4QYOA

Crystal structure of anti-msp2 fv fragment (mab6d8)in complex with msp2 14-22
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
b'QVQLQQSGDELVKPGASVKLSCTVSGFNIKDDFIHWMKQRPEQGLEWIGRIDPANGYTKYAPKFQDKATMTADTSSNTAYLQLSSLASEDAAVYYCATYGVAYWGQGTLVTVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fv fragment(mAb6D8) heavy chain
publication title Structural basis for epitope masking and strain specificity of a conserved epitope in an intrinsically disordered malaria vaccine candidate.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qyoA00
2NY5L 3VI3F 1F3JB 1EERB 3QFJB 1EGJL 3VXPB 4PJFA 5H37G 5I6XC 2GTZA 1R3LB 3NCBB 4LCCB 4KH2A 3T65B 2PW1B 2YMXL 1KGCE 3MRQA 1KFAL 3VFMA 3RJDA 3D0LA 4M8VA 4BH7A 1JNHA 3MLZH 4F9LA 4UQ2A 2V2WB 2G60L 1Y18A 2HMID 2N56A 3WXWH 2Y5EA 2FDBP 2GCYB 4LEOA 5MEQA 3O9WA 4R90L 1NLBH 1XR8B 3MFFB 3BAEL 3FN3A 4Y4HD 2VL5A 3LMJH 3KPPA 4S0SD 1JGEB 1PKQE 4FQJH 5DHYB 4APQD 3D87B 2NW3A 3WEXA 1PEZA 3C09B 4U3CA 3P2TA 3O3DA 3VRJB 1G9MH 4A6YB 3TO2B 3EJJX 3CPLB 4LCIH 4CVUA 5JIHA 4U0QB 3CDGA 4JKPL 3TN0A 5T1LA 3LKQB 1HH9B 3G6AB 2WWKT 1PG7L 1NKOA 3ULVF 3WO4B 2CIKB 4TVPE 3H3KA 1RZJL 4QYOB 1XIWA 3AREC 5INCB 2R2CA 4F2MB 4K07A 4UTAH 4NJAL 5A3ID 2ICWB 3QH3A 5TGBB 5DK2B 1DL7L 4NM8L 5CGMA 1X5XA 4ZS7L 1TJIH 2UWEA 3MA9L 3NACL 1WIOA 3AU1B 2DRUA 1LO0L 2VTFA 5FYJU 3WJJC 2XWTA 3DUUB 4IIQC 4Y4FB 3SJVB 1TQCB 4M7ZB 2PYFB 3I6KB 4IOIA 3B9KD 4P5TC 4Q9BA 5E1AA 3S36X 2C5DC 3ARFC 4JM2D 2VZOA 4ZFFA 3SKJH 1T03L 5JO5A 1PD6A 4OJFL 3CVHL 2KZ1B 3MGOA 3MJ8A 5TF0A 5JZ7C 4KK8C 1YUHA 1PYWA 1OPGH 2QV2A 4HS3A 1PZ5A 2RHEA 1HHIA 4FTVA 2HVKA 3NIDE 4BSVA 2BSRA 3QEHA 3QUXC 3GBNH 5GRYA 4BH8A 3NAAH 5D7IA 5FA3B 4HIHB 2BK8A 3RVWD 2WQRA 1P84J 1KENH 1YNTA 1G9EA 5T3ZE 3OB0K 2AJSH 1IC7L 4F3FB 2NY3B 4UIKL 5MI0C 4D9QE 2GTZB 2F74B 4JG0H 5F96H 4MXWL 4FQXD 1EV2E 3D85B 3T3ME 3TT1H 3QXTA 5GGSB 4OLEA 2V9RA 4LBEB 4Y5YA 1I9EA 1TQBB 4BH7B 1JNHB 3SBWA 4UQ2B 3GSUA 1E27A 4L9LB 3RNQB 3BGFC 4Z77B 1KCUL 3SDDA 3O9WB 1LQSR 4LLDB 3VXTA 3BMVA 1FZMA 4XWOC 5E56A 1FNAA 4LLQA 2IG2H 2VL5B 4XMLL 1G9NH 2DWEA 4PR5B 2EC9U 2FBJH 1UCTA 4HK3J 2NW3B 3MLSH 2VXVL 4JFOB 4K71C 4U1JA 3DNKA 5EZLA 3ELAT 2A38A 4ODWB 4PY7A 2Q86B 3RFZC 3LY6A 3MRNA 3GDBA 5DC4B 4EQ3A 3NN8A 3TN0B 4KTEL 3NCYP 3Q3GB 4XI5C 2R1YB 1CD8A 3SDYH 1E4WH 2JJTA 1CLCA 4Z76A 4I77H 3BP5A 1E6JH 1P4LB 5HYIA 4JFZL 3L5WB 1FDLL 2QQKL 4B7LA 1KT2A 1RZGB 2F5AH 2FEEI 4V1DE 3WIFA 3FFDA 4F58L 3EBAA 1ZWIA 3QH3B 5FKPB 1FSKC 2HVJB 2X4UB 4DKEL 2UWEB 1ZHBA 4NFBA 4NWUL 3T0EA 1MOEA 4GKOA 4P23C 4L29A 2FIRT 4UV7H 2SEBB 3STLA 2P5WE 3TJEL 3RIFK 1JGDA 5C0AA 4RNRB 3HLAA 3TBWB 5E1AB 2W92A 4YHOH 1QUNA 2ADJB 1AGDB 2WBKA 3QUMA 1JK8B 5DFVC 5FDYA 1J0YA 3MGOB 1QG3A 4GRWB 1KJVB 1YUHB 1PYWB 4OZFG 2J88H 4M61B 4QWWD 4HS3B 4PGDB 5GZOC 1FNSL 4LGSB 1KLFA 5TDPB 1CE6A 5D2NC 3RZWA 2PW2A 5EIVA 3QEHB 3LD8B 3WFCL 4R96B 4BH8B 4LLWA 4L4TE 5D7IB 1YY9C 4QOKA 3KYKL 5CEYB 4P4KD 1FORL 4OD2A 3WHE1 1JF1A 4N9GA 1EEUA 1XAUA 3KPSA 5GGUA 4Y5YB 4AEIL 4XVSL 5C7XL 5BJTB 3E3QC 1E27B 3CVIH 3SKMB 3KYOB 1IILE 4I0PC 5EULV 4R2GC 4A2MA 4EXPX 4PGZA 4NZRL 1V3LA 4GXVH 4KHTL 4QGTA 5E1HB 1U8KA 1UH3A 4LLQB 5EOCH 5K59E 4RGNB 4I5BB 5IFHH 2DF3A 2YA0A 5CMAA 4XNQA 3OPZL 3GJFH 2EIEA 3CSBA 2DI8A 4JFQA 2NY4C 5F9DC 3ZDYE 3MRNB 4ODTH 4I3RL 2WMPA 3WYRA 1YQVL 3NN8B 4WFED 5D93C 3JTSB 1N3NB 1AJ7H 3GMOB 4G8GA 4P2CG 1FL6A 2NXZC 4D8PA 4IRSC 1OW0C 3P40A 4Z8FL 4OI7A 1MRFH 4EZMA 4OCWH 2RAMA 3SDCB 5JW4M 3BP5B 1LP9A 4WI2A 1HIML 5EZOH 1RZKC 1UB5B 1H0DA 1Y6NR 2BVQA 3LS4L 4LSRH 1OTUC 1HQRA 4OGYL 1ZWIB 1VFOA 2JE8A 3MACH 3VGBA 4BK4A 4G8EA 1ZHBB 1IBGH 3WIIH 3BESR 3PWLA 3V4VL 1AD9B 3OKEB 5TJWK 3V5DB 4L29B 1LD9A 3EO9L 3W9DA 4EI5C 2A6DA 4N0UA 4HMEA 4LCCC 4FQHB 5CSBA 5GGQL 4UOJA 4OF7A 1U8PA 3QPXL 5C0AB 3BD5A 3W0WA 3TESA 3HAEA 1F8TL 3HG1D 3K1DA 3N85L 4RA3A 4J3VA 5TDNA 2BOBA 4NJ9H 1P53A 4HXAH 5I1AA 1QD0A 1ES0B 5C2BH 3RY5A 4ETQA 5D4QA 2OCFD 3RAJL 1OB1B 2FB4H 5ACMA 3GIZL 2NY5H 1CE6B 2PW2B 5D6DA 2Z8WC 4K7FA 4U1KA 1EGJH 5I1HH 1IGJA 3ARDD 4WUKL 4PJIF 3C09C 5D1QD 4HS8L 1RUPL 5IBTL 5E9DE 4GFTB 2BVEA 2ZNWA 3V79C 2NX5D 3REVA 5MEPB 5I0DA 4TUOB 1HH6A 2YMXH 4X4XB 2VAAA 4BQ8A 1JF1B 1ZLVK 3WBDA 1I7ZB 1G7PA 4N5EC 4YGVB 1AY1L 2G60H 3WO4C 1MLBB 5DJ0B 5GGUB 5KANI 5ECJE 1ZT1A 1ZGLA 1NGYA 1XZ0B 4R90H 3ILPA 1T7WA 3BAEH 5D96C 4XCNA 4HUMB 2AXFA 1CT8B 1MFCL 1U8KB 3KJ4C 5CGYD 1UGNA 2JJWA 5I9QB 5DQ9A 1RSFA 2VOTA 3KS0J 5DURB 3SE8L 2NR6D 3S36L 3VWKA 5IB1A 4JKPH 5CZVL 1VFMA 5AEAA 1A2YA 3VXSB 4RFNB 3TJHD 1N59B 1KUMA 1PG7H 4G8GB 4D8PB 5BVJB 1UWGH 2NY1D 4EJ1C 4DUXA 1RZJH 4XC1L 3SQOL 4J3OC 3DRTB 4NJAH 1IGML 4EUPH 4JFHD 1DL7H 4NM8H 4K7PY 3G5XB 4ZS7H 1CICD 3MA9H 3NACH 3TBTB 2CUHA 3WDHA 3HC3H 4G8EB 4LCWE 4Y2DB 3R1GL 5DRWA 5GSVA 5DF0A 4OM0L 2CDFA 2X4OA 1LO0H 2HT3C 3PWLB 2WWMD 2XY2A 3K0WA 3WKML 2NY3C 5I30L 1LD9B 5D5ME 2D0FA 2P43B 4JKLA 3W9DB 4YHLL 4N0UB 1X5YA 4PRNA 3TNMA 3WNOA 1UB6B 3QBTB 3QXUA 5IKCA 5J06A 1U8PB 2LFGA 5DK0A 4X8JB 1TQBC 3HAEB 3HI5L 1T03H 3UPAA 4OJFH 2LU4A 3CVHH 5IFJA 4NBZB 4L9LC 5D7JA 5I1AB 4GKZA 3O9WC 5JNYA 5IVXA 3FT2A 3QG7L 2AV7A 3UP1A 5J1TC 1U58B 4OZGA 1U8OB 2XWJB 3DX8A 