3K1KC

Green fluorescent protein bound to enhancer nanobody
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
QVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein/immune system
molecule keywords Green Fluorescent Protein
publication title Modulation of protein properties in living cells using nanobodies
pubmed doi rcsb
source organism Aequorea victoria
total genus 26
structure length 114
sequence length 114
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k1kC00
5EU6D 2CLRB 1ZXQA 4S1SL 4WV1B 5IBUG 3F5WB 5FAAA 2Z92A 1I7TB 4MD5A 3H3KA 2GUOA 4OZFB 1NFDB 4Q6IA 5IEHA 3EO1A 1HXYA 4U31A 5DJ8B 4PJAE 2HRLA 2K7QA 3S37X 5E1AB 5GGUA 3CU1A 1WT5C 4OUUA 4Y4FA 5K59E 1B90A 5MERB 1AR2A 4LSVL 5FF6B 3ZHLA 1IKFL 4D94A 1ZTXH 1JZ3A 5EZLA 1CR9H 4AIOA 3JUZA 5DQDH 1N4XL 1PLGL 1I1AB 1PDKA 4JFXA 1MELA 3O8XC 3EYOA 1U3YA 1IC7H 3TLRA 5DHXB 1EO5A 5EORH 1A22B 1QTYT 4BUGA 1MFEL 5IVXA 3QNZB 3NGBC 3PWJB 1H3VA 1VEMA 3GSRB 2F53A 3S97C 4Z7WE 3AMKA 2YZ8A 3TFKD 2A6KB 2BNQA 1A9EB 2OP4H 4Y1AB 1F3DJ 4P2RA 1FN4A 4OM1L 1Z9OA 4QRUB 3NPSC 3ULVD 5T1LB 3RA7L 3FQWB 4S1DD 1CS6A 4K55A 3E2HC 4I3RH 2DL2A 2WBKA 4I18B 3L7EB 4D0BA 4RRPA 4UOW1 1ZS8A 4KKNA 5KSBF 4HLZG 4NUJA 1RJLB 3RHWK 2E8ZA 4OD2A 4N90E 1K8IB 4L8CB 5ABDE 1KEML 1S9XA 2O5YL 4Y1AD 3KPQA 4Y4KB 1FZJB 5D1QB 4RQQB 5F7KC 4FXKB 1L9MA 5L7XL 4GW4B 1ZT4A 4LAJH 4FFZL 1A6UH 2GJ6A 3RI5K 3VI4E 4ZFGH 2VO5A 3BGMB 2D0GA 1O7SA 4LLQB 2VLME 4DZ8B 4EIZC 3W0WB 5D96C 3U0TA 5I1CH 4JZNB 1MEXL 3QG6B 3I9GH 3MBEC 1AQDB 4BUHA 1GGBL 1E27B 4C56E 4Y4KD 4HAFA 5D1QD 1T21B 4PJEA 1KGCD 1H5BC 5JNYB 1TDQA 2UVFA 4FA8A 2FATH 4XHQA 5CJXA 3FAWA 5GJSH 2ESVE 3ESVF 4C83A 3W0WD 3DX9B 4X98A 3DMMB 4E5XB 2QQKL 4KRPB 4YGVA 4R0LB 4N0UA 1BHGA 4NN7C 4IJ3B 4B7LA 1WZKA 1JE6A 2Y1VA 1CLYH 2W9LA 5ESQA 5JUEH 1CGVA 4EEEA 4ZS6C 4MNQE 3QWOA 5D7JC 4N0RA 3U7YH 5TDNA 3QO1A 2LVCA 4U1JA 3DMMD 5CWSA 2EH7L 4RFNC 1UA6L 4KV5F 1ZGLB 2PW1B 5DD0H 3UTPD 3V95A 3ARYA 2JIXB 5E8PA 4M6NH 1AXTL 2AV7A 3WD5L 5CCKH 3SDAC 5T33L 1BZQK 3O3UN 4WHTA 5KW9L 4NP4H 2O93L 3L5IA 3SO3B 4NRYB 2YC1B 2MCPL 5DURD 1K4DB 2E6JA 4F7TB 3FO2B 4JRXD 3KHOA 1QLRA 3P11H 1RZIA 4XPGL 5DRWA 4OGXL 1NGWA 2XFXB 2IFFL 4HJ0D 1KFAH 3GJEB 5E4EB 2ARJB 5CS7A 3D85A 2X4SB 3LCYA 3GSWA 3LN9A 3NABL 1Z9LA 3ZKQD 5B8CC 1HHJB 4CW1B 1CGYA 1AO7A 2Z31A 4MA7H 4MAUH 3DVGB 4HKJA 3WS3A 2HWZH 4KFZC 4BM7A 4N8CH 3V9FA 3LRGA 5F7WC 2A0LD 3VG9B 4L8BB 4DN4H 1FBIH 4M3KB 4TPRL 5EU6A 1CGXA 1G9NC 5IR1A 3LPWA 1A1MA 4DKEH 2SEBA 4KKLC 5DEGA 5C9JB 1S9KC 4NPYB 1ES0B 1EJ6A 4GXUN 4X7CC 5E2TL 2XY2A 1EVUA 5EU4A 2C9AA 5HY9A 1GC1C 5GS2D 2Y6SC 3T4YA 4ZOBA 2APXA 3QUYA 3MLRL 1P7QD 4Q6IC 5I8KH 4OZGA 1M7XA 2DLEA 4X6CE 3OJDA 1LE5A 4PJIE 2CLRA 5EA0H 2AP2A 3BPNC 1VESA 4PJ5B 4L4VB 1N0XL 1I9JH 5HI3C 5FM4A 3W11C 1SVCP 4WV1A 2J12B 4HUWB 4V1DE 3F5WA 4QTHB 4Y4FC 1I7TA 32C2A 4JO3H 3BUYA 4MYWB 2C1PB 2VDPH 3WBDA 4ZOCA 4X0KB 4OZFA 1NFDA 3NCYP 2LTQC 2ERJC 3ARGB 3G6DH 5DJ8A 3CFCL 2HFEB 2R9HC 5E1AA 1GGUA 2NTFB 1U3ZA 3HC3L 3QIUB 4Q9CA 3VGHA 3T8XB 2V2XB 4PJ5D 2NY0B 2GW5A 5MERA 5FF6A 4BYHA 3HZKA 4RGMB 1B4JH 3C6SB 2A9MH 4GAGL 1A3LH 1CVRA 4MDJB 4NJAH 3ARGD 1TQBC 3S4SG 1UXSB 4LVHB 1CWVA 1YJDL 2Y25A 5CUSH 3O11B 1TETL 4GG6E 4HFUL 4Q74A 8CGTA 3GBMH 3QIUD 3PWJA 3GSRA 1ZHNB 1FNFA 4QOKB 3DUUA 5E24E 3CC5B 2JF1A 3GO1H 2F8XC 2A6KA 2B1AL 1A9EA 4Y1AA 1NDMB 5E2WL 5T1LA 4F8QA 3FQWA 4AT6B 3RWFB 3PWUA 4I48B 4NC1E 3LRHA 4ZOEA 3L7EA 1KT2B 4YE4H 1A0QL 5IGXL 1T66C 1A3RL 1RJLA 4QOKD 4H0GA 2WWKT 3AS1A 5IG7A 4H88L 5HGDB 4NZUH 4Y4HB 3FQXB 4Y4KA 3WIHH 1VB9A 1D5BB 4G8GB 4NZRL 5C8JB 5GGRY 5D1QA 1MHEB 4PLNC 4RQQA 3KDMB 3VRIA 2YA2A 1R3JB 5KANG 5C2BL 3PP3K 4NM8L 5HHOE 4GW4A 2HJLB 3OQ3B 4ODVH 1VFMA 2VMFA 3JV4B 3BGMA 4X5LA 2AJXL 5DJYA 4M7LH 4DZ8A 1F4WL 5C07E 3W0WA 2AEWA 2NZIA 5CJXC 3QG6A 1AQDA 2B2XL 5IVZB 1JN6B 1E27A 1XGRB 3I50H 3VGDA 2OR8A 1RZJC 2E6PA 1T21A 5JNYA 1LWRA 2D7TL 1HCVA 4AEHH 4H20L 1Z3GH 3PL6D 3DX9A 4FP8L 3DMMA 2WP3O 4R0LA 5I8EB 1LNUB 4KHTL 3AU1B 2HT3C 4ELME 3H9SB 3UBXG 1OTTD 4XVUD 3WSQH 3ZT5A 1TZIB 2ICCA 4PYGA 5I8OH 3MRKB 4HGWB 4JRXA 1AI1L 4FZ8L 2B0SH 1WEJH 3UPAA 3NCFB 1HHGB 1ZGLA 2PW1A 5D72H 2ZWLT 2DMCA 1MFBL 2JIXA 1NGXB 2CH8A 3X3GL 1EO7A 4WW2B 2W60A 4XZUB 4NRYA 3G08B 5D6DA 2YC1A 3SDDD 3VXUE 1INDL 1K4DA 1QUNA 2DLFL 3ZKSD 4F7TA 3FO2A 2Z31C 2GTWA 1CQKA 4QHKJ 5KS9B 2IANB 4UBDC 1GSMA 5HHMD 5FGSA 5A3ID 2R1WB 1J8HE 2XFXA 3KYOA 1IL1A 3GJEA 3JVGA 3QDAA 2X4SA 1B2WH 3B2VL 1Q0YL 4UINL 3QHFL 4ODHL 4CW1A 2IBGA 1DBAH 3NZ8B 3ZKND 5KVDL 1U91B 3DVGA 4AM0B 5DRZB 4M93B 4U1HB 4PRHE 4J2XA 4L8BA 3HI6H 4LCIL 3QUYC 2FHFA 1SY6A 2BX5A 5CIPH 1JWMA 1JNNL 3CSYB 4EDWL 1AIFB 3BKJH 1ES0A 1KJ2H 4L4TB 4JM2D 4G9DB 3VFTB 3QCUH 2GEEA 4NHCH 4KMQA 4S1QL 4WV1C 5DFVC 1DEDA 3O4LE 2AGJH 2UUDK 2OK0L 1TVDA 1NBYB 5EU3B 3IFNH 1A2YB 4JQVA 4XT1C 4JFOB 3TBTB 43C9B 5GRJL 4YDIL 2DKUA 1RUMH 1P4BH 3D18B 4PJ5A 3ZE1F 4U05A 3ZKXB 1OP5H 3H6JA 4QTHA 4WU7A 3MV8D 4X0KA 4DK3A 1S9WB 1CG9A 1PSKL 2Q8AL 1P4LA 1Q1JL 5CIPB 5E2VH 3ARGA 3FQNB 5DJDB 1ZMYA 1KJ2B 1OAXL 4NRZB 4ZPVB 3TFKC 1NBZB 2NTFA 1HOCB 4NM4H 4LARH 4LLDB 5JQ6L 3JWOL 3ULVC 3QIUA 4G9FE 3T8XA 2V2XA 4S1DC 