2AJVL

Crystal structure of cocaine catalytic antibody 7a1 fab' in complex with cocaine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
216
structure length
216
Chain Sequence
DIVITQDELSNPVTSGESVSISCRSSRSLLYKDGRTYLNWFLQRPGQSPQLLIYLMSTRASGVSDRFSGSGSGTDFTLEISRVKAEDVGVYYCQQFVEYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody 7A1 Fab'
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
total genus 52
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajvL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajvL01
2CO6B 2CK0H 3I2CH 5J12B 3GMLB 1D9KB 3NA9L 1R5WB 4Y1AD 1TJHL 3CDCA 4Y4FB 1X4ZA 4NQDB 4Z0BL 2VYRE 3X3FH 2CKBB 4UAOC 2F19H 1T22A 2X42A 1ADQH 1P7QB 4XCFL 4J4PA 4UNVA 2ZUVA 4M5YH 2ED8A 2W38A 1NSNH 2YK1L 5B38A 4PJ8D 3JWOL 1LEIA 2CDGA 3IVKB 1IVLA 3A6BH 4N8CL 1GGIH 3LEVL 5DVKA 2BK8A 3HCVB 3T1FB 3P9LA 3K8KA 3T0EC 1AO7D 1NCWH 1CL7L 2VXUL 4K7PL 1LO4H 5DUPL 1AP2B 2R0KH 3B2UD 5C0IB 1I1AA 2R69H 2OJEA 3GBLA 5DD6A 5L88H 3CH1B 4UB0H 3RVWC 4ZOEA 1ZANH 1NGZB 4X6BA 1AFVL 2Z8RA 3D39A 5D71L 1KULA 3SKMA 3L3IB 2G75B 4IRJB 3VXQB 3QIBD 1X5IA 1S7RA 4FQHA 4WY7H 4EUPA 3F6LA 1AGBB 4YAQB 2PXYD 4GG8B 3KVQA 4OD2A 2CJUH 1ITCA 1RPQA 1BFSA 3OKOA 3ET9F 4NO3A 2ARJB 1IEBB 2VDML 2VABB 3UYOD 3N1PC 4IMKA 2BERA 2W9EL 1EHAA 3G6AB 2GK2A 3HZMA 3ARGA 1X5HA 3P11H 4QHUB 2IWGA 4XRCA 3H6JA 5FCUL 2LTQC 1CD9B 3ELAT 5DT1L 2NY3B 2NXZB 3KPQB 3RWEB 2VLJA 4KJPC 4OLWL 4P59H 4WUUB 4XI5C 1M6OB 4WFFE 4NN6C 5DRXB 4DVRH 3AC0A 2B1AL 3CVIH 5GGQH 1WICA 3TH4T 4RISH 3CXDH 4HKBB 4RFOL 4WEUD 1WAAE 1MRFH 1FIGL 3QUKB 1ND0B 4R26H 4S2SA 3HMXL 3TZVA 3P4MB 3MYJB 3OKDA 1MWAL 3RGVB 5EORL 4S1RL 5TDNB 4V1DB 5CUSL 2FECI 3CUPB 4GRLA 4PRPB 3DROB 5DHXB 3PHQA 5DHVH 3N1QC 4XNQB 4MJ5B 1LP9A 2HWZL 3SQBA 5D2LE 1IQDA 3TO2B 3EJJX 4JANA 3HC3L 1S8DB 4ETQB 2VXSH 3L5JA 5KG9A 3KPMB 4JCMA 1VHPA 1U8LB 2WK2A 3S35X 4P46A 1CDJA 4WFFD 3QDGB 2G5BA 5TGBA 2F53E 2J8UF 4NHCH 1UM4H 3O3AB 5IVXA 2CLVA 1T7XA 4AQ1B 4U7KA 3V6FA 5FKAA 3GMPA 3AGVA 3AB0B 5I1AB 1TVBB 4XWGL 1YEIL 4BJLA 5EU5B 4ZOCA 1FL6A 2AEWA 1IGTB 3MJGX 2DI8A 1X9QA 4PLJD 3VXUE 3WD5H 1BPVA 1OTUC 1JV5A 3HMWH 4F15C 1F6AA 3QBTB 3HZKA 1F6FB 3GNMH 4PRDB 12E8L 4JZJB 3MLYL 5T3XE 1J1OL 2XXMB 2VL5B 3L5WB 2DQDH 5DJXB 1GC1L 1G7LB 3NH7H 4ODVL 3BPLC 5B8CA 3CIQA 1JMZA 5DD3H 3Q6FB 5BJTA 4OZGA 5GS3A 3K8LA 3AFLA 4J1UB 4POUB 4PJBB 3BGAA 4JO3L 5F9WC 4RMUA 4UT9H 1OOAA 5F1KC 1IT9H 1A7OH 1RIVH 3GMNA 2F53D 4K55A 4I4WA 2MSPA 1C5CH 2PYEB 3BW9A 3DJ9A 3HPJB 1K4DA 3BO8B 3MRNA 4PJGF 2AABH 3KPRB 2A9NH 4CADA 1MNUL 3L5XH 3V2AR 1P4LA 4PG2C 1QSVA 3WUWB 1A7NH 3THMH 2H26B 1PZ5B 2BXZA 5T3XD 5HYJA 2E9BA 1XF5B 5E6IA 3MV8A 3UYRH 1DQDL 3K2MC 4HK3N 5HHXL 4UUJB 2OR9L 4PGBB 1KCLA 5I76B 1S9VB 1UYWH 1L7IL 5ALBH 2WW8A 1T1WA 3TCLA 5I71C 3FQRA 4PJCE 5I74B 3TYFA 2WUBH 2P24A 3RVXD 1I7TB 3QUYD 5J56B 1T2QL 4JFYA 4NYLA 4YHML 1VFBA 3WHE1 1B4JH 2DF3A 4LVHC 1OP5H 4A6YH 3GRWA 4M1GL 2NY1B 5JW4N 4HK0B 3JTSA 1WIOA 1INDL 2XY1A 3RUGF 6CGTA 35C8H 2YS4A 3T4YB 5F8QC 2C4FU 5DI8B 2X7LB 1O7VA 5JXEA 5CIPB 2GJZA 3D25B 4P4KC 4Y19B 3K74B 3G5XA 2AEQL 1XMWA 2B5IB 2YN5A 4DQOL 3VXNA 2XZCL 3P30L 4KV5E 1MQ8A 1JZ3A 1MIEL 3RVUC 5J0BA 1JFQL 4M02A 3C2AH 3D0VA 3IDXH 3KYKL 4YK4C 3QZWA 1DBJH 3RWDB 3ULVL 1YEJH 4QRQA 1BZ9A 4RWYH 4BFGA 1H3PH 4QRTA 2FD6L 1PVHA 3MLSH 1I3GL 3NACH 1W72A 3DLQR 5BVPL 2CIIA 5JMOC 5TF0A 4D3CL 4M1CC 3MTRA 1U2HA 5B39G 3VRLE 5EN2B 2UV3A 3MRIA 2BDNL 4GAYA 2VDRH 2NYYD 2X05A 3U4BH 1JYWA 1T4KB 2HFTA 4WFEE 2ICWJ 4WGWB 1SBSL 2P7TA 3L3DB 3NZHL 1GH7A 4LSUH 3RNQB 4XMKH 4U2YA 1NH6A 4J3UA 4D94A 3ZKNC 1PG7L 3G9VA 4TUKL 5DEFB 4OF3A 3QRFM 2EYTA 1R5IB 1NBYB 1ZLSH 4XNUH 4QRRB 2MCG1 3S4SB 1S7VA 3HG1B 4GQ9L 1NFDB 4FQCL 4RSVA 4XNMA 3P9WB 4MDIA 3RI5F 3CDGB 3W9DA 1MJ8L 1QO3B 4JFHE 3TJEL 3NA4A 1RD6A 3SKOA 3VRIA 4C59B 1IGFL 4JRYE 3JWDL 1F4WH 3F7PC 4P2QB 4MJIB 5HGHB 1T20B 5A16A 1S7SB 3QO1B 4XP6H 5T3XH 4AG4L 2WINA 4NKMB 3WJJA 4KVNH 3RFZC 4WFED 5GRUL 2AKRB 2EXYD 1CBVL 4LLVA 1AY1H 4L4TB 5D1QC 1CT8A 3CXHJ 4AEIH 4NUJB 1XGTA 5TJWK 1BZQK 3MRRB 1SJHB 5GQBA 5ALCH 4DGVL 4LAJH 4OV6F 3QQ9C 2CUIA 1WT5A 3MRJA 2FRGP 5HHPA 3OR6A 4QHMB 2FJGB 4R8WH 4ZTPH 1CQYA 4OM1L 5EZIL 5F7EH 3VWJA 4JFHD 1A1MB 5GZOD 1QNZL 1YNTA 3CFDA 5I17B 1KPRA 3O2WL 4NNXA 4D9QE 5FEBA 3DVIA 1RJZB 3BQUD 5E4IA 4EQ2A 2YBRB 4GAGH 4C56E 2XYCA 4JM2A 3ARDB 2ESVA 4FQXB 3O41A 2H8PA 1K3ZA 1N3NA 3CH8A 5J11C 3VXME 4XVSH 1A9BB 2O93L 1YUHA 5C7XL 4LOUC 5KW9L 5EBLA 4HFWA 4Y4HD 4OCXH 4PJ8C 5HI3D 1I9RH 1QQDA 2EEBA 1R3JA 1V5JA 3FTGA 2FO4A 1JNHA 2Y7QA 1J1XH 5TQ2H 1OP3K 3B9KD 4MJ6A 1MSPA 1YEFL 3UX9B 4UT6H 1NBVL 3DX8B 4U6YB 3O0RL 4JJHA 4OIIL 5ESAA 1H15B 4KKBC 3I50H 3WHE0 4D9QD 4XPHL 2IANA 3DGGA 4QTIH 4W6WB 5E1HB 4L4JA 4Z78A 4C56D 3C5ZD 3GI8L 2IFGA 2NX5A 3FQTA 5SWQB 1HK6A 3R1GH 2BP3A 1J0YA 3BKJH 3GSQB 4ZODA 5KANG 1U3YA 4ONFH 4YHIA 5C0AB 4LCUB 3VXMD 4WW2C 5DRZB 2PXYC 2CQVA 3BHBB 4HV8A 4TTDC 3RL1B 4O58L 3P4NA 5C0DA 1HH6A 4NPYB 4IDJH 1OY3B 1P2CB 2VLKA 3VFPB 2FX7L 3F7RA 4Y88A 1RK1A 1UWGH 4WGVB 5FYJL 3TFKD 5HPMB 3UCRA 4L5FL 2CLZB 1L9MA 1L0XA 2FX9H 2R1XA 4QHKI 4L3EE 1M7XA 3N85L 3KXFA 1BF2A 1TTFA 4ZFOA 2IJ0C 4TRPH 