2AJVL

Crystal structure of cocaine catalytic antibody 7a1 fab' in complex with cocaine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
216
structure length
216
Chain Sequence
DIVITQDELSNPVTSGESVSISCRSSRSLLYKDGRTYLNWFLQRPGQSPQLLIYLMSTRASGVSDRFSGSGSGTDFTLEISRVKAEDVGVYYCQQFVEYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 7A1 Fab'
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 52
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajvL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajvL01
1CI5A 4GRWH 3INUH 4D3CH 3QIWB 2VXSH 4HHAB 4XVJH 1QR1B 2H3NB 1U8KA 3GIVA 3L3KA 4MJID 3V6OA 4IMLA 5LXGH 5J56B 1B0RA 3D3VB 4Z7WB 4LSQH 4PJXF 1UM4H 5E4EC 5BVJB 3FB7A 1BAFH 1QFWH 1I7RA 5D2LA 5GJSH 1U3YA 3IS0X 3QFJE 1C7TA 3MACH 2L4OA 3OXSA 1EGJA 3OJVC 1HHKA 4Y4HB 1ZV5A 1WK0A 2LTQB 4MJ6A 3MCLH 1JHKH 5J1TC 5ELIA 5AG8A 3IDIA 2P48B 4RDQF 2YUVA 1SYVB 1ONQB 5J1AA 3S34H 1C7SA 3TBYA 5C07D 4AIZA 4NKMB 4HULB 3TIDB 2YBRB 3IJHA 1MFAL 4MD0B 2OL3L 2X9WA 1DEEB 1IEAA 5AWNL 1VADA 1LVEA 4KKCD 1M7IA 4TVPE 4P2QB 5IWLA 2DBLL 3X11A 3SKOB 1I3UA 5FCUH 5I1IL 1MREL 4ZUTB 5SWSA 2CKBL 3TBWA 1N2RB 3MCG1 4JLRB 1GHFH 4OAWA 3ES6A 5HGDA 1BD2B 3KYMB 3SPVB 2V2XA 2PYFB 5FUZL 3U9UB 3BKML 3NPSB 1FYTD 4PG9A 1B2WL 3BD4A 5HDQL 1KJ2A 1CGXA 1YEFL 4Z0BH 4NN5B 4LLQB 3O6LH 3MOAL 4DAGL 4GSDH 2UWEB 1HWGB 4TQEH 2CMRL 2DMBA 3L95A 3Q3GB 3TO4B 4ONGH 1AD9B 4AEIH 2X1QA 4WI4A 2YS4A 4MAYC 2C3XA 2B7DT 4DWHA 1N0XL 4JHZA 5H8DA 1FO0B 1W8OA 4H0HB 3ULUH 5FECA 4AMKH 5ALCL 4DVRL 4GG6E 5J1SC 2AK4B 5ANME 2VRAA 3S35L 1RUPL 3CFKA 3UXFA 1DDHA 3P73A 1QNZL 4M7KH 3U46A 1I8KA 3GSNA 2XKSA 4MCYB 2J8UA 1RK1A 4B53A 3T65B 4L8SA 3OJDA 3KPRE 2XACC 4OZHA 3TH3T 1AKJA 2YD6A 5E8EA 3ZE1F 1S7WB 4FFYH 4Y4FB 4UINH 1CFNA 4R4NC 3CVIL 3L3JA 4YO0B 4U1HB 2JTDA 2X4RB 1IC7L 5EBLA 1IGTB 4YHNB 3MGOA 4L5FH 4P3WA 2G60L 1TNNA 2NY2D 3P0YL 4NO5B 4PJEB 1E27A 3H9YA 2RFXB 4ZS6D 1S9YA 2NY0C 3HRZB 3MA9L 5DK2A 1WAAE 1G0XA 1KLFA 3ARGD 3DUSB 1IGML 4XBEH 4ZAKC 1J8HD 2EKSA 4TSCH 5MHSD 3QO1A 5JORB 5F8RC 1CT8A 1RZFH 4LSVL 5CSBA 2QL1A 5C0GA 1YYLL 4PJGF 5EC1B 3MBED 4BSWB 4UIMA 2CK2A 2UV3A 4I2XA 3I75A 3ARRA 1MCLA 4RAVA 1A7BA 1E4WL 2C4FT 3DX9A 1VACB 1O7VA 3FMGL 4YXLL 5HHNB 4RBPH 1E4XL 5JQ6L 1R6VA 4PUBL 2WM0A 5DXWA 4JQVC 5HPMA 2FIRT 5K9OB 1BQLH 5DRWB 4O58L 5D7KE 5EZIH 2FO4A 1XGTB 3P0VH 3WDHA 3O4OC 1KB9K 4XNMA 3UEZA 3IETA 3EYFB 4GXVL 1NGWB 1SY6H 3O8XB 5IB1A 3RWEB 3LKSB 3PABB 2A83B 1DVFD 1ZHLB 2CRZA 3CDCA 3G5ZB 3MZGB 4JGJA 4YHIA 5F1KC 1S78C 5TE4H 2BSED 3LKNA 3FQTB 5JR1L 3K2MC 4MNGB 3RVWC 3I6LD 4X7SL 4PRNA 5J6GA 3RBSA 5ACZB 3WLBB 1MRDL 2FIKA 1QFWM 5FK9A 3V5HB 4IRSD 5D5MF 3RWGB 4LL9A 5FO7B 4N5ED 3B9KC 5DQDH 2HT2C 2CSPA 1MRCL 2C1PA 6FABL 3QQNA 3KDMB 1QLFA 5LCVL 3QZWA 2BNQB 1YNLH 1UG9A 4N8VG 1ZANL 3MODH 3JWNC 1WBZB 2DYPA 2DQDH 3QEGL 4FQIH 5ILTH 3LSOA 3VDBA 1I4FB 1HWHB 1ZWIA 5FAAA 4M1DL 3UTOA 4E0RA 1IGIL 5KVFH 1F3RB 2V5RA 3T2NL 3T04D 3BJ91 3J7HA 4J23A 2C7UA 3L7EB 4A6YB 2R4SH 4PRHE 4GG6B 1B4RA 1BHGA 1KCRL 2YUWA 3K2UH 1AR1D 4FQ2L 5J12B 5AD0B 1MJ8L 1PG7H 3SDAA 4M3KB 1EJOL 3QQ4B 5JHDA 4OF5A 3BVNB 2ZUYA 3HI1A 5E8PB 5BRZE 5CIPB 4YUEH 1MFCL 1SJEA 3FB5B 3QEQA 4RMWA 4UOW1 3CXHK 1S5HB 4FXGA 5GSRA 4KDTA 3H42H 2VMFA 3MJ7B 4YIQB 4QHNA 1QSEA 3CFBB 1MJ7H 1QFHA 4QF1B 3V6ZB 1MHPH 5C6PB 3SDDA 4APQC 3O2WH 5JQHC 1MFBL 3GBMH 4R2GC 4ORGA 4MWFB 1OY3B 1JF6A 2ADFL 3EJYD 3KLAA 2RJMA 2XRAH 1QVOA 3TNNB 4L3ED 4HMEA 1FPTL 1N6QL 2CLRA 1HCFX 3GRWL 4I8DA 4Q9CA 2LABA 3OR7A 4QOKA 4LCWA 4BZYA 4PBVC 4PV9B 4KRPC 2RR3A 5HY9B 2WANA 1E6OH 5F9WB 1UEYA 2VJXA 35C8H 3KYKH 3QXDB 4OIIH 1UA6L 2OQJA 3NCFB 4Q9QH 1K85A 5EA0L 4K9EL 4NDMA 4JANB 1BQUA 4GRMB 2OXGA 3EYVB 5I19L 4EDXA 4LP5A 3VJ6A 5GIRA 1IFHL 1AC0A 3BKCL 3FQXA 2VABA 1UKTA 1J1XL 2G75A 4JR9L 2N7AA 5GGVH 3KPPA 2AP2A 1OM3L 3VGBA 2CGRL 3NZ8A 2IBZY 5I6XB 3O41A 1HSBA 2IPUK 2I07A 3RNQA 1T03H 1MCDA 1VPOH 2PTUA 4OCSH 4DZBB 5I76B 4G6JL 5I2IA 3KJ6H 1NC2B 2UY6A 4G9DA 3ULUC 5HHPA 1ADQL 1NAMA 1XFPA 3MV8A 3S5LA 5F7DA 5E5RB 1OARH 2OYPA 3MRLA 3RBGA 2B5IC 1PQZA 5KVDH 4OLWH 1MEXH 3I9GH 4AT6B 1FO0L 4P2CG 3WKMH 1V3LA 3H6JA 4PB9H 1CGSL 1D5MB 4LVHB 1NCNA 1A2YB 1WICA 3JUYA 3QDJA 5E9DA 4XVUD 3VFTB 4DQOL 4OM0H 5D71H 4F80A 5GGTH 5I73B 5T1DL 2NZIA 1D6VH 3RWJB 1NLBL 4POUB 3F65A 4JFHE 5E6ID 5KSBE 4FOMA 2JIXD 1TDQA 3NGBC 4QYOB 5EBMB 2Y25A 3MLWL 2KQNA 1YECH 4OUOA 5IIEA 4Y5VB 3EZ8A 3L3IB 1YPZA 1U8NB 5BV7H 2CDFA 2HT4C 2PCPA 4NGHL 3DX8A 5DD3L 1U8OB 5BCAA 2CIKB 2EDWA 4JZJC 1HQRA 5HHME 4H8WH 3VH8G 5HYSB 3MLTA 4JFFE 1T1YA 4OZIF 2RIKA 5AUMB 1T0NB 4KK5C 2VLRA 3RNKB 2YR3A 5GGRY 4AM0A 5D96C 1L7IL 2DBJA 1AGCA 3KYNA 5HVWA 2HWZL 3IT8D 3PNWB 1FVCA 4P48A 5CD3B 5FIEA 4ZUUA 3IDJB 3BDYH 4TYUA 2E5EA 3SDXE 3VXUB 5CBEA 5EU5A 3RUGF 1DUZB 2OR9L 3CU7A 3WLWC 1TQCC 2OJEB 4ZUVA 4XAWL 3VRIA 4M61B 4JY5L 1UXWA 1XR8B 4BQBA 5IHZA 1A7OH 4JFOB 3M17A 3WDJA 1MHHA 3IYLW 2R2BA 1EO5A 2EE6A 3BP6A 1SBSH 5IBTH 3DROA 1I7TA 1Q9WB 4JO1L 4MDIB 1FZMB 3M8OL 4HCRL 3FT3A 4FRWA 4KKNA 4KJWC 1UKSA 3STZB 1U95A 1K3IA 4MNQA 4UDTA 1A6TB 2ATPA 1LO2H 1U93B 1V3JA 4OD3L 5TJWK 1MLBA 1SJXA 2ITCB 5JZ7D 1UZ8A 2ZUQC 1U2CA 5CSZB 4BYHA 