3LEVH 3PHQB 1NGZA 1JGUH 1HQRB 3C6SA 3UC0L 3UMTA 5C0BB 1A7NH 4MDJA 2APBA 3WHE1 5BV7C 1UXSA 4P4KD 4XC3H 4TRPH 4ZD3H 3L3HB 3O11A 2YA0A 1C5CL 3QUMH 1P6AB 1F6AB 3IDIB 3SDXE 4R90H 1NMAL 1QNZL 3DETC 3HS0A 1ZHNA 4QOKA 3K3QA 3SOBL 1QFWI 2VLKD 3CC5A 4KJPC 3RWDB 1UCBH 1SEQH 1IRAY 1FNSL 1ZHBB 1NDMA 4KZDH 5HYEA 3F12B 4AT6A 3RWFA 1WFTA 2VXUH 5F93C 3MXVL 4Y4KC 2CO6B 5KZCB 3H42H 3G6JB 1XR9A 5D1QC 4KJWD 4LPTA 4XP5H 3TNMB 3DWTA 3O3BB 1Q9OB 5GJTL 4ODTL 4E41E 5D70H 5HGDA 4CVUA 4Y4HA 2VXQH 1EEZB 3FQXA 4GRWH 5C8JA 1D5BA 4G8GA 3BPCB 4NT6B 1PYWB 1MHEA 3LKSB 1R3JA 1KJ3H 5KZCD 5INCB 4A2LA 3KR3L 4LL9A 1D5IH 3BGFB 4PRBB 3SGJA 2EDYA 1KB5H 3Q48A 2R4RL 5IVZA 1JN6A 2NY3B 3TN0D 1N5YH 3DSNA 3P73B 3X14B 1PEWA 3DMMC 4HMCA 1XF1A 4R0LC 1BF2A 3S3JA 1B3JA 4IJ3C 1IMHC 4WEMB 1FG2B 2NY1B 3WIHA 4GRWB 4X7SH 3MV7D 4EVNB 2LQRA 3M8OL 1UXWB 4Y5YB 5B39B 2NY3D 3RY6A 5I8EA 1CN4A 1Z0MA 2MKWA 3DI2B 5ALBL 4F37F 1LNUA 4NFCA 3B2UC 2W65A 3AU1A 2YMXH 2Z8RA 3D39D 4A2MA 4HJ0C 1MREL 3UP1A 5BOPA 3QIBD 2FJFB 2D2OA 4X4ME 5E8DH 4ALAL 4QHLB 5I1EH 3MRKA 3QBTB 3QRFM 4HGWA 3ROOB 3SO3C 3WYRA 5D6DC 3UDWA 4YWGH 2FX8L 1G7IB 2VJXA 4Q58C 1HHGA 4Z7NE 5I15L 2QR0B 1IT9H 2A0LC 1WBZB 5IBTL 3SQOH 1NGXA 5DK3A 4OBRA 4KPHL 5ADOL 1BIIB 3JVGC 2VLJB 4RMWA 1R3HB 2L7UA 4MA1B 4XCCH 4RMRA 4WW2A 3G08A 1IC4H 2LU3A 4GAJH 3IETB 3O6KH 4HD9A 1L6XA 2DM3A 5EN2B 5KS9A 1ZVHA 1EGJH 2R1WA 4LSUH 1OGTB 5LXGH 2XA8L 1DQLH 3S36L 1BQHG 4I0PB 3G5ZB 1N64L 3GI9L 1KEGH 4AM0A 1X5JA 5DRZA 5DZLA 3KGRA 1VGKB 5GZND 2B5IC 3TJHD 4U1HA 5EU7C 1PKQB 4LLUB 5DMIL 4LK4A 5DMGD 1CLOH 1ORSB 5GS0D 3F65A 2VZVA 3CSYA 2J8UB 2NR6C 1AIFA 5HGAB 3V4UH 3MRQB 2P45B 3TZVB 4LSSL 3MV8A 4G8FA 3NCMA 4G9DA 4O4YH 1RUKH 1RZFH 3VFTA 5I30H 3OX8A 4L8DB 2MFNA 1EUTA 4CGTA 1U92B 2X9WA 4NQDE 1NBYA 3ELAT 5EU5B 1A2YA 5BRZE 4RIRB 3WNLA 3ARGC 1WFNA 4QYOB 4JFOA 1E4JA 3P0YL 3SKJL 43C9A 3A6OA 1GZPB 5HI5D 3D18A 3LPFA 1ZEAH 4HKBA 4MQXC 4OZGF 2CR6A 4HWEH 2D4FA 3QIUC 4LLYB 1UGNA 2NY0C 2NNAB 4MXVF 1S9WA 3QO0B 4RGMC 5E00B 2P43B 4P4RB 3FQNA 5DJDA 4WENB 1KJ2A 2QJDA 4NRZA 4P4KA 3BMWA 4ZPVA 1NBZA 1IGTA 1HOCA 1NFDF 4M8VA 3IDGB 5F7LB 4LLDA 4F7MB 1Q9LA 3PHQA 1HQRA 3IRZA 3EW3B 3GMQB 3T0AA 5C0BA 2VQTA 5HSFA 4LSTH 5F1SA 1CGTA 1EDQA 5INDB 5AYQA 3ULUC 4XVJH 3T0WA 3V7MA 1NL0L 4P0DA 1OAUH 3L3HA 1X5HA 1U42A 2WK2A 5MHSD 1F6AA 3IDIA 1I7UA 1JVKA 3QHZH 2OJZL 1QLEL 3FO0L 3O41B 5EZIH 2P47B 4Y2DB 5JXAH 4GBXB 1UADC 5EOCL 4HQQL 2GQHA 1H3XA 1F4XL 5T1MB 3RWDA 2A1WH 1ZHBA 3D9AH 3D0VB 3F12A 5IK3B 4Y4HC 1FE8H 1L9NA 4UV7L 3G6JA 4DKFL 4A6YH 1NAKL 3O3BA 2AJUL 4JR9H 1Q9OA 3BIKB 3FN9A 5DT1H 1FIGH 3P0GB 1YQVL 3SGJC 1NLDL 2DICA 1EEZA 1E6OL 3LAFA 1HWGB 3BPCA 4NT6A 1F58H 1PYWA 3PHSA 1IGFL 3LKSA 2IPKB 5DWUH 4MA3A 2VDRL 1QFUL 4PJ8B 4ZTPL 4DOHB 1LK2B 1OTTC 2HT4D 4XVUC 3QFJB 4PB9H 3FRPG 4UILH 3WFBH 3BT2L 1I3GH 4WRLA 2NY5C 4A6YB 3P73A 1KB9K 3VMNA 3X14A 2VZTA 1UQSB 4DN3H 3SDYH 1OSZB 1WWCA 3OG6B 1UM5L 2AERT 4M6OL 3QIBA 1FG2A 4JJHA 1HQ4B 5LJYH 2LV4A 3MXWH 4JGMA 2BFVH 1X3DA 1YECL 4EVNA 5I1DB 1NBVH 3HZYB 4U7MA 3DVFA 1UXWA 4Y5YA 5KSAD 4TSAH 5IP4A 2Y36H 3RPIB 3UDWC 1IGJB 4MD0B 4K8RD 4YDVB 5IIEB 5EOTB 1GH7A 4GRLD 5L2KB 1QSZA 3SHSA 4FXGB 4B5EA 2FJFA 4N1EA 3BE1L 4QHLA 1I1FB 2O5ZL 2YN5A 4KXZI 3ZKNC 4WW2C 4YIQB 3ROOA 3ARXA 4P2OB 3S36X 2XTJD 2LU7A 1G7IA 4P57A 4L1DA 1L7TH 3D0LB 2QR0A 4I3GA 3RY4A 1WBZA 5J12C 1K5NA 3RGHA 3A6CH 4OGAC 5FYJE 5DLML 2VLJA 3U9PH 5L2KD 3CVHH 2VXTL 4JAMB 3IETA 1IM9D 2DQEL 4UT7L 4UZGA 3VXRB 2HVJB 4H8WH 4X99B 5EN2A 2I07B 4S2SA 5BVJB 4HXBL 4BQ8A 4M93C 4NKIH 5DR5H 2MCG1 4LRNH 5C2UB 3MLPA 1F4YL 1RU9L 1URLA 3G5ZA 3WMSA 4DW2L 5JA8B 3VXRD 4S1RH 1JRHI 1A3QA 1T7XA 1VGKA 4D8PB 1NCBL 1YA5A 4G6KH 4J7RA 4G8IB 3TYGH 2X9XA 2WNGA 3MA9L 1PKQA 4LLUA 4ZUSA 1S8DB 4BK5A 1ORSA 1IFHL 2X1WL 3WLBB 2UV3A 4XWGL 2J8UA 5HGAA 1KN2L 3MRQA 3I75B 3TZVA 4YXKH 3VI3E 1XR8B 2E27H 4WTZG 3KPOB 1CDBA 5SWQB 2VDOL 5I9QB 4AEIL 5E4IA 1AFVH 5TJWK 1U92A 5EU5A 2J4WH 4RIRA 5BQ7B 4QYOA 1IGIL 3KNBB 1VENA 3DTXB 4P4KC 1GZPA 4FMFA 1G7QB 3CSPA 5ITFA 3RZWA 3BSZH 2NNAA 3QO0A 2D0FA 5E00A 4P4RA 4JVUA 5FOBB 3IJHB 4I3SL 4KK9D 3HI1B 1YN7B 3IDGA 4QRRB 3RP1A 4F7MA 1I3RB 4EI6B 1NANH 3RVWD 2V2TB 3RUGA 4YO0A 3S5LB 3V52L 1G9NL 5TFSL 2CIIB 2ARWA 4HIEB 2IPUK 5AWNL 5INDA 5C9KA 1GC1L 3OTTA 3J8F7 1OHQA 4U6VL 2DBLL 1JNLL 3PV6B 4QRRD 2EDQA 5F6HI 1RURL 2PYEE 4WIQA 1U95B 3HG1E 5FYKH 1Y6MR 3O41A 4ZFFB 5KAQG 4Z7OE 1FO0H 3DJ9A 2X4RB 5CJOH 4YH6A 5GSRA 2OZ4H 5FV2A 3U48A 1SJVA 5T1MA 3WIIH 1JZ8A 3D0VA 4NZJA 1V7NH 5IK3A 2FEEI 3TN0C 3ULUF 2CLVB 3VFOB 3EO9L 5SX5K 1NCCH 2P7TB 4HUXA 1N8ZB 3BIKA 1UCTA 1S78D 3LN5B 3S35X 1LEIB 3LQAC 2O5XL 4NO3B 1X5IA 3BGFC 2BOBB 3F7QA 3EJYD 4KQ3L 3PP3H 2HKFL 1KXVC 1DSFL 5I73B 2NY3C 1FO0B 2W92A 1FCCA 1T0PB 2IPKA 4R7DB 3HR6A 1DQDL 4PJ8A 1EO8L 3SN6N 5I8CA 4ONHB 3L3DB 1HHIB 3QFJA 4P9ML 5I1KH 3QIBC 2NY1C 1CXHA 1VFBB 3BPLB 4K71C 4K9EH 1QFWL 2XKNB 2VDNH 1CDUA 1CDGA 1DQQB 4A6YA 1KCKA 1LK3L 1PX3A 4GMTL 4C57C 2R2BB 1LO5B 4Y5YC 1UQSA 5E9DB 2EYRB 4JG1H 2YD4A 2LVEA 4D0DB 4GXVH 1RVFL 1HQ4A 4NGHL 5HHXL 3MRMB 4OZHB 5IMKB 3HZYA 3V8CA 3W81A 2C5DC 5I66B 1EBAA 1FVDB 3AROA 3RPIA 1IGJA 4MD0A 4YDVA 