CC 3MV9B 3VXRA 2X7LA 4L4TA 2HG5A 5ANMA 3GFUA 4ONOA 4NWUL 4R7DB 4PP1C 2AV1B 4RFNB 1WCBA 3AGVA 3U7WH 1JZ3A 1O7SA 4XPFH 2MPAL 4Y5YA 4CW1B 1TCRB 3HNVH 3MV8B 2MCG1 1I8IB 4EN3A 3MREA 5T1MA 4KGJA 3QXWA 4AQOA 5FYKE 3NOIA 5E6ZA 1REIA 5KS9A 3HUJB 4GLRI 4CN6A 2R15A 2CKBB 4MZ3A 1CGXA 3F62A 3TBSA 4I3RL 3FT2B 4NWTH 5E9DE 3WXVL 3E6FB 1YN7A 5FK9A 3WFEH 4Y2DC 3BD3A 4LAJH 3BO8B 3R1GL 1NBQA 5IHZB 1MQ8A 5FA3B 5KW9L 2V5MA 3VFRB 5MERB 4X0KA 4XGZA 1BVLA 1X9QA 3OR6B 5I1LA 3KPLA 3GMRA 5E8PA 2A38A 2GSIB 2Y9RT 1ND0A 4XPGL 2RFXB 1YY9D 3QT2A 2OJEB 3HAEG 3SGDI 1BBDH 4G8GB 5DFTA 4HWBH 2NLJA 1T5XA 5HYSG 3SE3C 1KTDA 3WHXB 1B4RA 1V8HA 4OUUA 3E2HC 2VABB 3HZMA 2FLBT 1CDYA 1INDL 5MENB 1YEDB 3K8MA 1N6VA 1NMAH 4WW1B 2X4TB 3D69B 3MR9B 4NPYA 2UZIH 3BISA 2D7OA 3QUKB 2YHGA 4LIQE 4EUPG 2EO1A 2NY5C 2PXYC 3LKNB 4LLWA 3VXUB 1I8MA 4OBRA 1W0WA 3NPSB 4XVJL 1IAIL 3C09B 3EYOB 4LFHG 3GM0A 1OSPH 1R0AL 3LN9A 5IKCA 1PZ5A 5JIPA 2Q1EA 4MA3A 5FO9A 2C1OB 4ODSL 5B3NA 1UT9A 1HNFA 4U1MA 5DS8A 3LRSA 2Y7QB 1CGYA 5IWLA 3RWCA 3O41A 3L5IA 4OF6A 5F7EL 1T22A 2D3VA 1IKFH 4K55A 5DC4B 4H8WH 4JDTH 5DQDL 5CKGA 2CD0A 3TNMB 5HI4D 4G8EB 4GQPH 3BKMH 4DKFH 4JO3L 2QQLL 2YPVL 4PGBB 1E4WH 2VKWA 1A0QH 4Q9QL 3C2AH 3QFDB 4PD4K 4Z8FH 2ICES 2UYLB 3QUXD 5HYSB 2M8XA 3FL7A 3N1FC 4Y16A 2A83A 3GSXA 5BRZD 1UWXH 5IVNA 1X3DA 2W65A 5E2UL 1T80A 4ZD3H 1MHHA 2W9DH 3V6OA 4BA8A 4I8DA 5FYLL 3GSNB 4PV8A 1Z9LA 2DQTH 3OKLA 1P1ZA 4G6JH 4HKXA 5CZVH 2BNRB 2BRRL 1PG7H 3CXHK 5F8RC 5GSRB 4ODVL 1F4XH 4RDQG 4JDVB 3QIBB 3BXNB 2FH6A 3MV7E 3D25A 1H3UA 1YMMB 3QIUC 4XBPA 3VXMD 3ZKMD 1LDPL 1NGPL 4YR6A 4JKPH 4PJDE 3BX7C 2Y4SA 2IPUK 1LNUA 5GRUH 1HKLH 1HWGB 3PABA 4LARL 4K23L 1NC4A 2EEBA 1GZPB 3AS3A 1AHWB 3OPZL 1AGCA 2CIIA 3U83A 2D7PA 3EBAA 3ARGA 4QYOA 4Y8DC 4LLMB 1KCSH 1H3XA 1R3IL 4PJCE 4GQ9L 3BP5A 3UAJC 4X7EC 4M7ZC 3O2WH 4I4WA 5K33A 3INUL 3U7YL 4P5TA 2XWTA 4XC3L 4KDVA 2MKWA 1Q9LA 3CVHL 1AGFB 3UTTD 2YC1A 3EO0B 3WN5A 1NMCC 4OB5H 3MGOB 3VFSA 3TZVD 3UPRA 1JHTA 3AU1B 4E9LA 1P9MA 2AJYH 4PRAA 4H5SA 4N0UA 5HYJA 5KJRH 5CSZA 3MX0A 3DROA 4K2UL 2VDOL 4NKIL 3RDTB 3G6AA 2CR6A 4MWFB 2EC9T 3GMPB 4OZGF 1OGAB 3PP4L 5GIRB 4WI2A 5MP6L 4J1UA 4LSPH 5F6HJ 1QRNE 4YHNB 4Y2DD 3TT1H 1X5AA 4U2ZA 2EDRA 1S7RA 3MXVL 3LEXA 3O6ML 4DTGL 4JR9L 2VSDA 3HC4H 1T6WA 3R0NA 1BVKA 4M7JH 2EIEA 4JPIB 5SWSB 3BVNA 3QI9C 3C5ZB 3QHTC 5DQJB 3I3EA 2R0KH 1IT9H 3DYMA 4K3JH 1Q94A 2DMKA 3L3OA 3WNLA 2X4NA 4PRIB 2APFA 2JJVA 1GGIH 4HUNB 1BZ7A 3KJ6H 4F15B 1OARH 1ORSA 4ELKB 3TWCL 3QYCA 4YQXH 4GS7B 4GKSA 4U1KB 1QYGL 4EZMA 2A6DB 1HHIA 4TQEL 5HDLA 4JZOB 4U1IA 1JPGA 4QXGH 5I9QC 1NMBH 2DQGL 4XXDB 1FE8L 5DUPH 3O3BB 5BVJA 3P4NA 3DIFB 4XVSH 3RU8H 5HVGB 5LGHL 4HCRA 1WAAE 2CLVB 1HXMA 2MQ0A 4IEFB 3SJVD 5DJ0A 1ZTXH 2GTWB 3CGTA 3RPKA 4GW1A 5FKAA 2UWEE 3IKKA 5DJ6B 2WQ8A 2YRPA 3PDOB 2NW3B 2BFVH 5CBEA 1HILA 3JXAA 3O3AB 1UXWB 1R5IB 4PLKC 3SGJA 5EIIB 1Q0XL 4QRSA 2VKXA 1H9VA 1YUHA 3BH8A 2Z35B 3HTLX 4HDIB 4WHCA 3G5ZB 1KNOA 3G5VA 1J87A 4GT7A 4LVNB 1D9KB 5IQ7H 1KF9B 1PFCA 1G7PB 1MCDA 2CLZB 5IG7B 1A2YA 1ZANL 3O6KH 1LEKB 1DVFC 1NL0L 5SX5H 5I71B 1IM9D 5DRNB 4PRHE 5HHMB 2OI9C 3IDMB 4HS3A 3ES6A 3TO4A 3IVKB 3UBXA 2YD2A 5DJCB 4KJYA 3LH2L 4PJFE 1IQWL 3MV9A 1P6FA 2Q6WB 4ZXBB 2ARJQ 3CFDB 3RL1B 1Z5LA 3A6OA 2AERT 4PGCB 1L9NA 4X8XA 3ARFA 4G5ZH 3QIUD 2WUBL 2CR3A 1L7IL 4JKWA 3IDIB 4L8SC 4XP1L 1LE5A 4S1QH 3BZFA 4NIKB 1MFCH 5LGJB 1CF8L 3DRQB 4KTEL 1TJHL 3BESR 4WWKA 3UJJH 2VXTL 4D0DA 5JOFB 3KJ4B 4I2XA 4QOKB 1FAKT 1QFHA 1MCHA 3ZDXE 5DK0A 3WJJC 4F80A 4HG4J 4A6YB 4PJ8C 5EH1A 2FH8A 3DURA 3FAXA 4R9HA 3E6FA 3UAJD 4KROC 1JWUB 2WANA 2OJZL 4I1NB 1MWAH 5IHZA 1PGRB 5MERA 3CPLB 3Q5YA 2F54D 4RQQA 4J6RH 1BWWA 4F2MB 1WFUA 3CUPB 4NCDA 1AXSB 1UCBH 3BIAX 2MTPA 5ALCL 4L4JA 1I3GH 1WBYA 1IMHC 3BZ4A 4U0RB 1Z3GL 1CLYH 3MRMA 1GHFL 3BQUB 5D96B 4MCZA 1ROWA 1P2CB 4UUJB 1XGYH 2CDEA 1A14H 4NNPH 5D93C 5F9OH 1T21A 1BD2E 1CD8A 2FATH 2VABA 3GSQA 1FRGL 4H8WC 2ZPKL 3EFFB 2X4TA 4JEGB 3CX5K 5EU7C 4X6BA 3OGCA 5IJVB 1VKXA 4IRSD 1KTKE 3ABZA 1L6XA 2Q8BL 4APQD 4JB9H 3G6JE 3DMMB 2BX5A 4NP4H 5DR5H 3JUYA 3MNVB 4P23B 5DZOA 3TYGL 2YPLA 3QI9D 4I0PC 4ODUA 3TVMB 1HOCA 5E00B 5IB5A 3L95B 2KZWA 1LK2B 1P84K 5DMKA 1LVEA 1I1AC 2DLHA 1CD1B 5JHDE 4OZIB 2IQ9L 2JJUA 1NANI 1SEBA 1K2DB 4MAUL 3QFJA 1FIGL 2VLRA 1A7OL 4MA1B 3JV0A 2XYCA 3H9SB 3QXVA 4WW2C 4TVSa 4OLZL 5LCVL 4RGMC 4G8EA 4FFZL 5J57B 3DXAD 4XMPH 1FVEB 1KCRH 4N0RA 3B5TA 3P4MA 3REVA 2AJVL 1VEPA 3VWJA 4MQ7B 4PJCF 4FQXC 2UYLA 3S35L 4LDOB 5L88L 3OXSA 3H42H 3DO7B 4PJHE 3GRWH 4XMLH 4E41E 1A1MB 3P30L 5L2KA 3L3GB 2BNRA 3OKYA 3ZKQD 4P5KA 4XC1H 4OZHB 4PLKD 1MCPH 3SCMB 4DCQB 3OZ9L 3I9GH 3U1SH 3BKCL 4JO1L 4UIKL 1J8HB 1JIBA 2VQ1A 1T3FA 4NQXA 4P2QB 3U79A 3MYJA 2NNAA 2KBGA 4C56A 3BP4A 3OAUL 4HX1B 3VMNA 5T1LD 3CVHA 