1A3RL

Fab fragment (antibody 8f5) complexed with peptide from human rhinovirus (serotype 2) viral capsid protein vp2 (residues 156-170)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
220
structure length
220
Chain Sequence
DIVMTQSPSSLTVTTGEKVTMTCKSSQSLLNSRTQKNYLTWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLSISGVQAEDLAVYYCQNNYNYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords IGG2A 8F5 FAB (LIGHT CHAIN)
publication title Crystal structure of a human rhinovirus neutralizing antibody complexed with a peptide derived from viral capsid protein VP2.
pubmed rcsb
total genus 51
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1998-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a3rL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a3rL01
4KRPC 4U6VH 2NY6D 3THML 2FL5A 1EIBA 3E8UL 2CDEA 1DEDA 4PJXB 1ZVSB 3WLBA 5H37G 2GJZB 4L4VE 1MIEH 2VL5A 3SJVB 1JZ7A 5I1DB 4QXWA 3CSGA 2RIKA 4S1RL 1FZMA 3CIQA 5AYUL 5I71B 3FO2B 4FQIL 1BQUA 4PJ8D 3C5SB 2JKXA 1YUHA 2HJLB 1X5AA 3K81A 3L3GA 1XH3A 5FM8A 2A6DB 3LEVH 2EIEA 3QWOA 3D18B 1DBKL 4MVBC 4GAJH 4DVRH 2ZSVA 4LBEB 43C9A 4W81A 1E4XH 1MIMH 3V8OA 2G5RA 5ESVB 4NCC2 4OM0L 2VZ1A 4ESKA 4LNRB 4HIIB 4LPTA 4FN0A 3TBVB 3IFLL 4JM2F 3G6AA 2BJML 2YUXA 2CO6B 2NYYC 3RZCB 1KEGH 4XMPH 4N8VB 4KZEH 5IEHB 3VWJC 4G43A 4H1LB 4NC1E 1VEOA 4U2ZA 3RUGF 4P5MB 1JWMB 3WNLA 3JTTA 4EQ3A 5ANME 2DWEA 5HGAB 5T5FL 2YA0A 1C5BL 2DICA 3BGMA 5FYKL 4Y1AD 3R4DA 1BQSA 5KVDH 3H3PL 5DMJB 1A9BB 2JELL 2IPTH 5JOPD 2QHLA 1T5XA 4G8GB 1II4E 4IIQA 4X5LA 1FNEA 3TBSB 1ZWIA 5LGHH 4X99B 1TVHA 1U93A 1X9QA 2DYPB 4JKPL 1S7WA 4L1HA 3CJJA 5GS2D 4DAGH 3ARFC 3JV6B 3S34L 1AKJA 2AK1L 2H8PB 3J8F7 1XGTB 4WV1C 3P77B 2X4NB 2OK0L 3FQNB 4OT1H 4QOKB 3GNML 5D7KD 2P44B 1BP3B 3CZJA 5GXBB 1KCUH 2DM3A 3BYTA 4G6JH 1RULL 3UTOA 4FFZH 4K3DH 4U1JB 3GI9L 4LRIA 3TVMB 4D0CB 5IKCB 1I1AB 3KNBA 3R0MA 4MNGB 2HA1A 1X5KA 4WW1B 4TNVK 3IGAB 3F7VA 2ZCKH 1VFOA 2CIIB 5I0DA 4HBQA 1G1CA 1D9KD 2BNRA 1INEL 3U7WL 2HT3D 4Q7DA 3MFFB 5L88L 1J5OH 3GHEH 2CMRH 5DEFB 2CDGA 4CU8A 3BGAA 2QEJA 2D0GA 1PEWA 1A21A 4YFLI 2K3TA 1CLCA 1Z9MA 3QULB 1YYLH 4O2EB 3QNXA 2B1AL 3VU2A 4DK3A 5DD0H 4AYFA 5BRZE 1HIML 3UJIH 2ED7A 3PWNB 4XMKH 4UQ3B 5D2NB 2ZG2A 5I75B 1UT9A 3PJSA 2A2QT 1P69B 4PRIE 5EO0B 3R1GL 4H0GA 5HYFA 4DKAA 5GS1C 5ITBH 3DURA 2UVFA 4MQXD 3BO8A 4M48H 3S4SA 3WD5L 3BN9C 2VLKA 3V5KA 5E8DH 1HXMB 4WWKA 1OPGL 3PDGA 4NNYA 35C8L 1HI6A 3C08L 4P59L 5I9QC 4UAOC 3O8XD 5D2LE 3CX5K 5LWYL 4J3OC 5IHBA 5A2LH 1ORQA 1QA9A 1RIHL 4FTVA 1SEBA 2GTZA 2KQNA 4HQQL 1IAKA 4UQ2A 1PSKH 4MB4A 9CGTA 2HMIC 5E7FA 2B5IC 2R15A 1JNHA 5ID1A 2WQ8A 4UBDD 4GJTB 3W11C 4R96B 5E94A 5MEQA 1WFTA 5JORB 1JGUL 4H25B 4YO0A 4BH8A 5HYSG 3DGGA 5CUSL 4XVJL 5I1JL 3VI3E 1YJDL 5HDBE 5B38A 2MPAL 1Q9LA 4IOSD 3IS0X 5FDWB 3HI5L 3ARPA 4LCIL 5E5MA 3P4OB 4WFHE 5IB2A 5JLZA 4KVCH 4NC0B 1L0QA 1A6ZA 4D9LH 1QFPA 2LV4A 2NW2B 3GSOB 4GRLC 3DUSB 2VC2L 3TO4A 2Q86B 1JZ4A 3RNQA 3OX8B 4L4VD 5DC9B 2WNGA 1EV2E 4ZFOA 2B4CC 3OB0H 5JOFB 5DLML 4KKBC 1KBGH 4XVTL 4OCYH 4YGVB 1QFOA 1CK0L 2WM0A 4JHAL 1G6RA 1ADQH 4PTTA 1T4KB 3SY0A 3VFRA 5GGUA 3MRDA 3C5ZC 5IW6A 3C8KA 1JP5A 3I85A 3H7LA 3KHQA 5C7XH 4J3SA 2HFEB 4N90D 4DEPC 1TQCC 1IC1A 1YNTA 5T5NF 5IR1B 4EDXB 5EOCH 2XV6B 5EOTB 3KPRA 1L4IA 4S1DC 1KCLA 5IVZB 1CE1H 1Z0MA 2X1QA 4LARL 5BQ7B 5CEXB 5SX4H 4K3GA 2R69L 3S3JA 2FYYA 1LHZA 3S36X 5FCUH 3VMPA 2DM4A 4NHUA 1Q0YL 4S11A 4ZXBA 5HHQB 3U6RA 1RU9L 2EE3A 2XYCA 1RZJL 4WI4A 4RAUB 5IVXF 3CNKA 3CUPB 4RFEA 3QQ4A 3L3OB 2QQLL 4XPGL 4X6EB 2IMNA 5C0DB 1HHHB 4TSAH 4E5XA 1CGVA 2D7NA 5JUEH 3HN3A 3TT3H 4NUJB 1NMBH 1NCCL 3MUZ1 3HE7B 2ESVA 2VISA 2IADB 3FB6B 3QUZC 3JVGA 4O02H 4XHJD 4F7TA 4KPHL 3WS6A 5CBAB 4LHUB 1BBDL 2PTTB 3PABB 1NGPH 1U8QA 2F15A 2D7TL 3MXVL 1K4DA 3QDJE 5J57B 2QV2A 4XCFL 5FDYA 3JUYA 4M6OL 2D03H 3QXVA 4K9EL 1PFCA 2DQCH 3U79A 2HG5A 4WUUA 5ANMB 3MLWH 3BFOA 3HZMA 4YUEH 4BZ2L 4EN3D 3VXQA 1S8DB 4RFOL 2B4CH 2NY4D 4TUKH 5CP3H 3O9WD 4Y8DC 5GGSY 1G7LB 4IRSA 4IDJH 2IFGA 2FZ3A 3BISA 1EVUA 3SCMC 2PR4H 3HFMH 4LU5H 3Q1SH 1BREA 1UKQA 4WTWA 2WUBL 5FYJU 5TH2B 1QEWB 3LN4B 4P57A 3P73A 1P53A 1CE6B 1JUFA 1T0MB 4LKCB 3TBTB 2VDNL 1N26A 2Q8AL 4XBPA 2GUOB 1CGSH 5FF6A 5DJXA 4JRXE 1PYWA 1K85A 4WFEE 3OKLA 3KS0H 1MF2L 2CKBH 4ONHA 3EOBA 5EBLB 4MD0A 4DGVH 5DJDB 3FO9A 4ORGA 1I75A 1K5NB 4AZ8A 3OF6A 3MQIA 5FIEA 5DJYB 5GJTL 3HLAB 1ITBB 4N8PA 4PRAA 5DEGA 3MRJA 5CJQH 4JG1L 2AAVA 1IGTB 4F7CB 4YZFF 3REVA 4ALAL 3RWDA 3L3KA 1YPZE 2NY1D 4HBCH 4KK9D 2YD5A 1EHLL 1UVQA 3U7YH 5KW9L 3Q5TA 2VXTH 3QZWA 3LV3B 2HP4A 3IRPX 5BRZD 3QFJE 3QIWD 3GMLA 1F4XL 1MFCL 3GSVA 