3K1KC

Green fluorescent protein bound to enhancer nanobody
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
b'QVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green Fluorescent Protein
publication title Modulation of protein properties in living cells using nanobodies
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein/immune system
total genus 26
structure length 114
sequence length 114
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k1kC00
5E08H 4Y4HC 4LSRL 1AXSB 1XF4B 4HKZA 2EE9A 2VLRA 4FFVC 1NL0L 3VXSE 1XGTA 2WP3T 5JLZA 4ZDHB 5FGRA 1KOAA 5DD0L 5ACZA 5L88L 3M1BB 4ZNCD 1LO0L 3BKJL 1E4WH 3HG1A 4RGND 4QHKI 5MEPB 4ODHH 4EN3C 3PE9A 3OJVC 1S9YA 3NCEB 2FECL 1TCRB 4X7SH 4YHKL 3SDDA 3KPTA 4MDJB 3C08L 1ONQA 4G7YH 4Y1AD 3VD4A 4BUGA 2BDNL 2DQEH 4PRNA 1YEFL 3OX8B 3QZWB 4ZO9A 3O8XC 5BMFH 1BFVL 3FO0H 1ZLWK 2PW1B 2HFFA 2D7QA 3RU8L 2M1KA 2XT1B 1IKNA 1U2CA 5C0NC 4BH8A 1WIPA 4WO4C 1FNSL 2HYMA 4F37K 1G9EA 3VGGA 1EBPA 5GGRB 1P7QA 4OM1H 2AXGA 4JZNA 5JA9A 1MIEL 3ARED 1I9EA 4DOHE 2AK4D 3FQUA 3KJ4B 4TTDC 3INUH 1BGXL 2QSTA 3CLEH 4NCC2 2DKUA 2FGWL 1BVLA 3LPFA 3MLVL 1MI5B 3HE6A 1MNUL 2YD1A 1PQZA 1WT5C 3O6FB 1T89C 3VFVB 2ZUUA 4MAYD 1YY8A 5E7FA 1CBVH 2W0FB 1HCFX 5GSRB 2A9NH 5E8DL 3FFCE 5EU4B 3VA6A 5D93C 4HJ0C 3QUZD 3U4BH 5E1AA 3L5XH 1WITA 4PLJC 4WFED 4NKMA 1NC2D 4NFBA 4WFGE 4N5EC 3AM8A 5IVNA 3H9SE 1WAAE 3MR9A 1H3UA 1LP9F 1S78D 3KWWA 1VGKA 4KDWA 4M7ZC 1XR8B 3O4LE 1HZHL 3CFDB 1J87A 1JHTA 2OM5A 3GJFA 3D25B 1D3CA 1UJ3B 4HUXA 2H6PA 4LVNC 1PFCA 5DGRA 5MERA 3OR7A 4JCLA 1INEH 1LE9A 5C09D 3VG0H 3BP4A 3IDXL 3D5OF 3EO0B 3LS4H 5CP3H 5EFIA 1TJGH 2VDOH 3I02B 4MNGB 2R0WH 4IJ3C 4HK3N 2PXYC 1AGCB 2YUVA 2ATKB 2F19L 3W2DH 4R4NC 1IAKB 2AQ3A 4PJDA 5ERWB 3PV6B 3ARSA 4YHIB 1CVSC 1QUNA 3PDDA 5CJ8A 4OI7A 1JGDB 1IEBB 2MKWA 3WD5L 2IC2A 4HIJB 3I9GH 2WBJA 1DP0A 4BQ8A 1EVUA 1QFUL 2DOCA 4AENB 5HD8D 5E8EB 3DX6A 1A6WH 4JY5L 3TP4A 4CAGA 5F7EL 3RDTA 4MA3B 4J8RA 3BJLA 3QUXA 2YBRA 2KDGA 3ZT6A 5IKCA 3EAKA 2ORBH 1JPGA 3SKMB 1JZ3A 1AXTH 5TF1H 1WC7B 2D31A 2P24A 3DV6A 4POUB 4TUJB 4Z7NF 4YHZH 3TGXA 1W0VA 3MODL 3MRHB 4W4NA 4XXDA 2EYSB 3LV3A 4J3UA 2ICEB 4PRAA 4U1HB 4KKAD 1JFQH 2Z9TA 1LO5B 2ZUQC 2IQAA 4P2OC 2GIYA 3OB0H 3QO0A 1JI1A 3I85A 4JM2A 4LHUG 5KOVC 1SYVA 3ULVH 3VXSA 1NFKA 2DQHH 2ADGB 5F7HA 4ODUB 3QXDB 1TETL 1G9NC 4J3XA 2G9HB 1P9MA 3EO9L 4M7KH 5FB8B 1CWVA 1TMCB 1KPUA 4P3CL 2BMKA 2IGFH 3ZHLA 1GGCH 1JPTL 4ZSOE 3BKMH 1UXWB 4ZUUB 4XMPL 4ZFFB 1AE6L 3R06A 5DJCB 2UWEF 3Q5TA 2ATPA 5ADOL 3BSZL 2NXYD 5E2TH 1RZIA 1UB6A 1DL7H 1RZ7L 5EU6A 4NQVA 1EXUA 2C1OB 1FRGL 1YEIH 1FL5A 5CZKA 4X0KB 5J6HB 2HT3C 4AT6A 1IM3B 3IDNA 3T0XA 5EO1A 3H42L 1MRFH 3BH8B 1DDHB 5ISZA 3HZVA 1F11A 2FATH 2YN5A 1TZHA 3G9VA 3MACL 4YDKL 3VXRE 2DQGL 3LHPH 2R0LL 4NRYB 4XX1E 3AVEA 4WHCA 1ORQB 4JRYD 5CJOH 3T0DA 2FGZA 4F9PA 3L3DA 4J3WA 2BVQA 1OT2A 1YUHA 3NCYP 4LDLB 2MSPA 5IVXB 4PLKD 5HVHB 1MAML 3DROB 3DVFA 3TA3A 2H1PH 4AMKL 4CBPA 2WBKA 1LP9E 3FFCA 4JN2B 4OM0H 1ND0B 4DKFH 2B4CH 5CJ5A 4UT9L 5F96H 1NANI 3DYOA 4HIIB 3CU1A 3AAZA 3MLZL 3HLAA 4YPJA 1I4FB 4U1LA 2IALB 1J0KA 5I0ZA 4NUGL 2D7MA 3MGOB 1WK0A 2Z91B 3D69A 1X5KA 4U1JA 2AEPL 3F12A 3HC4L 4PYGA 3O4LA 4I0PD 2VQUA 4MXWL 4PJXA 5I75B 5SWZE 4FQXD 4MD4B 2HN7A 1NBVL 4J6RH 3OWEA 3L5HA 4R97C 4X4XA 2A0LD 1A9BA 4MJ6A 3HZMB 5DC9B 1NEZG 4H88H 4I18C 2BVOB 4O9HH 4QTHB 4P57B 4EI6B 2V5SA 2NY4D 2VDML 3BWAA 1TTUA 1ZOXA 3HAEH 1V7NH 4MQXC 2YD7A 2BNUA 4G6MH 5T3XD 4DN4L 1NBYB 3C5SA 5FO8A 2R2CA 2OQJB 2X9WA 1KULA 2JJSC 1PY9A 4PGCA 1BZ9A 4NT6B 5E5MA 2J12B 4Y4FA 3C6SA 1AY1L 1KBGH 1KCRH 3O2VL 2P8MA 4HH9B 4X7EC 3MTRA 1PDKA 4U7KA 1JZ5A 4Z7NE 4XI5D 3VFMA 3W9DA 3ESVF 1B6DA 3WLBA 1TPXC 3V2AR 1H5BC 1AKJA 4P99A 4TUKH 2W65B 1CFSA 1K4CA 3EFFB 3SE9H 2EDDA 3TT3L 5C6WH 1QSZA 3MRNA 1OOAA 1BPVA 2Q6WA 2XZAL 4OUUA 5FO9B 4JPVH 4KQ4L 5FYJD 3KYNA 3QPQC 2NNAA 3HB3C 4QTIL 3FQNA 1FNGA 3SJVA 2C3GA 2P42B 2O5ZL 4MJID 1J0HA 2DIJA 4GQ9H 3WFCH 3F7QA 2XFXB 1OAUH 1CICD 2FO4A 1Q38A 1JK8B 4A6YH 3CPLB 2JJTC 4Q6IC 5I71B 1IAII 2EDOA 1YECH 2UWEE 3PL6D 4OZHB 4LCWD 1NMBL 5DK2B 4M62L 1Q0YH 5JDSB 1A7NL 1T04A 3BT2L 4JFHE 2X1PA 4UV4L 3HPLA 4ZOAA 4ZSOA 1P4BH 4ORGA 5BVPH 1JN6B 5EUKA 5AEAA 4LSVH 3S34H 3MV9E 1YEEL 4MZ3A 5CLTA 1AGBA 4KK5C 4EUPB 1RULL 2VDRL 2QADC 3TBSA 1XF5B 4OV5A 1HWGB 1HIML 3CXDL 4FS0A 3BZFA 1J12A 3FTGB 5CZXC 1Z9MA 2BNQD 2D4FA 4OSUH 4JPWH 2AKRA 5D6CB 4X99A 5J1TC 4MS8C 5C8JA 1OB1A 3WUWA 5H35A 1RHHB 3QCVH 3ARFC 4JZJA 5GS0L 5J1AB 4EI5C 4NM8L 3TPUA 2X4TA 4KVCL 1A6TB 3VMOA 4JG1H 3MV8B 3TO2A 3WS3A 2X42A 1NC4A 2X6MA 3TJEL 1U8HB 4G3YH 3PP3K 4ZFZA 1Y6KR 4JKLA 1CD0A 3SPVA 5CWSA 1BQLL 5MI0B 5C6TL 4Y5VC 1T0NA 4IEFB 3O3BB 3ZKMC 2EDRA 1LP9A 4P5MA 1UH4A 4N0UE 1U3HD 3O45A 1Q94B 3GSWB 3D0VB 3BGMA 4I9WE 1ZVHA 1JHLL 1M7XA 4FQIL 1MI5D 1FE8H 4W81A 3P73A 5JW4N 1X5AA 3WS6A 3O6FD 1MCWM 1I1YA 5CINH 3MRFA 2CRYA 5FECB 3C09B 1LEGA 2Z92A 4LLWB 4WHYH 4QOKE 2FCBA 3CDGA 4L3ED 5F44A 4LRIA 4YDIH 3IFPA 5SWZA 5HJ3A 1OSZB 3OAYH 4I2XB 3RJQB 1H8OA 1NFIA 2PYFB 3EHBC 1OHQA 5IMLB 4EBQL 4K7FA 2Y1VA 3ULVE 3VWJB 1MCPH 3T0WA 1A14H 2BSSB 5AAMA 4L8DB 2OX5A 4MXVF 5J9PB 