3FJTA 1GZPA 3T65A 2LU4A 1S9WB 1TVBA 4LASL 2P24A 1DDHA 3B5GA 1FNGB 3EFDH 5I17B 1K6QH 1INEL 4FQJH 4O9HL 2M2DA 1DQLL 4L3CA 2R29H 4KZEL 1CDJA 4LSUH 5HJ3B 4OQTH 3LEVH 2VAJA 3OF6D 3PWPD 2FR4B 3T3PF 3GSVB 3EOBB 1K5NA 2ITCA 5C8JB 3MGOA 3Q3GA 4U3CA 3U0PA 3V95A 1WT5A 3TN0C 5LKNA 3AU1A 5TFSL 4OFYA 2R1WB 3L3DB 2WP3O 5J0BA 3EYVB 2GW5A 2BSSB 3FQXA 4YFLI 4Z95H 3QEQD 3CH8A 4C83B 4N0YL 2BOCA 3AXLB 2D9QB 1A6UL 1DLFL 4F7TA 5A3ID 1JGVL 2H8PB 4BZ1H 5IV2A 4HBCH 4F33B 1KEMH 2L4OA 2Q76B 1ZWIB 2YA0A 2O5YH 3VH8B 1MRDL 3MOAH 4KK5C 2CRMA 4XXCC 3WLBA 5C0NC 3FFCE 4XP9L 1KN2L 3DX8A 2LAGB 1N64H 4Y5VA 3NZ8B 4HUUB 2XRAL 4NKOA 1D5BA 1C7SA 4K07A 2VISB 1B0GA 4ONFL 3LCYA 1WWCA 1EVTC 1T04A 4EQ3A 2G2RB 2A1WL 4WHYG 4ZO9A 4WI7A 2VDNH 1VA9A 4TNWF 4ELKA 1FH5L 2H2PC 1A6VL 4PJGA 5BCAA 5JIKA 1MFEL 5EU6D 4LQFH 4JZOA 4FQ2L 2VLLB 4O2FB 3QNZB 3T2NH 3QIWC 5H94B 4Q9RH 5C0EB 4FFYL 2JLLA 3O3BA 1T89A 5L8KB 4M5ZH 1PD6A 3VFUA 5SV3A 2JJSA 4YDLC 5TGBB 4ZO6A 3KLAB 4F7PB 2H1PL 2VJXA 3IFOB 3JV6A 3QG6B 1XR8A 2ADJB 4O2EA 1LDSA 1PZUB 2AEQL 1HDMA 2ZCHH 3PDOA 3R8QA 5TH2A 4FXGA 4UT7H 5F7WC 4MZ2A 2QKIB 4LEXL 3ZKXC 3U36B 1DBBH 1UXWA 4ODTL 4YXHL 5KSAB 4Z7UA 2R56L 2WBJB 5EU3A 2W92A 5JLZB 1BAFH 4HDIA 1G7MA 2HFEB 2XG4A 4OBSA 2WAHA 3CMGA 2G75A 5IHUL 1IEAB 4HD9A 4PP2A 4M8QB 4NO0B 4WUUD 3X12B 3V52L 5DD6B 4HLZH 4RRPA 1JUFB 4TPRH 5FYJD 4U1SB 2FX8H 2NY4B 2Y1VA 2VB5A 3QXAB 4OM0H 3JWOL 1UACL 2BSTA 2VLJD 5FM4A 1WIUA 4LCIH 5IVZB 3BSZL 3TZVB 4PGCA 5EC2B 5AEAA 1A7QL 1CIUA 3F8UB 4K3GA 5TE6L 4HAFA 2VZ3A 3O9WC 1P69B 5D7LB 1HHGB 4WTXA 3DRQA 3V6ZB 1AGEA 2EDHA 4R6UA 1X7QB 1MNUL 1CDUA 4QOKA 5ISZB 2XWBB 5I75B 1X6NA 3UC0H 4L8CB 3DRTB 2DS4A 3MLYH 4HXBH 1KCUL 1YN6B 5JR1H 1XMWA 3RVWD 5DD5L 2VE6A 5DJ8B 1JWUA 2XQBL 4ERSL 1JPSL 4GAYB 4Y8AA 3TJEL 3G6JF 1I9RL 1SMAA 4PG9B 3CPLA 3N0PB 3CUPA 1OTSC 2BVTA 1M1SA 4IS6B 2WW8A 1ETZB 4K9EL 4CAGA 1QBBA 1F13A 5BS0B 15C8H 3CZJA 4PLJC 3LD8C 1AR1C 1JWSB 4D0CB 2ZOKA 2C3HA 4JCLA 5C70A 3UO1L 3MLUL 2BOBB 4YGVA 2BVUA 1F8TH 3LHPL 4IDJH 1GIGL 5A16A 4QCIA 3LKRB 4RIRB 2EDKA 1SBSH 1VFBB 4TSCL 2P48B 3S96B 1R6VA 3K2MC 1BFSA 3VU2A 4X6CB 2F74B 5C0ND 3VW3L 1ZHNB 3MV11 4PB9H 3SJVB 3PWUB 2BHZA 3AC0A 3MNVA 2ILLA 5DVNA 1B2WH 3R0MA 4MDJB 4L5FL 5JMOC 4O4YH 1I8LC 3ILQC 4OGAC 3RAJL 2X70B 5TF1L 3ZE0F 4Y2OA 5IIEB 4MNGA 1KJMA 3KPMB 4TULH 1AE6H 4G8IB 5CKAA 1DQMH 4HUMB 2H2PD 3LSOB 4HK0A 4R4BB 5F9WC 3LOWA 2XNAA 3CXDH 1G7HB 2QSTA 3QIWD 5FO8B 2XZQL 1KG0B 2A0LC 3E8UH 4YO0A 4MQ7A 4JZJB 4JHZA 4XNXL 3A6BL 3GBMH 5HI5C 5CLWA 3LY6A 3WDJA 4HWNA 2WZPD 3X3GL 3FQTA 4CU8A 2PR4H 3RWIB 1TFHA 4ZS7L 3RX7A 4HFWB 3IGAA 2DICA 2XTJC 4YE4L 4J23A 1JF1A 1G7LB 3RGHA 3JTSA 3LPWA 4BSVB 3LS4H 4XCFL 3L3GA 3I6GA 2DJUA 5DUBA 2DM2A 5K9KB 1NFKA 5J1SC 4YHML 5J12C 1A6AB 4F3FB 4GRWE 2EDTA 3PGFH 4PJBB 3VD9A 3GEWB 3LAFA 4RDQF 3D48R 4Q9CA 4D0BB 4PLOB 2VZUA 4JFFA 1K3IA 1N2RA 3QUYA 3SDXE 3RWGA 2R23B 5J9PB 1CR9H 1FGVH 1NAKH 5EZLB 3O11A 5D2NB 5F7KC 2DQJH 5T1DL 4R0LB 2YRZA 5FYKL 5GQBA 1AI1L 2NR6C 1TPXC 5T33H 2OZ4A 5I1DA 4JHAL 2FNBA 1R24A 3RBSA 4HIXL 3ZZ1A 3BRFA 5I74B 4BUHA 2VLME 1KB5H 4JRWA 4LRIA 5FDWB 2AK1L 3QCUH 1C8PA 3CH1A 4DW2L 3FOLA 1UADC 4Y16C 3FN0L 3B9KC 4DKEH 1HZHH 5HHVH 4QXUL 1KCVH 3DGGB 2MKLC 2AGJL 2DIBA 2HWZL 5DVKA 1MIEL 2ZCKL 3EJYD 1JGUL 3W39B 4DOHB 4NRYA 4K3EL 4Z0XA 3WIFB 1IARB 3O9WD 3MLSL 3LQZB 3S8WA 4UQ2B 2DYPD 1S7TA 3CFCH 4NZRH 1BGXL 3MODL 4YAQB 2EH7H 1ZT7A 5ID0A 2ZP0T 3OAZH 4PBXA 4GKZB 2XA8L 4JG1H 3S34L 1NBZA 1V5JA 3QWRD 1MVFA 1LO3L 3CU1A 2CDFA 4C83A 1M7DB 3ILPB 5ALBH 2VDLL 3G9VA 3SPVB 1MI5A 4F33A 4QRPB 2Q76A 5D72H 2F5BH 5M95B 1J1PL 4APQB 4F58L 2QADC 1Q9OB 3HA0A 4P4KB 1EH9A 4XH2A 4LIQL 4O58H 5BV7L 2IEPA 1DQQB 3HG1A 4FQ1H 1UWEL 3NZ8A 3C87A 4M6OL 4UOW1 1D5IL 3DVIA 3MYZA 5EO1A 2OBGA 2VXVL 3FKUS 3QWOA 4PLJD 5EZJA 1AR1D 3LEYH 5C92A 4KDTC 2NXZD 5I1KH 2C1PA 1H8OA 3MOBH 1HIML 2I5YH 3IF1B 2F8OA 1II4E 1CCZA 2APTA 1M7XA 4YDIH 1UVQA 1XCQA 3L3JA 4X4MA 1F02I 1UM4H 4NM4L 2X4UB 3DXAB 5CEZH 1HWHB 4MD4A 4EOWH 4JHWH 2LE9A 4PJAE 1IC4H 1A1OB 4KUZH 1LO2H 1PX4A 5I30H 3MXWL 1KJ2L 3SDCB 1MCWM 5C7XH 43C9A 4OV5B 5TGBA 4RMQA 4JM2F 4QF1B 3SGEI 3SDAA 1OTUC 1SHMA 4XPAL 3KPRD 3QA3B 1DE4A 3TP4A 3VXME 4B7LA 3TM6A 5BMFH 2YZ8A 3F7VB 4OGAD 4HS6B 3QXDB 4GJTB 2OR9L 2AXGB 4D9QE 4X9HA 4ZNCD 1T03H 2W1NA 3NZHL 1XF5A 4G80B 1B0WA 4K7FA 1RK1A 5GGVL 1NDMA 2BVQB 4ZDHB 2R2HB 4IRZL 5JLZA 3QDMD 4HPOL 1ZEAH 3LN5B 1ULVA 3MACL 5C0BD 2D7NA 4Y4FC 2I26N 5T1LB 4NNYA 2W60A 1IEAA 1JI2A 2A0LD 5GISL 3W2DL 3X12A 4FQLH 4HFUL 5EZOH 4DGIH 5IFAL 3UTTE 1CBVL 3HFML 1UM6L 2A9MH 1FG2B 4Q0XH 5FUZH 1U8NB 2NZIA 1U3HC 2XTJD 3VFVB 4W6YB 5HHNB 5CGYC 3DX6A 3MCG1 3ORJA 5C0RL 3OKMB 4M7LT 2H9GB 1AD9B 3NCMA 1KLUA 1UJ3C 4GG6F 2EYRA 1ADQL 3CLFL 1OGTB 3NACL 1KELH 3KLHC 1HQ4B 2FBJH 4EDXA 