5J57B 1IKNC 1KTKE 1CDHA 3GMQA 1ED3B 5KSVB 4TUKL 3N50A 2NR6C 2JCCF 5KSAA 4P59H 4X99A 2DM7A 2YWZA 3B9DA 3BEWA 4U1MA 2KZ1B 1A22B 1IGJA 3WKNA 4L29B 4J8RB 5JHDD 5KVEH 4PJFB 2XWJB 3NIGF 2V2TA 1CDIA 2ZUUA 3FFCE 3WFHA 1S7QA 3VFVA 5GRZA 2VAJA 3MBXL 1CLYH 2BVTA 2H41A 3ARDD 5CILH 5F89A 3MRJB 2BSSA 4TVPL 1AJ7H 2X70A 5C0CA 1YMMD 4X9GA 4YZFE 1QFOA 3GI8L 1QSED 3PWVB 3TN0B 4YWGH 5LQBL 5HDOA 4ZNEA 3QSKB 5E6ZA 5TE7H 2AKRB 1OAUH 2P5WD 1G9EA 4M43L 1GZPA 2CK0L 2GITA 4OKVB 3HG1B 4YDLB 3EYUH 2VLMD 3V95A 4JDVA 1A8JH 1GAFH 1L9NA 4N8VB 3LEXB 4QOKD 3BGFB 3IF1A 3NFPB 1BGXL 3QQ3B 4EJ1C 1X5GA 4KTYA 5DDHB 3CVHH 2WBWB 1T1ZB 4Z7VB 2KPNA 5MHSE 3DO3A 5IT2H 5DS8B 3O4LD 4KRNA 1JWMB 3QG7L 5I1DB 3TP4A 1QBLL 1NFDE 1DUYB 4Y16D 3RWCB 3NMEA 5AZ2L 1NGPL 1BEYL 5E6YA 1PJ9A 4NKQB 2X4TA 1JPFB 4HKBB 4JFYA 3MNZA 5GS2H 4LLYB 2HLAA 4OLEA 3HAEH 4ZFZA 3BISA 4WWKD 5IP4A 1I1YB 1W0VB 3SE3C 3VGGA 4ZFFB 3H9SD 4M93C 1ZGLB 2P49B 4ODHL 1W72H 5DA0B 4ZXBD 3LZFL 2E9BA 3OMZA 4GKNB 3KPOB 2EZ0D 3GKZA 5CGMA 5E99L 3SDXB 5BJTA 1VFBB 3MV8D 1HH9A 4F7EA 5JXEC 2FL5A 3WFDH 2HJKA 5IMMA 1ZA6A 3WHE0 1TQBC 2OSLB 3T77B 5ERWB 4LEXH 5D7IA 4HC1H 2AEQH 3T0AA 5FYJH 1ZHBA 3SJVA 3VWKC 1INEL 2DF3A 2A6JB 4LSUH 2QADC 5TQ0L 1FNLA 1MCFA 3DYPA 1EAPA 1I9RH 2ICWI 2WINA 3JUZA 5D2LE 4YHML 4Y4HD 2PO6B 1I9JH 1JV5B 3PL6C 1UENA 1X5LA 4K07A 1VGEL 4X5XA 2YEZA 3ZL4H 1A5FL 3MMEA 2H32A 1XF5B 4WV1B 1HCVA 5IFAL 4ODUB 2VLRD 4P3CL 4B7LA 2VDKH 2W91A 2VKXA 4NBZB 4EDWL 2B1HL 2DTSA 1DFBH 2APXA 3VFPB 4TOYL 1FFOA 1I3GL 4G5ZL 5FF6B 3D69A 4XP4L 4G42B 1JZ3A 2QSCL 4OQ1A 5SWSE 4X9IA 1ITBB 2OK0L 1KELL 4XP9L 3ARWA 4JO4L 4LCYA 2Z93A 2WMPA 2OZ4L 2Q87A 5BV7C 3BPLC 1U8PB 3QNXB 4LF3A 3QWRA 4H8WC 5DR5L 3HCVB 5D1XA 4KQ3L 3JV0A 2YRPA 4GS7B 4MXQD 2X6MA 3UX9B 4M6NL 4MNQD 4BSVB 1GGYA 3MOBL 1PW3A 5I16A 3UZEA 2W0LA 3CZFA 1DQDL 4HPYL 4K71B 4S0SD 2MJWA 4MHHI 3HNTL 3MLUL 4Z7OE 2AK4D 1GOHA 5IFJB 5DMKB 5IM7A 4U1LA 4NKIH 2XXCB 2FWOB 4TN9A 5IQ9B 2A73A 2ATKB 3MLSH 4S1QH 3DGCR 5D4QA 3VH8B 3NA4A 1KGCD 4NUJA 2KUTA 1U9KA 3DVNB 1JF1A 2YPVL 3D0LB 4RNRA 4L4VA 3KWWA 3HPJA 4C4KO 2J8UE 1NFDB 4FG6C 4HKXA 1U8HB 1B0WA 1MCRA 5C0CD 1FFPB 3GJFK 3C2SA 4Y4FD 4OZHE 1H3UA 1NGZA 4MB3A 4F7CB 3VD4A 5EH1A 3FONA 2R0KL 3SGKC 3UO1H 3C6LA 2Q1EA 2VDML 1DE4B 5GS1B 1U91A 5T1KB 4Z18A 1HIML 3TYGL 5EZLA 1S7SB 4JAMB 5J89A 3BP5A 1TMCB 2AGJL 3KPQB 3LKRB 4P9MH 4QGTA 3B5HA 4YHPA 3DARA 4X83A 3AU1A 4XI5D 2VWEC 5AWNH 1QO3A 3MA7A 5IJVA 1JCKA 4YHOL 4S1SL 1E4XI 3VFMA 1UVQA 2VQTA 1WWWX 1YA5A 3ARYA 4H5SA 3PXHA 5EZOL 1R5WB 4YFLI 1G1YA 1H15B 4I2XE 2OP4H 4H25B 4DOHE 3WXVL 5HHQA 3RHWK 1HH6A 2AK1H 1U3ZA 3LRGA 1LWRA 3S3JA 3IKCB 4U7SA 3QUXC 2G2RB 1S8DB 4MS8C 4CADA 5IEKA 4XCFL 3MOAH 1T2JA 4NOBA 5GGRA 3WD5L 1WISA 2CMRH 2CLZB 2DM4A 4HW6A 2VZVA 5I75B 3QDMB 1CDGA 5CEYA 2GY7B 5IGXH 2DI8A 5F88A 3CPLB 5ALCH 4WRLA 4MQXC 1AGBA 1FH5L 5D2NB 1IEAB 3S35H 4L4JA 3Q6FA 2WBKA 5KW9L 1T5WA 1GYAA 4PJ9C 2DQEL 3ZKMC 4XRCB 4DUVA 5IVXE 3QH3B 3BQUC 1QNZH 1BM3H 4BFBD 1YEGH 5D7SL 4PD4J 3BPCB 2BNQD 4P5TC 3Q1SL 5HHOA 4G43B 1P9MA 4NKOB 2ZG2A 1FL3A 5ALBH 3PHOA 1NEUA 3V7MA 3VE0A 3WIHH 3BEVA 4KJYB 1ORSB 4U6HB 2Y5EA 2E8YA 2DIAA 2I9LB 4MVBD 3P77B 4OZGA 3OXRA 2VIRB 2ZPKH 3GSXB 1MH5A 2GJ6A 3PQYB 3A67H 5AZEL 2VITB 5CEZE 2G60H 4P99A 4O9HL 2WZPD 1G6RH 5E5UB 3TGXA 5CJBA 3V0VB 3VCLB 2IMNA 2V5SA 4PP1D 4YR6B 3L3OA 5FM5O 4HS3B 2QQKL 3MRNA 1DL7H 3LOWA 1IGMH 4PV8B 5JHDE 5H35B 2WBJB 3NABL 4I18A 2BFVL 1RJZA 3HUJA 1YYLH 5HVHC 4R90L 1T83A 4HUNB 4IOIA 2EEAA 3QEQE 3DGGB 1NBVL 1QLRB 3CXHJ 4U1JA 1E4WH 2C26A 2VZTA 4YGVB 3O2VL 3AFLA 2EC9T 3FMGH 5C7XH 1QSEE 4Z7UB 1MAJA 1E4XH 2DWEA 5I8EA 3IDGA 3C5JB 3GMRA 4O58H 2X5PA 2CRIA 3KPTA 2Z8SA 3B2UC 3MJ9A 3F62A 4KKBC 4YXHL 3C8KB 3RA7H 4GXVH 3PF2A 1P7QB 4QLRA 1P6AB 2UZXB 4F7PB 5INDB 4MA7L 1MJUL 4MD4B 5C0BA 3CK0L 4XNUH 5JR1H 5E1AB 2DIBA 3RKPA 3OGCB 4BFIB 4X6EB 4QOKE 4LCWE 4HMCA 4HS8L 4ZD3L 1R5IA 1MRDH 3LN4A 1H3XA 4LPTA 3TT3L 1KB5A 1YMHA 4I3SH 4I9WD 3I02B 2VQUA 4OKDA 2R9HD 3O3BA 4EKXA 4LLVA 4AJ0A 1R5VA 5TH2A 3U30C 5J11B 1KIPA 1IC1A 1N5AA 2YRZA 3X3FH 3KYOB 4U2ZA 4UT9L 5LCVH 1TNMA 3IDYC 4GQ9L 4LLWB 2ZCHL 3UTTB 1FYHB 2LFGA 4F9LC 3QEGH 3U0PB 4A2LA 5GS0D 5IB4B 5FDWA 5D72H 1ODAA 1PSKL 3T3PF 2MHAA 1NC2D 3C6LD 1IGIH 4X6CB 4RZCB 4Z9KB 5EO1A 5I66A 4BH7B 4M8QB 4X6DA 4PLJD 5T3ZH 3MV8E 5FGCE 3QULB 4P23C 1ZHNB 3CD4A 2QJDA 1WIOA 5FO9B 4ZPTB 5IB3B 5IVXB 1LE9A 3U36A 3WN5B 4QRQA 2AEPL 2KH2B 4ONFL 3MRGB 2ENSA 3QDJE 1X3DA 5E9DE 1A6PA 2MFNA 4KDVA 4XNZC 1ZLSL 5KZCB 3B3IB 4P2OC 2N56A 5E8OA 4NYLB 4RMQA 4YLQT 4DEPB 1XF4A 2NW3B 1LK2B 1IQDA 1I3RB 3EW3B 1LO5B 3H3KA 3O9WA 2P43B 5E2TH 1JTPA 4NQEA 1GGIL 1KT2B 2ZCLH 1DN2A 1GZQA 1JWUA 3O0RH 3S37L 1KEGL 1CFQA 4TULL 4YXKL 1S3KL 1OCWH 3VXUD 4RGNE 1FPTH 2E6JA 3OKKA 2Z31A 3OWEA 5IESL 2CXGA 1SVZA 2GK0B 2VTFA 4YPGB 2E8ZA 5LAXB 4M5YL 1OSZA 5IK3A 5FKPA 4Q0XL 1YEIL 3ILQC 1HI6A 4J3WA 3MJ8A 3ZDZE 5GHWL 3ARBC 4MA3A 4XBPB 5FYKE 4IDJL 4V2BA 4XWGH 3U4AA 4FQ1L 4M7ZB 4RCAA 2F8OA 3RI5K 5T1LA 5I19H 5BVPL 3OJ2C 1UM6H 1N64L 4K3GA 3ZKQD 1IFHH 1P84J 1QBML 3BKCH 1IM9A 3VG0L 2XG5A 1J1XH 4JR9H 1OWRM 3VRLE 1XGQA 2X09A 2PW2A 1OM3H 3M45A 4HK3N 