3LS5L 4CDGC 1CK0L 5A1AA 5JHDD 5L2KA 4FXGA 5ICZA 4MX7B 2I5YH 3OPZH 4RDQG 3WKMH 3O2VH 3BP7B 5M94B 2CRMA 1I1FA 5SWSD 4G80A 2CKNA 1JGLL 2FNBA 4YIQA 5ELIA 3B9DA 4P2OA 5BJTB 4AMKH 1NC4D 2UYLB 4HIXL 2AABL 4XRCA 5DJXB 4NIKB 3D0LA 2F5BL 5GZNC 3TJHC 3WV0A 3A6BH 2R0LL 3SCMB 3C6LD 4BA8A 5ESAB 3LS4L 1RZJL 4N1HB 5DMGC 5GS0C 4Q9QL 3AVEA 1PKOA 4NZDA 4MXQC 4JAMA 1FC1A 5DUML 4G8EB 3VXRA 4NNYB 1CGUA 4Z0BH 4ODSL 2HVJA 3IAPA 4WW2F 5BVJA 5LQBL 1DFBH 2C3VB 4XC1H 5JOFA 1YY9D 5C0JB 5DZOA 4WO4B 1I3UA 3TYFB 5KS9F 5FA3B 4Y19D 3MO1B 1NGQH 5I18H 4YBLB 4EUPH 4YHZH 1P5UA 2VZOA 5ISZE 5ESVB 3QG7H 5HI5C 3V4PH 1OPGH 3TZVC 5HHME 4D8PA 1KTRL 2UWEE 4G8IA 5HYSB 1MLCB 1MAJA 5D2NB 3KYNB 2QLVB 3MLWL 4X7EC 3WLBA 4GKZB 4JFFB 1CI5A 3RKPA 4NQCD 3I75A 1DANT 4YHOH 2UUDH 1XR8A 4JVWA 3KPOA 5SWQA 4EUPB 3H3BC 1JBJA 4MAYD 4PJBF 5FIEA 2XG4A 3QAZB 2GY7B 2E7BA 5TE4H 4EI5B 1T1XA 3KNBA 3DTXA 4F58H 1I9IL 4DVRH 3MNWB 3VXPB 3VD7A 2FBJL 1G7QA 5AZEH 4LCYB 3UZQA 1X4YA 3VFPB 1A7RH 1CTOA 3IJHA 3T2QA 1HYSC 2EDBA 3FL7A 1CFVL 3HI1A 1YN7A 4QRRA 4KUZL 2EO9A 5BMFH 1I3RA 4EI6A 2V2TA 3O6MH 4JRYB 4UT6H 2NY6B 3S5LA 3Q1SH 1KLUB 5AAMA 3TWCH 3OZ9L 5C70A 1MF2H 2CIIA 4JN1L 4ZUWB 4HIEA 5DD1L 5MENE 4ERSH 5C08E 3PV6A 2CR3A 4OF7A 1C12B 1HIML 2VXVH 3IKKA 3IFLL 4OTXL 2WBJB 1U95A 4JRYD 2NY6D 5L8KB 1DQMH 2ZCLH 4OT1L 4ZFFA 4I4WA 1G6RB 4GQPH 3TPKA 3VH8G 4QRPD 3WFEH 2X4RA 1OTSD 2GSGA 2VH5L 5DHYA 1V5JA 2HT4C 4WEBH 1J1PH 2Y5TB 5K9KA 3RVXD 1WV7T 3FFCE 4XVSH 4W6YB 2CLVA 3VFOA 1XH3B 1A6VH 5D8JL 1EXUB 5DVMA 1U8QB 2P7TA 3ULVL 2I60H 3Q6FA 2VLKE 4PJ8C 1N8ZA 1LEIA 3LN5A 1YYML 4D9RD 4NO3A 3G6JF 5DEZA 1RAMA 3GUTA 1IGCL 1B0GB 5KSBE 3P2TA 1SJEB 3HNTH 5BV7L 4X9GA 4UNVA 4QXGH 4FQLL 5E6YA 1KELH 1CL7I 1J87A 4J3WA 4I1NB 3L3DA 1HHIA 4TVPH 5E5MB 2ZKHH 4OUOA 4X9HA 4XMLH 1U6AH 5D9SA 2XKNA 3RWGB 4CU7A 5L9DL 1FAKT 3SGEI 2XTJC 2R2BA 1LO5A 5E9DA 1BZ7B 1ACYL 2EYRA 1YNLL 4W68A 4ZOAA 3MACH 1C5BL 3REVB 5D7IB 3MRMA 4OZHA 5SWSA 4D3CL 5IMKA 2XTLA 1VPOH 4U7SA 4GRWF 4LU5L 4WFED 3OHXB 4G6ML 4OV5B 1FVDA 4ZUVB 3P3YA 3JTTB 3D69B 3SGKA 4TOYL 1CICB 1JUFB 3C6LA 5EZOL 3UZEA 1DLFL 1BFOB 4JG0L 4LMQI 1RI8A 4OCRH 4MX7A 1EZVX 1V3LA 3MV7E 3K46A 5EH1A 5KSUB 4Z7VE 4JPIB 4KI5D 5EO0B 4Z0XA 4YC2C 5BJTA 1CE1L 5D5MB 2YZ1A 3N1GC 1IC5H 5DJXA 4KDTA 3HMXL 2BVOA 1N0LA 2Q8BH 1Z0NA 2NY7L 4Y19A 1FZMB 3SCMA 3H7LA 1AC6A 5ESAA 2VUOA 3QPXL 4KV5E 3P9WB 2D7PA 4QXTB 2V17H 2A9NH 4WHCA 4G8EA 1REIA 4NNYA 3PNWB 4HPYH 4HBCL 3QYCA 1JPTL 1E28B 4TULH 3AS0A 1HH9B 2C3VA 1UACH 3PWPD 5C0JA 1YQ2A 4PBWD 4WO4A 3I3BA 5FA3A 4OLXH 3MO1A 3O6LL 5A16B 4APQB 4FQCL 3P4LA 3MUGB 3NTCL 4NQCA 2AI0H 2ZG3A 4JFDD 4H8WC 3RVUD 4NWTH 4RSVA 5EIQA 2AJSH 1FVCB 4O58L 1KXQE 1K4CB 3MV9B 5HYSA 5AUMA 3H7BB 5I9QC 3KYNA 2AXJA 5TDPB 4KK9C 4GKZA 3MLVL 3FHQA 5CSZB 4DTGL 1G9ML 5K93A 2DOCA 2BC4B 3RVWC 3QR2A 4UOW0 4XBGB 2YD6A 3QNXB 1QYGL 2YKLL 2MNUA 2J8UF 2ZSWB 4Y89A 1OF2B 2Y07H 3JV0A 3QEUB 1AJ7H 1KCRL 1U8PB 4ELKB 4P23D 4EI5A 3T3MF 2VZUA 3MNWA 1MJ8H 4J3VA 3VXPA 2Z93B 3QULB 1AGCB 3BYYA 2EXWD 4JFED 4LCYA 3ARSA 5E08L 4BZYA 3VFPA 3GSUB 1SY6L 3MOQA 5JR1H 1JRHL 5E0QA 2ZP0T 1BQLH 5SX4I 5LKNA 1MI5B 4JRYA 3ZT7A 2W0FB 4MXWH 1KLUA 4NO5B 4DGIH 4M43H 1Q0XH 4QRPA 4OV6F 4JKKA 5DC0A 2NX5D 1XEDA 1HINH 4GLRH 4ZUWA 2DB8A 4WY7L 2EIZA 4WUKH 3KPSB 1B0RB 1KN4L 4YHNB 5I74B 4NQEB 4HEME 4POYA 3EJYC 2D03L 4M1GL 3H9HB 1C12A 4I77H 1MQKH 2WBJA 4XPTL 1J5OL 3LMJH 3SDCB 2OR9H 1G6RA 1JPFB 4XPAH 1YC8A 5B3JF 4NZTL 5H94B 2VUYA 2DBJA 2Y5TA 2YRLA 3VFRB 4HJJH 2V5SA 1A47A 5FYJU 5HI4D 5IF0B 2D7QA 4JHBA 5MHSE 1XH3A 4I2XE 3P30H 1BF8A 4MWFA 3T2PA 4YPGA 5I73C 5IWLA 1U8QA 3IT8D 4LRIA 3IAGC 3SDCD 2ADIB 1FNGA 2EH8L 3NIDF 5K9OB 1PW3A 5FM5M 3QA3B 1B0GA 1S5IL 3BPLC 4ZTOL 1SJEA 3ABZA 3EYUH 3T77B 3QUXD 3ULUL 2IPUG 3TBVB 1MCCA 2RCSL 4XPFH 1TJIL 5E5MA 1PAMA 3D3VD 2HP4A 5EZJB 2XZCH 1IAOB 4OB5L 2Z91B 3RWGA 2DMKA 25C8L 4GMSH 3FB5A 2BRRL 4OQ1A 1QRNB 1WK0A 5D1ZB 1BPVA 1P4IL 1BZ7A 1U9KA 1U8HA 4PJHB 4WI8A 3ES6B 3AB0B 4TTDC 1Y18B 4MJIB 3SGKC 5IFHL 2IG2L 3C6LC 3RTQD 4Q0XH 4CL7A 2FB4H 1FP5A 3FKUS 4RFOH 1G0XA 3OHXA 2ZUYA 3WL9B 3BXNB 4OV5A 1NC2D 4ZUVA 3JTTA 2VR5A 2XZZA 5D1ZD 3GFUA 2XN9E 3PGCB 1JUFA 4KDTC 1YY9C 1BFOA 4HGMA 3MRNA 4G3YL 1BAFH 3SCMC 3C9NA 5KSUA 2HT2C 3EDDA 4JPIA 2DM4A 4YXLH 5EO0A 1QKZH 3CAFA 4CADB 5D5MA 2MQ3A 1YYLL 3BKML 3U9UB 4GG8B 2NY5L 1U8OB 4Z8FL 1FDLH 1FZMA 3ZO0A 4MHHG 1FPTL 1YMMB 3HFML 4LCUA 2DLTA 4OLYH 3HC0B 4WO4C 1X5AA 4QXTA 4YBLC 4D2NA 4WFFD 1MCJA 3CVIL 3PNWA 3BKCL 1E28A 1WISA 5J89A 1L0XA 5ETUA 2X7LB 2ZSVA 2XA3A 5DK2B 3QDMB 4APQA 5A16A 5DJ2A 1W8NA 1YMMD 3MUGA 3WLWD 1ADQH 4P3DB 3UJTH 1ZT1B 4LSPL 1AXIB 6FABH 4XCFH 2DJSA 5GHWH 1UZ6F 3FOMB 4OQTH 5I75B 1LO0L 1FVCA 1M6OB 5I1GH 3BJLA 4HUMB 1K4CA 3MV9A 5EOCJ 3V6OE 4JFPA 4YHKL 3EKCA 2QQNH 2UY6A 2Z8VC 5TDPA 3QAZC 5CSZA 2X4OB 3FQTB 3MBXL 5E8NB 3QNXA 4H0IA 2FZ3B 4ZO6A 3FMGH 4LP5A 4EN3D 2ZSWA 4C4KO 4JO1L 1JMZA 1PZUB 2PKDA 4WJ5B 1OF2A 3QEUA 4RFEB 3AREB 1U8PA 4ELKA 5FUOH 2Z93A 3U1SH 3QULA 1NBQA 5DK0B 2HLFD 1QA9A 4AQOA 2NY6C 4BFIB 1HNGA 3CNKA 4JY5H 3ZE1E 4IDJH 5TE7L 3V8OA 1OTSC 4WUUD 5FM8A 4N8PA 5KBNC 3QRGL 3LD8B 1E0OB 4HXAH 2BJMH 3QXUA 