2D7PA 2A9MH 5CINH 1XF5A 2ERJC 4WUKL 4JQVC 5J06A 1RQ5A 4G8IB 4JQIL 3SE4C 3EYUH 5HDQL 1TZIA 1N5AA 3V95A 3T2NH 4U1LB 2ZKHH 1TJGH 4PRID 3TJHD 4UT9H 3DO7A 4NIKB 4YDIL 4QRTA 2DN7A 3IDYB 3FOLA 3WLWD 3PDDA 5BRZB 2ATKB 3LH2L 4X9FA 4L8BA 2V17H 3BW9A 5DJ0B 1SM3L 3ULVE 3OZ9L 4G5ZH 4UDUA 4YDVB 3QUYD 4Z78B 2I9LA 4HF5H 3CU7A 1SJVA 2QQNH 4HGKC 1P7KA 4OIAA 4UT6L 3FRUB 5JXAH 4PJ9C 4N8CH 3D3VA 4ZNEA 3WMSA 3KPQA 3FAWA 3CMOH 3PV6A 3LKOB 1A9EA 5D2LB 4GQ9H 4IBLT 5LXGH 4PJCA 3Q3GB 5DJCA 1UB6A 2W9DL 4OZIF 4CN6A 3AS3A 5KN5B 1S5IH 4RA0C 2VMFA 2W91A 1R3KB 1WT5A 4PLOB 5GRXG 3SDCB 2V5YA 1NCBH 1C5DB 1S7QA 2MKLC 4OV6F 1OTSC 4KKAC 5ACLA 2R0ZH 4U33A 3RWGB 3EHBD 3NFPA 5BW7C 1I4FA 1I9IH 4PJIE 5HGDB 5LVEA 1U91B 2QSTA 4LVOB 4ZPTB 5HI3D 4QHUA 4KRPB 3O3DB 5HHPB 4HV8A 5SX5K 5E99H 4P3DA 3TA3C 1A14H 1IAII 2C4FU 3UZQA 1NPUA 3H9HA 3KPOA 3O41A 5I1IL 2P7TB 1B90A 1MJUL 5A2FA 3REWA 2GITA 3SO3B 4PFEA 1E4WL 5F7DA 5F9OL 4IJ3C 5BV7C 1H9VA 1XIWA 3TIEB 4C83A 4PREA 3BEVA 1WVZA 2MWCA 4IMLA 5T1KA 5MEOA 3VXPB 3QDGA 4HKJB 5ADOH 3MOAL 5IFAL 3PWJA 4M7LL 4OGAD 1LEKB 4NBZB 4LGRB 2F53E 2X89A 1A5FH 4Y2DC 5ID0A 3VWJD 1WZKA 3C60D 2ICEB 2EDQA 1FO0H 1KTLA 3N9GL 4X7SL 2PYFB 5GRJH 4HCRA 1ZXQA 2EEBA 4Q0XL 3V0VA 4K3JL 2ZNXA 5E00A 1DANT 4AK1A 1QSEE 4JO4H 4ZS7L 3OKEB 4NKDA 3DX9B 4YAQB 3MRQA 1HZHL 1UYWL 3VWJB 4AEHL 4JFPA 1EO8H 2VR9A 3KAAA 4ODWA 2GJ6D 1RUQH 4LFHG 4C59B 2E6QA 5J1AB 3T0EA 4JFYA 3RRQA 3W39A 3UTSD 3BQUA 4HS6B 2KQMA 2IH1B 3FB5B 4KHTH 4ZSOA 3G6JE 2Y6SC 4PRBB 2V2WB 5DK2B 1S7XA 2D7MA 4PJGE 3WXVH 4FHBD 1MSPA 3C5JB 4XVUC 3PL6C 2PXYC 4FQCL 3ALXA 3QDJD 3SGDI 1VEMA 4MA7H 3WFHB 4BSWB 4AH2A 3S37X 5E8OA 4N5ED 4JO2H 1SMAA 1XCTB 4PLKC 3T0AA 4XAWL 1GL4B 2DQHH 4N1HB 5ADPH 4J12A 1F4WL 4WU7A 1GOHA 1KTDA 4LF3B 5BV7H 1KCRH 2L7UA 3ARFB 5TE6L 3UZVB 2RCSL 2OX5A 5ENWB 3QDJB 4PJ7A 1P1ZB 5T33L 4G3YL 3CDFA 4WV1B 5GGRY 4M93C 4XTRC 4HIEA 2V9QA 3ARBD 4N9GB 3BIBX 4JFHE 3RVWD 1X6NA 3PE9A 5HHNA 1SBSL 3U36A 1P4LB 1J1OH 3B3IB 3Q5YA 2AXFA 3RY4A 5DUBB 5T1MB 1OP3K 3VFUB 4MMZC 5K9QG 4U6VL 5EZJA 3QR2A 4JRXD 4NN6C 4WFED 4NOBA 1YEIH 3OBAA 4XT1C 4ORZC 4M4RA 3F5WA 4OCSL 4EI6A 5EU7C 3QEHA 4JRYA 1MIEL 4XPBL 1PKQE 2JTDA 2GSGB 4GLRI 3IDUA 2DWDA 4LIQE 4HD9A 1D6EB 1T03H 3O45A 4ONOA 3TP4A 5DO2D 5I1KL 3BRDA 4JRXB 1FIEA 2AGJH 5IEKB 1NKOA 3HZKA 1UJ3C 1JF1B 4XPAH 2JF1A 4J4PA 3LEVL 4NJAH 2AXGB 5FA3B 4ZFGL 1JGLH 5L8KB 1QHPA 5L2KE 1XMWA 4YFEA 3QFJD 5EUKA 4GAJL 4S10A 3L3JA 1KXQE 4MHHG 3HI6L 4OGXH 3UPAA 3WS3A 4CDGC 5A2KH 4QRSB 4K8RC 5K9JL 4WW2A 2J5LB 3RDTD 1I1FB 2C3VA 1JN6A 1Z9OA 4OCXL 3I02A 4XNXH 1KEGL 4NQEB 2JCCF 2EKJA 2EYTA 3K74B 5JA8B 1U95B 5I9QB 5HY9B 3STLB 3ULVD 4GKOA 4AQOA 5C0CA 1X6LA 3QHTC 1YYML 4JVUA 4ZQKB 2X40A 4XCNA 2IPKA 1U92B 1X7QB 5ICYA 1NFIB 5HHME 2CGRH 4U05A 3V8CA 2EH8H 2B5IB 5CD5C 1WZMA 4UB0H 3B2VL 3MNVA 5JO5A 2I07A 2D7QA 1CXIA 1CL7I 4NT6A 3CPLB 3SDXB 1Z2KA 4MB5A 1LEGB 4LSPH 5DYOA 4IHOA 4HWEH 4OJFL 1V3LA 3UTPE 5MI0B 1JPSH 5DJ6B 4NQXB 2VAAA 5IJVB 1LE9B 3VFPB 3NZ8A 4W6WB 5FOBA 1FDLH 4DAGL 2YXMA 5D6DC 3QQ3B 5KG9B 1UZ6F 3UYPA 5IMMA 3D85A 2X5PA 4PJHF 3WUWA 4FXKA 4OT1L 1X5IA 1RFDL 4Z7WE 1HHKA 5K9KA 2VERN 5DJZA 4GRLB 3PQYE 3WHXB 2YXFA 5HD8D 2UY6A 4K3DL 1V3KA 1I9EA 4LRNH 4NNXB 2DTMH 4XC3L 2HKHL 5BOZG 1RJLA 1HKFA 3LKSB 4K8RH 3QIBA 4S1DD 3VRJA 2ZCKL 4C56E 2VDKL 3HAEA 1KCSL 2YEZB 4P4KD 5EOQH 1RHHA 5KBNC 2ORBH 2UZYB 3C5ZB 3K3QA 2XTJC 4P5TD 2CUIA 3SKOA 3KJ6L 3P9MB 4DEPB 4H5SB 1J5OL 3RJQB 2OZ4L 3GHEL 2X6MA 3OKOA 3S5LA 2F53D 3UX9B 2J12B 4KQ3L 5IMOB 1YMMA 3WFZA 2QR0B 2YK1H 1MQKH 4YH6A 4P4KB 4H0HB 4HG4J 1MWAB 3K2MC 4ETQA 1OW0A 2CKBB 3GBML 2GJJA 4XCCH 5E56A 3AS2A 5C0BA 2QSQA 4FQLH 3UJIL 1QSED 3H7BB 4XMKL 5M94B 1SJHB 2F53B 4KJPC 4Z7UF 3MACH 1YEGH 3HZYA 2BVYA 4CGTA 3PWPA 1J88A 2X4TB 5H94B 2VLLB 3RVUC 5ITBL 3BPCB 4KJYB 4M48L 3HMWH 5E1AB 1CD1B 4JKLA 5E8DL 2FBJH 1E6JL 3QUZB 1D6VL 4LK4A 1KC5L 3S8WA 1FZKA 1TVBB 4MB3A 3V0AC 5E8PA 1JZ5A 2H1PL 2NY2C 3KR3H 1WFNA 3E3QC 2W0FB 1OARH 4R0LC 3L7EB 3L5XH 4QRQB 3OKDB 5HHOB 5FUCC 3EZJB 5LGKA 1LEIB 4F57L 2JE8A 2W9EL 5CP7A 4FQQA 4E41E 1KB9J 2BOBB 3JXAA 3V4VH 5IHZA 5ACZA 3MJ9A 4M5YH 3BVNB 2XOTA 3V5DA 3HNTL 5JDSA 4PJGB 3VFSB 4GW1A 1JHTA 2LFGA 4KDVA 3LQZB 3X14A 1R6VA 3O4OC 4HUNB 3SCMB 1XCQA 2BRRL 4XCEB 4YHPB 1EXUA 3V5HB 2QBWA 4HIHB 5DHVB 3EYVB 2W9LA 4EUPG 1OT1A 5EU7E 5C0AA 3H9ZA 1NKRA 3IJSA 4XX1E 1WZ1H 4U1IB 4ERSH 1FIGL 4UIKL 3MRPA 1XR8A 1MRDH 4OLEA 2WIIB 4DUVA 4KVCL 3PDOB 1KELH 2Q6WA 2PO6A 5EU5A 4D9LL 4LQFL 3D39E 4EIZC 5KSBE 4HJGB 5FUZH 2OL3H 4NO0A 3TO4D 4P2OA 4PRHA 5IM7B 1AO7A 3ZL4H 1A6AA 1HH6A 1MCOH 1PY4A 5EUOA 2X09A 5A2JH 3VD5A 1W72H 2HVKA 2JJSC 4HX1A 4Q6IC 