2A77L 2W1NA 4OCYH 1SY6H 5LXGH 3CFEB 5E2WH 4KK8D 5JIPA 1JGVL 2DOCA 2MNUA 1FPTL 1JJUA 3ARFB 2KBGA 1CGWA 1QBML 5C0FB 4M7KL 3LMJH 5M94B 1QPXA 5CBAA 2DQJL 4KAQH 2VH5L 2QSTA 3RPKA 2IH1B 3DNKA 2XN9B 3NVQA 5F6IB 1MJ7H 5IHBA 1TVDA 2PCPA 4HUWB 3V6BR 4L3CB 3PWPE 3SY0A 4ZSOB 4PR5B 5BZWB 3EYOB 4LASL 4CRPA 4E9LA 4MX7A 1GZQB 3D3VB 4YBLC 3GSNH 1HCVA 5DEZA 2LVEA 2QQLL 4L3ED 1FV1B 1OGTA 1FVEA 3QULA 5EU6A 3FO0H 2DQFA 1A6TA 2ZCLH 5F7DB 3QUXB 1QG3A 3WS3A 1G9NL 5ADOL 5EOTB 1N2RA 3ARTA 3E3QE 3BD3A 3BP5B 4JRXE 3KS0H 2C4FT 2H2SC 3H42H 1YEGL 4Y5XB 5IB2A 2FX8H 4UOW1 3ZDXE 2UWEF 4N0RA 2HTLD 5C0BA 5INDA 4G9DB 1KBGL 1X6NA 5F7LB 1TITA 5DR5H 2X4SB 3LD8C 3SGKA 4KK5D 4L9DA 1FNEA 2XTLA 1Y0LB 3FQUA 3RUGE 3PWPD 1MFCL 1SMOA 5HDQH 5CP3A 1JI1A 5CBEA 2IC2A 2P5EA 2Z35A 2PTTA 1ED3A 1DR9A 1FGVH 5DLMH 1YDPA 3OGOE 5F1SA 4WUKL 4PRIE 4E41A 2NR6D 3V0WL 4M8QA 1H5BB 1U8NA 1F4HA 3BP4A 5MENB 3FQWA 4G7VH 3GJEB 1VPOH 3FB6B 5DWUL 5GSRB 3SDAC 4JRXD 2OSLB 1BF8A 3NBNA 5D5MA 3LV3B 4WDIA 1T21B 1AD9A 5FDWB 3IT8D 3A67H 4OFPA 4ZUVB 5KSBE 3WSQH 4LRNL 4RMQA 5ICXA 1QSFE 3RDTC 4U1GC 2Y72A 4PV8B 1NDMA 3UC0H 3IU4H 4ZQKA 4EDWH 4F9PA 5CGYC 1U8IB 4X7SL 1T83A 1I9EA 2IALA 4Z76A 4UV4H 3K1KC 5SX4H 3MLRL 4HEPG 4Q74A 1BFVL 4XAWL 4W4OA 1MQKL 3SKJL 3U0PB 4FXKB 3ARBB 5T5NF 3PDGA 3R4DA 3WXWH 4PRID 1C12A 4TPRL 2WBJA 4UQ3A 1H3WM 1WWWX 3HUJF 3NTCH 5AYQA 3FQNA 5AZ2H 4OZ4B 3I6KB 3WLBA 1NC2A 3DTXB 4DZ8B 4JQXA 4APQC 3TT1L 2D7OA 5ITBH 4PV9A 1I1AD 1QSFD 4PY8J 5I15L 1BFOB 5CGTA 4OUUA 1K4CB 5F1IB 3DURA 3QG7H 5F9OH 3U9PH 1I8IA 4LPYA 1W0VA 3TH2T 5JXAL 2MHAA 2NNAA 4R96A 5D7JB 5FK9B 3SDDD 4B50A 4JR9H 1WFUA 3MRLB 5AUMB 1GL4B 1R3HA 4LQFL 4XC3L 4X9FA 5C71A 1S7UB 3FAXA 1YC8A 2VL4A 3QI9D 1B2WL 4PJEB 4M61B 1TXKA 3V5HA 7FABL 5JA8B 2NW3B 5JOPE 5IJKC 1VKXB 5DMKB 3E1F1 2X2YA 3V5KB 2UYLA 3EYVB 3ARGD 3FRUA 3CFJA 3HI1B 4C4KO 4S0TD 2I60L 1EO5A 1MCQA 3SPVB 3QUML 4M6OH 4O02L 4WHTB 4HGKC 2DM7A 2ORBH 1ZV5A 2KQMA 5LAXB 2APWA 1X7QA 2JF1A 2NYYC 3MA9H 2D3VA 3BUYA 3P0VL 4WWKD 5E8EA 1KXQE 3SQOH 4MB5A 1UXWA 4FMFA 1CD1A 2VUYA 2NY4D 1MPAH 2HJFB 4Q6IA 1U3HD 4JFQB 3UMTA 3GDBA 2NY5L 1WEJH 2V7HA 1ZHNA 3MREB 4FZEL 4OZIF 1Z9SA 1EA9C 3IFPA 5DVNA 3UXFA 4WU7B 1OAKH 3FONA 4MQXD 1VFAB 5JOPD 4R97B 2L7UA 4X4YB 2VTFA 4BZ1H 3WIHH 1UKQA 1D9KA 4WI6A 5BV7B 2APVA 2XIDA 1QRNE 1VCAA 4NQDA 2YZ1A 4DW2L 3TNNB 5ACLA 5J13C 2CKBA 3NPZB 3PV6B 4LVOB 4UOW0 2COQA 2DQTL 1P7QA 3U1SL 4OLZH 2VZSA 2PO6C 3MPCA 3QHFL 1NEZA 1A6PA 2FH6A 3QXAB 2ZUTA 2EXYC 1JL8A 2VAAB 4KTYA 5DD1L 1PSKL 1MHCA 2J88H 1MRDL 1LO0L 3HKFA 5KANI 3HCVA 4GFTB 4OZHF 5F9JB 3T04D 4XP5H 3T1FA 4KMLB 4KDTA 1PKQB 1V7NH 2H1PH 1HXMA 5C0IA 4U1HB 2CMRH 1J5OL 4TSCL 3W39A 2XTJB 3WDHA 8CGTA 1ROWA 1PD6A 1AI1L 3MLVH 5HYJE 3LH2L 5GZOC 5DJZB 1UB6B 3MV8E 2BSED 2G75A 4IRJA 1OQOA 3DPBA 4LPTA 2IPUK 1QRND 3QZWG 2Y25A 1KGCE 4YAQA 4GRWF 5KS9A 1QLEH 5K9QG 3CMOH 1A7PH 3QXDB 25C8L 5EBMA 1FO0L 1IEBA 1CXLA 4P2OD 2VABA 4EI5A 3L3KB 4X4ZA 4C57C 5F7FA 2RJMA 4KQ3H 4R0LA 3G6AA 2R29L 1MH5B 1PY4A 1TLKA 1QLFB 4MAUL 4Y4HC 4QHUA 2CO7B 5HI3C 5KZCB 3T08A 3H0TB 2ZKHL 3VI4F 2WIIB 3KPQA 3PP4L 3RWEA 1J8HB 1CFVH 4NQED 2EH8H 4WUUA 1M6OA 1GYAA 2XQBL 5DRXA 3WEXB 4NCC2 4MXQD 2X4OB 5LBSH 4WHDA 5HYJD 5ACMA 2X4NB 2ITCB 1GVIA 3QUKA 1ND0A 2GKIA 3DV4A 2YRPA 1FZMB 3P4MA 5C9JA 5D8JL 4MD4B 1J0ZA 1I1CA 4IOIB 2O61B 4D9RE 2XZAL 4CVXB 1JWUB 4V1DA 4Z7WB 1EIBA 3PWJB 1FAKT 3CUPA 3DROA 4P49A 4RGNC 3RKDD 4XNQA 1KFAL 4MJ5A 4JDVB 4FQ1H 1Y6NR 5LCVH 4NN5C 4C54A 1S8DA 4ETQA 1TJGH 4JKKA 5F8RC 3KPMA 2IAMB 3VGHA 3L3HA 3TFKC 4OQ1A 3DETD 3M8OH 1KJ2H 5T1LA 3C60B 2WNGA 2APTA 5DRWA 3O3AA 1OAYH 5D7IF 3D48R 5E5UB 4AEFA 1TVBA 4KROB 5EU5A 4X80L 5JPNB 1IC7L 4K3DH 2W91A 4D9RD 5D70H 1IGTA 2UY6A 4YXLH 2HA1A 3T3PF 1Q9KB 3DO3A 1KCUL 3GKWL 3RTQA 5E24E 4PRDA 4JKWA 4JZJA 2EECA 3VFUB 3RKPA 2YEZB 1DLHB 3L5WA 4XP4L 3HE7B 5DJXA 2FDBP 1G7LA 3O4LE 1L6ZA 4WTZA 3O2DA 4LGRB 2PUQT 5JIHA 2DJSA 1LEKB 4J1UA 4NZRL 4YGAB 1QUNA 4K2UH 1CDUA 3BDYH 3QPXL 1A21A 1G9MH 2NZ9C 4OZFA 1JMXA 4G7YH 1OHQA 3KPNB 3OXRA 2PYEA 2RCSL 2CRYA 3BZ4A 5CINL 3HPJA 4K7PX 4KWUA 3BO8A 5F3HA 3AM8A 4AQOA 3A6OA 4U1MB 3KR3L 3UPCA 3KPRA 5IV2B 1HH9B 3Q5TA 4JREC 2E6PA 4HJJH 1GAFH 2D7TL 2BFVH 5IB1B 1J87A 3IKKA 4YHKL 2X6MA 3EKCA 4EN3C 3WUWA 4P23B 1L0QA 3KPLB 1A6UL 1FG2A 4X8JB 5E5MB 2H26A 1PZ5A 1NCBH 1XF5A 4ZUWB 4OLVL 4KK5C 4GLRI 4ELMF 4UUJA 4F2MB 3O4LD 5I76A 3RP1A 1S9VA 1FYTE 3IS0X 2HH0H 5E8NB 2WZPD 4LSVL 2ED7A 3MV11 4LK4A 3TBVB 4ZTOL 1I7TA 4NNPL 4XPAH 1BD2B 3GSXA 2NR6C 4GS7B 3JZ7A 4JDTH 5I9QB 4HK0A 1ZT1B 3L3GB 4OFYD 5H37H 1KCRH 3VG0H 3MRDB 1I1FB 4FQJL 4L8BB 1KYOJ 3QNYB 4XHJD 4MCZB 3V7AG 4JKLA 1U8HB 3T4YA 1DBAH 5DI8A 2D31B 3L95B 2X7LA 1LK3H 4OV5A 1OQXA 5CIPA 5AEAA 3D25A 2JLLA 4ISVB 4U33A 4Y19A 5AAMA 1Z3GH 1JWSB 2YPVH 4HFUL 3FB5A 3U48A 3PABB 2D03H 1U2CA 4YHLL 5BW7C 4QRPB 1FYTD 4JN2A 5IMLB 3IETB 2BRRL 2EC9U 5D7LA 3WXVH 3I3BA 3RWDA 3D9AL 4OKVB 1UKTA 2H6PB 3W0WD 1EAPB 1JK8B 2MQ3A 4HJGB 2QV2A 2EYRB 3MGOB 4Z7QF 2Y07L 2FR4B 3U2SA 4AIXA 4JJ5B 4JB9H 2IBBA 5IBUB 4RAVB 4ZFZA 2CK0L 3I2CL 3V7AE 3ILPB 3U36A 1WITA 4HWBL 2A74B 2X10A 4PRNA 1ACYH 4ODSL 5KSAB 5EO9B 2R1WB 2F19L 