2DKMA 2IPKA 5D7LA 1TITA 1QFWH 4IHOA 2DMBA 1C1EL 4P2RA 5IK3B 3RTQC 3MUJA 5H37H 3MFFA 1ZE3C 5H2BA 3FAWA 5ICXB 5B39G 1QR4A 2NR6D 4ZUSB 4KI5C 3ZTJH 5JIIA 1AY1L 5EG6C 2CJUH 1WICA 1LO5A 2BSED 1DBML 4Z0BL 1G1YA 3PV6A 1R3KB 3DSFL 1N3NB 3BN3B 4RBPK 3DECA 3BWAA 3GBNH 4FTVD 4PG9A 1X5LA 4CGTA 5JORA 5KSBF 4EKXA 2WWKO 4LSTH 4Z6AT 1JK8B 4QRTB 4OLEA 4HC1L 3DVGB 4IS6A 3AAZA 2CUIA 2ZKHL 1IAKB 5DSCB 1QSVA 1RHHB 3MCKB 1B4JH 4U1LA 5T3XH 1F3JB 4ETQB 3BT2H 5EO0A 4MS8D 1JFQL 3PQYA 4G6FD 2AI0H 4X6DE 3TBYB 2VLKD 5CILH 4AIXA 3TPUB 3LKRA 5F8QC 1XGUB 1VFBA 2QADD 2UWEB 3B9VA 3S96A 1U3JA 1IGFH 3HS0B 4X6CA 3T0EC 4U7MA 1DBKH 3MLRH 4PJ7B 2DOCA 1EO8H 1VPOH 4ZYKB 3TJHC 5JDJA 2P5WE 3KPPA 1WEJH 4JE4B 4TRPH 1M7IA 4P46A 3FFDB 4XTRC 3VI4E 4LLYA 3TBWA 5TQ2L 3K4ZA 1NGWA 3BPCB 5D8JL 5EIQA 4GRWF 5IIEA 1MJ7L 3RIAK 4K7PL 4JM4H 2L7JA 1NLBL 5GS1B 3FO0H 3DSNA 5TPWL 3SDDC 5B8CC 1KIPB 2VIRB 3SDXF 3BW9A 4R4BA 1RUAH 5HHOB 1A4JB 1NUFA 4GMSL 4QHKI 3MUZ1 4PRHB 4M7KH 3D0LA 5DMGC 2ICWI 1OAUH 1SVZA 4NHUA 1RJZA 1MRFL 1CDBA 1QVOA 4M43L 3QG7H 3B3IB 4NQCD 2BJML 4O00A 5ID1A 4JJ5B 4W4OA 2A73A 5FV1L 1LO4H 3U9UB 5BO1L 1A7RH 2NY3B 4BH7B 1A21A 4U6VL 1U8HA 4HUXB 3G5XA 4LCWD 2DL2A 5JUEL 5DMIH 2DDQL 4NKMA 1JZ4A 1QOKA 3MC0A 5TE7L 4YXLL 2CUHA 2I07B 1JWMA 4P2OB 5MEQB 4LQ1A 4Y4FD 5AD0A 5E5UB 3GIVB 4OLUL 5E9DA 4YUEH 4JFXA 3FONA 2R23A 1WLHA 2OQJB 5FB8B 2VDRH 2F54E 1ZOXA 2Z91A 4IIQA 4MXWL 2FO4A 3B83A 1YECL 5IFJB 2H6PB 4ZAKD 1IC7H 2L0DA 2VTFA 4PRNB 1U3HD 3CCHB 2JB5L 3ZT6A 4RISL 1UH4A 5FDWA 5CBAA 1OQOA 5IF0B 3BGAA 1IM3B 1QLFA 1L9MA 2YUZA 4OIBA 1ZT1B 3DGGA 4HIJA 5DUML 1ORQA 2PO6C 1J86A 4PGEB 1IGML 4JZNB 3UTQA 4EI5C 2FJFB 1SQ2N 1Q0YH 4HH9A 4K8RD 5GZOD 1KIQA 3LQZA 4GBXC 1UM5L 2OR8A 3BDBA 5C9JB 3PJSA 4ELMF 2RBLA 2JE8A 4JVPA 1YY8B 5I66A 3ILPA 3R06B 4TSAH 3ULVD 1FAIL 3SPVA 2DLFL 4L9DA 4NO5A 1S5IL 4H20L 5D6DC 2B5IB 1Q9WB 1MF2L 3CFJB 3V2AR 1RIVH 3UZVB 2ZUQC 4XVUD 3KYNA 4PJ9C 1WC7B 5DC9B 1CD0A 1PKQB 1B9ZA 1FLTX 4H0GA 2AP2A 4FFWD 5TDOB 2WIMA 1T7VA 1NJ9B 4KRMB 4FQCH 3X13B 3VXTB 4QHKJ 4B5EA 3TA3B 4XP6H 1A3LH 1OP3K 4L4VD 1FDLL 1KJ2A 1RUKH 3RUGE 3C8HA 1VEOA 1LP9B 3MJ7B 3PHOA 1IAOB 4EIGB 3RA7L 2JB6B 3BDXA 5GGUA 3D6GA 1NCWH 12E8H 3O8XA 2VAAA 1ZHKA 3VCLA 1A9EB 1RHFA 2OZ4H 3O6FD 4Z5RA 3QUZC 1CFSA 3T0ED 3FQUA 3VXSD 4MVBC 5BW7C 1S7UA 5HTSA 1JNHA 2IBBA 4QF1A 2AABH 5AWNH 3MV7A 2WINB 3DHMA 1T4KA 2E9JA 4R90H 3QA3A 5JW5A 1BEYL 2FGWL 1DP0A 5GS0H 1XF4B 4PTUA 3I02B 4PJDA 5FOBA 4NRZB 4LPUA 4G42A 1OWRM 5SWZB 3MUHL 5DD1L 5ACZB 4IMLB 3SDDD 3ME0A 5DDHA 5CJQH 1PSKL 2D0FA 4GKOA 3DV6B 1Z9OA 3WL9A 2A6IA 1R3JB 3LKPB 4PJCA 1TXKA 5DMGD 4Z77B 4RNRA 1EAPA 1NCAL 3MLTA 1FVCB 1X6LA 1PY4A 2HH0L 3ARDA 3HN3A 1G0XA 1Y6MR 5ADPL 3KGRA 2ESVA 1ADQA 4RAHA 1NUGA 1PEWA 3DBXA 2DQEL 2NTFA 3KPQA 4M6ML 4NKQB 3AB0C 3UTOA 1MJ8H 4H1LG 5C0AD 1X5JA 4OCMC 1KB9J 2VITA 1OTTC 2AXJA 2COQA 5CAYB 5HHNA 4TUOA 3WSQL 4NT6B 1BJ8A 4PREA 2EIBA 5C07D 1HKFA 1E27B 1P4LB 4UB0H 4G7YL 1CG9B 1QACA 4MAYB 3O2DA 3QEQE 1NGXB 1K8DB 2J88H 4YJZL 3JWDH 4NO2B 4U31A 1HXYB 3P73B 4BZYA 5FHAH 1XIWD 5F7FA 5E99H 5I1GH 4X5XA 2XPGB 1I1FA 1QRNA 4QNPF 2IANB 3UP1A 5IK3A 3R8BB 3EOAB 1V7NL 4LCCB 1BM3L 2I60H 1DN2A 4UIMB 4X6DF 1A3RL 1HHHA 3B5HA 3WNMA 1TZGL 2VZSA 3WFDH 1R3HB 5F3BA 3V4PL 4YZFF 4PY7B 2GK2A 2A74A 5E1AB 2SEBA 1VENA 5DHYA 2I9TA 3T0AA 4LSQH 1GC1H 3WHE1 1FO0L 1TNMA 4PRPD 1YJDH 2F19L 1J1OL 1U36A 3BIKB 4QRTA 4RZCA 2R1YA 3EHBC 2PO6D 4Q6IB 4EI5D 3MO1B 5EU6E 2GJ6B 3OKNB 1E4KC 4XHQA 1BQLL 4GBXD 5D71H 1PBYA 5EU7E 4NZDA 2K7PA 3EDFA 4P99A 4WU7A 2PYFA 3UTPD 2WQRA 5IJKA 1EUUA 4IRJA 1NC2D 4NQDD 1CK0L 2H32H 5FXCH 5IBUB 5CEZD 2R69H 3VRJA 1WAAA 5D1QB 3RL2B 3G08B 4A2LA 1T2QH 2UWEA 4WFFE 1KYOK 3DJ9A 1FYHB 4PJBF 3L5HA 5ESQB 5F9JB 1IVLA 1Y18A 4ZYKA 1I4FB 5DRXA 4PJ5D 3W0WD 2O5ZL 1G6RB 4XBEL 4Y4HC 3GNML 3WE6B 4XNYH 2BNUB 4S1SH 3U46B 1GXEA 1ZLSH 3RI5K 3QHZH 4BFIA 1SJXA 1N4XH 4FG6C 5I1JL 4WUUE 5F1SA 1YEKH 1KIPA 3M07A 4QTHB 4UV4L 3U48A 5JIHA 1WBZA 3OJVC 2AJ3B 4P4RA 4KMTL 2MHAB 3MROB 4PRHA 3PUCA 4LP5A 3MFGB 4WNQB 2NCMA 2ITDB 2P8MA 3QZWG 5EWIH 3LQAH 5J13C 3N1GC 3QUZD 2HT2C 1UWGL 5CZKA 2CO6B 4JRYB 2VLJE 4G9FE 4MVBD 2DLTA 1ES0A 4PJFA 5TQ0L 1KACB 3WO3B 4HXAH 3LKSB 2V9QA 3W9EB 5J11C 1FCGA 3U9PH 1IBGH 1W72B 5D1XA 1AD0A 2RHEA 3DX7A 5DD3H 3S7GA 4DJMA 1IZJA 3OXRB 3F6IA 4JO2H 1ITBB 2NZ9D 4GW4A 5ERWB 3HC0A 1X5HA 1EHXA 2I07A 2BVOB 1WBXA 1KGCD 1HI6B 2KQMA 5MEQA 2EDWA 2EO9A 4JKMA 4OCRH 1IC5L 1A6WL 2NX5A 1MCOH 5EBLB 1I7ZB 1WWWX 1S78D 3HE6A 5E94A 3LPGA 4KKCC 4JFEE 3PWVA 2BK8A 2EDYA 2W9EL 5EIVA 4PRNA 1CXKA 1OTTD 4N8CH 2NY0D 1YEFH 3LPFA 4J3SA 1IM3A 2OXHA 5GSVB 8CGTA 3TESA 5GGVY 1E28A 3RWDA 3QZWB 5DI8B 2R8SH 3GBLA 1CXIA 5ADOL 1O7VA 3ZHDA 4YHIB 1BD2A 1KC5H 4QY8B 3MUGA 4HLZG 3GI9H 1QQDB 2ZJSL 4G3YL 