4J3SA 2JK5B 3WJLA 4UTBH 1TCRB 3UTZA 2W0FA 2VIRB 4NO5A 3VGAB 1MCKA 2WBJC 4RGNE 3X17A 1VGEL 4S1SH 3C5ZB 4X9BA 4MNGB 4L3EE 1B0RA 1ORQB 4YHNA 4NQEA 5EBLB 5DFTA 4F8TA 3H9HA 1ETZB 1P9MA 2F19L 5HDQL 1TENA 3CDGB 1CFNB 4PLKD 3PWNB 1F11B 1B6DA 4N8VG 3SDCA 2YD7A 1JPFA 3WFDL 5IWLC 4LSVH 4JPKL 1IKFH 4LRIC 5LWYL 5H94A 3ZTNL 2VDLL 4FN0A 3VFRA 4F9PA 4IMLB 1QO3A 2LE9A 5SX5H 1RIHL 5IF0A 1N4XH 1PLGH 1GOGA 3G5VB 2P5WB 5C92A 3ARFD 4NCC1 4XP1L 1MFEH 3MX0A 2ADIA 2BNQE 3LKOB 3U7AA 1AKJB 1MAKA 1ONQB 2WZPD 2H32B 4LKXB 2W0PA 3QA3A 5FGBA 2R15A 3HNSL 3STBA 5EBMB 3T77A 3FCTB 4OM1H 3P9MB 1C8PA 2P5WD 3RA7H 3TBVA 5T5FL 3QI9B 2DIAA 1I1CA 4R7NB 3SKOB 1XGTB 1A6TB 5FOJA 8FABB 5EZJA 5F9DC 1IAOA 2H8PB 1UYWL 3NAAL 1AKJD 3EFFB 5L2JB 4DFHA 3ET9F 1KEMH 1QRNA 5D1ZA 5FECB 2O5YH 4ODBD 1M71B 3ES6A 3VD5A 5T1KB 4MJIA 4POZD 5J56B 5DF0A 5L7XH 3RQ3A 5HVHB 3EO0B 4FFZH 3L5HA 2XT1B 2ATPB 1T7ZA 4NC2B 5FDWB 3LQAL 3ILPB 3BXNA 4OZHF 3WL9A 1MEXH 2W0KA 2HJKB 1ZVSB 1GGBH 3L5XL 1WAAA 3PGCA 1LVEA 1MCPL 5T1KD 5ACLA 3HCVA 1Q9WB 1CL7L 2X4PB 5DUBB 5IB5A 1NEZB 4U2ZA 1HI6B 1VADB 4CADA 3GMRB 1Z2KA 3DPBA 3U9UA 2A6DB 2YUXA 1U8OA 2QQKH 3E0GA 4B0MM 4GOSA 1YMMA 5HHNB 1X5GA 3K4DA 4ZYKB 2V9QA 2R23B 3HC0A 1EEQA 1QP1A 4XGZA 4APQC 2CGRL 4P2QD 4D9LL 4MVBC 1SHMA 4GKNA 5SWZB 4I5BB 4PRPB 3WHE0 2ZNXA 1N5YL 5JIIA 2X7LA 2X44D 1IEBB 1ZHLB 1MLBB 4HUNB 4PRIE 4EIGB 2EH7H 2XQBL 1UA6H 5DK2A 1JHLL 4L5FL 5KN5B 1AXTH 4JKWA 4P3DA 5DQ9B 3WD5H 4JCLA 1YEHL 1ZT1A 1MVFA 1IM3B 5T33H 4QRSA 5KW9H 2R0KL 3FOMA 1M6OA 2MCPH 4KK5C 2JJTA 4KUCF 1PY4A 1V3MA 5SWZD 4PRPD 1JGDB 2DI9A 1EEUA 4XPGH 5C09B 4OGXH 5IOPA 1ZVYA 3MZGB 2IFFH 4Z7QE 1AO7E 1N5AB 1OGAB 4EXKA 2FSEB 1JZ4A 3FQTA 3CMOL 3NABH 5I1IL 5E8NA 2G2RB 2Z35B 3E1F1 4UQ3A 1BM3L 2FZ3A 5GS0L 2CUMA 1CF8L 4MSWA 4GRMB 5I0DA 3JUYA 2X40A 4WJ5A 4RFEA 1UM4L 4X7TB 3G6AB 4MNHB 1D5MA 5C09D 4OQTA 3V6BR 3P77B 1TTFA 3L6FB 4TPRH 2DL9A 2MKLC 1F02I 1JV5A 5DK0A 5CEZE 3GSQB 1XT5A 3WJLC 4JE4B 4PJ9B 4BFIA 1PBYA 3LIZL 3BO8B 4OZGE 5E2TH 1MCEA 1ZLVK 1DJSA 1LE9B 5F7NC 3MLRH 2BZDA 4MXVE 5IB2B 1INQB 5HI4C 4BKLB 3KXFB 1P9MC 2VIRA 3UTSD 4HX1B 1NFDE 4HH9B 1KEGL 1N0XH 4PJ9D 2QQLL 3C5ZA 3R0NA 1YDPB 5KAQF 3SDCC 4JEGB 3DUSB 4MNGA 4X7FC 5J1SC 1ORQA 3O6FB 2APWA 5EBLA 1CVSC 3KJ4B 3TH4T 3CFCH 1CLOL 4F9PC 1ETZA 4PRAB 1CFNA 3B8YA 3PWNA 2Z9TA 3HC3H 4ETQB 5C0GB 1MAML 1NLBL 4XBPA 5GGVL 3O3DB 2WMPA 4GAGH 4XNMB 4IMLA 2VWEE 4NBXB 4Y8DC 4FQHA 4ODXB 1I4FB 5GRUL 1FFOB 3G5VA 5FGBC 2P5WA 1YJDH 3BUTA 3E3QE 1TETH 1A64A 4HFUH 1WJ3A 2GKIA 1A6PA 2IBZX 3LKOA 2MSPA 1AKJA 1ONQA 2H32A 4LKXA 1U8LB 4AYFA 2FX9L 3U83A 5E5UB 2EDNA 2B1AH 2UY7A 4PP2B 3EOTL 3FCTA 5E2WH 5I16B 1VEOA 1M7IB 2DJUA 4JFHE 5D1ZC 3QI9A 2ADFL 3AB0C 1CLZL 4R7NA 1XGTA 1A6TA 8FABA 1A0QH 5IGXH 1A3RH 4LLMB 12E8L 2E5EA 3B5TA 4OLWL 4H88H 2FIRT 3EFFA 3OXSB 5DEFB 3I2CL 3S7GA 5FECA 1FCGA 4ACPA 1M71A 3DBXB 4NZRH 1RIUL 5T1KA 3V5KB 3AGVA 5GGSA 5C2BH 1WVZA 1A6AB 4NM8H 4OCSL 3EO0A 3P4NB 4RDQF 2KDGA 2BP3A 2ATPA 2AJXH 4UTAL 5FDWA 1F4WH 1SBSL 5D7IF 5DD5L 4ESKA 3ILPA 4NO0B 2HJKA 4CN6A 2B2XH 1ZVSA 1KENL 4V2BA 5CD3B 4WHYG 3RNQB 4LEOB 4MZ2A 1Q9WA 3HPLB 3EYFB 1FORL 4K8RL 1TTUA 2X4PA 4JQIL 5DUBA 3QDGB 1NEZA 1UJTA 2CO7B 1CFQA 2D7TH 4H20H 3SE3C 3GMRA 4UOJA 4NO0D 4Z5RB 1ZLSL 4FP8H 5IMLB 2A6DA 4LVNB 5TPWL 4NBZB 2ENYA 2P8PA 5HHNA 4ZYKA 4KHTH 2R23A 4QHUA 4X6DB 4CJ0A 2NY2B 2OMBA 2CLZB 3BKYL 3TBWA 2J88L 4G6AC 2X05A 3DX6A 5SWZA 4I5BA 4PRPA 5TF1L 5FDYA 1MRDL 5I75C 4G42B 4FZ8H 1IEBA 1ZHLA 1MLBA 2JJTC 2D9QB 1RZKC 4OZIB 1NUDA 4OIIL 4TSBL 1MFBH 5KN5A 4RGOL 4YEFA 5DQ9A 1H0DB 2RQ8A 4CVZB 4R6UA 2NY2D 3RDTD 3QDJB 3X3GH 3DO7B 2JCCB 2HLFC 1INDH 2DLFH 4JKLA 1KOAA 1JGDA 4FFVC 4HUUB 4OF8A 1JTTA 1PD6A 4ZSOB 5C09A 1KIPB 3G9VA 3S98A 1N5AA 1OGAA 4KDWA 2BY2A 2FSEA 5JZ7C 4JFDE 3B2VH 1Q0YH 4UINH 1J05B 3QHFH 4ODHH 2Z35A 3QDJD 5F70A 5KVDH 4R4NC 5C71A 4FTVB 5DXWA 4X7TA 3G6AA 4MNHA 4LCIH 5IUSA 2OTUB 3LD8C 4OLVL 3L6FA 5GZOC 1OQOA 3UTSA 3GSQA 4EDWH 1JNNH 1NCAL 4PJ9A 4PLKC 2Y06L 4RAVB 5CHNB 2XWJB 4TUKL 3VGAC 5CINL 5EUOB 3BO8A 3MUHL 4OCYL 3C5ZC 5FUCE 4S1QH 3QB7C 5EO9B 2OK0H 1LE9A 1A4JB 5IB2A 4L4VE 1INQA 3UTTB 1FYTB 2VLRD 5GRJH 4UQ2B 4YDIH 4BKLA 3KXFA 4HX1A 4HH9A 4LPCA 1IBGL 3PQYE 3MJGX 3IDNB 2GSIB 3O6FA 1PSKH 2Q8AH 1Q1JH 3AXLB 5LCVL 4NKQB 1OAXH 1S3KL 4M02A 2EDRA 5C0RL 4NFDA 3STLA 3UTTD 5DA0B 5C0AD 5CBAB 1KIUA 5JQ6H 3DV6B 3JWOH 4WDIB 4NN5B 2JTDA 4CVWA 1MNUL 2X4NB 4ETQA 1JGVL 2D3VA 2EEBA 3O3DA 1MCLA 3UC0H 4XNMA 3C09B 1QVOB 3L3KA 3INUL 3GGWB 4WWKD 2YPLD 1I4FA 1EZVY 5F9WB 1FFOA 4PJAB 5JTWA 4BQBA 3IRPX 5GPRA 1UKSA 5FYLD 2DTML 1C5CH 4P99A 1EHNA 4MB5A 5DD6A 1NMAH 1QNZH 3QI9C 4POZC 3PGFL 3QEGL 3SOBH 3CFJB 2ZUSA 1U8LA 2KBGA 5KVGL 3NN8B 2VAJA 2A2QT 1FNSH 4PP2A 5FGCE 3NFPA 5I16A 1M7IA 3LZFL 3OBAA 3ZYJA 1J9CT 7FABL 1X4ZA 3MXVH 1SBBA 4M48L 1OCWL 1C7TA 4ZUUA 5J4MA 3TH2T 1KBGL 4LLMA 3OKNB 1FLRL 5HVHC 5GJTH 1TXKA 1WTLA 1QEWB 1K2DB 4Z7WB 3OXSA 5DEFA 2VN7A 1YPZF 3JWDC 4U4BA 1EV2E 3DBXA 1Z9SA 3V5KA 2PR4L 5GRXG 1A14L 1A6AA 3D3VE 4PJHF 1AP2B 5IMOB 2WWKO 3P4NA 3KR3H 4WEUD 1JHTB 4WFGD 1TNMA 3HN3A 3S88L 1K3IA 3MODL 3DIFB 4NO0A 3R1GL 4KKAD 2R4RH 1OAKL 5JW5B 