5HI3D 4BQCA 1IKFL 1CDJA 2V2XB 1CLZH 4NZTL 4DFHA 1YYLH 2YD9A 1VGEH 4O2FB 3T4AB 2FR4B 3MV01 1CG9B 1EMTL 1JGVL 3GIZH 3VFRB 4JKMA 1IAOA 3NIGF 1OTUC 4QHLA 2X4PA 5F9AC 3B2UC 4Y4KA 1XIWA 3L3HB 1HDMB 1ORSB 1H8NA 3PWJA 4OLUL 1DE4B 2DKSA 3CC5A 1KC5H 3O3DA 2KBGA 1ZXQA 2W60B 5CGYD 5SWSE 3C5ZA 3E6FA 5EO0B 2QQLH 3BW9A 1YNLH 1A4KA 5ESVA 5J1SC 3HI1B 4J12A 3GMNA 3MNVA 1VKXA 3KYOB 1NUDA 3IJYA 4U3HA 3WL9B 2D7TL 3IDMA 1HKLH 1BOGB 3BAEL 1FH5L 1NCAH 1CLOH 5T5FH 1K3IA 1JMXA 4OD3L 1PKOA 2MCPH 4PPTA 2A6DA 4GLRH 5D7SL 2FRGP 4I4WB 1G6RA 1A3LL 1T6VN 5E0QA 3L5WA 4K94H 4YDJB 1A1NA 5DMIH 2D7OA 3UEZA 2GJ6E 3ARGA 5GGSA 2VIRA 1JHKH 3H8NA 5IM7A 3GRWH 3E3QC 3RGHA 3UPRA 3SQOL 3V5HB 3EDDA 4YAQB 1DQDL 2C4XA 2A38A 2A1WH 2XTJD 1OAYL 3MRMA 2UWEA 3V4VL 3HR5B 1MHPH 4OCRH 3MXWL 4HBQA 4L9LC 4GSDH 1CLYH 2J4WH 1PVHA 4I3SL 3PDGA 4GUPA 4RQQB 4YC2B 5J11C 1EGJH 3CUPA 2APXA 4NO0B 1FORH 1UENA 4IRZL 3SDXE 4R2GC 3U0TB 5F9JA 3FZUC 4C4KT 5D70L 3GGWA 4S1RH 1IT9H 1EZVX 3QNZB 4BZ1L 1DBAL 3IVKB 5CP3A 4D3CL 5I74C 1IEAB 4UNTA 1P6FA 3G5VA 4AG4L 2I60L 1BBDL 4WW2F 4HKZB 1TQCB 1D9KA 1GGTA 4F80A 3N9GL 1XGTB 3GMOA 4ENED 4ONFH 3IF1A 2BK8A 3SE8L 5JLZB 4MQTB 5ACZB 3BESR 2D7PA 3H9ZA 3HG1B 5JW5A 4OJFH 3T2NH 3PWPD 12E8L 1S9YB 1MCNA 2BXYA 3VFGL 3PWVA 3SDDB 1RQ5A 2J5LB 1ONQB 3LKNA 2HTKC 4PRNB 3MRGA 3U48A 4N0UA 4OLXL 4ZTPH 4XVUC 1NMCC 2HFFB 4NJAL 3WFBL 2H9GA 1GOFA 4LOUD 2VZ1A 4BH8B 3O0RL 4H26A 4DEPC 4N0CC 4J3VA 4JB9L 4MB3A 1S7TA 1SEBA 4QOKA 2YRZA 3W11C 3E1F1 2VERN 5GGVL 1QFWI 5J6GA 4S1SH 1P7QB 2AXGB 4JZNB 2Q8BH 2EDWA 2NR6C 1M7IA 5FCUL 5L0QC 1EO8L 1DQQA 2F54E 3LQZB 5E99L 2R4RH 2EDLA 1BVLB 3HE6B 4M43L 1PQZB 4EDWL 2VXVL 4LHJB 5DRNB 4GRLD 1JE6A 2HJFB 6FABH 3E8UL 3NIGE 2E7HA 4RMUA 2KZ1B 4P5TA 3MZGB 5E2WH 5E1AB 2O93L 4NKMB 1Q9OA 1DBMH 4Q2ZB 3ZMRA 5I2IA 1HWHB 1KCKA 3PP4H 3MR9B 4XP1H 3KWWB 3QO1A 4QEGA 4ZTOH 4G8EA 1EA9C 2EIEA 3PWUA 4G6JH 1JHTB 3V8CA 3AB0B 3L6FA 2DL2A 4YQXH 5AZEH 4JFZL 4HUXB 2H6PB 2YEZB 4C59B 5MERB 3OR7B 3MJ8B 5SWSA 1RFDH 1LE9B 3BP4B 1MREL 1FNLA 5EFIB 3ULUC 2R56H 2PYEE 5C0ND 2VAAA 4YBLC 1LGVA 3F58L 3QB7C 4LGRB 4MSWA 1ZT4A 5DFTA 5EA0L 5I9QC 4PJDB 4DWHA 5MENE 2EXYC 1LWRA 1QFHA 2NX5E 4UIMA 1PEZA 4JE4B 4XNQA 3P0GB 5E8NA 2GJ6A 2YPKB 5CSBA 5FYLH 3MRLB 1JNNH 5LXGH 4JFFD 4TTDD 4LSQL 4XMLH 1F90H 1NEZB 5M94B 4M7LH 4HKJA 1MFCH 1E27A 1QSFE 2DQCH 3DX6B 3L7EA 2WWMD 3GB7A 1JYWA 3RDTB 1I9JL 2DB8A 4J8RB 3QUXB 2YBRB 3TCLA 3TFKC 3TVMA 5IKCB 2JB5L 4ODBD 1JPGB 5T1LA 3SN6N 2IF7A 4HG4K 4Y16C 2D31B 4FP8L 2P24B 5DYOA 5SV3A 5IB2A 3DV6B 1AC0A 3B9KC 2LTQB 1QZ1A 3TWCL 1C16A 4X6DF 1YEKH 4PYHA 3MV7E 5HHXL 3OQ3B 1W0VB 4XXDB 5IB4A 3EDKA 4PRAB 4DGIH 2A83A 1YA5A 2YMXL 1XGYH 2RGSA 4NO3A 1C5DA 2IQAB 1OAQH 3MOAH 1RUPH 1RV6X 3HAEA 3FO1A 4JM2B 4HKXA 4MA1B 2IFFL 5GRUL 1TNMA 3LQAL 1SYVB 3VXSB 2K3TA 3HPJA 1WVZA 3CFCL 1ZTXH 1Z9OA 3ARPA 1KIPA 5I16A 3I6LE 3NABH 4A2MA 1SJXA 4XCNA 1KPUB 1UWGL 2BMKB 3OBAA 3ZE2F 1U0QA 5HPOA 1R5IA 2IG2L 5F9WB 3R06B 1P1ZA 3TIEB 2DIAA 2ATPB 2FH6A 3TF7C 1J5OH 1N7MH 1UB6B 3GSNL 2ZNWA 4NQVB 1EXUB 4DVRH 5DJ8A 1FL5B 5IHUL 2FX9L 3QQ9D 4AT6B 3C60A 3IDNB 4C56E 4RZCA 5CMAA 5EO1B 4GRMA 5JOPE 3CX5K 1YYMH 3EJJX 5ISZB 4ZOBA 1H3TA 3KJ4C 3HZVB 1F11B 3BXNA 1J1OL 1S7XA 3ARRA 1LNUA 2P8LA 2IH3A 5BVJA 3O6LH 5GPRA 2F54A 4EJ1C 2E9JA 3ULSB 1JZ2A 3JWOH 1CGSH 3ZDYE 3L3DB 3EIFA 1YUHB 3ROOA 3MFGB 4GW5A 4KWUA 1LE5A 1A3RH 2FLRT 3H3PL 4A6YA 3RNQA 1R0AL 2VLJE 1F2QA 1FZOA 3RY5A 3FFCB 1Q9KA 3UJIL 3HLAB 3BO8A 4N8CH 3N85L 3O6MH 4U1LB 2LAAA 4JFDE 5C92A 4PGZA 3H9SB 3D69B 4ODWA 4U1JB 5GRYA 3IETA 1UJ3C 4YK4B 3F12B 5DUPH 2DM3A 3A6CL 3O4LB 1EUTA 3DWTA 4PJXB 4TRPL 3WNPA 1KF9B 2HN7B 3TCXA 4X4XB 1LO2L 3WJJA 1A9BB 2HT4D 4MJ6B 4YWGL 5I18H 5GS2H 2ZUXA 5GS3A 2EE2A 3CK0L 3OF6A 4S0TD 4DW2H 4P4KB 5E2VL 3WXVH 1A6UH 2CK2A 4WHTA 4M00A 4UV7H 1LILA 3GI9H 4UT6L 4M4RA 3BWAB 5C08E 2HT3D 5IMMA 3RAJH 5FKAA 4JGMA 4NZDA 5EPMA 5EULV 1UZ6F 3C5SB 2R1XB 3O2DH 5MENA 4O4YH 2NX5A 1WF5A 4HGWA 4PGCB 1BZ9B 4QLRA 3U4EA 2KQMA 5E5MB 5E08L 1X44A 4WNQA 4DN3H 3FQXA 4RISL 4Y4FB 2E7BA 2VZVA 4KQ3H 3C6SB 1MIMH 5HHOD 1D6VH 2P8MB 4OD1H 4MXQD 4NWUH 2BX5A 1BFOA 3HAEG 2IH1A 1QSFA 3LOWA 4K55A 4BKLA 1T03L 1T83A 1FYTE 1PKQA 3VFMB 5BXFB 3W9DB 4XBPA 3WLBB 2NY0B 4DKAA 1LEIA 4L8SC 1AKJB 4G7YL 2YPLA 2DQEL 1CFSB 1K4CB 2GK0B 2Y07L 3G9AB 4PJ8A 2BVEA 4PV9B 5GRVK 3MRNB 5BMFL 1J10A 2Q6WB 4WW2A 4OUUB 2AV7A 5LCVH 3MV7A 3KYNB 2NY2C 2XRAH 2NNAB 1L7IH 1NPUA 5EC1B 3FQNB 1A7RH 1FNGB 3T3MF 4M6OL 3ISWA 3WNOA 3FMGH 2YD8A 4ZAKA 5GS0D 1LDPH 3BFOA 5B22A 4NO0D 4CN6A 2FO4B 5E2UL 3ZE2E 5IROC 4PJAF 3INUL 3MJGX 2R1YA 3CLEL 3FN0L 2LAGB 1G6RL 3C9NB 4F58L 4O5LL 1T04B 4HPOH 1CDHA 4OBRA 3HPLB 2RJMA 1RMFH 1CXHA 4ZSOB 4D9LH 4ORGB 4Z7OF 3EUUA 2VLRD 4F57H 5HYQA 5EUKB 5JW3L 3QEQE 1AGBB 5IP4A 4G8GE 3JV6A 1TVDA 4EEEA 1SM3L 3L5XL 4O2CA 3TBSB 4OV5B 2F53D 5DVLA 3BZFB 3RVVC 1FAKT 4C56A 1T2XA 5D8JL 3SDDD 2AKRB 3SE3A 4X99B 3VFPA 5C8JB 1OB1B 5H35B 3WUWB 3IFNH 3HI6L 4N1HB 4LCIL 1ZANL 3SDAA 1TVBA 1BLNA 3O3UN 2FX7L 2EIZA 3TPUB 2X4TB 1IAIL 5IB3B 3TO2B 1NGQH 3BISA 1NC4B 4U1KA 1A02N 1SVZA 3VDCA 1I3RA 2D0FA 4HIHA 5FYLE 1VFAA 4ZFZB 3GRWA 3LS4L 2CLRA 