5C09D 1ZVSB 2YPKB 4NUGL 1P4IL 1S3KH 2J12B 2LVCA 4YPGB 1KJVA 3O3DA 1KBGL 2ICWB 1QSEE 1NH6A 3G6JA 4XNQB 3P9WB 1A6TB 4M62H 1B0RA 5M94B 2MSPA 3VG0H 1UENA 4W81A 1IEBB 3BKJL 2F8XC 3WIIH 4W6XB 3KXFE 2X4PB 4WV1B 2OP4H 1UA6H 5IW1B 1CFVL 1EEYB 2B1HH 2X9YA 3MBEB 2R4RL 1G0DA 4EQ2A 1FNSL 5JHDA 2CIKB 1FYTA 4KI1A 4LRIC 2VOTA 2HKFL 1INQB 1T1WB 3HAEA 5I1EH 4YFLF 4G43B 3ECBA 1KEGL 1YYLH 5KG9A 1FN4A 1NJ9A 3O4OC 3VA2C 3X13A 5GS0C 4RGNB 4M48H 4NC2B 2FL5A 5DJAA 3F12B 3MJ7A 4X9BA 4GAGL 5DRZA 1BWMA 5EC1B 1A47A 1EK3A 4HKJB 4PTTA 3HNSL 5DGQA 5F7HA 4O2CB 1JRHL 5FDYA 1GL4B 1TTFA 1FL6B 1MFBH 2ZNXA 2A6KB 4PJHA 3UTSE 4WY7H 5BZDA 3D0VB 1DANT 2ARJB 1A9EA 3WJLC 4OLXH 2C7UB 4E41A 5LBSL 2FX7L 4NQCB 1U8OA 2ZZUT 1HHJA 4LVHC 1S9XA 1IGCH 1GGCL 3BFOA 2W0FA 1DL7L 3G9AB 5B38G 4TTGA 3C6SB 4DVRH 5IMLA 1SYVA 4Y0GA 4UQ3A 5E8OA 3C6LC 2PTUA 4Y4HD 3IFPA 1XT5A 3WFBL 4NM8L 4LHUB 5D2LE 2YD9A 3V6BR 4H88H 1DZBA 2GFBB 3RIAF 1P7QD 3EW3B 4X83A 1ZLWK 1L7TH 4Z7VE 5I8EA 3JWDC 4XPHH 4MQXC 5FV2A 1FV1B 1VHPA 3QJHA 2HRPH 4G6KH 1PYWB 2E7LC 1JNNH 3MRGA 2HT2D 3WFZA 1FVCA 3PG2A 3BPOB 1BFVH 4OSUL 5DXWA 3HLAB 3TT3L 5CINH 4ZAKB 3VDCA 1U93A 3KNBB 1BLNA 4I13B 4NZTH 5EPMA 5C0CE 3CMOH 3WS6A 3L7EB 1U8KB 3QP3A 2B4CH 3L9RB 3QDGD 2VQTA 1OPGL 2LFGA 4AEHL 2APXA 1LK3H 4HWEL 3RY6C 5IW6A 3E6HA 2ICEA 3ARBB 4KUCD 1IGYB 1GC1C 3TIDA 3OB0H 1XF2A 4MAYA 1YJDC 1N5YH 1DEDA 4UDTA 3SQOH 3WFHA 1J88A 4QT5B 4LPYA 4NO2A 4FN0A 2IWGA 5BQ7B 1Q8MA 4J3UA 2D4DA 5HGAB 1KJ3L 4ISVA 1OM3L 3BEWA 2XPGA 3K4DA 1MVUB 1OAXH 3M17B 1AO7B 5FGBA 2NY1B 3BP6B 1CFQA 1FO0A 4KKNA 3PL6C 3T0VA 4M6NL 4KKCD 4LKXB 4NJAL 1QBLH 1YYMH 4PJ7F 1HINH 2MWCA 3SOBH 3FFCA 4NHCL 1A7NL 1R3HA 3I75A 1MQKH 3AREB 3VXRE 3NGBC 5H35B 3T8XA 4W68A 1Z9SA 2DI7A 3CU7A 3Q1SH 1YPZE 3CFEA 2C3VA 4FABL 1ZVHA 4OD3L 2GAZB 3IXAA 4KXZH 1T66C 1JPST 1BJMA 5E6IA 4MB5A 1T5WB 2XZCL 1RZJH 2PW1B 1MCCA 5JO5B 4HIHB 5I6XC 5BZWA 1GPOH 3IDUA 5EU5B 5K9OB 4FNLL 3LRGA 3ZYOA 4PJAB 5GRXG 5JOPE 4YDVB 3MJ6A 4KY1L 1AKJD 5GJTL 4YHPB 1A9BB 3ZLQC 1TQBB 2MOVA 3KPRE 3H0TA 3HNTH 5EUKB 3O4LE 2ATPA 1FCCA 4KQ4L 3LQAC 3GMMB 2P8LA 3ZE2F 4D3CH 1NEZG 4JFZL 1EZVY 25C8L 3BP7A 5FEBA 3KR3L 3MJ9L 1DLHB 5ESQA 2EDFA 4OAWB 5D7IF 3T4YA 2HJLB 1YNKH 1M71B 3QDME 4KHTH 5C0BE 3RWJB 4JRXD 4OCXL 1U0QA 4GUPA 1YEJH 2BNUA 4L3ED 4HKBB 5LXGL 5GHWH 3ZDYE 2AJUH 4KVCL 2YD3A 3L7FA 2E27H 3F6LA 4YC2C 4HPYH 4WJ5B 5DYOB 4GRLC 5CEXB 1ZT4A 2AXHA 5JW3H 2XTJE 4JM2A 1QLRB 4QRRE 1MAMH 2GTZA 3QDJD 1I3VA 3LKOB 1IRAY 3VGFA 4R2GC 4U6HB 1RUQL 1XCTB 2ED7A 3C6LD 4HZLB 2AJXH 2F53D 2H3NA 4KGLA 5ICZB 5EUOB 4G7VH 1EV2E 4JN2B 3PNWB 1DUZA 4MCYB 3U4AA 2PYEE 5K9QI 4J8RA 1J1XL 1F11B 2J8HA 1NFDE 1CN4A 5DJXA 4I3SL 3HE7A 4P46C 5L6YL 4WO4A 5EU4A 4I0KA 1XIWB 5JW4Q 3H8NA 2BVOA 1DQDH 1ZLUK 4AQ1B 2Z92B 3BD5A 3NTCH 1AQDB 3QQ4A 4WEUD 3P9MB 2XQYK 3ARSA 4Y4KC 1UB6A 1X4YA 1S7QA 3MRIB 4FTVE 4XBGA 3O2VH 3QJFA 1MFNA 2FGZA 4HIEB 1KIRA 4LRNL 5L0QC 3E2HB 5KSUB 2XICA 4RMSA 2QSCL 2XKNB 4JY4B 4Y5XA 1EIBA 3NFSH 1EJ6A 1LP9F 2YWYA 4UILL 4JKKA 1BBJB 2ZUVA 4OLWH 3Q6FA 5DI8A 4XCNB 3O0RH 4S1DC 5IOPB 1ZAGA 4XB7A 2Y06H 4QY8A 2MPAH 2D03H 2XFXA 5F96H 1URLA 3LV3B 4YK4C 3QCTL 3QRGL 4BFGA 4YFEA 3IT8D 2APBA 4OGYL 4X4YA 4FMFA 1NC2B 2AKRB 2NY5L 4NQDB 3FB6B 1J5OL 4NQVB 3C60A 5D7JB 2ADGB 4NN5B 2Q8AH 2CK0L 5DJ2B 1I8KB 3CFKA 1YEHL 1AP2B 3IRPX 4YHKL 2HFGH 5E2VL 2DKUA 2OXGA 4L8DA 3WD5L 4XRCB 2DB8A 3VFNB 3UJIL 3VXQB 1T66D 2CKBH 1CD9B 6FABH 5H37G 3BUYB 4G43A 5CP3H 2GT9B 2E6PA 3CSYA 4MYWB 1Q9KA 4Z7VF 2IAMC 4GW5A 3F12A 1P4BL 3L5WB 4YXKH 3CSPA 4HKJA 4R26L 5DJDB 2IADB 1FL6A 1U91A 1UQSB 3B2VH 4Y19E 3RVUD 4TOYH 3DUSB 2EEDA 3MLXL 1WV7T 3CSBA 4P5MB 3F7YB 3WIHL 3TV3L 2DWEB 3AM8C 1BIIA 4LCWE 1RIUH 1AFVH 1CZ8L 4WCYL 1N6QH 5ILTH 4M1DL 3Q6GH 5JNYA 5DRWA 4JFPA 3JV4A 4Z78A 3P4OA 5IHBA 4JHBA 3GJEB 32C2B 3EGSB 4ODBD 4JPKH 1MEXL 2B4CC 3BPNC 1NSNH 3IFNH 4QTIL 3KVQA 3SDXA 4EBQL 2ARWA 3QUML 5D6CB 1RUPL 4KTDL 1H8NA 1NBVL 1DN0A 2X4QA 1I7TA 3KYMA 5CJOH 3NFPB 5AAMA 1FV1A 3RZCC 3BMVA 3FO1A 1PYWA 1OAKH 1JHKL 1XR9B 5EORH 4IJ3B 3NFNA 5HDQH 5J1AA 1GOGA 2GJZA 3FZUC 1MCIA 2RCSH 4YDJA 4Q9QH 3D39B 3IJHA 5EOQH 3C8KB 4AMKL 5E2TH 1TJIL 5MHSD 5KN5B 4KTYA 1CICC 2NY0B 1SEQH 1JZ2A 5MEOA 4POUB 1YPZF 3L9RA 1XGTA 3VXPB 3JUZA 5D5MF 3AMKA 4X8JB 5GGSB 3HMXL 4I18C 3IS1X 4KI5E 5L9DH 4JJHA 3MRDB 1RZJC 2IQAB 5D1ZC 2XN9B 2KH2B 2VXUL 3GSWB 4X5WB 3NA9H 3D85B 5HGAA 5HYQA 4X4XB 3SE4A 4Y4KD 4H25B 4NSKA 2EIZA 3GSNH 4I5BB 4LARH 4GSDH 3OPZH 4L4TD 2BVEA 4EUPH 2DRUA 1MRCH 3RVTC 1FC2D 4FXKA 2HRLA 5E2JA 4N90D 4XNMB 3CAFA 2V17H 3MA9L 4XAWL 5DHVA 3ROLA 4GXVH 1ZK9A 3CVIL 5C0IB 1AR2A 2LQRA 1JTPA 4ZOAA 5JHLL 1LEGB 3X11A 4ZUVB 1A64A 4DGVH 1FFNB 3QUXA 2WIIB 2EKSB 2QQKH 2FSEB 3ZDYF 1XEDA 1IILE 4FRWA 5JXEC 2Z8RA 3VWKB 3IJYB 5I2IB 4JPVH 3MJ9A 