5JXEA 2ICES 1QFWM 4L9DA 1YEIL 2R1XB 1TZHB 3HPLA 1T6WA 3EYFA 3QDGA 5IHUL 3BWAB 5A2JH 1F00I 4QGTA 3M8OH 2ZUUA 4Z5RA 3H9SE 5IMLA 4KY1L 4N90D 5DJ0B 4LSQL 3TM6A 5ALBH 4C56B 2E7LA 2H1PL 3T3PF 5D2LF 3ZLQC 1QHPA 2CKBB 1MREH 3F8UB 4X6DA 3VXSE 2X41A 2CLZA 1KJVA 4P5TD 3DX7B 3A0OA 1HYRC 3CK0L 5HDBF 2WUCL 4FQ1L 2VLMD 3RRQA 1BFSA 1U2HA 3BAEL 4G42A 1OP3K 3SKUD 2FX8H 4XPBL 2E6QA 3IS1X 4OZIA 4KHXL 5I15H 3G04B 4C56D 5IBTH 1VERA 2FJGA 4KPHH 5ADOH 1H0DA 4CVZA 3QDJA 5IB1B 3QISA 5KS9E 3DO7A 1X5ZA 2IANE 2YWZA 2JCCA 4MNQB 4RISL 1CD9B 3LKQB 2ESVD 2R0WL 4HUUA 5JOEA 4UNUA 3GSVA 4YFLI 2MWCA 4ZSOA 2DQFA 3R8QA 2V7NA 4PGBB 3V4VL 2XA8H 1MJUL 3F62A 2J5LC 1XZ0B 3S36H 2WANA 3N1PC 4O2CB 5IHLB 3OPZL 2DRUA 1J05A 4I13B 5E56A 3GSXB 3TBYB 2X4TB 3IJYB 3ORJA 3V0VA 1N64H 4MNQD 3GI9H 2FJHB 3IFOA 4PJ9C 4HC1A 4FTVA 1LMKA 4NUGL 3WFCL 5F7EL 1G1YA 2EC9U 4G7VL 3O45B 4XBEL 2K7PA 2VXSL 3L3IB 5DMIH 3FT2B 2VLRA 3N50A 3MRRB 4L4TE 4PJBE 1K8DB 1VKXB 1E4XI 2RB8A 5CHNA 4RAVA 4Y88A 4CNIB 5F6HJ 4ZQKB 3VW3L 2XWJA 3MCLL 4IHOA 4LSSH 3UCRA 5EUOA 1J1OL 2J8OA 3RX5A 1VFOA 5EO9A 5JMRA 1A4JA 1P2CB 2DF3A 3Q6GL 5KANI 3O6FC 2BNRE 3P0VL 3UTTA 1FYTA 3KJ4C 4YAQB 3SKJH 3P0YH 3SY0B 4UQ2A 4YFDB 4QNPE 1YNTA 2GJJA 1PQZA 3MRDB 2VKWA 4WUUE 3DV4B 2BY0A 3IDNA 4EQ2A 4O9HL 2YPLA 1RHHB 4KRMB 1L4IA 1FLTX 2CDGB 3AXLA 4U0QB 1BFTA 3CXHK 2JJWA 3P9LB 5AG9A 3PDOB 5KVEL 2P1YA 3MNVB 3LKPB 5KTEL 4PYHA 4OSUL 5CBAA 3DV6A 4PJIB 4WDIA 4JKPL 4XNQB 1MH5B 3MRPA 4WTWA 2X4NA 1DN0A 3GHEL 1QVOA 2DQHL 1AE6L 2BVTA 1M1SA 3G5YB 1W72B 3GGWA 5C0CB 2LAAA 5IKCA 1XGQB 4OD3L 4PJAA 3U4EB 3UBXI 3FQUB 4AEFA 2BHYA 1NL0H 3FZUD 5IFJB 1WBXB 4TNVK 1T0NB 1XF3A 2OJZH 1QLEH 3FO0H 2V7HB 4V1DD 3CFJA 3S3SA 5EOCH 2AK4D 4BSVB 4HQQH 3NN8A 1KCSL 1F4XH 1G6RL 1YJDC 4LHUB 2DTSA 1IAII 3SQBA 2Q7YB 3MQIA 1FIEA 2IGFL 3G9AB 3CFBA 5DGRA 4F7CB 4GXUM 4Y16D 3C87A 4GG6B 2XPGB 4UV7H 3EJZD 4DKFH 2VE6B 5MP6L 1NAKH 2AJUH 5EC2B 4NKMB 3OKNA 3R06B 1MCSA 1QSEE 4XB7A 4Z7WA 1K2DA 1YQVH 2EECA 1NLDH 2FRGP 3WIFA 4LHUD 1E6OH 3BH9B 1GOFA 1IGFH 3X3FL 2YD5A 5JXEC 3KYKL 3KYMB 4PRNA 2VDRH 1QFUH 1AP2A 1TZGL 5IMOA 1HHKB 1U8MB 5F88B 4ZTPH 3WHXB 3BT2H 4Y0GA 3DIFA 5F1OB 2X4UB 2DM2A 5JW5A 2ITDA 3P4MB 4LVNC 1UM5H 2R1XA 1TZHA 5DJCA 2E7LC 4M6OH 3MRLB 2VDQL 3BWAA 4NBYB 1QR1B 2NY2C 4HDIB 1YECH 2EICA 2VN4A 4JY6A 3LQZB 5DJ0A 4OM0L 4C56A 4TSCL 3NGBB 4WTZA 4X6FB 4ONFL 2CKBA 4LDLB 3HB3D 5HHOD 2GI7A 1DVFD 3DX7A 3BE1H 3PXHA 5I19L 3BDBA 4Z7UE 1EMTL 2Q6WB 5FKAB 2O5ZH 2J7LA 5H2BB 5C07D 4GSDL 2EDTA 4KKBD 2VLJE 4YPJA 1B0WA 4NCC2 1HDMB 1JPSL 4ELMB 5HVWA 4O02L 5IBLC 3NCJL 5DLMH 5CBEA 1FAIL 1ZOXA 5IB1A 2NXYD 2R4SL 5JIPA 4MNQA 2VXTH 4YUEL 2AV1B 5ALCL 1TQCB 2DQEH 4UT7H 4K3GA 4YR6B 2O61B 1BIHA 1H3UA 4HXBH 1QBAA 4PGBA 1BJ1H 5BZWB 2IAMB 1Q9KA 3EAKA 1XCQB 1XZ0A 5FV1L 1H3GA 4O2CA 4AENB 1RJYB 4LGPB 35C8L 3TBYA 1F4YH 1RU9H 2X4TA 3IJYA 4OF5A 4OLUL 5D96B 2VTFA 2FJHA 3MBEB 4DW2H 3VXUB 1PKQE 1AGDB 5BS0B 5T3ZD 1ZGLM 2ATKB 3VJ6B 1NCBH 1JWSB 2Z4QA 3O45A 4R4BB 1F4HA 4AY0A 3OWEA 2J8UE 1BEYL 3MA9H 3L3IA 3FT2A 3E6HB 3N9GL 3MRRA 1IFHH 4OD1L 1K8DA 1VKXA 4XWGH 1OB1B 2DQTL 1KN2H 4CNIA 4PTTB 4ZQKA 4GW1B 3T3ME 2R2CA 3VXUD 2H26B 1F6LL 2VDOH 4NN7B 2L4OA 4AEIH 1F3RB 2DM7A 1P2CA 1CDIA 3TIDB 4PJXB 1J8HD 4O51B 1O5DT 4YAQA 1IGIH 3E8UL 3MRDA 5F1NB 1UEMA 2EYSB 3DV4A 4NN5C 4PY8I 5ENWB 5TQ0L 5CLWA 1KLGB 2CDGA 3C09C 3O4LB 3U46B 1KC5L 3HMWL 3P9LA 4PRHD 4I3SH 5B38G 3MNVA 3LKPA 1GPOL 1UENA 2VZ3A 4PJIA 5F9WC 4YQXL 5J1TC 4XNQA 1MH5A 5FK9B 3S8WA 5GS1B 3LB6D 3V52H 1G9NH 1R3IL 3BDXA 1F45A 1OQXA 2YOCA 5LVEA 5TFSH 1MRFL 4Q2ZA 3G5YA 1JF1B 1W72A 1XGQA 3IDMB 3O4LD 5AWNH 2CUHA 1GC1H 3U4EA 4U6VH 4FRWA 3IDUA 1HEZB 3AC0A 2DBLH 1JNLH 5EUKB 3ARUA 4DKAA 5IFJA 1QLFB 1RURH 1WBXA 2E8YA 4WTXA 4G9FB 4J6RL 3K81A 3QJFB 5EG6C 1T0NA 2AJZB 5C6TL 2V7HA 1GCFA 2DLGA 3U4AA 4LDEB 3O9WB 4BSVA 1YEJL 4XP6L 1XGYL 4LHUA 3E6FB 3NIDE 1KJMB 4KKAC 4OLZL 3QJHB 2Q7YA 4F7CA 4KJQD 2VSDA 2QBWA 1KG0B 2MJWA 1OD7A 3EO9H 3FO9B 4GG6A 2XPGA 5LAXB 4G9FD 3VD9A 2VE6A 3ARVA 2Z92B 4UAOC 5EC2A 4NKMA 1U2CA 2O5XH 3ZE2F 4Q6IB 1JK8B 2C26A 4HZLB 4Z95L 4WNQA 3MOAL 4KQ3H 2HKFH 3BH9A 1U36A 3Q5TA 4DOHE 1DSFH 1G84A 4NDMA 1DQDH 3KYMA 1EO8H 4J23A 1HHKA 1U8MA 4DAGL 3WHXA 1TLKA 2ERJB 4P9MH 3NACL 4RBPH 1RMFL 1I1RA 3B43A 4LSDA 4P5TC 1QFWH 1ZKAA 4E41B 4JHWL 4YHYB 1U3HB 4OZFG 2X4UA 1LK3H 5IV2B 4JFXB 4GMTH 3WUWB 3V2AR 3T2NL 4LCWE 4X83A 4NQVB 1HSBB 1RIVL 1CGWA 1RVFH 5HHOA 3MRLA 3FTGB 1QR1A 2F53B 1XMWA 3VDCA 4HDIA 4NGHH 5HHXH 3WNOA 4CVXB 4M1CD 4XI5C 3LQZA 4P2CG 3CH8A 2FDBP 2R2EB 5FXCH 3REWB 3DNKA 3KLHD 3LS5H 1CK0H 1GXEA 4BQCA 4KKCD 5CP3A 4D0BB 4NUJB 4POUB 5JMOC 4X6DF 5FKAA 2Q6WA 2P8LB 3ZYIA 1JGLH 1LO2L 2APFA 1QQDB 3GSNA 4HIXH 2AABH 3GK8L 1H3WM 4TNWF 2F5BH 1HDMA 5F21B 2ILLA 2R0LH 4ELMA 3LS4H 1RZJH 4OZIF 4Q9QH 1LEGB 5BZDA 5DUMH 2AV1A 4OFYD 4YR6A 3L7FB 4ODSH 2O61A 1N59A 2JCCF 5LQBH 5T3XD 1UZ6E 1MY7A 5BZWA 2EZ0D 1Q72L 2IAMA 2KZWA 2PF6A 1XCQA 5I1LA 4W4NA 4JFZL 4AENA 1RJYA 4WI5A 2VLLB 1D5XB 1QSFB 4KI1A 3VXUA 4C83B 1AGDA 2XRAL 4BZ1L 5BS0A 2ATKA 3OKMB 3VJ6A 3BGAA 1JWSA 4R4BA 1J8HA 1T5WB 4B53A 3E6HA 4PRDB 3VH8A 2IBZY 1LEKB 1RZKL 1BOYA 1FFRA 