2J8UA 1KN2H 1N4XL 2AKRA 3TIDA 3DUUA 5HSFA 2WMPA 3GGWB 3OJ2C 3LB6C 1WBXB 4R6UA 2IAMC 1EMTL 4GG6A 3O3AA 2DBLH 3F7YA 2H9GA 5C7XL 4YXLH 1J12A 1UXWA 4X4YA 4BQCA 1PKQB 2AK4A 4JQXC 3P9LA 3S96B 1LQSR 3HI1A 3WE6A 3JV4A 2R0LL 5CILH 5EB9A 2ERJB 1D5MB 2NTFB 2VTFA 4DKDC 2F5AL 3MLRL 5C0FB 3DX7A 4V2BA 1BVZA 3SN6N 5EO1A 1AR1D 4PJXF 2W65A 5D7IF 5EBMA 3UEZA 1YN6A 5L2KB 4M5ZH 3T09A 1SYSB 4HAFA 4Z9KB 1MCKA 1LDPH 1N2RB 1P2CA 5D7LE 5HPMA 2AJZB 1N64H 1EJ6A 3EO0A 4TSAL 5HHXL 2RB8A 5JUEL 3VG0H 2KKQA 3TT3L 3GMRB 3JV0A 2ZUVA 4GOSA 4O2CB 4LCUB 4FQ2H 1FO0B 2ESVD 3O4LA 4N0FA 2OTUB 4X6FB 1EFXD 3FQXA 4KKAD 3CDGA 4UIMB 4PJ9B 3K8KA 1JZ8A 1KENL 4DVBA 4QO1A 4LLVA 1K8IB 2R9HC 1FFNA 1KN4L 4LP5A 2Z92B 3BGFC 3CC5B 2X44D 4RBPH 4HKXB 4NZUH 3B43A 5CHNB 2J8OA 4JN2B 3FT4A 3J7HA 2XWBB 2D03L 5AG9A 5HBBA 2FX9L 1YEDB 1MFBH 2WBJA 3TZVD 3MLWL 3UTPD 3BKJH 1GJIA 5B38G 1DBBH 4WEBL 5HHMB 4MJ2A 2B4CL 1IGIL 3MRCB 4TUKL 5DVLA 3GMPB 2B1HH 2PKDA 4P4RA 3B2UD 4FXGB 2B7DT 4Y5YC 4JM4H 3KLHD 1FLRH 5J6GA 3VFGL 1CFNB 1C16B 3O0RH 4KKCD 3TA3B 1WTGT 1YNLH 3TZVB 4DCQA 4G6MH 5INDB 1XGUA 2UWEE 1FYHB 1A6UL 3MRFB 3UTZB 1AXSA 1MAML 1KB5A 4KK8D 4PJDA 4XP4H 3BUTA 2CLZA 4Q2ZB 1WF5A 4R3SB 5DJ2B 3PNWB 1MWAL 1OAXL 2VR4A 5BV7B 1YN7B 4GMTL 2CKBL 3MJGX 3HZVA 3NAAH 1GZQA 3VMNA 3WNKA 2QKIB 2EZ0C 3P3YA 3MBEA 5AZ2L 1DSFL 1IZKA 3PQYB 4I9WD 4Q74A 3MZTA 3RI5F 2AJVH 5C9JA 1VFAB 4IRJC 3CXHK 3N0PB 2R23A 1G0XA 3P0VH 5D1XC 5AEAA 3U30B 5L6YL 2R1YA 4C56B 4NFCA 2Q76A 2EC9U 4RWHA 2OJEA 3U7YL 2VXTL 1CDCA 1DQDH 3VFWB 5SWSB 1ZE3C 5BJTB 1OTTD 1VA9A 3DVIA 3ZE0E 4XH2A 2YA1A 1IFHH 3E3QE 3OXSA 2AP2A 1NDMB 5FUCE 2ZKHL 5T3ZD 1TJGL 5TDOB 4S1QL 1CIUA 5K59F 3BZEA 3OXRA 5F89A 4JJ5B 4PLKD 5L7XH 4LVEA 4KK6D 2QTEA 5C08E 2YMXH 3ESUF 4G5ZL 4KGLA 3PL6B 2PXYB 4NBXB 2D31A 4HF5L 3VXSD 5F8RC 2F19L 1RZIA 3KYMA 1U8IA 2QQNL 1I9RH 3NH7H 2YSSB 3NN8B 4AIZB 4E41D 2AJYL 4UZGA 2A6JA 5IF0A 4P2RE 2BOCA 3RP1A 4R4ND 1D5XA 5CIPB 5C86A 1F13A 4JAMA 5DRXA 5FOJA 1AGDA 5HI5C 3FN0H 1HINH 3UAJD 3MV8A 3KGRA 4GXUM 3ARDC 1T83A 4GG8B 5IT2H 1J8HA 3IU4H 1KV3A 3I3DA 3FONB 4CW1B 3GO1H 1FVDB 1L7TL 4P23A 4WNQB 1NCBL 4E41B 2CRMA 2W07A 4M93B 4RRPA 5IQ9A 4NJ9H 4J7RA 2CRZA 2XI9A 3BT2H 2FJFB 5DJAA 3WJLC 1JK8B 3T8XB 2YR3A 3LN5A 4UOW1 1U8KB 3FO0H 4RX4D 3FQRA 3D0LA 3QWRD 3L95A 3QXDB 3SDDA 3BP7B 1FL5B 4KMTL 5I18H 2FDBP 5B39G 4NN6B 1BFSA 1A14L 1BAFL 3VXMA 4PJFE 4AL8L 4I0KA 2EYRA 3DETC 4LIQL 2R2HA 4Q9RH 4PJEA 3KDMA 3M45A 3HUJE 5DK0A 2DQFB 2JJTC 4C4KO 5IFJA 3T1FA 1NCAH 4TULH 5E6IC 1BZ9A 3T0VA 1AGCB 1JYVA 3QDME 4JPIA 5DHYB 2GEEA 3QUMH 1UJ3B 3D39B 5KSBB 4NKMB 3UP1A 5ADOL 2FEDC 4QNPF 3ME0A 3GBNH 3IB4A 7FABH 2ZUSA 1FSKC 1RZGB 2R1XA 4LSTH 1U42A 5GGVH 4EDWL 1TTFA 3ARED 3IDNA 1RVFL 4I8DA 1FO0L 5GRJL 2NXYD 1RK0B 4FFWC 1LNUA 1S9YB 4FFYH 5HI4C 1RZ8A 1YY8A 2EDFA 3FZUD 4BQ6A 3UBXI 1AQDA 4LLWB 4G6FB 4BZ1H 1XF4A 3LCYA 5AD0B 1A3RL 2DLHA 2VDLH 3RTQD 3GRWA 2RJMA 5DA0B 1I7UA 3CVHB 4JM2A 4NZJA 4PP2A 1J0JA 5SWZA 4MAUL 5D7LD 4WY7H 2PTUA 3RVTC 5E4EB 4PG9A 3RUGA 1T1ZB 4OZGB 5FA4B 1LD9A 4YHML 1O7VA 4J3XA 4U1NA 5JXED 1A6PA 4IOFD 1B2WH 4MCYB 5TE4H 3O6FA 3LS5L 2AEPH 3MRKB 1FP5A 5HYJE 3BEWA 4JVPA 2PN5A 2HVJA 1MCDA 1JPTL 2BVOB 2FJGB 3HC0B 3JWDC 3AMKA 3U82B 4XX1G 2B2XL 4RA3A 3KPNA 3ARTA 5BV7L 4J8RB 2CUHA 4NQUA 3KYNB 4S2SB 3TC9A 2EDOA 4X9IA 2EH7H 4KI5D 1QKZL 4OF7A 1PX3A 5F9DC 1OM3L 3QPQD 1XGPB 4XMLH 4LASL 4Q9CA 2Q3ZA 4HXBL 1J1OL 4P2QE 4OFVA 5KSAD 2VLJA 5JOEA 1NC4B 2NW3A 5DZOA 3F12B 3ZKNC 4XNUL 2NLJA 1YEIL 3DV4A 4EVNA 3T0WA 3U1SH 3HG1A 3H3BC 2VXUH 2ZSWA 5CJBA 5IIEA 2XTJB 3IAGC 1LMKA 5E5UB 4R4BA 4EKXA 1Q9OB 5EC1A 5F9AC 1T03L 2NY5H 1NC2D 1MFDH 2AGJL 2BNQE 5CLWA 4X6BA 1QRNE 2MFNA 4XPAL 4J4PD 3FO1A 4XNYH 4R2GD 3E6HA 2BFVH 2R4SL 4NJAL 4QRPE 5GGTA 2WK2A 1JGLL 2ZPKH 4TQEL 3QH3A 5FYLH 4HHAA 5F7EH 3B9KA 1NC2B 3GJEB 4F7EA 1W72B 1UG9A 3ALPA 1U58B 1CU4H 1KOAA 3JWDH 5J0BA 4LDLB 1MJ8H 2HLFD 1QVOB 5KTEH 4ZO7A 4R2GB 4IIQC 4C58B 2CLRA 1YMHA 2NY0C 2OP4H 2QHRL 4YNYA 4XNXL 5AAMA 4YHLH 1N6UA 3TESA 4OQ1A 2IG2H 3WFBL 1QR1A 1DEEA 2DKSA 5E2TH 2K9UA 1MEXH 2CDFA 4ENEC 4R0LB 1FN4A 1G0YR 4LHJB 1CFBA 1IT9H 4G8EB 4ISVA 1IAMA 4OLZH 3Q6GL 3DV6A 5F8QC 1ZV5A 1TJHH 2EH8L 4XNMB 4HS8H 4M61B 4UB0L 3UPCA 3PWUA 1HH9B 5C08B 1MCJA 3VXNB 3BAEH 2DQTH 1H15A 5I1LB 1JWSB 3O4OB 5F70A 5HXMA 1S78C 2R2BB 5JMOC 4HWEL 4JZOB 1WISA 1ZTXH 1JPSL 1C7SA 1LE5A 4P2RB 1TNMA 4BK5A 3RWEB 3W0WE 5DA4A 4I18C 3IF1B 3KPMA 3AM8A 4YPGA 2ZUQC 4JHWH 2C4FT 2ITCB 1LO5A 3FMGH 2AV7B 4FFVC 3BHBB 5C2BH 2VAJA 3V4PH 3LEYH 5FYKU 4F80A 1O7SA 1G7HA 2IBZY 2IAMD 1ZOXA 4Z7QE 1RI8A 4LRNL 1C7TA 1NFDE 2HRPH 2FSEA 3B8YA 3MYJA 2X1WL 5EU3A 3FB7B 3ZTJG 