4RWYL 3T0EE 2ENYA 3S5LG 1F3DJ 4PJXE 3WS3B 4XAKE 2FECL 5F7NC 4UTAL 1DEEB 1I9IH 4JFDD 2LTQC 3VXMA 4AM0B 1NFIB 1QA9B 4QHLA 1T0NB 2FBOJ 2NXYC 3FTGA 1WZLA 1A22B 4EVNA 1MLBB 3NIDF 1A02N 2DBLH 2NY6C 5GRJH 3RWJA 3U7WL 4XPFL 4X7TA 1IE5A 5E4EC 3RGVC 3PWLA 1VACA 5ENWB 4Y1AD 4MA7H 2CRYA 3UTTA 3U2SB 4OM1H 5C0AE 4JO4H 4UV7H 4NWTL 2DQGH 1QLRA 4IRJC 3WFEL 3SKOA 1U58B 2KUTA 5C07E 3OAYK 3RP1A 3WEXA 1HEZB 2XT1B 2W0KA 3LKOA 1J11A 4AT6B 4EJ1C 3GJFA 3S5LB 5GGTL 1F45A 4CVZB 4PJ8B 5ICZA 3DUUA 4XZUB 5CIPA 2CXKA 4P48A 4Y2DA 5FM5O 2VLRE 2EYTB 4ZPTB 5IVXE 5IEHA 4HWBL 4M3JA 2IALB 1WITA 5JPMA 4ZOBA 2VDKH 3UDWC 4HHAB 4OF7A 4YIQA 5I73B 4S10A 2FJGB 1AQDA 4MJID 5J06A 2Z31C 4LBEA 1NMAL 1VGKB 1MHEB 4M61A 3FZUD 2X09A 2UZIL 4YBQC 4UI2A 4WENB 2IH3B 3QPXH 1KCKA 5K9QG 5EN2B 3SE3A 3OGOE 4PRPE 1O0VA 2YUVA 4RFNC 2Q86B 1CICD 4IBLT 1NCDL 1OSPL 3IXTB 2AK4D 2BRQA 4X6FA 2B0SL 1ZLVK 3T1FA 2P1YA 1VDGA 2PXYA 2RIKA 1ONQA 1JMXA 3AS1A 3QO0A 5DFWH 5D1ZD 5KVGH 3K8KA 5CEZE 3DI3B 1HE7A 1MFDH 4XP1H 1IKFL 4I0PB 4X6DA 1M6OA 4N8VA 4UNUA 4H8WL 3P0YH 4JDZA 4U1HB 2HVKA 3BKML 5A2LH 4Y89A 4DKFL 5CFHA 1FJ1B 4M93B 3FB6A 1LE9B 3RVTD 3DTXA 3KPSB 2D31B 1A0QL 3C2AL 1KPRB 4Z8FL 3W0WE 3MLPA 5I18H 1CL7I 2JIXB 2P5WA 2FIKA 2OJZH 1WFTA 3Q5OA 4JY6A 3VI3F 1T6VN 4ZD3L 4JAMB 2W9DL 3D9AL 3IFLL 3WYRA 2J8UB 5K93A 3ZSSA 1HH6A 4DVBA 2DQTL 4G6JL 2Q3ZA 1BFOA 4QHNA 3VXQA 5CZVL 1PG7L 4WWID 1F4XL 3MRCB 4FQXB 3MRNA 4JRXB 1NLDH 4A6YH 5IGXH 4PG2C 4MD0B 1IM9A 4WVRA 1R5VA 3VMOA 4ZFGH 3WIHA 2D0GA 4DZ8A 5JXED 1BQSA 4H26A 4MA8H 1ITCA 3ULSA 5CEYB 4JKPL 5FECB 2A6JA 3L5JA 3VGAB 5SWQB 1UYWH 3NPSC 4V1DD 4D2NA 3C09C 5GRUL 1HKLL 2UVFA 3W5NA 2EZ0C 4FQHB 1CDHA 5FGSA 4V2BA 4GG8A 1K4CB 3QIUA 5DK2A 3VGDA 4MXQD 3QUMA 4FZEH 3O2WL 1EFXB 3WKMH 1HYSC 1MAJA 2BVPA 1J05A 4OF8A 2NXYD 3TYGH 1CFBA 5FM8A 2NY6D 3GJEA 4L9LC 1SJEA 3EGSA 2ZSVA 1KGCE 5E2WH 5I0ZA 4LOUD 4OD1H 5I1AB 1UWXK 1OHQA 1GRWA 4HQQH 1JN6A 1TZIB 4OB5L 5CS7A 4X6EB 4PJEE 1K85A 3LS5H 2WBWB 3BOVA 3EOYG 4AH2B 2E9IA 1HSAB 5D6CA 3MRFA 5HGDB 3ULVF 2F54A 5KJRL 4K94H 4KK6C 4JFEB 4POYA 3VE0A 2AXFB 5C08E 1C5DB 4LSPL 2YEZB 3GMLA 3TN0B 2AJVH 5DHXB 3HMXA 4YGAB 1MCKA 5I8CB 2FJHA 4TN9A 3QIBC 5L88H 3HZYA 1R5WA 3HC4L 2HLFD 2IMMA 3MNZB 5E4IA 2QLVB 3PWJB 4M7JL 5F9AC 5CUSH 1XZ0A 4XNUH 1OSZB 4GLRH 1MSPA 2Y36H 4ODXB 1TVHB 3VXPA 2YSSB 4PRDB 4UBDC 1A1NB 1A6ZA 2R0KL 1IT9L 4K3JL 4MMZC 4YH6A 5C09E 1G6VK 2XY2A 5T3XE 4OUOA 1GGIL 1AHWC 4S2SB 4ONGH 5TE4L 1K4DB 4IRSA 5DFVC 1OARL 1AGBB 4DEPB 4M3KB 5FFLA 4YQXL 3TO4D 4X5WA 3QI9A 2Z31D 4X4XA 3N06B 4DUWA 5ITBH 4MNQE 4KMQA 2CK2A 4YBQD 4OJFH 4QXGL 4I5BA 1S7VB 3MV9D 1KUMA 1D5ZB 5C2BH 3LN4A 2KPNA 3KXFB 1NMBL 4WIQA 3SGDH 5DUPL 5E08H 1U8PB 3MLWH 2DMCA 4LASH 3BJLA 3ARFD 3EYFA 5IFHH 3IDXH 4LGPB 5C0JA 3RU8L 1D6EA 2QQNH 4G9DA 4Z7WF 3MV8D 3VGBA 1ZTXL 3D3VE 4P3DB 1BQHB 3SE8H 2QTEA 3LRHA 3RUGA 3BZEB 3T77B 2BFVL 2HAZA 4ZUVA 2Q7NA 3RNQA 1XF3B 1U8LA 3QULA 2P5EB 2VQUA 5L7XH 4UDUB 2VDPH 4DK6A 4NBXB 4QO1A 4DN3H 1CLZL 3UTSB 1HQRB 1FL5B 3UBXI 5IQ7L 2J6EA 3K7UA 3MRQA 4IDLA 3ZKXB 4ZUTB 3O6KL 3ZL4H 1SY6H 3C5ZC 4N68A 3OJDB 5EUOF 1T1XB 4Z76A 1FL3B 4LKCB 4F7MB 4G8GD 5D2LB 5C6TH 4AIOA 3JBG7 3PHQA 4QRUA 4QHUA 4F15C 2EXWC 2PKDA 5K59E 2G5RA 3DVNB 4OZFB 5MEND 5IMMA 3P9LB 4GS7C 1HCVA 5E0QA 1U41A 1DVFA 2PCPB 1P5UA 4ZNEE 1DSFH 4F37F 2DQIH 4MGXA 3AVEA 4G5ZL 1C08B 3VXUD 3GSUA 4B7IA 1U8JB 1MFCL 3D2UB 2BXYA 2FEEL 1ZA3B 1A6VH 3TYFA 3PWPA 3UJJL 3X14B 2VNCA 3U2SA 4FQ2H 5MEPA 2X4RB 2ICCA 4EXKA 3SKNA 2VZ1A 2X40A 4Q6YA 4L8SA 1I85C 4HWBA 1HYSD 1JGDA 1MWAL 4F7CA 3DPBA 1MIMH 3REWA 1IAII 2X5PA 4J6RL 1Y0LB 3QEQA 4NO3B 4XCYB 1UCBL 3WJJA 1I3GL 3U7AA 4PJ8A 2DWDB 5FYLD 4RMVA 3O6LH 1D7FA 3L3HB 3VJ6B 1CLYL 1D9KC 4CMMA 1U3YA 4LU5H 1H5BB 1C12B 4NDMA 2YKLH 4YXHH 1XGYL 4ZO7A 4ZUWB 5DJYA 4KK6D 1A14L 4NNPL 1YNTB 2FYYA 2VWEC 2X1PA 1W0VA 2FATL 1LEIB 1F2XK 1RZFH 4KJPD 3GIZH 2C3WA 1FNLA 4R97B 1MHEA 3VXRB 5L2KD 2X7LB 1OAZH 3OTTA 3PWNA 5T1KA 2BNRD 4AENB 3LD8B 5ANMB 1JGEA 4ZXBC 3QIBD 5DVLA 1WCBB 1I3UA 2VDQH 4Y5YB 2P47B 3B2UC 4WHDA 1YMMD 4NP4L 4EN3B 5DR5L 3MREB 5T1MB 3HRZA 3IXTA 4KQ3L 5EU6A 2MQCA 4UBDD 3RWHA 5KS9B 3M45A 3N85H 4BELD 3KJ4C 3TBSB 3GB7A 5JZ7C 5DFVD 1YN7B 5FK9B 4WHYH 3E3QC 1IFHH 4ZOEA 1SBBA 4HZAA 3HZKA 1DR9A 5C6WH 4WO4C 2K9UA 1BVLB 2ZUXA 3O4LB 5I1LB 1EBPA 3GMRB 3KPLB 5E8PB 4AIZA 3PHSA 4XMPL 3U4EA 5IVOA 1KENH 1FJ1A 1ND0B 1I1AA 3QDAA 5E70A 1RVFH 1TTGA 4UOJA 3MRKA 4U0RC 5DD5H 3BQUC 2NLJB 1T0MA 4ZSOE 1YC8A 5F1OB 4ERSH 4NZUH 1F90L 2MCPH 5E5RB 4OFYD 4WW2A 1KTDB 3GRWL 4BK5A 1I9RH 1CXLA 4XMLL 4OUUB 2NYYC 3HZMB 3IAPA 5GS2H 3RDTD 4WUUA 1OGAD 1T1ZA 2JCCF 4NPYB 2EDQA 4FQXA 4XC1L 5IESH 4U1NA 1MCPL 4PJEF 1S7SA 4QGYA 3I9GL 2VL5B 4PD4J 3U1SL 2IG2H 4LLWB 1I8MB 2H2SC 1W0WB 4JGMA 5GGSY 5CEYA 2D9CA 