4QYOA

Crystal structure of anti-msp2 fv fragment (mab6d8)in complex with msp2 14-22
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
QVQLQQSGDELVKPGASVKLSCTVSGFNIKDDFIHWMKQRPEQGLEWIGRIDPANGYTKYAPKFQDKATMTADTSSNTAYLQLSSLASEDAAVYYCATYGVAYWGQGTLVTVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fv fragment(mAb6D8) heavy chain
publication title Structural basis for epitope masking and strain specificity of a conserved epitope in an intrinsically disordered malaria vaccine candidate.
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qyoA00
4DGVL 4R26H 4X7DC 4NJ9L 3C2SA 5F21B 3FN0L 3LCYA 3QUXC 3GJFH 5DQDH 4QGYA 3VXSA 5CJXA 2OP4H 2AP2A 2OQJA 2ZUTA 3K46A 3CPLA 4RMVA 3RU8L 1WZ1H 2ZNXA 3U6RA 2MSPA 3BXNA 4MDIA 1IAIM 1U8IA 5A40E 1HXYA 4BYHA 1DUYA 1CLCA 2EE2A 1XGQA 2WIMA 5F9JB 2IPKB 5E8NA 1UJ3A 5D70L 4DZ8A 5FGRA 4PRHD 3V5DA 1JRHI 1VPOL 2MCPL 3IDUA 1I8LA 1NMAH 4AJ0A 2GI7A 5L8KB 1TFHA 4M6NL 1V05A 1RJCA 1UYWH 5IGXH 1HHIA 2FDBP 3QUKA 3HZVB 4QOKD 2OJZH 2FSEA 4HC1H 3QO1B 5B39G 3TFKD 2BFVL 4PFEA 5D2NC 1HILB 5D7KD 1RHHB 4UV7L 4HIHB 3TIEB 4S11A 1B88A 1DP0A 2GSGB 4KQ4L 4OZHB 1JBJA 2Q20A 1MHHA 5JQHC 4RIRB 1DBBH 2X10A 3MGAA 1F8TH 3OKKA 4JKLA 2FX7L 4PJEF 4NHUA 4DKFH 1M6OB 1P6AB 3GSUB 2L7UA 3NFPA 3P4NA 5HSFA 4HGWB 2BRRL 3ZSTA 1A7PL 5KSVB 1NAKL 3IJHB 3L9RA 4ZNEA 1KEMH 4G43A 3VFUB 3ARDA 3VXRE 3V4UH 1D5IL 4DGIL 1S9WA 1VGEL 3WIFA 2UZIL 3LPGA 5C7XH 2GK0B 3IFLH 5D2LB 1LWRA 5ESQB 3GI8L 4I0PD 4OLZL 3RWCA 5J13B 5MEND 2XTLA 5C0NC 1I8MB 2R0WH 35C8L 1FZJA 4OGZA 4M93C 2D3VA 2Y9RT 1MVUA 1AGCA 3VG9B 3QDGB 5I1LB 3TA3C 1G7LB 5DD5L 4FRWA 3BDYH 1KB5A 1W0YT 4HCRH 3FO2A 3QIBB 1YNLL 2EDXA 1I85A 1F02I 2BCKA 5IKCB 5FUCC 1PX3A 1BZQK 5EOQH 3MBED 2L4OA 2ICCA 3VXMB 4WEMB 2AEPL 5D1XA 3PABB 1LO4L 1BREA 4H25B 4QF1A 1R0AH 3QO0A 1P69B 3FAXA 4XXDB 4JLRA 1AIFB 4PGZA 5E2UL 2X9WA 3B4NA 2X9YA 4D94A 5GZOC 4UV4H 1A7QL 1BOGA 5GS0C 4R96B 2EDWA 2YD3A 1YUHB 4N8VB 3QCVL 3MLUL 4LL9A 1HOCB 3BO8B 3FB7B 3CDGB 4MNQB 3FT3B 5DYOA 2F5AL 1FFPB 3NGBB 5DVLA 2NZ9D 4N0UA 4M62L 1U42A 3U9UB 1HQ4B 1G9ML 4PV9A 5C9JA 1AQDA 1PKQA 5E9DB 4RMQA 5CSZA 5C71A 2DLFH 1OSZB 4PJAA 1H15B 1MLBA 4M7ZC 2J1KA 4H20L 4NQDB 4APQA 3O6KL 1OF2A 5HHQB 2BJMH 3ARWA 5JHDD 2X40A 2AXJA 1T66D 4YDVB 3NA9L 4FQXD 1IGML 4AIOA 2VXQL 4YJZL 1F2XK 4JQVC 1FIGL 4WGWB 2HH0L 4OF8A 4L4VE 5I1EL 2GSIA 1N8ZB 1RQ5A 2NYYC 3QDJE 5AD0A 4KXZI 4HUUA 4HT1H 3FONB 4XVJH 1S3KH 4WUKL 5CZKA 3AREB 5DZOA 4ZAKD 3BRGC 3LOWA 3CDYA 3DETC 3KLDA 1WBZB 4X99B 1AD0B 1DQML 4PRNB 1RZ7H 3CXHJ 5K33A 4O2CB 5EUOA 4NCC1 4K94L 3X11B 1AGBA 1B0WA 1JF6A 2QBWA 3K80A 5TJWK 4MB4A 1F4YH 4P46D 4MJ2A 2Z8RA 2BOBA 4UIMB 3QEQE 5IMLA 4M7KH 2EXYD 4G9DA 5T3XE 2HLFC 3VU2A 4I3GA 1MRFL 3O0RH 5MERB 1A7OH 1BFOA 3BKCH 4M7JH 2NXYC 3T3MF 2DDQH 5BO1L 5HI4D 3U4AA 5IF0B 5DJCA 5EBMA 5J1AA 2JB5L 4YE4H 4MQXD 5FYJH 1NKRA 3F58H 3M07A 5JPNB 2VITA 3MLWL 1F2QA 3O45A 4AL8H 2P49B 2JF1A 1WVZA 4J3SA 2Z92B 1GGBH 1NBZB 1MFAL 1BVKA 1INEH 2BHYA 3O6LH 3SKJH 1DDHA 1W0VB 1WFOA 4WI8A 1GAFL 3ILPA 4YXLL 4KQ3H 4JRYB 4QYOA 1FVDA 2CQVA 4NC0B 3L3IA 1A3RL 1TCRA 1RULH 2ZG2A 4QRTB 3CVHA 1P7HL 3RAJL 1OAYL 2V5RA 4PRIB 3WXVL 3MV7B 5HHMD 5CKGA 4YAQB 3NCYS 1DCLA 3OWEA 5HI5D 2GW5A 3IDYC 1DVFB 4LEOB 3BKML 4AMKH 3BP5B 1HSBA 2AJ3A 2ED8A 1JNHA 3EGSB 3IVKB 2YPKB 1XGYL 4HUMB 3S36X 1RD6A 1PW3A 4PJDA 4S1SH 4MA7L 4DGYL 2NX5B 4HF5H 4UT6L 4XP4H 4PJFF 1RFDH 3WEXA 1ACZA 1FGNL 3EDFA 3U7YL 1KULA 2VN4A 3SE9L 3EOBA 1IGIH 5GIRB 4GKSB 2B39A 2ORBH 4MQ7A 1D9KC 3HI6L 4NGHL 5EZIL 1E4JA 4R4BA 4WGVB 1BGXL 2P43B 1MHPL 3TN0B 3X13A 4JFHD 4R7DA 1EGJH 1C5BH 5BOPA 4CVWA 1AGDA 4MD0A 2P5EB 5J9PA 1AGEA 1YNKL 3PHOA 3K2UL 4HW6A 4LEXH 2DTSA 2YEZA 1BBDL 4GG6F 2D31A 1HCFX 3RTQD 3SDAD 1FPTH 4OD3H 2CRZA 1J1OH 3DVIA 2AW2A 2IANA 3BWUC 5JOEA 4M1GH 4MA8H 3FJTA 4KTDH 3EYUL 5SWZD 2NTFB 1UACH 2YRZA 5K93A 3SN6N 5L9DH 4K8RD 2DWDA 1YDPB 4L5FL 1T04A 5BVPH 3O9WA 5FA4B 2ZUWA 4ZS6D 4FNLL 4V1DD 4JG1L 1UWEL 1Z3GH 1KIRA 2QSCL 5FV2A 3LKOB 5D7JC 2Z93A 5HDQH 4WHDA 3RVTD 1I9JL 4PJ7E 1AY1H 5IB3B 4UI2A 1X5YA 2GJ6E 2IF7A 4JFEE 4Y5VB 4FFYL 4PP2A 4NO0D 4M61B 1XF5A 3QIUC 4HBQA 5EDXA 3MV8E 5CEZE 5C09B 1GGTA 2SEBA 1F42A 4LSSH 3KPMA 5AEAA 1Q8MA 2DM2A 3IDNB 4YDLB 1A5FH 3UTPD 3WUWG 2DL2A 2COQA 5D9SA 4N5ED 4NHCL 3V6ZA 5F6HJ 3RUGB 4M1CD 2BY1A 2ZCHH 1NCWH 1XGPA 3MACL 4UOJA 1BZ7A 2LAGB 5CZXC 3MRLB 1FLTX 5BS0D 3O6ML 4HKJB 1U8PB 3T4YA 1YQ2A 5FCSH 3TV3L 3S36H 2FRGP 2Z91A 1H3TA 3Q3GB 3AB0C 3SOBL 3A6CH 1L0QA 5JUEL 3DUSA 3H9SA 4HFWA 4Q9RL 4JR9H 1MHCA 4Z7OE 12E8L 3H6JA 4PJ8A 4Z7VE 2VIRB 2VLME 4XPFH 2EIBA 5HPOA 1K6QL 4JZJA 4MNHB 1DQQB 2LU7A 4KROD 2FO4A 2BMKB 4HLZG 5K9QI 2YK1H 3LKSA 2EH7L 1XIWA 1S7SB 3VMPA 4F9LA 3W2DL 3DVGA 4LSQL 3PWPB 1YC8A 1NCNA 2B1HH 4DVRL 2XQYK 1IFHH 4XWGH 4U6YA 3U79A 1D6EA 1K85A 1TVHA 1M71B 1Z6JT 2XTJE 3MRMB 5HGDA 1KJVA 5CP7B 1A6PA 2E7MA 3IU3A 1MIEH 3UYOD 2EDQA 2Q8BH 2AK4A 1I8IA 4GKZB 4PS4H 1L9MA 4IMKA 4XH2A 4U6VH 5DGRA 4OI9A 3TFKC 3S88H 1T1WA 1UWXH 4IOFC 1QG3A 1S5IL 1ETZA 3HG1B 4RNRA 4AH2A 4Z8FH 1AKJB 4WUUD 1N2RA 3CDFA 2XZAH 5EIQA 4YHOH 3VFWA 3OXSB 2A6JA 1WFNA 2BVTA 4UDTA 5FGBA 3U1SH 1N59A 1JF5A 1KFAH 