4RDQG 4Q6IB 5D2LF 3LRGA 43CAA 1JGDA 3DX6B 2XKNB 3QDMD 3TNNB 2D0FA 5F1OB 3UYOD 4L3ED 1D7FA 3VRIA 1QSVA 5FKAA 4ZFFA 2ORBL 4NQDB 3VXOB 5LAXA 2IAMB 5DUPL 3CVHL 1T1XA 1NEZA 4PJFB 4X9BA 2NR6C 3OSKA 4WWKC 4CVZA 3AS0A 3IKKA 1U8LB 1YMMD 1DDHA 3I6KA 3RWFA 4EZMA 5IBLC 2XN9A 1MQKL 2OSLB 3IFPB 4I48B 1FZOA 5FCSH 3RGVA 5BS0E 3EDDA 3IDIB 4D9QD 4XNQB 2MMXA 1WC7A 3KXFE 2ITDB 1RJZB 3O2VL 4NSKB 1RUPH 1YEKH 1EZVX 1EDQA 4Y4HD 5IHUL 4KRMB 3VI3F 5HDBF 2ZOKB 4HUWA 2VLRA 3MACL 1VENA 2GSIA 4DUXA 5FYLE 3L3HB 5IVXA 1RAMA 2V7NA 2H6PB 2X4PA 2ADGA 4M62L 3UTQB 4X6DA 4L9LC 4U6XB 4G6AC 1Y18A 2FBJL 5AWNH 2XQYK 1DVFC 5AUMB 3VG9C 3HPLA 3UBXA 4HUKB 4EXKA 3UTTB 4LCWE 2WINA 3MGOB 4RMTA 3LS4L 3BGFB 3MUGA 3KR3L 3DUHA 3HCVB 1Z3GL 3VWKD 3ALWA 1B0RA 5HYJD 1OY3B 5D93C 4Q9BA 1T1WA 1KJ2A 3R0NA 3V4VL 5D1QD 1CTOA 3QPXH 4DTGL 2YPLE 3MRRB 1BVLA 4ZPVA 1P4IL 1RD6A 3IXAB 1T66D 4ZO6A 25C8L 3N1MC 1R5WB 5E4IA 4OQTA 3TYGH 4LL9A 3ZLQC 2CPCA 4YHNA 4X0KA 1WQVT 2XFXA 5D9SB 2A73A 4Z95H 5HYJB 3SOBL 1DN0A 4Y5YB 5E8NB 1KJMA 5D1QB 1U8PA 1NAKH 1X4ZA 5E2WH 5C0AD 2FRGP 4G7VH 3DNKA 1F8TH 4G80B 2OYPA 1F3DJ 4Z76B 4OF6A 1JYWA 4Y16A 5DMIH 1NGQL 1WZ1L 4ZD3H 1RZ7H 3BXNA 4ERSL 1A3LH 5I16B 3C9NB 1MRDL 1MLCA 3VJ6A 2I9TA 1F97A 1UM5L 5D1XD 3HAEG 3QJHB 1KELL 5J13C 3LKRA 5E24E 4X98A 1XGYH 4ODXA 1VFBA 4W4NA 1PZ5A 3MUHL 4OZ4A 4LSVL 3RKDC 4ZXBC 1MCOL 3MLTA 5F7FA 2AJUL 3U0PB 4YHZH 3CFCH 5TGBA 3OB0K 4P2QB 3GHBH 2SEBB 3GSQB 1HHGB 3O2DL 4QHNB 5D1XB 3RWCA 1QSFE 3SKMA 3CFJA 5HDLA 1BVKB 2EE6A 4PPTA 2DQDH 5D70H 2KZ1B 4Y7MA 5DI8A 5FYJD 2P24A 1GGCL 4OBRA 1I1RA 2DBLL 3LAFA 1VPOL 2OMBA 4KKNA 1QPXA 2O5YH 4BFIB 4RQQA 2O5ZH 4G9DB 4BH7A 1UQSA 3O6KH 5DRZB 1CYGA 2P48B 4ZOBA 5CEZE 3WS6C 4OFIA 1KYOJ 5CILL 1W0YT 1VGEH 3U4EB 3KYKL 4PR5A 3PGFH 1PVHA 2BNQB 1QRNB 4Q6YA 5IW3A 1DQLH 4DN3H 2GW5A 1AGBB 3CDCA 5CMAA 1A1NB 1AGFB 3NIFF 3L5HA 3QUMB 4QRPB 4JFDA 4Y19A 3P0YL 3SGKA 3L7FA 2VITA 2X05A 3MCKA 3MRMA 1CTNA 3MV7E 3S98A 1IARB 1RJYA 5D1ZA 3S35L 4JFEB 4IRSC 5GRUL 1G6RH 1N64L 3GBLA 3VG0L 1R5IA 3RL2B 2BVPB 2QSCH 3MV9A 2DJUA 2ICWB 4LSSL 2H2SC 5MEPB 3WIHA 2IH3A 3D2UA 5GIRA 1MFNA 2O61B 3B9DA 3B6SA 2J2ZA 1NGZA 5JPNA 4WTZG 4YBLC 2DLTA 3ARDB 3SDAD 4NZUL 5FAAA 1IAIM 2B0SL 1I85C 4HWZB 2E7BA 3OG4B 4HWBA 2HN7B 1PAMA 1YPZF 1OP5H 2VKXA 3BKJL 4OV5B 3DYOA 1DBBL 1M7DB 4D0BB 4QRUA 4QY8A 3WFCL 5HVHC 4Y4FA 4YX2H 5GZNC 4YE4H 2OQJB 3KWWA 3T77A 1A4JB 4CVXB 5GSRA 1KEMH 3S88H 3QNYA 3SDAB 2JIXA 5EZIH 4PY7A 1XZ0A 3OV6A 3QUXA 4AM0B 3IFOB 5KS9A 5BVPH 1I8MA 4JM4L 1FLRL 4HZLB 3UCRA 3O0RL 1V7NH 3RA7L 1A1OB 4G6ML 1FL3A 3RPIB 1T20B 3FQTA 2FEDD 2FNBA 3W0WB 4C54A 1NGYB 4JFZH 1ZT4A 2VIRB 2VLKE 1T21B 1C08B 1CR9L 3QXUA 5JW3L 4PBVC 4WEUD 1F58H 1FVCB 5IVOA 3ULVF 3EO1A 5E6IB 5MHSE 1FC1A 5IMLB 3FT3A 1AIFA 3QG6A 5HPOA 3NAAL 3QIUA 2R39A 1SY6A 5BMFH 3MYZA 3ILPA 1KNOB 5F96H 1F42A 3LHPL 4XPHL 4L8SA 3TFKD 4HPOH 4M6AA 1LO2L 3DIFB 3OHXA 3X13A 5F3BB 5CSZB 5EG6C 4XI5D 2G75A 3L1OL 1C1EH 1QFUL 4Z0BH 3E6FB 3FFCE 4QGTA 4CKVX 1J1PH 1HYSD 1HNFA 4X5XB 4G9FA 3SKUD 3O3BB 1EGJA 3I75B 5BS0D 1QLRA 1KPVA 2ADIA 2EXWD 5F88A 4BK4A 3A6BL 1M05A 2HT4C 4IEFB 1T2QL 4FP8H 2I26N 4NYLB 3TYFB 5T1DH 4RWYL 2R0KH 1IFHL 3K46A 3NZHH 4L8DA 4RMSA 4RISH 3ZKMC 4KUZL 3ECBA 3V4UH 1MFEH 4HC1L 4L4TA 1SJEA 1Q9KA 5DMGC 2Y9RT 3KXFB 3CFDA 1MI5B 3RX5A 3ETBF 1CG9A 3BIKA 5L7XL 2CJUH 1U2CA 3CFBB 4RMRA 1CBVH 5EPMB 2YMXL 4B53A 4LCWD 1HXYB 2FO4A 4P9HC 2NX5E 3HMXL 1OP9A 1G7QB 3WFEL 3UC0H 1I9RL 4V1DA 1Y6KR 4PP1D 3QT2A 2FL5B 4MXQC 1I1YB 3OL2A 4U1MB 2CDEB 2YPLD 2P5WA 3IKCA 1YECH 2EDKA 3WLBB 3MROA 5ALBH 1G6VK 1KPRA 2NZ9C 3BP5B 1Q1JL 4L1DA 1J8HD 5I17B 4U6YB 1PKOA 2E9JA 3MRGA 1FZMB 5T3ZH 2H3NA 2XQBL 5HHVH 4PGBA 1XIWC 1I3VA 5C3TA 4BQBA 5B3JE 4NJ9L 2YPLB 4GKZB 3BT2L 2V5SA 1XH3B 1IEBA 3QXAB 2C7UA 3DJ9A 3G5XB 3PGDB 4DGIL 5CJXA 4WO4A 4LEOA 2ZSVB 3GSUA 2AV1A 4DWHA 5I18L 4MCZA 3T04D 3C8HA 5C1MB 1OOAA 4OSUH 3PIQB 1BX2A 1X5JA 1LK3L 1QBLH 4YWGL 4UT7H 1TLKA 5BZWB 2OMNA 3MLUL 1I7ZB 4D9RE 4Q9RL 3G6JF 4QHMA 4OI9A 3G6AB 4ELME 4Z77A 4PJGF 2UUDH 2XACC 4F2MA 1NCAL 1F2QA 3MRNA 1WEJH 1OAYH 3WHE1 3LDBC 2KL6A 3QUML 3JTTB 3TGXA 1FYTA 3T0EC 4NN7C 3GBNL 1ZHBB 7FABL 3MMEB 4MSWA 4FMKA 1I3RA 2DWEB 3BQUC 1S9VB 4P9HH 5EH1A 1Q94B 3OKKB 1UACL 4I77L 4LSTL 3ES6A 5CEZD 5GGVL 4JY6B 1D5ZA 1OSPH 4AQ1B 3D9AL 5E8EA 3QCVH 1QSFB 2FB4H 3G5YA 3D69A 2J8HA 4FFYL 5IK3A 1KPUB 1T5XB 2ZUYA 3X11A 3TNMB 4IIQB 1TXKA 1ZA6B 3LIZH 4BZ1L 4GRWH 1R0AL 2W0LA 1ZWIB 1CICA 2VDLL 4FQXD 3W2DH 1TVHB 5KOMC 1HEZA 1T80A 1S7WB 4UOJA 2OTPA 4CNIA 4HXAH 4WY7L 1NLBH 2IMMA 5JR1L 4LNVA 5ISZD 5DRNB 3FT2A 4I3RH 1WIPA 1ZEAH 4P46A 5DFVC 1FNFA 4BM7A 1E28A 1FV1A 4LMQI 