3SPVB 2WUBH 3O4OB 5FUCC 4A2LA 5CWSB 3BDBA 4RMTA 1T0NB 3VFNA 4KK8D 4EIGB 5JQHC 1NCUA 4P5MB 1LP9B 1P53A 1M1SA 1I8LA 2NZ9C 3WFDH 3HE6D 4DZBA 5IV2A 3QIBA 1J1XH 4JFDA 2D9QB 3MRFB 5TDPB 1IVLA 2D7NA 2NXZB 5D1ZA 3I9GL 1YEHL 3ZYOA 1LEGB 4PRDA 4MWFB 2Z92B 2VH5H 1MFDH 1EGJA 3QUKA 4XVSH 4M93B 5DA4A 4KXZI 4HUMB 3U9PH 3IRZA 3TIDA 2VB5A 3IFPB 5SWZB 2ENYA 5HJ3B 2E6JA 3WHXA 1I75A 2HG5A 4PRIA 4E0RB 3CDCA 1NFIB 1ZGLP 4IIQA 4WVRA 1YDPA 1WV7T 1AXTL 4K7FB 4N90D 4KJYA 3WFZA 1UZ6E 4KJPC 2G75A 1J9CT 5EOTA 4XVTH 5IJVA 4NQCE 4L4VE 2FWOB 2APBA 4YHZL 2DJ4A 4F15B 2DD8H 3UCRA 2UY6A 4JHAH 1SMAA 5E6IA 2P5ED 1FBIH 1ERNA 1KEGL 4LLYA 5EBMB 3CX5J 3RWJA 2XWBA 3QIWA 5BV7H 1WISA 5IB1A 1IAOB 4WHDA 4QHLB 2X4PB 5T1KA 3IJHA 1XIWB 4Y4KB 4NNXA 5ALCH 2GFBB 4KJQD 1CR9H 4APQB 4JVWA 3PWJB 1T20A 3LRHA 1BBJA 3CC5B 4MQSB 4M7KL 4RGMB 3AY4C 4X6DA 1FO0H 5JUEL 1G7HA 1FYTA 3C5ZB 3AMKA 3BW9B 1A4KB 4JR9L 4LNVA 5HGGS 5ESVB 2WBJD 3GMNB 1VKXB 4BH7A 1L0QA 2K7QA 2ICES 3IDMB 4OCYL 2Y6SD 4OGXL 5J57B 3W39B 1A1OA 1AGEA 2A6DB 3GUTA 3BWUC 3TT1H 3L5WB 4MNHA 4PJAE 1A1NB 4I0KA 2OI9B 3ARGB 1AJ7H 5GGSB 4M48H 2VIRB 1HQ4A 4NQSA 4HX1A 1IGCH 4FFWC 4P59H 3ZT7A 3OKOA 1RIUH 1A4JA 3VGDA 4OQTL 4Z7OE 4OLEA 3CMGA 2RCSH 1RUML 3KAAA 3MRMB 2UWEB 3OXSB 4POZC 5CJOL 4NQUA 4TSCH 1EERB 1L7TH 2ZUYA 1FQ9C 4XBEH 5JDJA 4O58H 3VXSD 1KEMH 4F7EA 2DTMH 2H1PL 1P2CA 3MV9B 4DKFL 3QEQA 3CUPB 5F96L 4LKCA 3V0WH 2BRRH 4G5ZH 5F9JB 1CQKA 4M5ZL 3GMMA 1PZUB 3GGWB 1R3JB 3WYRA 4YHOH 2BHUA 5L9DL 1JRHH 1P6AB 1I7RB 4TN9A 3G5VB 2OR9L 3SQBA 1D9KB 1GPOL 3V4PH 4PY8J 1IGTA 4ZXBD 3S97C 3OPZL 3GMOB 5EU6D 4XCFL 2Y23A 3IF1B 4BQ9A 3B3IA 4RWYH 3VXNA 1T5WA 3ZDZF 5CILH 5JW5B 1EPFA 3UBXG 1BM3L 4LPXA 3DXAE 5ISZD 3PWVB 5JXEA 4NZRL 2B1AL 3LKNB 5D6DC 4TOYH 3IU4L 1IEHA 3RGVD 1ZV5A 3MRGB 5ADPH 1T1ZA 4PJ5A 2Q7NA 4N0UB 3SGEI 4JPIA 2C1PA 2J8HA 3V6BR 3JVGA 1SBSL 4ORZC 5IBUB 3JTTA 1EBAA 1WZ1L 3ARDA 2R9HC 2AXHA 3TA3D 1S7TB 1SEBB 4QOKB 4NBYB 1MHEA 1ZHLA 5FOBA 1M7IB 3OL2A 3MV11 3VWJC 4M9OA 1PG7X 1DQQB 2D0HA 3VXPB 2A73A 2VL5A 1U95B 4NHCH 4NQCA 4P9ML 4L4VA 4YEFA 2ZG2A 3QH3B 3FAXA 2DQFA 4P5TB 3LRSA 1II4E 5IEHA 2V5YA 2OL3L 3VXOA 5I8EA 3T65A 3LPWA 4V1DE 2I27N 3WFCL 1Q9OB 3UJJH 1D5IL 5I2IB 2WK2A 4JN1L 1G7MA 2UUDK 3QO1B 1QBML 3MA9H 4G8EB 4D8PA 3PWUB 3EYSL 1G9MC 1QFWL 1KCSH 1TVHA 3AGVA 3L6FB 1Z3GH 4OQ1A 3MLTA 1BAFH 1Q0YL 5E4EB 3MPCA 5SWSB 3GK8L 2Q86A 1MHCB 2WM0A 4Y4FD 5EC2A 3X3FH 4Y2DA 1SYSA 2AI0L 4AIOA 4LSVL 4GAGL 5F7WC 5GHWL 1ETZA 2VAAB 5A2IH 2DM4A 1NCBL 5F7YC 4MSWB 1ZT4B 4N0CD 3D87B 5TGBA 2B20A 1IRAY 4LEOA 4MMXC 4XNQB 3W11D 4HW6A 4KPHL 4PJAA 5E8NB 2GJ6B 3IDGB 2NR6D 3QCVL 1HSAA 2D3VA 5FXCH 4XCEA 5IOPA 1RZJH 3BYTA 3NFNA 4GQPH 4HKJB 4QXGL 4ZPVA 4QY8A 5T1DH 1PLGL 1TZIA 4M6ML 3QULA 3SJVD 3L7EB 1RVFL 3NCFB 3GB7B 1HYSC 4L8BA 4X7DC 4YC2C 3TCLB 5FA3A 3B5HA 3TVMB 3Q1SH 4QF1B 4OZFG 3QWRA 5T1LB 5DYOB 4UB0H 2A74B 3Q0HA 5IB2B 4TSBH 3OAZK 1C16B 4I3RL 3ARBA 4TSAH 4XPGH 2RB8A 2EDQA 3SDXB 4D94A 5IB4B 4GKSB 2OXHA 2BSED 1TQCC 2A83B 4GBXD 3B5TA 4K8RH 5HGHA 1P7KB 4NO3B 2RAMA 2H3NA 3CH1A 4PLNC 3ZDZE 1U36A 1C5DB 3BRFA 3HAEB 3EDJA 3FO1B 2EXWC 2VC2H 1T0PB 2Q7YA 4BZ2H 3C87A 3W81A 4YDIL 3HPJB 2Z8WC 4OFDA 1KIPB 5I16B 1KIUA 3KXFE 2J5LC 1FVEA 4XCNB 4CJ1A 4OB5H 3DXAA 3BDYL 4XWOC 1X5JA 2W0KA 1U8MA 1R5IB 5GXBB 3GSUA 2XOTA 3MJ9H 1IKNC 4NQXA 2G2RA 2DWEA 4UILH 3DMMA 1INDH 4L5FH 4F7MA 3UX9B 4ETYA 4YXKH 2DYPD 1IEAA 3G5ZA 1NC4D 1RZKC 3HTLX 1I7ZA 5DJ8B 1YYLL 1VGEL 2VDNH 2DTSA 1OLZA 3EYOA 4OIBA 3C60B 2N4IA 1FDLL 5CS7A 4RZCB 5CMAB 3GIZL 2XQBH 4GRMB 3QDME 4XAWL 1XCQA 1YZZA 4YXLH 2ERJB 4WI5A 3CH8A 4IRJD 2VNCA 4JGJA 1N0LA 4LFHD 3T0EA 3BXNB 5D71H 2OXGA 1MFNA 3TFKD 3DYMA 1S7XB 2PO6A 4OCXL 3TJHD 5GZOD 2P8LB 2IH3B 5BVJB 3QFJE 3IYLW 2BC4A 3S4SG 4M6NL 3GO1L 2F54B 1YNLL 1MVFA 1FC2D 1G7LA 5GRWA 3CLFH 4WEBH 3TBTA 3ROOB 2B0SH 4GW5B 1LE5B 4PS4L 3W9EA 2EDKA 4O02H 4A6YB 3RNQB 1AQKH 2IQ9H 3FL7A 1CLOL 1FZOB 5JOEA 5E4IA 1PAMA 4TNVK 2R0KH 2DMKA 3AM8C 4RMVA 1Q9KB 2NY7L 5BZWA 1C1EH 1KGCE 1MJUL 1T22B 4X5WA 3S35H 3BO8B 3WN5A 5HYFA 1AD9B 4U1MA 4UDUA 4WENB 2EDNA 4LSUH 4V1DA 4GMSL 3P4OB 4ODWB 3AB0C 4YDLB 4DGYH 3IETB 5MHSD 4HT1H 3BOVA 2AS5M 1RK0B 4NO2A 4X7TA 2DBLH 1NCDL 1CYGA 1FLTX 3CMOH 4EQ3A 3THMH 2BVPA 2J4WL 5TJWK 3S98A 5T33H 4CN4A 3L1OL 4WHTB 1BEYH 2J1KA 3QBTB 2JCCF 3HI5H 2PYEB 5GJTH 1KUMA 1FORL 2AW2A 1RSFA 5HHPA 4FQJH 3RTQD 2AJ3A 5EPMB 4ODSL 1OGAE 1L9MA 4S1RL 1U8IA 1IT9L 4D0DA 5MENB 1QEWA 4F33A 1ZT1A 2NX5B 3OZ9L 4LGSB 3U4EB 3VD5A 2BNRE 4WNQB 3EYUH 4P46D 3FQXB 2NQCA 4JG0H 2BVUA 1OWWA 4GW4A 5A2KH 1KPRA 4JFED 3QUYA 4YO0A 3QUXC 5DEGA 1FL3A 1BFOB 4R0LA 5I1AA 1VFBA 3RWHA 1QSFB 1QNZH 4BKLB 2DMBA 3LKQA 4NKOA 1PKQB 1QRNE 3HMXH 2LTQC 4JQXC 2QQNH 4XBPB 4NC1C 4AL8L 2A6KB 1LEIB 4N68A 3RIFK 3GKWH 3HFML 2EH7H 1U92A 1BQHA 4PJ8B 2AJYL 2B2XH 1D7FA 4JFOA 4E42A 1H3PL 4WW2B 5T3XH 2AV7B 3MV7B 1EFXA 5A16A 4Z8FL 4IMKA 1GHFH 1YEDA 4KKNA 2Y4SA 25C8H 4H8WC 43C9A 2DQDH 1UM5L 1ACYH 1MHHB 1ROWA 4Y1AE 4XTRD 2ENSA 4ZAKB 5CIPH 3OKMA 4TUOA 2JIXD 3MUGA 3WSQH 4QRPD 4RFNC 3BJ91 1A6VL 1V7ML 1KXTB 4P23C 3FHAA 1EHLH 2R1YB 3KXFA 4I3GA 2EDTA 5F9WC 2IPTH 4RGOH 2EC8A 1F4WH 