4X6DA 3CC5B 3R1GH 2QR0A 4MVBD 3T77B 4N8CL 2APFA 4RFOH 3MRDA 2ZUQB 4OGAC 4WTXA 3KPLA 4PJ5D 3VGAB 4X5LA 5FIEA 2GT9A 2PYFB 1NL0L 4JY4A 5LCVL 4J1UB 5E1AB 5IESH 1FVEA 3FOLB 5GSRB 1A6WH 1FYHB 3EIFA 4NZJA 4QNPE 4AQOA 5IEKB 1ZT4B 4RQQB 5B39B 3HMXH 4G8GE 3FQWA 2NY4B 5KZCB 2BVQA 1YQVL 2QQLH 3BZFB 1Q0YL 1MRCL 2HJKA 3HFML 3UJJH 3MA7A 3CK0L 4DCQA 5IMKA 4KRPB 1XR8A 3FCTB 3E2HB 1WWCA 3ALPA 2EO9A 4C56A 4LSTL 1NFDF 3I6GB 1F5WA 4O58H 3UTSE 1ZVSB 2F8VA 2R2CA 4K07A 1CL7H 3LS5L 3CSYA 2NW2A 3RRQA 4F7MB 4O2EB 3GSRA 4P5KB 2GFBA 2QSVA 3BWAB 4K8RL 3MBEC 1EHNA 4H0HB 3V6FA 1EAPA 2R4RL 1CR9H 3HRZA 4XNQB 1JF1A 2A9NH 4JCMA 3GGWA 4UQ3B 2F15A 2OXHA 4PJ9D 3KJ6H 4R90H 2H2SD 4OCNC 2PXYA 4PJBF 1P84K 2D7MA 4LCIL 2DQEL 4GBXD 4GMTL 2OS7A 4PJEA 3PQYE 4S2SA 5FECB 4Y4KC 1HXMA 1QSED 1ZEAL 3DRTA 3FFCE 1I3RA 4J6RH 1CQKA 3RQ3A 2KDGA 1N6QH 3SJVB 4KKBC 3DXAD 2Y36H 2ZNWA 2NZ9C 3HE6B 3RZCA 5DO2D 3VRJB 3UAJC 3DYMA 4CGTA 3KS0H 5EC2A 3BP4A 3P73A 4L4JA 2Z9TA 1IVLA 1I1CA 4M5YL 3QPXH 3DX9B 4XX1E 5EZJA 1QLEH 2VLKD 4JM2D 4QWWD 5EOCL 3A6BL 4RRPA 3TYGL 4PRAA 3VFGH 4R0LB 5JORA 3IF1A 2YKLL 1T66C 4M4RA 2J12B 5F9WB 4JRWA 1A4JB 3EJZC 4YC2B 3Q5OA 5ESVA 1N64L 4XAKE 2JJUA 1NDMB 4Z77B 1HKFA 5I19H 3NACH 2O5YH 1VEMA 5KW9H 5L2KE 1KCVH 1CICD 3WHXA 3M1BB 4J3WA 3RDTB 1OGAA 4BSVB 3H9HB 1R3KA 1JYXA 1SYSB 4U0RB 3AXLA 4Q2ZB 2DIJA 1TETL 4EN3D 4YZFE 3BPNC 3L95A 3OKYA 4XP6H 5FGCE 3QHZL 1A1OB 5ITFB 3NZ8A 4XMKH 5E0QA 3IDMA 5IFJB 2J8UE 3MV9D 1ERNA 3RKDD 1CDBA 4HQQH 1TXKA 4XPHH 2G75B 4UNUA 3WS3A 2IFFH 4Y16D 3MNZA 1LO0L 4GMSH 2JIXA 3BKJL 3MYJB 1WAAE 4I48B 4YK4B 1HQRB 4R4NC 4NBXB 3ZMRA 4KV5E 2UWEE 4K71B 1CD1A 4OAWB 4OSUH 3KWWA 1K4DA 1CFVL 5DJ0A 3VWJB 3QUZA 4Z7QF 1QFUH 3GM0A 5KVEH 1X9QA 4MXVE 4NZUL 3GSNH 1VESA 1ND0B 4AM0B 3KPRA 4JFDE 2XYCA 5LGJB 2B5IC 1PLGL 5DWUL 1J0IA 3KPQB 4HKXB 1JPGB 1JGVL 1A6VH 1F3JB 1BHGA 4MQXC 4YPGB 4P3CL 3TEUA 1NFIA 4LIQL 3PWLB 1GIGL 5JIHA 3MXVL 4DK6A 3D39A 5C0DA 3CMOH 4NJAH 3MLRH 1BD2D 2ZG3A 3NZHH 2GUOB 1WICA 1U3HD 2A73B 4WI3A 3ARFB 5DEFB 2IADA 1IAMA 2OR8A 5IMMB 4XGZA 3FT4B 1YJDC 32C2A 3UTOA 4Q7DA 1A64A 4G7VH 5HVHC 5DHVA 3EHBD 4IMLA 1R3LA 3BW9B 3B83A 3DMMA 4L9LC 3BGFC 3F62A 2J88H 5D5MA 1VEOA 4K3GA 1GHFL 1KIUA 4P4RA 5IHUH 1S9KC 4GQ9L 3C08L 3DTXA 3WE6A 2QADB 4XNZB 4BKLB 2CJUH 3QG6B 4ETQB 1PZ5B 3CD4A 1UM6H 4LU5H 3DHMA 1UM4H 5DD0L 1YPZF 1SEQH 5BMFH 3VE0B 2J7LA 5CLTA 5SWSD 5LGHL 5EB9A 3MLXL 4QHKJ 2GITB 4QXTB 4RCAA 1DJSA 2CUIA 1X4ZA 3PWUA 2Y7QA 3VFRA 1JVKA 3MJGX 1DBKH 4G6AC 1TTFA 3WNLA 2ZCLH 5F70A 3Q48A 2OZ4L 2WBJA 1AR1C 4UT7H 4JGUA 3JUYA 5HHPB 1SY6A 2HFTA 3QJHB 2CMRH 2ZKHL 3MRPB 3KPSD 3DSFL 1X6LA 2B8OT 2YPLE 1CGWA 4OZGA 1AFVL 3MUZ1 1NBVL 3G6JE 4GOSA 5DUPL 1F11A 5IB1B 3IFPA 1BFVL 3GSVB 2AJVL 3OKMA 3O8XC 3QCUL 4LSVL 3B9KB 3OG4B 3RTQC 3ZTNL 4K7PY 4JHZA 1QRND 4NQEB 1BJMA 3RGVD 1RZKC 2VMFA 5J1SC 1BX2A 2BVOA 1HHHA 5GISH 5GRVL 4O2FB 2R2HA 3EOTL 4ZODA 2Y1VA 4UU9B 4WI4A 5KN5A 3BEVB 2CDFB 4YXHL 1GPOH 5IQ7L 1ZGLP 1X7QB 2G2RA 2C3VB 3NOIA 5MHSE 1CGSL 2XWBA 4OZIF 3QIWA 1JPFA 4D2NA 3RWIA 2Q8AL 3QA3A 3QNZA 2FIKB 4Y1AA 5IM7A 1TQBB 4M3JA 3GBML 5DRNB 3VA6A 4Y8AA 1IAIL 2AS5M 3RWFA 4PRPA 4QHUA 1CXKA 3IYLW 4HDIA 4YBLB 5DD1L 4PJFA 3OR6B 5ADPH 4TVPH 4HPOH 1G6RA 3JWDL 4R8WH 1FC2D 4MWFA 4HD9A 3DV4A 5I30H 5CMAB 4NO3B 3BRDA 4BA8A 4QRPD 1A3LL 5CUSL 1CDHA 2EH8H 2GAZB 3LRHA 1FFOA 4NUGL 3MR9B 5E2JA 3LS4L 2NY6C 3JTSB 3QXUA 3RIAF 1IAOB 2F54D 5DJZA 3MMEA 4RX4A 5DMYA 1CE6B 1Y18B 3N9GH 4LLQB 2P8MB 4P2QD 2IH1A 1YEGL 2DIBA 4HWBL 4GG6A 2E3VA 4XBPB 5ENWA 1TZGL 5EORL 1ZGLA 1IM3A 1A6TB 1OAKH 2XXMB 4LLVA 5JW4Q 1IC5L 4E42A 3LH2L 2VDNH 3MLZL 4ZD3L 1N7MH 2F53D 4GG8A 5I1CL 1U2HA 1QUNA 4NFBA 1MCRA 3Q1SH 4Y19B 1NGPL 4IRSD 5E99H 2Y6SD 3VWKC 1MLCB 4U1SB 1IC4H 1T1XA 3NIGF 3O2VL 4HX1A 2EKJA 3PWJB 4MAYD 1FIEA 3MODH 1CYGA 4GAJH 3GMLB 3GNML 4FZ8H 3WUWB 2IAMD 3A67L 1U93A 1MRDL 5E2WL 2X1QA 5EUKB 3T08A 5DR5L 4K7PX 4KROC 4F57L 1HE7A 2HTKD 2IG2H 2CPCA 3KLAB 3TO4D 4Y5YC 5DJAB 4YHPA 4OCXL 3FQXA 1OW0C 4RAVB 1LVEA 5IHZB 1YMHB 3ARTA 5DEGB 5J89A 1P7KB 2VDPH 3L3KA 1KB5H 3ZKQD 4H88H 3VXME 1GZPA 3DGGA 3VGHA 2Y25A 2WBWB 1GOFA 3LEVL 1U92A 2APXA 4D3CL 1KGCD 4NRZB 5C0CE 5BXFB 2GJZA 4U7KA 4OCLC 4ZTOH 3SDDA 5JOFA 15C8H 2EECA 3O6FB 4NQVA 5D7LA 4P57A 4FQIL 1MQ8A 5INDA 5JDJA 1FAKT 3S35X 5TF1L 3VI4F 3MNVA 4PJHF 3IU4H 1D6VL 4P2OD 4X6CE 3BVNB 3D2UB 5EA0L 1L4IA 3VH8A 5FEBA 2RR3A 2Q3AA 2O5XH 1A4KB 5IOPA 3TBYB 1WUNT 1JPTH 2RCSL 5I6XB 4ELKB 3NN8A 5T5FH 2H41A 2VDMH 3T0EB 3RPIB 1Q9WA 1CL7I 3DUHA 5JQ6H 3ZKMC 4G9FA 2FJGB 4LCWB 4NP4H 4ODHH 5GJTH 4QXUH 4Z5RA 3RY6C 5IW1B 3TCLB 4FFWC 2AK1H 3UJTH 5ALCH 3C5JA 3CZJA 5J06A 1HSAA 1WT5A 1MFEL 2WQRA 1GGIH 3MZGB 3D9AH 1REIA 4ODWA 1F45A 4PG2C 3MBXL 4XZUB 2HN7A 1JPST 3TZVA 2FYYB 2DI9A 1JI2A 3DYPA 1I9RL 4LGSB 4GT7A 1A7NL 1QFPA 5DC4B 5FHAH 2C7UB 3BGMB 1ED3A 3WXWL 4GJTB 1I7RB 4Y7MA 3L3OA 3VG0L 5JXAL 2A77L 2D7TH 5BW7C 5MENE 4X4ZA 3I3BA 5ITBL 1FO0A 3K4AA 1OP5K 2YD8A 3N50A 2R1XA 4EDWH 1P5VA 3CX5J 2PTUA 1QBMH 1I4FA 3QFJA 3ECBA 2AXFB 3V5KA 5CSBA 5J6HA 4NWTL 5CD5D 4LPYA 1ORSB 1BQLL 5FYKE 2ZZUT 5BV7L 4JN2B 4A6YA 1RJLB 3RWGB 1P7QD 4LCCC 4JO1H 3H0TA 4IDJH 2YA2A 