3MV7B 32C2A 5IWLA 4GQPH 4PB0H 2LE9A 5J11C 2CUMA 4HCRH 3PP4H 3ARUA 4MZ3A 1X44A 2Z4QA 2BNRB 2ENSA 2HKFH 4O51B 1U8NA 1UEYA 1OAZL 5GZOD 4U7SA 4I18B 2UYLA 2ZUQB 4FNLH 3CGTA 1UGNA 3QSKB 1FG2B 1FNHA 1AD9B 3CH1A 5JHDA 4MZ2A 3B83A 4PJHA 4MJIA 4HUVB 3QNXB 4KDTA 2OM5A 3T2OA 1T7WA 2AI0L 3OB8A 1ACZA 4MAYC 2KDGA 2FR4A 4DFIA 2HFFA 1GSMA 3HE6A 4POYA 5MHSD 4MNQE 2LAAA 4PRPA 3CFKA 5C09A 5BCAA 12E8H 2NNAB 4O9HL 4WW2C 3U1SL 5DMYA 2CLVA 1LWRA 1URLA 5FHAL 4XRCB 1X5FA 3B8SA 4ZUSA 5L9DH 3BO8B 2C1PA 4PS4L 1DLHA 1IGJA 2EC9T 3B5HA 3S4SB 5IB1A 2VLKB 2X4SB 5A1AA 4WWKB 1HI6B 1S3KH 5C71A 4L9DA 1MCCA 3FFCD 3WSQH 3BPLC 5J1TC 1RURH 1U3HA 3TBWA 4OLXL 3CCHA 4ETYA 1ORQB 1JWUA 4I0PA 1QA9B 4XNYL 3BH8B 4ODSH 4QRRE 1KJVA 1SEBB 2BFVL 2J4WH 4I3SL 1FC2D 3UZEA 3VCLA 1E27A 1HOCA 1ZT7A 1DVFD 5FYLL 1F90H 5H2BA 5F7EL 5CKAA 1JNHB 5E6ZA 3FFCB 5EWIH 3QCTL 5ID1B 3TJEL 4ZAKA 2HLAA 4Z7UA 3JWDL 3KPSD 2NY3C 3CX5J 1GXEA 1MJ8L 4HWUA 4JZJA 4Y5XA 3GKWH 3K2UL 3M17B 2GIYA 4L9LB 2OP4L 2XZQL 3QI9D 1P7QA 1I3GH 4YO0B 1DVFB 3S7GA 2IG2L 4GRWE 1FE8L 4LDOB 1IQWL 1Q9LB 1S9XA 2AJSH 4DOHB 4X4XB 1D5IH 3PHQA 2NX5D 4YC2C 2X70A 4HLJA 2YD6A 1A0QH 5E5MB 5IB2B 4OCRL 4JG0H 5D93B 1A6ZB 4OLZL 3A6OA 1INDH 3QEQD 2VWEE 3TN0A 1W0VA 1T3FA 3RNQB 3FN3A 4X7FC 1HCFX 5K9OA 5M7QA 3VH8A 2WSKA 5F7UA 5T1LD 2R29H 3BZFB 3QIBC 2IFFH 5TPWH 4OKVA 3EOAA 3MRDB 5CD3B 3C8KB 1MCHA 4JHWL 1FBIL 2DB8A 4A2MA 4YHIB 1FORH 3H3KA 3FMGL 1XEDA 2Y06H 3KPRB 2EIDA 3UJTH 5J13B 1B0WA 2Z91A 3LEYL 2BCKA 4GUPA 2FX8H 2FYYB 1OW0C 2J1KA 1AFVL 4ZXBB 4QLRA 3ZO0A 3U6RB 2PW2A 1F2XK 3BH9A 4D9RD 1MPAL 2HRPL 3AB0C 5KVMC 4ZSOE 5LCVH 1ZVHA 3RVVD 3IJYB 2GTWA 3GUTB 2AABL 5CBEA 2Z0BA 4RFEB 4PJ5A 1DUZA 3C2SA 2ZWLT 3NCFB 4MD4A 4TRPH 3Q5OA 4JDVB 4E5XB 5D8JH 1BD2A 4LAJH 1T7ZA 3W5NA 1ERNA 5CEZL 1ZGLP 2F74B 2G5BA 2VISB 5I1GH 1UB5A 4ELMB 4F7TB 1U8HB 2FIRT 2XN9D 1JFQH 4NBYB 1YEEH 1KCVH 1MOEA 1U8QB 4OTXH 4QHLA 1A7OH 2IF7A 1WWCA 4GW5B 4PJ7E 1CLOH 2IWGA 1DQMH 1RUPL 1MRCL 1YEKL 4JGUA 2BSTA 3HZMB 5E03A 5D7IA 3UROR 3VDAA 4NWUH 5GGSB 1ACYH 5E0QA 4IRSB 3IFNH 5FV2A 3SJVA 2EIZB 3HAEH 2EEAA 2FZ3B 2W60A 1YEJL 3LRSB 1KTKE 4GRMA 1IGCL 5AG8A 5C3LD 3NFSH 5KSBF 2VXQH 1X4XA 1IAIH 2HJLA 4P57B 2VDPH 2G60H 3TV3H 4A6YL 2FHBA 3PXJA 5TFSH 2HRLA 4YBLB 3SQOH 5JW5B 2E8ZA 1KTRL 3IT8D 4IS6A 1NUFA 4EXPX 1GVIA 1PYWB 2QL1A 2JB5H 3EJJX 3OKLB 5B4MD 2PO6C 3QPXL 4ONHB 2DLFH 5ESVA 3EOBB 4MJ4A 4MD0B 4P2OC 1QNZL 3FO9B 5HVHB 1JZ6A 1U8OA 4LNRA 1AI1H 5DQ9B 3OAYH 3G5VA 3FTGB 3LEXA 4U1SA 3RZCA 3EDJA 4PRAB 5DEGB 4MS8D 4N8VA 4Z95L 4CMHC 5IEHA 3LKNB 3WFDH 4GMSH 1IQDB 3TH2T 2YOCA 1NAKL 4PG2C 3REVB 3RWDB 3L3KB 4OZGF 4P5MA 1JWMA 3U83A 1UWEH 3I2CL 5KAQF 1F8TL 1UVQB 4URTB 5C0JA 1PZUB 4M03A 4ZD3L 3QZWB 4MA3A 2PTVA 5JZ7C 5HGAA 3GMLB 4OD2B 3OAUH 4BKLA 3GSVB 4KKLC 4N0YL 1ZAGA 5C6PB 4OZFH 5C0NC 1XGYL 4V2CB 3IVKB 1ZLSH 1TZIB 1N5AB 4H88L 1NEZG 1DTUA 3EIFA 1CDGA 4KK5C 3MJ9H 3DO7B 4FZ8L 4QRTB 4ZFZB 2HT4D 3FOLB 3TBSA 3C6SB 1F6LL 4PIRF 4L8BB 3BW9B 2VE6A 5T5NG 4KTDH 5KJRH 1I1CA 4Y1AA 2XZAH 1NANI 4MNQB 5E95B 4UDUB 1CD9B 3BMVA 3JV6A 2DQDL 5D70L 1H3PL 2H8PA 5DRWB 3MREA 5DMGD 3SGDH 4BSJA 3LPWA 3P77A 2O5ZL 4GBXD 2DD8H 2AQ3A 3KPQB 1MAKA 3PV6B 1RIUH 4D0CA 5FO8A 5IKCA 5BXFB 2WZPD 3PGFL 3SE8L 1T7VA 2FGWH 3BE1H 3TPUA 4OKDA 5DJCB 1OF2A 1UB6B 1U8MB 4QRRB 3ARYA 1S7QB 2WBJC 3FKUS 4P9MH 1ZLVH 3D48R 2UWEF 1UENA 2DQIL 2ADFH 5I15H 4Y8AA 2JCCE 5D1ZD 4MA1C 1EFQA 3V6ZB 5ILTH 2R4RH 3MFFA 3O6LL 2GCYB 4JRWA 1U41A 1FFPA 2F54E 3IU3B 4QHUB 3QO0B 2ADJA 3U48A 5DEFA 1EBPA 3U0TB 2HAZA 5J3HC 2QSCL 1HILA 5FO9A 2AJXL 3S3SA 4JPKL 1D9KA 3EZ8A 2IQ9L 4UNTA 4NNPL 2DQGL 2A0LC 3H9HB 2J7LA 3KPOB 1FPTL 4GRWB 4UI2A 1DR9A 1ND0B 4RBPK 5TF0A 2KBGA 3AXLB 4GLRH 1J0YA 3PWNA 3M07A 5D5ME 2GITB 1EJOL 1BOGB 4OLYL 4EOWH 3NCJH 4XP1H 1XIWB 3VGAC 3MBEC 3IS1X 4IMLB 5T1KB 5CJOH 2EDDA 4YX2L 2NQCA 1RUAH 4K7FA 3ZE0F 4MWFA 5EZIL 1HXMA 3LZFH 4JB9H 1DBML 4S0SD 5BVPL 1UZ6E 4HFWA 5ESAB 2X2YA 1KTLB 4RSVA 2WANA 2A9NH 3PWPE 4KAQH 3DMMD 4UILH 2F5BL 1QACA 4QWWC 4D0DA 1F3DH 1F58L 1GPOL 1V7ML 1N0XH 3MRQB 4PD4K 2PYEE 3QIUD 3LDBB 3O8XA 3MRLB 3MV01 4TVPH 2Y5TA 4JFPB 5BMFL 4ODWB 3ZKQD 1UC6A 3T0EB 4NN7B 4KJWD 4JFYB 1JHLH 1B3JA 3IDGA 3W39B 3TBYB 1WUNT 3BQUB 4KZDH 4H8WL 5I8CB 4KROD 4ZSOB 4H25A 1C1EL 4Z0BL 4EBQL 1S7XB 3K1DA 1J1PL 1JNNH 4HMCA 5I19L 4LSQH 5D71H 4XHQA 5FYKE 1CL7H 4DK6A 5ACMA 3P4OA 4FRWA 5E8OB 2N4IA 4K7PH 2NW2A 1KB5H 4KROB 5GRWA 1V3MA 1P9MC 4YFDB 2Q86A 5T1DL 2R0KL 2Z8RA 3NZHL 1TQBC 3ZMRA 3T0BA 3WXWH 4RISL 5SWQA 5E08L 5K9QI 1T83C 3QG7L 1MFEL 3EJZD 1OWRM 3CXDH 2X42A 4KV5F 4PJ7B 3VRLE 4P23C 1KG0A 4PGCA 5GGRB 5IESH 4PJFF 4PRHE 3P11L 1CBVL 5B3NA 