1A3RL

Fab fragment (antibody 8f5) complexed with peptide from human rhinovirus (serotype 2) viral capsid protein vp2 (residues 156-170)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
220
structure length
220
Chain Sequence
DIVMTQSPSSLTVTTGEKVTMTCKSSQSLLNSRTQKNYLTWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLSISGVQAEDLAVYYCQNNYNYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A 8F5 FAB (LIGHT CHAIN)
publication title Crystal structure of a human rhinovirus neutralizing antibody complexed with a peptide derived from viral capsid protein VP2.
pubmed rcsb
molecule tags Viral protein/immune system
total genus 51
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1998-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a3rL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a3rL01
2IFGA 4FQLH 4JFQB 1MREH 1K5NB 2DWEA 4OLWH 2ESVA 4PRPB 5DD5L 4KQ4L 3EYOA 3LCYA 3ULUD 2YWZA 1UWXK 3DJ9A 1PW3A 3AXLA 3MOAH 4KV5E 2HFTA 1W72L 2X70B 4XGZB 4F7EA 4PRIB 3MXWH 1YY9D 4JFED 4PUBL 5L2KB 4LKCA 4Y1AD 3TN0C 5JW4M 4ZNEA 2JKXA 4GRLC 4DKFH 5LGJA 2A6IA 4WDIB 5E8OA 3JV6B 3ROOB 5DT1L 2UUDK 1IM9D 2W9EL 4XCNA 4NT6B 2Q7YB 4EQ3A 3MACL 1XAUA 5J1SC 2PYED 3HNVH 5C07D 4WGWB 4NP4L 2XKUA 1VFAB 4JFZH 3LKPB 4HKXA 5I1AA 3GSXA 4PV9A 3KNBB 1ZHKA 9CGTA 2D31B 4OZIE 4Q9RH 2R2EB 5GISH 1ZWIA 2ADFL 5T33L 3BDYH 3FOMA 1BQHB 1C16A 3VD4A 1T04A 5SX5K 5FYKE 4L4VE 4X7CC 1IQDB 2C5DC 4ZO9A 2VH5L 5I1DA 4G3YL 1A7PH 4XP9H 5DJ0B 5DD3H 1K4CB 4MNQB 1GVIA 4G9FE 1U8OA 1AO7A 4O02H 3MA9L 4PJFF 4YAQA 4I5BA 1AY1H 1QYGH 1KUMA 1A6TB 2WUBL 4NNYA 1KN2H 3FOLB 1WV7T 3QIWA 4ZSOE 1AKJB 1P69B 1MFCH 2BSED 3QCTL 3QDGD 2NY2B 4LLMA 3BQUD 4XPFL 1RIHL 4ZG1A 1YPZE 1BVLB 1FL6A 1J9CT 2J6EL 2GYSA 4MCZA 5EBLB 1QSVA 2MOVA 4WFED 5KW9L 4HCRL 3UTPD 5KANI 4G8EA 1G7JB 3CSBA 3OKKA 4M7JH 4FNLH 5E5MB 3BDBA 3DUUA 4ODXB 3MJ9L 4G8GD 3JV4B 4MGXA 3RWFA 4TULH 2P5EA 5DYOA 3WO4C 1RZIB 3N9GL 3VXRE 3VGAC 4LCCC 2DOCA 4XT1C 3S37X 1BEYH 3FT2A 3GJFA 2P44B 3IAPA 4KK6C 1CT8B 5HYQA 5EOQH 1YJDC 5E0QA 1ORQA 5HHVL 2R2BA 5IHLB 5FKPB 4Y19D 1REIA 5LGHL 4RFOL 3CGTA 5DQ9A 4HXBL 4C54A 4NO5A 4ZXBC 3PWNA 4N1EA 1YN6B 3HI6H 3DX7B 3PDOB 3X13A 1N6QL 1AD9B 4FFVD 3QXUA 3QO0A 1I85A 2ZCKL 4P5TC 3KPOA 5GRZA 5INCA 3U7AA 3WKML 5BMFH 1VFBB 3B9KA 3MV8B 1N7ML 2LE9A 5E8DL 4XVUC 3T1WA 1NBYA 4NZDA 1DDHA 4K94H 3QCVL 3X11B 1VB9A 4F33A 1A6AB 1MRFH 4P0DA 4I0PA 5ID1A 3WV0A 4PGDB 1GSMA 1QTYT 4OGYH 4G6JH 4QXTA 4HZLA 4L29A 4OZHF 3L7FB 4BH8B 4HLZG 2FH8A 4GRMA 1I8IB 4F58L 4KHXL 3P30H 3RZCB 2IWGA 4BZ1L 1KLGB 1EXUB 5CZKA 3MOBH 5LBSL 1OARL 2JCCA 3LN5A 3VFUA 3W9EA 5E08L 1DQML 1TCMA 1D5XA 2FJFA 4LVEA 4ZUWB 1KLFA 3PV7A 1QVOA 3DX9A 5IVXF 1XF2A 3HC0B 4M1GH 4GMSL 1TTUA 4UBDD 4JQVA 1Q9WA 4YHIA 3DSFL 5EUOB 3BP7A 3UPRB 2R0LH 3O6LH 2EDDA 2ENYA 2G75A 1HH9A 4XWOD 1KTLA 2Y7QB 1Z5LB 4GKSB 5KVFL 4GW4A 5IB3A 4I13B 5EO1B 3SDXA 4EDXB 2A9MH 4QRRE 3SQOH 3IDIB 3JUYA 4P57B 1EAPB 4XTRC 1WBZB 2YD2A 2AK4D 4M62L 3N50A 1T21A 3THML 4ONGL 4P2QE 4DTGH 1KYOJ 3UBXB 1A2YA 4WEBH 4MXWH 2J8UF 5F7WC 1FV1B 4O58L 3FO2B 1S7QA 5EU5B 5FYJH 1BFOB 5C0EB 5JA9A 1B0RA 1RSFA 3GJEA 4UU9A 2VDMH 4FQCH 2F8XC 2CPCA 1D9KA 3DV6A 1AC0A 2D03H 3LRGA 4WUKH 4PJAE 1CGUA 4PJGA 4RMRA 5DJYB 3E3QC 4X99B 1Y6MR 1B6DA 2WM0A 5DFWH 1QKZH 5CGYD 5J1TC 4IOIB 5TPWH 2IF7A 5J12B 5GGSB 1CLCA 5L6YH 4M61B 1Z9MA 4FQIH 5IW6B 2IANA 3MV7E 2IPUG 1HKFA 5DRXA 3E6HA 1JHTB 5E1AA 1FZJB 3UJJH 5I0ZA 3GM8A 4GAJL 2DYPD 1WSST 5C8JB 4OSUL 2EKSA 3U0PB 4EXKA 4KVCL 5I8KL 1RJYA 3IKCA 5DVLA 2A83B 4LPCA 2VDOL 4B7LA 4NN7B 3QWOA 1FCCA 4NZRL 5E6ZA 1JIBA 2FWOA 3AB0C 4LMQE 3DVNA 1I8LC 1LVEA 4E42A 1JHLL 5EN2A 4LLWA 3FT4A 4KRNA 3BOVA 3D39B 4YDIH 1Y18B 2ADIA 4WY7H 1JRHI 3LIZH 3LKNA 4IRSD 5J8OA 5F88A 1F8TH 3BUYB 5F21B 3OR6A 3VU2A 3MRPB 1UM4L 3AM8C 4QRPE 4LHUG 1XF3B 3WN5C 5B38B 4JREB 4KI5C 5T3XE 2XN9B 1WICA 4NN5B 2A38A 3ES6B 1KEML 43C9A 1UM5L 5GGTH 1KJ3L 3B9DA 3U48A 4JO4H 5JHLL 2WLZA 3TA3D 3DUSB 4E41E 1AGFB 5KVEH 3MYJA 4NO3A 5K9KA 5DJ8B 2Z4QB 5GRUH 4ZFGL 3DXAB 5D1ZC 3DYMA 1P9MA 4ORGA 3VXME 5HHQA 3MRMA 3ULVL 3RX8A 4LAQH 2BOCB 4YK4C 5JQ6L 1ZLVH 3P0VL 3TCLB 3V5KA 3LDBC 5D7IB 5EOCL 1MJUL 1Q0YH 1T1YB 4MD5B 4ZUVB 3PQYE 4ZDHA 3HZMA 1A1NB 4UT7L 5I74B 1RZ7L 4N0FB 1BVZA 1GGCL 4FFZH 1ZS8A 3HG1B 4JZJC 1WAAF 5E2VL 2GUOB 4MNGE 3FB5B 1MSPA 5AD0B 4NC1C 4RISL 5H94B 1IRAY 2J4WH 2Q86B 5CZXC 4N0UE 3KPLB 4P4KB 4XNZB 3HMXL 1JPFB 2I60H 3VWKA 3OJVC 2UZIL 4NPYA 1JF1B 2AI0L 3EHBC 2VE6A 3O45B 5GRYA 2PUQT 4M8VA 4OQTH 1RIUH 5DLMH 4LSUH 5JZ7C 2QSQA 1SMAA 1VFUA 4MX7B 4KK8D 3V4PH 3FQTA 5HVWA 3Q3GB 4EVNB 3OMZA 1U8IB 2XWTA 1IZKA 1G6RA 3M8OL 3WXWH 4WWKA 3EYOB 3IJHB 4KK5D 2OL3B 1FE8L 2X4QA 2FBOJ 3OB8A 5DDHB 2QQLL 3LQAL 4FP8H 4RZCB 4KI5F 4U1HB 5T1KA 2IPKB 4X7FC 4XPBL 5AYUL 1QLEL 1RJLB 3KPRB 4LVOB 4NQEA 3SJVE 3BYYA 3MFFB 3QZWG 3DBXA 5DEGA 5JW4R 1ZANL 2HTKC 2W65A 4UV7H 2YD1A 4TTDD 3D85A 4LQFL 3VD3A 3MRRA 1AGDA 5AZEL 3FO1A 3LAFA 4HKXB 4HULB 3C5SB 2QQNL 4PV9B 5E4EB 4L4VD 3NCCB 2KBGA 5ISZE 4Y5VC 5J6HB 4HAGA 2YPKA 3FOMB 3L5WA 4X6DF 4OJFH 1P7KB 1KACB 5AAMA 4B50A 1IC5H 3NBNA 4G9FD 4X83A 2OYPA 3RA7H 3U9PL 5HBBA 2ZOKA 3M17B 1E27A 4G6MH 2O5ZL 