1ZEAL 3BJ91 1WZ1L 1BM3L 4U1KB 2B39A 5E24E 1NBZA 4KZEL 4DN4L 4NQDD 3QEQA 5E94A 4Y7MA 1S7WA 1HDMB 4UIKH 3QSKB 2E6QA 2EXYD 5JHLL 4MXWH 2DQCL 1QSEE 3BXNA 5KS9A 1XGUB 3TN0C 5HHME 1HH6B 3DMMA 1G7PB 1HI6A 1LEKA 4LGRB 3O6KL 4U6HA 4ZXBD 2H2PC 3K80A 4YJZL 5HVHB 1GOGA 1XIWC 4Y16B 5E00A 4JZNB 1OP3K 4XCNB 4XMLH 5I18L 4G6AD 5I17A 5HYSB 4OKDA 3LEYL 2VZVA 1CK0L 1EAPB 2VXVH 4P2QE 3L3GB 1C5BL 1MREL 1FG9C 4XHQA 1FC1A 4JHZA 1CIDA 2VYRE 4KTEH 4G9FD 1CDGA 3CUPA 1NJ9B 4QXTB 1A2YB 5HYEA 5KAQF 4Q9CA 4XNYL 4AG4L 5JR1L 3TEUA 5HI4D 3RBSA 1LE9B 1DQDL 2A0LD 2XY1A 3OAZK 4AH2A 4JFZH 1FDLH 2QQKH 3MREB 3LZFL 4F58H 2QBWA 4AIZB 4NO5A 3MRBB 2G5BA 4JO2H 4Z0BL 3B6SB 1K9TA 4DKEH 3DHJA 1DEDA 4ZFOL 4L5FL 1D9KA 1D5BB 4NWUH 4PJCA 4DTGL 3BGMA 5DRWB 5GSVB 4APQA 4BQ9A 4E41D 2X4OB 2EIZA 3CLFL 1BOYA 3VXNA 1I8IA 2APVA 4BA8A 3TJEH 4OF6A 4PRNB 4R7DA 3T77B 3OAYH 2VN7A 2WLZA 1W8OA 3QUKA 5DJCA 4Y5YC 4B41A 4N0RA 3L7EA 3V8CA 3WDIA 3EJZD 4G8IA 3SDDC 4G3YL 5C6WH 2F53E 2AV7B 4YFEA 4OGZA 4NQSB 1CL7I 1FNSH 4U1NB 5LGJB 2WIMA 2HJKB 3ARGD 3WFCH 3KPLA 3QA3A 1UZ6E 2I27N 2EEAA 4Q0XL 3AS0A 4X6DE 2LTQB 4HC1A 1JWMA 1NBZB 3KYKH 5E94B 1X6NA 2ICEA 2YPLB 3V7MA 1FORH 4EEEA 4ZSOE 5DXWA 4XWGL 1FFQA 1MCPL 2NY7L 4LSQL 5KS9B 3PL6D 2D2OA 2VO5A 3UAJC 1S5HA 4X6BA 1FL3B 4XVSH 3DMMB 1LEKB 3B9KA 4FQ2L 3ARTA 3K8MA 4NFCA 3EDJA 2JJTC 4U6HB 3WNPA 2H9GA 1H5BB 4JM2A 2WNGA 1XGTB 3BIBX 3VFTB 4NZRH 1MF2L 1UKTA 4KHTH 4HWEL 5TE7L 3GUTB 2UWEF 4YHNB 4Y4KA 5CP3A 4CNIA 5L6YL 1RI8A 4LAJH 1XF4A 2XTJE 1SHMA 3ILQD 3OPZH 4PJXB 4KK5D 4M1CD 3F7PC 1X3DA 3HE6B 4J3WA 4PJFE 1A9BB 5T5FL 4I3RH 4LIQE 1YQVH 2EE9A 4M6NH 3VI4F 4FQXA 1NFDA 4Z8FH 4RMWA 4GRWF 1T04A 1FYTE 4P4RB 1HIMH 2NTFB 2AXGA 1I7TA 4WO4B 3LS4H 1FFOA 2CR3A 3GB7B 2ESVB 4LDOB 4JY6A 4OGYH 4RFOL 2FATL 5D7IF 1ZSDB 3U83A 4ZQKB 3ME0A 1LVEA 4U1LB 3DUSA 3L95A 3KPQA 4MVBC 1D9KB 2DOCA 3IRPX 2V9QA 3BGMB 3V4VH 2EYTB 1KLGA 2GJZA 2GW5A 2Q1EA 3EO9H 3VXNB 5ALCH 1I8IB 2QSQA 1NDMB 1YN6B 3MV9D 3PQYE 5GGQH 4HLZH 4HEME 3QPXH 3QIWD 4MX7A 2VLKD 1MQKL 4EUPG 2YOCA 1HKLL 2L7JA 4JDTH 1F8TH 3QUKB 3O6FA 5T3XD 5EN2B 3N85H 2QJDA 3DX7A 5JPNA 3L7EB 5HYJB 3BQUA 4G8IB 5DD1L 1WICA 3RAJH 3VXRE 5E2VL 4I48A 3GIZH 3CXHK 2W0LA 4UAOC 2IFFL 5EU4B 2EE2A 3UTZA 5I9QC 3ET9F 4WUKH 1JF6A 8CGTA 3VMOA 4WFFD 2YEZA 4HS8H 1T1XA 1YMME 1RUPH 4X99A 4YDJB 5IBTH 3I3EA 2X70B 1ND0A 3I3DA 4LRIA 2O26U 5DC0A 5GS1A 4O58L 3TIDB 4Y5XA 2DL9A 2ZOKA 4L3ED 4RFNC 3RX8A 1FAIL 2X89D 1AY1H 2BNRD 1S5HB 2B0SL 2OSLA 3MRHB 1BIIB 4PP2A 5IB3A 1HSAA 4ZNCD 3VFRA 3G5YB 1KELL 1S7TA 5BRZB 1MHCB 1JFQL 2D4DA 3JBG7 2UYLA 1MFCH 4PP1C 5F7EL 4DCQB 3ZYOA 2GY7B 4Y4KB 3KLSA 2A6KB 2A83B 1MJJB 4XGZA 5FCUL 5CD5D 2ZPKL 4Y2DC 3SE8H 4J8RA 3S36H 1CXKA 1EZVX 2BJML 1A7PL 3FRUB 1LILA 4Y1AB 2YPVL 2L4OA 5CZVH 1GL4B 3B2VL 1N5YH 5HYFA 2EH7L 4P4KA 4K8RD 2J8UA 4FXGB 4GS7B 5CIPH 3ISWA 4FQXB 5KN5A 4TPRL 1T04B 2JELL 4XC1H 3SQOH 2AXGB 4OB5L 1I7TB 1I1FA 1IGMH 4JY6B 5AAWA 5MENB 1GGBL 5MERA 1KIPA 4KQ4L 4N0FA 1JPTL 5JXEC 5D6DC 1E4KA 1A1NB 3L95B 3R1GH 5AG8A 4OM0H 5E6ID 3IDIA 3WKMH 3KPRE 5CINL 3HMXL 3V52L 5I30H 2QSCL 2GJZB 4YHLH 3VFNA 4HF5L 1XGYL 1NEUA 35C8L 3LB6D 4L4VB 3DBXB 2VLRA 3JWOC 1BD2B 3HI5H 1TITA 3SKNB 4PGCB 1J8HE 1GAFL 4OFDA 3O6FB 5JQHC 1MCHA 2AI0L 1HYSC 3DX7B 2DLEA 5HVHC 5IMOA 5JPNB 3QG7H 3BQUB 3FQRA 1UEMA 3C9NA 1OGAD 4Y16C 1I4FA 5IW6B 1CFTB 3M1BB 1D3CA 1JZ8A 2H2SC 1WZ1H 1BM3H 2CR6A 2PF6A 4NN6B 3HPLB 1W0WB 5SWQA 1FNFA 4ZD3L 4KZEH 1WAAA 2YEZB 3T0EE 5JHLH 4X99B 2DQCH 3VWKC 2C3GA 3TNNA 1S5IL 4N0YL 2P49B 4J4PD 3QB7C 5I74B 1OVZA 3D39A 3O6KH 1L6XA 2OSLB 3T08A 1XGRB 5HGHA 5IB3B 1FVDA 3HG1A 1FVCA 4JRYD 3V7AG 4ISVA 1CI5A 1D5MB 4XNXL 2BSED 2CXGA 3OKNA 5I18H 1KCRL 2UYLB 3LEYH 4MNHA 1CK0H 2LABA 2WWKO 2HFGL 4XGZB 1C16B 3ULUE 3CMOL 1C5BH 1MREH 5FF6B 4J8RB 2VDPH 1U92A 4Q74A 1BF8A 3TA3B 4QOKE 3ARDA 3QNZA 1XF5A 4NP4L 4PYHA 2M8XA 4Z7OF 1Z9LA 1H9VA 3RI5F 4MNGA 4NKMB 3T4YA 4Z5RB 4XNYH 4AG4H 3QJHB 3C8KA 4QXUL 2ICWI 2NX5A 5JR1H 2HLFC 2AJZA 1KOAA 4QHLA 5CZKA 1DQDH 4LNVA 3KPSE 4LPWA 2AV1A 3ARVA 3TCLB 4GXUM 3LZFH 1ED3A 4ERSL 3GMNA 1IGTA 5EU7E 1G6RL 4Z0BH 1S9XA 1XF1A 5MERB 4TVSa 4L5FH 3ZLQC 4OGAD 3NZ8B 1FJ1B 4DTGH 3RGHA 1GOHA 2LTQC 2XFXA 3EUUA 3TVMD 3U48A 2FEDC 4PGJA 3VFNB 1DN2A 5E2WL 4R97B 5D1XD 1I8MA 1XT5A 3PP3H 4WU5A 2VLRB 3UTTD 2XIDA 1PX3A 5J57B 5E95B 5EO1A 2DLHA 3DMMC 3Q48A 2FLRT 1QLEL 5HHOB 2EDKA 5JOPE 1QSFE 1ITBB 4UI2A 1LP9E 1BJMA 2V7HA 1I4FB 4ENED 3D9AH 4PV8A 4HLZG 1JYWA 4Q0XH 5F7KC 1JGVL 2FR4B 2XZZA 1VCAA 4WEUD 4YLQT 4MJIB 3DYPA 3HZMA 3HNVL 3HE6C 4PB9L 1HK6A 2BERA 4S2SB 2WIIA 4XWGH 1MCPH 2NY7H 4LSQH 2Y36L 1F6LL 3ALXA 5D7LE 3TNNB 3T3PF 4XPGL 3MMEB 2ZG3A 3TYFA 3L7FB 4FQ2H 1R5VB 3D39B 4PJGA 4JB9L 3W0WE 1WFNA 2D7NA 2EDXA 1MJ7H 4CJ0A 1FVDB 1NCCL 2H6PA 1MF2H 1KLUA 1XH3A 2Y5TB 1EZVY 4B0MM 4WFHE 3GHBL 5TE7H 4HWEH 2HMIC 3X11A 4ISVB 5ETUB 2HTLC 5FKAB 5F7MC 3OKNB 4FZ8H 4RSVA 5L6YH 3PWPA 3CC5A 5CEZD 2FL5B 2X40A 1KB5A 5CD3A 3WXVL 1A4KB 4KVNL 3MOBL 1D9KC 1VHPA 3G5ZA 5DEGB 3QQNA 1U92B 4TSBH 1CXEA 1EIBA 3QDGE 5EC2A 5T5FH 3D25A 3RHWK 1ZK9A 4IS6A 3U82B 3QNZB 1XF5B 4NQDA 4PJAE 4YPJA 2FEEL 1G7LA 2MPAL 5SWSB 4OUOA 3T4YB 2ZSWA 