2R1YA 4MNQE 2CLVA 3SKJL 4LKXA 3HLAB 3L5XL 5IHLB 4M4PA 1NCWL 1Q9OA 2F74A 1AHWB 5JIKA 3QJFA 1CG9B 1P2CA 4J6RL 5GZOD 4NKDA 1FCCA 2X89A 2YPLB 4UOW0 2I5YL 1ADQH 5IMKA 1HHGB 2A6DB 5DJZA 4FNLL 1WBXA 4JKMA 4XXDA 3LVEA 4HG4J 3G5XB 4K23H 4JM4L 2H9GB 2NY5H 2ADIB 3HZYA 3GSWA 2AEWA 4X5WA 4NWTL 4IOFD 3EOBB 3KXFA 1CGSH 4AEFA 2EH8H 3S35X 4DQOH 2PN5A 2AJ3A 3V79C 1C5CH 4JO3L 4W6XB 5T1DH 5T3XE 3DMMC 1NLBH 5IFHH 5C0CE 3O2DL 3TN0D 4LPVA 1GOFA 1T04B 4DKDC 4E5XA 3ARQA 3VXSA 1IAKA 2VN4A 1BF2A 2QQNL 4W4NA 4NGHH 3IJYB 3SGDH 4E9LA 1DQQA 2BSRA 2NY4B 1JGDB 4YBQD 2PYEB 2YD3A 3BUYB 3STLA 1MWAA 1L7IH 3B5GA 3JV4B 5DVMA 2A9NL 5DD0L 3FT4A 3PWPB 3CUPB 5FGCB 5C0BD 3WBDA 1W2KT 1U3HC 1PYWB 2OR9H 3HC0A 4G7VL 5FM5M 2R56H 2J7LA 2RCSL 4C83A 4QXGL 1GJIA 3DTXA 1A1NB 5GRXG 4XPTL 4WY7L 5TE6L 4NQSA 4UTBL 2GT9B 1T6WA 3HRPA 2GSIB 4S2SA 3BW9A 3P11L 4OBRA 5DMGC 3M8OH 3DX6A 4XZUA 2V5YA 3U6RB 3OG6B 4MJ5A 3LDBB 3SGJA 4JG1H 1OPGL 3X13A 3BIAX 3E3QC 3BN3B 5DYOA 4E41B 4JG0H 4K94H 2Q76A 5EO9B 4OGAD 3HPLB 5EUOB 5HJ3A 1S9KC 3WUZA 1CFBA 4QTHB 4NZRH 5J9PA 3IFLH 3OKDB 4ZFOB 4NO0A 1FBIL 1XR9A 1XEDA 3EO0B 5E0QA 4YK4C 3RZWA 3ROOA 4LNRB 4U1GB 4JRXA 2Q8BL 4Y8DC 1OF2B 1A7QL 2OXHA 2E27L 1AD0B 2IADA 1UJ3B 3MO1B 5D7IE 4YGAB 4NCC1 5DK0B 3TVMB 4K7FA 5DLML 4NCDA 4XH2A 1F6AA 3SJVE 3MBXH 2BZDA 2UZYB 4TVPH 1Y6KR 1TPXC 5B38B 3DOSA 3H9HB 2DWDB 1G7JA 4U1IB 4XNXL 1NCBL 5LQBH 1I1AB 3F12A 3TWCL 3CIQA 3P30L 2K7QA 3RGVB 1JVKA 3EYQD 1DLHA 4Y5XA 4LMQI 1S7TB 5EPMA 3ULVE 3ARFC 4JFQB 4BZ1H 1Y0LA 1FGNL 5E24E 2HFEB 2Z31D 4LKCA 3A6BH 5HGGS 1X6LA 5I9QB 4PTUB 5EBWA 1O0VA 4WI9A 5J6HB 3SDCA 4Z7QE 2LQRA 1BGXH 4PRPA 5FKAB 1I8LC 4PTTB 3MNWB 1MCWW 1HXYA 4NJ9H 5I30L 5IR1A 2R2HB 3QIWC 1LDPH 2AW2A 1NBZB 5GPRA 5E2WH 3DO7A 4MX7A 3EFFA 4EVNB 3JTSB 5AZ2H 2W65A 3WJJC 1NGPH 1BEYH 4Z76A 4RIRA 3W9DB 1OAQH 1FL5A 1EFXB 4GW4A 3ZT5A 4WEBH 4TUJB 4HZLB 3K4DA 3ME0A 2R0ZL 3LQAH 3LZFH 3D0VB 3RPIA 3FTGA 4PB0L 3LS5L 2NLJB 1XCQB 4WHYH 5CEZL 4IM8A 4XPBL 5BZDB 3RWIB 3QA3B 4I3GA 1BLNA 1R24A 2ID5A 1SJHB 3GDBA 1A7NH 5CCKL 3MTRA 2BHYA 3KXFD 3EHBC 4L4VE 3MSPA 4X4ZA 1P1ZB 2C3VB 1R3LB 4GW1A 1J1OH 4UU9A 4Q7DA 1D3CA 1WSST 4U4BA 1YYML 1HHJB 1WCBB 5C86A 4QWWC 3C5SA 3L1OH 2NXYC 3RTQB 4HUMB 4NJAL 5KSBF 4YHMH 3VXSD 2ZOLA 5GSVA 3S8WA 4PY7B 3OKNB 3F7YB 4IRJA 4FQHB 3EDDA 1A5FH 3GSOB 2OS7A 2XOTA 4JZNB 5CSGA 3PWUA 4NM8H 2O5ZH 4P3CH 5MEOB 2DKUA 4XNQA 3QEUA 4NN5C 4EDWH 5I1EL 2B1HH 1FN4A 2NY5C 5B39G 4TOYH 4LVNC 4PY8J 1AXSA 4IIQA 1WFUA 2FEDC 4RFNC 5JIHA 4JCLA 3BH8A 4G5ZH 4Z95L 4HJ0D 3ZTNL 3CFEB 4HJJH 4Y89A 5ADPL 4R96A 1G7MB 2G5BA 1CL7H 4N8CL 5DJ6B 2QSCH 5FYJU 1CE6A 4D0CB 4EN3A 5HGBA 4XGZB 1M71A 4JO4H 4XP9H 1KPVB 2YUXA 5IW1A 4H20L 2EE3A 2OZ4H 3I6GB 1LO4L 4S11A 2XZAL 1A7PL 3QQ9C 5TDOB 4JJ5B 4S1DC 1YY9C 4PJ5A 5DFWH 5ABDE 1P5UA 3TNMA 4KQ3H 2Y1VA 4M6NH 1J10A 2J88H 3MLYH 5IB5B 2NY6D 4FFZH 3RY5A 3QCTL 4HPYH 1WT5C 3QDMD 3RPKA 4JPWL 2A6KA 3Q5TA 1J12A 3HNTH 3MLUH 2EXYD 1OAXH 1S7UA 1HZHH 1T3FA 3EJJX 4NO0D 4X4XB 5FHAH 3HB3C 5E94A 4L8BB 2FSEB 5IJKC 1AR2A 5DQ9B 3GM0A 1CU4L 1JZ2A 3ZTJG 4ELKA 2YPVH 2A74B 2I60L 3R06A 2HJLB 4PJAB 1NEZB 5F9OL 3VXTB 1JYXA 2HTKC 5F1NA 5HHOE 1RK0A 4M7JL 4HUXB 2HMIC 2Z93B 5DJYB 4CRPA 4YZFF 3FOLA 1PAMA 3W81A 2IBBA 5C08A 3SCMA 5EIIA 1K6QH 4OZGE 3PQYD 3MYZA 5KSUB 4K94C 3BT2H 3KPSB 4Q2ZB 4L3CB 2R0KH 4IS6A 5DHVH 2O61A 2CUHA 2GJ6E 5EC2B 3F5WB 1FNAA 3LKPA 5K93A 5F7NC 4KJQC 1UZ6E 4UNTA 4P46B 3MUGA 1A6WL 3BZDA 1U41A 2FDBP 3BSZL 5GGUA 1J5OH 1HIMH 1YNTB 3TYGH 3O8XC 3CFCL 1G7QB 3VFOB 3X3GL 2CDEB 4DVBA 2XPGA 2YMXL 2XFXA 2R0WH 4CVZA 2NY1B 3KLHC 1T1XB 3QIUA 1NKOA 3WO4B 1NH6A 4YHOH 4ZFOL 4G9FE 3HUJE 5EZOH 4NO2A 4MAUL 3N1GC 1KLGA 4GH7B 1KLUB 5FYKL 4PJ8B 4YHLL 4NM4L 5JW5A 4PREA 5SWQB 4HXAL 3C60B 4U1NB 4NFDA 1MPAL 4TUOB 1U58A 3SDYL 1KC5H 2OTUA 3I50L 5J06A 1S7VB 1T2XA 3V6FB 1IEBB 3WFBL 1P7QD 1KCKA 2JJTC 5D6DC 4G3YL 4XCFH 1TZIB 2ZJSL 5D7JB 1RJLB 4CVXB 2H2PD 4NRZA 1RIUH 4OFVA 3E2HB 2XQYG 4FQXB 3O6KL 4Q6YA 3AXLA 3NA9H 1FH5H 1F4WL 3FKUS 4GKSB 5IJVB 5IBLC 5KG9A 4PJDB 2GW5A 4I0PA 5IVZA 5D7SH 4O4YH 2MKLC 1S7RA 3Q1SH 4GO6B 4CW1A 5HYFA 1CVSC 1U8MB 4KMTL 4HF5L 2ZSWA 4XHJC 3LKQA 5D2LF 4KTEL 1YY8B 4YHYB 3NIDE 4FQJL 5I1KL 4HIHA 4IRJD 5D9SB 1MFDL 4X9BA 1JWSB 3LQAC 4G6AC 5SWZA 1LDSA 3OL2A 2DAVA 4O9HH 2VLLA 1T7WA 1R3KA 2X4UA 5E2VL 5JOPD 4X6DE 3AREA 4QRSB 2HAZA 4L4TA 5DRNA 3S97C 4RMTA 4F33B 2FJGB 3C08H 5DQJB 3F58H 2BC4A 4W81A 1MI5B 4RMSA 3HNSL 1U8QB 1CICC 5F9WC 5GRJL 5KZCD 4N9GA 4GMSL 1JPTL 3TZVA 4XCNA 1RIHL 5HYJA 4EN3D 4ENED 5IQ7H 1NBVH 3FO2B 3O6FC 3GSUA 5HYIA 4R6UA 2R0LL 2ZUTA 3V4PH 3QAZB 5JPNB 2VLJA 4OZGB 1K8IA 2A77H 4OJFH 5BOZG 4NQEE 4Y19A 2GUOA 3PGFL 1DQTA 3MUHL 1JK8B 1FDLH 4FQQB 3V8CA 2ESVE 3W39B 3LB6D 2R4RL 4ZPVB 1G7IA 3BJLA 1G84A 2B20A 1D9KA 4Z7OF 4JY4A 1KCUH 4HS8H 2VXTL 4QHKJ 1M6OA 4FFVC 4ZD3H 3GI9H 4U2YA 1QYGH 4PG2C 2HG5B 2YK1L 2Z92A 5AAWA 1J8KA 4G9FB 2R23B 5E4EB 2FJFA 3DIFA 1UWEL 5EULV 1RZIA 3C09B 2XZQH 3LHPH 4Y2DB 2J8UF 1BIIA 2DM2A 3LN5B 5IHUH 5I73C 1TJHL 5B39B 4KPHL 1T5XA 1A47A 4JN2A 4OZHF 4XVSH 1RQ5A 3ALWA 4X9FA 4B5EA 3SCMD 2D7QA 4U6XA 4Y5VC 1A6ZB 1U92B 2W9EL 5EN2A 5CHNB 4Y4KA 3HMXL 