4TPRL 2AERT 5K59F 3VD9A 3RVXC 2UZXB 2Z8SA 2CLZA 4MCZA 4TNWF 3A67H 4M8QA 1I9RL 5EZLA 6FABL 1N5YH 5HYQB 1ITBB 2AK4E 2DM7A 3VW3L 2XY2A 5FYJH 2EEDA 2QJDA 5FYJU 1PZ5A 4JY6B 4U31A 1FO0A 4PG2A 4K2UL 1MFAL 2GTWA 2X9YA 4O2CB 4YLQT 1KXQE 4R4BA 3OGOE 5C0JA 5ID1A 4C56B 1EV2E 5DI8A 4NPYA 3VFPB 5I0DA 2HKHH 2GW5A 1IFHL 2CMRL 2ZJSH 5E8PA 3LN5A 4R6UA 1JGLH 3SDAB 1MCRA 3BKCH 1TVBB 4WFEE 2EIZB 4I9WD 1F6LL 3QFJA 3U7WH 1DVFA 4U1KB 1RFDL 1I3RB 3ORJA 4HIHB 1VFAB 5HI5C 1B0GA 2CLRB 3QSKB 1WBYA 3FT2B 1WCBA 1CK0L 2GCYA 1U58A 2ID5A 3PGFL 4Z0BL 1GSMA 3DSFL 3KNBA 5SX5H 3VFNB 1MJJA 1UH3A 1K6QH 4N8VA 2BVYA 2R23A 5K93A 3WKMH 2GY7B 4YK4C 3MMEA 5IV2B 4OGYH 3QIBB 4JFDB 2CDEA 5D1ZB 2QSCH 3U1SL 5LXGL 2DQTH 2YXMA 5DJ0A 4PRDB 3QUKB 1ADQL 3T1FA 2HLFC 1FGNL 2RBLA 3QXAA 2EH8H 3OG6B 4P5TD 4P4KC 3TIDB 3P2TA 3RHWK 2JCCE 3FN3A 5FHAH 3UROR 2C3XA 2HG5B 4PRIB 4Q97A 4IIQB 1YNKL 1TJHL 4KJYB 2G75B 1PYWA 5EOTB 5IB5A 4G7VH 1B2WH 4LARH 5C08B 4J23A 1YEKL 3QI9A 5F8QC 4PY8I 5E6IB 4XNYL 2A77L 1HCVA 4OF3A 3QCTH 4LLYB 3MCLH 3RWJB 3UDWA 3D2UA 2XWBB 1A0QH 1VPOH 3QIWB 2MWCA 3HMWH 4ZS6D 3MOAL 2BNRA 2VLMD 4WCYH 1OAZH 2IWGA 3TZVA 4JANA 4LRNH 5KSBF 5T1KB 3B8SA 3IJHB 4NNXB 3HE7D 4B41A 3MOBH 3DO7A 1RZGA 1ZTXL 1I9IL 1T20B 4PJBF 4UNUA 3P11H 1BBJB 1NGZB 4AEIH 8CGTA 3MRIA 3TYGH 3PDOA 4X6DB 2NY5L 1G7HB 1FYTB 4UT7H 5I1GH 1QRNA 2GJ6D 3EJZC 5GGUA 3O3EA 3UAJC 3K4AA 5HHNA 4BH7B 5DS8A 2DKMA 1F4HA 3ZKSD 2P45B 4DVRL 4JFXA 1A1OB 5HHMD 1AGEB 3GUTB 5DFVD 2MHAA 3TVMD 4OGAC 3UZEA 4MNHB 1KLFA 4UQ3A 1U8OB 5EZIH 4Y1AA 4LSDA 5CSZA 5TDNA 4HX1B 2RR3A 3NAAL 4LQFH 3GSVA 3N1GC 1HK6A 5EDXA 5JHDD 5ELIA 5K59E 3OKOB 4YFLF 4NZUL 1A4JB 2W9LA 4Z9KB 3QHZL 4XXCA 1V3KA 2EE6A 4GS7B 3MLRH 2IBGA 3JWOL 3WLWD 3K8MA 1OAKL 4KRPD 1BD2E 5IT2H 1IGML 3U2SA 4JAMB 2LE9A 5L8JB 4F7EB 1JTOA 2AK4A 1P2CB 3QEQB 2DWDA 4JRYE 3V52L 4NQED 4G8GB 4PRHE 4KFZC 3WMSA 2D9CA 3T3PF 3IXTA 4N8CL 3O6ML 3S36L 5INDB 3GFUA 4KKBD 4MAYA 3CAFA 3CDYA 1NL0H 1MCQA 4M3KB 5DD0H 1LO0H 1YJDL 5JR1L 4PJHE 3QUZA 3B3IB 1PBYA 4PJ9A 1T5WB 1AGDB 1ZHBA 3KPOB 4YHKH 4N0YH 4NIKB 4OKDA 1YMME 3C08H 3WXVL 4PP2B 4KUZL 1IBGL 4HWZA 3RL1A 1I1AD 1OP3H 4AQOA 2VXTH 1KB5H 1BFVH 1R3LA 5BW7A 1MFBH 4P9HC 5C07D 3RU8H 5E6ZA 1T1YA 5KSAD 1T1ZB 2F54D 4JPIB 2C1PB 3UZVB 3D48R 4O4YL 5CD5D 3JTTB 1IGJA 3MRBA 2Z93A 3LB6C 4LRIC 4J3TA 4DN3L 3ARDB 3VI3F 4PTTA 1MIML 1MIEH 5F9OL 1MCEA 3KLAA 4NWUL 3OG4B 5T3XE 1U9KA 1BGXH 1MHEB 1ZHLB 2FGWH 2IBBA 1XGRA 1ES0A 3MLVH 5FOBB 2CIIA 2JCCA 1MNUH 1EEUA 2E7CA 4HFWB 3PXHA 1LMKA 4F15C 5C0EA 4HKBA 2VL5B 4D0CB 2C3VA 5E8DH 1IILE 2ZCLL 3LDBB 3G6DH 2ESVD 3ZKXC 1FVCA 4NQCB 2AABH 4U6HA 4AEEA 4L4VB 5DRWA 1WZLA 2E5EA 4D9RD 2DQFB 2XRAL 1L7IL 3LRSB 4WWKA 1A7RL 5CHNA 3OF6D 3LKOA 7CGTA 4FFYL 4Y4KC 1XIWC 5I8EB 4PJBE 3T65B 2K7PA 1HZHH 2V7NA 5HGDA 4APQC 3VA2C 5D1XD 1LDPL 4DZ8A 1G7MB 3MJ9A 4ETQA 2BOBA 5FYJE 3SCMD 2R29H 5F1OB 3C5ZC 5C0CE 3OJDA 2V2WA 1N3NA 1HNGA 1S9WA 1TVHB 3BPCB 4MJIE 5MEND 1UM4H 3MLTB 2NX5D 3L7FA 1P84K 2OZ4L 5H94A 4HQQL 1MVUA 5EC2B 4P3WA 4Y2DB 1VEOA 5IMKA 1SYSB 3K46A 5IQ9A 4LCWE 3ABZA 1ETZB 3ECBA 2Z35A 1JPFA 3QEGH 2OI9C 4OFPA 1U8LA 4MLIA 3WD5H 5I1CL 1F6AA 3UBXI 4QYOA 5TGBB 2XXCB 1YY9C 4PJAB 1QFUH 5DK0B 1XEDA 2YPLD 5DJ2B 1MFEH 1O7VA 3DETC 1HSAB 3EYVA 4Z5RB 4JY5H 4XCEB 5IOPB 3HUJF 3MV7D 4WUKL 4G80B 4QY8B 4ZPVB 1TZIB 3QULB 3AMLA 2BNQE 3DYPA 4JHWH 4LSSH 1NGQL 4X9FA 4WIQA 3KDMA 2PUQT 4L8BB 3TNMB 5FA3B 4M8VA 1D5XA 3T3PE 2WUBL 2EO9A 1T66D 1BD2A 1YPZE 1VHPA 2W9EL 1BWWA 5IW1A 2W07A 2QLVB 3MODH 3MLPA 5AUMA 1G84A 4Q9CA 2CRMA 4JRYA 3ARBB 2XPGA 4OFYA 4PRHA 1FCCA 1GH7A 1FJ1A 1SJEA 1J1XL 1D9KC 5B21A 5HGHB 4NKQB 3OJMB 2H3NB 3MC0A 4XWGH 3CH1B 3MBED 2VH5L 1MFDL 2CGRL 4GXUN 1TETH 2Q7YB 1TQBB 4X5LA 1ZK9A 4HIXL 4JRXD 2HVKB 2VDQH 3U9PL 3EO9H 1HXYA 2EC9T 1DLHA 3WNNA 4P3CH 3VDAA 4HUWA 4Z77A 3EYQD 4WUUA 1JPTH 5IBLC 3ZDXE 1JGEA 1DR9A 4NUJA 4XMPH 1AE6H 1YMMA 3JWNC 3DXAB 3S9DB 1XCTB 4I0PA 1S5IL 3BSZH 4L3EE 4XVTL 3QG6B 4KUCD 1VERA 1FRGH 3GSUB 4NQXB 4JHAL 2G2RB 3SGJA 2DWEB 3DMMB 3RZCD 4F7MB 4KDTC 4QT5A 3G5ZB 1I7ZB 3LS5H 5B39G 4PP1D 5CJXC 5IJKA 2LVCA 3DO3A 3WE6A 4EVNA 1FGVH 4YDKH 3JUYA 5DHXB 2CLVA 1XCQB 2DQGH 4HUUA 4Z7QF 2R0LH 5ALCL 3OSKA 4ODXA 1OAXL 4M7LT 3BPNB 1ZKAA 5B8CB 2PO6B 3TC9A 4K9EL 1FO0L 3ULVC 3OKKA 5D2LF 1MCKA 4BFEA 1MAMH 1E0OB 4XP6L 5CIPA 1G7LB 5KOMC 3TBTB 4W70A 5ANMA 2DLFH 1U8PB 2ICWJ 3W9EB 4U33A 4KZEL 3TYFA 2EECA 4CDGC 1NSNL 3MLZH 1MH5A 3UPCA 2X41A 1JZ8A 4NUGH 1MCIA 5DHVA 5KSBA 4PRID 1M05A 2I24N 1BWMA 2I26N 3F7VA 5KJRL 1KYOK 4X5WB 2WQ8A 3WN5B 2AEPH 3OKDA 3HC4H 4PJBA 3C5JA 4U1MB 4V1DB 4GKZA 4PJ7F 2W1NA 2F8VA 1AO7D 3RI5F 4P48A 4CW1A 1MRCL 1RIUL 5DGQA 5MP6L 5C0CA 4NO2B 5LKNA 4X7TB 2X44D 3RNKA 4MB5A 2NW3A 2D2OA 4LQ1A 4HWEL 3QIWD 1ZE3C 3IRPX 4KK6C 2G60H 2DTML 5KTEL 2XTJE 1J18A 4GRWH 1R5VA 3DUSA 1MLBA 4KMTL 4DN4H 1T7YA 3PL6A 4LCWA 3IKKA 1MCSA 2BRRL 5HHPB 1NBQA 2P47B 5FV1L 1IC5H 3QAZC 1OPGL 2AJ3B 4FMFA 2AAVA 3ZTJG 5B3JF 1FYTD 2BY3A 3HUJE 3VJ6A 4D0DB 1X3DA 1U8IB 2W38A 4DAGL 1QEWB 4F33B 1EAPA 1ZT1B 3AU1A 2B4CC 4YHOL 3SBWC 5ICZA 1NAML 2NY3C 4R90H 3TLRA 3UTQA 3CXHK 5TE7H 4GW4B 1XF1A 1KPRB 3QUYB 4YBQC 