1T4KA 3SGDH 1I1AC 1P7KA 3L9RA 5BS0E 1X5ZA 2EE6A 3L3DA 1U36A 1HKFA 3QJFB 5EPMB 3RNQA 1NSNL 3QEQB 2DDQH 5ERWA 3T1WA 4DOHB 1ZA6B 1NUNB 1HKLH 2ADJB 5DEFA 1R5IA 3A6BL 3V79C 3P4LA 1C1EH 3CZFB 3MCLH 1GGIL 5ENWA 2R15A 3HG1A 3SDDC 4NT6B 1OTTD 5GGVH 1NCWL 4LLYA 1LO4L 2R0KL 3NZ8B 4LIQH 3CDGA 2R69L 1QO3A 3RZWA 1MF2H 5L88L 3I3DA 4UB0L 4HZAA 2PETA 1CDYA 4JGMA 1IARB 2MWCA 2P42B 3CK0L 2GSGB 4GW4B 4IMKC 2P5WB 3OKLB 5IFAH 4P2QA 4WU5B 4MJIA 1CU4H 4BFBD 3IJYB 3IKCA 1T20A 4WY7L 3OXSA 3ARGC 5C0RH 1S7SA 3MRGB 2G2RB 1T7YA 4R2GD 5JORB 5H2BB 4XNZC 4ZFFB 2AKRA 5BS0D 4MWFB 1ZHKB 4L4TA 4F7CB 4TUOB 2PYFB 1T0MA 1CFNB 3TPUB 4AH2A 1BGXH 4NUJA 4NRYB 1SJHA 1SMAA 2JJVA 5K9QI 4N5UA 3TZVC 3P11L 5FO8B 3SO3B 4QHMA 5ACZB 2NY4C 2FJGA 4MD5B 1UWEH 4H1LA 1S78C 3R06B 4XNXH 2VLRB 3FL7A 4P59L 1A1MA 4GRLC 5I17A 2ZNWA 4ZS7H 4DVRL 4N9GB 2OTUB 1RJZA 4E0RB 3CXDL 1T2XA 1OGAD 2VZTA 1MRFL 2YBRA 4HX1B 2P5EE 2ZSVA 5KAQF 4R26L 2DMKA 5BOZG 1NUGA 3Q6GL 4FQXA 4HEME 2WM0A 5EU7E 2VN7A 2JJUA 4E41E 3ARUA 4TOYH 5C0CB 3SKNA 1NMAH 3QIWB 3DUSB 1A9BA 4ALAH 1QR4A 3K2UH 4HK3J 3KPOB 2J8OA 1C16A 5HHMB 4YGVB 1UB5B 3IFNH 1YPZB 2AXFB 4CVZB 3MRPB 5E2TH 3RVVC 5J89A 3KYMB 2VXSL 4HJ0C 2ADGB 1LK2B 2X4PB 5IK3B 4HIIB 1YN7B 3S36H 5F3BB 4OGXH 2OTPA 4Y16D 4Z7VB 5FOJA 3STLB 4DKAA 4KMTH 1A22B 4U6YA 1H15A 4QHNB 1UM4L 1HIML 4PJ5E 2DWEB 3D69B 4LVEA 3C09B 1KN4L 1G9MC 1N59A 3GSQA 5C0AA 4G5ZL 4LCUA 4E41D 1C7TA 2ATPB 4QXTB 1C08B 5DRZA 1PAMA 3BHBA 1NAMB 4R3SB 3WD5L 5ISZD 3MUGB 3LKSB 4TULH 3WMSA 1CCZA 3HMWL 4NPYA 1DUZB 5EC1B 4R4FH 2BVYA 1FH5L 1P2CA 4P2OC 4WIQA 5HI4C 3VFPA 5EOCH 5CJBA 5KBNC 2V5TA 3SDCD 4KRPD 1QFUL 3WKMH 2AJUH 4OQTA 4JCLA 3UTPE 3U79A 4FHBD 5HPMA 2HKFL 4JFEE 3JV6A 3NH7L 4DK3A 4NO0D 3DECA 4QNPE 4X5WB 3C5SA 3L5IA 4HKJB 2BY0A 3QDAA 1U8MA 4UT9L 3PDOA 1A7OL 1RIVL 4GBXB 2FIKB 3CFEA 4NRZB 3BKCH 4PJ5D 1XH3A 1C5CL 4PRAA 3ARFA 5C0FA 2H32H 2QADD 1NJ9A 5E6IC 4FQLH 3EO9H 2C3XA 2NLJB 4LPUA 2AABL 2A9NL 2XN9A 1QR1B 5I30H 4P5MB 3OHXB 3L5XL 4LLMB 4BSVA 2EDNA 1P4IH 1MCBA 3BP6B 3O4OC 4PLKD 4H25B 1HQ4A 2AK4E 3HFMH 3DVNA 4PR5A 5BZWA 3EYOA 3THML 1CLOH 3UTPD 1GZQA 3D3VA 3S88H 4PGZA 3E6HB 4JFED 3HR6A 2N7BA 1XGRB 4LKCB 1DZBA 1FV1A 2AVGA 5L9DH 4P5TD 5ALBL 3EDFA 4Z7OF 3L6FB 3DETC 5DD5H 2P43B 2WUBL 5JXEC 1NCDH 1B4JL 3V4VL 5EOTA 1IM9D 3P4OB 5MEPA 1TJIH 3FO9B 4J8RB 5DD0H 35C8L 3TIEB 3GHBH 1ZGLP 2PF6A 5CSZA 5DC0A 4NO2B 2R1YA 2R39A 1JYXA 1BP3B 3V7MA 1TPXC 3T3MF 3UTTB 1IKFL 2X4SA 3BIKB 1HHJB 5C09E 3EGSB 1Y0LA 5K93A 4YFEA 3GO1H 1CXHA 1EDQA 2AK4D 5E2UL 3ZHKA 2LABA 1G0XA 1KUMA 1NCNA 2LVCA 1F13A 2NY2B 4NQDE 1NGXB 1IAOB 2XKNB 4RMSA 2CD0A 1H5BA 3C2AL 4P3DB 1NBZB 3IDXL 3CGTA 1DBJL 1NCTA 1XGPB 2QQKL 2B2XH 4GKOA 1YEJL 3PJSB 4G43B 2ARWA 1VGKB 1A7QH 3FB6A 3GMOB 5GSRA 3CC5B 4RWYL 4PJAB 4RMTA 1H3PL 1LO2H 3MLSL 3LV3A 3HZYB 1KB5B 1IJ9A 1QHPA 4G8GE 2MQCA 5FDWA 4ZUVA 1MOEA 3RI5K 1FFQA 2AJ3B 3ZO0A 3OZ9H 3LQAC 1HOCB 5C09D 3UROR 2VDRL 2VZ3A 4I3GA 1U8IA 4O51B 3QPQD 4JDZB 2BOBB 4LSUL 4WCYH 5FA4B 4MD0B 2EIDA 4HKZB 4PJDF 4Y4FD 1TZHA 4NQDD 4ZAKD 2ZG1A 3U0PA 4FXKA 3ARBA 2F8OA 2IPTH 2O5XH 1MFBL 5HHVH 3TBSB 5C07B 1LE5B 1P7QD 2XA3A 4IOFD 2OZ4L 4K23H 3UTSA 4F7PB 3DBXB 4PTUB 3SOBL 3WJJC 1CF8H 4JPIB 1T7VA 2FGWH 2JELH 4MQSB 4OZ4A 5JO5B 3I6KA 3VXOB 3UBXB 3DTXA 1F4WL 4XHJC 4NHUB 3UAJC 4IEFB 4G8GD 4WO4B 4POYA 4YDLB 2YD7A 1ES0B 1WT5C 4QWWD 3F5WB 4WUUE 2J7LA 1CXFA 5F1IA 1K4CA 2IEPA 2RIKA 4XP6L 5T3XL 4HKXB 5J7CC 5L2KA 1DQQA 1QFWM 4M43H 4X6FA 3VWJC 4ZOBA 2NY6D 2DYPD 4ZUUB 2R2BB 3MMEB 4IRJD 4FNLH 5LGJB 4M48L 2Y1VA 2HMID 5FK9A 2UWEA 3RIFF 2H9GA 3V9FA 4MNQB 3X3GH 5ALCL 4XWOD 4QT5B 4V1DE 3QFJB 4Z7UF 5AUMA 1DQTA 4JM2C 5IMMA 1S7UA 4PRPE 4U3HA 5KJRH 4BQBA 3T2OA 4R8WL 3DX7A 4ZTPL 4PJEA 5F7EL 1A47A 2FJHA 1WTGT 2NW3A 1VKXA 4K9EH 5DMKA 3LDBB 3EOTH 4M6NH 3QDHA 3V5KA 4XHQA 3C8KB 3EYVA 1B0GA 3B3IB 5TFSH 4XMLL 5HDBE 3MOAL 4R90H 1BM3H 5HYSG 3Q3GA 4GAGL 5E5RB 1NKRA 5E2VH 3PNWB 5AYUH 2DWDB 2NY3D 5FXCH 3SPVA 3TN0D 3VFNB 3PE9A 4MYWB 1XF3B 4BFEA 1E4KA 3QWQB 4WHTA 3QDGE 1JGLH 5LAXA 1RMFH 2R2HB 4XVSL 5I18H 1KEMH 4M1DH 1KCSH 1UJTA 4FQ2L 3CLFH 3TCXA 3VH8A 4YFDB 4I3SL 1DSFH 4M00A 4OCXL 4DVBA 3RGVD 1I9RL 2HJFA 3HS0B 2A9MH 1QSEB 1EPFA 4V1DD 1MCHA 4NKDB 4YZFF 3CX5J 3IDYB 3MREA 4PRPD 4QEGA 4UU9B 4QRSB 1Z2KA 3ZYZA 4ZUSA 4WU7A 3TF7C 4UT6L 1KLUB 4JM4H 5GS1A 1HWHB 4X4YA 3ILQD 3OAYH 2OM5A 5KOVC 4QTIL 2WQRA 4FTVB 2P44B 3TNNA 4OCWH 1X3DA 4PJBE 4X9BA 3BKJL 3WFDH 4FP8H 3HUJA 2NW2B 1A1NB 3QDGD 1K6QL 3QXAA 2PYEE 4S1DD 3X17A 4NO5B 3AVEA 2K7PA 2VAAA 4X4XB 4IDJL 4RA3A 2CKBH 2IF7A 3N1GC 1UWGL 2JJWA 1BBDL 5DJDB 1MFNA 1PKQA 2ZSWB 1FNSH 2V9RA 2FX9L 1JHLH 4Q2ZA 1P5VA 1I8MB 4ACPA 2D0FA 1DDHA 2QQQA 4FQPA 4NM4H 4TRPL 3K3QA 3VFVB 2AQ2A 4OCYL 5DJZA 1UB6A 1Z9LA 1RV6X 2QL1A 2DIBA 2VIRB 5LXGL 4L8SB 4O5LH 5E2WL 4CBPA 2GY7B 1JPFB 1ZLWH 3CPLA 5TH2B 1QFOA 2DLGA 3LMJL 3HI6H 4KAQL 4NWTL 3QXDA 4PREB 1ZGLB 2FGZA 5IQ9B 3ULVF 2PYED 1OTSD 1C7SA 3L3KA 2FB4L 1TZIB 2YC1A 3SDXE 1NFKA 2VQTA 1MH5A 4D0CA 1QLFA 1P1ZA 5CGMA 4RFEB 4LCWB 3BGFB 3G5ZB 1Q9OA 3GEWB 3SGEH 2WIIA 3VRJB 3TWCH 3U9UB 3P3YA 1J8HA 4KFZC 3GSNL 3O3EB 4ZS6D 4B5EA 3WEXA 4Y19E 1MREL 3Q1SH 