1QTYT 4WWKA 3C6SB 2CDEA 1UCTA 1IEAB 5TH2B 4U1HB 3FOMA 3FHAA 4NQSB 4U49A 5B8CB 4PJCF 1MREL 5HHNA 5CCKH 3FQRA 3KYMB 2FD6H 4P3WA 1Q72H 3QHFL 3T1WA 1MF2L 3HCVB 5GRJH 1NBQA 5F9DC 2YD2A 3B43A 1SEBA 1U8NB 4BH8B 3GSWA 3SE8L 2GEEA 3DX7A 1T7ZA 5T33H 1S7VB 4K3EH 1FZKB 5T1KA 3VW3H 2Z4QA 1WEJL 4Z0BH 3QDHA 1HWHB 3ULUD 1KT2A 1CS6A 1YEHL 4JFXA 2AERT 1HKLL 1ACYH 1E27A 3SKNA 4YNYB 5FKAB 4ZOCA 1FL3B 4ZXBB 2MKWA 5KSBF 5D71L 3GSNB 2F58L 3QDGD 1IE5A 1E4WL 4WFHD 1PGRB 3TVMB 3VFVA 2VDRL 2FHFA 4Z7WE 5GGTL 1KN2H 4YFEA 4JRYE 5E7FA 4GS7C 2VLJA 5E5MA 5C08E 5C0FB 1NFDA 2R2BA 5JHDE 3JWDC 2HT4D 4JFFB 2Q86A 3KXFE 1EO8L 5F88A 4HH9B 1FNSL 4PRIE 4I5BB 1KBGH 1YEJH 1QACA 3CVHH 1SM3L 2YUZA 4I3RL 1DBJH 4XBEH 3ULVH 4K55A 1RIHL 2HRPH 4BQ6A 1MI5B 2NY3D 4PJ7A 5DJYB 1YY9D 1PBYA 3GM8A 4ZFOL 4PJBA 4EXPX 1A22B 2CIIA 1ZOXA 3HI5L 4QY8A 1IT9L 4MNQD 2V9RA 1UCBL 4F58H 4GRWE 4X7FC 5E4IA 4ZQKA 4HBCL 1EFXA 2YXFA 1FH5L 1LEGB 1S7UA 4QXGH 1CGVA 3KYOB 3OGOE 2X1OA 4NQDD 2P5EE 1EEZA 1RUAH 4LP4A 1VFAA 2C26A 2X42A 5DFVC 5GGQH 4KRNA 5JW5B 2X44D 3OKLB 5I76A 3D1MC 3NA4A 5T1DL 3X14B 2DLIA 4M3KB 3JV0A 5I9QB 1YN7B 5HHVH 4PJXF 4N0FB 2AXHA 1U3HC 4B5EA 4NT6A 1N26A 4TSAH 3LKRA 5JDSA 3RGHA 1RZIA 4KVCL 4KJWD 4HKZA 4RWHA 1T83A 2XN9E 3R06B 1BZ9A 1FSKB 2DBLH 4LHUG 4DKDC 4NM4H 1I7UB 2EDDA 3RWEB 4XMPL 3W0WA 3EHBC 4U1MB 4IIQC 5C2BH 2YRPA 3QUXA 4U1KA 4L3CB 2RFXA 5CAYB 1C1EH 4PLOB 4X7TB 4WV1B 2P5WE 2WUCH 4LVNC 1M05B 2R0LL 3WFHB 5I1HL 1EPFA 1K4CB 2W65A 1MJ8H 1MFDH 4TTDD 4YWGH 1JZ6A 2ICWA 5DJDA 3BPLB 2E6JA 3X12A 5KSUB 2HVJB 1DSFH 4OFYA 4CVXB 3KNBB 1KCLA 3B9VA 5JPMA 5BQ7B 3D0LB 1DBAH 3KJ4B 3SO3B 1RHFA 3VXUD 4FQQA 3U0PB 3ZHKA 5DVNA 4I3SH 1D5ZB 5TDOA 5C07A 2X4TA 5L7XH 1HXYB 3EYOA 2FL5A 5HDOA 1XGQB 1BJ8A 4XTRC 5E8NB 5F7NC 4PGCB 5LXGL 4ZSOA 1KN4L 3FTGB 1T5WA 4NZRH 1C12B 3BIKA 3Q0HA 5E95B 3L5XH 3WNPA 4ZPVA 1JGLL 2H32A 4IJ3B 3FB6A 5HHOB 3JV4A 1FE8L 4PUBL 1UB5A 1FFQA 5K59F 1ITBB 3HC4L 4EIZC 2CDGB 4V2CB 4CDGC 4E5XB 1BAFH 4P2RB 1KCSL 5EO0A 1ITCA 5JW3H 2Q87A 1EDQA 4DW2H 5CIPA 3T4AA 3O4LA 3PGFH 25C8L 4ZO6A 1G1CA 2ITCA 3MV7D 3BAEL 2JCCF 1MJ7H 4OZFA 4UT9L 1RK0A 4L3AA 3AS3A 2AABH 4GRLB 4NZTH 4DQOH 4NNYB 2IJ0C 3TNNA 3X3FH 3VFPB 4D9RD 3SGKA 3ULUL 3JV6A 4APQD 1P6FA 5SWZE 3G5YA 1CFSA 2HJFB 4WDIB 1BF8A 1LP9B 5BV7C 1RZJL 2NX5D 4LDLB 3FB5A 5KSAD 4X83A 3P4NB 5FO7A 3G5XB 1HZHH 1YPZA 4D0CA 1I3GL 3PHQB 4JY5H 4V1DE 1JK8B 3ARDB 1I1AC 2H9GA 3TA3A 1S9WB 5IJVA 4XCEA 1R3HB 1YECH 1MOEA 4A2LA 2I9LA 3TN0D 3VGGA 3PGCB 2XT1B 1FZJB 1D5BB 2AJXH 1K3IA 4I18A 4NRXA 1CG9A 2HFEB 3LKQA 4YHML 4PJGE 1VA9A 5HYFA 4RGNE 5TPWL 4YHKL 1JGDB 1JGUH 5F96H 3QXAA 4X9FA 4O02L 3L3GB 1TQCB 3MOAH 4IHOA 4EBQH 2V2TA 1IQWH 3C5ZC 1KCUH 1F4XL 1MIML 4LNRB 5HPMA 5FDWB 1KCRL 3P0VL 2XZCL 3QEGL 1KTLB 4RRPG 5FUOL 3K8MA 4DUVA 5CJQL 4X0KB 2P7TB 5DMKA 3U30C 4KGJA 3ZDYE 4PJIB 3LRSA 4IRSC 5IHBA 3TJEL 1U58B 2JE8A 4G7YH 4YH6A 5SWQA 4LASH 1NEUA 4WTZA 1OOAA 1JZ5A 4E41B 1FJ1A 5AYUL 1VDGA 3P0YL 4FQCH 4MAYC 3OJDA 5DYOB 5C6PB 5IVXB 4ELMF 3LD8C 5B3NA 5TQ2H 1JIBA 3QFDB 5F7DA 5D2NB 3VGDA 4Y2DA 5C0GB 5C0BA 3BIBX 4JQVA 3SQOL 1AQDB 3FO9A 1J0HA 2Y07H 3HNVL 2EE3A 5CJBA 3F7VB 2IWGA 2YBRA 4JHAH 5C09D 5GS3A 5FKPA 5H2BA 2EDHA 3GMNB 1B4RA 5J11B 2JB6B 4F3FA 1PQZB 1KPRA 5I73B 1MH5A 3HS0B 2H1PH 1CZ8H 5MEQB 4ONHB 4OZ4A 3PP3K 2EDTA 4X80L 1YYMH 4Z7UF 1SQ2N 4OT1H 2C5DC 4LCYA 5E6IB 4P5TC 5I1DB 3AS2A 2CLVB 2EDLA 1I1FA 1A7RH 2LV4A 3SEPA 3EW3B 4ODTH 4WHTB 1TTUA 4QRSA 1ORQA 3ARBC 1FYTE 5HJ3B 3WLWD 3DPBA 4QRQB 4QTIL 1R24A 3PGDB 1NSNL 1K8IA 3HMWH 4FTVD 3LHPL 4MYWB 5TE7L 5IK3B 4NQXB 3BT2L 5DHYA 1INDL 5I2IB 2E7LC 3VI3F 5DUBA 4KUZH 3MCKA 4WW1A 4XCNA 4OLYH 3D0VB 3I2CL 2AJUH 4EI6A 4JPIB 3IB4A 1YMMB 1J8KA 1BVZA 3T0XA 5IFAH 1WBXB 2ICEA 5CSGA 4JKMA 5EN2A 3BQUA 5FYJE 3PWPD 1XGRB 3WSQH 3LKNB 4N9OB 2RBLA 1U3JA 5EOTB 4OKDA 3NFSL 3VFOB 4FXLA 4CU6A 3NFNA 3V7AE 2VZ1A 1K9TA 3HPLA 5EC1A 2IAND 1MJUH 3WFDH 4Q9CA 5JTWA 2X6MA 3H7LA 4YDIH 4N0YL 2EDFA 1QVOA 2VE6A 4RWYL 3O45B 2YD1A 1IGFL 3IJSB 1KG0A 3SE3C 5GSVB 4Y4FC 1NPUA 4XNYH 1J5OL 4J8RA 1P4IL 4TOYH 1KIQA 4PR5A 4G5ZL 2BOCB 1X5LA 4KGLA 2VISA 4KWUA 3HG1D 3OKEB 1JZ3A 1FNEB 1VFMA 1CGUA 3O81A 4NKIL 1AQKH 5D1QB 1UENA 1RZ8A 4M7ZB 4PJHA 5DDHA 1D3CA 1NKOA 2VXTH 4OLUH 1FVDB 2NCMA 5KG9B 2FATH 1A9EB 3PIQB 4OBSA 1M7DB 2VLRB 4LBEA 3CVHB 3VXOA 4DFHA 1RJZA 2MWCA 5GHWL 5MEPA 2VQ1B 4JZOB 4XP1H 1CT8A 2B4CL 1FCCA 1ZT7B 3DYOA 1T7XA 2V7NA 5T1LA 3WIHL 2R29L 1G9NC 4P3DB 3F7YB 4HGMA 5C6TH 1U41A 5B21A 2V2XA 2JJVA 1S7RB 2I24N 3SKMA 4R3SA 4B50A 1D9KA 5DI8A 1J0YA 5KZCD 4I9WD 3MFFA 4XPBL 5DLML 3B2VH 3AU1B 1QKZH 3ULUC 3DXAE 4WTWA 2NNAB 5J13C 3MRJA 1MHEB 2DAVA 3Q5YA 3HNTH 5I8CA 1FNAA 1NCBL 3PUCA 1RZJC 1FORH 2BSTB 2BNRA 4KRPD 6FABH 3BZEB 4KI5E 3EDKA 4HGKC 1NMBH 4K7PL 1M7IB 1PFCA 3QIBC 3JBG7 1WIUA 5E56A 4NFCA 3BESR 3BPOB 5FO8A 2ARWA 3O11A 3OZ9L 2X1XR 2YZ8A 3L3DA 1I75A 1AGEB 5E08H 2QJDA 4TUJA 3BH8B 2LABA 1GZQB 2YEZB 5GJSH 2D31B 2YPVH 5KS9E 3U48A 4HJGB 3RBGA 2Q76A 1BVLB 1C08A 5MEOA 2D0GA 5D7JA 3EYQD 3SDXB 3KDMA 4PJCA 3WJJC 3GI9L 1Z5LB 5DQDL 3ZDZF 1U8JA 4LOUC 3S35L 1P9MC 2OP4L 5I1GL 4WEBL 4L8CB 3SJVD 3UMTA 3QULB 4KU1A 5F1NB 3NGBC 