1BOYA 5IBTH 5CLWA 2H41A 4JFFA 4AG4H 1EBAA 1S7SA 3E8UH 5DC4B 1WUNT 2Z8VC 1BZ9A 4G6AD 2VLRA 5I30L 4PJ7A 2A1WL 3BW9B 3K8KA 1AO7B 1J5OL 4QTIH 3DMMB 4X98A 3WUZA 3QDAA 1TDQA 1N4XH 1GCFA 4WI2A 7FABH 2KDGA 5SWZE 4DKEH 4I8DA 4WFHE 1FNLA 3IFPB 3SGEI 1F6FB 3HUJA 1UWGL 3WCYA 3VXRD 5DSCB 3NABL 4MDJA 4PRAA 3RU8L 3EFDH 4HS3B 1XGQB 5IESH 3BIBX 3OKKB 4ISVA 1NFDF 2G5BA 4RGOL 1S7VB 3QPXH 4S1DD 5GZNC 4ZOEA 2P5EB 4PJBA 4XB7A 3H9SA 5C0CE 5FUZL 2HKFH 4M7LL 5F3BA 4JVUA 5GS3A 1IGCH 3FT2B 4X6BA 4MJIE 2AJZA 1D5MA 5HYQB 1BVKB 2VDNL 5JUEH 2SEBA 1ZE3C 2AJXH 2IH1A 2GK0A 3UTTA 3O6FD 1B2WL 2R0ZH 1CD1B 2HMIC 3Q6FA 5D6DA 3KYNA 2RCSH 4HX1A 1INDH 1NGXA 2Z9TA 4YPJA 3OGOE 1QG3A 1VENA 3AVEA 5INCB 3KPOB 4R90H 1DQQB 5IMLA 3CU7A 5GGVY 1NFIA 1TPXC 1JZ8A 3TVMA 5J6GB 4OFPA 4HC1A 5CAYB 5IGXL 1VACA 3ZE1E 4NQCB 2I27N 3L1OH 5IVXE 5ECJE 2X6MA 2FIKB 2AS5M 1YA5A 2AXFA 2OI9C 2VQ1B 3LN4A 4PJ5E 2J5LB 2R0KH 1U8KB 1F4XH 3GSNL 4IMKA 4K71C 5KTEH 5FCUL 4ZS7H 5A43C 3VRJA 1FL5A 3BP6B 4DW2L 2Y6SD 4N8PA 1F90L 4N5UA 3OJDB 1PLGL 3PHSA 4N0CC 4PREB 3SE9L 5IB5B 1SJHA 1OT2A 3CLEL 5F96H 2IQ9H 1FC1A 3HHRB 2YUZA 5DMJB 4U1LA 1EMTH 5ALBL 1H5BC 1RV6X 3NA9L 1FZMB 4UQ3B 1INEH 2MFNA 1XF2B 4RFNB 3V4UH 4K55A 4UT6H 4EN3A 1JRHH 5CEZH 1OD7A 4UINL 3EJYC 4QRRD 1ZT1A 1Q9WB 2NYYC 3S5LA 3BP7B 3RUGB 3OJMB 3HC3H 4EDWH 1FP5A 4V1DA 2X4PA 1YQVH 3HC4H 4P2QD 3ZTJH 3DURB 4XC1L 3EGSB 3RIAF 5EU7C 1C08B 4OIAA 1P4LA 3BEWA 4TVPE 3WBDA 1HOCA 1TJHH 5DR5H 1XH3B 1K3ZA 4OZGB 4LAJH 1RZJL 1T21B 4LSQH 4Y2OA 1FZKB 2CK0H 1ZK9A 2AERT 4EIGB 4MNHA 4PJCB 2C7UA 3W39B 1NCCL 4ZTOL 4MJ4A 5F72S 2VABA 3DECA 2NX5E 4KRPD 4TYUA 3CMOL 4I3SH 4Z7NE 4WI5A 2DQIL 3RVUD 2QHRL 5DRNB 3MV7D 4RBPK 4MA8L 1UACL 1NDMA 3VFNA 2XPGA 3EYSL 4XMKL 1PKQE 5C08A 4KRLB 4ODHH 3MOQA 1A1MA 2HFEA 2X4UA 1AQDB 1A7NH 4YC2C 1AGBA 1WLHA 4Q97A 2VLLA 1HI6B 1X3DA 1Q9OA 2EKSB 4YXKH 5HYEA 4WO4D 5I8CA 1IFHH 5TDPA 3IKCB 2QSCH 3NCFB 1KENL 3PABA 4M6OL 4R4BA 3SGJC 3QWOB 5GGVL 1DL7L 4UOW0 2PR4L 4JJHA 4F8TA 3JBG7 5KS9E 1UXSA 3PV6B 4AEIH 3UC0L 2HVKA 4CU7A 3MRNA 3BSZH 4QRPD 1BD2E 1YC8A 3BH9B 3FT4B 1F6LL 4U7SA 4YXHL 1GAFL 3FB7A 2EH8L 4HAFA 4PJ8B 3X12B 2NY6D 3LKNB 3GKZA 4Z78A 3MXVL 5GHWH 4NJAL 1K8DB 5DO2D 4Z7OF 1Q9LB 4NKDB 3QI9B 3S37L 5HXMA 2BVOA 3QUZD 3O2DA 4E41D 4K23H 4EI6B 2NXYB 4NHUB 4TOYH 1JI2A 3MZGB 3SKMB 4JG0L 3X3FH 3E3QE 2WV3A 2Q7NA 4MAYA 3GMPA 4LCIH 1OM3L 3C5ZB 2HLFD 1KCUH 1SYSA 3VXMD 1IEBB 4WU5B 5IT2H 1NCUA 1HDMA 3BRDA 3W0WA 1A7QL 1IGFL 2EECA 3QJFB 1CDGA 1FFPA 3EDEA 1A1OA 5JLZA 1BJ1J 4DVBB 1J0HA 3I85A 3D9AL 3PQYD 4ONOA 4Z95H 3CUPB 2VDKL 5HHQB 3EYUH 3C09B 3U9UB 1HHIA 2PCPA 35C8H 4ZMAT 1J87A 4Y4HD 3G6AB 5EA0L 1QUNA 3TZVA 2OR9L 2HH0H 4JO3L 4C83B 2BY3A 4N0RA 4YWGH 3TBWA 5CJBA 3C5JB 5C3LD 1Q9KA 2LVEA 3SDDB 3JWDC 4PGJA 4Y5XB 5KSUA 3P4OA 3P77A 1OSPH 1WEJL 3SDYH 1L6XA 3UTSB 3GBLA 4CKVX 4L9DA 3P11H 4KI5E 1G7PA 1BP3B 1MAKA 1QSFB 1UEYA 2VE6B 4HDIB 3IFOB 3D0LA 4LDOB 3BKCL 4KTDH 4S0TD 3FFCE 5I1HH 5T1MA 2OS7A 2UVEA 1CI5A 4P23C 1DQJA 2QR0A 1N0XH 1NLBL 3E2HC 3MROA 4KKCD 4LSDA 3TBSA 1UH4A 3WFDH 2CIKB 3F7VA 2Y36H 5T3ZE 3E1F1 3GSQA 3T8XA 3VE0B 3U4BL 2CJUL 4NQDA 2R1XB 1YEIL 1E6OL 4PJIA 1JGLL 3I3BA 2GCYA 3RKPA 2BNQB 2X4QB 1KJVB 3SJVD 1WF5A 2VZ1A 3EOTL 4TSBH 2FJGB 3ZKSD 1YEGL 1KB5A 3L3GA 3QCUH 4MHHG 2XY2A 4WHYG 1DQDH 4NQSB 1T0NB 3Q5TA 4XP1H 1I7ZA 2OZ4H 3FFDA 1FJ1A 3GSVA 2YSSA 4L3CA 4DVRH 1CR9H 3A6CL 5FYKH 4JFEB 4Y89A 5T1LA 1JZ2A 1E28B 3W11C 3MJ7A 4G8FB 2IAMC 1U8PA 5J11B 1EFXA 1LP9B 3MBED 4B41A 2ZUWA 1XIWA 2A9NH 5K33A 5DMKB 4X4YA 1U95B 4OAWA 2AQ1A 2PYEB 4P9HH 2DDQH 5DUML 3L5WB 2I9LA 2R23B 1G0DA 2R2CA 3L3JB 3MCKA 2GTZA 1MCPH 1AI1H 1Q72L 3BO8A 4JO2L 1RUMH 2HN7A 1XZ0A 1ORSB 2WBJA 5K59F 3IDJB 3BHBA 3KYKH 1NFDE 2GY5A 2VLRB 4GKOA 1JBJA 1NLDL 5SWZD 4MJ6B 3TV3L 1JPGA 4YEEA 5IR1A 5B21A 1PG7L 1CU4L 2D7NA 2LU3A 5IBUB 3TN0D 4Q74A 4FFWC 1CLZL 4GRLD 2XTLA 4NWUH 2F5BL 1F4YL 2ADJB 4YGVB 4RCAA 1CIDA 4LSSH 4MDIA 4M5YH 3CVHL 3T3PE 2HTLC 3MNWA 3JWDH 1YDPB 3O2WL 5C0CD 3SGDI 4HKJB 3BQUB 3CLFH 5IMKB 5DEZA 1Y6NR 4PBXA 1CL7I 4MJID 5KJRL 1MRDL 3VA6A 3IDYC 2V7HB 4UIKH 1BQSA 1J1XL 4QHLA 1ZVSB 5F9WC 2O61A 4HIXL 2GT9A 3CFJA 2YUXA 1KNOA 4G8GB 3I02B 4ELMF 1N8ZB 2BVTA 5DRZA 5HHPB 4C58B 2JIXA 1JWSA 5IW1B 1F6AA 2VZTA 3IFNL 5HGDA 2K1MA 4HGWA 5CP7A 1MCEA 1LMKA 3BZFB 2DJ4A 2XACC 3Q6FB 2JELL 1ZT4A 2XFXB 5J9PA 4MQSB 4Y19B 3Q0HA 5ADOH 2UVFA 4XXCA 4KWUA 1CF8H 3KPSA 3X3GH 4X6CA 4OFVA 2ICWI 2FHBA 3IF1A 4XPGL 1J86A 2VQTA 4PJ5D 4YDLB 4JPWH 1EZVX 3RX7A 3BRFA 1VFMA 5D1QA 4A2LA 4KU1A 1Z9LA 3DI2B 5C0IB 5DEFB 1QO3A 3LD8B 4D9RE 3L3IA 3CNKA 2UYLB 4XNUH 1SM3L 3WJJC 2CIIB 3LN4B 4KTYA 4Z77A 1AHWA 1XGRB 3EUUA 2WW8A 1FNGA 2P46B 4JRYE 3KJ4C 1GZPB 1IC4L 3L3DB 3ZO0A 3QEUB 3L7EB 5FM8A 1FL5B 3VFTA 1OOAA 1QEWA 1CQKA 3MTRA 3SOBH 4FQHA 1E4XH 3MSPA 5KSBB 3D87B 3TH4T 3DIFB 2YMXH 3OTTA 4ZXBD 4PBVC 5CINL 3T0XA 3WXVL 1UADC 4QNPE 1MNUL 2AJYL 3H9ZA 4YHKL 3GMRB 4P5TD 4KI1A 4YDJA 1QQDB 3P9MB 2QLVB 3C6SA 3E0GA 4XVUD 5C2BH 1W0VA 3BZDA 2VLKB 3WFEH 2BHUA 4OFYA 4TVPD 1FHGA 4M6ML 3VFPA 4WNQB 3I50L 5FDYA 3NFNB 4UI2A 1UT9A 1ZLVK 4BH7A 4JFDB 4TUJB 3OQ3B 3WUWB 1SEQH 2P5WE 1KPVA 4GKNB 1WCBB 2EICA 1H9VA 3OPZH 4UILH 4NKOB 1ACZA 