1NUFA 1LNUA 2AJZB 2B4CL 5A16A 1RD6A 3EOBB 2DD8L 3OKLA 4QEGA 4WTZG 4XPAL 4CVZB 4U3XA 5H35A 1YECL 3GFUA 3EKCA 4Z6AT 2BVTA 4ZXBA 1NFKA 2VSDA 2VABA 1OGTA 4YXHL 2NLJB 1F90L 4YDKL 3EYFA 4YE4L 4N8VA 2XKUA 3WFZA 4S10A 5DSCB 2KPNA 5A3IC 2YA1A 1OWWA 3PWJA 3LKOA 4XPHL 1BFTA 4JPIB 4QXWA 5KS9F 1WQVT 5FHBL 1X5HA 4X6EB 4UIMB 4JFXA 3FT4B 1OM3L 4FMFA 2P4AB 3H7LA 4B7IA 3JV6A 1MJ8L 1MQKH 1I8MB 1HKLH 3KHQA 4LKXA 4WU5B 2EEDA 4M7LL 2F9BT 1AGCA 3BDXA 4GW5A 3H9YA 1JMXA 3O41B 3ZHDA 1B90A 4BZ2L 3FONA 2Z93A 4JN2B 2NY1B 2W60A 4JM2C 5DD1H 1MFBL 3FAXA 4Z7VA 2BSSA 1VB9A 5E2VH 3U0TA 3LHPL 5TQ2L 2V5SA 1ORSA 2IFFH 4PJXF 4Y4KC 3MV8B 4ZUWB 1L6ZA 2AK4D 2XYCA 4PJ5D 4M4PA 3FO2A 5EOQL 1OAUL 3RWHB 4WUUE 3NCFB 2I60L 1R3HB 1G6VK 1OAYL 3ARBD 5FOJA 3MLTA 2WIIB 4O58H 4FG6D 5GIRB 4GS7C 1QVOA 1FAIH 5FYKD 1W72L 2B0SH 4FQXC 3IFPA 3WDJA 4XB8A 3TYFB 3FB7A 5KG9B 5D1ZD 4PJGB 3QDMD 6FABL 3S4SA 4XX1E 2CO6B 1XH3B 2B5IB 1BZ7B 1JFQH 1QR4A 3B5TA 4PJCF 3UYRL 3X11B 5F7EH 5IVXE 1D5XB 3GKZA 4KQ3L 1NCDL 4GAYA 5C0CD 3PWPB 4OZGE 1KB5B 4AK1A 5IHBA 5FCUH 5GS2D 2VUYA 3ARGA 1YY8B 2CK0L 2BJMH 1A7PH 1CFQA 2YPVH 3IXAB 4PJDA 3QEQE 3D25B 2Z31D 3B2VH 2EH7H 4KK9D 3R0MA 1G7LB 4MDJA 1LEIA 4WEMB 1J0IA 2AEPL 1KV3A 1LNUB 2VLJB 3PL6A 4TPRH 3O6FC 5A16B 2JELH 1N8ZA 2VUOA 3OKLB 3SCMB 1FP5A 4OB5H 4KROD 5H35B 5GS0C 1WFOA 3BQUC 3ROLB 1BQHG 3OAUL 3OSKA 4K3GA 3TC9A 1OGTB 5JMRA 1GGBH 2A1WL 2YXMA 2CJUL 4JFDD 3HS0A 4KQ4H 1IARB 1JPTH 4I4WA 4N8VB 5I1IL 5B38A 4NN6C 2DTSA 3CFEA 5L7XL 4IDJL 3MRPA 3HMXH 5CINH 5BZWA 2QSCH 3V52H 2FD6L 1JF5A 4JHWL 4HF5H 1XGYH 3CSPA 35C8H 4JFXB 5DD5L 3GSNA 4P57A 4PRPB 5FYLL 2WUBL 3JV6B 2FSEA 4P2RD 2EYRB 5CZXD 5GS1C 4KJYA 4I18B 5HDQL 4JM2F 4TUJA 2JJVA 1YEJL 4BQCA 1GAFH 3JV4A 5I74C 1UACL 2E9IA 5F21B 4BJLA 4K3EL 1AGCB 3L5JA 4GW5B 3B5HA 3HMWL 1DN0A 2Z93B 3DVNB 2W60B 3GSWA 4I2XE 5ALBL 2CUMA 2FBOJ 4Z7VB 4RBPH 1RULL 3U0TB 3S96B 1JUFA 1ORSB 3O3UN 2W07A 4QWWC 3LQAC 2QL1A 3WN5A 1CBVL 1KIQB 5ENWA 4CDHA 1YJDL 4KI5D 5I2IA 4Z7NE 5DMGC 5GRUL 1U8LA 3MLTB 1S5IH 4N0YH 4G9DB 3MV9A 4EI6A 1QEWB 2AP2A 3BKJH 4BFBD 3IFPB 3QIWA 1P7KB 4ZPVA 2VLKA 3FB7B 3VFSA 4OF0A 3DUHA 3JTTA 4NHUB 1HXMA 3P11L 1JWUB 4M1DL 3MLYL 4XNXH 1XF3A 1KCRH 5DK3A 3UBXA 2EKSA 4F7TB 4RQQA 3DSFL 4GAYB 2HFGH 4ZO7A 4OZHA 3CMOH 4JFFB 1IQDA 1TNNA 2OI9B 4M3JA 1JI2A 4N8CH 4C83A 2NZIA 1P1ZA 5J13B 4NP4H 4QT5B 4ZOEA 4R97C 3RRQA 3BX7C 4UU9A 1ZOXA 3X13A 4QXUH 3LKRB 5FAAA 5DMYA 3IRZA 4L3EA 1N8ZB 1LEGA 2X89A 3O0RL 3NBNA 1B0GA 4YNYA 4JQIL 3B8SA 2Q87A 1CN4A 1OP9A 1G6RH 2AK1H 3NA4A 2ADIA 1HN1A 1FN4A 3ULVL 3RPIA 1BREA 1I1CA 4JCMA 2R2HB 2BNQA 5B38B 5EO0A 3DXAB 5EC1A 3RVTD 1EBAA 2R56L 4D0BA 3O2DA 2CMRH 3MRPB 5GGVY 5BZWB 3RL2B 1ZHLB 2FECI 5E2WH 3IB4A 3MYJB 2FSEB 4FP8L 2JK5A 3S97C 4M7KL 3B83A 5IG7A 1Z5LA 4TUJB 4OCXL 1DZBA 1ZGLP 4CL7A 2ED8A 3L3OA 4MJ5A 1QLEH 1NFDE 3CNKA 4P5MB 1CD1A 1JYXA 4OD3L 1L0XA 3DV4A 3U2SA 3MLUL 4G6FB 4NQEB 2C3WA 2C3XA 1YYLL 4NO0D 3GK8L 2ZOLB 1F11A 1JUFB 4LDLB 1JGVH 4JHBA 3T0BA 4GW1A 3QIBD 5DJDA 4NO3B 5I2IB 5B3NA 4Y8AA 3EO1B 5FECB 3P77A 4MHHG 1U8LB 3ARDC 1Z0NA 5E6IA 2Y36H 5GRWA 5KVEL 3RHWF 4RRPG 4XPGH 2MHAB 4BUGA 5ITBL 3VE0B 5B39A 1F6AA 4U1MA 4JB9H 2A6IA 2DLIA 4WI5A 3BWUC 4ZPVB 3VFSB 2J12B 1AXSA 3H9SD 3JTTB 1NCCH 3RKPA 1K5NA 4HMDA 2VLMD 1X4XA 4OIBA 3UBXB 3VU2A 4AMKL 2AJ3A 1OGAA 4HUWA 4ORGB 5C8JA 3WXVH 5HI5C 3IFOB 4KVNH 1FQ9C 3MOBH 2CDEA 4POYA 1JHKL 2BOCB 2CRYA 1NCAL 4HMCA 3X17A 1RY7B 1CD9B 5L8KB 3CX5J 2B1AL 1HOCA 3ORJA 3AXLA 2NR6C 3MUZ1 3UROR 3VXME 1VFBB 3X13B 1GCFA 3OKOB 5C92A 2B4CH 5HHQB 1FV1B 2Z35A 5E4EB 1CGVA 2DD8H 4XPAH 3U7YL 3H3PL 4QRPE 4YNYB 1YECH 4LGPB 2NY1C 2EDJA 1JJUA 3OXSA 4YXHH 3MV7E 1KXTB 5SX4I 4AEHL 1F90H 4YDKH 2J8HA 4YE4H 4JRYA 5HGBA 4WY7L 3OGCA 2VR5A 1WAAF 3BDYL 2BNQB 3PV7A 3IVKA 4XPHH 5C0ND 5H94A 4PJ7E 2F54D 3RL1A 5D8JL 1U42A 5FHBH 5EU3A 1FAKT 5BQ7A 3MJ7A 5DJXA 1OM3H 4JVWA 3ARSA 3IJHA 4WWKD 1U8QB 2IC2A 1NAKL 1I9IL 1MJ8H 2DTMH 2WWMC 3QUZB 3K8KA 2CO7B 5IHLB 3IDJB 4M7LH 5IG7B 1KNOA 5F1KC 1Z5LB 2CDGA 5SWZD 5ID1A 4ODXA 1MY5A 4BZ2H 3Q6FA 5TFSL 1CD1B 1MFBH 3DV4B 3U2SB 5KVDL 4CN1A 3HZKA 4X8XA 2A77L 3IS0X 3LHPH 5TQ2H 1E28B 5F7YC 2J7LA 4CMHB 2CKBA 1F11B 1JVKA 3QULB 1QLFA 3AMKA 1N7ML 2YZ1A 5GZNC 5EOQH 1OAUH 3OKMA 3QO1B 2I60H 3VGDA 5JOEA 1A6AB 3P77B 1OSZA 4KKCC 4LPCA 3TVMA 4JRXE 4U1GB 5H2BB 3PF2A 1MSPA 3BUTA 1OOAA 1W72H 3PWVA 3HI1A 1ETZA 3G04A 3NIGF 5D1XA 4TSAL 1F6AB 2AW2A 5CJBA 4LKCA 1Q8MA 5I16A 5DS8A 4KJWD 3UTTA 3Q5YA 4WFEE 4CDGC 6FABH 1T89A 3SCMC 1OP5H 4LOUC 4DQOL 4U33A 5GGRA 4RAVA 4Y2OA 5J11B 5DYOA 3UYRH 4KQ3H 1XCTB 1NCDH 3K4DA 1C12B 1SJVA 5E8PA 5C8JB 1I7RA 4JO3L 4ZO6A 1B88A 4CAGA 4MZ3A 3F58L 1X5LA 3HE7B 1VEPA 3P9MA 4G6AC 5TDOA 4KGLA 2CK0H 3NIFE 2DYPD 2EECA 2R2BA 5IB2A 1RIHL 4ZUTA 5L8LB 1R6VA 2OTUA 4L8SB 3H8NA 1HOCB 3AXLB 1QBBA 3JUYA 1FO0L 4HGWA 1OAXL 2AEQL 5IEKA 2AEPH 4I18C 3X3GL 1AKJB 3OTTA 4OLYL 5EBMA 4X9FA 3UPCA 2HFEA 3DYOA 2R8SL 2V2TA 1BLNA 1MAJA 2KDGA 2X4TA 3OAUH 4Y8DC 3SHSA 3HG1E 2A0LC 4XB7A 2A1WH 1JYVA 5HGBB 5I1IH 2OLDA 1EBPA 5HYQB 1P2CA 5L7XH 2BXZA 3IVKB 4IDJH 3MSPA 3PP4L 2FD6H 5FYJE 4JHWH 4XP5L 5F93C 4M6OL 5DD5H 5DJXB 3UMTA 5FYLH 2WUBH 