2R0ZH 1T5XA 3FRUA 5GRUH 4IRJA 2X09A 3QDMA 3UTQB 4MDJB 4MJ6A 1CDIA 3QQ4A 2DMBA 2AK4D 5DT1H 5C0EB 5GS1B 1NCCH 3B5GA 1VKXB 5AUMA 4HWEH 5KSBA 3N1QC 3BOVA 4PP2B 3TPUB 1IQDA 1WGOA 3IDYB 3VXQB 4YHYB 5DRZA 2KBGA 1QR1A 4JFQB 5CHNB 4GUPA 4ZUTA 3U4BL 5C0AB 3C6LC 2ZOLB 3ZHDA 1YN6A 4KDTC 5ICYA 2LQRA 4R6UA 3EO9H 4GO6B 1MFNA 4BM7A 1IAKA 3V6ZB 4DAGL 5HYJB 1KJ2A 3AREC 1EH9A 1U9KA 3L5WB 4JKPH 5J1TC 3L1OH 3CFIC 1F8TL 4LRNL 5I1IL 4AENB 2Z91B 3K0WA 1SMAA 1KEML 1II4E 1LK2A 2A6KB 3DUSB 4NKQB 1XR9A 4HFWB 1C16B 4U1NA 1LHZA 4N90E 4K2UL 2DQUL 1WBYA 3VWJD 3H9ZA 4PJ8B 1J1XL 3IFLL 3HUJB 1KLUA 1AE6H 4PRHA 4U1JA 1DZBA 4MCZB 3QWOB 2APBA 4OM1L 1GOGA 1CGTA 2AVGA 2IQ9L 4N9GA 1E28A 2VUYA 3EJYD 3FRPA 3VH8G 5JO5B 3BDYL 4LHUB 4BZ2L 4TRPH 3LEYH 3TBWA 1FVCA 3SKUD 4XMLL 2C4XA 4QOKA 4PJXA 4JDZB 3G5VA 4D8PA 4L29B 4JO4H 1NGWB 1H0DB 3ARFD 1SYVB 3WFZA 5HGDB 3EYSH 4JKWA 2V9TA 3B6SB 1T2QH 1SJHA 1RK1B 4F9PC 2W0FB 1QEWA 3QZWG 3NCJH 4GXVH 1IKFL 1S9YB 3EFDL 2LVCA 1A6AA 4JB9L 1TDQA 2G60H 4NZDA 4HK0A 4KHTL 4KJYA 1G7IA 3QG7H 5DD3L 5LBSH 3CH1B 1T21A 1LE5A 2WAHA 1N2RB 3QIUB 4NRYB 1IBGH 3MRRB 4HV8B 2A6JB 5ISZB 3OMZA 4AEEA 1DVFC 5F3HB 4YUEL 2BERA 3JSSA 4OD1H 1MCSA 4QCIB 3GMOA 5BZWB 1YNTA 3MRDB 1CK0H 4I0PA 2UY6A 1NANH 1AO7B 3K2MC 5JA9A 5IT2L 3NPSB 1H3UA 4JM2F 1TENA 4PGEB 4M4PA 1ZKAA 2C9AA 1U6AL 1JTPA 4J7RA 2BJML 5EO9A 1CTOA 4BFIA 1H3WM 2OK0L 1JNNH 2B4CC 3HB3D 3OF6A 4PG9A 5FYLD 2ZJSH 3B9EA 2ARJB 4LSRH 3RX8A 1UH3A 5L6YH 4I2XB 3VJ6A 5J8OA 3TN0C 2H8PB 3MBEA 4LLMB 2HJKB 2W9DL 3QH3A 4DCQB 4HT1L 5IMKB 3LSOA 4XVJL 5M7QA 3PWNB 3CAFA 3KPPA 1BEYL 4WENB 4C56B 4YEFA 2R8SH 4U2YA 4X98A 3VDAA 2Y06H 3B9KD 5DA4A 1EJOH 2F54E 5DRXB 2EKSA 4DZBA 3PWVB 1RZ7L 4H5SB 2BSSB 4LCWE 4I4WB 2VLLA 3V6FB 2X9XA 2A9MH 3NH7H 4RBPK 5KAQG 3LN4A 4JHBA 5E6YA 1DUZA 3HRZB 4Y4KA 2JCCA 1P4BH 5BRZB 3GGWB 1FC1A 1NUGA 3CCHA 5JIPA 2DQDH 3REWB 3ISWA 1R3IH 3KPRD 2PXYB 1IL1A 5EU5B 3P4MB 1MCHA 4EI5C 5BZDA 5IW6A 3D69A 4BQCA 1A7OL 3BKCL 2VZ3A 4NNPH 5EBGA 1JFQH 1HXMB 2DDQL 3V5HA 5B3JF 5CS7A 2JJTC 3BP6A 3OJ2C 1F6LL 1JHKL 4KY1L 1H5BC 1RJYA 2VABA 3EO0A 5C0IA 1PG7X 3VA2C 2W07A 3H3PL 1E0OB 3JXAA 1P1ZA 3ZE2F 5TDPA 3CZFA 4Y5VC 5EC2B 3PP4H 2E6QA 4MS8D 3C8KA 4M8QA 4NNXB 5DQ9B 4FABH 2DM4A 3RNKA 5DF0A 2D03H 3GRWH 1FO0H 3RY5A 2UY7A 2AQ1A 2X4QB 1INEL 3SKJL 4JHWH 4HWZA 1QSVA 4CVUA 2W9EH 1FDLH 3UEZA 2UYLA 3I02B 5INCA 4QLRA 1RZFH 1UT9A 2X41A 5DURB 1ZHKA 1XCQA 3SO5A 5ANMB 3SGDH 1W8NA 5ECJE 1FN4B 1OP5H 4KJPC 5ADOH 2C1PA 2HT3D 2E6PA 5EU3B 3VFTA 1MUJA 5H35A 1AXIB 3TF7C 1I1YA 1S9XB 2AAVA 4NQCB 1UA6H 4M48L 2AXGA 2A83A 3ZL4L 1ZT1A 3FKUS 1MCFA 5FCUL 4AMKL 4Y19D 1A02N 4OCSL 5M95B 1W72L 2D0FA 1FNGA 5C1MB 1LQSR 1RUQH 3RVWD 4S1SL 1XCTA 1YY8A 1G7PA 4TNVF 1A1MB 4WVRA 3RVXD 4HF5L 4UTAH 3N85L 4XP4L 2WBJD 2JIXB 3SKOA 1XGUA 5DJXA 3HPJA 4ELMA 1K5NB 1NGZA 1IGIL 3KWWB 3MREA 1QP1A 1CWVA 3ARZA 3OAZK 1OTSD 3DECA 5D8JH 1ZVHA 4JFFE 3V6OE 1N4XH 4JAMA 4PGDA 3MXWL 4XPTH 2XY2A 3QT2A 1C5BL 4L8DA 5GGVY 3TBTA 4M9PA 3RI5F 3NCMA 5MP6H 3GB7A 4XB8A 3F5WB 1RY7B 4LEXL 4ONGH 1YC7A 5HY9A 2QEJA 3D39B 4G8FA 1J1OL 2NY2C 2FJFA 1UB6A 2FHBA 1SJXA 3O6FD 3O41B 1LEKA 2WIIA 3QIWD 4L9LA 2I07B 4Z7UA 3D6GA 4KTDL 3I6KA 4WO4B 4OV6F 2DD8H 3PXHA 4HS3B 1XF2B 4LVEA 1X5IA 3D2UD 5L9DL 4XGZB 5BVPL 4RGNC 4YZFF 1PY4A 3QJFB 2ZOKA 1DFBL 2DLHA 1OAQL 1Z3GL 1HNFA 5CEZH 4Z7NF 1GCFA 5HDQL 3N0PB 5D5MB 1PG7H 2ZUQC 5KVMC 4PGJA 1AY1L 3VGAC 4Z95H 1U36A 1EA9C 5FYLL 3OKNA 1MCQA 1W2KT 3KLHC 1KC5H 3EYVA 1D5XB 2Q6WB 4OI7A 3RWDA 3U36A 2O61A 4M5ZL 4U3XA 1OLZA 2RJMA 1MCLA 2CIKA 8FABB 1AJ7H 5EU6E 4BUGA 2NY4C 3GIZL 2J8OA 5EG6C 3MRBB 2N7AA 4HMCA 4XC1L 1F3DH 1OP9A 3MRFA 4JEGB 5GGRA 4CNIA 2M26A 2PR4L 4JPWH 4UQ2A 5FF6B 1NAMH 1U8LA 1A5FL 1I1RA 3O8XA 3E2HC 3UBXG 3RTQA 1T03H 4MJIE 1NJ9A 1T80A 1O7VA 5GRZA 4FQ1L 2ZCHL 1Z9SA 1EEYA 2IALB 3ELAT 2ATPA 1WZKA 4I8DA 3G08B 4LPWA 4OZGB 5A1AA 1URLA 3RKPA 2H3NB 3S3SA 4OKVB 1T7WA 1G7MA 3A6CL 1QZ1A 3MJ9L 4HJJH 4XAWL 2OTWA 1T20B 2NY1D 1TPXB 3RL2B 4G6MH 4JR9L 4ZDHB 4KDWA 1F4WH 3INUH 3VXRB 4LLAA 1DN2A 1CDYA 4FQJL 4XPFL 3VXSE 3NCFB 5DSCA 3ARSA 3VXNA 1GGCL 1MAML 1BIIB 1U0QA 1FL6A 5D7IF 5IVZA 3SDCC 3FFDB 1DQJB 2YK1L 1OGTA 2VL4A 3QNZB 1KTDA 4CDHA 4Y1AB 3HE6C 1XZ0A 3GMRA 3V0VA 1GGUA 1PVHA 2J8HA 4RZCA 5IB2B 2B20A 4MB5A 2MTPA 3D25B 1BM3H 2A0LC 2CUHA 2XFXA 4XWGL 5D7LD 3MRCA 2YA1A 5CBAB 5BJTA 4JVUA 2QKIA 4MAUL 3BGFB 4LQFL 4NYLB 3M8OH 4R0LC 1JV5A 2H32H 1AI1L 1IGCH 2DB8A 3S37X 4ZUSA 3VXPB 1S78D 3LV3B 1MIEL 4Y4HB 4XX1G 5J0BA 2Q8BL 4X4MA 4KZEL 2Z8SA 1X5JA 5F9WC 2G5BA 4PS4L 4YC2C 1EMTH 1FFOB 1MCOH 3OPZH 4X6BA 1YEEH 4K7FB 3S88L 2IBBA 5BS0A 3MMEB 4Z8FL 3G6JF 2GK2A 5CIPH 2CK0H 3RDTC 3L7EA 2BSRA 3WJLC 5LGKA 4P4KD 3RPKA 3DURA 2HKFL 1MI5D 3R0MA 3R1GL 2EIZA 2R2EA 3IFOA 4LF3B 1AP2A 2OCFD 1ZGLB 4L4TD 1EBAA 4ORGA 1AHWA 4GW1A 2MMXA 1N5YH 3MLSH 1KOAA 3U0TA 2HLAB 2D9CA 4ZNEE 2NW3B 1KPVB 5DUML 3K7UA 2VNCA 4YK4C 4K71C 1LO5A 4Y5YA 3C60B 1T1XB 2ADIB 3VWJC 5F7HA 4D9QD 4LLUB 1DQLL 43C9B 1ZTXL 3QI9C 1Y6NR 3ULSA 4L4VB 2X4NB 1U93B 3TWCH 4PY8J 4ERSH 4I77H 1U8HB 4HS6B 4ZUWA 5E00B 3EJYC 3GBLA 4OCRL 3F7RA 2HWZH 4UINH 2WZPD 2J6EL 2AKRA 3IKCA 4O58L 3LIZH 9CGTA 