5DWUH 3HUJF 1KGCE 4HT1H 3ILQD 1N8ZA 4GS7C 5EUOE 1E4KA 5HHNB 1P5VA 5DF0A 1PY9A 1P6FA 3NMEA 3U36B 3VDCA 3IAQA 4L4VA 1BIIA 1MHPL 4O58H 2AXFB 4TSBH 3UC0L 1UWGL 4OM1H 1J1XH 1HSBA 5J11B 1W2KT 3SDDC 4EDXA 4O00A 4XZUB 5EZJB 5EIVA 1BHGA 1DQTA 3KHOA 5CEXA 1YECL 3F5WB 3H9SE 4EI6B 1PJ9A 2NZIA 1E6OL 2AK4E 5ICXA 4MAYD 4GXVH 1ZLUH 5C6TH 2DWDB 1R24B 4MHHI 4RAUA 2IGFL 3O45B 1OGTB 4X6EA 1BEYL 4NRXB 3PGCB 4PGJA 4M00A 3HZKB 5F3HB 1HHHA 2FH6A 3DROA 4NUJA 1BGXL 4LVHC 1QFWL 3GDBA 3HE7A 3GMNB 1IGYB 3G04B 4MAYB 2Q7NA 1QYGH 5EUKB 1NAML 2GY5A 3NGBC 3L3JB 4LHUA 1A7RH 5DT1H 3I50L 3PABA 4KUCD 3IDMB 5GPRA 5FGRA 3AY4A 2AEQH 3GMOB 1QBLL 5EFIB 4UT7L 3VFOA 4X6CA 4OIIL 1IC5H 2X4RB 3I02B 4YK4C 4NKOA 5ANMA 5I0ZA 4WI2A 2ENYA 1CFVL 2Q3AA 3GM8A 3N1GC 4X7TB 1HSAB 4JM2C 3T4AB 4CDHA 4HK0A 2EECA 5I1HH 3HB3D 3X3GH 3KG5A 5GJSH 5J4MA 1NCDL 2IALA 1GGYA 4XCNB 2IPKB 1HK6A 4MDJB 1MHEB 2HT2C 4WCYH 5A3ID 3GMMA 3O11A 2DQUH 4LCYA 4YHOH 4P9HL 1QEWA 4N9OB 1OSPL 1CE6A 3HNVL 3EDKA 3O9WA 3O6FC 2FB4L 1T0MA 5JO5B 2I07B 1A7PH 2IQAA 4JVWA 4OFYD 4NT6B 2APWA 1OTUD 1JL8A 4FG6C 3CVIH 3SO5A 3BYYA 5D96C 2C4XA 4BUGA 2VL4A 4LPUA 5EBLA 4U2YA 4POZC 3W2DL 3NZ8B 2RR3A 5FOBB 4CL7A 1K5NA 1BQHB 2ZG1A 5CZXD 4PJDE 2L0DA 4HXAL 4YC2B 1MAJA 4WI6A 4I13B 1NLBL 3HLAA 3U46A 1GC1H 4YXHL 3D85B 3RY6A 3MLYH 3WUWB 4TN9A 3GIVB 1FNSL 4XWGH 4I3RL 4OAWB 1AY1L 1HHKB 1ZEAL 2GYSA 5HJ3A 3HNSH 5D6CB 4F7CA 2LU4A 1BLNB 5DJZB 3ZDYE 1NDGA 5DURB 5KVEH 1MHHA 2FX7H 3BSZH 4PB0L 3PWLB 1Z9SA 4NO5B 2F54B 5LKNA 3PP4L 2OJZH 2AEIT 2E6PA 2C3GA 5CLTA 5J89A 2D4DA 3K1KC 5AZEL 4U1LA 2CK0H 3GRWH 2E27L 3GI8H 4KWUA 4FNLL 2VH5H 4R90H 5BRZA 5IBUB 3BKYH 2YD4A 4IRZH 3OKOB 4RFNC 3S5LB 8FABA 3S35X 2GT9B 5D5MB 5DVMA 5I30L 3VFMB 5IB4A 2BSED 3MUJA 2V6HA 2HH0L 3WUZA 4HUUB 5CS7A 4ETQB 3A6CH 3FB8A 4WFGD 4JCLA 4PRIA 4LHQB 2DS4A 2VSCA 4HPYL 5E2UH 3DI2B 4CN4A 3D87B 3AB0B 3HA0A 5CGYC 5TQ2H 3VE0B 1OD9A 1NSNH 3F7PC 3B9KC 4M1DH 4ZTOL 3WCYA 1OAKH 2CXGA 3HZYB 5D2LA 3GB7B 1NBVL 12E8L 4HJJH 1AD0B 4G8GE 3SGJC 3PWPB 4F9PA 5KN5A 4S1SH 1R3KA 5MP6H 4P2YA 5K93A 5IHLB 5B8CA 2EEDA 1BQHG 3RWGA 1LO3H 1FZKB 5HVGB 4BZYA 4LLMB 3MGTB 3GM0A 3QHZH 5HGDA 2PYEB 1RURL 1MUJA 3BI9X 5IBTL 5FYKD 4ODSL 4OZFB 1CXKA 5HHPA 3WN5A 1YY9D 4QOKE 4B5EA 4WFFE 5F71A 1WBZA 4APQD 4KJQD 5ACZB 5JHLH 1F90L 2UVEA 3QAZC 4R7DA 3V5DB 1INQB 2KUTA 5EWIL 3EYQC 2Z31C 3MLVL 2X4QA 5GHWL 3ARGD 2CQVA 1ITCA 3NCYS 3V7AE 1L7IH 3HR6A 2OI9C 1XCQB 1SYVA 1H5BC 4WI7A 1FL6A 2FWOA 3DBXB 3RWJB 1I3GL 5H8DA 4Z7QF 1NFDF 3VXPA 3IJSB 4HKJA 4UUJA 3ZDZE 3B9AA 2YKLH 4PJEE 1KGCD 3GKZA 3DTXB 3INUL 1D5IL 2FD6H 2X9YA 1LEKA 1KIUA 1A0QL 4HEME 1OHQA 2HTKD 2Q6WB 4EI5D 2ICEA 3OR6A 4TYUA 1INDL 5GGTH 1JTOA 2PYFA 4NO0B 1EA9C 4P2OB 4PRHB 3H9SD 2FIKB 1AO7B 1HN1A 3VXUE 1M7IA 4OD3H 1A6AB 1NMCC 5EUOB 1EEZB 4R97B 2HVKB 3R8QA 4HX1B 1VB9A 2J8UB 4YAQA 4CMHB 1VACA 5FHBH 3VWJA 3C60A 3DUUB 5TPWL 2OZ4A 5DC4B 4R26L 3UJJL 5I66A 4KK5D 3H9SB 2H32H 1FZJA 4JPWH 5HGBA 3O3AB 1CGUA 4L4JA 3F7YB 2H9GB 1G7IB 4HS6A 4DGYH 1GH7A 2FJHB 1FORL 2AK4B 3FB5A 2K7QA 4PRBA 2Y06L 2APBA 1OCWL 2ATPA 2EXYC 1S7RA 4U0RC 3C5JA 4JFFE 3RGVC 5D7JD 2AS5M 4TNWF 3CMGA 1VFUA 4KHXH 1JI1A 4NZRH 4LPWA 5EBMB 3FAXA 5E9DD 1XCTA 4LEXL 5JIKA 4Y4KC 2HTLC 4G7YH 4GXUN 3L3IA 4LOUD 1FGNH 1S9KC 2A83B 1P2CB 2KPNA 4TRPL 1TNNA 5HPMB 1P7HL 3IXTA 3UPRB 4GAGL 5D8JL 2YD9A 3QDJA 5F7MC 1MVUA 1BJ8A 1XGQB 1IM3B 3RVXD 3O4LB 1UM6H 4N0FB 5B21A 5I1GL 3FQXB 1DFBH 1MCWM 1AR2A 3OPZL 4LLVB 4XBEL 5FK9A 1FFNB 3IDXL 1S5HB 4H20H 3ZYZA 5FGCE 1A7OL 1TJIH 3B3IA 1CLOL 1QBAA 4AIOA 3QXWA 3QBTB 2I5YH 3ZE1E 5DGRA 1HKLL 3ARBA 5BVJA 4W70A 2FECI 5T3XE 4X7EC 4MA1B 3MODH 1JNLH 3SJVD 1DBJH 1NBZB 4CVWA 2GSGA 1FLTX 4M1CD 2OCFD 2ZJSL 1TCMA 3RL1A 1D5BB 3NFSL 1R3IL 3EW3B 3RX8A 4PB9L 2VXQL 4JRXA 3CK0H 5IEKA 3ULSA 2E9WA 4DCQB 2VDPL 3TV3L 3T3MF 4BFEA 2N7BA 5AYQA 3RWHA 2PCPA 5TFSL 3ULUC 4Y16C 3X17A 3VH8G 1AXSB 5ALCL 2WWMC 1CFQB 1KB5B 3L5JA 5FA3A 4PJDB 3SQOL 2CLZB 3WEXB 3VXRE 1RIVH 1GZQB 5GRVK 2DLFL 3VGAB 4QRSA 3WDJA 1BQLH 4HW6A 1YPZA 3OGCA 1AI1L 1P84K 15C8H 3LQAC 4N0CC 3P4NA 3RZCD 1K6QL 3QFJA 4R4FH 4OUUA 1FQ9C 1U95A 3MTRA 4OBSA 4GMSL 2R1YB 1KIQB 4KMLB 3RIAF 1NCNA 2Q76B 4MLIA 4F7MA 2D2OA 4JY4B 3RDTA 5DGQA 4XPFH 1X7QA 4PYGA 3RWIB 5L2JB 3C6LD 4DW2L 1F4YH 4XH2B 4MQSB 3TEUA 2R8SL 2VXSH 1KJ2H 3MLXH 4F58L 5DFTA 4M8QB 3LVEA 2LAGB 3DX8A 3CPLA 4G8GD 2B20A 1LEGA 3VDBA 3OXRB 3SGKC 5I6XC 3C6LB 2DYPD 4HJ0C 4OQTH 1HWGB 4JR9L 5A16B 1LE9A 3VFPA 5F44A 5KJRL 4NHCH 4M7KH 2XZAL 1BJ1H 3QQ3A 5KG9A 2JK5A 2MNUA 5JTWA 4K7PX 1RZIB 3KYMB 4XP6L 4QOKD 2V5MA 4FQJL 2A6JB 4NO3B 4ODUA 3ULUH 2QADC 5D7SH 4G8FA 3S37H 1D5XB 3L5WA 3MNWB 