3MMEA 1S5IL 4Y4KD 4K7PY 2PNDA 2FSEA 4NYLB 4A6YH 2NX5D 1HSBA 2J88H 1LILA 2BXYA 1WC7B 4MXQC 2CLZA 4JB9L 2LAAA 3CFEA 3LKOB 3VCLA 1XGTA 2E27L 2OP4H 4D0DB 1RUQH 4YDKL 2VRAA 3S5LG 1IAIL 4J2XA 3BP4B 3IDGB 1M05B 2YPVL 4JG1L 2OR8A 2R56H 4Q0XL 2B4CL 2OJEA 4K7FB 1JWMB 2G9HA 3SDCA 4OFDA 3N06B 5D6CA 2YEZA 3RGVC 1FFRA 1NDMB 3WFHB 3MZTA 1G0XA 2F5AL 5D2NB 2R1WB 3MRFA 3STZA 4XP4H 1E4WL 4GSDH 3AUVA 5EBGA 4YPGA 4HWEL 1NC2D 3QB7C 3KR3L 3MRJA 4CMHB 2Q76B 2E6JA 2VZVA 4FQXA 4XTRD 3SDAA 3P4MB 3O3DB 1BD2D 4LCWE 4XBEL 5C0FB 2YD3A 3O2DL 2R69L 5EBMA 5EU7E 1CD0A 3D18A 4LEXH 5LWYH 3J8F7 2DYPB 4U6YA 3OX8B 1UXSB 1C5CL 5T3XH 3D25A 5EU3A 3UZVB 5FYLE 1AXSB 1D5BB 1MCFA 2H9GA 4LLDB 4RFEA 4TSAL 3QQ3A 1YMMA 3LZFH 4LKXA 3MNZA 4LBEA 1TFHA 4M5ZH 1JWUA 4F7TB 4PRHA 4HBQA 2KL6A 5ICZA 4IRSB 5CS7A 3STLB 2BNUA 4PRBA 4F9PA 3F12B 5EZJA 1FG2A 4M8QA 4X8JB 3V4VL 1HE7A 3MRCB 2NXZC 3V5HB 3QUMA 4JFHE 1RZKH 3FRUA 2E6PA 1I7UA 1U8QA 1QBLH 3O8XA 4OCMC 3TA3B 5JIKA 1QFUH 1U3YA 5BV7L 1OTTC 1RZ8A 1CXHA 2CMRL 5HVHC 2VITA 4HIIA 4R97C 3VFGH 4Q6IC 5MEOB 2XWBB 4W4OA 4XNYL 1K9TA 5LXGH 1JPSH 3DX6A 1U6AL 4M48H 2C3HA 5I16A 5L8LB 4WEMB 1R5WB 4XAWL 4U0RB 4P2RA 4MVBD 1KELL 4OFIA 4K7PL 1T6VN 5HHNA 4KI5D 3OJ2C 2NY0C 5IFAL 3RIFK 1R24A 4FQJH 1ZGLB 4P2OC 2Y5TB 3P77B 2R2HA 1FVCA 2A6JA 3FFCD 2CDFA 3DO7B 3T4AB 5I19L 1I1AC 4ZPTB 2V5YA 4XHJD 5IFHL 4RDQG 4PJXE 4RQQA 4U1SA 4DGIH 4XMLL 1IT9L 1T1XB 3KPNB 4OD2A 4X9BA 1GRWA 2OJZL 3NZ8A 5C0GB 5F7LB 5D1ZD 5IMOB 3D0VB 3SKOA 3PIQA 4QGTA 5LCVL 1GXEA 2Q8AH 1CBVL 1MI5E 1BM3L 4D3CL 5JXEA 5E6ID 4MS8D 1BX2A 2G60H 1FYTE 3SGDH 2CGRH 3PHOB 1K8IA 3C9NA 2H2PC 5A16B 4RRPG 1A0QL 4J4PA 1CL7H 2QV2A 1AD0B 4NQDB 3ZKND 1V7NH 2BSTA 1BQHG 4IRJA 1MEXH 1I8KB 2ZG2A 2PYFA 4R0LA 4UIMB 1F4WH 2FR4A 1ERNA 4O5LL 3N1QC 4WJ5B 2H26A 5FB8A 4X4ZA 3S35L 5C9KA 3OSKA 4KDTC 5K59E 4OKVB 1I7ZB 1OVZA 1FJ1B 3L3HB 3S36H 1XCTB 5I1KH 5HGAB 5GS0H 5I8OH 4XCYA 2FO4A 4PJFA 3EHBD 1FNHA 1FNFA 2FRGP 3HE7A 5AWNH 4F80A 1P7QA 2Z31C 1JN6B 3HR5A 3CXDL 5D7JC 3VMPA 1U8PB 4NQTA 2IPTL 3SKJH 1N3NB 3OXRB 3R4DA 1A7RL 3G5VB 5L88L 4NSKA 1YEKH 2NY3D 2XOTA 3UZEA 3K8MA 3WE6A 1XF4B 1C5BL 2I9LB 3OGCA 3QIBA 4MA3A 4L4VB 5EORH 3WLBB 4JLRA 3MCKB 3NTCL 5E8PB 4EUPB 4L9LC 1DBJH 4F9LA 4IDJL 5ESVB 5K9JH 2GQHA 5TQ2H 4CNIA 1V3JA 5INDA 3IXAB 1NC4D 3CJJA 3FHAA 3RWIB 1JP5A 1X4ZA 3D6GA 3H42H 1S7TB 4OCXH 4QRTB 3TFKC 3RL1B 4D0BB 4APQC 5C3TA 1WT5C 3PJSA 3AU1A 4CW1B 1LD9B 1I75A 5DQDL 2PF6A 1NMCC 2GSGA 4U1IA 3QBTB 1FVEB 3PGCA 4RAUA 3HE6C 2E8YA 3DETC 5GGUA 4AJ0A 4ZFZA 2YBRB 4MXVE 4HBCL 4WHTA 2R0WH 1RMFH 1P84K 3LKRB 5JMOC 3MLVH 5DJXA 4WHDA 4NCC2 3GMQB 3FKUS 4K3EH 4HJJH 4PGBA 2X4RA 3VXRB 4NN6C 4O2FA 5C0BD 2ZJSL 2MCPL 5HGBA 2CD0A 3WNOA 4Z7VE 3B5HA 1I3GH 2QJDA 4ODWB 5C92A 1U41A 5DRZB 4PJEF 4U1GB 1CXKA 1D6VH 1RIVH 2R8SL 4JQIH 1UWEH 4OZHA 2O5YH 2PO6D 1HH6B 5EWIH 2DTSA 1A64A 1U58B 4JN2B 5D2LB 4Y4FB 1LE5A 1ZT4B 2XZAH 1WZKA 1XF5A 5BO1L 1QLFB 1OTSC 1S78C 1CFQB 4LSPL 2AJSL 1NUFA 3O6FB 4JHAL 3HPLB 3FT3A 2DKMA 1KIRA 5FA4A 4F37K 3ARBA 2YPLA 4G7YL 1S7XA 3MLTB 3BPLB 5AYQA 3QG6B 4JRYD 5GGQL 4ZAKA 4IHOA 3MUY1 5MENE 1LO4L 1Z0NA 1FVDA 4Y16C 4X5XA 3UDWC 2LV4A 1ND0A 3QP3A 4Z77B 4QWWC 3U1SL 3NCBB 4XPTL 3MACH 4UTBL 2F74A 3VFTB 1V7MH 4LPUA 4EI5A 5BQ7A 1FNEB 2HMID 3VFWB 2BXZA 4WHCA 4BZ2L 1RVFL 1JNNH 2J8UA 3MGAA 2NTFA 1LDSA 3UBXG 1CG9B 4PG2A 5GIRA 5D8JL 1EUTA 1MCHA 2VH5H 4NRXA 4G3YH 2VLME 1YEEL 2H2SD 4L5FL 4K3HA 1L7TL 3CU1A 1RURH 4Z0BL 3GI9L 1U2HA 4F15C 3MJ6A 4HUUB 4JO1L 5SWSB 1UJ3C 4XPAH 2PTTB 1RK1B 2HKHH 4XP5L 5C09A 3BIAX 4P2QB 1RIHH 3G6JB 3A67L 1QFOA 2H6PA 2CSPA 1UZ8B 3DO3A 4XCEB 3OR7A 4O4YL 1FN4A 3MLYL 2CLZB 4HLZH 4PJAB 5SWQB 2EYRA 1XR9B 3P9LB 4GT7A 2XXMB 1KSRA 2DQUL 1CLYL 4DN4L 1MVFA 3B8SA 5FGBC 5I76B 3EJYD 3BKYH 3QFJA 2NYYD 5GGTA 2OJEB 1FBIL 3KWWB 4FQQB 5FOBB 1JGVL 2Z92B 4I4WA 1KB9J 3VFVB 5IFJA 5LGHH 4RFOH 3VXQB 4ERSL 3WHXB 3BKML 2I5YH 5GRWA 2EC9T 5E7BA 2Z0BA 5BCAA 1ETZA 5IMMA 4Z7WE 4R4FH 4AEHL 2ZCKH 4NQVA 4ONFH 3GSUB 4QF1A 3WIIL 4OUOA 5C6TL 5FYLD 1F2QA 1MCOH 1CZ8L 1N7MH 3TCXA 2V2WA 2BFVL 4PJHA 3WFBL 4U6YB 3QCVH 4WO4B 2ORBH 2Z93A 2VDRL 3VXNA 3D25B 3KDMB 4FXKA 3VI3F 1PY9A 3G5YB 1Q38A 4FQ2L 4XRCA 4XZUB 2XQBL 4Z7UA 2XZCL 1JPST 3LQZA 4OM0H 2COQA 3QUML 4JGMA 5DI8B 5BS0A 5CKAA 2OM5A 2VN7A 2WIMA 4MA1B 4QRPB 1IM3B 4OLWL 5DHVB 3EFFB 2NY6B 5ICZB 4JGUA 1J1PL 2J8HA 4JZNB 2F8OA 3HKFA 5GZOC 4HXAH 4JFHD 1T89C 5IHUH 4BZ1H 2OXHA 1A9BB 1OGAE 4OQTA 1U3HA 1TVBA 1OARH 1NUNB 2HLAA 4E41B 1DQMH 2H32H 4ELKB 3MXWL 3O4LA 2F8VA 3MRLB 2XTJC 5ANMA 5IJVA 4GXVH 2ARJQ 2DD8H 4XCFH 2ZUUA 3OKLA 4WW2B 5C9JA 4Q6YA 3VXMB 1BBJB 4M3JA 4JPIB 3VXUE 3HNVL 3MV9E 1NKRA 2VITB 3JVGC 4JRXE 2B20A 3DSFH 4YHYC 1KCKA 3V95A 3LEVL 4G6FD 1R5VB 4Q9RL 5DD6B 5GISL 3ZE2F 5ESAA 2M1KA 3BDYL 3PQYB 3ULVC 4IIQC 4Y1AA 2O93L 5F3HA 4HT1L 3BPNB 2O5XL 2NY4C 3QRFM 1WZMA 2NQCA 3HMWH 4Y4HB 3GMMA 2DLEA 3OKNB 1IM9A 4M62H 1CXIA 3GB7A 3SY0B 2FJHB 1FPTH 5D4QA 3BGFC 3NGBB 4N0UB 1MVUB 1TJGH 1A7PL 2CO7B 4XP9L 5I2IA 5EIIB 4RX4A 2BVQB 1FVCB 5DD3L 3ARDC 4POZC 1OQOA 5HI5C 5ETUA 1MI5D 3GBMH 3UO1L 4TSCH 5T3ZH 4GRWH 2AXGB 1FYTD 1QYGL 1S9WB 4JKPH 3EYVB 5C0AE 1CK0L 2GJZA 4HUXB 3V6ZA 1QBBA 1MFCL 1TZIA 