1T20B 3W39B 4PJGF 1BEYL 1WBXA 1BJ1H 5EBWB 2D7OA 1KGCD 5HDQH 4DZBB 4NCDA 4HJ0C 5IT2L 4NYLA 4EKXA 1MWAL 1YEJH 3D18B 5ITFA 3SPVA 1ZLSL 1UACH 4MNGE 5F3HA 4K3EH 1KNOB 4LSVL 3HMWH 2NX5E 1UXWA 1WWBX 1NFIA 4NKDB 1V3KA 3GSOA 5ALBH 4I9WD 3CU1A 1RULH 1QRKA 3HZKB 5CHNB 2BFVL 1AGFA 2CKBB 3MRMA 1HXYB 4XVUD 1CBVH 1PVHA 1YJDH 3OKMB 4O9HL 2OI9C 4HX1A 5GRUH 4HXBL 1LWRA 5EPMB 4NQCD 5J13C 2APBA 2ATPB 1IAMA 1OSZB 3ZKND 1X5FA 4CJ1A 3TVMB 4DJMA 4DUWA 3GM8A 3N1FC 5HD8D 2J4WL 3BT2L 3IAGC 1HWHB 2X9XA 2DQTL 1ZA3A 1ETZB 4XBPB 5EZJA 3PL6C 2IQAA 3QFJE 4L1DA 4LP4A 1C08A 3QZWG 5DS8B 1OHQA 3UJIH 3AM8A 3P11H 3VD3A 1QP1A 3CDYA 3KLHD 4HKBA 4M1DH 3MLYH 5GGRB 4RAVB 5FYJL 2CK2A 4M9OA 5DYOB 5GRVL 3VWJA 4KZDL 1MI5B 1URLA 5C0DB 1I1AB 1Q94A 3U36B 3DSFH 4UNUA 2HH0L 2OM5A 1I7RB 4ZTOL 5CAYB 3R06A 4MQXD 2BC4A 2I07A 3R0NA 3TBYA 1SYSA 1DP0A 2R2BB 4PGBB 3HPJA 5IB2B 3QJFA 3MROA 3C5ZA 3HN3A 4RGOL 5EUKA 3VGAB 3MCKB 2NY2B 2DQFA 1A3LL 1KYOK 4M1CC 1ZT4B 2O5ZL 3ARBA 1ZS8A 3QNXB 3MRDA 3SGJA 4I1NB 3W9EB 3S98A 4KU1A 3O0RH 4L3CA 4X6CA 4Z7VF 4ZNEA 3HZYA 2HFEB 4JQIH 1G7JA 3VG0L 3RBGA 1C5DB 2IJ0C 1CG9B 1DUYB 5D1ZA 4GKNA 2V2TB 1T0PB 3QDMA 5T1KD 1MCSA 3TZVB 1T80A 3F7YB 4EVNA 3AGVA 1RZKL 3ULVH 2GK2A 3KYNA 1F4XL 1TZHA 5B3JF 4U1SA 1JZ6A 3A6OA 4PD4K 1P2CB 5C0CA 5JPMB 5EUOB 2R56H 4D9QD 4Z0XA 2ILLA 1MHHB 2NY0D 4XH2A 2K7PA 4FP8H 1E0OB 5FGCE 4NQDE 2Z31A 3QEUA 1SJHB 4NYLB 3EJYD 3IU3A 2H26A 3O4LD 5F1OB 5F3HB 4KV5F 1MHPL 3JV0A 3QIWC 4KDTA 4H88L 1DEEB 1WF5A 3VD9A 3MLUH 3GSOB 4OCSL 1GC1C 3F6IA 1YYLH 3GK8H 4GRLA 4PG2A 3NVQA 4MD0A 1AGFB 5DJYB 1NCWL 2ZG1A 4W6XB 2ZSVA 5K9OB 5DEFB 3VXOB 1BFVL 3EYSL 4JFDA 3KDMA 1TTUA 3SDAD 2XACC 3CX2A 4HX1B 1JGLH 1U2CA 4PJBB 4MB4A 5ACZA 1RHHB 2Y7QB 5KVEH 1FZKA 3O2VH 2WV3A 2ATKA 4KXZI 3Q2CA 3BJLA 4HFWA 5ITBH 4A6YL 4WHYH 5DZNA 4ZFZB 4HHAB 4P2RA 5I1DB 4HKXA 5JQ6L 5E4EC 1PY9A 5EZJB 4JAMB 5HDOA 4G9FE 1IL1A 2HAZA 5BS0D 4YIQA 1C08B 4YFDB 2X4SA 3I3BA 1SEQL 2BSTB 3ZDZF 4NRXA 4HKBB 1LK2A 4PRDB 3C6LB 3VWJB 2LVEA 4AMKH 5KVFL 1ZTXL 4HT1L 2Q76B 4YH6A 3VXUB 1OCWL 4ONFL 2X9WA 2EDOA 1TVHA 1LMKA 5C86A 4KDWA 3R06B 1JHKH 3OJ2C 3NFPA 5CBEB 1NCAH 2BC4B 2I07B 2W9DL 4YHIB 2ZUVA 1DJSA 3LOWA 3D0VA 4IOFD 2B1AH 2JJUA 1RZ8A 3MROB 3C5ZB 5DHVH 4P3DA 1ZHKB 3RWEB 3QUZC 4GT7A 4E41E 2FJFA 1FVEA 4Y0GA 4KUZL 3BVNA 3E6FA 1CFNA 3U7YH 2MTPA 3H3PH 4X6CB 1AQDA 5DFWH 5DMJB 1G7JB 2V5RA 4M4RA 2R69L 4H20L 4GKNB 3LPGA 1JP5A 1IGIL 4AEHH 1KCKA 3IGAB 4CMHC 4WY7H 3TYGL 5C0BD 3KYNB 3BDYH 1FL5A 1OSPL 5C07D 1TZHB 3RWJB 3WUWG 4L4TD 3L3HB 3S35X 5D8JH 1X9QA 1CDJA 3BIKA 2ERJB 3O8XD 5FM8A 1MY7A 2Y9RT 2ZUUA 4Z0XB 2R1WA 5F6IB 1GGUA 1I9IH 1NAKH 4U1GC 4PJDE 5IHZB 1MCIA 1AC6A 3QEUB 2H26B 5ICXA 3SY0B 5I8KH 1T1WA 1KULA 5ANMB 5B8CB 3P9WB 5KVDH 2A77H 3VH8A 2PO6B 1INEL 5GJTL 3C5SA 3UTSB 3LDBB 5TF1L 4GRLB 4MD0B 1H3WM 4HGKC 4MGXA 3SO3C 1N7MH 2ZSVB 4MD4B 3HE7C 3MGTB 3RTQD 5CJ5A 5ID0A 3T09A 2IBZY 1TTGA 4MXQD 3SGKA 3VI4E 5C71A 4G7YL 3RDTD 3BW9A 1JMZA 4L8SC 4QLRA 3UJTL 5KSVB 1DDHA 1NGQL 1AGEA 3QI9B 1T0NB 1NGWB 4E5XB 5GSRA 3MA7A 4HFWB 5ICZA 1KJMB 2H45A 4TSAH 4JFPA 4BZYA 1CF8L 3V9FA 3MRKA 43CAB 4DQOH 2ICES 5HY9B 3GMRB 4KMTL 5CP7B 4NRXB 1LK2B 1H3PH 4MNQB 4AIOA 1F6FB 1NDGA 1N0LA 4JO3H 2L0DA 3F58H 4HKJB 2DMBA 2OL3A 3NFPB 3S3SA 1RIHH 5FFLA 4O2FA 3U0PA 3QIBA 3PGDA 2P5ED 3S3JA 4WFGE 1RZ8B 3RU8L 1FO0H 4X5XA 1B6DA 1OAXH 2VWEE 2AEQH 3PIQA 1FVEB 4QHNA 3X3GH 1VFAA 2JB6A 3BVNB 3E6FB 4RGNE 2X44D 2R8SH 4X98A 2VLKE 4DKAA 5E2JA 4HUKB 4ETYA 4CN4A 2KQMA 3DIFA 3H9SA 1U3HA 1IGYB 4XMKL 2P8LA 1FL5B 3QCUL 5HVGB 25C8L 3F8UB 4OF8A 1AI1L 2HG5A 3PP4H 1DSFL 4XP5H 4M6OH 5E9DD 1UQSA 3GSXA 5E8NA 5F6HJ 3D3VE 1JRHL 4OKVB 1BEYH 4WFFE 3TVMC 3IAQA 5IT2H 4CUCA 5EU6D 1PSKL 4LSVH 5D1XC 3FFCD 1YMHA 2X10A 5ICXB 3DETD 4MA7L 3GJFA 4BQBA 3T8XB 2BNRE 3VH8B 2BFVH 2P46B 3H0TA 2QSVA 3C5SB 4HBCL 4FFZH 4XVJL 3L3KB 3BD4A 3QO0B 3CLEL 3GMMB 1NCNA 5E2TL 2PETA 4P5KA 4O9HH 4HXBH 3GRWA 4X80L 1TZIB 2NY2C 3BW9B 4YBLB 1A4JA 2VZ3A 1H3VA 4CW1A 1FCCA 4EOWL 1AGEB 4KMQA 1HNGA 2YUVA 1VENA 4WWKA 2J4WH 3BT2H 3O3BA 3MA7B 3TO4B 1S7UA 5ICZB 4I0KA 1SYVA 1BOGA 4JFPB 4YUEL 3C6SA 2NZ9D 4NZJA 1T6WA 2CIIA 4XPBL 3VFUA 4IRJD 4NQUA 2Z91A 3QQ3A 3QG6A 4BFIB 4KZDH 1NDGB 2HH0H 4ZTOH 3O3EA 3DECA 2BX5A 2COQA 1MCRA 3MRJA 4LCWD 1INDL 3LKSA 4QY8A 4TNVF 5J1AA 3WS6C 4WHYG 1ITCA 1FNGB 3IDNA 2OL3B 2HT4D 4QRSA 3PABA 1YEDA 4RGOH 4I3SL 3U0PB 3HI6L 1A3LH 3IXTA 3QYCA 1HHGA 2O5ZH 4M7JL 3FO0L 4YPGB 4X5XB 4JG1L 2MJWA 4PY8I 3WLWC 3REWA 2ID5A 32C2A 1VFAB 3IDUA 3PHQB 4OF5A 4NCC1 1UEYA 3VG0H 1U93A 1BHGA 4HW6A 3GMLB 1MFAL 5KSBB 4OUUA 3DIFB 1S78C 1RZKH 1U3HB 1F4XH 3DOSA 2R2EA 3OGOE 1OGAE 4QXGL 1RVFL 1P84K 3RWIA 3STBA 2HG5B 1X5IA 3ZDXE 2CUIA 2HRPH 1M7XA 1IM9D 1T1ZA 1QSED 2DYPA 2W59A 1UQSB 2V7NA 3GSXB 4OFYD 2P8PB 1QO3A 4H26A 1CQYA 3VFVA 3LPWA 1YPZA 1IM3A 1MHPH 2DKSA 5TE4L 1YMHB 2OXGA 5C0GA 4GOSA 4H88H 3OB0H 1MAML 1Z9MA 2ENSA 3AM8C 4OCSH 2XN9D 4CU8A 1UADC 5L88H 2QR0A 3C6LC 3H0TB 3VWJC 4UNTA 4WEBL 5CCKL 5JIPA 5KZCD 5FO9A 3PHOA 1NCWH 2JCCA 5LGHL 4OLWL 4XP6L 4JRYE 1BFVH 3EYSH 4P2QD 1DTUA 3E6HA 4GAGL 2QKIB 4YR6A 2APXA 4LASL 1J0JA 4PREA 1L0QA 2A6JB 3QNYB 3C5ZC 4QRUB 