3W5NA 3ULSB 2X4OA 5I1GH 4Y16C 1EGJA 1D5XB 4Q6YA 2ITCA 3NFNB 1FDLL 3SGKC 4DWHA 3S4SG 2Z31D 1FZMA 3CMGA 3HZVB 4HGMA 5INCB 2O61A 1TZGH 4I0PB 3JV5A 3QFDB 5A43C 3H42L 4MAYD 4CVXA 3PWJA 5EA0L 1IILE 3MJ9H 1KXTB 5EU7C 4KJWC 1Z9OA 1T0NA 2NY1D 1SHMA 4JDVA 3MO1B 5DR5L 4NQVB 2R0LL 3RWIB 2N4IA 5HDQL 4OI9A 4PJFF 1WCQA 2IAMA 1JZ7A 5HI5D 1FGVL 2YKLH 4CMMA 1CVRA 3C60A 5HVGB 3HNVL 4XTRD 1BEYL 3ZL4H 3BN9C 1YEKH 3FRPA 3C6LD 5MERB 3VWKA 4KI1A 4F9PC 3RU8H 4G7VL 1YMME 1T83C 4KZEH 2YD5A 5JPNA 2W07A 4QRRE 3T2NH 3O6FB 2QADC 3MRCB 3J8F7 2DLFL 4W4OC 1NFDE 2WWMC 4TSBH 1HE7A 1FC2D 4M3KB 1AXTH 4PRHB 3SDAB 2AQ1A 2J2ZA 4F7EB 3VFUA 4HC1L 1JHTB 2YEZA 4EDWL 5LGHL 3QHZH 2EDHA 4P2QE 3IDJA 5MEOB 4MJIE 2FL5B 1Q38A 4G8EB 4UV4L 2YUWA 1LEKA 3KLHD 4LLAA 3SCMB 2H2PD 1JWMB 3V4PL 4LCCC 3VDCA 4ZD3H 4JQXC 3WXWL 5FUOL 1KENH 2WIMA 1RJLB 3LN9A 3KPNA 4GG6F 3IF1B 5SWZB 4JFDB 5HGBB 5CSBA 4G6FB 3MCKB 4N1EA 5FF6B 2VXVH 4FG6D 4LHUB 1YMMD 3NTCL 1T3FB 3BFOA 4U1MA 1I8LA 4MMZC 4UTAH 3QRGH 4QRRD 5TDOB 4NQTA 5IB1A 3UEZA 5HHNB 5FECB 4K94H 1CDIA 4K9EC 1QFWH 3ARRA 5ITBL 1IEAA 4P23A 1Q9LB 5I6XB 2X9XA 3R0MA 2E9JA 5E5MA 1F2QA 3EFDH 3GJFH 3QG7L 1IAIH 1P84K 2WUCH 5F9OL 4ZUWA 4ZDHB 4APQB 4F2MA 1D6VH 4P2QD 2N56A 1PYWA 4X6DB 1ZLUH 4FABH 3LCYA 4XVTL 2DQHL 2PNDA 2R0WL 3TBVA 4JR9L 5EUOB 1YYMH 1CFTB 3FAWA 4LLDB 3VGDA 2UUDK 5LGKA 4HUMB 1BD2A 3T0AA 4HXBH 4JGJA 1V3KA 1ZT1A 3I9GH 3L3GA 5DA4A 1MCJA 1RUAL 5DVOA 4ZXBA 2XA8H 5LVEA 3MRDA 4OD1H 1I1FA 4L8BA 3QNYA 3WO4C 4MCZA 1U8HA 2F54A 4YC2C 3DVGB 1I85A 3QDJB 4MA3A 1E6JL 1YNLH 3L95A 4Z7UE 5I16B 2ZCKL 4H88L 3ZSSA 5D1ZD 4HIEA 1OW0C 1TDQA 4ISVA 3U30B 1IMHC 3UYPA 1JWSA 4M6OL 3CSYB 5AG9A 4LEXH 1VA9A 2AXHA 2ZUQB 3W2DH 1OWRM 3PABA 3T8XB 4JQIL 4NKOB 4F33A 4NDMB 4K07A 5F96H 1LDPH 3CFCH 4KQ4H 3PV7A 1S3KL 1J0KA 3SQOL 4QOKD 5J12C 4TVPE 3ARDD 2GUOB 4GO6B 1D9KC 3MXVH 3SN6N 4KC3B 4LHQB 4JY6B 1MPAL 1V7ML 3DGCR 1CLYL 2I25N 4Y4FC 5C0AE 3UJJH 5TE4H 4OKVA 1WEJL 5EU4A 3S7GA 3O9WB 1RI8A 1T5WA 1EAPA 3CSGA 4HJGA 2EYRA 4U3XA 4IOFC 1KTLB 3LB6D 4J3OC 3SE8H 4JJ5A 1TJHH 4XC1H 5DMIH 4ELKB 1OAKL 3QNZB 4BZ1L 3WIHL 2VO5A 5FAAA 2HT2D 2A74A 4H5SA 5EOCJ 2YK1H 2R1WA 3JWOH 1TCRB 2Q3AA 3EJYC 3M07A 4QWWC 2BNQB 2VE6B 3CDFA 4UIMA 3SHSA 3WIIH 5EPMA 3QEQA 1ZA6A 2BVTA 4YFLI 5AZEH 4OCMC 4IRJC 2J88L 3CZFA 4TVPD 2XZQL 3NCCB 3KDMB 5C0AD 4NT6A 4XP5L 2X4QA 2XN9E 3RBSA 1IC4H 1ONQB 2SEBB 2WBWB 1V7NL 2H1PL 3DYPA 1KCKA 3NZ8A 2A6JA 3MLTB 4LRIA 4XWOC 2CMRL 5KSUB 5C8JB 1D5BA 1MCCA 2CRIA 2J6EH 4RGOL 2WV3A 4ZSOE 5IWLA 1J7VR 4WU5A 1ZT4B 3D3VE 1V3JA 5JTWA 5IB5A 4P5KB 1WTLA 2ILLA 1DANU 1ORSB 3MRGA 2G2RA 2VDMH 1YNKH 4PJIF 5JORA 1S7XB 2QSQA 5H2BA 4Z7NF 4Y2DA 1ZVHA 2NXZC 2NY3C 3OKNB 1QLEL 4ZFFA 1I9IH 4P2YA 4N9OB 2A6DA 1E0OB 4NQCA 5GGSY 3PGFL 1A7PL 1ZHKA 3GBNL 2PYFA 3TNMB 1O0VA 2HRLA 1CFNA 3TPUA 4ONGH 4NRYA 3DMMA 3CFKB 4OLWH 3W81A 3HN3A 5DZOA 3GM0A 3PGDB 5FO8A 4F8QA 5ACZA 3RGVC 1JGUH 1A1OB 2W0FB 3R06A 4ZG1A 3ULVE 1FIGH 1CFVL 4CVUA 3LEYH 2GCYB 4YX2H 4N9GA 1U9KA 2HVKB 2OTUA 1MWAH 5EORH 3P0GB 1GRWA 4S1RH 4EXKA 4GAFB 4HX1A 1FL3B 4MNGB 3D3VD 5CUSH 1MY7A 3EUUA 3ILQC 3QISA 5I1IH 2R2EB 4PJ7F 4XX1G 3S96A 2RHEA 4KH2A 3VXSA 5C0CA 3QIWA 3DUSA 1B3JA 4BK4A 5MENE 3QUXD 3HC3H 2YPLB 4KVCH 4O2CA 4P2RB 2M2DA 1FJ1B 2D4DA 3KPOA 5DEGB 2HT4D 4L8DB 2A2QT 4FQ1L 4P57B 5LCVL 4YGVA 1UB5A 2FSEB 4NZTL 3H9SB 4S1DC 3H3KA 3TP4A 2D0HA 4LVNC 1YPZA 4CVZA 1ZK9A 3AB0C 5E00B 1CGXA 1TJGL 3K80A 1JCKA 3RZCB 4NFDA 2ADGA 3NCBB 1LK2A 3B9EA 2X4PA 1SJXA 3QUZA 1YN7A 5F3BA 5IW6A 3ULVD 3F58L 3M8OL 5E7BA 4QCIB 1MHHB 2CXGA 2JTDA 4U7SA 5E8DH 4XWGH 4QHNA 2CRMA 1OAYL 4JZOB 3LRSB 4M3JA 4JZJC 5SX5H 4DKFH 4JY4B 4KK9C 3MRFB 2UZIL 5IBTH 1AQDA 3PQYA 3FQXB 1R5VB 2F5AH 3F12B 1T7WA 12E8H 3IXAB 4XPBH 3O11A 4QXTA 1C08A 5DK0B 1KB9J 1XZ0A 4R3SA 4YXLL 4L4VB 5MEND 4XX1E 3LKSA 5JDJA 1DUZA 2OL3H 4RWHA 5EC1A 4ODVH 4YBQC 1XIWD 4TVPH 3RX7A 4K94C 1OTSC 3QDMB 1T6VN 4HMCA 4MXWH 5JZ7D 1CFQB 3AM8C 4DGYH 1JF1B 2QSVA 4WRLA 4XNYH 1OCWH 4I9WE 3PG2A 4RFNB 4HKJA 2DQCH 2X1OA 2GJ6B 4K2UL 5T1MB 3P0YL 2FIKA 2XG4A 2XRAH 2AXGA 1G9ML 3CSPA 4NRZA 1IGYB 1WFTA 3GFUA 4WFHE 1P4BH 3OAYK 3T0WA 2ZG3A 1BVKA 2HP4A 3BGMB 4UINL 4HJJL 1QR1A 2BFVL 4P5MA 5I74C 3OHXA 4LLMA 4HS6B 3VG9B 5ETUB 5HHXH 4PJEE 2FLBT 2OR9H 1AIFB 1F3JB 4PJ9B 2NY1C 4H25A 1NCBL 2AJXH 1DL7H 4PJHB 2IGFH 3E6HA 1XGRA 2DN7A 3G6JB 2IMMA 1FCCA 1T04B 2D9QB 3L6FA 4I9WD 5EBWB 4MLSA 3OJMB 5F6HJ 2HKHH 4XPAL 1YZZA 4JDTL 2A6KB 3FCTA 1KCRL 2B5IC 5D7JD 3VG0L 3P4OA 4K3EH 1UH2A 3FO9A 4J8RA 1XEDA 4WFHD 1A9EB 4EZMA 2EICA 4NO2A 1HILB 1DBAL 4Z5RA 1AGCB 4P9HC 3GRWL 3UTTA 1FNGA 1S7TA 5DO2D 3E6FB 3BIKA 4DQOH 5KVDL 3P30H 4F9LC 4I5BB 3EGSA 2E8ZA 1MIEH 1Z3GL 1U95B 4LP4A 5BRZB 1K9TA 5GGVY 1UACL 2BY3A 2D03L 4ZOAA 4M5ZL 1NC4D 4KHXL 1DN0B 4BH7B 4X5LA 3ULVH 3K46A 4HIHB 1NGXA 1IAOA 2XKNA 3MNVB 3KLHC 4P3DA 3HAEG 1NBZA 1H3UA 2OJZH 3GIVB 3WXVL 5DFTA 2B39A 1I3GH 2AS5M 3PJSA 4G43A 1GOHA 1VGKA 4AIZB 2D7QA 3GMOA 3CC5A 4HCRH 1UENA 5DMYA 2BDNH 3HZYA 1KB5A 4FG6C 2FO1A 1OSZB 4JQVA 4KK6D 5FUZH 5IF0B 2EIBA 1U0QA 1ZTXL 1RIHH 1ACYL 2AJ3A 1CLZH 2XTJE 1HOCA 5FM4A 3CVHA 4JO4H 3G9AB 4HWZA 2CDGB 3FOLA 3E2HB 1F3DH 