5A3IC 1BX2B 2VB5A 3I6KA 3ZYOA 3U46B 4ZUSB 5JW5A 1QRNE 3QXTA 4LVOC 4NNXA 1TXKA 4M7JL 2FECL 1NJ9B 4FNLL 4UUJB 3GMNB 3WLWC 1RULL 5JW4Q 1AXIB 4YHML 4QOKE 4TULL 4L3EE 5ILTH 2VLJA 1HILB 4KVCH 2CLVA 3U4EA 3ZZ1A 3QDGA 1LDPH 4WUUE 3AREA 5H35A 1BEYL 3I75A 3LQAC 3SJVB 5EOQL 3RNKA 2WWKT 1ZT7B 4XPHL 1XT5A 1DBAL 4J3UA 3UCRA 1JZ4A 4XCYB 2FO4B 3BH8A 3VRLE 1JHLH 4PJFB 1IGML 5C70A 1I1YA 3B6SB 3HE7B 4CRPA 3ROLB 1F02I 2DQFB 1NGQL 5ENWA 5IB1A 1BBDL 4P23D 4IOFC 1UM4H 5IP4A 3LHPH 1VA9A 1XR8B 2YD8A 3CK0H 1KFAH 2ARJB 4WI7A 3UROR 3EZJB 1ED3B 3B83A 4PRPE 4PJDF 3MRDA 1CD9B 3MBEB 3QIBB 4MA3B 4K94L 3T4YB 3ULVF 1KJ3H 4LIQL 4XXDA 3ET9F 5JHLH 3QIWC 3T65A 1MRFL 4O2CA 5JHDD 5CFHA 1A6WH 4Z9KB 3QHFL 4KJYB 5HPMA 1KIUA 3RWJA 1TZHB 1J05B 2OK0L 3GO1H 4QTHA 3HA0A 5JQ6H 5E2UH 5SWZB 3P0VH 3W11D 1IAKA 3MOBL 2EYTA 3TN0B 2IAMD 3TIEA 5HYSG 4RGNC 4GRLB 4G7VL 5F6HJ 1JI1A 3K4ZA 1LEGA 2XZZA 4YH6A 1GGCH 2RFXA 1M6OA 3U0TA 5E2VH 4WHTB 2D0FA 4OT1H 4RISH 1E6JH 1QBAA 3VXOB 1MF2L 2DKSA 1NANI 5DJZA 5C6PB 2Y06H 3BN3B 4P5KA 2D3VA 3HMXH 5D1XA 2HFGL 2R0LL 2AEWA 4MJIB 3L3OB 4MNQE 1IARB 1VCAA 3BT2L 2W91A 2CDEB 1I85C 3FZUC 5BRZA 3B9KC 3WMSA 1QR1A 1QR4A 2A9ML 3CPLB 1JJUA 4PBWD 1R3LB 4M6AA 3B9AA 4OZHB 5F7DB 4BQCA 3MGTA 4DTGL 1UXWB 2F54D 3O9WA 1UVQB 4WEBL 4MXWL 1NPUA 3UYRH 4I0PC 3JWNC 3M8OH 3O3BA 4RA3A 5MEND 5FA4B 1FE8H 4FQCL 3VFRA 4ODBD 4P3CL 3U36A 2D03L 1J0ZA 4OBSA 2QQLH 4WENB 1OAQL 2EYSA 5IVXB 3LMJH 4XPBH 3PWVB 4ZAKB 1GYAA 1NAMH 1S3KH 1QLEH 3NCYP 4NFDA 4OI8A 3U6RB 3BIKA 4B53A 5TPWL 5SV4A 5L6YL 2YUVA 3NIFE 4FQIL 2ZOLA 4NIKB 5GGRA 3WO4B 4RFNC 4L3AA 3VGAB 4HV8A 4LCCB 5EO9A 1CFNA 4X5WA 1NMAH 4JQVC 4MHHI 2VQUA 4OCNC 4DN3L 2EKJA 2VLMD 2BJML 1KJMB 2WMPA 2IADA 2J8UB 5FIEA 5GIRB 3UTOA 3RDTA 3GMLA 2XZQH 1PZ5A 5EC2A 1I4FA 5CHNA 1T7YA 3DVIA 5HYJA 4OF5A 1JCKA 4WY7L 4NNPH 4POYA 1EUUA 4P5TB 5GSVA 1CTOA 2EDOA 3GI8H 2A1WH 4QY8B 3BUTA 4BJLA 2IBGA 1I8MB 1LE9B 4XH2B 1HEZA 1ES0A 3DV4A 1T3FB 1D5IL 2NTSP 1D9KC 1IC7H 5EPMA 1JK8A 1WISA 1D6EA 5GGTL 1GGBH 4DCQA 3B3IB 2K7PA 3LPWA 5KVEL 3PL6A 4ZQKB 5I1JH 4JKWA 1RZJC 3RU8H 3O3UN 4HUNB 2AVGA 2NX5B 4LCUA 1MQ8A 2X4SA 3BISA 1M7DB 4PY8J 4RGOH 1JL8A 1AFVH 1A22B 4XBGB 2X09A 3P73A 4WFFD 4U1MA 2AXJA 4LAQL 1Z6JT 2DN7A 4ZO6A 4OZFH 1A3RL 2VDNH 4NOBA 3UYPA 3DWTA 5ID0A 1PKQB 3HB3D 1TIUA 4DGYL 2DQGH 2YA1A 1B2WH 1T0MB 4FFZL 2C1OA 3RWCA 4RGMC 2JCCF 4NO2B 4JCMA 4JDZB 1H8NA 2BCKB 1ROWA 3O4OC 2I60L 4FTVA 3QIUD 4P3DA 4K2UH 4RWYL 3WS3A 3GMOB 1HYRC 4MXQD 4OQTL 1RIUL 5DLML 4U6XB 4LSUL 2OTWB 1T66C 2GKIA 5MERB 1MH5B 3SDXF 2NY7H 3GSNH 4XBPA 1WFTA 5JQHC 1OGAD 3JSSA 5FCUH 5FYJU 4R4NC 4X7EC 4OI9A 3L95B 1LWRA 3DVGB 3WXWL 4JZOB 4YR6A 2WIIA 1P9MC 1GZQA 4AT6A 5IQ9A 1KCVL 4NJ9H 2GIYA 1XGUA 1PLGH 3SE9H 5F7EH 1JGUL 3VXUD 5K9OB 3R06B 3OBAA 4JRXD 3DROB 1VSCA 5ALBH 4BKLA 4PJGF 4LPXA 2X42A 2OTUB 3LPFA 3NN8A 4N68A 5JA8B 4JQXA 1MHCA 4S2SB 2GJ6A 1PGRB 1SJEA 3SGKA 3FN9A 2VDPL 4YNYA 2IBZY 3BZ4A 5KSAA 3AB0B 4X4XA 4XC1H 5CP3H 1ZHNA 2XKSA 3V79C 3VWKC 5FO9A 3S96B 1TTFA 4OJFL 4OIBA 2XN9E 5ICXB 2ZNXA 4OZIA 4X7TA 1IC5L 1RUAH 2L0DA 3RA7L 1EFQA 2RR3A 3GB7B 4G6ML 1EJ6A 5IVZA 5AUMA 1KB9K 5IBTL 3B9VA 3IYLW 4AG4L 1N0LA 1RFDH 5CBEB 3C8DA 1T1WB 2VC2H 3WN5B 5C0AD 2ICEA 1EEZA 2IMMA 4ZTOH 1LEIB 4U1KB 3DXAE 4QTIL 4QCIA 1ZAGA 1QA9A 25C8L 2BP3A 3FFCB 2NXZD 4JE4B 4BQ8A 3JTTB 4PTTA 4WWKC 4G9FA 2DQIH 3HI1A 3JWOL 4YO0B 1N4XL 1OTTD 5JOFA 7FABL 1TZIB 4MA8H 4GW5B 5JNYB 2XTJE 4DKEL 1UACH 3MUZ1 4QOKD 5D1ZB 4ZSOA 2X4NA 3EYSH 4XMKH 5DJAB 5JW5B 1YPZA 2EDTA 1Q0XH 1HXMA 4WUUD 1MWAB 3K2MC 5GGRY 3CC5A 5CJQH 5IESL 2W0KA 3HG1E 2CDGA 2BY1A 4X6DB 15C8H 1GHFL 3QPXL 5IV2A 4YK4B 2MJWA 1TNNA 1EEUA 1WBXB 3CFKA 3MRHA 3LDBB 2NY0D 2P48B 2HKFL 1DLHA 4P2OD 5GGVH 1IGCL 3ARFA 2W60B 1DL7H 4YBQD 1E0OB 1YNTB 5JUEL 4JZJB 1EHAA 3S97C 1XFPA 2AKRB 2AJXL 2X89A 2WWKO 3OKOB 4TUKH 1PVHA 4MQ7B 2CR6A 3PWPD 3HZKA 3BH8B 4RMSA 3LEXA 4PRPD 3MUGB 2RCSL 5IBUG 4J3TA 1INDL 5JIIA 5E8EA 1TVHB 3MRIB 4JY6B 1KT2A 2HT2C 2ESVE 4RIRB 6FABH 1INQB 1NCAL 1I1FA 2H2PD 1LQSR 4HWBL 4JG0H 4M3KB 4PLOB 2YK1H 4XXDB 2X40A 3BDXA 1NFDB 1GGIH 4PP1C 4KZEL 5SX4I 3MODH 2GTWA 1A7QH 2R0KL 5KTEL 4UB0H 5JDSB 5HDQH 4ZNEE 1ZVHA 2QSVA 3D9AH 2DLHA 3RHWK 2FH6A 4AH2B 1T4KA 1JPTL 4OV5B 4HFWA 2G5RA 5CGMA 1VKXA 1A5FL 2I9TB 5L0QC 1NC4B 1IAII 3F7YA 3FO9A 2VKWA 5EDXA 5EA0H 1T7WA 1V05A 3AMKA 1QRKA 5D7JD 5F96L 2IQ9L 1GC1C 2BVUA 1YECL 1EMTL 2CKBB 4LPWA 4IEFB 1O0VA 4MNQD 1JTOA 2DQHH 3V4UL 3QH3B 4LLQA 5DJCA 3KHOA 1Z3GL 5CEZL 1CICA 4U6HB 2P8MA 4Y5VB 2X4TB 1R6VA 5KZCB 5D6DC 1HQRB 3CX5J 4I1NB 4P5KB 5ESQA 4XI5D 3HC3L 1MCNA 1LNUA 3HC4L 4FHBD 2DM3A 1AO7E 4N8VB 4AQOA 2V5TA 4JFOA 43CAB 5BZDB 1RHHB 5C0BB 1OHQA 1QNZH 4YDVB 1TJHL 4FOMA 5DR5L 1KCLA 3TVMC 3MGTB 4LSQL 2E9JA 4CU8A 3FB6A 3S36X 1SBBA 3U4BH 4U1JA 5IB4B 1VEOA 2D7MA 3K4DA 1E6OH 1JGLH 4IMKC 5GRVK 3VFSA 3HE6D 3VGEA 3DETD 5E03A 5IEKA 1EGJH 4TTGA 1DSFH 4NC2B 3F6IA 2HWZH 2P5EE 3QDHA 2BHZA 1G7HB 4PJ7F 1NDGB 3ZHDA 2C1PA 2X1WL 1KPRA 3M1BA 4RGNE 4G8IA 2A74A 1G9MH 4A6YA 3QNXA 3FQRA 4OD1H 3QHTC 3IJSB 5SV3A 1DUZB 1KGCE 3A6CH 4QLRA 3WUWG 3T04D 3ZT5A 4WCYL 3SHSA 3O11A 4EN3C 3HUJF 4YXKL 3W81A 1IFHL 3MV7A 3ARWA 2QSCL 3K81A 1I3VA 