5IKCB 1PZ5B 3QDJE 1EJOL 3MLUH 3DMMC 3QQ9D 1HSBA 2VLJA 5SWSD 4MA3B 4G9FA 4K94C 4W4NA 5FO9B 1NCNA 3KG5A 3LHPH 4P23C 3CXHJ 3C5ZD 2X6MA 5DS8B 4OCSH 3LRSB 3TVMC 3EFDL 4PRID 1K6QL 3RWCB 3O41B 3DYOA 1T22B 4FQJL 3C60C 4PUBH 3V7AG 2R29L 5ETUA 4LSUL 2PYEB 5HI3C 3X17A 4OQTL 1NFDB 3IAGC 2R0WL 4NN7B 4LNRB 4MA1C 3W9DA 2GYSA 3FO9A 5C1MB 1ED3A 3QH3B 3O3EA 4Y16B 2A83B 3B9KB 3GSXB 3JTTA 1HSAA 4NJ9H 4N9OB 4QGTA 5AZ2L 2W65B 2D0HA 1HHKA 2BSRA 4Z95L 1MHHB 2XXMB 4LHQB 1VFUA 2AXFA 3GHEL 4PV8B 3OKLB 4HKXB 1P1ZB 4WEBH 2BZDA 2ERJB 4BZ1L 4YHYB 3KYOA 4EI6A 3DHJA 1KEML 5GJSH 5KSVB 2JK5A 3D25B 3EO1A 2O5YL 1H0DB 1UB5A 5ESAA 1NGQL 1QHOA 3MOAL 3SCMC 4XBPB 4LVOB 2E8YA 1FORH 2IC2A 4KFZC 3FB7A 4YR6B 3MNZA 4PJIE 3MGAA 1KPVA 2Z4QA 1IAIM 2G60H 3FOMB 4ODXA 1OD7A 5HXMA 1YEEH 1NC4B 35C8H 4PRDA 4RFOH 1AGCB 2CIIB 3C08H 5IP4A 1KTRL 1V3JA 3ARGB 5I1CL 5E24E 3CDFA 4RCAA 2VERN 4XXCA 3ZMRA 4UTBH 1K4DA 3BP5B 2VDNL 1FBIH 5IB2A 5HHMD 2ZUWA 4FQIH 4I4WB 2YK1H 1GAFH 1QSEA 1CDIA 4P5TB 2XWTB 2QJDA 4LQFL 1Q9LB 4L1HA 4WFEE 1EHNA 3T2NL 3TNNA 1IGIH 3KXFA 1X5YA 2YC1B 4ZXBD 3GGWA 4Q9RL 4OGXH 4RGOH 3KYKH 4MXVF 3WN5B 1H15A 5CMAA 4JHAH 4M5ZL 3B2UD 4HIXH 1D6VH 1JHTB 3UPRB 1SM3H 1X5KA 1I9EA 1NGZA 1UZ6E 5BJTB 4H5SB 4N0UB 5HYJB 5DO2C 3W5MA 2BCKA 4P3DA 5CSZB 3DROB 4N9GA 4ZG1A 3QIWA 1JGLH 3G6AB 2J1KA 3UXFA 4R4FH 4QOKD 3MA7B 1MIEH 2IGFH 4J1UB 4UT7L 2NY2B 4K3EH 1DBBL 2PW2A 3BWUC 5ICYA 5TF0A 1F6AA 1S7RB 5K9JH 3LEXB 4KKAD 4C54A 3UTSA 1BVKB 1BAFL 4MNHA 3SKMA 5DURB 4RMUA 1FGNH 5ACLA 1MCNA 3TO2A 3L3KA 3CNKA 4ZUTA 1Q94B 3L3OB 2X4NB 3BQUD 4DZBA 3OJDA 1BZ7B 4TPRL 4KUCF 3VFWA 2YBRA 1NANH 3WNOA 4F58H 3BGMA 1ORSB 1IKNC 4OZ4A 5A43C 2FX8L 3TBTA 1AC6A 2HJKB 4GKSB 3WMSA 1HHIB 3UBXG 1G7JA 4U1IB 1JPGB 2Y25A 3ARPA 3F5WA 4LMQE 4Z7VA 4OZGE 4LCIL 2YA2A 4S1RH 1EHLH 4BZ2H 5BVJB 3P4NB 1M4KA 1U8JA 1MWAA 1HXMB 3DMMD 1RU9H 1OAYH 5DJ0B 3TBVA 4BJLA 1U2CA 2RGSA 2DQDH 1GGBH 1RK0A 5FKAB 5MHSE 4QXWA 3UC0L 1RJYA 3MLYL 5C0CA 4HXBL 5CBEB 1HILB 5JR1L 3O9WA 3BH9A 1EBAA 5J56B 2DYPA 1YUHB 3BH8B 5CGMA 5I19L 5KSAC 4F8TA 2WBJC 1CS6A 3ZKMC 1MUJA 3LZFH 4UMGA 1KNOB 3G5VB 3H9SD 5CP7A 2DWDA 3L5XH 2KQNA 4U6TA 4MJ2A 15C8L 5LWYH 3WKNA 3ZT5A 3S98A 4ZUWA 3HCVA 2P8PA 5GGVH 4TNVF 3F65A 3CC5A 1RUMH 4HS3B 3ES6B 3TO4B 4PBWD 2AJSH 5AUMA 3UBXB 2YWZA 1PDKA 2NY4C 1IAMA 4KJYB 1F8TL 2J6EH 3T0XA 4IDJL 1QO3A 4JGUA 4LNVA 4RBPH 4AENA 1Z5LB 3HI6H 2OMBA 1SBSL 2A9NH 3EYUH 1KCLA 1S9VA 5IFAH 3ARFB 2IPUG 3SCMD 3HFMH 1QKZH 1YPZA 2ZOLA 4HK3N 2DBJA 5KOVC 1CBVH 4MQSB 3TZVC 1J8HD 3N1PC 1LE5B 3BZFB 4PB9L 4P2QD 2WLYA 1B2WL 4NN6B 4HWZA 4LVEA 4WWKB 1PEZA 2X1WL 4D0DB 4F57H 4O4YL 4I2XB 5DK0B 3CX5J 4P9HH 4YNYA 3DURB 4YEFA 5I75C 1EO7A 3CLFH 4I48A 3CSGA 3OL2A 4TULL 4ORZC 1AE6L 4PJXB 1DQML 1OAQH 1OF2A 3GRWA 2BHYA 4OT1L 2Q87A 1TIUA 1EZVX 3CXDL 3KPRA 2CDGA 4RQQB 1I8LA 2VXQH 3O4LA 3P11H 2Z93A 4MHHG 1WBYB 3BZ4B 3MRMB 1P84J 1TNNA 3E8UL 4MCZB 4GKNA 4PR5B 5C0DA 5FHBH 1QFUH 4OKVA 4XPBH 5DMJB 3NCJH 4Z0BH 2C9AA 3QDMA 2GY7B 1K8IA 2PR4L 5DO2D 5C0BA 2CDEB 4R4ND 5F72S 1T21B 2EDNA 2ATKA 3GSQB 3B43A 4P3CH 3LS4L 1T7WA 2X4OA 4LPVA 4Y1AE 2E7MA 2N1KA 3PGFL 1FNAA 2WSKA 3WO4B 2EEAA 4X6BB 2VL5A 3FRPA 3OGCB 3SDYH 2E3VA 1OL0A 1VKXB 1C16A 5GGRB 3VG9B 5I8OH 1KB5B 3E1F1 4QRRA 4OQTA 2YPLB 3DETC 1EEQA 1CR9L 2D4FA 1JNLH 1NAKL 1VSCA 3GI8H 3OR7A 4ODUB 5F1KC 1HOCB 2DQJL 3U0WL 3BAEH 5IB5B 5CHNA 5T33L 2X4SA 1UKSA 5DMKB 5HVHC 1KB5L 1SEBB 4DAGL 3QCUL 4XX1G 3QFJB 2PYEA 3NBNA 4N0CD 1X5GA 2VLRB 4BQBA 1UKQA 4DKEL 4PJIF 1HZHL 5HHVL 1NFDA 3KHQA 3MOQA 4S0TD 4LNRA 2EDDA 4ZQKA 2DM3A 4NGHH 3P4MB 3REVB 4MJIE 4MD5A 2EDEA 3VWJB 2OTWA 3QH3A 4AEFA 1Z9MA 1NLBH 2FDBP 1Q1JL 1BOGB 3OXSB 4CU7A 4NZRL 3CFCL 3B9KA 4FTVA 4JZJC 3V6FA 2EH7L 2DL9A 2Q7YA 1L0QA 4JG1L 1G9ML 1QHPA 4GMSH 5L2KB 1BJ1H 4PV9A 2AK4E 5ALBL 4P5KB 3EOTL 3UPCA 5KSVA 3EJZD 3ULUL 5D72L 5F1IA 1H0DA 5KSAD 2FX9H 5A2JH 2VQ1B 2WBJD 1T3FB 4NQXB 5I8KL 1U6AH 1QPPA 1UZ6F 1N59A 1GJIA 4FFVC 3MYJB 4O58L 2NNAB 3V7AE 4GAJL 2M1KA 4WI6A 4C56B 2DLGA 3BP4B 1U92B 4FQ1L 1LD9A 2A77H 2VLKA 2FCBA 3CVHB 3FOMA 3HZVB 3I85A 4JY5L 2I9LA 4OCLC 3T65B 5JUEH 4NO0D 5CSGA 3LEYL 1IGJB 3SE9L 3DYPA 1TVBB 5D2NC 2P24B 1DDHB 4PJ9B 4R0LC 4YXLH 4OFDA 5FYJH 5HGBA 5I1KL 3GK8H 1S8DA 5EBWA 3MOBL 4CVXA 4L3CB 5I74C 2Y6SC 4YDIL 2NY4D 1UM4L 2ESVE 1Z2KA 5CEZL 3MJ8A 4JHWL 4EOWL 5HY9A 1IC4L 1FNHA 4KDTA 1N5AA 4KUZL 1LO2L 1K5NB 2D7MA 4FZ8H 2ZG3A 2ITCB 5I30L 2BNQE 3Q3GB 3U0PB 5C7XL 3JVGC 3ALWA 4U49A 4R96A 1LMKA 5D7LD 5BJTA 3FQXB 2OYPA 5A2IH 1WZMA 5BMFL 4P2RD 1OP3H 2F15A 3FHAA 5SX4I 5IR1A 5GS2D 2BOCB 5ISZD 2RAMA 3OX8A 5FUOH 5F88A 4F7TB 3MA7A 3NH7H 5IROC 5IV2B 1T03L 2X9WA 4P57B 5F89B 3BUTA 3NIFE 3LDBB 3BIBX 1UM5H 1I1YA 3WLBB 1ZEAL 4IRSC 4APQC 4Y19A 2HKHH 3DX8B 4P4KC 3OG4B 4D8PB 4Y5VB 4NKOB 1FSKB 