2DM7A 1A4JB 3ZSSA 4CW1B 4A6YH 3O3BB 4WNQB 4XC3L 4Z7QF 3T0VA 3SGJC 1U8MB 2EXWD 5JQ6H 1MPAL 1BOGB 2AJXL 3C6SB 4WW1A 2CIIB 1RIUL 1NPUA 2FNBA 4FFVD 5JA8B 3WSQL 3QXAA 1V7NL 3S35L 3PJSB 4WV1A 4HQQL 1ZTXH 4HT1H 4RMVA 5EUOF 3PE9A 1MCWM 5GGTL 2EZ0D 1NBVL 1OCWH 4ONFH 3ULSA 5BV7B 1PKQA 4R7NA 4LNRA 4R6UA 4QY8B 3LKSB 2W9DH 2EE3A 3RIAK 3IDNB 2YBRB 3CVHA 5KTEL 5DJZA 2VIRA 3T4AA 2EYSA 1N5AB 4UUJB 1YEDB 4OAWA 1UC6A 1UJ3B 4YZFE 3H7BB 3IXTB 3HHRB 1HHGB 1MCKA 4ALAL 4CADA 2XXCB 4KRMB 4IMLB 3V6FB 3MJ9A 4MCYA 3REWB 1T22A 4KK9C 2VQTA 4QNPE 3HCVA 3UYPA 4Y5VA 2VR4A 3DX6A 4KDTC 3U4BL 4XPTL 1H3GA 1DANU 2R69H 2FZ3A 4H20H 3UTTE 1IMHC 1IGIH 5DRXB 2PO6C 2UVFA 4OUUB 1WISA 3LDBC 4KROC 3TYGH 4GRLC 4HV8A 4QRRB 1RUKL 1OSPH 4PJBF 3PGCA 4LVEA 4G42A 5DZLA 5IP4A 4UTBL 2G75A 3C5JB 1U3JA 3VG9C 4L1HA 2Y07L 1T1ZB 5E8EA 5HJ3A 1ADQA 3P73A 5HHPB 2VDKH 3GJFK 1QO3B 4H26B 1EHLL 2GUOB 3RUGB 1IM3B 3IETA 5CZXC 4AT6A 2UUDH 3AS3A 4L8BB 3BPCA 4LPXA 3JWOL 4F37K 2OQJA 1MVUA 1EFXD 5AUMA 1INEH 5GJTH 1BWMA 1OTTC 8FABA 1IAKA 3MNVB 5TF1H 2QR0B 4XXDA 4W68A 2G2RB 2DI9A 4JDZA 3HUJE 3AS1A 1F3DJ 3PWUA 4U31A 5I1KL 1S9VA 1IAIH 5J3HD 3ZKXB 1OLZA 1AGBB 4YR6B 4JFED 1GPOL 3BPNB 4JY4B 2Z8VC 1H3XA 3H6JA 4PREB 4G7YH 3E8UL 3UJTH 1KIRA 5I66A 1JTPA 4PTUA 2A74B 4BUHA 5ERWA 1NGQH 3QWOA 1ZV5A 1NEZG 4X6CF 1Z6JT 4M7LT 1N0XL 1N6UA 2ZUQC 5F1NB 3WUWB 1CF8H 5DHXB 1FYTD 1TZGL 3EGSA 3RWDA 4C4KT 1WBYA 4HBQA 5ESAA 3QPQD 3O4LA 1RJYB 4FQCL 5EA0H 5E8OB 2VE6B 3D2UD 4HUUB 4KMTH 4NKIL 3MLVL 4GG8B 4PLOB 2VITA 5INDA 4WV1B 3EZJB 1JWSA 1UG9A 4GH7B 1PKQB 4R7NB 1I85A 4LNRB 1YEFL 4LSPL 3B2UD 5DI8A 4OBSA 2VIRB 5D7SL 4AM0B 4B53A 1NUNB 3ZTNL 4NO2A 1OF2B 1NC4D 3RU8H 3P30L 3PQYD 1WZMA 4QCIB 1WV7T 2L7UA 1FFRA 2XG4A 5J7CC 1FLRL 3TH4T 2IAND 3FO1B 1ZVSA 4MCYB 2A73A 3RVUC 2AJVL 3HCVB 4Y5VB 2ZCKL 3MO1A 1RK1A 1XGQA 4LLVA 3UO1L 1DBBL 4MJ4A 3RKDD 5BS0A 5GJSL 4MAYB 1P9MA 3G08A 5F7NC 4GRWH 4NIKB 4XMKH 5HDBE 1QHPA 1IC4L 3QCUH 2LAAA 3RA7L 25C8H 3N1QC 3SKUD 4G42B 3FQNA 1DSFH 1YMMD 5IB5A 2QHLA 1U3ZA 3QCTL 2AK4E 4PJ5E 1IVLA 1JRHH 5E8EB 5HJ3B 4YBLC 3RVTC 2R0ZL 5F71A 2ESVE 3P73B 4LMQI 2OX5A 2ARJA 4AENB 4ELKA 4DOHB 3TO4C 1PSKH 4ZYKB 3OR7A 4MA7H 4AT6B 1E4XI 3BPCB 3OKKB 2NXYB 1WC7A 5DQDL 4TN9A 1WT5A 4ZNEE 4GKSB 4Z78B 1LK3L 2OQJB 4G80A 1MVUB 5AUMB 1F42A 5CILH 3WO3B 3QQ9D 4HBCH 4XVJH 1ZLVH 3QDME 1UXSA 4S1DD 2FWOA 4JDZB 3CLEH 1IZKA 3PWUB 2ZNXA 3RGVD 3O4OB 2C1OA 3BKMH 1IZJA 5F9JA 4C56D 4ZAKB 1JN6B 4QF1A 2HT2C 4L4TA 5C0CE 3SKOA 1YEKL 4HJJL 4X80H 3OG6B 3GSQA 3GZKA 1P69B 3QEGL 4EOWH 5ERWB 1S9KC 3LKPB 4Q97A 1OARL 1WSST 3LQMA 4YUEH 3EGSB 3BUYA 4XPBH 1QRNB 2X4PB 4MQSB 1JE6A 3ZYZA 4G8FB 3KHOA 3PWNB 1QFWL 3GKWL 3LKNA 5CSGA 3DX9A 1U3HC 3ZSTA 3FB8A 2Y25A 5BOPA 5F7UA 1JWSB 1INDH 4WHTB 4W4NA 3TBVA 3RNKA 5BXFB 1DLHA 3SE3C 4R26L 2YD7A 4MCZB 5AAMA 3EIFA 5DI8B 1K4DA 1R3KA 4I3SH 3RTQA 1AR2A 3HI6H 4NC1C 4M7JH 4NSKA 3FO0H 1U8JA 4NWTL 3C60D 3RDTA 3CFCL 1ZVSB 1X7QA 1QKZL 1WWAX 2A73B 4YHPA 4CU7A 2H1PL 1A6UL 4AY0A 5FA4A 4P2RE 1BFOB 4BSWB 3CAFA 1FZOB 5A2LH 3CZFA 3DURA 1YNLL 5IESL 1RK1B 4PTTB 4LLVB 2JKXA 4FQQA 2YWYA 4HWUA 4WTXA 3JVGA 3RX7A 5CFHA 4V1DB 4Z95L 4M93B 3EYQC 1ORQA 1J12A 4QXGH 3WE6A 3MRRA 2R0KL 5K9KA 3EYUL 1Z9OA 4UDUA 1K2DA 4ZDHA 5F7LB 4XTRD 3ZE0E 1SY6A 1KCSH 5DGQA 1M05A 4HC1L 4KI5E 4XXCC 2P5WB 5KAQG 2ARJB 4WWKC 3D69B 3MUJA 2HJFA 4IMKC 4WTZA 1B3JA 2WP3T 3GJEB 5TE4H 4TOYH 4XAKE 1PZUB 1MAMH 1DBKL 2BVOA 4W4OA 3QRFM 5DEZA 4WEBH 4WIQA 2EE6A 1GYAA 1EAJA 1T5XB 1UXSB 4OLWH 5BV7C 4KHXL 4LHUD 2FWOB 4XP6H 1YQ2A 2PKDA 3ULUD 4GAGH 1BD2E 5C0FA 1AR1C 2X2YA 4LASH 1KC5L 3RIAF 2IALB 1ZA6B 4QF1B 1UJ3C 3WJLC 4HIIB 1MCWW 2JLLA 2LAGB 1OP3H 3BISA 1G7MA 5E9DA 3V95A 4XC3H 1MPAH 2VLLA 5CJOL 2RFXA 3V6ZB 2AJXH 5KSBF 4DFHA 1M7IB 1RIUH 2X9YA 1AIFB 3OAYK 3WSQH 3FFCA 1V7NH 1U41A 3MPCA 3S35H 2ITDB 2WK2A 3GI9H 4KJWC 1QBAA 3LKNB 4HJGA 4HQQH 4N1HB 3X12B 3DX9B 5GGTH 2IAMD 1NBVH 5FUCC 1NGPH 1H8NA 4KRPB 1PG7X 4MS8D 4U0RB 3TBVB 3RNKB 5AZEL 5KTEH 1RJZB 3OAZH 1MUJA 3ZE2E 1L9NA 3MRFB 3VXQA 4ALAH 2YC1A 4Y19D 3OXRB 4NSKB 1MLCB 5LBSL 1BF2A 5DJ6A 1U8JB 2GK0A 4F33B 4MXVE 2QADB 1S9YB 4IIQB 3VRLF 4H0GA 1X7QB 5F96L 3U7WL 4YHPB 2P7TB 4BM7A 5BZDB 2C1PB 3U4BH 4XPTH 3I85A 3DURB 3HAEH 4F37F 4KJPC 4Z7UA 3DV6A 4FN0A 1GIGL 4IRJA 1EHAA 3DROA 5ISZD 1QA9B 1RUKH 5GS0L 1EO5A 3QIUD 2QEJA 4M6ML 4YAQB 2YZ8A 4P59L 2XWBA 4I0CC 4HD9A 4PV9B 3ZKXC 2W65A 5J0BA 4UTBH 2FO4B 2AVGA 4G6JL 3SGEH 3CFIC 4LCWA 3LSOB 2Y07H 3IFLL 3MOQA 5DRNA 1FFPA 4GG6A 3MLSL 1QYGL 1U8IA 4X6FA 4WU7A 4KKLD 5D5MA 1T7XA 4PJ8B 2FRGP 1EHLH 2E8ZA 3MRGA 1NGXB 3DI2B 4XP1L 1S7XB 3JWOH 1BQHA 3KWWB 4RWYL 4ZUUA 4FXKA 1CDYA 5E2UL 4WV1C 3F7VB 3BGFB 2VL4A 5I1KH 1T7VA 3BSZL 1UYWL 2VLME 1GPOH 1SVZA 4ZPTA 3FZUC 4HWBA 2X4RB 3QDGD 5HHOE 5JW3H 2EEBA 3E8UH 3NZHL 5DLML 1VGKA 2GTWA 4IOSD 4K71B 1IM9A 2QTEA 5CWSB 5JHDD 1QSEA 1N0XH 5E9DB 3BWAA 4OFYA 3STZB 3CH8A 4N68A 4KGJA 3ZKNC 4ZFOA 1TZGH 2VDOL 2VLLB 1DQTA 2IPUG 4FQCH 1BQSA 4Y5VC 2F15A 1L7IL 4NKIH 4MJIE 1CVSC 3F5WB 3MLVH 4M9PA 1NCTA 4GBXB 3IFNL 3CFKA 4YHOL 3U4EB 4Z7WA 5EBLA 4YEFA 2XN9A 4MAYC 3VDAA 4NQXA 5L2JB 1J10A 1K4CA 2EDBA 3N9GL 2PTUA 4YX2H 2QQLL 1YEFH 