1S78D 3ZTJG 5HD8C 1UEMA 4PRNA 2J7LA 4PJBF 4GO6B 3SPVB 4G9DA 4JO2H 1OGTB 3G6DH 3BSZL 4HPYL 5E8NA 4GAGL 5CHNB 4NQCE 3PP4L 4NO0A 2B5IC 3PWUA 5TF1H 3G08A 2EXWC 3QEHA 3U2SA 1S7UB 2DMBA 3BXNA 3TV3H 1TPXB 2VIRA 2FATH 1PG7H 1W0YT 5EZLA 4Y16D 2Y23A 2ILLA 1CLZH 2VISA 4K23L 4ZUTB 1YNKH 2HJKA 1RU9H 1IAIM 4QWWD 4LLYB 3X3FL 4A2MA 1MLBA 3WJJA 3CVHH 2AEPL 3MBXL 1KCUL 4UQ2B 4ZO8A 3UZQA 4K71B 2JCCE 5J06A 5DS8A 1U91B 4U1NA 4OGAC 5BW7A 3QUZA 1DUYB 1MRDH 1RHFA 3V7MA 1T83A 1J1XH 4Z95L 5ICYB 3D69A 1NGYB 3IRPX 35C8L 3ULSA 1PQZB 3RUGE 3ARQA 4YHNB 1OF2B 2HT3D 1M71B 1H5BB 2R9HD 2ENSA 2HH0L 3LH2L 4XB8A 3IFNH 3RPKA 1CGWA 1DR9A 3SDXE 2DTML 1MCSA 2B4CC 4YFDB 2ATKB 4YHOL 3WIFA 4P59H 3REVA 1S9KC 5I1IH 2QQQA 2C3XA 3GDBA 3TM6A 1FL3B 1B6UA 1HHGA 2DI8A 5EBWB 5CLTA 1CDHA 2WQ8A 5H8DA 1U92A 3CFDA 3IKKA 1NEZG 4KTDL 4R7NA 4CVXA 2K3TA 4MJ2A 2Q3AA 5I1HL 4FMFA 1HYSD 4JVPA 1DEEA 4PJGE 5CMAB 2PXYA 4M43H 4MAYC 3S4SA 1HSAB 5TDOB 3WFDL 5DC0A 2CRZA 2VAAB 4N1CA 3HR6A 1MCQA 1NGZA 2GHWB 2YRPA 1C1EL 3N1FC 4MSWA 1S7WB 3EAKA 1IC4H 2BRRH 4WGVB 3IDUA 1OPGH 2IANE 4X7DC 3HLAA 3LB6C 4AT6B 4E0RA 2IBBA 2PKDA 4YIQB 4OGZA 1H15A 3OXSB 4TSBL 5CINH 4H8WH 1KEGH 2C3VA 3MO1B 3QCUL 1DQDL 2AJYH 2OSLB 5CILH 3HZVA 1R3JA 1UKSA 4IS6B 2OZ4L 4XP1L 3T77A 5DMGC 3S9DB 4G5ZL 4F7CB 3FQWA 5FXCH 3TZVC 1CCZA 2Y25A 2CLRB 1W0WB 4K8RC 2ZNWA 4YC2B 2OQJB 2FCBA 5FYKL 3HTLX 3IGAB 2XN9D 4M6MH 3U4AA 3F8UB 5BV7C 3BPCA 4HKBA 3RWHA 2A9NL 5CEXA 3BZ4B 2E9BA 2JB6B 4X4XB 5DK2A 1RJZA 3KLAB 4P9HL 3UBXI 2V5MA 3FJTA 3RTQA 1S5IH 1T5XB 4G6FB 5ISZA 1MCPL 1SMOA 1KBGH 4ACPA 1A8JH 3QDJB 1RUML 3RWGB 4BK5A 3VGGA 5GSRB 5SX4H 1B3JA 2EXYC 3P4NA 2V2TB 2BSSA 2MPAH 3JXAA 5FO8A 1U8HA 3D3VD 1MHHA 4M93C 4PFEA 3C8KB 2XTJD 4YDKH 4IJ3C 5FHBH 1AE6H 3OF6A 4MD0B 2HT4C 1MCLA 4PTTB 1QFWM 4UDTB 2APTA 2P8LB 5DJ2A 2BC4A 1MI5B 4Q2ZA 5DQJA 1NCDH 2YPVH 1DEDA 1JYWA 3HG1D 1FRGL 4EIZC 1FYTB 4LSSL 4M5YL 1SVCP 4QRQB 3O3EB 1UCBH 1PD6A 4GUPA 4HG4J 5J57B 1S9VB 3CLFL 2VXTH 1HQ4B 4BQBA 2ED8A 2GAZA 5C7XH 4HWEH 1A4KA 3CC5B 3ILPB 5CIPH 4PP2B 2GFBB 5T5NG 4ETQB 4L4TA 2NY4D 2YD4A 4UIKL 1ONQB 3O3AB 1CGXA 3E6FB 2YRZA 3TBVB 4PRDA 1A3LL 1KG0B 3IRZA 4XBEH 3UTSE 4H1LG 2R69H 3EIFA 5CD3B 4R96B 2XWJA 1XIWC 3MJ8B 4LLVA 3BVNA 3EOYG 3VRIA 5C0CA 4D0CB 1N2RB 5HI5D 4MA7L 2HFFA 3DRTA 3MRGB 3Q6GH 2ESVD 1JMZA 2C4FT 3WEXB 1ZHBA 4GW1B 5CWSB 2WBJC 1ZEAH 2YRLA 4LVNC 4E9LA 1CF8L 3X3GL 3JZ7A 5A3ID 1KT2B 3QQ4A 1NH6A 1CTNA 3PHQA 3GNML 1OB1A 1FIGL 4LGPB 4P23B 4NRYA 4JPWL 2BNQE 3E2HB 3PWLB 3UJIL 3WLWD 3V4VH 5MHSD 4F7MA 5E5RB 3ULUE 3KLDA 3L6FB 4G80A 3VD5A 1CDYA 5AZ2H 4TRPH 4NQEE 4Z5RB 4WW1A 3CZFB 2WANA 4ELMB 1VERA 4NFBA 5JHDB 2CMRH 3TPKA 4DEPC 4PJ5A 4JFEE 2PN5A 5E2WL 3SOBL 3RVVD 1O5DT 1E4XL 4WU7A 1QACA 4RSVA 2YMXL 2OLDA 3ZL4H 3BE1L 5MP6H 4ETYA 5E1HB 4PJIF 4XAWH 5IIEB 4IOFD 2QKIA 1KELH 4HGKC 2Z8RA 2AAVA 2A73A 2BVPA 5DF0A 4ZUUA 1NMBL 3LVEA 2HG5A 1NGWA 4H88L 2IAMB 5IFAH 1AO7D 4M1DL 5C2BL 5DJDB 1KIQA 3PWJB 3L3KA 3WFEL 3OWEA 3EOBA 1CN4A 5I8EA 1P2CA 5I19H 5F6IC 3QIWD 1G7MA 2MKWA 5IFHH 2VLRE 5EU6A 3IJYB 4PJ7E 1SEQL 4XXCC 4YX2L 4Z0XA 2AV1B 1B90A 4UILL 3P0GB 1H3PH 1FGNL 2DLGA 3BPLC 1BM3H 4D3CH 4A6YL 4PG9A 5F89A 1G9NH 5D1QC 1AQKH 4M6NH 5JPNA 4GXUN 3FB6B 2F53B 4LEOA 2P5ED 4ODUA 4O51A 4U1JB 3BP5A 3HUJE 2HP4A 3PGDB 1DE4A 1T1ZA 4RGND 5DMYA 2F54B 1AHWC 2OP4L 3BMVA 1GOFA 1RUQL 4Y4KA 3QO1B 3EJZC 1OCWH 4JANB 5F71A 3GRWL 5IEKB 1FO0B 2W38A 4O5LH 1KGCD 1YEDA 2CXKA 3FRPG 3H9SE 3HAEB 4CN4A 4ZS6D 5F1IA 3ZMRA 2R56L 5B39B 2P8PB 2ZCLL 3OKDA 1FAIH 5JTWA 5F1NA 4XP4L 1MY7A 4JDTL 3V6BR 3FZUD 5F9WB 4BUGA 3QEQB 3UTTE 3B9KD 1U8MA 1CFBA 4JY5H 1JNLH 3CXDH 1PEWA 3OKMA 2IPTH 5KVGL 4PV8A 1A7RH 5L88H 1UB5A 4HIJA 4NQCD 2E7CA 4KROC 2R1YB 1WTLA 1C5BH 3VXPB 4I0PD 4FXGB 2IH3A 2L4OA 2MKLC 3NTCH 5T3XL 1KTDB 2X9WA 2V6HA 1NC2A 4QHUB 4IDJH 3RWEA 1Z2KA 3QRGL 4ZODA 5KSVB 3LZFL 1IC1A 1X9QA 1R3KB 3WS6A 1BD2A 4NO0B 1Z9SA 3QXAA 3PWUB 3VXSA 3G08B 3G5XB 3IVKB 4PGCB 3VWJA 5KVMC 4M5ZL 5C86A 5FO7A 2HVJB 3TGXA 3ZKQD 1HINH 5IB2B 2X1XR 3CX5K 4CMMA 5H2BA 1HHJB 2EDXA 3BYTA 4JFYB 1N26A 5EG6C 5J7CC 4N5ED 1V3LA 1G7LA 5DQDH 4X6CF 5GS1A 1A7OH 2KKQA 2QHLA 3EO1B 3TIDB 1OW0A 3KJ4B 1NCBL 2DJUA 4HBCH 3SDCC 4XNMA 5ITFA 1CXLA 1QFUL 2YWYA 3FL7A 4HH9A 2FECI 5MEPA 3ELAT 5IF0A 3IDMA 3QJHA 2VLKE 4YE4H 2MCPH 5LXGL 4FQXC 5CBAA 3SDAC 1JPSL 5TH2A 1IGYA 2EIDA 1T5WA 1CFTA 1EEYA 4LGSB 4M48L 5EOTB 4BSVB 4JFDE 5EUKA 3P0YH 2H32A 2I07B 4DK6A 3ZKXC 4YZFF 1JFQH 5L8JB 2ZUYA 1KOAA 5J13C 4HMEA 4X9IA 4J1UB 5BO1H 4FQJL 2E9WA 3PNWA 3F5WA 5HJ3A 4N9GA 2VXUH 3VDCA 2ZKHL 4IMLA 4QT5B 3RVXC 3AROA 3ZDZF 5CJOL 1J8HA 1RD6A 2V7NA 4M02A 1IBGL 2X9YA 4K3JH 1VADB 3FQUA 4LDEB 4X4MA 1AP2A 2NW3A 1UZ6F 4F9PC 2IAND 1LO4H 1IAOB 4MCYA 4H5SA 5IKCB 2G60L 1HCVA 3CSGA 3GSOB 3PF2A 2CGRL 1IL1A 5D2NE 3U1SH 1YUHB 4QYOB 3KXFA 1QD0A 1I9RL 5C08E 2QSTA 1OSZA 3O8XC 1V7NL 4POUB 1OGAB 1MEXL 1IVLA 4P46A 4YHPB 5F9JA 5JW4N 1F4WL 4G42A 2C3VB 3BGMA 3ISWA 4W4OC 3RGVB 4BZ2H 1WWAX 4S10A 5E6IA 2FLRT 4AM0A 1T20B 3KLSA 1R3JB 2V2XB 1JMXA 4Q9BA 3KYOB 3S36L 5IG7A 5CSZA 5K9QG 4PJ9C 4FABH 1P1ZA 3H2WA 1YEEH 4QEGA 3QI9D 3RWDA 5AWNL 1KJ2B 3PP3H 2RAMA 2NXYD 1L7TH 1HZHH 4Z0BH 3SKJL 1T66D 1QPXA 