4YO0B 1DTUA 5FCSH 5DEGB 1FL3B 4R0LB 5I1AB 4PRPD 1CS6A 1VFBB 4LMQI 3RWHB 2BNQA 3SGDI 1FN4A 5C70A 4P0DA 2EDHA 4OTXH 2JK5B 4H20H 3LKQB 4NKOB 4PGBA 2DQIH 5EZOH 3TT3H 1MCHA 1L4IA 3MLYL 2GY5A 4U1NA 2IPKA 2XZAH 5CUSL 3LKSA 4KQ4H 4WFHD 1X6NA 3K0WA 1QA9A 1BQHB 4XZUA 3P9WB 5DFWH 3RIAF 3K4ZA 4JFOB 4E42B 2O5ZH 2I5YL 5ICXA 1EFXB 5A16B 4U6VL 3PWPE 1YEDB 4K71B 1TFHA 2P8PA 4K3DH 3GDBA 1JIBA 1CXFA 2GI7A 1CE6A 4C83A 3OKMB 3MUGB 1P84J 4RX4D 1FZMA 1A7NH 2XKUA 3U9UA 2DQUH 3KXFB 5BV7B 3CDFA 1B90A 3BP6B 5HGBA 1QPXA 4NHCL 4RFEA 1JF1A 2CLZB 4L3EA 4M7JH 4MCZB 1RULH 5KVDL 3W0WA 3GHBL 4M8QB 1OCWH 2VDRH 2YPVH 5EZLB 3S37H 4DQOL 4X8JA 3RVTC 4S11A 1HIMH 3CXDH 3N1PC 1JWSA 4YHMH 1FO0B 1NCWH 3ZYJA 2GTWB 3UJJL 4R4BB 4U0RC 5C0JB 5ID1B 5DI8B 5GS0H 4NPYB 5GGRY 5D2LE 4NM8H 5TE4L 3I50L 4PJ5D 5E8PB 1U8JB 2HTLC 1H0DA 3CVHH 4LLUA 2E7MA 4GRWF 3E2HB 4LCCA 3QFJB 2AQ1A 5B4MC 5DJ6A 1DVFB 4OF0A 3B83A 3X3FL 4ZO8A 1B0GB 1E6JH 1WCBB 2GCYB 1WWWX 2ZOLB 1U58B 4WI2A 3KNBB 4FQIH 1J05A 3K81A 2R23B 3VRIB 2YZ1A 4Y5XA 1AD0A 3MMEB 4MVBD 4LPWA 2GT9A 2CDEB 4IDJL 3D85A 4L4VD 3MUZ1 5DJ0B 3WJJC 5CEZH 5BRZA 3QT2A 3T1FB 4DGVL 1RAMA 3QXAB 1NCTA 5JIHA 5FA4A 5DVOA 2E27L 1T0MB 3RVXD 4EBQH 1Y18A 3GMLA 4AEHH 4NKDA 3BN9D 4J7RA 5IR1A 1YQVH 4UOW1 3H0TA 4JFFE 3T1WA 4KROD 5B3JE 4QRQA 4FZ8H 1EFQA 4UB0L 4CVXA 1IKFH 2NY1C 4FQ1H 5IB5B 1S7VB 1ZMYA 4YHYB 4NZTH 1I1RA 3G04A 3LQMA 4P2QD 1AGFB 1EMTH 4PJFF 4TULL 4K8RL 3HUJA 1OGAB 3D2UB 4KTYA 1SMOA 4YGAB 4Q9RL 1KB5A 2BNRB 3DVGB 3GHEL 4OLUH 1IM9A 3AS1A 4YUEH 4LAQH 1J8HD 3I6KA 4OAWA 4OZGF 1T7VA 3TZVB 4JANB 3GMPA 3D0LA 2ZUWA 3O3AA 1RZGB 3DO7B 1YC7A 2OLDA 4WV1A 2Z31A 1HEZA 2VISA 3SKNA 3LIZL 3MRIB 5IMOA 5EN2A 2NY6C 4OB5L 4PJ8C 1DEDA 1QRNB 1FH5H 5D1QA 5GGUB 4U1GB 3O3EB 1BJ1H 3KJ6L 5FKPA 1H15A 4OD3H 3GJFH 5HHNB 3U7YL 3OMZA 5D7SH 5DS8B 1KYOJ 3LEYL 1EUUA 1A3LH 2QR0A 3L3JA 4JFXB 3HNSH 2FB4H 3N0PB 3I3DA 3PWPA 3DGGA 2MHAB 1LHZA 2JELH 3JWDL 1QKZL 2HLFD 2WZPD 8FABA 1HHKA 3QWRD 5F9DC 3ZYZA 4UQ3B 2GK2A 4Y1AB 2R8SH 5CSZB 5TDNB 1JWMA 3GSVB 2V5TA 3NFPA 2CPCA 5D71L 5GRVL 3V4VH 2NYYC 3NN8A 3OR6B 5CZVH 3MXWH 4I3SH 1IC7L 4PJGF 1AHWA 5FAAA 4Y2OA 4KJWC 3CLFL 4WEBL 4JDTH 3BI9X 4HEPG 3U2SB 3TNNA 2AK4B 1KIQA 3V6OE 4BYHA 5D70H 5IUSA 2DWDB 2R0KL 3RWGA 4MMZC 3NMEA 4BQBA 4BZ1H 1DBAH 4D3CH 2JB6A 3BH9A 2Q20A 3IXTB 3NGBB 1VCAA 3CXHJ 1OM3L 4AG4H 2I60H 2AEQH 4K7PH 3DXAD 2WW8A 4LSUL 2EDFA 4GRLA 4MAYB 4Z7WF 2X70A 2VLKD 4GRWE 3SDAC 4G6KH 3SE8H 4DGYL 5D2LA 4BJLA 4HT1L 1G7IB 4S2SA 2NTFA 4K94C 5HDLA 3VWKC 5I1LA 2DBLL 3BD3A 1OP3K 3QUZB 2GAZA 4PRBA 4O51A 4EQ2A 5CCKL 1AI1H 3JV5A 3CMOL 1IARB 3QEHA 1ZHBB 3THML 3SE4A 5C9JA 3VFGH 4K07A 3T77A 4IOIA 4XAKD 3QPXL 3L9RA 5H2BA 1BEYL 3RL1B 4OLXH 3T0ED 4JFPA 4EN3A 1R3LB 1JF5A 5A2FA 1A6ZA 2VR4A 5I6XB 3HI5L 4KAQL 2IAMC 4OGAD 3WFBH 1LK3H 3QIBC 1T1YB 4PJ7A 4RA0C 3ZLQC 3HNTL 3O0RH 1J0IA 4K3GA 4YR6A 3F6LA 3UTPD 1JZ7A 2F9BT 1ACZA 3B9VA 3O8XA 4ESKA 1I1FA 4Y89A 2JLLA 1OP5H 4GW1A 1IGJB 3MRBB 1EH9A 3BKYL 1UJTA 1CGYA 2VOTA 5F6HJ 2NCMA 5DZLA 4O00A 2ZSVA 4JG0L 1QQDA 4PTTB 4BSVA 3BMWA 4FNLL 4WO4A 1QLRA 3KLAB 5FCUH 5FOJA 1EO8H 5ETUA 4F3FA 3QIUD 5I1KH 1ES0B 1GAFL 2JCCB 3I2CH 3K2MC 2VXVH 1EEYA 5I1EL 4PJFE 1CQYA 5F97E 4JFFA 4Z78A 4HKBB 5C0EB 2CXKA 3E8UH 5HHOE 1QR4A 2C3VB 4GMTH 5E6IC 1BECA 3NPZB 2EH7L 3LD8B 1JNJA 1S8DA 3N06B 1FVCB 4U6HB 5FO7A 3VXMA 5J13B 5FHBH 4NBZB 5B39B 1T89A 5KN5A 4OZGE 1GHFL 2DRUA 1MCFA 1OW0A 1E4JA 5J12B 1EDQA 4N0FA 5CHNB 5HTSA 4MX7A 1FNEA 3RRQA 2XY1A 4U1SA 2V7NB 5HGDB 1X5FA 1LK2A 2P5WD 3DIFA 4F7CA 5IHBA 4ETQB 1H3XA 2BOBB 1Q9LA 5GGTL 4JFZH 2VE6A 4LNRA 4OFKA 1E6OL 2HT2D 3MRJA 2QHRL 3OJDB 1NH6A 2V2WB 1N3NB 1S9WB 1LD9A 1EHLL 1WBZA 5H94B 1UH2A 3KYKH 3KLHD 1MVUB 3A67L 5IMKB 3I6GA 2HKFL 1DLFL 4R3SA 5EA0H 5IQ9B 1AR1D 2Z35B 3ECBB 1Z5LA 2A9ML 4JQIL 3KYMA 1JPFB 1T2QL 1U8LB 1F6AB 4QYOB 4N8PA 3N50A 5IBTL 2VLRE 3IT8D 4DUVA 1UB5A 4PJGE 4JO2L 2DLTA 1M71A 4WFFE 1WLHA 2NXYB 4GS7C 3U30B 3EYVB 2ICWI 3BKCL 1I9JH 1XF3A 5D4QA 2F53E 5KZCB 1MJ7H 4HC1H 4X98A 2XWTA 5EOCL 2X9XA 2JB5H 3U7WL 4B5EA 1KJ2L 1JGUH 3KDMB 4FP8H 4JPKH 5FK9A 1KN4H 5CEZE 1D5XB 1TLKA 2R0ZH 3OKEA 4UDTB 1BD2B 3GI8H 1BJMA 3FN9A 3M07A 32C2A 5IW1B 3MLUL 4Z7WE 2VXSL 3EJYD 5AUMB 3D18A 2R2BA 3C8HA 3V6OA 2YMXH 1K6QL 4JRYB 2XPGB 4PRHB 3KXFD 3SKOA 3TEUA 1FJ1B 1SJEB 5GRUH 4BK4A 2QSCL 2X4UA 4OF7A 2P4AB 3NBNA 3CFCH 5JO5A 4B53A 1RZ8B 3S88H 4LCYA 4LDEB 5GQBA 5AYUL 5JQ6H 2D03L 3AXLB 4XB7A 1HXYB 1DLHB 4HUWB 4Z77B 4WUUB 5FHAL 1OWRM 3HC3H 4N9OB 1JGEB 1FIEA 3TV3L 1X5YA 3QHFL 2ZUSA 4R7DA 1NLBL 5JXEC 2I07B 3GBMH 1YMMB 2IG2H 3GBLA 4I0PB 5C9KA 4D0BA 2PTTA 1K9TA 4G7VL 3GSNH 1B2WL 1WZKA 3JVGC 4L4TA 5GZND 5IHUH 2FX9H 2VDLL 4F9LC 1AFVH 5E56A 3NTCH 4FA8A 4QT5B 3QFJD 3REVA 1IQWL 4N90E 35C8L 5KSUA 1GGIH 5DMGD 1A0QL 2KKQA 2J3SA 2NY4B 1VADA 4PV8A 4OZIF 3HMWL 1R6VA 3WE6B 1OAZL 4NRZA 3BIBX 4ZFOL 2CLVB 4LRNL 3P77A 3Q5YA 2R69H 4HUUB 5IK3A 2P5EE 3MRKA 5INCA 3ZKND 3K1KC 1KXVC 1BZ7A 1W8NA 2BFVH 3P11L 4OCNC 4AEIL 5C0BA 5FDWA 2UYLA 3LDBC 2X1QA 3ULUH 1YNTA 1U6AH 3OKKB 4UT7L 5I1GL 2LU7A 4PJFA 5CIPB 5F6IB 4YX2L 4JREB 4PTUA 3ARUA 3LSOA 5TF0A 4IBLT 3ARTA 3UJIH 4UTBL 1NFDF 