2QHRH 4JDZA 4TVSa 5FA4A 5T5FH 5FYJD 3VU2A 4PJXB 4MD0A 4HKZA 5B21A 1HKLL 2CRZA 4LPWA 3KG5A 3S37H 3MBEB 1C1EL 4CN6A 3MCLL 4CUCA 1NKOA 5C07A 1LE5A 4HF5H 1HHKB 5GGVL 3DBXA 4PTUA 3D39B 2V6HA 3SKMB 1MF2L 4JPIA 5JR1L 3VA6A 1S7RB 4FQHB 4PGCB 5JO5A 4EUPB 3UBXA 4X99B 4DUWA 4HG4J 5IFAL 3JBG7 1KSRA 3LKOB 4CN1A 2ADFH 1F4XH 4WO4A 3QR2A 4GXUN 4OD2B 1CBVH 1J8HE 3O8XB 3OKOB 1ES0A 3F5WA 5C0RL 2E7BA 1E4XH 3FRPG 2XTJD 4XXCA 4X6CB 2ENSA 3D2UD 1IAKA 4ZUUA 3HZMB 2R2BA 3MMEA 1D7FA 5LGJA 4WENB 1JYNA 1BGXL 4Z0XA 4MNQA 1I8KB 4RDQG 9CGTA 3UPRA 5EZIH 3FHQA 1UWXH 4QT5A 4Z7WE 3QFJA 3NIFE 3U7YL 1S9KC 3ARDC 4FQXC 4XB8A 4ESKA 3GIZL 1UWEL 1ZT7B 3VGAB 4XNXL 4H20L 4NNYA 3DUUB 1IKNA 1HEZB 4EIZC 3KJ6H 2FBJH 4I2XB 3O3UN 1QA9B 3B3IA 3LB6C 3OKDB 5K9JH 1YN6B 2E9IA 5KZCD 4IS6B 5DRNA 5L6YL 1G7IA 1BLNB 2HTKD 2DIAA 1XF3A 2HT2C 3W11D 5GGSB 1A3LL 1I9JL 4G6AC 5I8EB 1WBXB 5E99L 1UJ3B 4TOYL 2R2HA 1NMAL 1IQDB 2EH7H 1MAMH 2QKIA 3HR5A 3L7EA 3DI2B 4GXUM 4OF7A 1NUFA 3K2UL 3B4NA 5TE7H 3GJFK 3HS0A 3IFNL 1YEFH 3C2SA 1QSEA 1ZLUK 5E2TL 4NKDA 4P46B 3TPKA 5SV4A 2ZNXA 2G5BB 3MA7B 4FXGA 4UU9A 3NGBB 4QRSA 2EDJA 5IVXB 1REIA 3NAAH 2CLVB 1PX3A 3S36L 3V6FB 4AK1A 4ODUB 3GI8H 4PJDA 1M71B 4KMTL 3HMXA 3WJLA 2X89A 1I7UA 4YBHA 5JW4Q 4S0SD 4FTVA 2IAMD 3K0WA 5A2LH 1RZIA 3CLEH 4ZMAT 4O58H 1ACZA 1F6AB 3ORJA 1A1NA 4M93B 1L7TH 5FYKU 5FYJH 3LKNB 5A2JH 3BE1L 4NO5A 2Q7YB 3EYSH 4L5FH 4TULL 3UP1A 4X4XA 3U46B 4UV7L 4D8PB 3KNBA 3N85H 5B8CB 5JOFB 1FGNH 4UILH 5EOCL 3RY6A 4KROD 4WI4A 2FHBA 3ARFC 1OPGH 5DJDA 3WKML 2AJUL 2BHUA 5CEXA 4GSDH 3GMNB 2Q7NA 1I8MA 3QIUD 5F6IC 1WWBX 3VFVA 3TJHC 1QBMH 3O6LH 3QB7C 2ZP0T 3HE7D 2NCMA 2DQJH 4OF6A 5HHQB 2VIRA 1JNLH 3BKCL 1MCFA 3ZKSD 5K59F 5HSFA 4G8IB 2YPKB 1UADC 1RSFA 3EO9L 3PDDA 4GT7A 5GS0C 1BD2E 4PREA 5T33H 5JHLH 2QLVB 3QUXC 2X1WL 4NIKB 5IBUG 1TZIA 1PW3A 5GRVL 1KIRA 1GGBH 4RFEA 2HT4C 3MCG1 4LCWA 5L8JB 3S88L 3VRJA 4Y5XC 3U9UA 4OCSL 5IKCA 3HAEH 3O3EA 5ADOH 1OVZA 3QO0A 3H2WA 3I84A 4JKPL 4X0KB 3JTSB 5DD5L 1D5XA 2P8LA 5D4QA 3N0PB 2X4RA 3T4AA 3NFNA 1F90H 3BEWA 3DRQB 4OLYL 4MA7H 4QRPE 4D0BB 5CD5D 3IU3B 5D7SH 2YN3A 4ENED 4I0PA 4U6TA 1ZSDA 1TJIL 4M03A 3IFLH 5DD0L 3GHBL 1MFCH 2YHGA 1BD2D 3TBYA 4K71C 3C87A 5CJ8A 1H5BC 4U0RB 2XZZA 4XPTL 4NQVA 3VXNB 1EZVY 1B0WA 4PGEB 4CDGC 1WZ1H 1FNHA 3GO1L 1XAUA 4S1QH 1X6LA 1NLDL 3QCVL 2EDKA 4OD3H 3AREB 1CVSC 4KGJA 4QRQB 1A2YA 5ESVA 5MERA 3QEQE 2O5YH 4DOHE 3BZDA 4QRPD 1A7QL 1CK0H 3O6FA 3MRCA 5DTFB 1V3LA 3H3BC 5E6YA 3MUJA 1AKJB 4U49A 3ARBC 2PW1B 3WNMA 1RZKH 1L9NA 3GSUA 4FFZL 1FFPB 4Q9RL 2ITDB 3MLRH 4F7EA 1BFVH 3OZ9L 1JHTA 2FATL 4XAWH 4OGZA 5C92A 1MQKH 2Y5TB 3JV4B 2P5WE 2EYTB 1X5JA 5MEOA 2FL5A 3FT4A 3RJQB 4WCYL 4Y89A 2KZWA 3SCMA 4ODWB 1JWMA 3W82A 3VI3E 2LV4A 5KSAD 4I77H 4XNMB 5GJSH 3LPFA 1BVLB 3W9DB 5HHVL 3VRIB 1CG9B 1P9MA 3IF1A 4K23L 4JFDA 4XVUD 2HJKA 5HGBA 2VDPH 3QEQD 3RIFK 3R8QA 3TT1H 4FMKA 4LLQB 5FF6A 2B4CC 4LHUA 1BQLH 2Z93B 4Y4KA 2GT9B 2FGWL 3EIFA 3UJIH 3K4ZA 5D7JC 3PWLB 5HHNA 4QYOA 5FECA 4MVBC 3RY5A 2GI7A 1UZ6F 5CCKH 2VLRE 3TV3H 3FOMB 1Q9LA 2ICES 4AY0A 1P7HL 5DO2C 4ZDHA 3P9MB 4M43L 3VFSB 3T0ED 2P5WD 2VC2H 3GMQB 4LQFH 4FNLL 1I1RA 5L2JA 1BQHG 1MFAL 3KYOB 2BMKA 4V2CB 1CFTA 2BY2A 2R8SL 2XXCB 4LLDA 5C0CE 1G6VK 1Q72L 1KPRB 4Y2OA 5KJRL 2KQNA 3F65A 1E4KC 4XPFL 4NUGH 2XOTA 3ZLQC 4KKLC 4Z8FH 1CGVA 5HHME 4OBSA 4PD4K 1R0AL 2I60H 3N9GL 4UMGA 3DVGA 4JM2B 1YPZE 4K9EL 5T3ZE 2NXYB 2ESVB 3EOTL 4O02H 1RZ8B 5TFSL 1EBPA 1N3NB 3L3JB 5I16A 5K33A 5KVFL 1BM3L 4KK6C 5E2VL 1CIUA 2IBZX 2VLRD 4Z7VE 2AXJA 2GW5A 3CSYA 4NKOA 3WLWC 1JGLL 3NMEA 3S3PA 1RMFL 3ZE1F 4NDMA 1KEML 1KCSL 4R97C 1YY8B 3CLFL 2NY5H 3FTGB 3DSFL 5K9OB 4KXZH 3K4AA 3ME0A 1JNHB 2Y7QB 1DSFL 4WW2F 2W9DH 5BV7C 4MJ6B 1ZOXA 2A9ML 2QBWA 2MJWA 5C0CD 1JZ2A 3WNLA 5ESAB 4I0KA 4LVOC 4CN4A 5IBLC 5C08A 3QCTH 1KTLA 2IANB 5EO0A 5HDOA 3QH3B 1XGUB 4AJ0A 4ELKA 1BQSA 4DW2H 3EW3B 4Z78B 4M7ZB 2NX5B 3QNZA 5T3ZD 2Y5EA 1IGCL 2CPCA 4YHIB 3WFHB 5CKAA 3QHFH 2F8XC 4GG6A 3GK8H 5HHOB 3QWRD 1VSCA 5DD1H 4FP8L 4H8WC 4IRSB 2XTJC 3TO4A 2Z8SA 5GRZA 2VXTH 3WHXB 3PP3H 2M8XA 1RULH 4TSCH 4PD4J 3IDUA 2CKBL 3KXFB 2BRQA 1MJUL 5BMFL 4ZFOB 3LN4B 4IJ3B 3KDMA 3F7VB 1NANH 1I4FB 3JUZA 3MV01 1AI1H 1PBYA 1X5AA 1ONQA 1FNSL 3LH2H 3MLTA 5C8JA 3BAEH 4YDKH 1E4WH 1T03L 5FGSA 5CBAB 1ZT4A 3PWVB 2X4UA 4P5KA 3EDKA 25C8H 4JY5H 3C8DA 2PCPB 2DL9A 3ES6B 3ZZ1A 2HTKC 1OARH 3SY0B 1KIPA 4GBXD 1EJ6A 1WAAF 3TNMA 4KRLB 3F7YB 2ZKHH 3CFKA 4B41A 1G6RH 1FVEB 2Z92B 3PGDA 4ORZC 5EU6B 1D5ZA 3AS3A 1A6TB 1A1OA 3TWCL 4X83A 4LMQI 5IVOA 3QIBB 1F11B 3Q1SL 5D2LF 2HVKA 4QGYA 3MOBH 2XZAH 3AS2A 4A2LA 4MNGA 2FWOB 5GHWH 4NKIH 1C5BH 4KI5E 4GW5B 1NMBH 1TZGL 2IAMC 3MROB 5JHDB 1RZ7H 5FYLL 2HG5B 3C60C 4Z9KB 5E8PB 1FJ1A 5EDXA 3EDEA 2I07A 4L8DA 4P57A 5DEGA 4U1SB 5CBEB 2FSEA 3H9SA 4PJAE 1GOGA 1LHZA 1XT5A 1RZKC 5E00A 4GW1B 4RMVA 5E1AB 1JF6A 4KROC 1VEPA 1Q9WB 4M8QB 3ESVF 3BP4B 1OAXH 1UWXK 2YKLL 2FYYA 3NN8B 1B9ZA 1M05B 4A6YB 4HIJB 5T3ZH 4X80H 5D1XB 1FAIL 5D93B 2OP4H 4MXVE 4ERSH 4JY4A 4MS8D 3MRFA 3RU8L 1AD9B 4F7TB 2NY2D 1QD0A 4P4KD 3FQXA 1R5VA 4KI5D 4KZEL 3MNWB 3F12A 3T2NL 1QHOA 1K8IB 4XP4H 5I2IB 4TSBL 2HFFB 1AXTL 1W8OA 1Y18B 