4LSPH 4R3SA 5D7SH 2I25N 2FCBA 3ZTNH 5JW4R 4P2QA 4NQVB 3P0GB 3P30H 2UVEA 1SBSL 3RUGF 1ZXQA 4MAUL 3RZCB 3VXQB 2YC1B 1FLRH 1I3UA 1ZHNB 2F54E 3BH8A 4P23B 5DJ6B 2PTVA 3I02A 1R5WB 2AJVH 1JHTA 5HGDB 1YA5A 4O51A 4ZOBA 1TCRB 2R9HD 2YK1H 2ZCKH 2NXYC 1P7QB 3OKDA 3UO1H 1DBBH 2OXHA 3U9PL 2JCCF 1Q9WB 4HUXB 5GJSH 5SWZE 5K33A 5FB8A 2AQ2A 2DN7A 1IC4H 2CPCA 2W0FB 2XICA 5SWSE 3RA7H 1WUNT 2XWBB 1H3TA 2P45B 2DAVA 3GM0A 1QFHA 4ZAKC 2GT9A 3BE1L 3QCTH 5LAXA 1UKSA 4LCWB 2PXYD 4NKOA 4RZCA 3OR6A 2CLVA 1U95A 2R0ZH 2HN7A 1FFPB 3MRIA 4P46D 1U8IB 4WU7B 4PS4L 2EO9A 2DQUL 3VRIB 1Z3GL 2OJEB 4F7CA 4YBHA 5DQDH 2C7UA 5MEOA 4DGVL 4DKFL 2X1XR 1LK3H 2E6JA 4OQTA 1Z9SA 3WFHB 4JKMA 4PYGA 3TIEB 3U9UA 5FDWA 4FFWD 5EZOL 2XQYG 2HFFB 5FV1L 1I85C 2MKWA 5J8OA 1A5FL 4R0LA 1WZLA 1CLYL 1YEKH 4HJJH 4X6DA 4X83A 3EYVB 1Q38A 2GTWB 4U3HA 2APWA 4X5WA 4F9PC 1OARH 1RUML 3BWAB 3MV8E 3B3IB 1NCBH 3ESUF 5HHMB 1Y6KR 1YDPA 2YD4A 2YRLA 2EDTA 4LFHG 3W82A 4TNWK 4KFZC 1QFWH 3O6LH 1FG2A 2ICCA 3GKWH 4NJ9L 5FM5M 1EFXA 1P9MC 1K8IB 4NQXB 1NBQA 4M93C 2YHGA 5KZCB 4R26H 5J9PB 1YN7A 1EH9A 1ZLWK 4HG4J 3B4NA 3X14A 4MB3A 4NWTH 5I1HL 4F7PA 1A8JH 1A9EB 2WBJB 3CFCH 5E8DL 3BH8B 5C1MB 3RVVD 2BMKB 1WFUA 3I02B 1QKZH 4EI5B 5E03A 2H1PH 1A6UH 4MSWA 1J7VR 1XCQA 1VDGA 2ED7A 4O51B 5IMKA 1YNLH 4N9OB 1Q1JL 5IESH 1FYTA 2MCG1 1PEWA 1IAOB 1AXIB 3CSYB 3VFPB 3I2CL 2PYEE 4Z95H 4PJ9D 5FB8B 3BN9C 4I9WE 4QHMB 4WCYL 2R0KH 3EYUH 4PGEB 3VFOB 4XHJC 4ONOA 4MZ2A 4HC1H 3ULVD 4RZCB 4ZODA 3T3MF 3HAEG 5F8QC 2HN7B 2YKLL 3MRIB 1JTOA 1NC4A 2DWDA 3PQYA 3WNMA 3MUGB 4NQCE 1SEBA 5DMKA 2IANA 1QPXA 1T66D 1DBKH 5L2KD 4UBDC 2C7UB 2IADA 4I8DA 2AXJA 1UWGL 4PLJD 5JOFA 2GSGB 1I1YA 1A1OB 4KHXH 2F53B 5FDWB 3U9UB 3VXRA 3MBEA 5DUML 5D96B 4KRPC 4EIZC 4U0RC 1R24B 5CP3H 2N7AA 2MQ3A 1PW3A 4OIAA 1KC5H 1WJ3A 3KJ4B 1KB5L 1DE4A 2XTLA 4X6DB 4OLZL 2J6EA 1YMMA 4P2OB 3HC3L 4MXQC 5JTWA 5LXGL 1XGPB 2QADC 3P9LB 4RAUA 3WUZA 4ZSOB 1YEGL 2EC9T 3RDTC 5CJOH 2H32A 4X0KA 2IGFH 1OL0A 3DI3B 4LDEB 4D0DA 3BEVB 5F9AC 3O3AB 4K3JL 5HYSG 3RQ3A 1NLDL 2Z0BA 4JANA 4KDVA 4O2EB 4ELME 3JVGC 4LPUA 1IAIM 2V5YA 1BJ8A 5AZEH 3U6RB 2NNAA 1WZKA 3V0VA 4Q6IA 4F7EB 4K23L 1JIBA 3BD3A 3C08L 2XTJB 3RGVA 2EDRA 5D2LE 4C56A 2WUCL 2HKHH 4NCC2 5LBSH 2OBGA 1KIUA 4F7PB 4PJFB 4RIRA 4PJ8C 3U7WH 2BZDA 3LRGA 1XCQB 4JFFE 1L7TL 3MRQB 2WZPD 4OZIE 1FYTB 4OD1L 4W4OC 3VFMB 3D0LB 1GIGH 3O4LE 1Y18B 5E7BA 5GS0H 4JPKL 4M6MH 4ODUA 4LEOB 3RY6A 4P59H 5MEQB 2EIDA 5A2FA 4F8QA 2IH3A 4G6JH 4G6ML 3KPPB 1BVLA 3G6JE 1I3RA 3IFLH 3CK0L 1Q9OA 3ARED 3KPRA 1KPVA 1QYGH 1WCBA 3WEXB 5HTSA 4BK5A 1IEHA 2WINA 1E6OH 4GQPH 3O3DB 4V2CB 1SEBB 4XP1H 5KSAA 5DMKB 2JJSC 3CDGB 3PV6A 5T1LB 1J8HA 3DXAE 2KQNA 2XKNA 2IADB 4GBXC 4RWYH 1ERNA 2R1XA 5E2UH 3V7AE 5K59F 3WNNA 4KXZH 3QDJD 5BS0E 1TXKA 4HSQA 3MV01 3VXRB 1OD9A 3VGEA 1XIWB 3BSZH 3MBEB 1UYWH 2ARJQ 3ARFD 1YC7A 3KAAA 3BZ4A 5T33L 4JFYA 3LQAH 4R4BA 4JO2L 3ZDYF 1DE4B 3NZHH 3AS2A 5DLMH 2Y4SA 5JZ7D 4KK8D 1YMMB 3RZCC 5IVNA 4GW4A 3VXMD 4O2CA 4D9RD 4RAUB 3ZYJA 4P48A 2XWTB 2VDOH 3QUXD 4X0KB 1MEXL 4K7PX 2F19L 4D0DB 2Y6SC 4IOIB 1KACB 1L7IH 4QRPD 3BP7A 4HULB 3IFNH 3FO9A 4PRBA 3MV7D 4ZFFB 4IRJC 5JO5B 1NBYA 2G5RA 1EHXA 5F7HA 3MJ8B 3X3FL 3N9GH 3DO7A 2QQLH 2NTSP 1PZ5B 1WCQA 4LHUA 4YBQD 3V0VB 1HHIB 4FTVB 3U46A 2HVKB 1O7SA 2EC8A 5C0BE 4BSVB 2BSRB 5C07E 4KK6C 1SBSH 4ODBD 5IJVA 1G7QA 1N4XL 4MAUH 1CGXA 1SBBA 2HT4C 4KKBC 3KPNA 1GGTA 3MNZA 1KBGL 1YNTB 4D0CA 3JWNC 4HS6A 5J6GA 1HNFA 2WW8A 4TTDC 3WNLA 2PR4L 4AJ0A 4RISL 3U9PH 3CDCA 4HZLA 5D72L 2ADGA 4K2UL 4P2YA 4YDVA 4RGMC 2YRPA 3GSUB 3MXWL 1BBJA 5HI3C 4ODUB 4XI5D 3SDDB 4YXLL 3V4UL 3VXTB 1FZMB 2IAMA 4YDLC 1WBZA 5ICYA 3BE1H 5CKGA 1ODAA 1R3JA 2DWEB 5IFAL 4J1UA 5A1AA 3P4MA 1ZT7A 1Q9OB 4KAQL 3RWCA 4N0CC 1CYGA 4JRXD 3KPRB 1WCBB 4PS4H 4U1JB 2WINB 3KGRA 4MJ2A 2E3VA 5EZLB 4PY7B 2DQUH 4Y19A 3SEPA 2D31A 1NC2D 3KNBA 5HGAA 3IKCA 1Z3GH 3SDXA 5KSAB 3ROOA 3HC0A 1JCKA 1B2WL 4DGVH 3BEWA 4DKFH 4M6NL 1J8HB 2ZKHL 4DVBA 4TNWF 5SV4A 1QSFA 3V5HA 2B1HL 2R23A 4Z76B 5T3XL 4NBYB 1FGNL 5F3BA 1GC1L 4EN3A 2I9LA 2D7QA 1KT2B 2DKMA 2C4FU 3WIFB 3MLRL 3FFDB 1TPXB 3AAZA 1A5FH 2Q8BL 5CLWA 4C4KO 5E0QA 1CLYH 2B2XL 3BZ4B 4PJEA 4JFYB 1QBLL 5DFVD 5JUEL 4KJQC 3SE4C 4LMQE 1G0YR 3T0EB 3M8OL 4JREC 4GW4B 4YO0A 2WBJC 4JCLA 1RUMH 5D7LA 3STLB 5ALCL 2P5EE 3P4LA 4HH9A 1YY9D 1JGDB 4W6WB 1NKRA 1WWWX 1EX0A 3HLAB 4JDTL 4PRBB 3DVFA 1S3KL 3QUMB 4XBGA 4HWNA 2DBJA 3K4ZA 4RBPK 1WK0A 2EZ0C 5C09D 3UYOD 5FYJD 4RX4D 1LDSA 3DGGA 2CLRA 3Q5OA 5D5MF 4I0PD 2GJ6D 1P5VA 4R2GD 2FLBT 4L8CA 2Y23A 5FK9A 3QDGA 4LLWB 3FT3A 4DEPB 3KPNB 1P4BL 4QOKB 5E8DH 3TH2T 4PJAA 5M7QA 1AO7D 3MNZB 4R9HA 4D0CB 4I3GA 4HS6B 1MHEA 1S7VA 1KTLA 3EDEA 5IMMA 2Q20A 3JZ7A 4OD2B 1JHLH 1Q1JH 5FO8A 2YD8A 4N9GB 3OBAA 3KPSB 5EU6E 1MCJA 4M03A 2NY4D 3FFCE 4YDVB 3I2CH 3PXJA 4OGXL 1ZANL 2IEPA 1BBJB 4WGWB 4U6TA 4WCYH 4IRSD 5C9KA 2MFNA 1EEQA 1WBZB 5K9QI 5C08D 1E4XL 5E6YA 4FQPA 4P99A 4UAOB 3VMNA 5C70A 4P2OC 5CMAB 2YKLH 5CBAA 4XNQB 3O6ML 4JFQB 4NM4L 1S7RA 3WL9A 5HGAB 3H9HA 3QFJD 3FL7A 2X4NA 4GMSL 1X4ZA 1N5YL 1F58L 3ROOB 2X1PA 3DWTA 1FL6B 3O45A 4DVBB 5DJ2A 5DD3H 1QSFB 3V5HB 1X6LA 3GBLA 1M71A 4J3SA 4Z7UE 