3TYFB 1FAIH 3D3VA 5F7LB 2QQNH 3ARGB 5ID1B 1FBIH 1NANI 5L0QB 1CL7L 3U7AA 1NC2B 5LAXB 5D7SH 1GZPB 1UQSB 5T1MB 1KJ3H 1U92B 4WWKD 4MXWH 4Q0XH 4CN4A 3B3IB 1E4XI 1CR9L 4HH8A 2AI0H 4WUUA 5BVJA 1XH3B 4OZHF 5F72S 1UZ6E 4NSKB 1B4JH 4OLXH 4MD5A 4W4NA 5E8OA 2H26A 3HR5B 1P53A 2OTPA 4OF5A 1FV1B 4XC3H 1C5DB 1H8OA 4P9HL 1A0QH 2OXGA 1OCWH 1YEIL 3QEQB 4F7EB 4PJ5A 2EDEA 4F33A 1H3PH 4ODBD 1LK3H 1ES0A 3E6HA 3VH8B 1O0VA 5IOPB 3UPCA 4PG2A 4N0UE 2NY6B 5FB8A 4FOMA 4POZC 3QNXB 1J12A 2O26U 4OGYH 3IXTA 3L7FA 1F3DJ 1CFNA 5HGHB 1QSFA 5I1JL 4PRDB 1PKQE 4CW1A 3MUGA 5I8EA 1S5HB 3LKPB 2QADC 5D2LF 4XNZC 1MEXH 3DVFA 4PJAE 2OMNA 3ULUF 3VRLF 3RA7H 4D9RE 3RL1A 5FHBH 2Y5TB 4P0DA 4NKOB 2PCPA 2VLJD 1PEWA 2BK8A 1QLEL 3F12A 3UO1L 4TPRL 2BVEA 2IQAA 4LKCA 1KLGA 3IDIA 3VFGL 1CDCA 3QZWB 3M17A 4KKCC 4AIXA 4HFUH 5JXED 2Z8WC 2XZQL 4C83B 4P5MB 4TTGA 4D0BA 4ZUVA 5C6WH 1RVFH 3VWKB 5I19L 3MC0A 1ED3B 1VFOA 1MFCH 4PY7A 5HHOD 2OZ4A 4FMFA 1MPAL 1CFTA 1RUML 1F58H 4O9HH 5E8EA 5I1AA 3RHWF 1KSRA 4PJ9A 2R1WA 4P2RD 4CVZB 4LKXB 3B9KC 3MROA 1PG7W 3QFJB 4F2MB 3P0GB 3ECBB 3PP3H 3GJEB 5EUOE 1KB9K 4XB7A 3O2WH 4WW2C 4XPHL 2M2DA 2EYTB 3H7BA 3GBNH 4FFZL 4IOIB 1HYSD 2ZUVA 3S3JA 1QSEA 1V7MH 4GRLD 4KHXH 3NIDF 3H0TB 3OAUL 3PV6B 3AMLA 2ADFL 4PLJC 1UXWA 1IM9B 2PNDA 5KJRH 3SGDI 1KCKA 2CDEB 1OARL 4DUWA 1QFUL 4HKBB 5KVEL 1EO7A 2G9HA 1G84A 5CWSB 3GSNL 4DGVH 4WJ5A 1BMGA 1TQBC 5A16B 2XRAH 3F8UB 3SBWC 2VLKA 4JM2A 3OGCB 3RU8H 3IDGA 1A6VL 3DX7B 3MNWB 2BVPB 3UZEA 1JTTA 1CI5A 3GKZA 1U91A 4JFOA 5D70H 4NOBA 3CMOL 2VH5L 2BNQA 4JFXB 1VPOH 2MCPH 2OSLB 4MS8C 1JYVA 4KK6C 4Z78B 3MLRL 5GGUB 3QNYB 4M6OL 1CICA 1HHKA 3W0WD 3DUUA 2CO6B 1CFQB 2F5BH 3O4OB 2FJHB 1PAMA 3GSXA 4YHNA 3QUXD 1G7QB 4DOHE 5SX5K 5E5MB 5IROA 3R4DA 2J4WL 1XGTB 2Q86B 4JFYB 3MV9A 2OL3B 1HHGB 4HWBA 4UV7H 4TSCL 5C0RH 4RMWA 2FGWH 5DQJA 4KQ4H 2E9JA 3JV5A 3WHE1 5IHUL 5F1IB 1QLRA 3MRQA 4PJ7B 5ICXB 4H26A 5M94B 4PJDE 2CR3A 4PY8I 4HZLA 2ED9A 2ZSWB 2CIIB 2FX7H 2GJ6B 4JFEB 2CJUL 4CL7A 1TZIB 4YPJA 4LU5L 4O4YH 1U95B 3O3DA 1SEQL 2BP3A 2BRRH 1A7PH 1NAKH 3G5ZA 4YQXL 2HA1A 2XY1A 3MV8B 4Y5XC 4DGIH 2DWEA 3VFMA 2UZIH 4F7TB 3KR3L 4NPYA 2ADGA 2ESVA 3P11L 4RDQF 4LCCB 1CN4A 3NCEB 1BD2A 4NO5B 2CMRL 2ICES 4HHAA 1U3HA 1DN0A 1OTUD 3O4LD 5DD5H 1P2CB 3LB6C 1YNLH 1HI6A 3BRFA 2H6PB 4XVTL 1UJTA 2BNUA 2KUTA 2XWTA 4FXGA 3LMJL 4WFFD 2IANE 3GZKA 3EOAA 1NAMB 2IH3B 4QHLA 4P9MH 3O6FC 4QO1A 2FEDD 3CX2A 4IIQA 4JKKA 2V5MA 1HINL 3MRKA 4HEME 4JJ5A 3BD3A 4KK5C 1HEZB 1QO3B 3LQAL 3V52L 4Z7VB 3F7PC 3FRPG 5C0ND 4WNQB 2UZXB 3IGAA 1AD9B 1A7QH 5CILH 4JQXC 1LEIA 4KZDL 1T1YB 3T0EC 3QCVH 2XWJB 3MLUH 3MA9H 4MXQC 2RFXB 1R3JA 3LN9A 4H1LG 4MNGA 2HFGL 2PETA 5SWSA 3DWTA 4OLWL 4Z0XB 4KPHL 4N8PA 1TTGA 4TVPL 2F5AH 1A1NA 1G0YR 4HPOL 1B0GA 4R8WL 1JJUA 1IZJA 4JY6A 1YMMD 2ICWB 5I30L 1G9MH 1D5MB 2EDKA 3BI9X 3ILQC 5F89B 2XTJB 1OT2A 1T0NB 4JGMA 1RURL 2EH8L 3WKML 4H20H 4OD2B 2ICWI 3EZ8A 3IRZA 5GZOD 3KPSA 3TBVA 3GO1L 3QQ9D 4G42B 3NA9H 1IGMH 1N3NA 1FIGH 1JHLH 4M43H 1SVCP 5I1EH 5GS2H 1XF3B 1FG2B 5EU4B 2V5TA 5EU7E 5DMJB 5HXMA 1QRNA 2VAAB 3RGVA 4EQ3A 4WEUD 1ZS8B 5CJOH 3ARUA 1BBJA 3HTLX 1ZGLM 2UVFA 1OAKL 3SY0B 2VDNL 4WUKH 2X4SA 3OKDB 5D1QD 1DTUA 1IGTA 3H9SE 3Q1SL 2PW2A 2NY0B 5EBLA 5E99L 1JWMB 3KPNB 2PYED 4HUXB 2VLRD 1IGJA 5IV2B 3BZ4B 2KQMA 4K94H 2UUDK 3D5OF 1CD9B 3V0WL 5B8CC 2YD5A 4HIEA 3MODL 3O3AB 3MLYL 2X2YA 3QEHB 2AJZA 2NYYD 4G8GB 4K9EH 3UBXB 5T5NG 1AGFB 1WIOA 2P8LB 2V2WB 3ZO0A 4QRPA 3FQTB 5EBWA 5BO1H 4D0CB 3U9PL 3DETD 3ZYZA 1JN6B 2VDPL 4QRUB 1GSMA 3P9MA 3UTSB 4ZFZA 5D96B 1AXTH 3HZMB 4EOWL 4ZXBC 3I9GL 4PB9L 1DLFH 3LRGA 3NTCH 3CFKB 4CMMB 4H1LH 4P2QA 3TVMC 5F6IB 2EICA 2AK4E 3RUGF 3QHTC 2I9LB 15C8L 4OM0H 4S1DC 1KIPA 3SGEH 1A9BB 3IETA 3C5ZA 3QRGH 3TPKA 3V6OC 5GGTA 4NRXB 1CG9B 2YC1B 2HLFD 4PRBA 1T22A 2NQCA 3JTTA 3LKQB 1EO5A 2FNBA 2EDJA 3BE1H 3S97C 5T3ZD 4FQPA 1BLNA 2F53A 2DI8A 2GY7B 4HK3N 4YXLH 3EUUA 3MPCA 4HIJA 5H94B 3PQYB 4X6DE 2O5XL 4IRSA 3GKWH 1A3RH 5CP3H 3FFCB 4BQ9A 2J2ZA 5T5FL 2VDML 3RAJH 1OAYH 1WWWX 4TQEL 5CKAA 3SPVA 3WNKA 4NP4L 4FFVC 4QXUL 3TIDA 4AG4L 5FM8A 2NLJA 4MAYA 5ALCL 4X4YB 1G7HA 4ZFOA 3BKMH 5GGRY 2IAMA 1BECA 3D9AL 4LHQB 5CINL 2WINA 1B0RA 1XGYH 3E6FA 5D7IA 1UADC 1KELL 5TF0A 2EZ0C 1UVQB 3TO4A 1RZGA 1CD8A 3CLEH 2OJEB 3THMH 1MY7A 2IPUK 4I0CC 3SE9H 4XVUC 2GTZB 5F7DB 5FYKH 4Y2DB 1MJJB 3WL9B 4DN4H 1BQHA 5L2KB 4C56E 1E4KC 1ZSDB 3WIIL 5EFIA 1KYOK 4NGHH 1A2YA 4LP5A 1IILE 3IJYA 3T65A 2R0KL 2MPAL 5IMOA 3QXDA 3T8XB 4LARL 5FKPB 5I9QC 3UTTA 1QBML 4ZPTB 5C0AD 5DA0B 1YNKH 3ZT7A 1KPRB 3HAEG 4QHMA 2J8UB 5FK9A 1YA5A 2Z8VC 4P2OA 2VRAA 5F3BB 3BSZH 2Z31C 3CFEA 4NDMB 4EJ1C 5HYJD 1UZ8A 4XCYB 1IGYB 4JO1L 1I1AB 5IB4A 2AJYH 4XRCA 5J6GB 4LLDB 2VSDA 3ESVF 4LCYB 1MCDA 4MCYB 3U83A 1FSKC 4PJEE 2V17L 4MSWA 2UWEB 2I9TB 5EO1A 5I0ZA 1D9KD 4XXCA 2JELH 1T1ZB 4RBPH 2FD6L 2X4RB 1ZHLB 1Q72L 4HUVA 3NABH 2VN7A 1JWSB 5CEXB 2ADJB 3HZKB 4L5FH 4KRLB 4QRRD 1OTTC 4WV1C 5E94B 4JFDB 2V5YA 1VGKB 4FNLH 1K8IB 5T33L 1CE1H 4JG1H 2CRMA 2QSCH 4K3EL 3VW3L 5F9JA 1CXFA 3S96B 5ID0A 2IPKA 3BPLC 1I9JH 5GGVL 2UVEA 1ZLSH 1I9EA 3EFFB 3KJ4C 4X7SL 3SO3C 4EI6B 2D7OA 3C2AH 4YEEA 5B38G 3MCLL 4HMEA 2D4DA 