1D5BB 4LCWA 3T3PE 1B0GB 5EFIA 4FQLL 4DGIL 2W38A 4H20H 1T04B 5BS0D 1JI1A 5ITFB 2GY5A 2A9ML 4QLRA 4Y4FA 3CFBA 4Q0XL 5FUZL 1TCMA 1EGJH 2HJKA 4HKZA 4PJGB 5JQ6L 1OLZA 2JKXA 4K71B 3H7BA 1KELL 5C08B 3VFUB 1U3HA 2FBJL 1A6PA 3CX2A 4LSRH 4KRNA 3SDCC 3NN8A 2DD8H 1QFWL 1FLRH 2ZG2A 3DETD 2O5XH 3RA7H 3JV6B 4GFTB 2GIYA 1XR8B 4OFVA 2DF3A 1UJ3A 4O2EB 1TQCB 2EDLA 1FFOA 1HDMB 2EKJA 5TH2B 4FXGB 2CJUL 1QBMH 4Z7UB 5GXBB 2DM7A 5EU3B 5B38A 3GBNL 3RTQA 1VADA 1PG7W 4LSTL 1JV5A 1G7MB 1XGQA 5KOMC 2RQ8A 4CNIA 5HDOA 2G75B 4PP2B 3RY4A 3GMNA 2XG5A 4MNQB 5HDBE 5IT2H 4P9HC 1JHLH 4TVPH 4YHOL 3MRJA 3D18A 5T3XL 3BT2L 5ECJE 2HLAA 5F7DA 2AI0L 3VDAA 4ONHA 2BSTB 5CILL 3MNWA 2O26U 3EO9L 5E1HB 3K2UH 2ED8A 3D3VB 2YMXL 5EULV 3ZHKA 3HUJE 5C9KA 1ZGLP 1IGFL 5HGHA 1OWWA 3MLZH 2AEPL 4FFVD 5E03A 4N0FA 1CT8A 1J9CT 1G7IB 1DBKL 3MLRL 4UU9A 4MLSA 1AGEB 1EO8L 1VPOL 1RIHL 1WEJL 4PLNC 4TRPL 3WSQH 2RJMA 4XWGL 4ZPVA 2B7DT 2OX5A 3O6FA 3EAKA 1V7MH 5A3IC 4JM4L 2VE6B 3T0EA 3VXSA 3FO0L 2J4WL 4PJXA 5L2JB 2NX5E 3GUTB 2Y6SD 1E4XL 1RUAL 1E4JA 4G8GE 2VMFA 1V7NH 1EFQA 4M7KL 1MREH 1OAUL 4H0HB 1U8IA 5MENE 2EE9A 4PR5A 3SDDA 3QG7L 3ZYJA 5B8CA 4DQOH 5L8JB 5J4MA 5IW3A 2ZOKB 2MFNA 3JZ7A 4PYGA 1A7RL 2ED9A 1S5HB 2C4FU 3VXUE 4YGVB 5DEGA 1J1OH 5I1HH 2Q3AA 5DMIL 4KKBD 3QNYA 4ZO8A 5A16B 3K1KC 5D7KD 4QCIB 5L8LB 4QRPD 4OI8A 5GGRA 2R4SH 5C0AA 3SGEH 1KB5A 3CFIC 1RY7B 4PGDA 2ZSWA 4HH8A 4P4KD 3VA6A 4HW6A 4YUEL 1P7HL 4WFGD 2DQCH 1E6JH 1A7PH 5C07A 1KTLA 2VDRL 1DUYA 5D70H 1X5IA 2OM5A 3GDBA 4OD2A 4JQXC 4J3VA 4WI3A 4MNGB 1CE6A 1KJMB 1NEZA 4LHJB 3VDBA 1FYTE 4MB3A 1IC7L 2ZUUA 2O61A 4NFBA 4YLQT 4H1LH 1NGYA 4HK0B 5GS1C 3WFCH 4HGWA 7CGTA 4B41A 2E7CA 2XNAB 5IVXA 1VERA 3OKEB 4NRXA 3P0VH 3R4DA 1H3PH 4O02H 1BOYA 4HGMA 1GYAA 3UYPA 4CVUA 3O8XD 4R8WL 4KHXH 3KPNB 4YO0B 3HI1A 4LDLB 1Q0YL 1CLOH 3SDCD 3QEUA 5JXAH 1BOGA 5C0GA 3I84A 3FQTB 4B50A 4KJWD 5AYUH 1GGYA 3IGAB 3HR5A 1RFDH 4PRPA 1JF1B 1YMME 1RJLA 3JTSB 2NY3C 2PO6A 3PXJA 4LLDA 3DX9A 1G6RH 4EI5A 3I6GB 5DUBB 4OCWH 4TSAL 3PXHA 2YUWA 4GBXA 3ZE0E 1RIVL 5TQ0H 3FCTA 1HH9A 4S11A 2QV2A 3VFTA 1DFBL 5KANI 3VH8G 4JFFB 1N2RB 3QUYB 3RWGB 4P2OC 1D5MA 5KVEH 1QLEH 1U92A 3QCVH 5IMOB 1SMOA 3HZVA 4FQPA 4WUKH 3O11B 5D6DA 2XIDA 4FQCL 4WI4A 3STLA 5F6IB 4XP6L 1A3LL 1IGJA 5I1DB 1R24B 4PJ9A 1ZA6A 3NIFF 3W82A 3ZHLA 4N8PA 3RVWC 4ZTPH 4U1GB 1KXQE 1SYSA 2HT4C 4JREB 5GRVL 3CH1B 2H26A 3FOLB 1G1CA 1W72H 3C8DA 3ESUF 4X7FC 3V0VA 4PJ5A 3W0WA 1NCWL 12E8L 3RY5A 3S3JA 4CADA 4QWWD 2DJ4A 5HVFB 3CDCA 2C3XA 2OZ4L 4NRYB 3OQ3B 4Z0XB 1U95A 1OGAE 3KWWB 2DM4A 1ZHBA 5I16B 1S7TB 2AABL 5AWNL 1ZT7B 1QRND 3G6DH 5ID0B 1RZIA 4R90L 4OKDA 1JBJA 1NBZB 4L29A 3ALXA 4J7RA 5FA4A 5GS0L 2CDFB 3THMH 1TZHA 3QUZA 1CXHA 4X7DC 3V5DB 5SWSE 1MI5B 5ADOH 5BW7A 4XCCH 4P57A 4HGKC 5F89A 5EOTA 5CJQL 1AC0A 1MFAH 2DQHL 4RAUA 4XH2B 5JTWA 1P4IH 3FQWA 4IOSD 3HG1B 2IPTH 4D8PA 5EO1B 5C71A 3GKWH 3SBWC 1EEZB 3QWOB 5GRVK 5EZJB 4PGJA 5ITFA 4XMKH 2C1PB 3TA3C 3ARUA 1MJ8L 1ZS8A 1NAMH 3F58H 5HHQA 2V5SA 3K1DA 4M9OA 1UVQB 4PJEA 1XCQB 3L3JB 1KT2A 1JCKA 1ZLWH 2YD7A 4UB0L 3FT3A 4MD4B 1A3QA 1JP5A 4XWOC 3EKCA 4NQEE 1QNZH 5EO9A 3JWDL 5HDBF 3K80A 5C08A 5FHAL 43C9B 5E99L 5I1GL 2AQ2A 1MCJA 2UZXB 3SDAB 3HNSH 4G6AD 1DE4B 1QFOA 2I60L 1WZ1H 1ZGLA 5MI0B 1NCCL 1QSFE 1RQ5A 3HUJF 3L6FA 3WFDL 1XF5B 4K7FB 4H0IA 4DWHA 1RK1B 1SJHA 1NDMB 5C09A 1DJSA 5T3ZL 4LSQL 1GC1L 5HHME 3AFLA 2VWEE 4NNYB 1CLCA 2W60B 5HHOD 4PRHD 4NM8H 4JQIH 1OOAA 1RZ7H 3HC3L 5D71L 2R2EA 4MNQA 2VXSH 5C0FA 2HVJA 2MMXA 5HHPA 3WXWH 3S36X 4JG0H 4WFHE 2W07A 2NY3D 2UY6A 4UOW0 1H3WM 8FABA 1T83C 2P7TA 3DX6B 4Q74A 2R69L 1E4KA 2XZAH 1KLUB 2EYRB 3D3VA 2FZ3A 1T2QL 3EJYC 3NCBB 1XGRA 4C4KO 4CDHA 4EDXB 3E3QE 4P2OD 2IPKB 5BOPA 5TDPB 1KLFA 2CO7B 1WF5A 1G7IA 2GUOA 4IHOB 1DQJA 4P2RB 3GMOA 1AXTH 3MFFB 2EIDA 5H2BB 1S7WB 4XNYL 4LCCC 1I7RA 4KVNH 4S1SL 3NAAH 1UXSA 5J6HA 3QHZL 1LO5B 1N4XL 5L2JA 1GOFA 2HT4D 3PV6B 4RWHA 3GUTA 1FZMA 3BWAB 2BY3A 3B9EA 3B6SA 5JORB 2X89D 4Y4HA 5FCSH 1JPFA 2FD6H 5J1TC 1EXUA 3H2WA 2EE2A 5EWIL 1YNLH 3LQAL 2YN3A 2YS4A 3AAZB 3VFGH 4GG6E 4LLQB 1MJJA 1P7QA 4NHCH 4Q6IC 4K8RH 3PIQB 4W6WB 5FYJU 2VR5A 2ZWLT 5DJZA 4PY8I 4HXAL 3QO1B 2NXZC 1CFNA 1MLCA 4S0SD 4ZNEA 4U1LB 3MRPA 4ZFOL 1S5HA 3U9PL 1IBGL 5EO0B 4NOBA 3MZGB 3PQYB 1S7XA 5J6GA 1FNEB 3ULVH 4YHLH 4LLUA 4JO2L 1F58H 2B20A 3N9GH 5I15L 1MHCA 1GVIA 1NKOA 4WU5A 2OL3H 2R0ZH 1AJ7H 3QDGA 4CMHB 4OZIE 5KSBE 2YZ1A 2HT3C 2V2TA 1MCOL 4MJ6B 3KPPB 1OW0C 1M7IB 4P46B 1TETH 4LLYB 1FVDA 3TBWB 1NGWB 3ESVF 3H9SE 1R3LB 3FO2A 3V5KA 3TA3D 5A2KH 4N8CL 1YEFL 5IM7B 4NOFA 3BW9B 2BC4A 2JJTC 1JZ5A 3OKEA 1PQZA 1Q72H 4J3TA 3D0LB 4XWOD 3C5JA 2X1QA 1ZLUH 3V4UH 5GS3A 2R8SL 4QXTA 4NHUB 3IB4A 1KC5L 1RJZB 5IEKA 3KPNA 1QVOB 4YDKH 1W0YT 2ZUTA 5ID1B 1BJ1J 4KAQH 2A73B 3LB6C 