1MH5B 3CGTA 1BHGA 3TO4C 3N85H 2K1MA 1GC1C 4R26L 2RIKA 4OZGA 5KSBB 3VFOA 1M05B 4FQQA 1IMHC 3F7VB 2E9BA 1KJ3H 4I77L 4PJBB 3C5JB 3A6CH 1KTLA 2MPAL 5IHZA 4FQPA 4GKZB 4TRPH 3J7HA 4CADA 3QI9D 4CW1B 3DX9A 1MLCA 2HMID 3QUMH 5C0CB 1IGIH 3BGAA 3CK0H 3RNKB 3ALPA 4LPUA 5E2VH 3RVWC 3RY6C 4MJIB 2NW3B 4M03A 5DQ9A 1MRDL 1CFNA 3D2UD 4PR5A 1FG2A 4YIQA 4UT6H 1BQUA 2DLHA 3CSGA 2YWZA 2OP4L 5BZDA 5E8OA 5JHLL 5DXWA 1OTSD 2VN7A 1R5VB 1ZHNA 1MLBB 3DUSB 3WKNA 3PL6B 5L2JA 1NANH 2CK0L 2V9QA 4LCWB 1CE1H 2A2QT 3CVHA 4RDQF 5LGHH 3B9DA 3VJ6B 1QOKA 1HI6A 1QRND 3E0GA 4RISH 4WW1A 1EAPB 2CRIA 3AU1B 3T2OA 5ICZB 4M61B 4PJGA 3S6CA 1JV5A 3QG7H 2WLYA 5KVFL 2QL1A 5JMRA 1BVKA 3PGCA 5T1MA 4YGVA 1T03H 3L3GA 3Q3GB 4ONHB 5MEQA 2F53A 5JZ7C 4D2NA 3BPLB 3EOAA 1U93B 4NQDD 4XP4H 2BNQB 4N0YL 1CD1A 3FB6A 1FN4B 2NMSA 5DMJB 2FO1A 4PGBB 2JTDA 2XTLA 1CDIA 3OKLA 4WTZA 43CAA 1CLCA 2UZIL 2Y07H 3ARBC 4ZUVA 2VXTL 5EU6E 1KB5L 1YPZB 2IPKB 1MFBL 2W91A 3LKSB 4Z7WA 1QA9B 4XZUB 4PJIF 1H5BA 4M6OH 3RPIB 1T80A 5ICXB 3QXTA 5HVWA 5ISZE 4OLVL 5B38A 1HN1A 1CFVL 2AJXL 1T21A 3TH4T 3VI4F 3MCKA 1NJ9A 5DRZA 4IOFD 4OKVA 5E2UH 3ULUF 2HLAB 1U3HB 1CE6B 3V4UL 1MCDA 3FN0H 3ZSSA 5IWLC 1G6RH 1FZMB 3E3QE 4F58H 2YD3A 4Q0XL 4O5LH 4UI2A 2F5AH 3IDIA 2FIKA 4KK9C 1D6EA 3DARA 1FZKA 2JJTA 5FF6A 5HGBB 3QDGE 2H2PD 5JW3H 4KI5D 1JF1B 2ARWA 3G6DL 4HK3J 4L3EB 2AABL 3W0WB 2ADFL 1OTTC 3WDHA 1RUAL 1SM3H 4PJ9D 1ZVSB 1JWSB 5HYEA 3P9LA 5D8JH 4JLRA 1P4IL 3HI6H 4PJXE 2YKLL 4LCIH 4N0RA 1ZANH 5B8CC 2PO6C 4P3DA 3BQUD 4NDMA 1P5VA 2FX7H 2R29L 3QQ4A 2GTZA 4YZFF 5J3HC 2P5EA 3BGFC 1GYAA 1IAIH 4GT7A 1CDUA 3KGRA 1MF2L 5TH2A 2Z4QA 1UM4L 3KPSA 1H0DB 3MX0A 2MKLC 1NFDE 4LLUB 1UQSA 1AQDB 4UAOB 1HXMA 4LCCB 1A47A 1Q0XL 1KT2A 5C1MB 3KPMA 4W6WB 1TJIL 4GG8A 3QEGL 1J05B 4K8RD 1K4DA 5C0RH 4Y5VA 3RUGF 1YEHH 4I5BA 4OUOA 4Y5XB 1IJ9A 1WICA 2GT9B 2I9LB 1X4YA 1MFEL 4NYLA 4QCIA 3MLXL 4YNYA 3PGDA 5BRZB 3T08A 5FM5O 2VDKL 1F3DJ 4MB4A 3UJTL 1RIVL 4HMDA 5FA4B 3X14B 4WWKD 5I1JH 5GRJH 4JHWL 1Y18B 4LSSL 3GMLB 3NPSC 1A7PL 1Q1JH 3C6LC 4NKDB 5HYIA 3QNYA 3H0TB 2O26U 2JF1A 5DSCA 3DTXA 3O81A 4QRQB 4KDVA 3DVIA 3UTOA 2VQTA 2QSVA 5C0AD 4CVXB 1GOGA 2XTJB 4WTZG 2VZ3A 1X7QA 3SJVE 1KEGH 5HI4C 3G04B 2KZWA 4AEFA 5A3IC 5SX4H 1N26A 3QXWA 1S3KL 2OMNA 4AJ0A 3HUJB 4ZODA 4LP5A 1KELH 4XWGL 3NACL 2HFTA 4WU7B 3QUYC 4X5XA 1KB5B 1FFOA 2LVEA 1IM9B 4R0LC 3V0VA 4HUNB 5DEZA 3I6KB 4OAWB 3GMPB 5KS9F 2VDQL 1N2RA 3D0LB 1MUJA 5JUEH 4XPAL 3O3AB 4WJ5A 5DUML 3GJFK 4JJHA 1XT5A 4JR9H 2Z31B 4WRLA 1HEZB 2EYTA 2FEDD 2VISB 2UVEA 5EBLA 3SKNB 4L4JA 1T3FB 5IMOB 2VUYA 4AH2A 5EN2B 2HP4A 2QHLA 2ZPKL 5AAWA 3VD7A 4OCYH 4CU7A 4OGXH 5D1QB 3IDYC 1EHNA 4ZXBA 5FKPB 1XGQA 2LU3A 3U0WL 3R0MA 1H15B 2LFGA 3VI4E 2O5XL 3LEXB 5F71A 1U91A 2DJSA 5KZCD 4QHNA 2QR0B 3B9AA 3ULUE 2M8XA 4F8TA 3L3JB 3WNMA 4JHBA 3LS5L 3PWPB 3DGGB 4XHQA 1HQRA 3QDHA 2DIBA 2FX8L 1BD2D 1FGVL 4HFUL 8FABB 3VE0A 4KRMB 4U7SA 4YPGA 3SGKA 4OQTH 2JJVA 1JWUA 3RGVA 3ZO0A 3WEXA 1X9QA 4C57C 1JWMB 1RUMH 3NFPB 4PREA 5BV7C 4OFYD 3NN8B 4PRHD 5DMYA 3MYJB 4L1HA 4PJEF 3T04D 1AHWB 2FD6L 3ZE1F 3BVNA 2C3WA 4XGZA 4HIEA 3PHQA 5GGVY 3QDGA 2DLFL 5DTFA 1G7JA 4HS6A 4PG2C 4OZIA 3DECA 5D7JC 4M5ZH 2EDJA 3TNNB 3LCYA 3CFKA 1KIQB 4WUUD 2V17L 3UXFA 4NOBA 4NJ9L 3A6BL 4FTVE 2JB6B 3BH9B 5L9DH 1YMMD 2OR9H 1DUZA 1GPOH 4GRLB 4H25A 2X70B 2E7LC 3T0VA 4ZUTA 3OPZH 4XCFH 5D2LB 4YXHL 5JW4M 4S2SB 2NTFB 2FEEL 3DUUA 1C5CH 5I1LB 1XF2A 3BUYA 2GEEA 1DVFC 2NY6D 4NO5A 2OSLA 2GAZB 1BM3H 3GBNL 4LEXH 3MLSL 1NFDA 3T77B 4EXPX 4KHXH 1PSKL 4KTEH 2WINA 4IOIB 5HVGB 5MHSE 4NZRH 2B1AH 3IU4H 3RUGE 3L9RB 5H2BB 2G60L 2H32H 2WUCL 4JFPB 4L3CA 4EN3B 3RJDA 2WIIA 1SBSH 2MMXA 4HC1A 5DJDA 3GZKA 2V6HA 2EZ0C 4PJ7B 1IC5L 1WZ1H 3O9WC 4YR6B 3SDCC 1WWAX 1X5IA 2XICA 3MZTA 4HPYL 3EO1B 4MHHG 4PY7A 1T5XA 3O8XB 1I1FB 5E9DD 1RJCA 1FSKB 4GW1B 4R90L 1G9NL 2ZSVB 5TE7L 3VMNA 1QQDB 4BSVB 1KG0A 1QLRB 4HWBL 5T5NG 4M1CD 5ETUB 4F3FB 4XC3H 1FNAA 1GGUA 3L3OA 1ITCA 3WV0A 3MRQA 4PGDA 3NH7L 4HDIA 4OTXL 4H20L 1NCNA 1EEYB 2DQIL 2PTUA 3PWNA 5EORL 4P9MH 2AJSL 5EZOL 4JFFB 4JFEE 2FHBA 4OF6A 5CLWA 1CDYA 4OI8A 1FVDA 4HGKC 1S8DB 3NFSL 5FO7B 4Y8DC 3FKUS 5C0CD 2ED8A 3QDJA 2OL3H 1A5FL 3RWDA 3ES6A 4KKLC 3S8WA 3QFDA 1C5BL 5IVZA 5KN5B 4GXVH 5KS9E 4WEMB 1D5IH 4HJJL 4JN1H 4K3DL 4N0FB 1SHMA 2ZG1A 5D93B 1FNEB 3FHQA 4KVNH 1QBMH 4GAJL 3VWKD 2QQKH 3UTTA 3GSNA 1LK2B 4Y8AA 3EYSH 3DIFB 4F7CB 1QFWH 2K9UA 1RU9L 2GUOA 2NW2B 1Q9LB 4GJTB 3WXWL 4LLAA 2VE6B 4LNRB 4M7ZB 3MRJB 2G5BA 3FQTB 4GBXA 5T3ZL 3GK8H 1G6VK 4BFGA 3S96A 3GNMH 4Q9QH 2DQUL 1WBZB 4RWHA 2AI0H 4PJIA 2IAMD 5LG1A 2M26A 1NBZA 4GAGH 4LVNB 1NGXB 5GHWH 4M7JL 3NCBB 4RGNC 4XNZC 3I6GB 1OCWL 3LMJH 3EOBA 2YPVL 4QRPE 3S37L 3GSQA 1NCBH 4R3SB 1INQA 1ZEAH 4E5XA 2C4FU 4YHML 3KYMB 1NCWL 4KPHH 1G7QA 4HEME 4IJ3B 4PJEE 5L8LB 1UB5B 2XKSA 4AK1A 3ZE1E 4HWUA 1ZA3A 1M71B 4QXGH 1IC4L 1PLGH 4M6MH 2OR7A 2DYPA 1CL7L 1RVFH 1XF3B 5FYKL 1R24B 3CVHL 2XWTB 4JO3L 4CNIA 3DV4B 2FECI 5HDBF 1N8ZA 2WBWB 5EWIH 1UADC 3AREC 5BS0A 5FK9B 4IRJA 1KENL 1R3KA 1HH6A 1WBXB 4I3RH 4XHJD 1Z6JT 2P1YA 4KHTL 1E6JL 2VLLA 32C2B 3NGBC 3QUMA 1W2KT 4MA8H 3D18B 5FM5M 4X80L 2JKXA 1E4XI 