4LHUD 3OAYK 1KN2L 3SE3A 2VZUA 4EKXA 3NCBB 4EQ2A 1KV3A 3HZVA 5TE6H 2HG5B 4NKDA 1UJ3C 1JPSH 4UBDC 3QO1A 3WDIA 1I8LC 2G5RA 1HILA 4HIHA 1OGAE 5EPMB 2JLLA 1KBGL 1QVOB 1VACA 1YEJL 4LPCA 4S0TD 1WITA 2GSGA 4GRWH 1CXLA 4OCMC 1KG0B 4OZHA 4NHCH 4PTUB 1DBJL 3ULVL 5E8PA 4HEPG 4RMUA 3S37L 3PNWB 4RIRA 4HPYL 3V8OA 3KYKH 1DLHA 1VEPA 3O6MH 3I3DA 4JRXD 1M6OA 4F7PB 2ZPKH 3GSUA 4ZOBA 2E9WA 4L8SB 3QIUD 3TV3H 4UAOB 1ADQL 5KSVA 5L88H 5ISZD 2WWMC 3IJHA 3QDMD 4GRLC 5E70A 3VFUA 2IBGA 4Q9RH 4C57C 3HAEH 3ZYJA 1ZHNB 3GMPB 1QFWM 12E8H 1QBBA 5MEPB 2EXWC 2GK0A 4QXGL 5D2LA 1CT8B 5ESQA 4DKEL 3KPRE 1YEKH 4JDVB 1I8MA 1RUAL 1A6ZB 3ARDC 3KYNB 3QDGA 4J3XA 5CZXD 2E5EA 3SKMB 5I1LA 1G7LA 1ZWIA 2EH7H 3DSNA 1QHOA 3FQUB 1G7JB 3HNSL 3W39B 4F15B 4E0RB 3W2DH 5IKCA 5T3ZL 3OAZH 1OQXA 3ARBB 4X9BA 3RHWK 4F37F 2V7HB 1J7VR 1M7XA 1MCNA 3RIFF 2DLGA 3L6FA 1ZK9A 1Z9MA 1QA9B 2CKNA 4G6FB 2E9IA 3X3GH 5TE4L 2BNRB 4P23B 3ARVA 5A43C 1GL4B 2BHZA 3KLSA 4XXDA 3CDCA 1LE9B 1AIFA 1I85C 1YEDB 5FAAA 1JUFA 1J8HD 2DBLL 1TQCC 4Q6IB 3L3DB 4R96A 1UFUA 3D85B 3WDHA 1Q9OB 1YUHA 4N8VA 3WJJA 5C2BL 1S5IH 4TUJB 4XNXH 4CADB 5D5ME 1CVSC 1HOCA 3BO8A 5D1XC 3JUZA 3FB7A 1P9MA 5BRZD 4MNQA 2HKHH 4XPAL 5I8OL 2WUCL 3FT3A 3G6AB 4PBXA 1FQ9C 4TSBH 3T0AA 1FFPA 3CFJB 2Q76B 1OWWA 5HGGS 1MJ8L 3PL6B 4YWGL 4RAUB 5TGBB 3U9UA 5KVFH 4CRPA 5HHXL 4N68A 3T0BA 5FO9B 3OXRA 2B2XL 5E9DA 1DSFL 1JHTB 3S4SG 7CGTA 1OSZA 1TVBA 3HR6A 3T3ME 1H15A 5LCVH 4Y4FB 2F19L 1WF5A 4WU5B 4NQDA 5KOMC 5HHQA 1CGYA 2YUXA 3RBSA 1WTLA 1LGVA 4IOFD 5L7XL 4YDVA 1IC7L 1YQVH 3VRIB 3ZKNC 1UM5H 4IOSD 7FABH 1N8ZA 3L5XL 1MRCH 1NDGA 4KDTA 4OZGE 3HFMH 3AS0A 3E3QC 3CK0H 3FONA 5J11C 2C4FT 3WFCH 4L3ED 1BJ1H 4OGAD 1OTUC 4L8BA 5I73C 5JMOC 4LSTH 3AREA 3QUMH 1BAFL 4OQTH 2DMKA 1WBZA 4X99A 3N1PC 1AD0A 3LS5H 4JN1H 2XNAB 4DW2L 4PYHA 3UXFA 3VD4A 1EX0A 4K8RH 5ABDE 3PGFL 2FEDC 2P46B 1ZE3C 5E6IC 2R4RH 5GZND 3P9WB 3T3PF 4ZO8A 5JOPD 4UIKH 1MCEA 4NQCD 2AABL 3HZYB 2IMNA 3N1FC 4DQOL 3CFDB 5DMGC 2MKLC 2A6IB 4UIMA 4MQSB 1TJIH 2XG4A 5DJ8B 1K8DB 2DQEH 4Y1AE 4GMTH 4ODVL 5MERA 4PRPE 3OF6D 4PJFE 1HZHL 1ZEAH 4JY5L 3VXUA 5IF0A 1LK2B 2YD7A 4UB0L 5D93B 1V7NH 5JPNA 2P1YA 1JI1A 2R23B 2BRQA 3GUTB 1ONQB 2Z92A 5LJYH 1JYNA 1J05A 4KJQC 5C0CB 1NBZA 4X5WB 5E2TL 4RA3A 3TYGH 1W0VA 2VKWA 1FGVL 2XI9A 2YKLH 3QQ9C 4YHIB 4F9PA 5I0DA 4GG6E 4MLSA 2RAMA 4Y4KD 4OIIH 1FVCB 5F96L 1N64H 1R5WB 2APVA 4QOKB 4X6CB 3MOAL 3V7AG 4U1LA 4KKBD 1CLYH 4H1LB 1T7YA 3DVNA 1WZMA 4BH7A 1IQWL 1KCUL 3MV7A 4WO4D 3UAJD 1FZMB 2X1WL 4YAQA 4EVNB 5IEHB 4PV8B 4IS6A 4NM8H 1NGXB 1GH7A 2HVKB 4LEOA 5D1QC 1TETH 3BP5A 4WU7B 5DVKA 1U8OB 3IVKA 3EGSA 2YPKA 3HC0A 2FLBT 4HK0B 3MV01 4LASL 2NX5A 3OL2A 4KTEL 5KSAA 3ULVC 2FIRT 3EJZD 2YRLA 4FQCL 1WWAX 3BKJH 3ARXA 4YX2H 3OV6A 5TQ2L 1NGQH 3C6LB 1INQB 4HWNA 3V2AR 2DQTH 5GIRA 1CFVH 4GKSA 2DQHH 1N6VA 5TDNB 1KJ2L 3WIHA 2VSCA 2XACC 4NZUH 3ZLQC 2AV1B 3MJ7B 3TN0A 5MENB 4JHAL 1PLGH 5DWUH 4POUB 5DHXB 3TH2T 4P3CH 1XT5A 4JQIH 1GIGH 4OLVL 2DJ4A 1EUTA 5ICZB 4ZO7A 3MXVH 5D7LE 4R4ND 4LQ1A 1YYML 4LDEB 3BPOC 4OT1L 3QH3B 1A7RL 2NTFA 4OF0A 3QDAA 1A6UL 4X98B 5GXBB 4AT6A 1YDPA 4AY0A 2FECI 4G9FE 3TH3T 3HI1B 3EDEA 2P8PB 3VXRD 3LKOA 3CCHB 1U8QA 2X1PA 5IB3A 2JJTA 3I75A 4O51A 4KUZL 3ROOA 1AXSB 1GHFH 1HDMB 4OLYL 3C08H 4LPVA 4BUHA 4X6EA 1NBYB 1T2JA 3DRQB 3P4OB 5IW6B 4M61A 3VGBA 4DVBB 4Z7WB 5C09A 5LGHH 3BP6B 5C08B 5JHDB 2HFFB 2HJLB 1LMKA 4BZ1H 5GGSB 3W9EB 3KXFB 3EO0B 3WFDL 5GS1C 4FQXB 3IDNA 5TFSL 4B53A 4BQBA 4XI5D 1P1ZB 1VADB 1W0WB 2VKXA 5FYKU 2IC2A 3B8SA 2DKMA 1BQUA 4HZAA 4Y4HD 2ZUXA 3RUGA 3QFJE 4YHYC 3TP4A 2XIDA 3FB8B 2CKBH 2E27H 2ZKHH 4TOYL 2OI9B 2E9BA 3MGOB 1A21A 3S5LG 3DROB 1U8PA 1AFVH 5DUPH 1X3DA 4DN3H 3MSPA 4ONFL 2UYLB 4GAFB 4U05A 2AJVH 1IC1A 2GKIA 4XBGB 3C09C 4ZAKB 3Q3GA 2VDKL 4KMLB 1UEYA 3LPFA 4RGOL 3ZTNH 3BISA 5HGBB 3AUVA 3WFBH 4GRWB 2ATKB 3MLTB 5LKNA 1OD7A 1JZ4A 4BK4A 4FTVA 4G6AD 3EOTH 1H8NA 3TESA 2VIRA 1CFBA 3IAPA 1AR1D 3G6DH 5EWIL 2AXGB 4FZEH 1TVDA 4P46B 4NO2B 1VCAA 4MNHA 1DQQA 5C6TL 4YDJB 4W68A 3W82A 5DS8A 2BMKA 2Q8AH 3C60D 4A2MA 1XCTB 1YY8B 3EKCA 4H0GA 1S7SA 1FL5B 5JNYB 4PJ8C 3K1KC 3O8XD 3PWPA 1Y6KR 3HAEB 2JK5B 5IVOA 3SKOB 1J1PH 5GPRA 5DK3A 3HNTL 4L4VD 3OX8A 3QDJD 1M71A 1FORL 1XEDA 3MRMA 1HHJA 5CP7A 1XIWC 2J5LB 2VLJE 3CXDL 1NFDE 5FXCH 4X8JB 4AZ8A 5CUSH 4GKZA 3ARGD 3DLQR 2ZG1A 4NUGH 2XN9B 1CD0A 1QOKA 1NC2D 5HYSA 3TBTB 3LS4H 3OB0K 2IPTL 5E08L 1R5IB 4EI5B 5C92A 3CFCH 1WCBB 3HN3A 3CGTA 4K3DL 3HG1A 5J56B 4QT5B 5CZVH 1KXVC 3K4ZA 5GJSL 4XCFL 2YPVL 5HY9B 3OXSA 4HWBH 4G8FB 1X4YA 1PYWB 5C9KA 2PW1A 5C0JB 4PJBE 5SX5H 4HIIA 1UC6A 1N5AB 2P5WB 1H5BB 1ZA3B 4IMKC 1TZGH 2Z35B 5E7BA 3QEQD 3I6KB 1TZHB 1MNUH 3GJFB 1IC5H 2CLRB 5DJ6A 5T3XD 1I9IH 3MLZH 2PYFA 5B38B 3QXVA 4J1UA 3REVB 5E1AA 3GHBH 3GMQB 1QHPA 1NGPH 3FOLA 5F1KC 5FGBC 2NY6D 3O2DH 2VXUH 5AG9A 5GRUL 5B39A 3FQNB 3RJDA 5AYQA 1DL7L 4XNMB 1JZ8A 2PKDA 1NLDL 3GNMH 3BZFA 3NPSC 1JZ2A 5DT1L 5E2WH 5DR5H 2VJXA 4F57H 2FH6A 2FEEI 1YZZA 3FCTA 4E9LA 1NLBL 4OCXH 4GRMB 3I6GA 4BFGA 4KH2A 1ZVSA 1OSPL 3VWKD 5HVWA 3MRFB 1U8MB 4F7MA 4O2EA 4P5KA 4H0IA 3WYRA 1BF2A 3LEVH 4D3CH 1LD9B 4JM4H 1RIUL 1JWUB 1FNHA 4LK4A 3EO9L 3AROA 