3MLWH 3HE6B 4IRSD 3CUPB 3PP4L 1F8TL 2W9DL 4PTTA 4GW1A 3AS3A 3QWOB 3GI8L 4LOUD 2H26A 2KQNA 3QO1B 2FO1A 4ZO9A 5JOPE 9CGTA 4AL8L 1HHHB 1EEYB 5CWSB 4Z77B 1FG9C 5DVKA 5HYJE 5EUOF 3HRZA 4PRHA 3TIDA 4PJXA 4IEFB 4P3CL 5J13B 1YEKL 5E8PB 1I9IH 2J8HA 4K3EL 1FGVL 3FZUC 4N5UA 5GHWL 2RFXA 2QL1A 2FBJH 2J3SA 3V6ZB 2EYSA 2B8OT 4ZO8A 5ENWA 3K8MA 4GO6B 1UZ8B 1QLRB 1KLGA 1RZIB 4BJLA 5DRWB 3O4LA 1NGWB 3U46A 4J4PD 1LO4L 2HMID 4XMKL 4YEEA 1LDPL 1CFVH 5BRZB 5J11B 4MJ5B 4IIQB 4KUZH 3QCVL 4K7PL 3LH2L 1NGPL 5FK9A 5GS1A 2N7AA 1E4XL 3X12B 4YBQD 3EJZC 3Q3GB 3OZ9H 3WS3B 1FQ9C 4LNRB 4JN1H 1JF1A 5D1XB 5FO7A 2I9TB 1WSST 3IDMA 5DD1H 3HUJF 1CIUA 4NQDD 5BRZD 5EU6B 1HIMH 1QLFA 3IFLH 5IR1B 4JGJA 4OTXH 4PJAF 4G9FA 2QV2A 4HF5L 3QJFA 2G9HB 2AJZA 4ZPTB 4CUCA 3IF1B 4OT1H 4AK1A 4FNLL 5IESL 4OI8A 3O9WA 2VH5H 2H2PC 5HY9B 5J6GA 3QCTL 5D1XD 1IC1A 1NFKA 2VDML 3QJHA 3B9AA 3H9YA 1KG0A 1D6VL 2XZAL 3FO9A 3TC9A 5F1KC 5LAXA 4GFTB 5D8JH 1NPUA 3ULVH 3QXDB 32C2B 2BSTB 4NC1C 3BUYB 3VFNB 5F8QC 1T1WA 1YYMH 2AXFA 1A1NB 5T5NF 5A2FA 4PP1C 1QBLL 4KAQL 1RJZB 2EDFA 1JK8A 1FZOB 4HZLA 1IGCH 4LIQL 1TTGA 2N4IA 3WO4B 4AQ1B 4Z7WF 1OLLA 2YD2A 5BV7H 1IARB 4FQLH 3ULSB 5I71B 5IQ9B 2FO4B 5H35A 1QZ1A 3K0WA 5JPMB 4R2GD 3HZKB 1EFXB 4AH2B 3VWJD 2IALB 3HB3C 4MDIB 3CDYA 1N6UA 2EYTB 4E41A 3HC4L 4TVSa 1U3HA 1T1ZB 5IV2A 5L9DH 2E7HA 3W82A 4YNYB 3WUWA 4KKBC 5J1AB 1IAIL 3OXRA 3T04D 4QWWD 1ZLWH 1ACYH 5IJKA 1YNLH 4NQVA 1HSBA 4B50A 4PB0L 1WFOA 3FTGA 4WFGE 1LP9E 1C5BH 5HDOA 3DUUB 4RMQA 1EFXD 4D3CH 5BV7B 2NXYC 4PGDB 2H45A 4CVXA 3VGFA 2D0HA 1QACA 4LU5H 3VI4F 2BERA 1RZ8B 4G6MH 4BZ2H 2R2EA 3K2MC 3JWDL 3PWUB 4KTYA 3REWA 4TOYH 5F7YC 5EZOH 3F7RA 1DLFH 1OAQL 4BH7B 2L7JA 4JG0H 1PY9A 1OP3H 4X80L 2BOCB 3TO4D 5F6IB 2P8LA 5FEBA 5IG7B 4AG4L 1OD9A 1RUQL 3GB7B 1OW0A 1YMHB 1CE1H 1TQCC 5J7CC 1QQDA 2E9JA 1W0WB 5GGVY 5HPMB 3HMXH 2NY7H 1RULL 4G6FD 3VRIB 4HWBA 1HK6A 1CU4L 2IAMC 3QPXH 2NYYC 1LEGA 3EFDL 3QXVA 5CGTA 1HSAB 2C4XA 5DJYB 4X4MA 4M62L 2E3VA 4HBCH 3L7FA 3OGOE 4NQUA 1JPTH 1BLNB 3BRFA 1YNKL 4MQ7B 3B3IA 4XMPL 1RUPL 15C8L 4NNPL 3O6LH 4FQCH 3NTCH 2VLLA 1D5XA 5GGTL 1QSFA 3SE8L 4NCDA 5D2NE 3EOAB 4O58H 3OKMA 4OI9A 3V5HB 3DSFL 4KXZH 5CJBA 4JFFE 1T5WA 4PRDA 3HI5L 1LEKA 2GK0B 2FWOB 3HE6A 2XKUA 1F2XK 3CUPA 3MLVH 4HS8L 1II4E 4DTGH 5FYJD 1G9MH 2F74B 2OTPA 5DURB 4OJFL 4ZXBB 3PDDA 3LB6C 1QYGH 2YKLH 5HHQB 4JRXB 1HHHA 1EEYA 4Z77A 1GGCL 4ZFOL 3NPZB 3BRDA 2MPAL 1KCRH 3WNKA 3T0EE 3NIGF 5GS2H 3B8SA 3C8KB 3RVTD 5DQJB 3CSBA 3GMMB 2QADD 3B9KB 2W60B 4JHAL 3V6ZA 4ZXBD 5E08H 5GS1C 1SY6H 4W70A 2GTWB 3M17B 1UZ8A 1JRHH 2DQGL 3KYOB 3PWLB 1IL1B 4NQDA 5L8JB 2BCKB 5BRZA 4MJ5A 4IIQA 2FX7L 4NQXA 5K33A 1HCFX 3X12A 5DRXB 3BP4B 3B9KD 1OWWA 3Q3GA 3MJ7B 1FYHB 3S3PA 4LNRA 5IROA 5D1XA 2I9TA 4WY7H 2F54D 5HD8D 4FQXD 1P7QB 3O9WC 1DL7L 1KN4H 4IOIA 2AW2A 4G6JL 2D03H 4M1GH 4D9QE 1JWMB 4XPTH 4KH2A 1VACB 3DYMA 4Y7MA 2G9HA 1J5OH 4ZPTA 3IF1A 3RWHA 2B5IB 1CBVL 3FRUB 4NZTH 2BY3A 4LQFL 2HFFB 4K94C 3OG4B 5J9PB 3MZTA 4NYLB 3QQ4B 3HG1B 4CDHA 3GBNL 2A83B 3BYTA 3QXDA 4WU7B 2ARJQ 2BSTA 2AK4E 2ZNWA 5EWIL 3VFNA 3VWJA 1Z6JT 1A1NA 2EH8H 5CMAA 1OSPL 1CG9B 3GIZL 3RGVB 1RJZA 3DRTB 1FZOA 1P4LB 1S5IH 1U0QA 4KMLB 4ZTOH 1FH5L 4YHYC 1U3HC 1MRCL 1FL3B 2XICA 1X6NA 3ULSA 1OP9A 4G5ZL 3EHBD 4YZFF 5F44A 5IQ9A 1CGSL 2MHAB 2PYED 3ULUH 2FO4A 4NSKB 5I6XB 2RCSH 1TJHL 1NGZB 3HG1D 5IJKC 3L1OL 4K3JL 5JPMA 2PN5A 1EFXA 1TJIH 4O2EB 2Q1EA 4AH2A 1A7QL 2IALA 4MDIA 2YN3A 3KPRE 4OB5H 2EYTA 5DO2C 3RGVD 1DCLA 4L1HA 25C8H 3MJ8B 1T1ZA 4ONOA 3SEPA 4R97B 1BVLB 3L3JB 4QKXB 4YNYA 2AXGB 2BRRH 5J1AA 1P4IH 5D7IE 5CJ8A 2DYPB 3BVNB 1OAYL 3EOYG 1H8NA 5IFHH 1S7VB 2UZIL 2IG2H 3HS0B 5HGBA 2X70B 4PGDA 1A21A 4TVPE 4FS0A 3SO5A 1DBKL 4HEPG 5DUPL 1RZ8A 3NCEB 5DMKB 3DVNB 1FGNL 1OW0C 4I9WE 2RHEA 4XPHL 3D2UB 2DYPD 3NA9L 2EZ0C 5TDOB 4BSWB 4BH7A 1FNHA 1G7LB 1XR9B 4G3YH 1A8JH 3VGEA 2EIDA 2BOCA 3TIEA 3JWNC 2B4CC 4IDLA 5IVNA 3GB7A 1YMHA 5DDHB 1YYLH 3BKMH 1W0WA 1T2QL 2EEDA 5HPMA 4I8DA 2NY5H 4J8RA 4Z8FH 4H5SB 3H3PL 3D2UD 1FPTH 3F7YB 3HFMH 3V0WL 2FIKB 1HSAA 4CN1A 4ELMF 4YHPA 3CVIH 3F6IA 3KPPB 3PL6B 3BKCH 4C54A 1HNFA 1T2XA 1JPGB 1BLNA 1CCZA 3T0XA 2I9LB 3BPOB 4MQ7A 4N0CD 4MJ4A 1FRGL 3WUZA 1EVTC 2AEPL 3MJ9L 1I7RB 4NRXB 2VDKL 3C2AL 5CAYB 3HE6C 3HMXA 3MV9E 4LSPH 4HPOL 4N0YL 5A2IH 1LO0H 3EOAA 1JNJA 3V5HA 4JGUA 1PX4A 1F3JA 1X9QA 4YHKH 4ENED 1KTDA 4F33A 4PTUB 2GK0A 2FWOA 2W65B 2XNAB 4LNVA 1ED3B 2HMIC 1EJOL 5J13C 3STZB 2F74A 5ITBL 3MBXH 5ISZB 3SDDB 5L88L 4ZXBA 5T3ZE 5HHQA 1U41A 4J3XA 5HHMB 4JO1H 3FOLB 2UWEB 5CGYD 1NMBL 5D7LE 2ID5A 5B39G 2DLIA 4XCEB 2Q87A 3V6FB 4HC1L 2BVUA 4GLRI 3C8KA 5DQJA 5J11C 4PJXF 4IIQC 3GMMA 3MRGB 3VXOB 3B9KA 3CLEL 1BREA 5ISZD 5FHAL 3QDHA 4XNXL 1EHAA 3M17A 5TE7H 2IFGA 5B4MC 4M9PA 5J12B 1V05A 1MI5E 3PWLA 3QRGH 5IROC 3UAJD 5D1XC 2BCKA 4CJ1A 4YHML 4W4OA 4JDVA 4PLJD 5E99L 5DRXA 3BP4A 1JL8A 4JM2B 1B6UA 3TA3B 3KPSE 5FFLA 1EHLL 1VGEH 1ZT7B 2AQ1A 3MJ7A 4KVCL 4U1KB 1P7QA 3JV6B 5JW4M 2ZCHL 1F90L 1EX0A 3V79C 3NFSL 2ORBL 3MMEB 3RAJL 4PR5B 4LGSB 2DD8L 2F19H 1UWEL 5HDQH 4F2MB 1VACA 3MV8B 4G8FB 3TA3D 3WFDH 4MB4A 2W91A 3FRUA 3OX8B 4JPKH 5FYLL 5LWYH 1Y6NR 