3RU8H 4JAMB 4GRLA 5DRXB 3TVMD 1YNKH 4OZHE 1RIUL 3WKML 1I1AD 5F1IB 4B0MM 1NBYB 1SJXA 1TQBB 4NNXA 3MV8B 4PJIA 3GSNB 3BE1L 3MA9L 2FLRT 4UMGA 4FZEH 1B4JH 4P23B 5IQ9B 3LQAH 2O5XH 4UV7H 5I15L 4EUPA 4P5KA 1J87A 3C5ZA 4GS7B 4AEFA 3WKNA 3LN5B 3FQRB 3VGDA 3L95B 4MLSA 1JZ2A 3QUXC 1DJSA 3SDDB 3WL9A 4E0RB 4N0UE 2OXGA 1FGVL 4DKEH 5F7LB 1KT2A 4P4KA 3GK8H 3OWEA 1MWAA 5E2JA 3VXUD 4TOYH 2R2HB 2VRAA 4PJEB 3KDMB 4P5TA 4N8VG 5DK0B 2HJKB 5IFJB 3T1FB 4H1LG 1WFOA 1SJHA 1BZ9B 2F53A 2VDQH 5IJKA 4EOWL 3NCJL 5DJ8B 1MH5B 4XP1L 2FATH 4LLAA 1OP5K 4NP4L 1BM3L 2X4TA 5IFHH 5H94A 2VLLA 4L8SC 2DI8A 1ZSDB 3VXUB 3BPCA 4KJYA 1EAPB 1RUAL 1A6WL 3BP4A 3QUZA 2R1XB 1QSEA 1T5WA 4JO1H 4JY5H 3NGBB 4TUJB 1SVZA 3IDNB 4Z7VE 4WGVB 2R56L 2W0FA 3L7EA 3EUUA 3WIHH 1LNUB 2L4OA 3B5GA 3OKDA 1JPFA 4KAQL 1RZ8B 1YY8B 4UILL 4X6DE 3ZZ1A 1WIOA 3V6OC 1LEIA 3SPVB 1XT5A 1XR9B 5DD3L 1ZA3A 2BOBA 4J3WA 3QEUA 5DTFB 1NLDH 1XF4B 4YK4B 1A2YB 4HKBA 1BFTA 3G6JA 1HDMB 4JM2B 2WLZA 4KTEH 5SWZB 4PJGA 4Y0GA 3VFSA 1ZLWH 4TVPL 1DLFL 2XA8L 1GHFL 4HWBH 4JFFB 3LQZA 1HQ4B 3FQUA 1FCCA 4PG9B 4TNVF 4JKKA 3SCMA 3PUCA 4HIHA 5DHVA 1JMXA 5DS8A 3EYVA 4KZDL 1A02N 3V0WL 4POZD 1R3LB 2BVTA 3D0VB 1JNNL 2ZCLL 4AEIH 5INCA 2VLME 3O6FB 4MJ6A 3ZSSA 2HJFB 3BEWB 3QQNA 1I3UA 3PDOA 4H26A 1MREL 2HVJB 5B3JF 2APTA 2Z8WC 5D96B 4XPTH 4D3CL 1KB5L 4O5LH 4ODHH 3EYFA 3FHQA 3ULUE 1FAIH 4RIRB 5T3XD 2WAHA 5LG1A 3WXWL 4TTDC 1UCBL 2ICES 4JPVH 1SY6H 5FGCB 3TT1L 4C57C 3CXDL 2W59A 4MDIB 2ID5A 1JE6A 1QD0A 3ROOA 1RMFH 1J0KA 1JGVL 5I8OH 1IBGH 2R1WB 3GGWA 5FECA 5DWUL 4Z8FL 4HT1L 4ELMF 1MCSA 3MJ7A 1S7VB 1FFRA 4UV4H 4TSBL 3GJFA 1PKQA 2Y7QB 5CJXC 3L9RA 4OLVH 3W9EA 1EGJH 1BBJA 2VLJB 1J1XL 4WO4C 3S96A 2NW3B 4QXTA 4X7CC 5TQ0L 2Q7YA 3PF2A 4AT6B 5ABDE 2DQEH 2NLJB 4JQVA 1EK3A 2NTFA 3DV4B 4LQ1A 4UINL 3VFTA 2CK2A 1RK1B 2ZSWB 5I74C 1K2DA 5FGSA 4NQCE 5C6TL 4QYOB 5EC1B 3LSOA 5DR5H 4FQ1H 4RFNB 1SYSA 4ZS6C 3TH4T 3VXRB 1N2RA 1DUYA 3H0TA 4LPVA 4X6BB 2AJZA 3DXAE 2VQ1A 1K3ZA 4JCMA 2AEWA 3FO1B 1WWAX 3GMRA 5DK3A 4O2CA 1X5YA 3HE7D 4JFDE 4LCUA 5JW4M 3UXFA 5CWSB 4WU5A 2OTUA 4X6FA 1CIDA 4O4YH 3SEPA 4UIMA 4HHAB 3GEWB 4LHUD 3B9KB 2Q8BH 3LKQB 1A7RL 5DT1L 4F7EB 3CC5A 2CSPA 2PW1B 4HKXA 1TZGH 4LLDA 5CHNA 5KSVA 5GS0C 1WTLA 2A1WH 1N5YH 2CLRB 1IC5L 1YMHB 1CDIA 1SEQH 1EFXA 1CICC 3NACH 2UUDK 3GSNL 3V7MA 5JNYA 2H32B 5JMRA 2IANE 1QR1B 5EU6E 2VUOA 3BPNC 1LK2A 2Z31D 5KZCB 2CDFB 2DF3A 1FN4B 5IW1A 1G0DA 5GJSL 4FOMA 4YBQD 3KJ4B 4LCCA 4WCYL 2VDMH 4ISVB 4U4BA 1FH5L 1C16A 4YHOL 1YC7A 1UKTA 4BELD 4P46C 3DV6B 3O6MH 3TZVA 3SKNB 3QAZB 5INDA 5IROA 1RUKL 3HC4L 1EO5A 2NY7H 3MRFA 3PWUB 2BY3A 4X8XA 5D4QA 2Z31B 5IWLC 1FG9C 1CDJA 1H15B 5F97E 2YS4A 3HS0A 2MCPH 2BY0A 5DJ2A 5EZOL 2MOVA 2OI9B 4CU7A 4ZUWB 3CVIL 4HK3N 2DMKA 4X4ME 1YN7A 1H5BB 5BO1L 2QKIA 1A3QA 3NIFE 4WGWB 4Z7WA 1QO3A 2H45A 4WHYH 4NGHH 4YPGB 4OZHB 1DBAL 1K3IA 5ESQA 1EH9A 5C0EA 1MHCA 1VFMA 3O3EA 2XRAH 3MLYL 4P0DA 3CLEH 4KVNL 4C56A 3MBXH 4K3EH 4XWGL 1G9NC 3ZTNH 5B39A 1NGWA 1VDGA 2BMKB 5KVEL 2V2XB 1A6TA 2FX7L 4KDTC 3BSZL 1BJMA 4YLQT 1NMCB 2WUCH 1HYRC 1R3JB 3VFWA 5EU3B 2OJZL 3HE6C 4NUGH 1GIGL 5GS0H 3LPFA 1U0QA 5EBWB 1P4BH 4UTAH 3T0DA 1K4CB 4N0UB 2GY7B 3VXTA 1RZKC 3VRIB 1NDMA 4LKXB 1PG7X 4E9LA 1UH4A 4ZFFB 2CK0L 3QWQB 3V6OE 3I9GH 4Y5VA 5LAXB 1ZK9A 1TETL 3S3PA 1CFSA 1GAFL 4NQEE 1OB1B 2LTQB 4LHUG 3BKYL 4GKNA 4CVZB 3G08B 3I6KB 5TE7H 3RWFB 1WITA 3U4BL 3NA9H 4U0RB 3V6BR 1U3HC 1SHMA 3JSSA 3RGVB 3UO1L 3DSFH 3G6DL 4NM8H 2VDRH 3MR9A 5C0GA 2H2PD 3S36L 2YSSA 5E2UL 3NN8A 1PGRB 4M9PA 4M3KB 2W0KA 3E8UH 1OSZB 2J88H 4GRWF 5E2VL 1NSNL 5CIPA 4CU6A 4S0TD 1BIHA 4HLZG 1A7NL 4Y4KB 1RPQA 2VLRB 5HGHB 2GSIB 4ZAKC 4Z7VB 3SDXE 4N0RA 3VXSA 1QLFB 4JZJC 4CW1A 4S1RH 4X6DB 1EPFA 1FVDA 3P30H 5TDPA 3SDCD 5AYUH 4KH2A 4E41A 2E6JA 4FQIH 4OCLC 2BHUA 4F37K 1LO3L 1MRFH 3HPLB 2FJFA 5EIIB 2P1YA 4IMKC 3T8XA 2VLMD 4POUB 3L3DB 1G9NH 1DBKH 1RY7B 4HIJB 4KRPD 5IB5A 4M6MH 2BXYA 3BP7A 1FL5A 1T1WB 1KJ2B 4GW4A 1WAAE 5T3XL 5LQBL 5JHLL 1Z0NA 2MSPA 1BVLB 3F65A 2UV3A 1AJ7H 2VXVL 4NQVB 3MLZH 3DVGA 3QNZB 3IFLH 2DQFA 2R2EB 4XP9H 3NCMA 4RX4A 1YEFL 1RZKH 3QWRA 2XFXB 4WFHD 3VGEA 1I9JL 1KCKA 1KJMB 5J9PA 1U8PB 4N1EA 3H6JA 2DQJH 3JUZA 3D39A 5KSBA 5KSUB 3EFDH 1K8DB 4G6KL 4K2UL 4J6RH 3GIZH 4Y16B 2R2CA 1GGIL 4MVBD 1RZGA 2I9TB 1MLCB 3VJ6B 5T5FH 1QBBA 1MFAH 1C5BH 4K23L 1WCBA 3LKRB 4X98B 1JHKH 4ODXB 1UXSA 1VFBB 3KYOB 3VFNA 3PXHA 3H3PH 1FYTE 2X4UA 4JZNB 3T65B 3AGVA 4OF0A 4LLWA 1C5CL 3MLPA 2XWJA 3VFVA 2NYYD 5AD0A 4NQCD 1QFHA 2Z35A 2N1KA 3RWCB 3CVHA 3AREA 3CFJB 2ARJA 1EEQA 4PJ7F 3DXAD 4D2NA 3OGOE 2NXZC 5EA0H 3S34H 3AFLA 1EHAA 3TWCL 1T1ZA 3CX2A 2OK0H 3GNMH 3QP3A 4RQQB 