5CD3A 1R24B 5CJOH 1ZLVK 4LEOA 1ZHLB 3RVUD 1QP1A 1HHGA 3QDMA 5FA3B 2ZUYA 4NZRH 4EOWH 4PJIA 3EYUH 3QHZL 5EBGA 5C0GB 1CFQA 5KVGH 1NAMH 3QPXH 1JF1A 3MBXL 1C12B 1I8LC 3NABH 1EV2E 2RCSH 2WBJB 4UQ3B 1XGYL 5GS2D 4H0IA 3U4EA 5T1MA 1BOGB 4Q0XH 4P23C 3KR3H 1IGYA 4MA1B 1KG0A 4PGDB 3VXTB 3B5TA 3SDYL 4MNQE 3Q48A 4PV9B 3SGJC 4UTAL 1OD7A 4PJCF 3QFJE 3QRGL 4UTBH 1BAFL 2F5BL 4JFFD 3BGMA 5DQJB 5DURB 3OMZA 4OLVH 4JAMB 4K94L 1QFWL 2RBLA 2YSSB 3RA7H 2H45A 1F3JA 4GS7C 4PJ9A 4UNTA 5F7UA 5I9QC 3BT2H 3EFDL 4LSVH 4PJHA 2WUCL 4U6HB 4ZXBC 4PJ7A 4FA8A 4PBXA 4NJ9H 5KVMC 5I75B 1FZJB 3G6JA 1FORH 1R3HB 4OB5H 4WO4D 4FABL 3WNNA 1INQA 2CSPA 3MLWL 1DUYA 5CEZL 1FCGA 1ZGLM 1A6WH 4GKNA 5FM5O 3B8YA 5DDHB 4G3YH 2BVOB 4HXBL 1E27A 4O2FB 5L8LB 2UYLB 2A6KA 3I9GL 4KV5F 3MNZB 3KGRA 3CFJB 2XA8L 4OD1L 2XFXA 1A9EA 5H94B 1QSEE 1AGCA 4G8FB 3CCHA 3X13B 4G9FD 3O2VH 4ZO8A 2Q87A 3T65B 2DQIL 1X7QB 3QWOB 4YHLH 2EDWA 4I5BA 5E8EB 1A4JA 1U95A 1UZ8B 2LAAA 4LEXL 4ZUTA 5BRZA 3W2DL 4DK6A 2FHCA 2EKJA 5F96L 1DN0A 4Q6IB 4KPHH 3QUYB 4BH7A 3CFCL 4HIHA 4KQ4L 2V7HB 3MV7D 3TYGH 4RNRA 3VRLF 3MNVA 1KTKE 3MXVL 2AJSH 5KSAC 1Z6JT 3KPPA 5TE4L 5JW5B 4OCNC 3I75A 4YWGL 4AIZA 3I02B 5CLTA 4HWBH 4XVUC 3SE8L 4ODSH 4XC1L 5DMIL 3OG4B 2W59A 4P9HL 1CR9H 4NBYB 5F7WC 1OSZA 5CJ5A 1QSED 5CSGA 5IF0A 3N1FC 5JQ6H 1A3QA 1FIEA 2IQ9H 4LOUD 1NEZB 5C2BH 3TM6A 3V6OA 4LRIC 1VACB 3CU1A 2P8MB 2YRZA 1KB5H 4RQQA 1MHCB 2C7UA 4QXGH 1LILA 4OLXH 3B5GA 3WIIL 4LSRH 2X89D 4PJXA 3QQ4A 3X14B 5AZEL 5GS2H 1HXMB 3MBEA 3W39B 3KYNA 5C0JB 4KKBD 2P47B 1HHKA 1OD9A 2EDXA 2F58H 5IJVB 3CK0H 3INUH 1IC4L 2BNRE 3OTTA 4NSKA 2GTWA 2EE2A 1PQZA 4PGCA 2J6EL 4X99A 4LCWE 3WE6B 4JG1H 4RCAA 3IJSB 1MLCA 3LKOA 4OJFH 3IDMB 5KS9B 4J3XA 1HCFX 4TTDD 4KRNA 1DTUA 1QVOA 3O8XA 4WV1B 1WQVT 1RIUL 2VITA 5EBMB 3SO3C 1YNKL 1IC5L 4Y5VB 1ZXQA 5ILTH 2IBGA 4EI5B 4ETYA 4X6CA 1I9IL 2EDRA 4R0LB 5SWSE 4KJYB 4JFXB 4ZO9A 3MACH 2JB6B 4ONGL 1WFOA 1I8KA 3KPTA 2P48B 3TEUA 1FNFA 1F4AA 4N1CA 5KTEH 3QA3B 2M1KA 1JGUL 1ZT7A 2Q8AH 2BNRD 3DUUA 3QIWC 1HEZA 3DV4B 3LEYL 3MFFA 4YX2L 1CI5A 3IFOA 3Q6GH 4I2XA 5C9JB 2XPGA 5GXBB 1QA9A 1YN6A 5TF1H 1CZ8L 4LAQL 4IS6A 1VFOA 2C3GA 1BLNA 3E8UH 5I1IL 5GGSA 4U05A 1G7HA 1F4YH 1L0YA 1WBXA 5I8EA 3GSOA 1JZ8A 1YEDB 1UJ3A 1AR2A 2H3NB 1EEUA 3QYCA 2VKWA 1FN4A 1GIGH 5SWSD 4KVCL 5GGTA 2EDOA 3DVFA 4LSTH 3L3HB 4NJAL 3C09C 5T1LB 3C8HA 5BCAA 3MA7A 5DRWB 1HIMH 4WFGE 2JJTC 3IJHB 4PRHE 3UBXI 1EX0A 4LVNB 1LGVA 2H2SD 1KN4H 4ODUA 4YH6A 1M71A 2YOCA 5E8DL 4CJ0A 5JNYB 1UVQB 4G5ZH 4MGXA 5CMAA 4DKFL 5BQ7A 3MRMB 5IBTL 3RTQB 2VJXA 4HBQA 1NCAL 2F5AL 1FH5H 4YDJB 2V5SA 4U1LA 4XPBL 1NEUA 1G1CA 4KY1L 3LKNA 1CL7I 1QFUH 2Q7YA 5SWZE 2HKFH 2OL3L 4GBXC 4WTXA 3U46A 4D8PA 5JOFA 3FN0H 4TVPL 1MI5B 2X70A 3EYFB 3B9KB 4MXWL 4DGYL 4OZFB 4HMDA 5EFIB 5HXMA 4WFGD 3OXRB 4PRHD 1OCWL 4XNYL 2DRUA 1J9CT 3SDAD 5L0QB 3BZ4B 2EDDA 1MCPL 2AV7B 2DQCL 4GOSA 5F7YC 4C56B 3HRPA 5F3HB 3EDDA 5IHLB 5HHQA 4OQTL 3UZVB 2XRAL 5IR1A 4WHCA 2W0PA 3CNKA 4X6DE 2VR5A 3EO0A 5DMGD 3RDTD 1CDBA 4M7LH 3SCMD 3VXUD 4G8IA 2YPKA 4B7IA 5EUOE 1P4BL 4Y7MA 5CGYD 2E7LC 5F72S 3ESUF 1FG2B 5JA9A 2W65B 5JIIA 5SWZD 3RHWK 4RMWA 4G6FD 4JVPA 5C0EA 1FVCB 3QDJE 2MQ0A 3K81A 2AJXL 1DL7L 2X1PA 2JCCE 3ZDXF 2IG2L 2IGFL 2DMBA 4WWID 2H41A 4NBXB 3V4VH 4EDXB 4LLUB 3GSXB 4X0KA 5GGRA 2DJ4A 2VERN 5HY9B 1NUDA 2HKHL 4APQD 2Z91A 3DRQA 1K5NB 1JUFA 4D0BA 3IU3A 3F6IA 2J8UB 4OV5B 4K3EL 1IKFH 4MS8C 3P2TA 2NY2C 4KI5C 3OAZH 1DQJA 1WIUA 3FB5B 5E2UH 2EDFA 2RQ8A 2DM2A 2EE9A 4HPOH 4PGEA 1UH3A 5I1HL 1DJSA 4JN2B 1LWRA 3QDJD 4H0HB 4BM7A 2AERT 2DBJA 4WJ5A 5D7LB 1JZ5A 4NC2B 5KSBF 2QQKH 4QXUH 3AREA 4JQVC 3UPAA 3CXHK 4NRXA 1MFEL 2BNQE 2OJZL 1TQCB 3U2SB 3D85D 5D6DA 4XZUA 3FB7B 3BSZL 1M7IB 4HUXB 4XMPH 4ZFZB 3DUHA 4HCRL 3U36B 5A2FA 5JW4M 4PRNB 4X8XA 1AC0A 3OKEA 5DTFA 3S36X 4JVUA 1AKJA 5FUZL 4HUUA 3TVMB 2PW1A 1P7KB 3PWPB 3L9RB 4FFWC 4QKXB 3O9WD 5DFVC 1FFPA 2ITDA 1EAJA 1RIHL 4PJGB 1JN6B 1BHGA 1CLZL 5ERWB 2OBGA 4JO4L 2Y5TA 3JV4A 3ULUE 1MFBH 5ENWB 2QHRL 5T5FL 4OSUH 3QSKB 4ODWA 2OZ4H 3HE6B 1F58H 1T66C 3SOBH 4LLYB 4HUKB 4LP5A 5JUEH 1BVLA 3BPNB 4WO4C 3BXNA 3S37L 4YDLC 1KT2B 4MDJB 2BSRB 4NQSB 5F7NC 2BNQD 4JRXB 1CG9A 3AMLA 4HF5L 2ICCA 4XXCC 4LLQA 5TE6L 2Z93A 1U58B 1Z9MA 2GT9A 3ZT7A 3IKCB 3OXSB 3ZHLA 1YJDH 3PWLA 1VADA 2C1PB 5IW3A 2PO6D 5KN5B 2A38A 2ADFL 1F4XL 3RUGB 4OIAA 3UZEA 1ADQA 3FOMA 3DHMA 5CZXD 4M48H 3V6ZA 1LP9F 1E4XL 1T0MB 4AH2B 1DQMH 2LU7A 3P9MA 3HHRB 3VFSA 1IKNC 3ULUD 3NCYP 3GMQA 3LDBC 5IG7B 2M26A 1E4JA 4Y8AA 3KYOA 4H1LB 1SEBB 2ARJQ 5D6CB 1W8NA 2V2WB 4JPWH 4M7LT 4ZO6A 5C3LD 2YPLE 4N0FA 2P8PA 4JRYD 4P2RE 4XMLH 4ZNEE 3MOAH 4HHAA 2ZSVB 3H9SE 5KSVB 3KJ6L 2FBJL 4YDIL 4LDEB 1QSFB 4RGNE 1RZ8A 4YEFA 5K9JL 5HD8D 3L3JA 1KF9B 2N7AA 3SKNB 4FQ2H 1UM5H 4MLIA 2VQUA 3IDYC 4I3SH 3RAJH 2Y6SC 1JPTH 1C16B 2EH7L 1MAML 4WNQB 1YY8A 5K9OA 3FZUD 2X41A 1V05A 2HFEB 5TE7L 2BSTA 1CD0A 2CGRH 3DYOA 4NWUL 3KPSB 1FBIH 3QI9B 1DBMH 1C5DA 2V5RA 4L4VE 2YPLD 4BQCA 4P2RD 1EK3A 3TBWB 3NAAL 3QH3A 1XGUA 3O3BA 1AGEB 3JVGA 3FN3A 3H9SD 4NZUL 3QDME 1A4KB 1DE4B 2EDLA 5ICYB 1N59B 4R6UA 1TFHA 3OF6A 1S9XB 3QNXB 4RGND 3RZCD 3WFHA 5FGRA 1DBBH 4DCQB 