5ICYA 3B9KA 3SKOB 1VFUA 4FTVA 3CZFA 1ZHKA 4FQLL 1ZLUH 3HZYA 4ELMF 3QUZC 4U1IA 3W0WD 1BJ1J 2X4UB 4GRWB 2YRPA 5CEZL 5JO5B 2NPLX 4OT1H 3C8DA 4ONGL 4PJCF 4LCYB 1SJVA 4U2ZA 2CUHA 1S78C 3BP5A 3ET9F 1NDGA 3M1BA 5F88B 5HY9A 4AEHL 5DT1H 4F7PA 4JFQA 3BDYH 1RZJC 1YQVL 3SO5A 4R7DB 3UC0L 1V5JA 1X5ZA 3RUGA 4FZ8L 3LN4A 4XPFH 4D0BB 2PTTB 4FQ1L 2MCG1 2PW2B 4H5SA 4I1NB 5CBEA 5ECJE 1FDLH 1XGPA 3REVB 2CDGA 4XAWH 2COQA 4ZUSA 5KSUB 2J8UF 4QKXB 4PV8B 1VADB 2VZOA 5IFJA 1KACB 4ALAL 4YUEL 4Y19D 4LAQL 2XZQH 4LVHC 4NRZB 4OCXH 3P77B 1WFUA 3RTQA 4EXKA 5IK3B 5KSVA 2GYSA 3MRKB 5INCB 2P7TA 4M6NH 1Q72L 3GO1H 1BZ7B 4M1DL 5DC0A 4WGVB 2UYLB 3PV7A 5ID0A 5EUOF 1M6OA 2VLME 4KKCD 1YNTB 4PS4H 4P46A 3MA7B 1A2YA 1GGBH 5HD8C 1V3MA 3O6KL 4PJFB 3D85D 4NC0B 5HHOB 4JFEA 1FHGA 5BRZD 1NUNB 4PTUB 3LSOB 1E28A 2YC1A 3IKCA 1K2DA 3PJSB 1F45A 3G5XA 4J4PD 2NY7H 5J12C 5C7XL 1MJUH 5EU7C 1FAIL 3HNSL 2FB4L 5K9OB 4OZGB 4FFZH 3JV4A 3TN0C 3VFOB 4GMSH 5KS9A 3EDEA 2JELL 4X9GA 1CDCA 1C7TA 4PB9L 1KTLB 4JVPA 4RA3A 2R8SL 4X9BA 4KKAC 3WUWG 1QBLL 1UG9A 1NCDH 4CADB 4ERSL 1CD8A 5HHME 3DX9B 1MLCB 5F93C 3N1MC 5CZVL 2DM2A 4AQ1B 5TQ2H 2YUWA 3PUCA 5DJYB 4XX1G 3I75A 3AUVA 3L1OH 5DQ9B 4JHZA 4YIQB 1FG2B 2EE3A 4R97B 2YZ8A 3KS0J 2OTWB 2BZDA 1D5BA 1IM9D 4JDTL 5JW4Q 1BJ8A 3GSRA 5JHDE 3F7RA 2PN5A 5BZDB 5E8OB 4Y5YC 2JIXA 3BHBA 5D2NC 1HILA 3G08A 4HUKB 4QRPA 4YDVA 2QBWA 4ODSH 3L95A 4LFHG 5L2JB 2O5YL 2WWKO 2Z31D 2CH8A 3CVHB 3OZ9H 5HYJE 4OFIA 5L8KB 5ERWA 4B0MM 1IGFL 2AEQL 2NXYC 2Y7QA 3RZWA 1NEUA 4K7PL 1HI6B 4WW1B 5GGSY 3U30C 2VLRB 5D1QD 4PJEA 4HIJA 2Z8VC 4G6KL 4PJGB 1W8OA 5E5RB 4QRUA 1JV5B 1ZGLA 4HZAA 2H2SD 4NQEE 5CD3A 1PGRB 1BVKB 3PGCB 5T1MB 4YGVB 3L3GB 1F58H 5E8EA 2BVTA 1AI1L 1LO4L 2F53B 2J6EL 4MA3A 4AL8H 3EOAB 1CD1B 3FB6B 3IAGC 1RJZA 1BFSA 3HZKA 3UP1A 3HFMH 4LASL 3SKMA 4ZFGH 5DURD 43CAB 3OKLB 3VGAB 3TO4D 1UZ8A 2AJYH 4K23H 1WJ3A 3KR3H 3BIAX 4ZUVB 1RZKH 4NCDA 4F8QA 1H3PH 4R4FH 2EKSA 1K85A 4Z8FH 4ELME 4Z7WB 1TPXB 1BX2A 1LK3L 3HKFA 1YEGL 4L8SA 1H5BB 4PLKC 1UM5H 4HK0A 4OCWL 4QXUH 1T2JA 2ICEA 1JPSL 4PJCE 4U1HA 1GGYA 4MLSA 2LABA 5LBSH 1UGNA 5GIRA 3IFLH 3MCKB 5C07E 1CCZA 1NJ9B 1F6FB 5DRZB 2X4QA 3DX7A 4OKVB 4F37F 5AG9A 1A6VH 1RZFL 1V7MH 2X4RA 3FQUB 3VGBA 5I1DA 5L6YL 4MXVE 4PB0H 2C5DC 5I1KL 4KUCF 2G9HA 3LKRA 4TPRH 4I0PC 4L8CA 2FIKB 1D6EB 3I2CL 5EH1A 1S5HA 2XA8L 4IRSD 4FQXC 1FFPA 1FZKB 1UKQA 4Z95H 4IMLA 5FF6B 1YY8B 5IROA 3UTZA 1I9RH 2ADIA 3SGJC 4GMTL 3VW3H 2J8UE 1OD7A 4K2UH 4LDOB 1MFAH 4Y4HD 5FHBL 3WFEL 2FJFA 2NY4C 4FFVD 2Z8RA 4K3EH 5IGXH 3P9LB 4JLRB 1VGKB 1UFUA 4YHNA 4G9DA 1JL8A 1IFHH 2CMRH 2ESVE 1N4XH 4NFDA 2AV1A 5EUOE 4EN3D 5I8KH 2EC9U 3GJFB 4P3DB 4UU9A 4D9RE 1JNHA 1TTGA 3R8QA 3QQ4B 2GTZB 2P5EB 4XNMA 4GKOA 5TH2B 2Z4QB 3O8XD 1KTRL 2YOCA 3V9FA 1MCCA 1HXMB 3KYKL 1OGTA 1CK0H 4OQTA 1KT2B 3FB7A 3KPMB 3PGFH 3I84A 3DSFH 4Z0BH 3HE7A 1DSFL 4WO4D 1WWCA 4XI5C 3VD3A 4DJMA 2AJZA 1BF8A 2YUXA 3DI3B 4GG8B 1RHFA 2BHYA 4YHLL 4C55A 1FYHB 3DNKA 3SDYL 1K4DB 5DZNA 2APWA 4Y5VB 3U1SH 2WBJB 1ADQH 1FGNH 3HC0A 1XH3A 3K8KA 3VXMD 4NYLB 4QCIB 4YFDB 1PG7W 2CO6B 4HLJA 7FABL 4MD4A 1PKQE 1CICC 1MJ7L 4HC1L 1BF2A 1YNKH 2XXMB 1TJHH 3GMQA 3MBXL 4HJ0D 1PY4A 3OKYA 2BVOA 5EO9A 1JGUL 3VGEA 2YPLE 4JPKL 1KN4L 3V79C 3OB0K 5KVEH 2R0ZL 3QNYB 3PL6C 2EICA 4PLJD 3NZHL 2E6QA 3GI8L 5JHDA 4U0QB 3DTXB 4N5ED 2HA1A 4XNYH 3LV3B 4UQ2A 4H8WH 2A77H 3JTSA 3S35X 3CFBA 4JQVC 5HYJA 4LBEA 5ACLA 3QO0B 5IBUG 2XZCL 5EBGA 4N9GA 3V7AE 2FBOJ 2H32A 1Z9LA 2FIRT 4X5XB 1BREA 4X9HA 3F7PC 1FFOB 3V0VB 3HHRB 1I9IH 1VFMA 4KXZH 3OAUH 4LHQB 3S88L 2VKXA 1XZ0A 3BPLC 3LZFH 3EBAA 4NQEA 4QNPF 5JQ6L 4QRRD 1N2RB 4BUHA 1XGUA 2NY5H 4WJ5B 3HC3L 2PXYD 2EYTB 5EBLB 4R4ND 3RWCA 3GBML 5B3NA 4AH2B 2HRPL 2ZKHL 4JRXE 3AY4A 1RZIB 4ZXBB 4KV5F 3EFFA 5EU6B 1XGQB 4XNUH 5JTWA 3C2AH 4E41D 1N5AA 4ELMA 1AFVL 1U91B 3NTCL 4QHNB 3N1QC 4MZ2A 1JF6A 4OFVA 1JNLH 4PJCA 2V5RA 3NA4A 1GGIL 1GOHA 1I1AA 1U3HC 1HQRB 4P2CG 3NAAH 1TZHB 3VE0B 1IAIM 2YA0A 5C07A 4NZUH 2XACC 4YPGB 4X6CF 3QHZH 3EYFA 1JWUB 2R69L 3QQ3A 2OL3A 5F7DA 3RGVB 3WEXB 5KSAA 3O6FC 3C6LD 4PREB 2BFVL 5I1IL 5CEXA 2BVQB 1OAKH 3ULUL 4BSWA 5HHVL 2FSEA 5JDSA 1U6AL 1IGMH 3BVNB 4XGZB 4HIEB 3PHQB 3JXAA 1ZGLM 3TA3B 3QDGB 3TH3T 15C8H 2J8UA 3RL2A 5DTFB 3V52H 1G7JB 4HS6B 4P2OD 1Y0LA 3AAZB 3S36H 3X12A 3CFKB 3D6GA 4FXKA 3MJ7A 2XIDA 3ZE0F 1KJ3L 5HI3C 3VH8A 1DUZB 2ESVA 3CCHA 1YJDH 4H25B 5JR1H 5EUOA 4ZUTB 4L4TD 4MQ7A 1UYWH 4UAOC 4PRIE 4LCCC 3DUUB 3K8LA 5I74B 3QUML 1IGIL 4NO5B 2OSLB 3AS2A 1A6TA 5C3TA 2CR3A 4KUZH 1IBGH 3MV8A 1U8HA 5D1XA 4O2EA 1NFDB 3S3JA 1FFNA 2N1KA 2WINB 1AO7E 3SCMA 1NAKL 1HOCA 1RY7B 2BNUB 5CGYC 4L3CB 5IIEA 2WIIB 5FO8B 5LGHL 1CE1L 5DJDB 5C0BD 3D0VA 1T4KA 3PP3H 2AP2A 5D6DA 5LJYH 4NRXA 1KNOA 4PY7B 4V2BA 5F9OH 1CGVA 5C86A 4KY1L 1NMCB 4ZYKA 1KTDA 3L3KA 3QG7L 2AXFA 3Q6GL 4FQ2L 3P40A 4X7FC 4BFIA 1KG0B 4OF5A 5T3ZD 3GSXA 4X6DE 5I30L 1DQJA 2VXUL 1GZQA 1FCGA 4I2XA 4XP4L 3L3OB 1V3JA 3MRQB 4PGDB 1CIDA 4HUVA 2ZCLH 1UEYA 4HDIB 3ARZA 3V7MA 3PWNB 1I3GH 5L0QB 4XNXL 4UIKH 3UO1H 4PRPE 4QRTA 5TFSH 3AFLA 3SGEH 3RWDB 3SJVB 2MFNA 4FFYH 4WI7A 1UWEL 1FFQA 2AJUL 4WFHE 5H37H 2DLEA 2XQYK 4X6BA 3GSNB 