2XWTA 3K3QA 3KPMB 3VI4E 5EO0A 4HWZA 5MP6H 1G0YR 3RY6C 1SYSA 1EMTL 1T0MB 1ZEAH 4HUVA 5DFVC 1XGUB 4M6ML 4XB7A 3QIUD 4KKLC 5IMLA 3S96B 1J05B 4EEEA 1KJMB 3KXFE 1KTLB 1IT9L 4JQIL 4ZUSB 1ZLSH 1WUNT 4FMFA 3WDIA 4I0CC 2F19L 3QUZA 2DB8A 4PS4L 4GMTL 3PHSA 3CMGA 4JB9L 1BVZA 3QCVL 5GRVL 3QWQB 3T1WA 4PJHA 2NY4D 5CEXA 4HUUA 1URLA 4H26B 2PYED 1CFSA 4GLRI 1Q72L 1JN6A 3HZMB 1PLGL 4G6MH 2PXYC 4MAYB 3LEVL 5BW7A 3N85L 4P9HL 5CGTA 3PWPD 1S3KH 2Y6SD 1AO7A 1FV1A 1FC1A 4X7CC 5IESH 1MHEB 1OT2A 5HVGB 4X0KB 3L6FB 2Z8WC 1NMAL 1Q94A 3QFDA 15C8L 4JO2L 4M5YH 1FORL 4WO4A 2IQ9L 3DBXB 3MRKA 1YEIH 4Q0XH 4AIOA 4XMPH 4ZTPH 4QRRA 4UBDD 2PW1B 2JKXA 4FQ1H 4O51B 3C8DA 1G7LB 3R4DA 5E95B 5EUKA 3TA3A 1N64H 3VWJA 2EDBA 1NUGA 1QBMH 4HWBL 5DURB 3T4AB 3KS0J 1YJDH 3VXRA 3G6JA 3FRPA 4R3SA 1JL8A 3SKJH 1LP9B 3MLRL 5ESAA 1KF9B 6CGTA 1EGJH 3AM8A 2ESVB 5E2UH 2WQRA 3L5XH 1G9ML 1X4YA 4QY8A 3OAZK 4XX1G 2NY0B 4HWUA 4HEPG 1JP5A 2I5YH 3TYFB 1CLZL 4ZAKB 1ORQA 1L7TL 3TT1L 4JM4H 1EHAA 4UZGA 2BOBB 4JRXE 3V5DB 3W0WA 4JFZL 4NP4L 1IAIH 4L1DA 4U33A 1C12A 4NWTH 1W0WB 4D9QD 3OSKA 5DC9B 4NQDA 4CU6A 1FFNA 3TZVD 1X7QA 5HI4D 3FFDB 2IG2L 1U36A 2DQGL 1RULL 3RVXD 3TM6A 2IFFL 5T1MA 1BJ1J 4QRPB 1UH2A 1IZJA 4YBLC 2Z4QB 3EO1B 1NBYA 1GPOL 1I1AD 3O4OB 2VLJD 2DL9A 4PJBB 4QHLA 3QWOA 1HXMA 1ZA3B 3ISWA 3RGVD 4C56B 1IM3B 2R1YB 3MLZL 2D9CA 5ID1A 4G80B 5EOCJ 3T0EA 4F57L 2FHBA 3WHXB 4Y19D 5A40E 2F8VA 4RAUB 1A14H 4EI5B 5DTFA 4LEOA 5ITFB 3C9NB 7FABL 4JM2A 2A9NH 5TPWH 2D03L 3DNKA 3ZYJA 1D9KD 1CZ8L 1XIWA 3DETD 3MRIB 3IAPA 4HFWB 4ZS7L 3V5KB 1NKRA 4PRPE 4JKPL 3ECBA 3B9KB 3CH1A 2IH3A 5GJTL 3MUY1 2RCSH 3UAJC 1M7DA 5C9KA 1JTOA 3T0VA 3WUWA 1EHLL 5DT1H 4KKCC 5EU6A 2JJUA 1ZS8A 4WY7H 5TE6H 5FEBA 2DQTL 3WNNA 5D7LB 2BSTA 5DHYB 3AGVA 5KS9A 4CKVX 4BUGA 3JV5A 2F5AL 3GSNH 4UDUB 9CGTA 4NNXA 1F11B 1FLRL 1EUUA 3T4YA 4Z7NE 3JWOL 4YQXL 4GG8B 2PO6C 3GJFA 2VLKE 1OPGH 1M05B 4QNPE 1FZJB 2O93L 1Q9LB 3G08A 4WV1C 2Y07L 1LNUB 4GBXA 3WNMA 2FX7L 3NTCH 2VZ3A 1CR9L 1OP5H 3VA2C 1S9XB 3D25B 5EU3B 1JPGB 1ZT7B 3MRBB 1T7ZA 1HHHB 3W2DL 3SHSA 2W38A 2JB6A 2E27H 1PEWA 4PRDB 1XGYL 4ZDHA 2CPCA 3RWHB 1XF3A 1RZGA 1RFDL 2X4OB 4GW5B 4XX1E 2NZ9C 2JJSA 4JRYE 2HVKB 4AH2A 2QV2A 2CUIA 4GRLC 2WIIB 3RZCB 4W4OC 5E56A 4X4MA 1LEIA 4H1LA 4APQB 2G9HA 5F7LB 2F5BL 4R2GB 5DJ2A 5J3HC 5C2BL 4PGCA 5E5MA 1NCAL 5IMOB 4TSBL 4MSWA 5JMRA 1YPZF 2X7LA 4O2CB 5ENWB 2R8SL 4HMDA 4AYFA 3NBNA 4OGXL 3TWCH 1HN1A 4Z0XA 3REWB 3QI9A 1IGYB 4NCC2 1RIVH 5CMAB 2DMCA 3MJ9L 4PFEA 1WBYA 5JW3H 1AO7D 2NY2C 2HFFA 5CP7B 5DGQA 4FHBD 4KRPB 1L9MA 2DJ4A 3QXWA 5JTWA 2OTWB 3JV6B 4WO4D 3T2OA 5C0JB 4JFPA 3FN0L 4BQ8A 5I30H 4NQXB 4QEGA 1KXQE 5CJQL 3VMNA 2FCBA 1JGEA 2VDRL 2GKIA 3ZDZF 3QUMA 4BA8A 2Q7YA 1ZT1A 3CC5B 1H5BC 1UXSB 3MXWL 1AGFA 4PLKD 3VFRA 1QBAA 1XZ0B 12E8H 5I0DA 5KN5A 3UBXG 4PJ5E 1JE6A 4NFBA 3VRLF 4ODXA 4CNIB 1Z9LA 4Y1AB 5FA4A 2AJVL 2GEEA 3MYJB 5JXAL 4P4KB 4KXZI 3DV4B 1JBJA 1DLHB 4HKZA 4S1RH 1IAIM 3TCLA 4IRZL 1X9QA 2CIIA 1PVHA 1VKXB 1EEYA 2BHUA 2B5IB 3MGTA 3S37X 5CEZH 4OF6A 5F1IA 3AMKA 3L5WB 5B21A 3KNBB 1ZTXL 1AE6H 4IHOB 4NNYB 3W0WD 3BKJL 5CCKH 1MLCA 1ZKAA 5BXFB 4PRAA 3VFWB 1FNSL 3CFIC 1ZGLP 3MRQA 4N5EC 3U0TA 3VG9C 3KPNA 3NGBB 1Y18A 1UB6B 4NN7B 3QJHA 1HYSC 4NJAH 2P8LA 1L0YA 4JZJB 4WFGE 1YJDC 4P3DA 4PJ7A 3KPSD 2CDGA 5C08E 2XKNB 1X5FA 2VLKB 5D96B 1YEKL 2NYYD 4P46D 4GAGH 1VGKA 5T5NF 4U3CA 1QSFB 2AV1B 3OTTA 1JI1A 4LHQB 3OR6A 1OAZH 2UUDH 5I1EH 3D39A 2XNAB 1U42A 1TQCB 1XIWD 3UTQB 5M7QA 2NY1D 3U4BH 3BESR 4KJPD 1OLLA 4FQLH 4XCEA 1DANT 1IRAY 3Q6GL 4N0YL 4Z8FH 4RX4D 3O3DA 3FAWA 3HI5H 3EUUA 4UTAL 4WUUE 5ADPH 3FT2A 4NQCA 1NFIA 5IOPB 2WLYA 2CJUL 5IWLC 4G8FA 4JRYB 4QTIL 2O5YL 2HT3C 1LD9B 4GKZB 3UTZA 4JGMA 4PBWD 4H20H 3C60D 1T4KB 2YN3A 3WIFB 2XZAH 5CWSA 1R3JB 3GSRB 3V0WL 4JFEA 2Y72A 2PR4L 4PRIB 1AIFA 2ZUQB 3G6AB 4OZFA 2YHGA 2X1WL 3SO5A 5I8KL 3GHEH 1WITA 4LARL 2OI9C 4LRIA 5L2JA 3HC4H 3NFNB 1WJ3A 4LAQH 4U05A 3DXAB 1FNGB 1VEOA 4WCYL 1ZSDA 5HI5D 3E6FA 1ROWA 3RJDA 2F53A 2EDKA 3IDXH 5FO8A 1AFVL 1NAMH 5GRUL 4K7PY 5IG7B 1O7SA 2VYRE 1HEZB 4XTRC 4BQ9A 3L3HA 3UDWC 1OT1A 3BZFB 3UC0H 4KY1L 4WW2A 5F7FA 3VXPB 3CFJA 3GB7B 1CU4H 3GJEA 4HGWA 4PJXB 5IEHB 5D7IF 5C09A 2HKHL 2WBJC 2VDOH 3PWNA 1RVFL 1RHHB 4LDEB 4M03A 1G0DA 4L8SC 4GUPB 1QTYT 1NGYA 2FX9H 3OZ9L 4KHXH 4FQCL 1U2HA 2UYLB 2YD7A 3CMOL 2VKWA 3MFFB 3FB6B 2NCMA 2DI9A 4JZOA 3TBTB 1NDMA 1DBBL 5SWZE 5MENB 4ODBD 3P4NB 3H8NA 3BSZH 1I8IA 1LILA 2V7HB 2P8PA 1JFQH 3CFCH 2LV4A 1XGPA 3ULVF 3X3GH 3QIBB 4D0DB 4MLSA 4L4TE 5LVEA 5C1MB 5D5ME 4U7MA 1MI5D 2DD8H 3ARTA 2ARJA 4D3CL 2XTJE 4Z7QF 5DI8A 3TO2B 1VENA 1F8TL 5LXGL 4HWNA 4I77H 4D9QE 5JNYA 3F7VB 4LSQL 5HSFA 3UROR 5HYJE 1WC7B 4MAUH 1GH7A 1UM4L 3VGFA 4L9LA 5FYKH 1QFWL 2V17L 5GJSL 4YHLH 1CBVL 1SQ2N 3B6SA 3MACL 5F9DC 4CBPA 5DF0A 3TBVA 1UKQA 4NQVB 4FS0A 2B4CC 4M93B 4JCMA 5I17B 3QG6B 3BX7C 1JHKL 3OKYA 3UPRB 5DUML 3WFBH 5FM4A 3KPLA 1JUFA 2AV7B 1C5DB 1BBDH 1T20A 3ROLA 3QB7C 4RMUA 1NGXA 1H3VA 1J0YA 5CLWA 1GGTA 4KV5E 3CX2A 5DJDB 3TBSA 5A16B 2QBWA 1TQBB 4WTZG 3HNVH 4JEGB 1JTTA 3O3AA 3S4SA 1XH3A 2ZSVB 1TZHB 4EUPA 4Q9RL 3HE7A 4WUUB 4B41A 3VWKB 5ID0A 3G5VA 4WFEE 2QADB 