2CUIA 5MEQA 3WL9B 5FA3A 2R39A 1F13A 2Y72A 4XP5H 1AIFA 5DTFB 4R4ND 3C6LA 1UH3A 1S8DA 5D7SH 3MRKB 4XMPH 3JV5A 1CFSA 2AABH 4ZOCA 1X44A 3GBNL 1DN0A 5F9OL 4NM8L 4Q58C 3FONA 1H0DA 5DUPH 5TQ2L 3MLYH 4CVZA 4PGZA 4EQ2A 1CIUA 4HKZA 1MHHB 1ZV5A 3LRHA 4HMCA 2NY1C 1QLRA 3STBA 3W0WE 5CD5C 4J4PC 4PLNC 2ICWB 3H42L 5C0AB 5BVJA 3QG7H 2DQUH 2PW1A 4DN4H 4QRSA 4GG8A 4IRJC 5DRWA 1QPPA 2Q8BL 2NXZB 1HNGA 4R0LC 4BQ6A 4CN1A 1JGVH 1FG9C 1FYHB 3INUH 5JXAL 1TETH 3KS0J 4ZFOB 3H3PH 5HVHB 2GAZB 4R97B 1NCNA 4Q6IB 1RMFL 3BKMH 3RKDC 1MCWM 4PJDA 4QOKB 3MLVL 3VWKD 5I1GH 1WCQA 4AEHH 4HJJL 4NUJB 4D9LL 3WIIH 2A0LC 4WUUB 3TWCH 3X14B 3GZKA 1EAJA 2BFVH 2NNAB 4JFXA 1I3GL 2PTVA 2VXVH 4PLKC 4LSTH 3BVNB 2NY0B 2VDRH 3IDNB 1RIVL 3QZWA 4P2OB 1UWEL 2O5YL 1VGKA 2OL3H 4FQPA 5ACZA 4FQ2H 1HXYA 1QSEA 5B8CA 4ZYKA 2XZCH 1ZHBB 3UP1A 1I1AB 2CUHA 4IOSD 1RQ5A 5BXFB 5I9QC 5IOPA 4GBXA 4OLXL 5E00B 3PWPB 3NIDF 5T5FH 4PY7B 2VERN 1C12B 3EO0A 1DN2A 5T1KD 1A9EB 2F19H 3HMXA 3MLSH 2E7LA 1J1PH 4MZ2A 4NQDE 3MNVA 4UMGA 4FZEL 3NIGF 1JGDB 5L7XH 4PJIE 1UB6A 3I3EA 3QUXA 3KPMA 5IEHA 4NQED 1B4JH 3FMGL 5JO5A 4RNRA 1BIIB 3V0VB 4MB3A 2NR6C 4K94C 1NCWL 2XG5A 3TBYB 4XAKE 3D85D 1RZFH 2APXA 3VXTA 1LO5B 1IEAA 2VZUA 3V52H 4DGVH 3RNQA 4X6FB 1M7IB 5DUBB 3HRZA 1OAXH 1V7ML 4PJEB 2IQAB 2VWEC 5HVGB 5HTSA 3LEVH 3MR9B 3TT1L 4BSWB 1JGEA 2Z35A 1W72B 3WDIA 4HW6A 5DVNA 3H9HB 3CXHJ 1JNNL 1ZA3A 4JFFD 4HT1H 3ALWA 2O5XH 1NAMA 3ZSTA 4DZ8A 2VLRD 2Z31B 4JDVA 2EIBA 5FECA 5D7JB 4HG4K 5F1KC 3U7WH 3LN9A 3QULB 2WINA 3CVIH 1RURL 5A2JH 1Y6KR 3UO1H 4PP1D 4I18A 3QWQB 4P5MA 2B0SH 4L9LB 4OCSH 4XPAL 4JR9H 2DIBA 2HKHL 1CK0H 1G7IB 3ARBC 1TZGH 3RJDA 2P5WA 5E2TH 4GS7C 1MJJB 1JZ5A 3BPOB 3TO2A 4XNXH 3FB8B 1B0GB 2PETA 4ZAKC 2X5PA 4GAYA 2JLLA 2FEEI 4KKNA 2DI7A 3H9SD 3NZHL 1DE4B 3BMWA 4Y5YA 4APQB 1RULH 1CFVH 4YHMH 3TJHD 2P4AB 3OB0K 1NMCB 4ZTPH 1CGTA 4EI5C 4TNVK 1KIPB 3A0OA 3UTTD 1V8HA 3HE6B 3OHXA 3T0VA 4DOHB 2W9DL 4QXUL 3BKYL 2DWDA 2ITCB 4Z76A 2HJFA 2JJSA 4XPHH 1DBAH 5F1NB 1IGMH 1IGTB 1IMHC 4AENA 5ERWA 1ZA6A 1JHKH 2VR5A 2FEDD 2HAZA 4KY1H 4PG2C 4WI3A 3FTGA 5KN5A 4G43B 2Y4SA 1U8MB 4NN6B 2I5YL 1NGQH 2FYYA 3LKSB 2ERJC 3OKMB 4JY4B 5D2LE 1BBDH 2AJ3A 3MRQB 3DTXA 4R4FL 4J8RB 2W0FB 4ONFL 3TVMD 4PV8B 3R8QA 3B9EA 1MCOL 1EO7A 3KPSE 3EW3B 4OZFA 5GRVL 2EDEA 2WBKA 5DMIH 4LCWA 2ORBL 5EB9A 4LIQH 2EE3A 4NKMA 3D2UA 3OKEB 1MHEA 1MFEH 3QNYA 1QFHA 1UJTA 1GGUA 4LL9A 3TBTB 3KYMA 4OM0L 5D70H 3QFDA 3QHFH 2CH8A 3QXAB 3O6ML 1BOGA 4NM4H 5EIVA 2OK0H 1OP5H 3V6OC 4HXAL 5BJTB 5IHUL 3RPIA 5JIHA 4YZFE 4JRWA 4Y16B 1YQ2A 4G7VH 4EN3D 1OTUC 2VLKD 5L2JB 4GXVL 3IAQA 2ZUXA 2DD8L 1S5HA 4XCFL 4E5XA 3GSNA 4EKXA 5HD8D 1MCWW 2LFGA 4JFDD 1ZGLP 1MF2H 3BAEH 5D5MF 5IF0B 4P4RA 8FABB 1RK0A 4MD4B 1BFVL 3R0NA 3QJHB 2HFGH 3SKNA 1FZOA 2QBWA 2MQ3A 3BT2H 3TYGL 5JPMA 1FFOA 1EEYB 3VDBA 4JJ5A 2ADGA 5BOZG 2HYMA 2BSRB 2H32B 4CVWA 2EXWD 5SWSE 5HI4C 1WBYA 3HMWL 3MREB 1Q94B 3RY6A 2P42B 1NBZA 1FPTL 2H3NB 3G6JE 1DVFA 4L8BA 1TJGL 5CJXA 4F15B 4P3WA 5IM7A 5D93C 1UJ3B 3GBML 1MUJB 1BLNA 4TSCL 5T3ZL 4UTAL 3IS1X 4HUVA 4P3CH 4DUXA 2BMKA 1C5DA 5AG8A 1IKNC 5CP3A 5EC1B 5DK3A 2V7NB 2WP3T 1OAQH 3DGCR 3U7YH 4JKPL 4RAVA 2ZSWB 3LS5L 3NFPA 1BAFH 4PJXA 2NLJB 5C08D 4F3FA 3DHMA 1MFAH 4XVTL 3WJLA 1U3HC 4LLUA 3CCHA 5F9AC 1RZGA 2ZCHL 2YA2A 1CE6B 4LHUB 3V5DA 2FLBT 3KXFB 2ZSVA 4CL7A 1XCQA 3BESR 3VH8B 1VESA 4W68A 4W6WB 4X7SL 4XNQB 5ILTL 1F2XK 1F11B 3KHQA 3MRBA 2LU7A 4DN3H 5GQBA 1LDPL 2BJMH 1L9MA 3BGMB 1IGJB 4MWFA 1PG7X 3ARXA 4H25B 5ACLA 4H26B 2FX7H 4JKKA 1YY9C 3G04A 4K9EH 5ELIA 1NBQA 5CEYA 4PGEA 3QUYA 1F3JA 5I66A 3QXVA 3HPJB 1YMME 4JM2A 3GSRB 3H9YA 1TCRB 4LNRB 3LHPL 5L9DL 3CK0L 1MPAL 1N5AA 4OF6A 1KFAL 1U8NA 3VFOA 1D5IH 4PRHE 3TYFA 4R8WL 5I71C 4OF8A 1AIFB 3FCTA 1MFBL 3ZYIA 2DQDH 3KPQB 4R7DB 4JFPB 3REWB 3W0WD 3TESA 4P99A 1X4XA 3IXTB 5HHOA 3LB6D 4X8XA 4PJHF 3T1FA 1H0DB 5C0JA 1A6WL 3FQNA 4CVZB 4S0SD 4NDMA 4WTXA 5LQBH 1BJ8A 2VL5A 3IU3A 2YC1A 4XHQA 1K4DA 5DMGD 4Z7UF 5C0DA 3GO1L 5TDNA 3TZVD 3D3VB 2FX8L 4K8RD 4HWUA 5B3JF 3LKQB 3SCMA 5E2UL 5JORA 1BZ7A 2NW2A 2XTJB 3O0RL 1A3RH 2K7QA 3K80A 4P9ML 2K9UA 1MLCA 3AREC 4DGYH 1J0YA 4S1RH 2ITDA 5CCKH 4P2RE 4M03A 3GGWA 5EU4B 4YHYB 2AJUL 2DL9A 2OTPA 1S9YB 4OT1L 1G7QA 4PJDB 4S1SL 4BQ9A 1K2DA 1E6JL 2V5RA 4HUWA 2IALB 4PTUA 1IQWL 2Y06L 1WZLA 1MJ7L 2R29H 2EDWA 4CADA 4JN1L 4TQEL 4FXLA 1UQSB 1AGEA 1N59B 2EXYD 4HIEB 4IIQB 3I6GB 4HHAA 4Z7QF 2AV7B 2NY4B 5BVPL 4RWYH 1HHKB 3KPPB 5I1LB 3IETA 5I17A 3QA3A 3BGFB 4Z7VA 1L0XA 1VGKB 4BFEA 4NQDD 4UNTA 2HJLA 3ARDB 4TPRL 4YJZL 4GKZA 4W70A 1ZHLB 2FNBA 2Z91A 5IOPB 4GBXB 1QHPA 2CKNA 3UYRL 1HHHA 3ULUH 2DWEB 1PDKA 2ESVB 1DBBL 1F58H 3HRPA 5E99L 4B5EA 1X5YA 4XAKD 1KCVH 1RI8A 1YY8A 3AXLB 5JR1H 3DRQA 3RRQA 4F7EB 5FOJA 1JGUH 3LMJL 2N1KA 1NAML 1S3KL 5T1LD 3AS0A 4R2GC 4NCDA 1F3RB 4LKCB 1HIMH 5F1OB 4PB9H 1KTKE 4GAFB 5LGJB 1EFXD 2A6IB 5E8OB 5EZOL 3SE8L 5E94A 5MENA 1VHPA 4XCNB 5T1DL 1XIWD 5IK3A 4PJFE 3RNQB 2A6KA 5GRJH 4N8VG 5I1AB 3GSXB 3VFMA 1ZHKB 5JW3H 1NMAL 2VDPH 1EGJA 1ACYH 5HVFB 1ZWIB 5D1XC 3W9DA 3TPUA 2DB8A 2WBJD 1C16B 1II4E 4L8CA 3D48R 4AIOA 1T04B 2XZQL 2XKNA 1ODAA 4LNVA 5DK0A 5I1DB 4ORZC 3TO4A 1U0QA 4FG6C 4NNPL 5M95B 4UBDC 3K74B 