2YK1L 4LP4A 1G0YR 4NGHH 5TPWH 3CJJA 2GUOB 5FYKD 2BSRA 2BY1A 4U4BA 2G5BB 4GBXB 2OZ4H 2F5AL 4HQQH 4MQXD 3S96B 5LQBH 1FFRA 1QPPA 3CZJA 4ENEC 3MBEA 4XCYA 3RA7L 3BYYA 4JM4L 1CFQA 1NBZB 4JY4A 2UVFA 3FQRA 4WFFD 4WI9A 4JRXA 3R0NA 1FL6A 4XT1C 3EOBB 5BO1H 3GSQB 2L0DA 5I1CH 4YJZL 1INQB 4X6CE 4E5XB 4I4WA 1G7QB 2FBJL 1WTGT 2HFGL 4YBLB 5CEZD 4BA8A 4JZJB 2XQYG 5I9QB 1T7WA 1ZA3B 4LOUC 4WUKH 4X83A 3RZCA 2EYRA 4JCMA 3T2PA 4G6FD 3V95A 1AHWC 5SWQA 2DYPB 5HVHC 5GISL 3WS3B 4QXWA 4HHAA 1RUKH 3AS3A 1NDMA 3WIHH 3V5DA 1UKSA 2PKDA 1SY6A 4CNIB 1HH9A 4P4RA 4XCCL 5F1IA 1N8ZB 1PEWA 2W9EH 3QPQD 3HB3D 5DJAA 5BS0B 1WCQA 4MJ4A 3MRDA 4IRJB 3T4YA 3ZE0E 2Q1EA 4PJ5E 1R3KB 2XG4A 1HH6B 3O45B 2XZZA 2VLLB 3BGMB 3QUMB 4NM4L 3P73B 5EIVA 4LCUA 1K5NA 5C0RL 3OAYK 4GRLC 5I75C 1I1YB 3P4LA 4MJ2A 5ICYB 3RY4A 2VITA 3B9KB 3WDIA 2VDPL 4KRNA 1F4XL 4FTVB 3CZFB 2CGRH 1ZHKB 3HZYB 4HIXH 1SEQH 3CDGB 1KCUL 1S9XA 4U1IB 2MTPA 4XH2A 1QLFA 3CVIH 3SE4C 4TVSa 5IW3A 5C6PB 3BP5B 1Q9WA 2D0GA 5I1JL 5GRJL 1NDGB 5HY9B 4KK5D 4BELD 1Q1JL 4JFQB 4F7PB 1S5IH 2QADD 1AO7A 4WHYG 2DJUA 3RUGB 3LN4B 5CZXD 1H3GA 2Y9RT 4MS8D 4QHUA 4H5SB 4CVZA 2I9TA 3ARFD 1FSKC 5CBEB 2QSQA 3KPSD 5A40E 3EOTL 4EI5D 5C71A 2UV3A 1XGPB 2B1HL 4LHUA 2CDGB 4ZUSB 4PBWD 1E4XL 4HXAL 1KELL 1QFWM 4HXBL 1N6QL 5IFJB 1MCBA 1ZSDA 1QBAA 1OAXH 2Q8AL 4P2QE 2AK1H 3RTQB 3SOBL 3O3DB 5KSVB 3V7AG 4K9EH 5AD0A 1ZS8A 2P7TB 3JBG7 4RAUA 3E6FB 5DJZA 3ZKMD 4XP6H 3LQZA 4DTGL 5ID0B 3IS0X 1M6OB 3GM8A 3T3ME 3MNVB 4NFCA 1WIUA 4X4ZA 1J8HE 3IJYB 4P46B 1A2YB 4XPTH 4KZEH 3JZ7A 1I8MA 1NSNH 2WWMC 5DRNA 1RUQL 4JFEB 1E28B 1OW0C 2HJFA 2YC1B 3IKCB 1K2DB 1FPTL 3G5XB 4PRPA 2KH2B 1G6RB 5KJRH 1HHJA 4ZS7L 1NGWA 4H0HB 1X5HA 5I71C 3JV4B 1ODAA 1DQML 5KS9B 4Q2ZA 5IM7B 1ZLSH 4BM7A 3UPRB 1HINL 2GQHA 1MRCH 3ZHKA 5F3HA 3EHBD 5MP6H 3BE1L 2VWEE 4R8WL 1VSCA 3KPLA 4HWEH 1QVOA 3QXUA 4GAFB 4LGPB 2CQVA 3RPKA 2YEZA 1WFTA 3H9HA 4G6AC 4OLWH 5CJQL 3MJ8A 4GUPB 3I75B 1K8IA 1UCBH 2L4OA 5KTEH 3VXQA 4H1LH 5E94A 1D5BB 2IMNA 4KMTH 3GSRB 1NUGA 4CL7A 4P2RA 2JIXB 3BHBB 3IDUA 4JDZA 4RX4A 3ZL4L 1HILB 3G08B 4QRPB 1OPGH 4YDVB 1OTUD 2XWJA 3L95B 4DAGH 3B2UD 4X6CA 2Y72A 3PF2A 1NAMH 3REWA 3QA3A 2Y7QB 5JORA 1LDSA 2YPKA 4PJEB 4WY7H 3WIIL 1I8IA 3B5GA 3MRLA 3QQ9C 2MQ3A 5F7NC 4MNQD 4QRUB 1ZGLB 1NEZA 3WJLC 3HNVL 3C2SA 1C5CL 5CD3B 3DOSA 5MI0C 5LGKA 1RD6A 4LEXL 3WNKA 2CR6A 1CD9B 2VLKE 3MLYH 1ADQA 4RMSA 1EJOH 1MCJA 1MQKL 4KHXL 4KTEL 5CUSH 1PG7L 1RJZB 1Z2KA 1R5WA 3HZKB 5D96B 1MPAL 5ESQA 2Y25A 1UZ8B 3V6OC 5DDHA 1N6UA 3U6RA 4BK5A 2I5YH 3C09C 3TN0D 4JQXA 5J7CC 2EKSB 1W0YT 4U6VH 1BX2B 2H9GB 4XP9L 4L8SB 1OSPL 4HK0B 4X6FA 1MCWW 4XAKE 4H26B 2PCPA 4TVPL 1OARL 3Q5OA 3QDGD 3T0EE 1X4XA 1XR9A 2NY2B 5GIRB 5J6GB 3ZTNH 3MREA 2WQRA 2X4QB 3C8KA 3DX7B 1EVTC 2X4RB 5I1DB 3UTPE 1CZ8H 4WTXA 4XC3L 1BVZA 5EIQA 5DVKA 3LKRB 4CVWA 5K9KA 4L8CB 1T7XA 4R2GD 1S5HB 2JJUA 3VCLA 1K8DA 1FFPB 3FZUD 5KVDH 3MUJA 4IMLB 3GHBH 3UTZB 5FEBA 2HT4C 3V5KA 4DQOH 4P23A 2ADIB 1H8SA 3EFDH 1A9EA 5GS1A 4G9FD 2IBZX 5C3LD 3KHOA 4LPCA 3TIEA 1KFAH 2FJFB 4Q7DA 4EOWL 4GXVL 3BZ4A 2VABA 1QTYT 3SY0A 5GJSH 5C0DA 4YHNB 4HJGA 4KVNL 4G9DB 2QQKL 5TE4H 3I50H 2AV1B 1VEPA 3FB5A 5K9QG 1ZWIA 4KC3B 4P2QA 4UU9B 2OMBA 5F3BA 1JNHB 3ALWA 4KH2A 1L0YA 5CKGA 1UACL 3STLA 2HTKD 4KRLB 4RCAA 1DZBA 4LIQH 4XNMB 3GNML 4Q9QL 1LEKA 4MXQC 1HHIA 3MGAA 4BSJA 3ULSA 1U41A 4FABL 2P5WE 2PTVA 4XVUD 1CIUA 2YR3A 3SEPA 1J8HA 1OGTB 3X3GL 4WDIA 2DL9A 1F4YL 3FB7B 2MQ0A 3HE7B 2AGJH 3LMJL 2AJZB 3GEWB 1URLA 2QKIA 1ZEAL 3PHOA 4KZDL 1U8NA 4UIMB 5HVFB 3D3VD 2BHZA 5EZJA 4DFIA 3VGFA 4RBPH 1FLRH 4IDJH 3TPKA 5HGAA 3H9SA 3NCYS 4DGVH 1WAAA 5CAYB 2EKJA 2Q87A 1IE5A 2VUOA 3HC0B 1XH3B 5FUOL 3QDJD 1E27B 2E27H 5AZ2H 4JO4L 2CKNA 5HHMB 4LLVA 1TZGL 1F8TH 5J4MA 4PBXA 1NGPL 5GS0C 4M6AA 3FRUA 4CVUA 3O11A 3VFWA 5EWIL 3GMQB 5EO9B 5FGBA 4P4KA 3U7AA 4CGTA 4W68A 3UTTD 2YD5A 4JDVA 1CI5A 1QSEE 5JHDB 4FZEH 4OIIL 4FHBD 3FQWA 3MYZA 4TULH 4MA8L 4UQ2B 4NP4L 1X5XA 3JTSB 1Z0MA 3CFBB 5HYJB 4LBEB 4LKXA 4ZPTA 3AROA 4FG6C 2R1XA 4Q9RH 3ULVF 3GHEH 4KRPB 4HKXB 1S7QA 2X09A 3FONA 4N9GB 4X8XA 5CBAA 3M17A 2H32B 2CKBH 4OT1L 3GIVA 3R8BB 1XZ0B 2FJHA 4QRSA 4NQEB 3SDDC 3LIZH 3VRJA 3ULUD 1XGUB 5J89A 3VGAC 5DD3L 5DT1L 1UCTA 2VLKA 3U79A 3QRGL 1H3WM 5BXFA 3RWCB 3KJ6H 2UY7A 4NSKA 2FHFA 2EXYD 1P1ZB 3U7YH 1ZLVH 4XPFL 3LEYH 2V7HA 1UXSA 1HE7A 5F21B 2GK0A 5F70A 1V8HA 5ITBL 4PV9A 1B4JL 1N5AB 4ELMB 1JZ6A 4GAYA 3JWDH 1QKZH 4HCRH 4K3JL 5EC1A 3NIFF 5AWNH 3B2VL 4PJCB 3RX8A 4KK8C 3MLWL 5D5MF 4X9IA 1CFTA 5BS0D 1VEMA 1I1AB 4NNYA 3O2WL 1EEQA 4XC1L 4RIRA 2IADA 1G9ML 3RX7A 5C07B 2XZQL 2F15A 1HHHA 4U2YA 3EYFB 3HE6C 3QQ3B 2OL3B 1LNUB 3QJFA 5F7DB 5KSAB 4Y16D 2HJKA 1IC7H 4S1QL 4KI5F 3J8F7 4JJ5A 3B9KD 3DI2B 5CEXB 4P2YA 4UNVA 1CGTA 4FTVD 4YEEA 4BSWB 2FSEB 4YE4L 3C9NA 1GGBL 5CP7A 1E4KA 2WWKT 1DEEA 3P9MA 1Y6MR 1BIHA 3P0VL 2J8UB 3RL2B 1DANT 1Y0LB 3QIUA 2OZ4A 1JCKA 1OM3H 3X12B 4FXKB 3ARYA 1PX4A 4FFZL 3MJ7B 3HCVA 3QWOA 1SY6L 1ZAGA 3VH8B 1A7QL 2ESVB 3CCHB 1J0JA 5EUOB 3SDXF 4MQ7B 5CCKH 5HXMA 2E9WA 5DQJA 4HBCL 3EZ8A 3S3PA 3VXRA 2YWYA 2DQJH 3DLQR 5TQ2L 3QPXH 1CGUA 5IB3A 3WDJA 4NN7B 1YN6A 4KJQC 5DJXA 5D1XB