3QBTB 5LBSH 4QXTA 2HTLC 4Z77B 3ZSTA 2GJZB 1U8IB 1PGRB 3MV7A 3JTTA 1GHFL 3PWJA 4HBCH 3TJHC 3O45B 5ECJE 2CRMA 4G8GB 4ZO9A 3PL6B 3D18A 5T3XH 4NPYB 4D9LL 3NN8A 1I1FB 4FQJH 5I1KH 1N59B 1YUHA 1BWWA 4Z0BL 5L6YL 1MFDH 1R3HA 1VEMA 2C9AA 2CRYA 1OB1A 3GIZH 1TTFA 4AEIL 2IANE 4ONGL 4OLZH 5DMYA 5E2VH 5JZ7C 4PRBA 1DQJB 3D39D 4AMKL 1WFTA 4DW2H 4HIIA 5B22A 1QRNE 2ITDA 4WGVB 3UBXB 1I7ZA 4WU7A 3CSYA 4JDTL 5C0EB 4PJGB 3SDAC 3G5YB 5I0ZA 2F54A 1BZ9B 5MEQA 3PJSA 2DQJL 2H8PA 2FGWH 3GHBL 2IWGA 5E00A 5BV7B 3BPLB 4UUJA 1J1PL 5EBGA 4ONHB 2VL5B 5C0RH 4RAHA 4FFYL 4KDTC 1GGUA 2ADGB 2IH1A 4UINL 3OF6A 3JWDH 2BXZA 2M8XA 1K5NA 2JF1A 4X4YB 3SDDC 3GBNL 4L5FL 5DSCB 2DQIH 1ZHKB 2C3WA 4TNWK 1HQ4B 4U6YB 5DVKA 1YC8A 2R4RH 5D1QA 2Q86B 2HLFC 1LE5B 1JZ6A 3P40A 3W11C 3NCYP 5D5MB 4WU5B 1NL0L 2VXTH 3EGSA 2XTJB 4XBEL 3GUTB 3QXTA 4TSCL 1Q0YL 1ZAGA 4NO3A 2E7LA 4QRRE 1HOCB 5C0AB 3FO9B 3BRDA 1UWEH 5C09D 4P2RB 3QCUL 4JY6A 4R4ND 5J0BA 3O81A 3QUYA 3T09A 3U2SA 4KPHH 1FVDB 1ZT4A 1DQLL 3T0BA 2NX5B 3RL1A 1NC4B 1BQLL 4ETQA 5EZIL 3VXRE 3P0VL 3G6JE 5CGYC 4DJMA 4O2EA 2W9EH 1UCBL 4IEFB 2X4PA 1WZKA 2P8MA 1AH1A 4N0UB 1VSCA 2VDNH 1SEBB 2H32H 4ZAKD 2FATL 3MUZ1 1EMTH 2LU3A 3S98A 4ZTOH 4NUGL 3QUKB 3MRPA 4I0KA 3ULVH 1QEWB 3LIZL 3FQNB 5D1ZA 1KNOA 3W0WE 3G04B 5A2IH 2FNBA 4NFCA 4NQDE 2AXFB 1TJIL 3HUJF 5IKCB 1YEDB 5BQ7B 2Y7QA 4M5ZL 1VHPA 5AYUH 2F19H 1XCTB 1A1OB 3MODL 3H0TB 3GMPA 4GMTH 4QCIA 1OGAA 5HDBE 4C56D 4JB9H 4BSJA 2DQDL 4XNYH 3QUXB 4FQIL 4MLIA 2D0GA 5GGQH 1GGCH 2CO7B 2FJHA 3T0EE 1S78D 1Q72H 32C2B 1MCJA 4K3HA 3RVWD 5KVFL 2IANB 3LEVH 3N85H 4P9HH 2NMSA 3BDXA 1JHLL 3K0WA 3BWUC 4P2YA 1HSAA 3CVHB 3DX7A 4RGNC 5L2KA 2V2WB 1QRNB 2HJFB 3K2UL 3B9KD 4YHKH 4PJ9B 3H7LA 1GIGL 1JNNH 1EVTC 1PG7L 1NMAH 2NTSP 3MRDA 4LLUA 3NIGE 4YDIH 4RQQB 4JO2H 1FORH 3LQZA 4J3OC 4X8JB 5ICZA 1HILB 1N6VA 3MJ6A 2YC1A 5D7LD 5EU6E 1MQKH 2Y5TA 5JA9A 1D5IH 2F15A 1CN4A 1KIRA 1DN0A 5EZJB 3TVMC 1F6FB 1JRHH 3O3UN 3HAEB 1BQHG 3H42L 3TPUA 5KS9E 4M8VA 1SY6A 4I5BB 2GY5A 2XT1B 5JLZA 1MJ7L 1MHPL 4QHMB 1W72B 5HGAB 3VXME 4X98A 2K9UA 4GAYA 3GBML 2JJVA 4DZ8B 1CS6A 1CD1A 2GTWA 5IV2A 2FX8L 3VXQB 1FZOB 2XRAL 1NUFA 3CLEL 4XAKE 1I7UA 4D8PB 1Z2KA 1LEGB 4P4RA 4LBEA 4UNUA 1FJ1A 2MOVA 2AJSH 5K9JH 4X6DF 3GSVB 4XVTH 1CLZH 1E6OL 5KSAC 5A2JH 3TT1H 2WAHA 3EOYG 35C8L 5DJXA 3KYKL 4JFZH 5HVHB 1KCVH 2ZOKB 2F54D 1N5YH 3P9WB 4AIXA 2IG2H 5ICYA 4PBXA 4APQD 4FTVA 1RULH 1BIHA 4X4ME 1WZ1L 2C4FU 5GGVL 3OF6D 4YAQB 4OZIB 2HYMA 4KMLB 3MLZH 1D6EA 1T03L 4MNHB 1VPOL 1UEMA 2YD4A 3A6CH 4HH9B 5J4MA 2JJWA 4EIZC 1UADC 2JK5B 1YN7A 4KRPD 4NNPL 1PZ5A 7FABH 2P5EB 5D1QD 4ZG1A 4LHUA 3RUGB 5F9JA 5DJ0A 2FYYB 1CZ8H 1QBBA 1INQA 3REVB 5DEGB 2CR3A 1I1CA 1MEXL 2P7TB 3FQWA 1B6DA 3WKML 3GMMA 4PB9L 2VQ1B 3IXAB 4OFIA 4OZFG 3U30B 1QA9B 1EHLH 2XN9B 4OM0L 3MRCB 5F3BA 5GGTL 3MLXL 3MRHB 1D6VL 4OD2A 2C1OA 4XCYB 2DQTH 4X7EC 3IDYB 3V0AC 4UV7L 4HDIB 3QUYD 3QT2A 3JWDC 5FYLL 3SE3A 2A2QT 3RL2B 5BO1L 2XQBL 3AROA 5BV7L 1FLRH 3RTQC 3QWOB 4D0BA 1G7HA 3JWOH 4H8WL 4Y1AD 3WS3A 3ULUD 3MRMA 3PDDA 1MCWM 1BOGB 1A6AA 2JCCB 3VFNB 3PGDA 3ULSA 3BDYL 5I8CB 1EIBA 2UY7A 3RVTC 3BO8A 3BGMB 1EO8H 3FN9A 4WENB 3K7UA 3MV9B 1EBAA 5JDJA 1A7OL 4XNZB 4RA3A 4XMLL 4ZO6A 4JHWL 5HYQB 4P2OB 5K33A 1BZ7A 2FH8A 4GXUN 1XF2A 4OV5A 4M62L 1RFDH 1H9VA 2BNRA 1SBSL 5IBTL 1OVZA 2HT4D 4CVWA 4LCIH 3DWTA 1U6AL 3KYAA 3L9RB 4XXCA 2A38A 1OGAD 2VISA 1WGOA 1JMXA 2W0FB 4KK5D 1I9IH 4BJLA 2MQ3A 3VXMB 1FG2B 5C2BH 1F5WA 1NCAH 2P45B 3DRTB 1OP9A 4POZC 4TSBH 1QSFD 4KGLA 5CD5C 2ADJB 5ISZB 2FZ3B 4LVOC 1LO2L 4OGXH 2VL4A 3WLWD 4YDVA 4KWUA 3MJ9H 2YD8A 3TIEB 4QRUA 5EDXA 5E8DL 3VRJB 1C08B 3OB0H 4BH8B 1HDMB 1B88A 3ULVC 1BVKA 3VD7A 1Z6JT 4FXKA 4E42A 2APWA 3RWFA 5KVEL 3LRSB 4MJIA 4HJGA 2VE6B 4PGEB 4NQCE 3OAYH 3WE6B 1CLYL 4LLDA 5CILL 3VFGH 2VB5A 2EE9A 4KJWD 1OP3H 1KB5H 1RUAL 1A9EB 3MXWH 4H0IA 4M6OH 4Y2OA 2Z8VC 2BVPA 4M1GH 5DJ8A 4AENA 3VD5A 1OTTC 2IQAB 5E8NB 5KANG 4YWGL 3QNZB 4RWYL 4PRID 3S4SG 1EEZA 5TE7L 4JFEE 2QKIB 4I48A 4R0LB 3X12A 4R4BB 3C6SB 5D1XC 43CAB 4G6FB 5SX5K 2NR6D 2YA2A 1LQSR 2XZCL 3UYPA 3DXAD 2A9MH 3SO3C 2H6PA 3IDNB 5FA3B 4IRZH 4F8TA 5DFTA 2VZ1A 3GMLB 4TRPL 3ZTJH 3O6MH 5C07A 1DBMH 4HKJB 1CVRA 2F53E 3ILPA 3N1PC 3IU3B 2WP3T 3MV01 3BKJH 3K4AA 3RU8H 3DMMB 2DL2A 1FNSH 3ZHLA 1UYWL 3DSNA 5BS0B 2MWCA 1XGRA 3O3EB 2V9TA 5ESQA 5C0IB 3L3DA 5ETUB 3IVKA 4MCZB 1EX0A 2FRGP 1G6RB 1J0JA 5MEND 5F6IC 3GEWB 3GKWH 1W72L 2GFBB 4NZDA 4ZUWA 3SKNB 3C6LC 1BX2B 1U3HB 4HGMA 2AXGB 2HN7B 2J4WH 4X7TA 3ZHDA 1BQHB 2AEIT 3F6LA 2YPKB 3WFDL 5TDPB 3OQ3B 4UV4H 2IBZX 1BFOB 2H26B 3QEHA 3JXAA 4N0FA 3SKMB 3AAZB 1OOAA 3QDGB 1QFWI 4N0YH 5L8KB 2FD6L 4ACPA 4LEXL 4HC1L 1RJYB 5HI3C 2I9TA 3WIIH 2AEQL 4UTAH 2ED8A 2W0KA 5HTSA 3DHJA 5FYJL 5F6HJ 4OCRL 1QQDA 2O5YH 5FUCE 2NTFA 1I9RL 5DJAB 5I1AA 5DRZA 3HR5A 4G8IA 4U1KA 4ZMAT 4N1EA 2BVEA 4NT6B 3V0WH 4MD5B 3ZL4L 2PR4H 4Z7NF 4RFOH 3FOMA 4WFFD 2R2EB 1KPUB 4DTGH 3ZSSA 2PTTB 5GGSB 4U7KA 5JXED 3ARUA 5HGHA 3IFOA 1HK6A 5CKGA 3VFSB 4QNPF 2H2SC 4CMMB 4R7DB 4M00A 1DFBL 2VUYA 1QPXA 1T22B 4XPAH 4YK4B 4WCYH 3LEYL 2Y36H 4HS6B 3BQUA 25C8L 1UFUA 3QHZH 5DEZA 5F21B 1EO7A 4P5TA 1MHCB 1J8HA 2ICEA 