5D1QA 1FRGH 3VGBA 1K6QH 3LQZB 5E9DB 3CLEL 4XAKE 5HHOA 5J6GA 1CXIA 1RURL 2GJJA 4WWKB 3MRKA 5DHVA 2GJ6E 2RB8A 3CJJA 4RX4A 4NZDA 1QTYT 2ZPKH 4IRSA 1BJ8A 3WHXA 1L7TL 1BBDH 2D7NA 1UCBL 4YXHH 3EYSL 1U3HB 5DJ6A 3GUTB 3JV6B 4BQ8A 4L8SC 4WI3A 1FGNL 4UILL 3LN4A 2DKUA 3F7VA 5EU3B 1OPGL 1RUMH 1I4FA 4TUJB 1KJ2B 3C5SB 2BHYA 3K8MA 1U8MB 4GSDL 3PDOB 3VFOB 3PUCA 4L4VD 3IDGB 1XH3B 4PGJA 4PRAB 4Y1AA 3O6LL 1NJ9B 4GRMB 3QDMD 4PJHE 1DVFB 4JPKH 3PWVA 2GTZA 4NWTH 1JNLL 3G6JE 3BGFC 3FFCE 1W2KT 4H8WL 1MEXL 4XAKD 4BSVB 4PJ8A 2FB4H 3ES6A 3ULUH 2GJ6D 1HQ4B 3WO3B 3DVNB 1A6ZA 4K8RC 5T33L 3F7YA 5JHLL 3MOQA 4WW1A 1AO7A 3V4UL 1AD0A 1A6VH 1GGBL 1YEEH 1MRCH 2Z92A 3MRBB 2NZ9D 1MREH 2BVPB 5B38G 2X40A 1V8HA 5I1CL 4I0PC 3NCYS 2F74B 3NPSB 4HSQA 1YMHA 1FDLH 32C2A 5DA0B 5M7QA 5I8OH 4YHOH 2CXKA 2Z0BA 3WCYA 3QIBA 1F11A 3S5LA 2IQAB 5BRZE 5MEPB 5J6HB 1TNNA 4WW2A 2PXYA 1F90L 2NPLX 5EA0H 2FWOA 5CSZB 2R1YB 4EN3D 4MA7L 3U6RB 4GW5A 2OMBA 5D7SL 3MROA 3FFCD 5JHDA 3IFLL 2VDOH 1EGJL 2R0LH 4FXLA 1JVKA 2HG5A 3GMRB 5E8PA 4EUPG 1FE8H 4MZ2A 4U1SA 4UI2A 4LDOB 1AQKH 1JGDA 1N26A 3CAFA 2OYPA 4NQEB 4PP1C 2LE9A 4GW1A 1WZ1L 5E1AA 2FEEL 4S1QL 1HQRB 3HNVH 4K71B 1Q9WA 1MELA 1BEYH 4OD3L 3O6FC 5I1EH 3OPZH 3NN8A 8FABB 3GSRB 1M05A 3V6OE 4A6YA 4HIJA 2VAJA 4QTHB 4HAGA 2VR4A 1QKZH 5D1XA 1CXKA 5FCSH 1XCQA 4KKNA 2DLFH 2BOCB 4PJXE 1D6EA 2O5YL 4F7TA 2I26N 1G7MB 2MKWA 3MNWA 5DMGC 1CK0L 3CX2A 2VZOA 5ADPL 1MCOH 1K8IA 4HC1H 3SCMC 4EVNB 1AJ7H 5I2IA 3J7HA 5LGHH 5F7HA 3U82B 4PRBB 1YJDC 2HFFA 3BVNB 1RZKL 1Y18A 3D39E 1R24A 2Z4QB 4RZCB 5FKPB 1ZHLA 4OAWB 1P9MC 3V4PH 5FA3A 1TZHB 5C0GA 1EHXA 1XFPA 5FUOH 3EHBD 3WIFB 1AHWB 2VLLB 1BBJB 5EUKA 4J4PD 4HULB 3BESR 1WAAA 3UTSB 2C4XA 4I77L 5GJSL 5H35A 3NCJH 1VEOA 1BOGA 2VDLH 4X6CE 4EQ3A 1T0PB 5I6XC 4M4RA 2JJSA 2BSSA 2P49B 4PGDA 4XCYA 2VDPL 3VXTA 1J0JA 2VDKL 1BQLL 2BVUA 2VLJE 3WBDA 3UJIL 2HLAA 2A6IA 2MCPH 5DQJA 4NFCA 4P4RB 5L2KB 4JAMA 1DQQB 4CNIB 4X6FB 4WEMB 3FO2B 4I13B 5CCKL 3D39D 2YSSA 3TV3L 4ZFGL 4FS0A 3FFDB 4XVTH 2DQHH 4I2XE 3JWDC 2UWEB 2H9GB 2NTSP 2R0WH 4U6HA 4DTGL 1LO3L 4GJTB 3BKYL 2VC2L 1FZJA 3LEXB 5IMMB 1YY9C 3O8XD 4PYHA 3ALXA 1RUAH 3DX7B 3WL9B 3H9YA 3LKPB 1LP9E 2GY5A 2FJHB 2AJVH 2QSCH 5DDHA 4YEEA 2BVOA 3U30C 3CFBA 3LZFH 4O2FA 1N7MH 2R0ZH 2ZUQC 2B0SH 1E6JH 4NUGL 4OKDA 1B0GB 3MNZA 2ZCKH 4H88H 2E8YA 5F70A 4Z8FL 3Q3GB 5BO1L 4WEBH 5H94A 2EC8A 1NFIB 2HN7A 1CS6A 2VLJD 1QEWB 3VCLB 1HDMA 4G8FA 4QHLA 4ODXB 4JQIH 4QY8B 3X13A 3OG6B 3T65A 5IVXE 1CGYA 1FYHB 2O5ZH 2WQ8A 3QWOA 1U8QB 4TQEH 3OX8A 3O4LB 3O9WC 1S3KH 3VH8B 1UZ8A 2BVQB 3TZVD 4DVBB 1E6OL 3DIFA 1V7MH 1CLYH 1FZOB 1S78D 3QUYA 1U8PB 7CGTA 5FO9B 3I85A 2XWJB 4XBEH 4GRLD 1CICB 1BJ1H 2W9DL 4ZUSB 1EFXB 4HPYH 5JW5A 2W60A 5E8OA 1YEHH 5GS1B 1OP5K 2W0KA 3I02A 4HDIB 5J9PB 3QCTL 3MLUH 4OZGE 4WTWA 3ROOB 1U93B 2ZOKB 1EEZB 2AEPH 4P46D 3HUJB 5C0NC 1MCWW 3GZKA 5IHUL 1KPVB 1XR8B 3AUVA 3GK8L 1VACA 2LQRA 2P8MA 4M8VA 3RVVD 5CZXC 2XZQH 4HJ0D 3HLAB 4PJCA 2VXTL 1GHFL 3X14A 1RULL 1U92B 3ULUC 4MJ2A 3AS0A 5B3NA 4Q2ZB 3QXWA 43C9B 2E27L 4GKSB 4L9LB 1RHHB 3KLSA 3W0WB 5C0JA 4JZNB 1ITBB 4RGOH 1DDHB 1WCBA 2X4TB 5IJVA 1SM3L 1S5IH 1FFOB 4OI7A 3BAEL 4YDKL 2VNCA 2R23B 3CPLB 3WE6A 1A7RL 1E4WL 3IJSA 4OF8A 1EO8H 3IDMA 2OR7A 4L1DA 3PGFH 1G1YA 4WV1A 5HD8C 3GBNH 4JY5L 5HI4D 4Y5VA 1K85A 3BWAB 3T0XA 4EUPH 4F3FB 5DQDH 2YC1B 1OARL 4N8VB 4LSPH 2MOVA 4CAGA 3VMNA 4KJYA 4JFXA 4D0CB 1P1ZB 1CFBA 2JB6A 3TT3H 1Q9OB 3I6GB 2V7NB 3ROLA 4ZPTA 4AENA 3FZUC 2EXWD 5EB9A 4XP1L 4WVRA 5D72H 4BQ9A 1G6RL 3QA3A 1LNUA 3QCUH 1SY6A 5E6ID 3MV8D 4DN4H 5DYOA 2C3WA 4KUZH 3ZDYE 5E95B 3RBGA 3MODL 4OZIB 2H32B 4F7MB 1KGCD 3MOBL 5D5MF 5GRJL 4R2GB 4X7FC 3GB7B 1UQSB 1KNOB 2PW2B 1I7ZA 5GHWL 1UH4A 5BS0B 2E9WA 1C5BL 4NKIL 3RZCC 4J23A 2WMPA 2DICA 5I1DB 1D5MA 1NMBL 1T0NB 4POZD 1YEDA 2Y23A 4NZTH 4JFPA 1G7PA 2H3NA 1RZ7L 4W81A 4R4NC 2ZZUT 2FZ3B 1BX2B 2OTWB 1A14L 2B7DT 1AGDB 3JSSA 2A83B 3F58H 5ESQA 5JXED 1JRHI 4MQ7B 4U1IB 4CMMB 2HT3C 5CP7B 4MSWB 4KU1A 3IJHA 3BQUA 2ED9A 3LS4L 1OAXL 1OGAB 2EDYA 4R7NB 4OZHB 3VWKB 6FABL 5F88B 2UZIH 4GLRH 5JNYA 4TSAH 5T3ZL 2B1HH 3BI9X 1UVQA 4HT1H 2OCFD 3MV9B 2OP4L 4ERSL 3V0VA 5B39A 3MRMA 4QNPF 4TYUA 3ZE2E 4OM0H 4YDJA 1KYOK 1HSBB 4Y4HA 3GI9H 2AI0H 3B6SB 4RFNC 2FLRT 4GRWB 2NY0C 4BSWA 1S9YB 3IDJB 5DUMH 5CJOL 2FCBA 1CDCA 1K8DA 3LOWA 1MI5A 3RQ3A 3EYFA 3B9KA 4EOWL 3EYUL 3P0YH 3DI3B 5GRWA 4Y8DC 5KVGL 1A02N 1NAML 1Q0YL 5EFIA 3BIAX 3NABL 2J8HA 1IBGH 2AV7A 3VG9C 4C56A 1JIBA 3C5ZA 4LPXA 3IAQA 4UBDD 4Q0XL 4R4BB 4RAHA 4PJ9C 1QBBA 3BKML 3BZFA 4UINH 3VXMA 1I1YB 3W9EA 1L4IA 5ISZB 3OB0H 3LKRA 3NIDE 1IEAB 4UTBL 4LPVA 5ID0B 1OAZH 3SDCB 4KRPB 2W65A 3ALPA 4C83B 1EBAA 3RA7L 1PYWB 3MLXL 2CK2A 1SVCP 1FVCA 3BT2L 3EJZC 2ESVE 1NLBH 4PPTA 5HBBA 4NJ9L 5CJXA 3GSWB 2IFFH 4OB5L 1FORL 4LLUA 4EDXA 2OI9B 5I66B 2XWTB 4ZXBB 4QHKJ 5C1MB 1A6WL 3JWNC 1J86A 5HY9A 5IFJA 3UAJD 1N64H 2F54B 4G3YL 1K5NA 4MA3B 1SYSA 5I0DA 3F62A 2J8UA 2HJLB 3B9AA 3GRWH 1YYLH 5I1JH 1HYRC 5D7IB 5KVDH 4HIEB 4DKEH 2Y4SA 3GM8A 3VWJD 1CE6B 1J1PL 2GAZA 3G04B 4YHYB 2YRLA 4J3VA 3RWFB 1UACH 3O2VL 2YD6A 3ARXA 4F33B 4M5ZH 2DS4A 2IANE 4KHXH 1DFBL 2NX5E 4JM2D 4P5TB 