3ZTNH 3VWJC 2ZCKL 2VDLH 1J10A 2HFFA 2A77L 1AY1L 4CBPA 3CJJA 1RIHH 4KDVA 5C08B 5FA4B 5J9PA 4OCWL 2V6HA 4NYLA 4ODUB 3QQ4A 3WO4C 4HKBB 4QWWC 3DXAD 3HG1A 4Y2OA 5E95B 4XP1H 2A83A 3K8LA 5EB9A 5I71C 5F9OL 2D31B 4HSQA 1NUNB 3RGVA 3DRTA 4QEGA 4P4KB 3KLDA 3HNSH 1IGTB 5FO8B 3TV3L 3MRBB 4YGAB 5MEND 3UO1L 1FL3A 4O5LL 5C08D 1Q9LB 2MHAA 2ZZUT 4NSKA 1YPZE 5T5FH 4R8WL 4O2EA 2VLKB 2JB6B 4YX2L 1QRNE 1UYWH 3FQRB 3NAAH 4PJHE 3MJ8A 3TNNB 1BVLA 3L3JA 3U36B 2GY5A 2AXGA 1AGEA 3FFCD 2DYPA 3VA2C 3BVNA 3SJVE 1S7VA 1I7UB 3B83A 5J06A 2NXZD 2X70A 4KMTL 5IVXF 2FECI 3LDBB 4R96B 4FHBD 3LQAH 5F6IC 5DMKA 3DVNA 2PTUA 4PREB 3L5XH 4DWHA 2PW2B 3D2UA 5TDOA 1MCPH 3VGGA 4BSWA 1G7LA 3HE7D 4DEPB 1H9VA 2QSVA 4TQEL 1NCDL 1CL7H 3T3PE 3GRWA 5D2LE 2GYSA 1TIUA 3TN0B 5DDHA 3RIAK 4UI2A 5HDBE 5EOQL 4P3WA 4H5SA 3SGEH 4MA3B 1A7PL 3F7YA 2FIKA 1LDSA 2PETA 1ZA3B 3MV7B 2CGRH 4Z7VB 2CK2A 3BQUB 3KPPA 3PL6A 4D9LH 2CKBL 2Z8SA 5F71A 1JPGA 3SE9L 4NHUB 3QDME 4FQJL 2I9LA 4RX4D 3ARTA 4G7YL 2XQBH 3D39B 2ICEB 3MV11 1JHLH 4L5FH 1MJ7L 4OIAA 3UZVB 1I7RA 4NRXA 3QIBB 3UPCA 3SBWA 4K71B 1YEHH 4PJEF 1BZ9B 3RVTC 1D5ZB 1J0ZA 2R0KH 1YEEL 3BQUD 5BO1L 1P84J 4QF1B 5T3XE 4H1LH 4ZXBC 1BBDL 4ZNEE 1CYGA 1MFNA 2Y9RT 5IW6B 2C3GA 1CXEA 4PTUA 2C7UA 3GZKA 2XNAA 1ED3A 5AD0B 5DD3L 2R8SL 5FYKU 5KOVC 3STZA 3CMOH 2IH3B 5ISZA 5CZVL 4XHJD 3SDDA 5I1IH 1BM3H 3VXMD 5GS0H 3B9KC 3HR5B 1CF8H 2E7MA 2EDLA 3FOLA 2UWEA 4P57B 1VSCA 1UM4H 2HKHL 3ECBB 1J18A 4XCEA 3V6FA 2FEDD 1IKNA 1G9MC 5IVOA 1K5NB 3HAEB 4H1LB 4W4OC 3HA0A 4P48A 3MRGA 3VXOA 4X4XA 2K3TA 4LASL 3FB7B 4HW6A 3LIZH 4S2SB 2COQA 3TJEL 5E1HB 1J0KA 3C8HA 4XP9L 5DS8B 4OCXL 2R56L 3VFGL 5IFAL 1E6JL 3IS0X 4JM2A 2V5TA 4X6EA 3TA3A 4OI7A 2QQLH 1ZT7A 2PYFB 4DQOL 2DAVA 3ZYOA 5GISL 2CXKA 4U1KA 4JANB 1QSVA 3JV6A 4JM4L 4ZUSB 2VL4A 2J6EL 3GKWL 4KTDL 3MMEA 4PR5A 1QBML 5A2LH 5CFHA 4ZNCD 5DZNA 4F2MA 1KYOJ 5FB8B 2YR3A 2A6IB 2FGWL 1FFNB 1MAMH 1NLBH 1EK3A 5GGVH 1TJGL 2X6MA 4P49A 1I8IB 1L7IL 5J3HD 3RGVC 1F4AA 4MHHI 3VXNB 1DN2A 5MENA 5C08A 5FA4A 5GRUH 1W72L 4ODUA 2EDEA 2EIEA 1NQBA 5SX4H 3CU7A 4C58B 2BXZA 5F8RC 2D31A 5ITFB 5GGQH 4YDLB 1NAMB 4LP4A 5I6XC 1KNOB 4JJ5B 5F72S 4OAWB 5DGQA 1FZKB 5ADPL 2FX9H 1P84K 3OR6B 5FO8A 3MRBA 4S0TD 1BD2D 1DDHA 3EOTH 4R97C 3RUGB 5CILL 1R24B 4PG2A 4I2XB 4YO0B 2GK2A 2CJUL 2ED9A 1L0QA 4FZEL 4O2FB 2ADFH 5E2UL 1CLZH 2VLKA 2JB6A 3C60D 1DBML 3FQRA 5F7MC 12E8H 1A6ZB 4XAWL 4OLWH 3TNNA 3DHJA 3U36A 5C1MB 5KSBA 1U93B 3I2CH 5C3TA 2HA1A 3MUZ1 1WFUA 1BVKB 3HE7A 3K2UL 1RIUH 4I0KA 5HHVL 3ULVF 2OL3H 4PV8B 5JHLL 4OCSH 1BQSA 3S5LG 3K8KA 3O8XD 5GSRB 1UKQA 2YPKB 1B9ZA 3PGDB 4R96A 4UTAH 4U7KA 4RWYL 1SBSH 5DD5H 4PREA 4N0CC 2PW2A 1KENH 2P5EE 3ALXA 3CX2A 1FORH 4HUXB 4K8RH 4JQIH 3K1DA 5CP7B 1JZ7A 3QUKA 1S7TA 3T0DA 5D7KD 2QTEA 3TN0A 3PL6C 4RX4A 2OL3B 3OB8A 1ZLSH 3R8BB 3OF6D 2CSPA 3HNVL 5TPWH 4ENEC 2XN9B 3BPOC 5I8CB 1RZ7L 5JIHA 1HN1A 1ZA3A 3MV7A 4AIZB 4Z7VA 3BKYH 3ZDXF 3BQUA 4DCQB 2XXCB 2J88H 5DVOA 3SBWC 3T1WA 3VFUB 1VA9A 3FB8B 5E8OB 5KSAB 4NHUA 3FT3B 5TF1H 1MRDH 4U49A 1SYVB 3ZHDA 5JA9A 3D39A 2ICEA 5D6CB 2XN9D 4OIIH 4TSBH 5CGYC 4GRLB 4OGYL 3GSNL 4RGOH 2RAMA 1BZ9A 1MHPL 3UYRH 1D5ZA 3VCLA 5HXMA 3BP6B 2XTJB 4QF1A 3SDDC 1R3KB 3RJQB 3UYOD 1OGAE 3BDYL 3OGCB 1N7ML 5IW6A 3RJDA 5A3IC 3QZWB 5T3ZL 5C3LD 1MWAB 1K6QL 5AD0A 3UAJC 1F6FB 1FSKB 4BSJA 5ICZB 1OAZL 4OBSA 1IKNC 2AXHA 2BSRB 2IH3A 4PLJC 3LN4B 1IM9B 3GJFB 3OKYA 5C86A 4G80B 1QHOA 3HR5A 3X13B 3B9EA 4ZMAT 4XRCB 3DRQA 3BZDA 3ECBA 3ZZ1A 5FCUL 5JIKA 1JYWA 4XVTL 3ZE0F 2KH2B 3HAEA 2IJ0C 4H1LA 4OLVH 1UEYA 4U1MB 5B21A 4YC2B 1NCAH 1ULVA 2Y06H 2QHRL 3FB7A 4TUKH 1M05B 4JM2C 3TA3C 5CINH 1F3DH 2C3HA 4OCYH 3DLQR 5AG8A 1JTOA 5JOFB 3SDAD 5DS8A 2GITA 3CDFA 3CD4A 2J2ZA 3MGTB 3GNML 5HHPB 3LV3A 4KQ4L 1QOKA 2EXYD 2PYFA 1A1OB 1IBGH 1XF4B 5CD5D 4JO4L 3KPNB 4BFEA 4JANA 2WQ8A 5LCVH 1S3KH 3T08A 5C0RH 4YLQT 2ICWI 3RFZC 4WGWB 1CD1A 2X89D 5FB8A 2J1KA 3DGCR 4X4YA 2A6IA 1FFNA 1MNUH 1JGVH 1GHFL 2DDQL 3U82B 4CMHB 2F54E 3EOBB 1SYSB 1NFIB 1NCNA 4HLJA 4LKCB 2FHBA 1I8IA 1NMCB 1T83A 3INUH 5HYQB 3VXNA 1XGUB 4FOMA 5HYSG 1T1XB 1S7XB 2NTSP 4PJGE 2DTMH 4DVBA 4PG2C 3IAQA 3VMPA 1NAMA 3C60A 4RGND 1KNOA 4JJ5A 3PGFH 3PIQB 3QEGH 4MJ6B 1CD0A 4F57L 2NXZC 4TNVF 4OAWA 1FZKA 4L3ED 5KVGH 4EUPG 4Z7OF 3OR6A 3W11D 3F6LA 4LHQB 4Y4FD 3S37L 1W8OA 3LZFH 1NCTA 4EDXB 3KPLB 7FABH 1R24A 1YUHB 4I2XA 5AAWA 3WDJA 4O2FA 4M48H 1X5XA 3LHPL 1OCWH 1I9RL 3D48R 3HE7C 4KJWC 3ZKMD 2R9HD 3ALPA 1R5VB 1XAUA 1KBGH 1UT9A 2CMRL 1A6ZA 1FLRH 1BWWA 1MCOL 4LFHG 4UV4L 1U93A 3LDBC 4K94L 4KZEL 2JB5L 2DQIL 4NN6C 1S5HB 2D9CA 5KSVB 1BVKA 3V0AC 2PR4H 4OKVA 4PV8A 1A14H 4NKDB 4PUBL 5DHVH 1AHWB 4I4WB 3OB0K 4DEPC 3TT3L 2GSGB 5DHYB 2BNQD 2YPKA 1NKOA 3PGDA 5AYUL 3S88H 1R0AL 1SVZA 3MODH 3TO2A 3R1GH 5K9KB 3I6KA 3OF6A 1J86A 1OAKH 1YEIH 1DE4A 1V7ML 3Q6FB 4BK4A 5CP7A 5IHUH 1CXIA 4LAQL 2OR7A 3ZT6A 3GUTB 4MMZC 3OV6A 4EBQL 3BQUC 2OL3A 5DHVB 4KY1H 5LG1A 3BRGC 1T66D 3ARDB 4ZODA 4LSQH 3BIBX 2XN9A 3THML 2NY4B 1DLHB 1GVIA 2H1PH 5BXFB 4AIZA 4DCQA 3VFUA 3GMOB 4XHJC 3CK0H 5MI0B 1RK1A 3FB8A 5D9SB 5E8OA 2FECL 5KSAA 2WUCH 3FT3A 4OZIE 4FQ1H 4UDTB 1PEZA 3BAEH 1SYVA 4XPBH 