2BMKB 1IGCL 4KY1H 1MCOL 4ZQKA 5LGHH 4RWHA 1FNFA 3LH2H 1TPXB 3PIQA 1B0GA 1F97A 3MBEA 2W0PA 1AQDB 2BNRD 4G8GD 5KOMC 1E4KA 3PL6D 3ZE2E 3MV7E 5FGRA 1QKZH 1P9MC 5KJRH 1U8LB 4OI7A 1TVDA 2SEBB 3JWOC 3OZ9H 3M1BB 4JQXA 4FQCH 4HQQL 3M07A 3VA6A 3C5ZA 3HC3H 5DJCA 3FHAA 3RP1A 2ENYA 8FABB 3ARFB 3EFDH 4H88H 4MQSB 1P7KA 1DVFA 1RMFH 1ETZA 4X8XA 2WK2A 4XBGB 5BZWB 5M94B 1BMGA 2IAMA 4NKIL 1MWAH 5TF0A 2F53B 3TC9A 3FQRA 4HUWA 3MLSL 3RDTA 4S1QL 4P5KA 4WNQB 3CZJA 2GCYA 4IRSA 4LK4A 1C5BL 3PGCA 1UACL 5MEPB 5DZLA 1F8TH 3D85B 3T0WA 4NN6C 1YN6B 4WHYG 2RHEA 1OTUC 2C5DC 1CXKA 2BCKA 4I18C 1D5ZB 3RX7A 4F9PA 3DVFA 1T83C 3C09C 2V17H 4Y2DC 1CBVH 1GC1H 4LLMA 1EERB 4ZYKB 4OCWH 1KFAH 2NY7L 4YDJB 3T3PE 5FB8A 1F4YL 1QLEH 2QR0A 3UO1L 3T8XB 5DUMH 1K8DA 1C16B 2X10A 4OUUB 4X6FA 4N90D 1ZLUK 2O26U 3H3PL 5C0DB 1ES0A 2I27N 1NQBA 4P9ML 3L7FB 3K46A 3PV6A 1BJ8A 3B4NA 5H94B 4FG6D 3DYOA 1X5IA 3QNYA 5C0AD 4Q9RH 3H7BB 4RFEA 2DQFB 4P2RD 1PY9A 1NCTA 3MGAA 3MNVA 3AS2A 1JHTB 2EYRA 2NXYB 3S88L 1PKQA 4Q6IA 2OP4L 1ZMYA 2A6IA 5JUEL 5FYKU 1QHOA 2AK1L 4NQTA 4NRXB 2NX5D 2MCG1 5EG6C 3BP7A 5JOFB 3P9LA 4HV8A 4D9LH 1P53A 3BWAA 4TPRL 4YE4H 3OX8A 1KG0B 1UGNA 2BY2A 3OHXA 5L6YH 1E28B 4HK0B 3FO0L 3I6KB 4L3EA 5CJOL 4P23A 3FJTA 1GOGA 4OI9A 4PJCA 4PGDB 4J12A 4LVNB 5ESVA 5EU4B 3B83A 3FCTB 5IGXL 4RFNB 1HHIA 4JFDA 1KJVA 3K8KA 4J4PC 1WWCA 5TDNA 1FNEA 1N8ZB 2XWBA 4JDTH 3QO0B 2Y23A 4V1DB 1BM3L 3D2UB 1YEGL 3DV6A 1H3TA 1OAKH 4W6YB 4F7TA 2DQJH 1P4LB 3VXOB 3GHBH 3U4EB 5I1LA 5ALBL 3WIHL 1ZLVK 3GO1H 1EXUA 1J1PH 1MVUA 2ICWA 2IF7A 4PP2A 1D5XA 1NUNB 2APFA 4L8CB 3QUXD 1ZVSB 4L8DA 3STBA 4MS8D 4MZ3A 1IARB 4D9RD 3BXNA 2H1PH 3OKOA 3Q2CA 3MREB 3CCHA 2ZPKL 4C57C 2YA0A 2AJZA 3A67L 3GBNH 1UB5A 4HIJA 3O9WC 4JFXB 1IGFH 2OL3A 3UJJL 5F1OB 1RV6X 2Z91B 1G6RL 1KPRA 1FZKB 2YN5A 4U1SA 5B3JE 4MQXD 3EYQC 3DURA 3EOAB 1S9VB 2W9DL 4LP4A 4PJ9D 3ZKMD 5L2KE 1D5BB 5DEFA 1IEHA 2EIZA 3ARBA 4Y5YA 3BQUD 3VXNB 3HFMH 2CKBA 2Z31C 1DL7L 1NL0H 4MJ4A 4R7NB 4P5TD 3PP3K 1TCRA 3X14A 2X4NB 3BPNC 1A4JA 1RZKL 4UQ3B 1Q0YH 1I75A 5LGJA 1NGQL 3T0DA 5INCA 1QHPA 4P57B 5GS2D 3UTSE 4WFHD 3BP4A 3QCUH 3L5HA 5E6IA 3MRRB 2JIXA 1MJJB 3WEXB 3WL9B 3QFJB 1CXFA 1P7HL 5C7XL 1FRGL 1IILE 5DD6B 1K4CB 1DQLH 2F58H 5C0FA 4IDLA 3RVUC 3C5ZD 1CFTA 5A3ID 3BH9A 5JPMA 1UCBH 3D5OF 4I13B 4AEEA 2OR7A 3RA7L 1NJ9A 5JHLL 3MCKB 5EFIB 4PR5B 4G8EA 5K9KB 3CX5J 4XNUL 2FATH 3UJTL 4EI5C 4ELMA 2IAMD 5FYJD 4UNVA 1I8MA 3WNKA 3RDTD 4NUGH 2AS5M 1EAJA 4WHTB 3U7AA 3LIZH 5CFHA 4I3SL 4KQ4H 2BNUB 1OGTB 4QHUB 2R1WB 3S9DB 3GSQB 1MCSA 3PWLB 5C9JA 1UWXK 1TJIH 3S3SA 1YEEL 3X3FL 2X1PA 5CZKA 4M5ZH 4FTVE 4UIKH 5L0QC 3BHBB 3ZE0E 3B2UD 1S5IL 2NNAB 4KKBD 2D0FA 5MI0C 2WWMD 1QFUH 1A3LH 3GMOB 1TIUA 4XT1C 5D6CA 2XYCA 5D72L 1YQVL 1VFAA 1T89A 2P5ED 3GMNA 3NPZB 1II4E 2X4SB 1H0DA 3BZEB 1CDJA 1JHLH 3HE6B 4OGYL 5T3ZL 3BIKA 4HIEA 1K2DB 5DRXB 1N3NA 3UBXI 4KV5F 2DLGA 4PIRF 5ANMB 4OZ4B 3BPOC 1GIGH 4ESKA 2Q6WB 4OLUH 4RRPG 1T1WA 3AMLA 1AGDB 2GAZB 4Z78A 3JBG7 1RY7B 1KYOK 2X4QB 3ARDA 1IZKA 2BVQA 3K80A 2DMKA 3LV3A 4NRYB 3KPRB 3I2CH 1FL6B 2D31A 2Z8RA 3MROA 1GC1C 1YMMA 1FLTX 3IB4A 1QZ1A 2F8XC 3RZCC 2GQHA 3CFDA 3BE1H 1AI1H 2FJHB 2P5WA 2GSGA 1QSVA 4PJIA 4WJ5B 5E2TL 4ODWA 4ZSOA 2ZCLL 2FX8H 1UQSB 3O0RL 3SGJC 5CBAA 3SY0B 3VFUA 1JNHB 3CLEH 1OCWL 4LRNH 4P23D 2RB8A 4F7MB 3IJSB 2NY6C 4MDJB 3UJIH 1GGBH 3OKLB 4UQ2A 4GJTB 3IXTB 1ZXQA 3O11A 1DSFL 2ARJQ 5FM8A 1K4DB 4JFDD 1CICB 4P2OD 4GFTB 5BOPA 1NMBL 3O4LA 1P5VA 3QPQC 2A1WL 1TVHB 4XWGL 2YA1A 3UTSB 1IC4L 3BZ4B 1JNLL 3O6FB 3WXWL 2BNRE 4Y16A 3MZTA 4XP5L 1UM6L 5H2BA 4YEFA 5L88L 1Z0NA 3HZVA 4UILL 2FLBT 5F7EH 1LO3L 1WZ1H 5IF0A 3DYMA 3BFOA 5ISZD 2EC9U 2EC8A 3IGAB 1MELA 3E6HB 5HDLA 2XKUA 3HS0A 4WWKA 4PJHF 4LCCA 1MCQA 3SQOL 3H9SA 3P4OA 1OL0A 4Q9BA 4JDZA 5GS3A 1FVEB 1UM5H 1Q9KB 4ZXBA 4LPYA 5B8CA 2B0SH 2R29L 3PHQA 4NNPH 4F2MA 4P4KC 3ILQD 1AP2B 4Y5XC 1KN4L 1KENH 3ARBD 1A02N 3QIWA 4K23L 1EA9C 4HHAA 2NY5L 2XTLA 5MERB 2DDQH 1QR1A 2H3NA 1DLFL 5DMIH 5EU7E 3FO1B 3SDCC 3D3VA 4MJIE 4Z7WA 4KRLB 1JGVL 2EH8L 5BVJA 3RIAK 1KOAA 3MLXH 1C5CL 3QDAA 4GAJH 3JVGC 5F71A 5IFHL 4UV7H 2GIYA 3LRHA 2BVYA 1F3JB 1JMZA 1CE1L 2WSKA 4Y4HA 1A9BB 2YXMA 5FYLH 3FRUB 5BO1H 3NACH 2XQBH 3GRWA 4NN7C 1A4KB 1KTDB 4G6FD 1HNFA 4QT5B 3BN9D 4ODTL 1JNJA 2EDQA 3G6JF 4WWID 1SYVA 1ONQA 5L9DH 1RI8A 1F00I 5CLTA 1X5KA 4NKMA 4JPIB 3RY4A 4PRHB 3TIDA 2YBRA 4MD0A 5C07E 1DEEA 4TNVK 3PE9A 2XG4A 3P9MB 43C9B 4YBHA 4P2QA 2R56L 1IAOB 3SKOA 3DMMD 3C2AH 4B50A 4MQ7B 3NCBB 3VDAA 2NY3D 4ZUTA 5BRZB 4XMLH 4JHWH 1Z5LB 5AEAA 1N2RA 4JLRA 4M62H 1BD2A 3KYMA 3SPVA 2PYFA 5FOBB 1T80A 2JLLA 3U9UA 4BK5A 1IAMA 1U6AH 3GGWB 5DHVB 4OQTL 1CXEA 1FYTE 5HDBF 1ADQA 1Y6NR 1AGEB 1N26A 1HINH 4WDIB 4X80L 2P24B 2PXYB 4LLQA 3EDKA 4JG1L 2UWEA 4JG0L 3Q3GA 4URTB 4LSTL 1AD9A 4K94L 3CNKA 3TO4A 1U3HD 1FO0A 1ACZA 4HX1B 2Q8AH 2AK4A 5E8DH 4NZRL 4JM2F 1BJMA 3IFLL 2YSSB 3WFZA 2Z9TA 3QDGD 1S9WB 4NZUH 4IIQC 1FIGL 4MCYA 3T65A 1EUTA 5TGBB 5DMGD 2EO1A 1T2QH 4GXUM 4M48H 4K3JH 2BHZA 1RUAH 1DBKH 1S7WA 4Y4FA 1NDGB 4ENEC 4YO0A 4U1HA 2X4RA 5KS9F 1I9EA 1YEJL 1ND0B 1IGTA 4RWYH 4YHNA 1NCCL 5DD1L 1FNHA 1FP5A 3ZT7A 3UTPD 4NHUB 