2LAGB 3CDGA 5E70A 3GI8L 1G1CA 3DLQR 3O9WC 3C08H 1U8OB 4YAQB 3WNLA 4NRZA 1YEFH 1TITA 25C8H 2G2RA 4I5BB 4M7LT 3LEYH 4NNYB 3FQXA 2GSIA 4KQ3L 3RIFF 3QIWB 1K85A 1IC7L 3JWOH 5D9SA 2XNAA 4LLMB 1OL0A 4JEGB 1UENA 1GGBL 1FL6B 4QHNA 4MCZB 3Q5OA 1UGNA 2HA1A 4GAYB 5I1JL 4FA8A 5DFVC 4G8EB 4HWNA 2BNRA 1ZOXA 3M07A 5FGSA 2EO1A 3DUUB 1AFVL 1GHFH 2VWEE 4OLYH 3BWAA 4RAHA 3RWFB 4GQ9H 3ORJA 4FFYL 5DYOB 1LO0H 5FDWA 1YN7A 4RGNB 1EJOH 1T03H 3T2PA 3GJFB 1GIGH 4Y4FD 1ORQB 3CVHA 2R2BB 1MHPH 2DQGL 5DQ9B 1JV5A 3KPSD 3KJ6L 4YUEL 3GFUA 4NO5B 2Y07H 4OZHE 4YBHA 3RDTC 3PWNB 3WDHA 4KVNH 1KPUA 1XGYH 2IEPA 2APVA 4D2NA 1Z0MA 5FYLL 3X13B 2AJ3B 3T0EA 1BMGA 4OFKA 3QO0B 2A6DA 2NCMA 5KG9A 3B9KB 5D1QD 3FAWA 5FK9A 1NCAH 3Q1SH 1ZTXL 3GIZH 4LHJB 4K2UL 4Y2DA 4YBLC 1NBYB 4HWBH 1DDHB 3GSWA 2MSPA 4QGYA 3AC0A 4WV1A 2YPLE 3DX8A 1O7VA 4F2MA 3CXHK 1X7QA 3NACH 4H0GA 4F33B 4KZEH 2BOBA 3EJZD 4I0PB 5ID1B 3PP3K 1T0PB 4K7PX 2NY7L 4R9HA 3DYOA 4J6RH 2QL1A 4U6VH 4QXTB 2P7TA 3PL6C 4HZLB 4L29B 1U8LA 2DLFL 5J1AA 3P3YA 4HS6A 1I9IL 4URTB 4GG6A 1JPTH 2LU4A 1R5IA 4GRMB 4KUCF 5FYJE 2A77H 1A5FH 3B43A 2MMXA 4NJ9L 1BJ1H 1ADQL 2JCCB 2PW2A 3LN5B 5F7EL 3VFUB 4AMKL 3W9EB 1IGIH 4LQ1A 4F7PA 3NVQA 4OZFG 1D5XB 2FJFB 3TP4A 1A21A 1YECH 4OFYD 2J8UE 1QBMH 1QVOB 3DX9B 3EOAA 1Z3GH 3TNNA 2GEEA 3ZYJA 4Z6AT 5SWSD 4YHIB 5B4MD 2FZ3A 2ATPA 4BFGA 2G75B 1HH9B 1KTLB 3VXUA 1JZ3A 3MV9A 4X6EA 4GW4B 2DM2A 4JRXA 5IB3B 4QKXB 3SDXB 3QUKA 2B39A 5GXBB 2DM7A 4OLVH 1RUAL 3A6BH 4LU5L 1AGCA 5C09E 3S35X 1EIBA 1GL4B 1DVFB 1A2YB 1RFDL 4G6KH 1A6ZA 2C4XA 2VC2L 1S7QB 4X0KA 5IM7B 1B0RB 3GJEB 4UU9B 1MCRA 1D9KB 3DV6B 1HWHB 1C5DB 1WIOA 3NA4A 3SDCD 4KKAC 1RUPL 4PJGB 5D7LA 2WP3O 3FO0L 3QQNA 3V9FA 2N7BA 2UWEA 1OWRM 4C4KT 4AQ1B 4KK8C 1RZGB 4F37F 2M26A 4FQXD 3SDAD 2V9QA 5J3HD 3AMLA 1Q0XL 2IANB 5CJQL 5BZWA 1PAMA 4WCYH 5DRXB 3E6HB 5E1AB 3OAYH 3RVTC 1YMHA 15C8L 1WIPA 2YR3A 3GK8H 2Q6WA 1QRNA 1E4XI 1R3HA 1RJYB 4JQXC 3BZEA 1J7VR 4HIHA 2I24N 5LVEA 3RI5K 3SGKC 5AAWA 4L3EA 2ARWA 3G5ZA 2FWOB 3MFGB 5KSAC 2ZWLT 3H7BA 3DVNB 1YMMD 4PJHE 4ODSH 4RGMB 4HSQA 4TUKL 1T7XA 4HPYH 4E42B 4GAGH 5EN2B 4LLWB 2F9BT 4I9WE 1F3JB 2ADIB 1SEBA 2X7LA 4PRHD 3PP4H 5CIPA 1H3WM 1NFKA 5F88B 4Z7UE 4HUMB 3O4OB 4TTDC 3OR6B 2VYRE 5BS0E 2XA8L 4D8PA 5I75C 1N5AB 5FKAA 4L1DA 6FABL 1JNHA 3VFOB 1FFNA 3TYFB 4JFQA 1K5NA 43C9B 4P9HC 1ZLSH 4FZ8L 1MFDL 2AQ2A 4PRPA 2YK1L 2AEPH 1WAAE 2OCFD 3MBXH 3O8XD 1GGIL 5JOEA 3ARSA 3MYJB 3B4NA 4NO3B 3T1FB 3MODL 5K9KB 2WAHA 3O4LE 3FQNB 4C59B 1KYOK 4XC3L 4G6AC 2X70A 4UB0L 5HDQL 1FFQA 4PRIA 5F7YC 1AR1C 4ZOBA 3UX9B 4Z7QE 2VL5B 1K4DB 4ORGB 4W6XB 5I1EH 5L2KA 3MRMB 4YFEA 4P2RD 4WDIA 4BSJA 3JV6A 3ROOA 1LO2H 1FSKC 2D9QB 4NT6A 2Q7YA 2W1NA 3V5KB 3EDJA 2APFA 3ARVA 4I77L 4WRLA 3LH2H 1VFAA 4ZDHB 3LKPA 3HZMB 3ARFC 2DTMH 3KNBA 5C1MB 4RRPA 2VJXA 2ITDB 1ZS8B 2D31A 2R2EA 4YHOH 5ITBL 2DQHL 4LMQI 1BQHA 3C60A 4L4JA 1GGTA 4PS4L 5I6XC 4NQUA 1IQDA 3QXWA 3VWKB 4OQ1A 5HYFA 4NPYB 1EX0A 5JXED 3R0MA 5I17B 5DJ0A 1UYWH 1QNZL 1K4CA 4MNQA 3J7HA 5CD5D 4J4PD 1WFUA 3FQTB 1A6TA 1C1EH 3GHEL 4IRJD 4OZIF 4EZMA 2XWTB 1AKJA 3OAUL 3S3JA 1G6RB 4WWKB 1BVLA 5CZVL 1C8PA 2DRUA 3HNSH 1CVRA 1EGJL 4X6DE 1DSFL 1PY4A 2HWZL 5T1KB 2VLJE 4HK3N 3RKDD 1G7JA 1B0WA 1Z9OA 4OF7A 3KPTA 2VDQH 5M94B 5E5MA 3BD5A 3JV4A 1G9ML 3HE7D 1P7QD 4G5ZH 2A0LD 1MIML 1ZVYA 4NQEB 4OD1L 1L6ZA 1RZIA 2BVEA 3DBXB 5DEGB 3ARUA 4AYFA 1FH5H 4PLKD 2W65B 4NC1E 1OP5K 1CT8A 1MCDA 2LVCA 3D85B 3MRRB 1AGDB 3FO1B 4H1LH 4EUPH 1EDQA 5FKPA 3QIBD 1CICC 5A40E 3MLXL 1YPZF 4UOW1 1AH1A 2YPKB 3W9DB 1OP9A 1YN6A 3PDOA 3DX7A 1SYVA 3KVQA 1F42A 5K9QI 4GLRI 1AD9A 3MGOA 3G6DL 3BEVA 2ZOKB 1E27B 1VFBA 3MV8A 4CU6A 4JFFB 5BOPA 1S7SB 1BZ9B 1SQ2N 3ZYZA 3X11A 4PJ7B 5TF1L 5MI0C 2NR6D 2VTFA 1A6AA 3HAEG 2FATL 4GOSA 1DANU 5B39G 4X98B 3HNTL 4PGDA 1YNKL 1RU9L 2KQNA 2D4DA 2VXQL 4KHTH 1I7TA 5D9SB 1FCGA 3MLZH 1FRGH 3L7FA 4BH8A 2DLIA 3ZSSA 1BZQK 4KPHL 3WFZA 5FM5M 1I8IA 3HUJB 3QYCA 1SBSL 3P9WB 4HD9A 2FO1A 2W0LA 3RZCA 4MDJB 1KLGA 4PRAB 1EXUA 2BZDA 4O2EA 4OD3H 4YXLL 4ISVB 2G5BB 3OV6A 5L0QB 3BJ91 3BWAB 3QISA 1X5JA 4PJBB 4QHKJ 4ZUWA 4KRPC 4C56A 1A3LH 3H9SB 5FDWB 1EHNA 3HC0A 5F3BB 3QR2A 1LK3L 4X6BB 2AJZB 1D5MB 5HHXH 2SEBB 1E4KA 4HZAA 4MA7H 5EUOA 2IH1B 3UPRA 2GK0B 5C0BE 3UTTB 3S88L 2Y7QA 3PXJA 1Z5LA 2EDLA 2CRYA 2DIAA 4P59L 2IFFL 3KYNB 1LK2A 3ARBD 4EDXA 4HX1B 5I1IL 1EH9A 2YPLD 1NGXB 4P57A 1EAPA 4ZOAA 3BN9C 3RL2A 1WBZA 2A6DB 5IMLB 2DS4A 2WBWB 1WFNA 5J4MA 3A6OA 4ZAKD 3GNMH 1NFIB 1FIGH 3UBXA 5IQ7H 4QXWA 4LPYA 2XG4A 3TVMB 1FV1A 3FO2A 3DX8B 1RUKH 5EU5A 1VACB 3UJIH 1BFOA 1U42A 5C0EA 4OLUH 1X7QB 1ZLWK 1UCTA 4M43L 3NPZB 1MQKH 3EYFA 5FYJD 2AXFB 3C2SA 3QEGL 5KBNC 5DJYA 4KK6D 1WWWX 2BRRL 1VPOH 3VRJB 4X99A 5J1AB 2XRAH 2Y5EA 1OPGL 5E2WH 2WWMC 5BW7C 3QUZC 1CXFA 1T83C 2B1HL 5GGSA 3OZ9H 1KEGL 4M61A 4H8WL 3BE1H 1KJ2L 1U3ZA 1SJHB 4F7PB 1JHTA 1FZJA 2Q20A 2GK2A 2HLFC 5CILL 4U1LB 3U0PA 4FQ1H 1NMBH 4H88H 2A83A 2HRPL 3CIQA 4M1DH 4EN3B 3T09A 3TNNB 2P24A 1RZKC 3CSYA 1ZT1B 5HYJE 4HUKB 3S5LB 4GMTL 1TNMA 2ATPB 5C09D 5I15H 4V1DB 2X4PB 3D39A 4YX2H 1Y18A 2BY2A 5HPOA 1P4LB 1KC5H 3BEWB 1FGNH 3TC9A 3OG4B 1HOCB 3MRPA 1KBGL 3U83A 1XF3A 5B38A 5F93C 3O6KH 2B5IB 2NPLX 