4UQ3A 3SDAB 4JPKH 3W0WE 4JKPL 3MRGA 1F90H 2ATPB 3QUMB 4FQIH 3IDXL 3AY4A 3ET9F 4JDTL 5SWZB 4AIZB 5TF1H 5L8JB 1D6VH 4Y8DC 1BFTA 2CGRL 4C4KT 3QWRA 3SJVA 2RCSH 3GSQA 3RNQB 2PXYC 1YJDL 4V1DB 4KKAD 4Z7QE 3HE6A 3VRJA 4OTXL 1CLZL 2NY2B 3VFNB 4OFKA 3DX9A 2AV7A 3D3VD 3TH4T 5C07E 1UXSA 4LCUA 2Y72A 4U3HA 3ZDXF 3MBXH 3ME0A 3RIFK 1OGTB 2VDLH 4RGMC 2XKSA 3UC0L 3FMGH 4NO0B 3T09A 1E6OL 3Q6GH 1HYRC 5D6DA 4ZSOE 4PJGB 4U1IA 1A4JA 1QBAA 4RGNB 3KVQA 3N06B 1NDMA 3BN9D 4Z77A 1KNOB 3S8WA 4JO4L 1V3LA 4UTBL 5E8DH 1MCCA 3ZKMD 3M1BA 1FRGH 3VD9A 3EYSL 2VC2H 3H9HA 4FFWD 4ZUSB 1NH6A 3WJLA 5ITBH 1HNGA 1SYSA 1T2QL 2ZCKH 4M6MH 4Q2ZA 2IBZY 3UPRB 3NCJL 4GXVL 2VXVH 3S4SB 4ENED 5E1HB 3O4LE 5ITFA 2G60L 5IFJA 3MCG1 5BS0B 1F4HA 4NWTH 3QG7L 1QSFD 5TQ0L 2G75A 5GZNC 3V0AC 4WFFE 5CBEB 5IIEB 1MCWW 4PPTA 3CU7A 4DUXA 4YR6B 1VFBB 4DJMA 3W9DB 3F6LA 3MYJA 1HQRA 4LDOB 4ODXB 4OAWA 4ZOEA 4G8EB 3VWJA 1WC7B 2IPUG 4JFED 3JZ7A 1AHWB 4ETYA 1RZKL 1YPZE 1ND0A 4AM0A 1W72A 2C1OB 2UUDH 2WLZA 5DK0B 5KOVC 3QHFH 3QQNA 1MF2H 5LGJA 3KPQA 3MV8D 1E4XL 4HKXA 1JPGA 5CEZD 5DFTA 1F3JA 4YPGA 5FUCE 3PWLA 1WEJH 4LSRL 1CQYA 1YEHH 2K9UA 3BUTA 1J11A 5KVGH 4DKAA 2GUOA 2A73A 5D71H 3ZT6A 2CRIA 2K1MA 3ARFA 1Y6MR 1E4WH 5I17B 4PREB 2VDRH 2W0PA 3P77B 5IMMA 4OFDA 2Y23A 3HE7B 5EZOH 3VCLA 2R8SL 4WCYL 3FT4A 1IEBB 5T3XL 1EO8H 1MWAH 4AQ1B 3BKYL 4L1DA 3SDCB 1HH9B 3BW9A 1FYTB 4PTTB 1ZAGA 3IXAB 2A9ML 5ESAA 4IDLA 5BVJB 2FWOB 3WO3B 5D1ZB 3MJ8B 3MO1B 4WO4C 3RWJB 3WNMA 2CXGA 3GEWB 1SM3H 5I18L 4OZIE 1R3IL 2VLMD 1RIHH 1S7WB 4NBYB 3K8KA 4PBWD 4UUJB 2X89D 3ETBF 1LP9F 4BKLA 4BSWB 3WN5B 3QG6A 4ETQA 5EIIA 3DO3A 3H3KA 1PZ5A 3HI5H 3MJ6A 2HTLC 4RFEA 1JFQL 1XF1A 3VE0A 3K8LA 2EYRB 3G04B 2LTQB 4QXTA 2BY2A 2BNQD 2CO7B 2IBZX 4FHBD 5C0BE 5ELIA 3L7FB 3QCTH 4HBCH 4TNWF 3MUGB 1DBML 2ARJQ 1L7IH 1FH5H 3BDBA 3MRIB 3MGTB 2XTJD 3RL1B 1EEQA 2NY7L 4FABL 1IMHC 3L3JB 3GRWL 5HHPA 2F8OA 5SV4A 2GTWB 3QJHA 3V95A 3MRPA 3IDIB 4JHWL 2W9EL 1LDSA 1KACB 3V4VH 1ZLUK 1RZFL 3GSVA 5T1DH 4D0BB 4Z6AT 3B9KA 3T0DA 5ADOL 5B22A 1NEZG 3KPOB 4NQEA 4N0RA 2BVUA 4LLWB 3BEVA 5E8EB 1F6AB 2CKBB 2CDFA 1X7QA 4LRIA 2C3VA 4PJ9B 2R1WB 5JW4M 3QI9B 1UKQA 4PJIF 4CMHB 4FA8A 5DFVD 4QHNA 3U7WH 4UMGA 1RUQL 1TPXC 4GBXB 4U6XB 3PF2A 3PDOA 2FIKA 2CH8A 5ERWB 3MJ9A 5DRNA 2ESVD 5E2VL 4KK8C 5DTFB 4UTAL 3SBWA 4YGAB 1QSEB 1A14L 5IVXF 2P24B 5FYJU 2FX8H 3OR6A 4JCLA 5IG7B 2DQGH 3ZKSD 2R0LH 5I1HH 3DXAB 2DQJH 5AZEL 2XOTA 3OKOB 4B41A 3ZE1F 5CMAA 4XHQA 2DTML 5D8JL 4MB3A 1CU4L 5K9KB 5EZLB 2GAZA 4N8VG 4XPTL 3MR9A 2MJWA 3UTSD 3JTSA 3WD5L 1L0YA 1IAOA 3CFBB 4PLNC 4S10A 1Y18A 3MUY1 4LLQA 4ODSH 4ONGL 2P8MA 2DN7A 4LAJH 4LAQH 4XI5C 1JE6A 2OL3L 5LXGH 3CVIL 5F93C 3VXTB 1MCJA 4NN6B 5HDLA 1YYLH 3OAYH 1Q1JL 3K74B 4Y4HC 4OUUB 5KS9B 3TGXA 1GGYA 4KFZC 1FE8H 4PUBH 4FMKA 1A6TA 1UGNA 4ZYKA 3STLA 2DD8L 4MLIA 4NCDA 3VI4E 3CH8A 4PJHE 3PQYD 1KCSH 5AZ2L 4EN3B 4Y19A 2FLRT 1K2DB 2YUWA 4NWUL 1MLCA 3TT1L 25C8H 4U1SA 2NY5H 4XTRD 3QPQC 5CEZL 4OIAA 4UT9H 3MQIA 5DQJB 3PWJA 4Y16B 2GJJA 1HWGB 3GMLA 2X7LB 4NOFA 4NN5B 5F7KC 2ZUYA 3N1MC 2P48B 2FX9L 5EUKA 4HZLB 4TYUA 4XPGL 4S1QH 2OTUB 3MOQA 3KLAA 4HXBL 5DJAA 3C60C 1AR2A 4RAVA 4X5XB 2V9QA 3S5LB 5IHZA 1LO2H 1I3GH 5DEGA 1P7KA 4D9LL 2O93L 1I7TB 2NR6C 1LO3H 4HIXH 2BNRE 2ZUUA 1OHQA 4XAKD 4JPWL 4WW2B 1NAML 2ZWLT 5JR1H 5I8KH 3L3HB 5L2KD 5I71C 3E1F1 2QSTA 4NRZA 4K3JL 4DEPB 5BXFA 2EDRA 2F74B 3KS0J 2J3SA 3O6FA 2I60L 1S7TB 3E8UL 2FZ3B 3C5SA 5L0QC 3ARGC 3N1GC 4HHAB 4GAGL 4XP5L 3LEXB 2J6EA 1DN0B 4MJ5B 4GW5A 4Z18A 5D72L 4YHMH 1MQKH 4GQPH 3HC3H 5TPWH 2YA0A 4YHKH 5LQBL 3D2UA 2BNUB 4O02H 4HJJL 4JFZL 1I1AD 3QEUB 4JQXA 2B1AL 3NCCB 2HMIC 5C86A 3T0EA 3INUL 3RPIA 5KANG 3ULVF 1MIMH 4G8IB 2FJGA 4PJCE 5IW1A 3TCLA 3P0VH 2XZCH 2PTTB 3ORJA 3QEGH 5FUOH 2MCG1 3BPCA 2DYPB 1OM3L 2OBGA 2XICA 5JLZB 1DEEB 4JFDD 4TUOB 1LEIB 3U46B 4XZUA 2FYYA 3VFSB 4MZ3A 3T0VA 1RV6X 3QDME 2KL6A 1A3QA 4M8VA 3V4PH 4KXZH 1GYAA 2C7UA 3BGMA 5HYQB 1I7RA 1I7ZB 1B0GB 5KSBE 3C5ZD 3WUZA 1CLOL 3SCMB 3AM8A 2NXZB 3M8OL 3SQOH 1IGCL 3VD3A 5EIVA 4CAGA 3SGJA 3HLAB 4WFEE 1MCOL 2X4UB 3OPZL 4OJFH 2AXFA 3GMMB 1PSKL 1C5CL 1ORSA 3W5MA 1J0ZA 4JN2A 2CK0L 1RJLA 1RIVH 1Y0LA 3EDJA 1DQTA 4X80H 5A3IC 4Y5XB 3C6SA 3SDXF 1IEAA 5TH2A 4NQSA 5F97E 5B8CA 3MLSL 3KYMA 3WS6A 5BOZG 2VR5A 2XXCB 3TBSB 3HCVA 4GKNB 1U8NA 4K3HA 4BH8A 4QTIH 2GQHA 4ZMAT 5TE7H 4KKAC 1S7VA 1Q9KB 2BC4B 5F8QC 3BT2H 3GIVB 4YIQB 1INDH 3MV11 4PRHE 5IBLC 2WUBH 4ESKA 2R4SL 2ITDA 1SBBA 4YNYA 5FKAA 2FR4A 2B0SH 1FL3A 3TWCL 3I2CH 1WTGT 1I8KB 2E7CA 4I77L 3UTTD 4P5TD 3GSNA 5AAMA 3B2UD 5GRWA 3MUHL 3QUYB 5KTEL 1S7XA 2HWZL 4UINL 2YPLD 3KHOA 4N1EA 5EBWB 3LIZL 5C0FA 4QOKE 4PJXE 2P4AB 2FHCA 1I3VA 5JW4N 3ARBD 1IKNC 2R56L 4HH9A 5D7KE 5I16B 3BN9C 5F7UA 4MX7B 1KJ3L 2F54B 3EYFB 5F7EH 4R2GC 1H8SA 2UV3A 4MXWL 4YGVB 4ONOA 4FP8H 1FZOB 2AI0L 3MRHB 3PG2A 4LLYA 4MMZC 3T2NH 3O4OC 4P4KA 2VZVA 3BUYB 3STZB 4G6KL 1MI5A 5DJYA 1J5OH 4J12A 5MHSD 3NIFF 3WBDA 4ENEC 3D18B 2N7BA 4G5ZH 4L4TA 2VR9A 1ROWA 1L6ZA 4ZTPH 3ABZA 4NKIH 3CUPB 1MWAB 3OR7B 2F53B 3U2SA 1LNUB 1LK3L 4HG4J 4DTGL 2EC8A 4MD4B 1DANT 3ES6A 3C9NB 1Q0XL 2DKSA 4OGYL 2MOVA 1P4LB 5JOPE 3PL6D 5GHWH 4KRMB 