4NO5A 4PJEA 2RFXA 2XZCH 3BKYH 5E1HB 5FGBA 3HRZA 3LB6C 4XP1H 2YZ8A 3ARSA 1ACYL 4BZ1L 2V7NB 3WO3B 1P69B 4TRPH 5JDSB 3A6BL 3FQUB 3DUSA 3IFPB 5ACMA 5EOCL 4CN1A 2NW2B 4EI6B 5JORA 5JO5B 3QRFM 3QIBC 4WTWA 4NJ9L 1J8HE 3P4MB 4HCRA 5EC1A 4BSWA 3NAAL 2IPKB 1LDPL 1A3RH 1KIQA 1PG7X 3D6GA 4LCUB 3ARPA 1UYWH 1VACA 4PGBB 4YBLB 5E2WL 4OD1L 5HHNA 3SQBA 5KSBB 5IW6B 4WW1B 1U8JB 1G7PB 5K9OA 5EOTB 3SE9H 1JYNA 5DRWA 5C71A 4YC2C 1OAQL 1XGTA 3I85A 2EDHA 4LQFL 3T2QA 5HHMB 1A1MB 4X6BB 5T3ZD 1FE8H 4KVCL 4WEBL 3IDMB 4JFFB 1BQSA 1CYGA 3EYFA 5CP3A 4OCYH 3SCMC 1NGWA 3O8XA 3ARFD 1KV3A 1P6FA 2PTVA 2X44D 2VAAB 3LKSA 2A83A 1LEKB 4WUKH 3RWEA 1ZHLA 3G5ZA 2FLRT 3RVVC 3EBAA 3RHWF 3B5TA 3FQTA 3DVIA 3LQAL 4MNGA 5TQ2H 4PLNC 4XHQA 4BKLB 5ACZA 4U49A 4DKFL 3WLBA 2R1XB 3L3GB 2E7MA 3I6LE 3V5HA 3LKOB 3RWGA 3QIWD 3T1FB 2LAGB 4ZOEA 5IB2B 5FO7A 4LU5L 4Y7MA 3D85D 1A7NL 2FD6H 4N68A 1N4XH 3D3VD 3QIUC 3V6OE 4BFGA 3KDMA 1UWGL 3HHRB 1J1OL 2BNQA 4KMQA 4OCRH 3EJZC 4F3FB 1WBZA 3AS0A 3L1OL 4J1UB 3OGOE 5C8JB 3DLQR 5I18H 3MR9B 1X5YA 1FYTB 1I4FA 1MUJB 2JJTA 2FECL 4OF7A 2ILLA 3QXAB 2NXZC 1X6NA 4LASH 1OQOA 4NSKB 4NM8L 2O5ZL 2HFGL 3L7EA 4OBSA 4A6YA 3DECA 5E08L 4GG6A 4NBYB 2Y6SC 1F3DH 5AD0A 5GRVK 3LEYH 3QQ4A 3EHBD 3BVNA 25C8H 1RZ8B 5E8PA 4P2QD 1VCAA 4PY8I 3RWDB 5CIPA 4QRTA 4YNYB 5L8JB 4HJJL 1KULA 1IGCH 1JGUL 3FFCB 1MCOH 3FB5A 4FABH 4P5MB 1YEHH 3ZT6A 3NZHH 1CL7L 4GRLB 1S5HA 1MIML 1BD2D 2W92A 4I0PC 3MJ7A 4YIQA 4WHCA 3CFBA 4QF1A 3V6ZA 3TF7C 4K8RH 4XWOC 1F02I 5DD5L 2IALB 1YDPB 4YX2L 2FBOJ 3MV11 4MWFA 5DUBB 4HQQH 1BVLB 4PJ7F 2EYSB 4ISVB 3TNNA 4N0CD 1T21B 4NZTL 1Q38A 2J88L 3MLYL 3TO4D 4O5LL 4FFZL 3HZKB 2NY2B 4L3EE 4YFDB 4AG4L 5D70L 5DUPH 4PJCE 3QZWG 1OAXL 4PV9A 3TEUA 3W9EB 1L6XA 5HY9A 2FH6A 1HZHL 3ARGB 5FHAL 3AREC 3QXDA 1UH4A 2GTZB 1F13A 4N5UA 4V1DD 4JANA 1C5BH 3D2UD 4GRMA 3EYVA 3DRQB 1UACH 4WGWB 2W60B 2ZP0T 5F72S 4G7YL 2XTJC 1Z9MA 1H5BB 3CDGB 3WNPA 2GHWB 4DCQB 1G6VK 1S7XB 1CQYA 3OKEB 3R1GH 4S1DD 1YY9D 4JJHA 1E6JH 1C1EH 2D7MA 3VW3H 3KAAA 3VDCA 1TVBB 5GRWA 1K6QL 5IROA 1IL1B 4DZBA 5I76A 3BT2L 2NY7H 1JF5A 5L7XL 4CDHA 1F4YH 2PETA 1GCFA 1NC2A 2HVJB 3NFSH 2BVOB 1PY4A 3GJFH 1J5OL 3GK8L 4GQPH 3H3PH 2CH8A 2CD0A 3E8UH 4AT6A 5ICXB 1N0LA 2R0WL 1D5MA 1A2YA 2MMXA 2HTKD 2OZ4A 3VFTA 3RKDC 1U8KB 3GIVB 3L3KB 2HMID 3VG9B 4IMLB 4OIAA 3RWJA 4WW2F 1B0RB 3CSBA 2EDEA 4QYOA 3QFJD 5EBMA 3FB7B 3S88H 4Y5VA 2BOCA 1I7RB 3L3IA 5D2LB 5D8JH 5C2UB 5JUEH 1U8NA 1U8OA 3OXSB 2CIKA 4OFYD 3U9PH 1HHKB 1HE7A 5HYSA 4M7LT 4KJQD 3P4LA 4KK9C 3CJJA 4MJ6B 5AUMA 1T0NA 3RNKA 4TPRH 1KC5L 4R4FH 3O8XD 3PNWA 1X5ZA 1GRWA 1KB9J 5CD3A 3FO0H 5CJOH 1I85A 3IDJA 5JA8B 3VXUA 1RIUL 3IDIB 4Y4KC 5K9QG 4PPTA 5J1AB 3KLHD 3TBYB 1DUZA 4ELME 4AIZB 2WUCH 3PV6B 4M61A 3IJHB 1XR8A 3NA9L 4JFOA 4TVPD 1DTUA 4XCCH 1VADB 1M7IB 2ZG1A 4U3HA 3X11B 2VXUL 4KVNH 5SWSB 4O4YL 1Q9WA 3TBWB 4MDIA 1WV7T 1FZMA 3ES6B 4OAWB 5HGDB 1BPVA 3S5LG 2V2XB 4PGZA 3UMTA 3QUMH 3STZA 3QUZC 5D93B 1N7MH 4PG9B 1KJ2B 1A6TA 3D48R 1U93A 2ITCA 3RI5F 1T66C 2OI9B 4C54A 1CF8H 1WTLA 5CSZA 2E7BA 3WJLC 3UJJH 3L95B 4ALAH 1ED3A 5KSVA 1A7RH 5BW7C 2W9DH 5FECB 5IBLD 4GAFB 4L29A 3F6IA 4J8RA 5AYQA 5ADOH 3BUTA 3CFKB 4PJFA 2XWJA 4LOUC 1DDHB 2J5LC 3C08L 3F58L 2YD5A 3P73B 4K3DH 1RZKH 4WO4C 3B9EA 5T5FH 1NGQH 3U46B 1I8KB 1MCHA 3GSNB 3KPRD 1NSNH 2J8UB 1RK1B 4L8SB 4XHJD 3TFKD 3RFZC 1WFOA 3MLVH 5IQ7L 3OJDB 4OCXL 3LPGA 3OB0K 3PWVA 4MJ2A 1YMME 3IRPX 1FC2D 4OZHB 3TN0A 1AKJB 3ZE2F 5E8EB 4B0MM 1FRGH 3LMJH 3TA3C 1OHQA 4G6AD 4MA8H 2AKRA 3V4PL 3VWJC 4ERSH 1CFNB 3NCEB 3L3JB 4LGRB 5EBLB 2P5WE 4PJIE 2A77L 4OJFL 3HG1A 4K55A 4OKVA 4DFHA 3KG5A 3MGOB 4ZSOE 4QXUH 3QYCA 5F7WC 1FDLL 5F7HA 1OP3K 5JHLH 4N8VA 1E27B 4GRWF 2VLME 5B4MC 3LEXA 3NFPA 1S9YB 3UJTH 3QQ3A 4EQ3A 4IMKC 1KCUL 5DDHA 5DK2B 4Z7VA 1T1ZA 1QRKA 4OTXH 1EZVX 3GM8A 3GI9L 5DS8A 1QYGL 1CIUA 2D7TL 2EDLA 1JWMA 2EKSB 3K1DA 5I1DA 1A4JB 1ULVA 4QHKI 3QO1B 1CT8B 3O4LE 5C0GB 3O6FD 4OGZA 3RWCA 1DUYA 2VZUA 5E7FA 3RQ3A 2XZQL 3LHPL 4UIMB 4BZ2L 5KTEL 4I2XB 4ORZC 3I75B 1YEEH 4RAVB 4K8RC 4RGMB 4DOHB 1JPFA 4HKBA 3DX9B 5IHUL 2DOCA 1S5IH 4LLYA 4XVSL 3KVQA 5D7KD 1E4JA 5HPMB 1I1YA 1W0VA 4ZFFA 2FO4B 1ZGLA 1V7ML 4XNMB 3ZKNC 1YQVH 4GKNA 3IETB 3KPOA 3H9SE 3T0EC 3SDXA 5IB1B 1VFBA 1VERA 4YHIB 5MP6L 4FFVD 3B9AA 3LKNB 4HAFA 4OZFH 2EE2A 1F6LL 4OGYH 5KANI 4UT7L 4JM2C 5E03A 1J9CT 1ZEAL 4LPXA 4PRNB 3A6OA 5J6GB 1F4XH 2OSLA 2FIKB 1J0KA 1XIWC 3T77A 5ERWA 4CN6A 5FK9B 4JPVL 3QXUA 5T5NG 2XICA 3SBWA 1RZ7H 1J0ZA 4Z7WE 2A6JA 4JKLA 4U0QB 2C1PB 3SGDI 1QLFB 3QZWB 4NIKB 2A0LC 2ZNWA 3V4UL 1JV5A 2DYPB 2VSCA 4JVPA 3K8LA 3QXVA 1YPZE 4WV1A 1XF5A 3LSOB 1GL4B 1ZWIB 3CU1A 4ODUA 5FXCH 4G6ML 4LSDA 4E0RB 1ITCA 2VLRE 4HD9A 1TLKA 4PRHD 5I15L 3VFPA 5DFVD 5GISL 4FZEH 2C7UB 4KKLD 4GBXC 4LSRH 1Z0MA 2AJYH 2XY2A 5FF6A 2BDNL 5HI5C 1DSFH 3SDAB 5BRZD 2XQYK 4P2QE 5JHDB 3HI1B 4G42A 4XMPL 4ZTPL 4YH6A 2KL6A 1WZLA 2DQCH 1NMBH 4RMRA 2A1WH 1NCDH 1Z9SA 3A0OA 5E70A 1SJEB 3QEQB 1BD2E 1IC4H 2ICES 1JNLH 1MRFL 3WXWH 3CGTA 3WNLA 4FXGB 1U8PA 5GSRB 4XP5H 2XZZA 3QNXA 2BJML 5L88H 2JJSC 4QHNB 1QSEB 2X42A 3HCVA 5JW4M 5DMJB 4UILH 2PXYD 4LSPL 1LO3H 3CDYA 4M1CC 3SDDB 4BSVA 1YJDL 