4OZHE 4TVPD 2XV6B 1S3KL 3FMGH 3ROOA 2FHBA 3FRUA 4HF5H 3ARQA 3TPKA 2XWJA 4BK4A 1J8HE 2APWA 1CGSH 4P2QE 1U8HB 1CWVA 3G5XB 4M62L 3MRBB 3DI2B 1A8JH 4NKMB 5SWZD 3WIIL 1CGWA 1UA6L 1JWMB 1IC1A 2BMKA 2B1HL 3AS2A 5AD0B 1RUQH 1AKJA 5E9DB 3O81A 4JFXB 3FONB 4Z7NF 3S36H 5IMOA 3KPOB 5CCKL 1YYLL 2Z91B 3KDMA 4IIQB 2FO4B 4A2MA 4R7NA 1Y6KR 3RVXD 4IMKA 4M48L 4MSWA 4U6YB 4AEIH 5KANG 2J3SA 2VUOA 1TMCB 5CBAB 3NCYS 4D9LL 1QLFB 3MMEA 1CDGA 1MFBL 4LSSH 5E8EA 4ZSOA 5DWUL 4HIJB 4IOFC 4WY7L 4PJGF 1ORQB 4YHZH 4MAYD 3UTQB 1IJ9A 4DUXA 4HH9B 2X41A 1KIQB 5T5FH 1GZQA 3KWWA 4LLVB 4Q2ZA 2K1MA 1EMTH 3PJSB 5I16A 1I1CA 4DVRL 4KWUA 1UGNA 4RFEA 1JJUA 3I6KA 2IAND 3SKUD 5BV7B 4WI9A 1QUNA 3BHBA 3S88H 4MS8C 5A40E 3WJLA 4H88L 1GOHA 5I66B 3V0WH 4MX7A 1NCTA 3V5DA 5F1NA 3QDJA 5BVPH 1NCBH 4NO5B 4AEEA 1L7TL 3KYNB 4ZUUA 4XPHL 3C6LA 2EH8H 2HRPL 4G6KL 4WV1C 4OGYH 1JNNL 3P77A 4KV5F 1T7YA 2OTUA 4TSBH 1EEZA 2GJ6D 1KJ2B 4YHKH 4BH8A 1RZ8B 3RNKA 2E7LA 3CIQA 3PHOB 4RGNC 3BI9X 2B4CL 4ELME 4GH7B 1LK3L 5KTEL 4TYUA 5GGUB 5BRZE 3O8XB 2VAAB 1N5YL 4KC3B 5D1QD 1ZHKB 3OHXA 3VCLB 5IBLC 3SQOL 4Z5RB 1YQVL 4EDWH 1CFSB 2E8ZA 3FQUB 1S7UB 1T7ZA 1NBYA 2NY7H 1JNHB 3VGGA 2HT3D 3RY6A 3MV7B 3OB8A 3G5YA 1T4KB 3U4BH 5JW5B 2QR0A 4HIIA 5EBMA 1QBLL 1YYML 4PTUB 3U0TA 3SOBL 4PJDB 3S37X 5FOBB 2ADIA 3IETA 4PJIA 1ZVYA 4G42B 4WRLA 4LGRB 5IB1A 5EDXA 1MQKL 4ZOCA 3G04A 3UROR 1F4WH 5DDHB 3OKOA 5B4MD 5GZND 4LCUA 5HPMA 3WL9B 2A6IB 5B22A 3PL6A 4PJCB 4JFQA 1GGTA 2DQUH 4RNRB 1EAPB 1QPXA 2H32A 3CK0H 2WMPA 3MLTB 4Y88A 1RZJL 3STZA 4QTIH 3ARDB 3L3IA 5CJBA 1MELA 1EO5A 1S9YA 4EBQH 1GPOL 4JRYD 2ESVB 3BPOC 5CWSA 2GITA 3DBXB 2LU7A 2NTFB 3KPQB 3LB6D 3MRRA 4KTDH 1I3RA 4X99A 4ZAKC 3D87B 2BNQB 2AV7A 2VITB 2X05A 5LVEA 4RX4D 2JJWA 4CBPA 4TUOB 3DV4A 4PREB 1RZKL 1BX2A 5JPNA 2UY7A 4M1GH 4OTXH 3EIFA 3H9HA 3HNTL 3ARBC 5I1IH 3SO3C 1FZJA 1CYGA 4HMEA 1YMHA 2XA3A 3HE7D 5ISZE 4D3CL 3CDGB 4K8RC 4M8VA 4YBLB 5GZOC 4X5XB 5TDPA 1I1FB 1QRNB 4DN4H 4HULB 1YNKL 2UV3A 4KHTL 1JL8A 3MLVH 4YFDB 5IQ9B 5C6PB 1S7WA 2NY1C 1HHHB 3PGCA 3O2DL 1YEJL 3A6CH 3SEPA 3IU3A 5GHWL 3ULVC 5F3BB 2VN4A 4X9FA 1KYOJ 1VGEH 2E27L 4E0RA 2VXUH 2A74B 3AREC 2KZ1B 2PETA 4HPYL 4XVUC 5BS0E 2WWMC 4CRPA 4ZFOA 2SEBB 4OZIF 5DHYB 1YEIH 2I9TB 4IOFD 1YEGH 5JW3L 1ACZA 4RZCB 2FHCA 2R1YB 5E4EB 3FQNB 4FFWC 1MAML 4LAQH 5AZEL 4LLQA 4NFCA 3PIQA 1TJGH 4I77H 4OZGA 1FFRA 3QO1A 3SY0B 4O5LH 4GRLA 4WU7B 3UJTL 2AJXL 2PYFB 4QNPE 4IRJB 5JHLH 5E8NA 3SJVE 1FNEA 5HYFA 3VRJB 5E5MA 3ARYA 5IBTH 4BKLA 1U2HA 2H41A 3O6FC 4LEOA 5CJXC 3RKDC 4LL9A 5FUCC 1DQDL 4YZFE 4OZHF 2WBKA 3NTCL 4HUWB 3MBED 5AG8A 1Y18B 4M5YH 3WNNA 4LCYA 3NCEB 4MJ6A 5DRXB 4BQ9A 1U8QA 4UTAH 4OF3A 4LP4A 2AQ3A 3O2VL 2K7QA 4E5XA 4LPTA 1R3LA 4BFIB 1JYXA 4RGND 3MBXH 4Y4KA 4YWGH 1PJ9A 5IM7A 3NFSL 1IQDA 1WBZB 4P4RB 1WSST 4OLWL 3EDDA 1N8ZA 2P8MB 3O0RL 3V5HA 5IBLD 2OLDA 2UZYB 2J7LA 2Y06L 3VXOA 3IDGB 2D03L 5F96L 5ESVA 1ES0B 4PJFB 5IUSA 3S37H 5DVOA 4HWUA 3VFPA 3F7PC 4XCEA 4KZDH 4PJBE 3WHE0 4NNXA 4P9MH 5D1XB 1AD0B 1JRHI 2YD1A 1NPUA 3DX7B 2V2XA 4M6AA 4LHUD 4JVWA 2Q8AL 5DLML 3MRBA 1ZLVH 3Q5TA 2VDMH 4GW4B 2L7UA 5HHXH 3HC0B 2HFGL 5D2NE 5DTFB 1WBXB 1VESA 5KVFL 4F7EA 3VFOA 1XIWC 1F5WA 5GGTH 3GMQA 2ZCLL 3I50H 3KS0J 2CKBL 6FABL 2J5LB 2NX5B 2VLMD 2X44D 4HV8A 3KPOA 3HE6B 5E94B 3BEVA 4JFDA 3WUWA 3PWVB 3OKKA 3QHFH 3BDYH 3QQ3B 2R0LL 1RZGA 3FB5B 1L6ZA 4U6YA 5GGQH 1C5CH 3IDJA 3GKZA 4TNWK 3VRIA 4YXKL 4MJ5B 4DOHE 2X42A 4MLIA 1CFTA 2BERA 1E28B 2KKQA 3RWDB 3ARBD 3B2VL 4TOYL 3TIEA 2IAMA 1F00I 4UINH 1BD2B 1G9NH 2CLRA 3MUGB 3ELAT 1RIUL 1AFVL 3ZE1E 3FB8B 1N6QL 4LLVA 1NCDH 5D7KE 5ILTL 5HYIA 1X4XA 3Q6GL 4Y1AA 5F6HI 4QRPE 2J2ZA 3MV01 3W11D 2CMRL 2B0SH 1AO7D 4JPKL 1KJVB 2NY1D 5KVMC 3O3DB 2HMID 1NSNL 3IFNL 3G6JB 2JF1A 4WFGE 3AM8A 3DLQR 5D9SA 1MCLA 1B0RB 4QKXB 5IMKA 1FFPA 5D7JC 4NN5C 3ARED 4LF3A 2WWMD 3RWFA 1F3RB 4L9LB 5CJOL 1AH1A 1OAKL 5H8DA 5EORL 5JHDB 1J12A 1FYTB 1G84A 5HDQL 3BPLC 3OV6A 3HAEB 2RCSL 4K3HA 3ECBB 5KG9B 1CE1H 1FN4B 1SVCP 5EOQL 3DXAE 5E2TL 2XTLA 5DEFA 2ICWJ 3RZCA 2FL5B 5DJAB 3GSRA 1RZ8A 1SEQL 2DQFA 4MJIA 3D9AH 3IFLH 5DRZB 4PTTB 1AGDA 4XNZC 3FQRA 3T3ME 3QR2A 4Z7QF 3RPIA 4EUPB 2VC2H 4PJHB 4BQ8A 5BZDB 3C5SA 1N0XH 5TJWK 5I76A 5L9DL 4E41B 1UEMA 3SN6N 3RKDD 1CICA 1U8OB 3M1BA 2P45B 1HHJB 1QR1A 2AK4A 1S9XB 3NA9L 4U1JB 2W0FB 2V7NA 4NKDA 4D9QD 1UKTA 2J8OA 5IMLB 1SYVB 3GSNL 4UQ3B 4GSDL 5E8OB 2GHWB 3IFPB 4I18A 2GCYA 2GK0A 1MRCL 3FT4A 1RJCA 5D1ZA 3P0GB 5INDA 4ALAH 2FEDD 2NZ9C 4RAVA 5I8EB 2V17L 4GXVL 1WUNT 3O45A 2XOTA 4GAFB 3QJHB 1V3LA 2WUCH 1BPVA 4OI7A 3X3FH 3MRGB 5JDSA 4PP1D 1F4YH 1BZ9A 1G7QA 4IJ3C 3VFMA 4DGVL 3HRPA 4YX2H 2R1XA 3PWPE 2QQKL 4J3XA 2R2BA 3ALPA 1S78C 5CLTA 4UAOB 1X4ZA 1U93B 2JELL 1BLNB 5EPMB 2APVA 3C9NA 4JFYA 4JPVL 3V9FA 2BNQA 2AEIT 2NY0C