1LEGA 1MEXL 3HUJF 4NKMA 3EDDA 3RA7L 3WO4B 1G7HB 1QFOA 3KYOA 4Y4FD 3WIHH 2IAMB 1MCWM 3B8YA 5FA3B 2I5YH 1F4AA 4HJ0C 2BHUA 1E4KA 1XF4B 1HIMH 3OKLA 4TVSa 3VGEA 1OY3B 1RZGB 4MA3B 4XCCL 3X14A 4XPBH 4ZUUA 2FO1A 5L2JB 1YN7A 2MHAB 2D7QA 4N0FA 4KK9D 3OHXA 4KDVA 3WCYA 3NAAL 5K59E 2AEWA 1F58L 4O9HL 4UOW1 2EIDA 4HUWB 5IBTH 4FQLL 4K7PH 5D6CB 3QXDB 4RMSA 1S7QB 1FLRL 3R06A 3T1FA 1I7UA 1RUKH 3UCRA 1HH6B 4U1MA 1QQDB 2EYSA 2CLZB 3CX5K 2JCCE 3GBNL 4LFHD 4L3CA 4P2OB 5ETUB 3AAZB 1V7ML 4JANB 4X7TA 4WV1A 4NUJB 4YFLI 4LPTA 3BIAX 3WFHA 5KJRL 4QTHB 5HGAB 4Z76B 2H2PC 5KSUA 2HVJA 4J23A 5HYSG 4CVXA 3GI9H 3KNBA 4I1NB 3QIBD 2X4OB 4HUVB 2XRAL 5I1GH 5BQ7A 3S35H 3D0LA 4OIBA 2EE6A 3DBXA 4WEBH 3U0PA 3UYPA 1OLLA 1EUUA 1D5ZA 1R5VA 4PYGA 5FM5M 3VXMD 1KPUB 5ILTH 1NC4B 1KJMA 1QSZA 3GDBA 1U3ZA 5IB5B 5JXEA 5ID0B 4PGCA 2XTJC 3FTGA 5F7MC 1C12A 5C0CD 3HKFA 3Q6FB 5C8JB 5HDBF 2WW8A 5HHOA 1ZANH 5C2UB 3BH9B 1BPVA 2LAAA 2CDGA 2F5BL 2N4IA 4E5XA 4OCWH 4LOUD 4P2RA 3K4DA 4R4FH 3IFNH 5EH1A 4D0DA 4NKDB 4YHLH 2QHLA 3ESUF 4LHJB 3U4BH 1EXUB 1JGEB 1FFNA 1U8KB 1C7SA 3TNMA 3UTZB 1VACB 3UJIH 2FGWL 5C0RL 5E9DD 4URTB 4GRLA 1P7QB 4NNYA 4DAGH 2R1YB 2HYMA 5E8PB 3VFPA 1T0MA 1YEFL 5DD6B 1RUPL 1T4KB 2NY0C 1VB9A 3V79C 2HJFA 4WDIA 1DLHB 1EBPA 1LP9A 1GRWA 4OGXH 3LZFL 4LRNH 4O4YL 5I1IH 4TNWK 5CD3B 3FN9A 2X70B 5AWNL 2O5ZL 2WV3A 3G5XA 3BJLA 3TJHC 3PHQA 1SMOA 2I25N 3QQ3B 5FM5O 1E6JH 4ELME 1JK8A 2Q7YA 5EU6B 4U33A 2JKXA 1PJ9A 1EHLH 3C6LD 3SGKC 4K2UH 2DQUH 2YD6A 1R3HA 1LILA 1J1XH 1NEZB 5DJ2B 4PP1C 4QGTA 8CGTA 2Z31B 2ZSVB 3ARED 3PGCA 1D5BA 4MJIB 4OM1H 2ENYA 2IQ9H 5KVDL 4ZFFB 4YDKH 4MQTB 3RWHB 5D96C 3FO0H 2HFEA 2YSSB 2XA8H 1KEGH 1ZWIB 4MA1C 4TUKH 4BZ2H 1JRHL 5FYKD 1JGDA 5F6IC 4XMLH 2AEQL 4ZNCD 2XKNB 3L3GA 3KAAA 4Z7UE 4P9ML 3L6FB 4XP9L 4I18C 5HHME 2PO6B 3O3BB 5E24E 3MRNB 4LNRA 4EDXB 1NQBA 3DX8B 2XQYG 1DQDL 3OB0H 5FDWA 3U0WH 1MCPH 2NTSP 1L7TL 2EDYA 4PB0L 1KTLA 3VXSB 1JUFB 2P7TA 4HS8L 4X0KA 5LG1A 3S98A 2NY3B 1IKFH 5J57B 3EFDH 4PJIA 4JB9H 2OQJB 3HRPA 3CPLB 5CILL 3C8HA 1U58A 4ISVA 3U6RB 4KHTH 5DD3H 2HP4A 3BXNB 4MDIB 1U8IB 4E41A 1DUYB 3MA9L 3VI3E 1OAZH 4OFVA 4Q74A 1UJ3B 4DZ8B 5IFHL 3V5DB 2DQFA 5IVXA 4YUEH 3QFDA 5D2NA 5C0GA 4S1RH 1J10A 5H8DA 1NFKA 3QXTA 3OXRB 4ODUA 1NMCB 4KMTH 3QBTB 1TVBB 4JFHE 5IT2H 3F7VA 5JHLH 1HHIB 1U6AH 3QUKB 4JRYD 3GMNA 5C08D 2JB6A 2FSEB 4OB5H 1G9NL 1BQSA 1PQZA 3KXFD 2I27N 4Y2DC 2OK0H 3PV7A 4PRID 3HS0A 5L8LB 2QHRH 1JHLL 4O00A 5MEQA 4M43L 3LQZA 4ONHA 2YXMA 1DVFD 1P5UA 4HAGA 4TULH 4CN6A 5E6IA 1MHHB 1NDGB 2BVYA 2W9DH 2OM5A 2GIYA 5CJOL 5I1DA 2CLVA 3CLFH 2QV2A 3OKKB 3W11C 4NHUB 3WMSA 4L8BB 1BEYH 5J3HC 4WHTA 2C3GA 2PUQT 3NFPB 1D7FA 4C55A 2ID5A 3L9RB 4R97B 5HJ3A 4G43B 5FFLA 4QRQA 3PGDA 3SHSA 3WIFB 5IK3A 4NQXA 1KXTB 1RU9L 5D5MF 2YZ1A 2QQKH 5I2IA 2OLDA 3RWCB 3QRFM 1DE4A 4K9EL 3D0VA 4ZFGH 4JPIA 2Y5EA 3DI3B 1YMMA 1MVUB 1AGCB 2P5ED 1WBXA 4WI6A 1KB5B 1B2WL 3FO2B 1XGRA 2BCKB 3LKNA 3VXUB 5EOTA 3VFOA 1AXTL 1JHKH 4KY1H 3UTPE 3H3PH 1DLFL 3NTCL 5D1XB 3WHE0 4QF1B 3H8NA 3IJSA 3QO0B 4X4ME 1J05B 4JLRB 4OM0L 5GSVA 3BQUC 3NVQA 1HN1A 4OZIA 4YHZL 2XN9D 3QRGL 1B6UA 5DRWA 5BS0E 5DZNA 4OZGF 1BOGB 2BOCA 2A1WH 4EI5D 3BE1L 4YBQC 5KANI 2VOTA 3OKEA 2CR6A 1TJHL 1FNEA 5D1QA 5ACZA 5KG9A 1A9EA 3GKWL 3PIQA 4U1LB 1M7DA 3EO1A 2PYEA 3DVNB 5DMIL 2P5WD 2VLRA 5SX4H 4BH7B 4N0UB 1SBSL 2VQ1A 4JZOA 3RIAK 4PV9B 5C9JB 1PKQB 4FG6C 5CSZB 1ZT7A 4M48H 5ALBH 4IS6B 1OAUL 4L8SC 3ZDZE 3ZL4H 4PJAB 5FCUH 4UAOC 4X9GA 1MLBB 4P3DA 3F7YA 4HMDA 4OCSH 4APQB 1OF2B 5FUZL 1W72H 3HC0B 1S7RA 4CUCA 3ZE0E 1ADQA 2R39A 2R69H 5LVEA 4WY7H 4U1GC 4QEGA 3CLEL 5KSAB 3N85H 3THML 3AU1A 2NNAA 1AH1A 4KJPD 2GSIB 1MHEA 3I50L 3CSBA 5FYKL 5AD0B 2HT2C 4TN9A 2BSTA 4DN4L 1XFPA 4HUUB 3BZEA 2OR7A 3B2UC 3WNNA 4W4OC 3D3VE 1M7IA 4F15C 2WM0A 5K9OA 1JNJA 2FECL 4LIQE 3MXWH 1F6FB 4WUUE 4U3CA 3BH8A 3SDYH 1GZQA 5EUOB 4P23C 5DGQA 1MFBH 1AGBB 4XVSH 3BSZL 4OBRA 4HJGA 4JVPA 2AJYL 2BOBB 2C3XA 2KKQA 1BVLA 5IMLB 4M1DL 4G9DB 4Q6IC 4PJ5E 3SDXA 2VQUA 2N56A 2JELL 3M45A 1BFOB 1TNNA 1Z5LA 3NABL 4OF6A 4AT6B 2NZIA 1NCUA 5DJCB 5EBMB 4L8CA 5J1AB 1QSFE 2AGJH 3JWNC 3QULA 1N0XL 5F1NA 1DFBH 2A2QT 1CE1L 1OAQH 2VZTA 3PL6C 2VITB 4YXKH 3JWOH 1TJGH 3UTQA 1U8QB 5FOJA 3I75B 2NY2D 4MDJA 4O51B 3ROOB 5HBBA 5FYLH 1ZLSL 5C0EA 5GS1A 1BVKB 2YS4A 4X6EB 1VKXA 4EIGB 1QBLH 3C2AL 2EDNA 1DDHB 3TCXA 3TPUA 1CDUA 4M5ZH 1EHAA 5HD8D 1AKJD 4IRJC 3VXQA 4PLKC 1VHPA 3TT3L 4JO2L 3ILPB 5TE6L 3GIZH 2EC9U 4RGND 4JFQA 1JPSL 1QLFA 5CHNA 4DOHB 4QYOB 1NGYA 2X4PA 4XC1H 4KK9C 3L3IB 5C0AA 4BFEA 2ZOLA 1G9MC 3ZKXB 1TCRB 2PR4H 4M6AA 2K7PA 2D9QB 2DRUA 5GQBA 3BHBA 3RP1A 3EAKA 5HYJA 1ZLUH 4FQ1H 3KLHD 2NMSA 4EUPA 1HSBB 3L5WA 4UILH 4P59L 2AJ3B 1SJVA 1JNHB 3KYKL 2DI7A 4G3YL 3S6CA 4PJDB 2ZPKL 3DV6A 1QSEE 4AENA 4JG0H 5L88L 2E8YA 2NY4D 4AEHL 3MJ9H 1MELA 4XAWH 3WEXB 4QRRA 2A6KA 3AC0A 5J12B 1C16A 1B6DA 1IRAY 3EOBB 4FTVB 5IWLC 2VDQL 4MQ7B 3LDBB 4FQJH 3HUJA 3AFLA 4R4BB 1YEKL 2VLKE 3VDCA 4X9HA 1GGCH 2FBJL 4MCZA 1MAMH 3X13B 3QWOA 3PXJA 4R7DB 3E0GA 4GW4A 3UZQA 2VXSL 2ERJB 4K94C 5DS8B 1AGDB 4MD0B 3U82B 2D7NA 5J9PB 4M7LL 5JO5A 4LHUA 5D93C 3PHOB 5DHVH 2BNQE 3QP3A 4K9EC 4OF3A 4ALAL </