4ORGB 1FFQA 2UWEE 3KLAB 1EGJL 5C3TA 1QVOB 3KLDA 3SQOH 5E2UL 4R0LC 4Y88A 3HN3A 2VDQL 5IFJA 5DMKA 2CLRB 2R29H 2FWOA 5IQ9A 3RAJH 3QI9C 2AK4E 5B3JF 4G6KH 2ATKA 3OR7B 4QOKB 4LCWB 2EDRA 1KN4H 3DVNA 1DLFH 3D0LA 1IAIL 1KGCE 2OQJB 2ZUXA 4NDMB 1ZVYA 1U8HA 5C0NC 1G9NL 3NOIA 1JGVH 2DLTA 1FFPA 3ZYZA 1V8HA 2J8HA 4EDXB 4EUPH 5BMFL 3VJ6B 5GIRB 3FQXB 4F7CA 1CE1H 1QG3A 2VABB 2G75B 2PF6A 3KPPB 4F37K 3OPZL 3NZ8B 4ZNEE 2GI7A 1MOEA 3O41B 1HSBB 5IVOA 1F58L 2I26N 2I07B 3HG1D 4HBQA 3RNQB 1DE4A 2EO9A 5GS1A 4ODTH 5T1KA 5I2IB 4PJEE 1A14L 1AXIB 3FZUC 1KJ2L 1S7SA 4JAMA 4KI1A 4U0RC 3SEPA 4G9DB 3KPQA 5HHPB 1NAMB 1NLDH 3LKRA 4OLXL 5TPWL 3MV8B 3S5LB 5F7DB 1EHXA 4JHAL 3I3DA 2DQHH 3RIFK 3MRLB 1QD0A 3U82B 2J6EA 1PQZB 1RZKC 5KAQF 3QDJB 5DT1L 5E9DB 1R5WA 4Z6AT 2UVFA 1H15A 4JFHD 4H25A 2VXQH 1RUML 1NFKA 3AY4A 1FHGA 5IIEB 3GSNL 5HHMD 4OQTH 3ZE0F 1YPZB 4JFFD 2CDFB 2PCPB 2WUBL 3DX8B 4OM1H 3IKCA 3KJ4B 4XC3L 1HQRB 1MNUL 2G2RA 4X80H 1S8DA 3MLTB 1T1YB 1JPSH 2VLRB 3K8MA 2CLZA 4AM0B 4LSTH 3KYNB 1AGCB 3IFNL 4HSQA 4RGNB 3QDMA 1FVCB 4MNGE 3NTCL 4TSAL 4ZUUB 3CPLA 3WS6A 5CBEB 5EU5B 3Q5YA 5D2NA 3UAJD 3KS0H 5F3HA 2NQCA 4XRCA 3QH3A 4ZUVB 3VRIB 3O2DA 1UXWB 3CXDH 5F7UA 5IHZB 3MPCA 1GVIA 3M17B 4MA1C 1FIGH 3BPCA 1MHHB 1V05A 4G43A 4NKOA 2FECI 2R2BB 1SEQH 2BNQE 3BP6B 3U1SL 1BOYA 4KJYA 1ORSA 4U6HA 3DROB 1I7TB 2I9LA 4LLAA 2PO6D 4LDLB 3P77A 4KTDH 2M1KA 4DKEL 2VXVH 2VIRA 1YEJH 3FT3B 1A0QL 1F3DJ 4FZ8L 3GSXA 1U95B 2OR8A 3PQYA 1NCCH 5DD1H 4MNQB 1WIPA 2VITA 4UDTB 4KKAC 2ATPB 4LFHG 1U0QA 2B4CL 2WQ8A 5F97E 4OLVL 1MLBB 3V0VA 1UZ8B 3VCLA 1BJ1H 1RIVL 4YR6A 5I8OH 5JW3L 3MUJA 3GMQB 4HS3A 3UDWA 1ACYH 2B1AH 4LRIC 5KSAB 4X99B 1CL7I 1OTSC 4W6WB 3BEWB 1EBPA 2IJ0C 4U1MB 4PV8A 5HYSG 1H3GA 2NPLX 1IGJB 5EOCH 4WVRA 2V5TA 1DBJL 3FFCD 5H35A 2WBJA 2NZ9D 2JELH 4GRLD 2V2TB 1CGWA 3WFHB 1S7QB 3DGGA 3VFVB 4MXWH 3NAAH 4WW2C 5HD8C 5JOEA 5F89B 1QLRA 2BSSB 4YGVA 5J3HD 2X70B 5C0CB 1KN2H 4OD1H 1OQXA 2BK8A 4Z7UA 4JPKL 4DGVH 3C87A 3C5JA 12E8L 4LQFH 5L8LB 4N0RA 1A6VH 1KSRA 4KVCH 1GZPB 2JE8A 3HTLX 3C8KA 4M3JA 2GITB 1P7QA 5DVOA 4F7PA 4S1RL 5INDA 4MD4A 5E1AA 4BFIA 3OGCA 4JDVB 4X6EA 4HEME 3D1MC 4OSUL 4RBPK 3BMVA 4DKFH 3AS1A 3IF1B 2D9QB 3BRFA 1ERNA 1AE6L 3I02A 4LU5H 2YUZA 3GBLA 4I9WE 5EB9A 1KIQB 4HWEH 1UWGH 3KYOA 4CGTA 3SKUD 4J3TA 4LLWA 3UTTA 3QP3A 2X4TB 5FUCC 3U0PA 4JFYB 4L9LC 5IB4A 3H3BC 3MNZB 4IJ3B 2HLAB 4ZFZB 3IS1X 5DGRA 2DKSA 4S10A 4CU8A 4X6CA 4GAGL 4RZCA 2VNCA 3N0PB 2WP3O 5T1KD 4HUKB 1CXLA 2HFGH 4BH7A 4M8QA 4XPHH 2OJZL 2AJUL 5E08H 1OAZL 4LMQE 1V7NH 1ZLWH 5BJTB 3QULA 2QEJA 4OCNC 1HH9B 1ZHNA 4F7EB 5FO9A 4ZPTA 3U4BL 2FL5B 5FHBH 4OIBA 3PDGA 5IB3A 5IVXA 4FMKA 4FQLL 2HJKB 5IMMB 1ZA6B 3WN5A 3MRGA 4Z8FL 4PD4K 3HI5L 5D7IB 3GNMH 1JGUH 3B3IA 1HYSD 3HE7C 1ZHBB 2JB5H 4NYLA 3SJVB 1MIMH 1CK0L 4K7PH 2MKWA 1IMHC 2NW3A 2X05A 1IBGH 1LK2A 1EAPB 1I3RA 2WINB 3N9GL 1LO5A 5DD5H 4YX2H 4AEHH 1KT2A 4LVOB 4X5XB 5CZXC 2YEZB 5F7YC 1X44A 4PYHA 4QO1A 3MMEB 2H32B 4NZTH 3MX0A 3GHEL 3ELAT 4O5LH 4R97C 2ZUWA 4AG4H 5HHVH 3VXUE 3HC4L 5D70H 4LAQL 1KEML 2DLFH 2GK0A 2YOCA 4YPGA 3ABZA 5LAXA 1FFOB 1VFUA 3IDXL 3S36L 1NAML 2O5XH 2APVA 4QRTB 4XBPA 4KK8D 3UC0L 2HT3D 1FGVL 2YXFA 3D69B 5SWSD 1L0XA 4G7YH 2MQCA 4JN1H 1QPPA 4KUZL 2VDOL 3G9AB 4LCYB 2EDXA 5GZNC 3FL7A 2FX9L 4OFPA 4LF3B 4KHXL 5D1XB 4ZOCA 3HLAA 1CDUA 4KC3B 5L7XH 3SO3B 3U7YL 4CMHB 5I16B 1AHWA 4KZDH 3CZFB 1CG9A 2YPLA 3TPKA 4F58H 1HHGA 2A6DA 1OW0A 1JFQL 3GK8H 4FP8H 4XTRD 2DTML 5IM7B 3G5XA 4U1LB 1J0HA 1MIEL 2H9GA 4UB0H 2ADIA 4RSVA 5D1QC 2A73B 4QGYA 1RUKL 2DD8L 4PJFE 3EOBA 2WBJD 3ZDXE 4WHDA 4NUJB 3BIBX 1JF1B 4I77L 4RNRB 4L4VB 3KWWB 1JZ5A 3HPJB 2E7LC 4HKXB 5CJ5A 1AKJD 1XMWA 1T04A 1F42A 3BGAA 1OAYH 3SE8H 1NGZB 3IJYA 4EQ2A 3QUYC 5FV1L 1JGDA 1H3PL 3FONB 1Y6MR 2PYEA 5F6IB 3K74B 3BUYA 3HG1E 1KCSL 3JV4A 1VEPA 3C6LB 2VDPH 5C70A 3B2VH 1U91B 3PWPA 3CUPA 2UZIH 1BBDL 1CFVH 5EZLB 5CKAA 2E7CA 3BP5B 1PYWA 2YD1A 5C0BE 4JVUA 3HE6C 4ZNCD 3HNVL 4YHPB 2QLVB 4Z7VE 3AU1B 3ESUF 3TJEL 1A1NA 1QO3B 3MA7B 3C8HA 3Q5OA 1DANU 3SOBH 3VFMB 5D1ZC 1UVQB 2GT9A 2VH5H 4H5SB 5LBSL 1WWAX 2HKFH 1MQ8A 2VXUH 2GSIA 4FXLA 3NCCB 4R26H 4HBCL 2BOCB 5HHQB 1HH6B 5J13C 3UTTD 4D2NA 3U6RA 3T08A 4OT1L 5T3XL 2DRUA 4TTDC 4FFWD 3RX5A 4E41A 5TFSH 4OFDA 5EO9A 2AJXH 1AQKH 1EPFA 2P47B 3HPLA 5EUOA 4CADB 5IEKB 1CGTA 5IHBA 1KACB 2D2OA 3GIZL 5GGRB 1HKFA 2VC2L 4DK3A 3LPFA 4OLZL 5DVNA 2EXWC 4QTHA 3FB8A 3OKDA 4ZFOA 3EO0A 5CEYB 4DW2L 2QQLL 5F88B 4LNRA 1TZGH 3THML 1PDKA 1OF2A 1AGBB 1AD0A 2OBGA 2QSVA 3Q6FB 2HTLD 1UJ3A 3MO1A 3SE4A 1T5WB 4LDOB 5DK0A 3TVMA 1FSKC 3TJHD 5B38A 2FGWL 1P84K 5HHOB 3H9HA 1FL3B 3PHOB 4OV6F 2DWDA 4OCXH 3VE0B 2DYPD 3BEVB 3UZQA 4OFKA 4U1IA 5C0RL 1W8NA 1LHZA 1I1AA 3JWDL 4DGIL 3U0WH 3RGVA 1CD8A 2X9XA 1NMCC 3OXRB 3WV0A 5CEZD 1MH5B 2GJ6B 2DQIL 1S7TA 4EBQH 2VR9A 1JZ4A 4JFQA 2HFEA 4HG4K 4PTUA 1P4BL 5J6HA 4HLZG 3DSFL 3L3OB 2ZCKH 4PJCF 5DZOA 5LKNA 5FKAA 3SDAD 2ZKHH 4PTTA 3MNWA 3MRNB 2R2HA 4NN6B 3R8BB 4KAQH 2D7TH 3QEQD 4I18B 1NBZA 1RJZB 3HUJB 2KKQA 1IC5H 3LD8C 4EVNA 2FB4L 5F1SA 4IOIB 3JTSA 1SBBA 4DFIA 1JJUA 5KTEH 5DC0A 4BZ2H 3L5JA 4U1JB 3W9DA 3SDDD 1EFXA 2DWEB 1KXVC 4K7PX 5I8EB