1AHWA 1LP9B 5F3BB 5DUMH 4HPOL 4EN3B 1H0DB 4XNZB 2I9LB 2BVQB 2RIKA 1HSBA 1HQRB 1UM6L 1KB5H 3AAZB 3WFEL 3L9RA 4NOFA 2XTJC 3K81A 2FIKA 3PHSA 4OLZH 4PY8J 4WUUA 3MLPA 3HR6A 4LRNL 4WI7A 3ZHKA 5LXGH 2PXYA 3KYAA 3MC0A 1YEGH 1JPST 4GG6E 1CD0A 4MA1B 3CH1A 2A6DB 5D7LB 4DZ8A 5C6PB 4K3JH 3H2WA 1IFHL 3R8QA 1ZGLM 1NLDH 4KVCL 3W0WB 5CJQL 1UM5L 5GGRY 1ROWA 4F9LC 4YHML 2ITCA 1AFVL 3SOBL 5TDNB 2BOBB 3V6OE 1GZPA 3OZ9L 1DVFD 4N5ED 3INUL 4ETQB 4AYFA 4K23H 3C08H 1U2HA 2Z92A 1J0ZA 2OTWA 3NCYS 1KCVL 3DGGB 2CLRB 5F72S 2WUCH 4K7FB 5IK3A 2FYYA 3PG2A 3B2UC 1OAQL 4UOW0 3P4NA 1IGJB 4LVOB 2I24N 1MI5E 1A7NL 4N1EA 3U1SL 1MHEB 2CRMA 1KTLB 2VNCA 3MUHL 3REVB 1L7TH 5IOPA 5I8EA 2VAAB 4OD1H 3S34L 5F7DA 5JW4N 5ESVA 4HK0A 4Y4FD 3SJVD 3DJ9A 4CVWA 4JPKH 1ZT1B 4JR9L 1ZGLB 1NGYB 1UZ6F 4Z7WE 3ILPB 3BI9X 2XN9E 3MBEC 5DUBA 5IV2A 4X6DF 1Z2KA 4G6MH 2CKBL 2WP3O 2AXFB 4FNLL 2DMCA 3CK0H 4OZ4A 5DQ9B 5B21A 4K7PL 1TDQA 2R15A 5CBAB 2VDPL 4DUVA 3MQIA 3VWKB 2K1MA 2GY5A 5ACLA 5C2UB 2Q8AL 5IB1B 3DLQR 2X4NB 3MXVL 2X5PA 3RIFF 3VJ6A 2HT3D 3ZE1E 5K9JL 4OFPA 2OZ4A 4GLRH 3KYMA 4I2XA 1M71B 3D85D 2KH2B 1QFUL 3S37L 1PDKA 3QQ9C 3JSSA 5T33H 1RMFL 1DQQA 5GQBA 1RK0A 1F3DH 1ZVHA 4Q6IC 4PJFF 1JZ4A 2E6PA 4Y4HA 3CX5K 3O9WD 4WUUB 1RZIA 5D70L 2BVYA 2CDFB 3K46A 5SX5K 1IKNA 3O2WL 3FQWA 4LQFL 1MEXH 3CH1B 4FXLA 2F19H 3TNMB 5LGKA 5CS7A 5IQ9A 5I73C 5IKCB 5DK0B 4U2YA 5L2KA 2YUWA 4PJBE 1IEAA 1OY3B 3SBWC 5C0EA 5IFJB 4XMPL 5D7JB 3TN0D 4GKZB 3RY6C 3X3FH 5JNYB 5IVXB 1J87A 3FT2B 1UWXK 4QRQA 4OZGB 4PLKC 2Z92B 2H2PD 3D9AL 3DX8B 2DI7A 1N4XH 5DWUL 5CEZL 2FYYB 3ZTJH 2VQ1A 1K3IA 3P4NB 1KBGH 4NT6A 2DM2A 2CRIA 2YRZA 3QEQB 4LLUA 4OT1L 1S7WB 3HZVA 3IDYB 4OQ1A 5IBLD 4PJHE 3BXNB 3BO8A 1AQKL 4LAQL 5KSAC 2PR4H 1B0WA 4RISH 5A43C 1QFWM 5D72H 5T1MA 1BQLL 1B0RA 3SN6N 4K2UH 3G9AB 5F7DB 3Q6GL 4LARL 1HI6B 3WFBL 4JZOA 4HFUL 3L3IA 3MXWH 2IQ9H 1FC2D 2AERT 4YXLH 1MJ7L 3V4UH 1SMOA 3P0YL 5KSUA 5E00B 1TPXC 4RA0C 4FZ8L 5I17B 5IFAH 4KAQH 3T0DA 2J2ZA 1QSVA 2VB5A 2PTTA 4ODSL 3TP4A 3T0EC 1TNMA 4JFEE 4GO6B 1I8KA 1CDUA 2J1KA 4TSBL 2WAHA 2Z9TA 1IC5L 1Q9KA 3VFWA 1B2WH 4J12A 3CUPB 2ZKHH 5DZOA 4OM1L 3FHQA 5JIKA 3VJ6B 2B1HH 1LE5A 5T3XH 3KYMB 4I2XB 1FGNH 1GC1H 5C0IA 1K85A 5D71L 4AH2B 5JDSA 2YUZA 3FRPA 5IMLA 3MLRH 2Q8BH 4NHCL 2B2XH 4U6YA 1DQQB 4NO5B 1QBLH 1M6OA 2G5BB 5JUEH 3ULUC 4LL9A 5FUZL 4Y4HB 4WFGD 4PJCB 4EDXA 3FN9A 3S8WA 3M8OH 1RZIB 4DEPC 2BY1A 4APQB 3AREA 4OSUL 4WI9A 2EIZB 3GIVA 2C3VA 4RGND 3FQWB 5IQ7L 4R7DB 4WTWA 4WGVB 2EDWA 2IANE 5IQ9B 1GHFL 5I76A 1F4YL 5DJCB 5AYQA 5FYKL 1S3KH 3OHXA 5C0EB 1RZ7L 5CSZA 1J05A 3TPKA 2XKSA 5EU7C 2XG5A 3FOLA 1M1SA 6CGTA 3SDCD 3ARFA 3A0OA 3KPLB 3QA3B 3ARXA 3D3VD 3BRGC 1MCDA 1TTFA 2W91A 1P4BH 1C7TA 4JN1L 2VQ1B 1A6ZA 1HHKA 1JWMB 4MNQE 3I6LD 4M6AA 1F4AA 2ICEB 3VXMA 4PRHE 5DFTA 2LE9A 2VQUA 5EH1A 1BBDL 3QUXA 4ZUVA 2C9AA 3PNWA 4N8VG 5LQBL 1B0RB 4X6BB 4QHKJ 4QRPA 5T5NF 3B9KB 4OGXH 5DJ8A 3L3IB 1ZANH 4JGUA 2H9GB 4JM2B 3MV7A 2DL2A 4EN3C 4XNZC 2H8PA 5KSUB 1E4XH 3TFKD 2X05A 4CNIB 3ZT5A 1CTNA 2BHUA 4PJ7A 2EH8L 1XF4B 1J88A 1QR1A 2PTTB 2MSPA 4C56E 5FOBA 3O6MH 4NM4H 3WS3A 2FJHA 3JV5A 4MA1C 1VKXA 4GMSH 3MNWA 1T4KA 4MVBD 1F58H 2D0HA 2P42B 4Y89A 1NFDB 1XF2A 1QACA 1IGCL 2BRRL 4NRYA 5C9JA 1LE5B 1FO0A 4BELD 2ADFL 4HPOH 5JDSB 3OJMB 1Q0YL 1FFOB 3RVXD 5IMLB 1Q0XL 1GGYA 1UM6H 2P1YA 3WFEH 4CN6A 1KEGL 3OQ3B 1K8DA 3GMQA 4C54A 4F7MA 2YPKA 1T1YA 1CS6A 3DUSB 4OTXL 4LRNH 3KPQB 3VW3L 1FRGH 2ENYA 4EDXB 4LVOC 4M00A 4LFHD 1KLGB 2A9NL 4JRXA 3S4SG 2C3VB 5F89A 1IFHH 3LN4A 5DURD 1NC2A 3ARZA 4CKVX 4MX7B 4KVCH 5CJQH 5D9SA 1UM5H 4YHMH 4NPYA 4E0RA 1BIHA 1AFVH 3SOBH 1LHZA 4G7VL 2OK0L 4HIJA 3VXSD 1MWAA 2IPKA 3OZ9H 4G8GD 3INUH 3M45A 5J6HA 4L8DA 5JA9A 5DJAA 4PIRF 4X7TA 4YWGL 5IF0A 4I48B 5KW9L 1KCVH 2NW2A 3UTZB 1HILA 3VGHA 2P8MA 1S9WA 1OAQH 5IUSA 3OWEA 4PP1D 1A7NH 1T1XB 4LP5A 3AROA 3U1SH 3GSVA 4MD5A 1Z0MA 3VXMB 1CQKA 2Q6WA 1ONQA 1ND0B 4QO1A 4Y2DD 5D2NA 3QQ4A 1CFSA 5GS1B 3BYYA 3S34H 4Y5XB 3V0WL 2ZOKB 1LP9F 5EZIL 3PNWB 5IVOA 4KUCF 3BKJL 5DO2C 1KCLA 5EWIL 5B38G 1GH7A 2R9HC 4JE4B 3P0VL 4KTYA 4QRPB 3OV6A 3BHBA 4JR9H 3NH7L 5FHAL 4PP2B 2E7BA 1HSAB 3VFRB 1JNNL 3MV7B 3ZTJG 2DIAA 3MCG1 2CKBH 1S7TB 4FNLH 5LJYH 1VPOL 1KTRL 5I8CA 4K7PH 4PJ7B 4TSCL 4XCFL 1Q9LA 3BZFA 4ZUSA 1QR1B 2B8OT 4I0PA 2GJ6A 5EU5A 4FFYL 5ILTH 4N8CL 5ELIA 4LPTA 2Q8AH 5JXED 2I9TA 5D1QA 1VKXB 1AO7A 3MXVH 4BFGA 4P4KB 2J8UB 5K9JH 1G7IA 4BKLA 1JV5A 5KN5B 2YXFA 4NRYB 5D7JC 3HC4L 4NNXA 1QFUH 3S37H 1I1FB 3IU4L 1JZ7A 1RMFH 4FFWC 3BZEA 1U8NA 2AK1L 5CEXA 3GMQB 1KIPB 1HYSD 1CXHA 1Y6MR 4N0FB 1OW0A 4F7MB 3QDHA 3LIZL 3O11A 2DJ4A 2OL3L 3VRLE 4UINL 4Y16D 5D70H 3K2MC 3TF7C 5E5UB 4KKNA 3IDIB 2CMRL 3IDYC 2V2XA 3O2WH 2H2SD 4LQFH 3L1OL 3MJGX 1VADA 4LCYA 1R5IA 4Y19E 3UBXG 3BMWA 3SDXE 1F3JA 3QFJA 4HCRL 4EIGB 1T3FA 4E0RB 4XMPH 2Q7YA 1A6TA 3QWQB 4OLUL 1B4JL 5IMOB 4LCCA 3LRSA 3FQRB 3C9NB 4L8DB 5EBGA 5DJAB 1RIVL 5ISZE 5IF0B 2LV4A 5DWUH 4GSDL 1K3ZA 5CEZH 2V2WA 4NN7C 1HILB 2OR8A 4PJEE 2P8MB 2VN4A 3G5VA 5SWQB 3MODL 3RWFA 1CICA 1ACYL 4KY1L 4OT1H 1XR8A 3MFFA 3T04D 4UZGA 2X7LA 1KTDA 1AQKH 4LAQH 2Q6WB 5DHYA 3RVVC 3B8YA 2D9QB 4MLIA 1BQLH 3F7QA 3Q6GH 3V5KA 