3ARDD 1DQJA 1O0VA 3K80A 5D6CA 5JHDB 3T2OA 4KHXH 2NY4D 1I85A 4GRLA 5T3XL 3VMOA 1EERB 5SWSB 5IW3A 4FQ2L 4HWBL 1KXTB 4RISH 4ZSOE 3BP6A 4HMEA 1NC4B 1R3KA 2B4CL 2OX5A 3BH8B 3EYQD 3OGCA 2R0WH 1HKFA 4LVOB 2IMMA 2XG5A 4PY8J 3QZWA 4PRIB 3V4VH 3C6LB 1MWAA 4XNYL 1MJUH 3M07A 2BSRA 3K4AA 4FTVE 3TVMD 3LN4A 1IM9A 1RK0A 3GJFA 4GS7B 3MLXL 3U2SB 4DGVL 4Z0XB 3X13A 3WJJA 3TCXA 4NUGH 2VAAB 4HCRA 3WFCH 5F7EH 3V6OA 2BVOB 4G7VH 4XBEH 4EJ1C 5ID1B 4Y19B 1JYVA 4PRID 2VXSH 3EYVA 3DX8B 2AS5M 4U1MA 2YPVL 1IEAB 4KTEL 1YEGL 4X4ZA 3VW3H 3HKFA 1M05A 2DQUL 3MCLH 1J1OH 2VNCA 3WDIA 2WWMD 2Y23A 2V5YA 3D85D 5GIRB 3Q6GH 3P0VH 3MGTA 4NQCB 1AO7D 2X89A 1F5WA 5HHPA 2IQ9L 5JW4N 4UBDD 2FLBT 4PGZA 1A1OA 1YEFL 1XF4A 3BJ91 4HUVB 3KPNA 4MAYB 4JM2F 2XI9A 4JY4B 4O9HH 5AUMB 4N0FA 1T83C 2HYMA 5K9JL 1QPXA 5KVEH 4FABL 5KTEH 4OSUH 1CFTB 1M7DB 3HUJE 3RBSA 4JKPH 5CEZD 1YEDB 4WHDA 3EOBA 1SYSA 3QUYD 1NFIA 3GHEH 4YDLC 5DA4A 4L3EA 3C60C 4LKCA 2DQHH 1AE6H 4OZ4B 5HYQA 3EDEA 1XGUA 2VZSA 1GGYA 4OD3H 3DYOA 4K7FB 1S7XA 2AEQL 3MR9B 3VA6A 3D5OF 5DFVD 3NZHL 4KU1A 1T20A 2YRPA 5E94B 3PIQA 4MJ6A 2B1HL 5CZXD 1U8KB 1KCSH 1VCAA 3BP5B 1G6RH 2DMBA 2IQAB 2N1KA 4EDXA 3KPLA 1YUHA 2IGFH 3DXAE 1WLHA 3BOVA 3C5JB 4S11A 5KVMC 4UU9B 4QRPB 3GMNB 5E6ZA 5MP6H 1R5VA 3T0VA 3LPGA 3OR7A 3R4DA 4C55A 1I1AD 1AXSB 1CDCA 2EIZB 2DIBA 3U30B 3FN3A 1FVEB 4BH8B 2JJVA 3DVIA 4U1GB 1ERNA 1S5HA 3FHAA 5E5RB 5KSVA 2VYRE 3X3FH 2BXYA 3KYKH 2HTLD 5D71L 3W2DL 2F58L 4NKDA 3W5MA 1AHWA 1TZGH 2XIDA 1SJXA 2BVPB 3MRHB 3VWKB 3CFEB 4MCYB 2ITCB 3RIFK 1KCLA 1DBBL 3D25A 5T1LD 1UWGL 1WWBX 3DETD 5IEKB 2XZQL 2CDEB 4PGEB 1RY7B 3KPTA 3IU3B 4MWFB 4YPGB 5JW3L 1MPAL 4JFHD 3OJVC 4KJPD 3TCLB 5F3HB 1IAIM 1FNGB 1FL5A 2VDQH 4U0RC 1MY5A 3WXWL 3V5DB 3VWKD 3D6GA 4Q6YA 3EYSL 1IJ9A 5DHVA 3EBAA 5KSAC 3ARDA 5F89B 2OCFD 1KTKE 4OM0H 1DLHA 4TSCH 4M6AA 4K8RC 2VC2L 3U79A 4ONFH 1X7QB 5BXFA 4GRLC 1I85C 4P59L 2MMXA 3MNZB 3GMOA 1BECA 5I19H 4HV8B 1EMTH 4UDTA 3RL1B 4Z7VF 3FB5B 4GSDH 4DUWA 1JHKL 3MYJB 3O0RL 4TYUA 1U8HB 3OKLB 5JHDA 1V8HA 1XF5B 3OAUL 1JPSH 1RJCA 4PJCB 5TE6L 3OKKB 3ROLB 4O02H 4M7KL 3TVMA 1T4KA 1IILE 3NCJH 5A40E 1FAIH 1FSKC 2R4SH 4GJTB 5B38A 4YUEH 5ALCH 1NC4A 1R5IB 4KRPD 3BH8A 4BZ2L 3O4OB 3WJJC 1JYNA 1WITA 4PRIA 2B20A 5HVFB 3VDBA 3V6OC 3TPUA 3MRNB 1ZSDB 4M61A 4BQ6A 4FQIL 3C9NB 5TH2B 35C8H 3U2SA 1T7WA 4OLUH 4TNWK 5CJ5A 4MLSA 2EXYC 3B2UD 4PJDB 5EC1B 5FYJL 2VAAA 5CD5C 3PWPB 3BI9X 1T5XB 2JIXD 1HE7A 5ID1A 1BEYH 4LCUB 3DX8A 3N9GH 3LEXA 5GRWA 2BRQA 4JFDB 4OD1H 1IEAA 5IHBA 3VXME 2DQTH 3NIGE 1OOAA 5EPMB 2GT9B 2A73A 3AFLA 5ETUB 3O2DA 2ZSVB 3WDHA 1TVBB 2VISB 5GIRA 5IBUB 1WZ1L 5DJ2B 4GQ9L 1I75A 4HULB 1CE6B 4LEXL 3E8UH 4QRTB 3QEQE 4HUVA 4BELD 4P9HL 5IQ7L 5TQ0H 4MAYA 4RGNC 4JFPB 4JY4A 3UEZA 3L9RB 4CMHC 4LPVA 4P23B 2WINB 1KC5H 3HMWH 3GBLA 1NMCC 1MFDL 1GPOH 1OVZA 1CFTA 1M7DA 4HWZB 4YQXH 2YHGA 4JFEB 2X1PA 1PGRB 1YEDA 4IOSD 3NMEA 5C0CE 1R3IH 4HLZH 2F9BT 3PQYB 3ZKMC 1MRFH 4OZ4A 2NR6D 2MTPA 4K7FA 4L4VD 3MR9A 4K3DL 3NCBB 2LFGA 4XXCA 1QA9B 5JW4R 4J6RH 3SGDI 3IYLW 4OFKA 2NX5B 5E94A 2EE9A 5C6TH 3MREB 1I1AA 3PQYD 4L8SB 1YEJH 1U8KA 4XP6H 3BP5A 1XGYH 4MQXD 2IQAA 1CT8B 3ILQD 2ZJSL 3QNZA 4OLZH 2YEZB 2NY0D 2EE2A 3UTZB 1X5FA 1WWAX 3RU8L 1KSRA 1WWWX 3QXWA 3C5JA 5F1IB 4UU9A 3RUGF 3GMNA 5JDSB 4UT9L 4YZFE 1AHWC 1S78C 1AXSA 4U6XB 4LLWB 5GSVB 4QRUA 2QHLA 3AM8A 5D7SL 1BD2E 4LSRL 1FVEA 2WUBL 4Z95H 3MOAH 5EO1B 4BH8A 3CPLB 3JZ7A 5FGCB 4I18A 5JORB 2NLJB 3RVVD 2YD9A 1GAFL 2H6PB 2XXMB 3S34L 3DROB 2BVPA 1K8IA 4YXHL 4DAGH 4L8CA 3MRHA 3ULUD 3VWKA 3CFEA 4MCYA 2W0LA 3NACH 4WCYL 2ITCA 1RMFH 3CXDL 3WFHB 1NJ9B 1QO3B 1FZJA 1MUJB 4JHWH 5IEKA 3QUXB 2CDEA 4FXKA 3B4NA 4PGEA 1AC0A 4UB0L 3IU3A 2YA1A 4JREC 3T2NH 3ARDC 5GRYA 3HLAB 1DBJL 4JDTL 4LLQA 4QHNB 1JF6A 1RIVH 2C4FT 2NY4C 3TCLA 5F3HA 3D3VB 3DI3B 4JZNA 2G5BB 4WI2A 5I1JL 2WBWB 3V5DA 1QFPA 1J12A 4U1IB 4Y4HD 2AJYL 3TESA 4G8GD 5MI0C 1A7BA 4JPVL 3W9EB 5F89A 3EYQC 3B5HA 4LHJB 3HRPA 2FH8A 5HGHB 1X7QA 2C3WA 3RTQB 4M5YL 4PJ7B 5D7KE 3MNZA 2D7NA 2HTKD 1J0YA 1WIUA 3TVMC 4E5XA 4HV8A 3RL1A 1NC2B 1LO2H 1NGYB 3MYJA 3GRWL 5C0IB 3OKLA 3GK8H 2FEEL 3F7PC 4LVOC 2ZG2A 5ACMA 1XF5A 4K2UL 5I2IB 2WSKA 1W2KT 1WQVT 3OKKA 4PJCA 4X9FA 3ROLA 4F3FB 1W0YT 3VXSB 3MLSL 5JPNB 2EKJA 1R5IA 4GS7C 5TGBB 4U2YA 2ED7A 3BIAX 5H37G 2FR4B 3I6LD 3H9SD 2WWMC 4JCMA 1Q72H 1ZSDA 4JFZH 3HCVB 5BS0E 2X42A 2DQDL 3IXTB 4KK8D 5TH2A 3VXSD 5IB5B 1BJ8A 1C1EL 5I17B 4PJDA 5F96L 5EC1A 2JELL 2XRAH 4BZ1H 3UXFA 3U4BL 2ARJA 3PWPA 1XCTB 1T5XA 3BX7C 1HHJA 3NBNA 1AQKL 3UJJL 1RZKH 4JFDA 2N7BA 3MLYL 4XGZB 4JKMA 3VXTB 3PP4H 5J57B 1F8TH 2W9DH 5H8DA 4HS6B 5E7BA 3MLTB 3GI8H 2IAND 5EPMA 4GKNB 1KUMA 2GT9A 1IGMH 4PJXE 1NEZG 2GCYB 4OGAD 3V7AG 4AL8H 2X09A 1TVBA 2VISA 2YUZA 2ZPKL 3FJTA 4OF3A 4MAYC 1JFQL 3ZSSA 3U6RB 2R0ZL 5C9JA 4P3CH 1YEKH 4NPYA 2P24B 3UJIL 2DI7A 4PJBB 4K3EH 3MRIB 1CE6A 1FGVH 4QRSB 1SEBB 4QRTA 4EN3B 3I02B 3VU2A 3RBGA 3F7VB 4OF6A 4HT1L 1C16B 3Q5YA 5A43C 3L9RA 5CEYB 4P23A 4M7JL 5CZXC 2WINA 4JLRB 2PCPB 5IOPB 1X44A 1LO4H 4XMKH 4PD4J 2GIYA 2HJFB 3CMGA 1LDPH 4L4VA 2BNRB 5FKPB 4HUWA 4NOBA 3QCVH 4HIJB 4XP4L 4F7PB 4HWZA 4L4TD 4K7PH 2C1PA 2EDWA