2NXYD 2ESVD 1RUKH 5DZNA 5DJ0A 2DJUA 4KPHL 5EU4B 3TYGL 4WI9A 2VQ1B 3EHBC 5HHOE 1T5WB 4CW1B 1DQLH 2XV6B 1JGEB 1UKSA 4J4PC 3UZQA 3GBMH 1IM9B 4XBPA 2AJSL 2VLKE 3L7FA 3FB7A 1M7IA 3V6OC 1KACB 1SJEB 4HUXA 1I75A 4K7FB 1JPGA 4M6MH 1RAMA 2VDNH 5I1LB 3E2HC 3VW3H 1ZTXH 3KXFE 4MQTB 4H5SB 5C6WH 1CR9L 5E08L 2APBA 4Z95L 1N4XL 3TVMA 3PWPA 5EO1A 3MBEC 5JQ6L 2V5YA 2IQ9L 1F6LL 4UIMB 3BDBA 3BD5A 4AEEA 2GIYA 4PJGA 1JN6A 1W72H 2EDQA 3HI5H 2IAND 3IGAB 1NGWA 3FMGH 5C2BL 2DLIA 3VD4A 1KB5L 4HH9A 2NX5D 4QXGL 4OLXL 1A5FH 2GITA 1W0YT 1WUNT 3ARWA 4LSRL 3HE6A 2X4QB 4K7PY 2A6JB 2Y36L 1T89A 5HHOD 5JR1H 1KT2A 3O8XC 4MDJA 2BSRA 4NQSA 1D5BB 4IMLB 4ELMB 2FECL 1MY5A 4JRXA 2VLKD 3C08L 2F58L 2W9LA 3INUL 4Q9QH 3EOYG 5IGXL 1U58A 3LQAH 5TDPB 1EJOH 3WIHA 5IB5B 4F8TA 3KXFD 1TQBB 1TENA 4ONOA 4RIRA 2C1PA 3C6SB 5EU6E 4JG1L 2PTVA 5TQ0L 5KN5A 4Y2DB 3B5HA 4OJFL 3RUGA 4D9LH 2A6DB 5EZJB 1D5IH 4NQCB 2HLFD 5ILTL 1MVUB 2IH3B 3VGAC 4ZAKB 1CFSA 3DMMB 4HH8A 4PRIA 5HDBF 3BD4A 3U7YH 5IG7A 4N0UB 3MACL 5D2NB 3GIZH 1SEBA 5C0BE 2V9TA 5GJTH 4H20H 5D6CA 2V2WA 5JHDE 5KTEL 2AGJL 4XPGH 1UJ3C 2Q8AL 3HC4H 5L6YH 3REWB 4G8GB 5KSVA 5KSBA 5IT2L 1JBJA 2NZIA 4N5EC 2R9HD 5IMOB 1A3LH 1I9JH 1QSFA 3MFGB 5EU6D 2MKLC 5TF1L 2V2XB 4F58L 5E99H 3S96B 3VXSB 5HPOA 4GAJH 2DBLL 2FJFA 1GCFA 2NY6B 3E8UL 2DYPB 1H8NA 4O2CB 4P46C 3ZKMC 5C86A 1F2XK 2IPUG 1F4YL 3NGBC 1EXUB 3MGAA 4F37F 5CILL 3SDDA 3DXAB 4WNQA 4XB7A 5D5ME 1GIGL 1FHGA 5BXFB 1S7WB 1BJMA 2HFEA 3LIZH 1EEYA 4S1SH 3RWHB 5CLWA 4LSTL 3KPSA 3QUZB 5C0BD 5IW6B 4PJBF 3QI9A 5EOQL 2PN5A 5JHDD 5GGUA 1S9WA 2F15A 4JPVH 1QACA 4X6EA 2HRPH 3TBWA 3AROA 1TTUA 4M93C 4I0CC 1T5XB 1AGEA 4P3CL 3V0AC 2P5ED 2W0LA 3M1BB 4LHJB 1A4KA 1DE4A 5L7XH 5ICYA 3WFBL 3OJDA 3TN0B 1AQDB 3PQYB 2RR3A 2DQEL 1S9XA 3L3OB 3QNXA 4KJWD 3RY4A 1NGQL 5B8CC 4DCQA 2Q86A 2EKSA 3O11B 4YHNB 1RUQH 3HB3D 3LQZA 3BE1H 2FEDC 1XZ0B 5E9DA 1GGTA 1IQWL 4WWKA 15C8H 4UV7H 1I3VA 2NY7H 3ZTNL 5EG6C 1NAKH 1IM3B 5D1XD 1U3HA 3GUTA 3OAUH 3FN0L 3OKKA 3PXHA 5EU3A 4TUJA 3BN9D 1KJ2A 3OR7A 3AAZB 4PG9B 2EXWC 1S5HB 4YFLF 3VFOA 1PG7X 4GMTL 1F00I 3D5OF 3FT3A 2AXGB 3IDGA 2G9HB 1W0WB 3SDXF 2OQJB 4GRMA 4LPCA 1DVFA 1INEH 2RAMA 2WWMD 2XKUA 4IIQA 2NQCA 3S37X 5HVHB 1BVKB 2P1YA 3DRTB 4BZ2H 2WBJD 4M7LL 2ERJB 2AQ3A 4JHAH 5IEHB 4PY8I 1H3GA 4HIXH 1PX4A 4POZC 3RX5A 5J1TC 3GGWB 3U83A 1NC2D 4DZBB 1TCMA 1U8JB 4E5XB 4OCSH 2EIZB 5D96B 4JKPH 3MRBA 2BVPA 2EDBA 5EZOH 1NEZG 4X7TB 2F74A 5DURD 2C5DC 1O7SA 2AJYL 2AAVA 4OLYH 1CE1L 1F8TH 2WP3T 1U91B 2XKSA 3FCTB 2IQAA 4L8CB 1QRNA 5J6HA 4U0RC 5CJQL 3AU1A 5HYSB 1OB1B 2A1WH 3WFEH 4Z5RB 3U6RA 4Y5YB 5C6PB 4P2OA 4LKXA 4NGHL 1FNGB 1S7TB 3RWCB 4K8RL 1TETL 4XPTH 1F42A 4B7LA 3AREC 3PWUB 2QQNH 3GMRA 2VR9A 4Q9BA 1NLDH 3QCVH 3GJFB 3VFMB 1BJ1J 2E7HA 5D6DC 4HPOL 3G5YB 4NQEA 4HLZG 1GZPA 2EC9T 3IDIB 1HQRA 1OSPL 3NIGE 3HC0B 4KJQC 1NFDF 1CIDA 1Y6KR 5CP3H 8FABA 4QXUL 1MFDH 1N0XH 2Z8WC 3GSRA 4XCCL 3LHPL 2Z31B 5B3JE 4QTHA 4UT7L 1UM6H 3H7BB 3WNPA 1RZFL 2AK1H 2AJZB 4MAYB 2BOCA 4UBDC 2DM4A 4RA0C 4XMPL 5FGCB 1A0QL 1G7MA 4Q9RH 3ARVA 4FFZH 2CKNA 2XICA 4NC0B 4EVNA 2FATH 1ZWIB 3SDXB 4H0GA 3CVHB 1I7RB 4HWZB 4PRBA 2ZUXA 5E6ZA 3BVNA 5FKPA 2Z4QA 4RZCA 3FOLB 2A73B 4OAWA 5DJAA 5DJ8A 1D9KD 3L1OH 4HUVB 1J18A 1KLGB 1RHFA 3WS6A 5KS9E 2KPNA 1O5DT 4MHHI 3WIFA 1AHWA 2VLLA 3OV6A 1BBJA 4OSUL 1F58L 4LARH 3C6LB 5JUEL 5C9KA 2WWKT 3HRZB 1U42A 5K9KB 2UVEA 4N68A 4WI2A 3CX5K 4U1KA 2PKDA 3EJYD 1HNFA 3O3DA 4H26B 1YJDL 1KJMB 4HMEA 5C2UB 4P4RA 1VESA 1FP5A 3REVB 4CNIA 4YE4H 3LY6A 5DVMA 3FO2A 5FYLE 3H9HB 1IAKB 3FFDA 3U0TB 1DQML 4Z0XB 1MFAH 3UPRB 2FHFA 2R8SH 3MC0A 3LEXA 1Q72H 2NXYC 4XPFH 2NTFB 3WL9A 3LKPA 1AGFA 4NNYB 2PR4H 4JPWL 4EI5D 1LEGA 3K7UA 1R0AH 3N9GH 4WTZG 1YMMB 1JYVA 1WF5A 4DUVA 4X4MA 1YECH 5ECJE 1P6AB 3WKNA 5KVFH 5DRNB 2NXZD 1NFIA 1G7IB 4OZFG 5DQ9B 4LSQH 1QEWA 3SE4A 3VCLA 1QSZA 4WUUD 4LF3B 4ODXA 1WVZA 4QY8A 1OL0A 4LNRB 4YPGB 1CGUA 2ZJSH 4MMXC 5F9DC 1U8QA 4CU7A 4Z77B 5FYLD 3HR5B 2QKIB 3OB0K 3L7EB 1QBLH 1UM5L 3O4LA 5LKNA 3DSFH 2RGSA 2BVQA 3V5DA 3RAJL 1JPTL 4AMKH 5A1AA 4A2MA 1WZKA 5F9AC 2BY1A 1T2JA 3SO5A 1FZOA 3JVGC 3IB4A 4M7ZC 1DEDA 1U8PA 3WUWG 5BOPA 5MI0B 5FO9A 4K3GA 2XWJA 4FXGB 2DM3A 1CICA 2KUTA 2CGRL 1NGYB 4OFYA 3IS1X 1EFXA 1FBIL 3BDXA 3HPLA 3IRZA 1DBML 4NOFA 1T7ZA 4U6VH 4PJDB 3VXPA 2Q3ZA 3GSVA 1IGCH 3LAFA 1MWAB 4HDIA 2CR6A 5J9PA 1I7UB 4IRSC 3SJVB 4CMHB 3U0WH 4YXKH 2X1XR 1MI5E 5D1ZB 5ICZB 1RZIB 3ROOA 1U93A 4D0DB 5T1LD 2ZOKA 1EEZA 4GQPH 1RY7B 1NMCB 1DBBL 3VDBA 4IJ3C 1FRGL 3UDWA 1KPVA 1XR8A 2OXGA 3TIDA 4CL7A 2VWEE 1KIQB 1GOFA 1FYTA 3KNBB 4QOKB 4X5XB 2ZPKL 3UTQB 2HLFC 3UJTH 1MJUH 3HLAA 5BMFH 4KTEH 4G80B 5F7MC 1GGUA 3KPRE 4PB0H 1U92A 3NCMA 5CEXB 4YXHL 2JIXB 4X9IA 43C9A 1AC6A 2VISB 4GKSA 1RHHA 4L9LA 3UO1H 3RTQD 3W0WA 4JZNA 5I0ZA 5CEZE 1RUML 1URLA 2X4TA 5J1AA 1T03H 4MA8H 1T1YB 1ZAGA 4DEPB 3LRGA 1Q0XH 4KK9D 1FFOA 1ZKAA 5DJYB 3VFTA 5EIIA 4Z7UB 3LSOB 2R23A 3BZEB 4MB4A 1MI5D 5DK3A 4JPKL 5TPWH 3B2UC 2R9HC 4M6AA 3PWNA 5BVJB 4YBQD 3L5HA 2OX5A 3BWAA 3CD4A 1A64A 2MPAL 4F3FA 1IGJB 1F97A 3MR9A 4N8VA 2OL3B 5FHBH 1D3CA 3RL2B 3ULUL 4W4NA 1KIRB 3QIBC 4L1HA 3P73B 3KPRD 4HLZH 3I6GA 2V7N