4LARH 4KC3B 3WFBH 1IAII 3GHEL 4HFUH 1N6QL 2ZCHL 1RZFL 1UFUA 1A47A 3BHBB 3VRJA 5HGHB 1DR9A 3HG1B 1FVCB 1KN2L 3KLDA 3P0YH 2HLFD 2YD2A 2DM3A 3G6AA 3BPLB 3I9GL 1T2JA 5I8CB 1DVFA 2DLFL 4MNHB 2XZQL 2CIKA 2WLYA 4Y4HC 4ODSH 1Q9LB 3BZFB 4ZUSB 1A1MA 2F8OA 4APQC 5EU5B 1TJGL 3N06B 3ARDB 2ICWA 2I9TB 5D1QB 1IC5H 3PDGA 2MOVA 3TPUA 5JHDE 1P4IL 4OM1H 4MNGB 3C8KB 2NX5B 1JV5B 4U1IA 2YPLD 5IVXF 3DSNA 4LU5L 4QHLB 3S5LA 4OZGF 5D71H 2AV1B 4H25A 2LU3A 3V2AR 2NQCA 4NNXB 4PLJC 4Y4FA 1ED3B 4NHCH 2PYFA 3I6KA 5JMOC 3DMMD 3GMNB 1IGTB 5BV7L 3ETBF 2O93L 2VAJA 1S9XB 5FUZH 3T2PA 4FHBD 3C8DA 3L6FA 4DGIL 2X1OA 3T1FA 1NMAL 2CH8A 2XFXB 5ESQA 4OSUH 2YD5A 3K2UL 5IQ7H 3HNSL 4YK4B 1F97A 4LCYB 2DTML 4FA8A 1GHFH 5C6TL 2VDLL 1F4YH 5JDJA 3HE6D 4G9FA 5FA3A 4HIHA 5FYKH 5EO1B 1V05A 3B9KC 3EAKA 1T3FB 3QT2A 1RZ7H 4F3FA 2Q7YB 3VGFA 2UZIL 1A6TB 2ZUYA 2F74A 4PRIE 3D85A 1JRHI 3LRSB 2V7HB 1DQLL 4TYUA 5GGSA 1G0XA 4LBEA 5I19H 4PV8B 4J3XA 3BZDA 3OJDA 3VFGL 4WO4D 4L9LA 2NMSA 1C5CL 3RNQA 3SGDI 2ESVD 3G5VB 5GS2H 2HTLD 4JN1H 3RWFB 2I5YL 4Z77A 2ZP0T 1CICB 4LLDA 4KKAD 3HZMB 4KRNA 3RVWC 2X7LB 4O02L 4E41A 1KTDB 3UPRA 1BBDH 1D9KD 4TULL 2PN5A 4PR5A 5LQBH 1MCOL 3IDGA 3V5KB 12E8L 4JFOA 4GXUN 3L3JA 4ODWA 2A9ML 3JWDC 2Q86A 5FXCH 1A7RL 5FYLE 2H6PB 1KLUB 3VDBA 5GRVK 1TMCB 3Q3GA 3KXFE 4Z7NF 2R1YA 3CC5B 5MP6L 1DVFB 5CD3B 3BKYL 2EH8H 5HYJD 3WKNA 3WHXA 3G5ZB 1GXEA 1HHHA 2VDRL 1HKFA 3TH3T 1P4LA 2HYMA 1A1MB 3L5WA 4GQ9L 1HE7A 1RZGA 5EC2B 2WM0A 4XP9L 4S1SL 4IS6B 5FGCB 4NQDB 5FKPA 3TPUB 2HVJA 2V5TA 1EK3A 2X4UA 2D0GA 1F4WL 2VDNL 2ZSWB 4HIXL 4XZUA 1FNHA 1IGCH 2BRRH 3EOTH 4U1IB 3HNTL 3WFDL 1KF9B 2ADFH 2SEBA 3S5LB 4H25B 4QKXB 3ZHLA 1Q0YH 3VI3E 4DOHE 1Q0XH 4ZXBB 2VABB 2W9EL 5BCAA 1KEGH 4RNRA 2HJLA 5EORL 3EYFB 1QPPA 4F8TA 3TBWA 4HUVA 4OTXH 3N0PB 5IW3A 2DDQL 4OV6F 2ADJA 3VW3H 3L6FB 1AGDA 1JK8A 3PWJB 5BRZD 3T1FB 3LKOB 3LAFA 3E1F1 5ESQB 2A9NH 4Y4KD 1KJVA 1NUDA 1W8NA 4M61A 4OLVL 4PGDA 5TDPA 4LRIC 1C7SA 4FRWA 5E70A 3MJ9L 4Y5XC 2H41A 4LKXB 4R96A 5KJRL 4Y1AD 4G9FB 4J2XA 4G7VH 2OK0H 4TVPL 5CEYA 3FONB 2ZZUT 2BSSB 4YWGH 4D94A 1TENA 5KW9H 4PPTA 1QRNE 2GSIA 1C1EL 3UX9B 3OJDB 5BJTA 4WI4A 4YBQC 2X42A 5F70A 5H8DA 1MCEA 3FO2B 3SKMA 3C2AH 3QP3A 3KYOA 4JJHA 3T2OA 5MEND 1JYNA 5J89A 1CIUA 2Z4QA 3PUCA 1ADQL 1NFDF 3ULVE 4XAKD 4E41B 3UPRB 4LK4A 1R3IL 4P4KC 3V0WH 5EZIH 1QVOB 4I5BA 4M5YL 2FJGA 3IDGB 5EWIH 5I1JH 3P0VH 5FHAH 3NH7H 4W70A 1M7DA 3L3JB 4L4VD 3TM6A 5L2KE 3UJIL 1JNNH 5DVMA 1TLKA 3S4SB 5KBNC 5DMIL 4U1HA 1OAKL 4QHUA 4KI1A 4OI8A 1BD2D 3JTSA 1N3NA 1VPOH 1OTSD 3O6FD 3GMOA 2CD0A 2XA8L 4TSCH 4XCFH 2AXHA 3UTOA 2P47B 5GS0D 3BQUD 1E4KC 3WHXB 4X7SL 3SDCA 5AD0A 3ARGB 4FFYH 1HHHB 1UB5A 3D3VA 1CFQB 5T3ZL 4XP4L 4PJDB 3AVEA 1CFBA 2FH6A 1XMWA 4MDJB 1LEIB 1QNZL 4XZUB 3EOYG 2B7DT 3PL6B 3OKEA 1AD9A 3F62A 3V5DA 2OJZL 2BNRA 3HC4H 4JRWA 4CVXA 3IU4H 1U8HA 4FQHA 1BAFL 5ADOL 4AEEA 2E7LA 2HJLB 3HS0B 1IKFL 4I4WB 4HUVB 3LIZH 2OL3H 4UINH 3CFEB 5BW7A 1ES0A 4U05A 3L1OH 4WJ5A 2Q3AA 3IF1A 3B9EA 1OB1A 3GSNB 4P57B 2Y06H 4H1LA 1UA6L 4P9HC 4URTB 4KJYB 3GMPA 4X4MA 5DMGD 3TA3D 4HCRH 5CUSL 3JV4B 4R4ND 2UUDK 4FZEH 3SGEI 4OLUH 1B4JH 1DN0B 2OMNA 3GSWB 5CLTA 4PJ7F 5MEPA 1RIVH 4TUOA 4X4XA 1I7ZA 3BPLC 4GSDH 4YGVA 1I3VA 1MLBA 2QHRL 2GSIB 5DJ0A 5AG9A 1CXIA 3MODH 3WN5B 1XZ0A 5ENWB 1ACYH 4KY1H 1V7ML 5T1DL 2J8UF 3GI8L 2NCMA 1JGLL 1PLGL 2Z4QB 5D1QC 4RWHA 1CT8A 3UTQA 1KJ2A 3O2VL 3MV9B 4XT1C 4EI6B 4OCYL 2FJGB 3GHEH 4NNPL 3QIWB 1N6QH 2ZCHH 1RZFH 2VLKB 5HBBA 1M7DB 4MYWB 1HXMB 3WLBA 3W2DL 1KN2H 3TCXA 4Q7DA 2VLRD 4DN3L 4U1HB 1XF3B 2BCKA 4QHUB 3VGGA 1A0QL 3F65A 3L5XL 2W0PA 3VXSA 3I9GH 1N59A 2DLFH 2EKSB 3QDJE 5HHOD 2XZQH 4RQQB 4CRPA 5BVJA 4H0HB 4OZHB 1T5WA 5CGYC 5AD0B 3LN5A 1IQDB 3GRWH 3CCHA 3DRTA 1TJGH 3BPOB 4K55A 5GGTA 2DMKA 4C83B 3D3VB 1QBML 1P1ZB 4DAGL 5GGVL 1HEZA 4YK4C 1P4IH 3G5XA 4UU9B 4UB0L 2PCPA 3SE9L 3TBTA 4MJID 2R0LH 4D9RE 4Y2DA 4LU5H 4J4PA 4UNVA 3OKYA 3KPMA 4L3EB 3TJHC 1LEGB 4WW2A 1TCMA 1B0GB 2BNRB 1I1RA 1PG7W 4CVXB 1AC0A 3NIFF 1U8HB 2E8YA 1UB6A 5BV7H 3D39D 2ADIB 1FN4B 4L3AA 3RPIB 4X8JA 2KBGA 2Y72A 4DGIH 4U2ZA 5EO0B 1NMAH 3E2HB 3WIHL 4GAFB 2XV6B 5EC1B 1CICC 4D0BB 3K2UH 2GQHA 4WJ5B 4HZAA 1U58A 3IF1B 3HNSH 2AJYL 5EG6C 1RV6X 1U8OA 1ZE3C 2XWJA 1GSMA 4H1LB 5C6TH 2VDLH 5JXEA 1RFDL 2JK5B 2EDFA 3GMPB 5IBUG 3L3OB 4MJ5B 5I8KL 4RDQF 3KPOA 1HDMA 2UZIH 4FOMA 5SWSD 4DKDC 1FCGA 5KOMC 5FV2A 4PBWD 3RPKA 1XGUA 1DQLH 1NCUA 1KFAH 1S7SA 1DQJA 1DVFC 3VFGH 1ZMYA 4JLRA 2IPUK 1C5CH 4GW1B 2I5YH 1EO7A 5DJDB 1SY6L 4Y16A 5HI5D 1A3QA 4O02H 4JZNA 4Q58C 3K74B 5E6IB 1DFBL 3UTQB 3BGAA 4TULH 1KJ2B 5HYSA 2EXYC 2P48B 1MCOH 1NH6A 1EAPA 12E8H 1VSCA 3O81A 3L3GA 2IWGA 5B39B 4U1MB 1XFPA 3CDFA 4HDIA 2A6IB 1CLZL 1D5IL 2A9MH 5IJKA 4H0IA 1A7RH 1AXSB 3EW3B 9CGTA 2V5MA 3WLBB 4Y4FC 3D48R 3FB5A 4LLYA 1TQCC 1K5NB 4UILL 4M7ZC 4ZXBC 1NJ9A 2BCKB 4QXTA 1H3PL 5MP6H 4V2BA 2AJ3B 3EHBD 1OGAB 4GUPA 4HUWB 3BKYH 3SO3B 4LPYA 2Z8RA 3LVEA 2R29L 2CDEB 1LE9A 4IDLA 1T5WB 2VDRH 2E9BA 4R8WL 3LN5B 4GQ9H 1NUGA 3CCHB 1A6PA 3KS0H 3MREA 4S1SH 4XP9H 3MV8D 1QFWI 3VH8G 4AIZA 3MRBA 3QHFL 1NAMA 1HEZB 3B6SA 2VDNH 1F4WH 4HIXH 4KMLB 2PCPB 4YFLF 1D5BA 5D2NE 1NGZA 3LS