2MPAL 4MAUH 4HF5L 3ES6A 3CAFA 4MNHB 4OUUA 2C7UB 2PXYC 1X5LA 4X0KB 5FHAL 5TE6H 1V5JA 4OKDA 1OTUD 1DBMH 2VABB 4KDVA 3DUSA 5FHBL 1AGFA 1YYML 1AE6L 3GRWH 2NY5L 5DJ8A 2Z4QA 5D7LB 1IEHA 3DXAA 2J1KA 1NCDL 1YC7A 1TVDA 3EO9L 3HS0A 2ZCLH 4C4KO 1UCBL 3VFNB 4KKCC 2XPGB 2Z8WC 1YEJL 4CAGA 1UG9A 5C2UB 2BOCA 4JDTH 5KVDL 5C08B 4N0YH 2VXTL 5C7XL 3I6LE 1A1MB 2HFEB 4DQOL 4Z7OE 2X4UB 3TCLA 5D7IA 5M7QA 1AGBB 3T0DA 4MD5A 1T1YA 2VLLB 4ZUVA 5HI4D 1Q9OB 2Q6WB 5KVGH 5I8CB 4N0FA 5TDPB 4KKBC 4I9WD 1KXVC 3PABB 2GUOA 4R4BB 3S3PA 3FB5A 5AD0A 5H94A 3VGDA 2GITA 3KPLA 4P4KA 1JZ7A 5DHVH 2HVKB 5BS0D 3RTQC 3MRNB 3OG6B 2DBLL 2EDBA 3Q6GL 4HQQL 5A2FA 1JPFA 1N64L 2BY0A 3VD9A 1SY6L 3FB7B 1JF1A 3QRGH 1SEBB 2X7LB 3O45A 5GS0C 4Z78B 1OLLA 1ZEAL 3AY4A 1U3HD 2BVOB 5FEBA 4HJ0C 3CX2A 4CDGC 3Q3GA 2R4SH 3O4LD 1FNSL 4EVNA 1U8IA 4MAYB 3GMPB 5EZIH 2EDHA 1HWGB 3IJHA 2OL3A 1U36A 1SYSB 4QO1A 2ZPKH 1NCBH 5DDHA 1HDMB 4RZCA 5AZ2L 3W0WB 4TRPL 4U1HA 2IPKA 1FFPB 1A1OB 5JLZB 1WGOA 5FV1L 5DVOA 4B7IA 1RJLA 3KPRA 1KULA 1HHIB 2PCPB 3QWRD 3MFFA 3SBWA 2GJ6E 3ZL4L 5MP6L 3TZVB 4J7RA 1WTGT 4PJ9A 4TNWK 4GLRH 5DA4A 3C5SA 3TBWB 4RX4D 2DQTL 3KGRA 1Q9KB 3QDJE 5J6HA 5BV7B 2W92A 3C60B 3P4OB 5KSUB 1P7KA 4KKLC 3SE3A 1DCLA 1NSNL 5AEAA 4S1QL 4LFHD 2ZKHH 3M17A 4XP6H 3MLRH 1G7PB 3RAJH 5CJOH 5C71A 3PDDA 1IBGH 3D0LB 1EEQA 1H3PL 5T1MB 3BW9A 1DQJB 1OP3H 2QR0B 3ECBA 3MROB 3DMMA 4J3WA 4RMTA 3TBSB 1G9NL 4M93B 1AQKL 4M6NL 4XVJH 3F7VB 5D96C 3GSQB 3T8XB 4EXPX 2VLJD 4IJ3B 1XMWA 1I9RH 2N4IA 4FRWA 4HS8H 5F1SA 5C0NC 4PJIB 4CN6A 3ARED 4OCRH 4U7KA 2GCYB 4U2ZA 3IFPA 4HLJA 4MLIA 1OCWL 5GGSY 4R26H 5DSCA 5IVOA 1KB5B 1XGQA 4HS3A 3L3GB 5CZXD 1S7VA 2AP2A 3FFDB 1FAIL 4C55A 5LAXA 3GSVB 1HK6A 5CJ5A 3WHE1 2YSSB 4L3CB 1MCKA 2CRMA 2YD6A 5F6HI 5T1LB 3MJ7B 1BVKA 3O81A 4JY5L 1JNLL 3N85H 4KMTH 4Z18A 3ZTNH 2GW5A 1EFXB 5JZ7D 5IUSA 2BERA 1XIWB 4U3HA 4X4YB 4JPVH 4OAWB 1CD1A 1FLRH 5HYSA 3EDFA 3GHBH 5J89A 1SYVB 3Q48A 1P6AB 2GTZB 3WD5L 2X1OA 3BO8B 3L5XH 3MGOB 5IBLC 2HN7B 3BEVB 1XZ0B 1DQQA 3GBNH 2WBJB 4X9GA 1OAUH 3O2VL 3L9RA 5F9OH 2YHGA 3BHBB 3CH8A 4NM8H 3WSQH 4LVNB 3BPOC 3NMEA 1TJIH 4O9HL 5J6GA 4R3SA 1HN1A 1ZSDA 4NQCA 1JPGB 5IR1B 4R2GD 2FIKA 1HINL 4ELME 4WTWA 5JHDE 3ESVF 4YHLL 2VQ1A 1U8KA 3C8HA 2HTKD 4Y4KC 1I7TB 5CJ8A 2Q8BH 2UY7A 3V8CA 4MDIB 4N9OB 1A7OL 3BP6A 3BKJH 5ADPH 3MNWB 4IDLA 5JXAH 5F70A 1K6QL 4DEPB 5KZCD 4UV4H 3OJDA 3SQBA 5D1XD 2JK5A 4O2EB 4PREA 5IB5A 4RMWA 1A6UL 1OWWA 2Q3ZA 4QHLB 5BRZD 2O61B 4D9LH 3RBGA 3LPGA 4C56B 4YE4L 3ZE1F 2GT9B 4UQ3A 2JB5L 3GM0A 1FZMA 1FDLL 2VAJA 3BJLA 3CFJB 1KNOB 4FG6D 2DLTA 3P0YL 3O9WD 4KUCD 2JIXB 1JWSB 1F6AB 3ARGA 5CEZD 5HGDB 4HGWB 4OF3A 5CP7B 3RUGA 1JFQL 3AFLA 1A6VL 5E9DA 2AXHA 2JJTA 4MYWB 3DURA 4H20L 3EGSA 3OAYK 5F6IB 4AK1A 5J9PB 1C08A 3S34L 1LK2B 3IFLH 4OLXH 3BFOA 2VXUL 1X5GA 3FN0L 4QXGH 3KPSB 1XH3A 2F53E 3RL2B 4OZGA 4X6CB 3WS6C 3IT8D 2ZUQC 3IF1B 4FZEH 2F54E 3VWJC 3ZDXF 1FZKA 4N90D 2EEDA 1TQBC 4PJCA 4K3JL 2IMNA 5DFVD 3W39A 1I9JH 3FMGH 5D1QB 1QO3B 1NCWH 5GZND 3L3IB 4LVHC 5D5MA 3EYFB 2BX5A 2Y9RT 3B2VH 5GS1C 1YJDH 1I9EA 1AHWB 1FNGB 2ED9A 5DRNA 3F7RA 1OW0C 2KZ1B 1QEWB 4J3XA 3QEQE 4FQHB 1L7IH 3BRGC 2IG2H 1BIHA 1X5XA 3TT1H 4DK3A 4WIQA 1IKFH 3PXHA 1J1OH 3RDTD 3MLWL 4PY8I 2WQRA 2W0PA 5TE7L 2M8XA 1AQDA 5HYJD 1HI6A 3RHWF 4YDJB 3C6SB 2B7DT 3EJJX 4TVPH 4FABL 3UMTA 1W0VB 4FN0A 4DUWA 1AJ7H 2P24B 4Z7NF 3CSYB 2E7BA 4NOFA 3PV6A 1WVZA 3VFPB 4KROB 1HZHL 1T7ZA 1MIEH 4BH7B 4KFZC 2D7QA 3BH9A 3WO3B 4LSRL 1KPVB 4PJ8A 3X12A 1EV2E 3MMEB 1DFBL 1BFTA 1FORL 4U0QB 3PL6D 1K8DA 4MVBC 1Q9LA 2FSEB 5D7SL 4NKDA 3QI9A 4XMPL 4AL8L 1V3KA 2AABL 4XX1E 1HSBB 4EI6A 3VH8G 3HCVA 4JM4H 4NHUA 4UT9H 4OUUB 5DUPL 4HEPG 4I48A 3SKMA 4N0CD 3NZHH 3V6OA 3CFEB 3VCLB 1XGTB 4LPTA 5DURD 3C5ZA 4XHJC 3IU4L 5KS9F 1PSKH 1IEBA 3QDMA 4WU5A 2FD6H 3QG7L 3I6LD 4KZDH 3QJFA 4DVBA 2W9DH 4KAQH 4OLZH 4QXUH 4P46C 1ZKAA 3HS0B 2G9HB 3SDCB 2EE9A 4KTEH 5D6CB 2YEZB 5TQ0H 3CUPA 4WFFE 3INUL 5E6IC 4MS8C 3MRFB 3STZB 3U9UA 1TETL 4LLAA 3H3PL 4M9OA 4CBPA 3G6AA 1W8OA 4YPGB 4Q9CA 2ZG1A 4HWZA 5B38G 1PBYA 3MRJB 4FTVD 4ALAL 3ZKNC 5I1GL 4FQXB 3SDAB 2QQKL 4C83A 3V7AE 1D3CA 2JTDA 1HKLL 2P43B 3C5JA 5EBMB 5FGCB 3TWCL 3D18B 3SDDA 3ZKXB 3WIHL 4Y5XA 2VXVL 5J13B 4LSTL 2DQEH 5GJSH 2GITB 1UM6H 3DGGA 3UTSA 2V9RA 1D7FA 5F7UA 1UC6A 2IBZX 3WNPA 5EU3B 3K2UH 2OL3L 2XQYK 4KK9C 2H9GB 3C6LC 4RFEB 1QSFA 3QQ3B 4KKAD 4HDIA 1YMMB 3IFOA 4LKXB 2QADC 3B8YA 3MNZB 4LBEB 1A14L 3K46A 4K3DL 3O6MH 5T5FL 2EEAA 3TT3L 5FGRA 1IKNA 1JWUB 2OBGA 4PRHB 2F19L 4MB5A 3MLSL 2D0HA 2BNUB 4PRBB 2CIKA 4JAMA 5L7XL 2NY3C 3VE0A 5EZJB 1B4JL 1FG2B 4M8QB 2R1XA 5GJTH 3RVTD 1G84A 3C87A 2BNQA 1KJVA 1RZFL 3QUMB 4J23A 1LO3L 3FRUB 3MJGX 1I7UB 2FJGA 3CDYA 2GJ6D 1U8QB 3O8XB 3V52L 4DGVL 1D5ZA 4NQSA 1RZ8B 5KSAD 1H8OA 1T0NA 4M7KH 1OAXL 2AW2A 4HIIB 1BFVH 2AK1H 2B2XL 1QSZA 3TYGH 3QDJD 3DX6B 5HGHA 5ALCH 3VA2C 1EHLH 4JFEA 3F58L 5I16B 1E28A 1FAKT 4G8FA 4PJ9B 3H3KA 4GRWF 1YEHL 4P2RB 5FYKD 1LP9A 2UZYB 3LY6A 5HHNB 4ODTH 5DMKA 3GKWH 1SVZA 1U95A 2PYEA 5DA0B 5C07A 3CDCA 1R24B 3U7WL 2R2HB 2A6JB 2R23A 1T7VA 5B8CC 2CDFB 3CVIL 3L3JA 5HY9A 5KAQG 1F97A 4GBXC 4UTAH 4RQQB 4U1SB 1ORSA 3IDJA 4OD2B 4R6UA 1P4IL 3MLUL 3I9GH