4DGYL 4BH7B 4NQCB 4DUWA 1F3JA 3K80A 2BDNH 3RTQA 4XWOC 1WLHA 1JYNA 5BZDA 1CZ8L 2Q87A 5D7LA 5HHOE 1KIPA 3DXAB 5CZVL 4JDTH 2D7OA 1DQJA 5CMAB 4JANB 4JFDB 2BVQB 1Z5LA 2BVOA 2Z93B 2FJGA 5ERWA 4Y19B 5H37H 2VITB 3HPJB 3MRMB 5JXEA 2IAND 1I7RA 1RJYB 3MLSL 2EDBA 3ARFD 4Z7NE 3MOBH 2K1MA 3K4ZA 4LSUH 1JI2A 1R5IB 1BOYA 1UM6L 2NY6C 3MV9B 1LVEA 4DZ8A 1IAOA 2QADB 2IH3B 2YPVL 3D2UB 5GIRB 2AXHA 4B7LA 1NQBA 3NTCL 2AQ1A 5IGXL 2IANB 5EU6B 2B1AH 3QEGL 1HIMH 2DKUA 2IPUK 4PTUA 2EIBA 2V2TA 4GKSB 2I5YL 3BP6A 4PJ8C 2IC2A 4MJIE 4QRUB 4G42A 5SV4A 2BHYA 3T4YB 5EC2B 3R1GH 4RAVB 5C8JA 5FUOL 1L6ZA 2UWEA 3KWWB 3T77B 2EYSA 3F7RA 3WD5H 4K94C 1Q9OA 2VOTA 4KUCF 2CKNA 5KSAA 1XZ0B 3QUXB 5KS9B 5EN2A 4P59H 2YD2A 2H26A 3FQTB 1RIHH 2VB5A 3QQ9C 3DRQA 4LLQB 5F9WC 1S7TA 4ZNCD 2JJVA 7CGTA 3V9FA 1NC2A 4JDZB 1MCLA 2C26A 3NIDE 3GJEA 2CR6A 3QG6B 5HVFB 4XVSH 3UYRH 3O2DA 4W4OA 3QFDA 2XNAB 3OAYK 5CFHA 15C8L 3BN9D 1QBMH 3OHXB 3X13B 5FO7B 2NCMA 4NQED 3ZYJA 2G75B 5ICZB 4DVRL 1EAJA 1E4XL 1MIML 5I76B 5CUSH 4XVJH 4G9FB 5F7NC 2YPKA 1KPVB 2QLVB 4LCIH 4G8EA 5F88B 5GS1B 4XPFL 2HMID 3CSBA 4XMPL 4KZEL 2VC2H 3MRIA 4XNMA 1T1YA 3ARVA 4UAOB 4M61A 3MRHA 4ACPA 3QJFA 1IZJA 4L8DB 5F1NB 1KJ2L 2BHZA 3MLXL 4HSQA 3W11D 3ECBB 5I1LA 4UTBH 1CDYA 4OLUH 1JWSA 5DLMH 1SJEB 2R2BA 1CK0H 1U6AH 5CKGA 4JHAH 4JZOA 3CFDB 1AXIB 2DMBA 4QT5A 3BIKB 4K94H 2X9WA 1DQQB 1I8IA 5KVDL 4NHCL 4ZYKA 2YC1A 1BFOA 3NABH 2ITCA 5JDJA 3CU1A 5D5MF 2IPTL 4PYHA 2E7LA 1JPGB 1J10A 2AV7A 3TCLA 3BHBA 3ULUL 5JIIA 5D7SL 3S37L 5LGHL 1Y6NR 1D9KC 4GRLD 3RU8L 2R69H 1F6FB 5F9JA 1Q0YH 3MROB 3V52H 1M6OA 1KPRB 3LMJH 1RU9H 3EJYC 4U3HA 4KKBD 2I60H 5IG7B 4XPGH 4NQTA 5MENE 2XKNA 5I75C 3TNNA 1DE4A 1ZLVK 3LQAL 4L5FH 1XGRB 1KCUL 4UV7L 3C5ZD 4ZOAA 4G6JL 2BX5A 4FFZL 4HULB 3VXOA 1IEBB 2IAMA 4PJFA 3RJDA 1A4KB 3FQWA 3MCLH 6FABH 1CFTB 2VN7A 4F7PB 3HUJA 4WO4B 3GSUB 2AV1B 3QDMA 1FAKT 1EERB 3IFPA 4LLYA 4OI8A 4L3EA 2D7TH 3FFDA 5HVWA 3GK8L 3IDIA 4Q97A 3K4DA 4XCFH 1OGAE 4M6OH 4TOYL 1FFOA 4MQXC 2ITDA 1RJZA 4PY8I 5I74B 4QHMB 5SWSE 1TQCB 4Z77B 4D94A 5GS2H 4L3AA 2CMRL 4NDMB 1CD8A 5F93C 3HTLX 4BZ2H 2ZOKA 2VDQL 4RFOH 3KPPB 3I6GA 3LY6A 3O8XC 2C3XA 1MLBA 1FYTB 1YYLL 5F1KC 4LSDA 4I4WB 3BDBA 5DD0L 5IB3A 2YBRB 3S97C 1I3RB 3QUZD 2WUBH 4Y4HA 3BZ4A 4JY5L 4LGPB 4ZDHA 3MGOA 3CLFH 3G5YB 3D69B 3U2SB 1V5JA 2VDNH 4UBDC 3VRLF 5HHOD 5IK3B 4TTGA 4DQOH 1JPST 4QCIA 4L8CB 2GK0B 5C92A 2BNUA 3SDYH 4KGJA 4O2FA 1MF2H 1RSFA 4NRZB 3G5ZB 4HC1A 1CICB 5EUOF 4XCYA 2RQ8A 1HEZB 3F8UB 4KTEL 3BPNB 3BD4A 4CNIB 1R5WA 5GJTH 3VWKA 3SCMD 5HYJA 5E8NA 1PSKL 3HMXA 4JG1H 5D1QA 3FT2B 5DQJA 1H0DA 4P46B 1I8KA 2XICA 1XF2A 3C8DA 4X8JB 1EHLH 4G80A 32C2B 4Z76A 4AEIL 1E4KC 5KW9H 5I16A 3C9NA 2P8PB 1T89A 5FV1L 4NC2B 1F4XH 1MFCH 4WTZA 2P5EE 3QJHA 4PGDB 1A1MA 2F8VA 4WUKH 4JQIH 4AEEA 3IETB 3WBDA 4O5LL 4ODHL 5D72H 1NCWH 4DKFH 4M02A 1NJ9B 4JFHD 4FA8A 1FAIL 4YDIH 4LVNC 4Z18A 1WZLA 1KYOK 1K9TA 1SY6L 4JPVL 4P2QA 3DRTA 3LH2H 4HDIA 5L0QC 2SEBA 1WJ3A 1HHGA 3GSQA 5D1XA 3KLSA 3CH1B 3W5MA 4JFOB 1RMFL 1L9NA 5I8OL 3OZ9H 1BVKA 4PJHB 4MJIB 3AVEA 1PBYA 2W92A 4Y89A 4CRPA 5H35A 4CN1A 3ZT7A 4UV4L 4BFIA 1MCRA 1X5GA 1CWVA 2FGZA 4NKIH 1KBGL 1RJCA 4OCYL 4OLVL 1EGJL 3HE6B 1ADQL 1EEUA 4PRPB 3U4EA 2DQEL 3CFKB 4NC1C 5C09B 3AY4C 2BNQA 3OKMA 1XAUA 4XBGA 2CLVB 4BYHA 2VZSA 1J86A 1QUNA 2C1PB 4QRPA 1DLHB 1IGJB 1UJTA 1TVDA 3AAZA 5L2KD 1ZLUK 5DR5L 5EOCL 3WV0A 4XHJC 5I8KH 2DI7A 1DL7H 1CE1L 2XY2A 3JTSA 1U3HB 1ZT1A 2XG4A 1JWUB 1AGEA 3PWVA 5FCUL 5IV2B 4OZGE 3RL2A 4YDLC 2FBOJ 4NQSB 3SQBA 4ZUVA 1TCRB 2P8LA 4O4YL 1HOCB 4PJ9D 5D7KE 1ZT7B 4LPYA 4EN3C 2O61A 2Q8BL 4YPJA 4PJDF 1O5DT 2NY4C 1QPPA 3B5TA 3O9WC 2PNDA 4ZAKB 3ARDA 4Z7UB 4HWZA 1NMBL 4JZJB 4YHKH 1E4WH 3ZDYF 1OTSD 5J12C 5HHMD 3NACL 4NZTH 4O02L 4D0BA 3QCUH 3EYOA 3MOAH 1NH6A 4J3UA 5IFAH 1NGPL 4M7LH 1UCTA 3PHQB 2FEEL 3H42H 3SDAA 2LU7A 3RY6C 2VDML 2DQCL 4HZLA 3TA3D 1LP9A 2EDJA 4LLUB 3O6ML 4YUEL 3N9GH 1A1OA 2BC4A 1JV5A 1AHWA 2OTWA 4BFGA 2C1OA 4Q0XH 1GCFA 4K3JH 1ZVYA 3BDYH 4IDJL 2VIRA 1T21A 2BY1A 2PR4L 2MCPL 3HFML 4LU5L 4MX7B 3Q1SL 4HH8A 2QQKH 2F8XC 4AEHH 4OKVB 1B9ZA 3EOAB 3PQYD 2NY1C 4KK9C 2XTJE 4K7PY 3V6FA 4NGHL 1T04B 1IE5A 1NFDA 5F3BA 4HLZH 1CGSL 3QIWC 4OIBA 4RNRB 4Y2DD 3CLEL 4IJ3B 4MYWB 4JGJA 3S6CA 4C56D 2PETA 2Z91B 1Q9WB 5MENB 1JBJA 1JRHH 2BCKB 3MJ6A 3O3BA 4GUPB 1VCAA 3ZTNL 1OAQH 2BRQA 4DGVL 1JMZA 1ZKAA 1JIBA 4I5BA 3TJHC 5CZKA 4JHZA 2X41A 4X5WA 1OGAD 3AU1B 5SWSD 3IDJA 2EKSA 4XAWH 5CBEB 1B6DA 4NYLA 4KXZI 4PJ5B 4XWOD 2UY7A 4Y2DB 5CJQL 5GS0L 4H0IA 5I1CH 1F4WH 4MD4B 4UTAL 3ZSTA 4R8WH 1NANH 4LDEB 3D25B 2RCSH 3QUYC 4HBCL 5BS0A 4ZUTB 5C07E 4F9PC 5SV3A 4G3YH 2GAZB 3WYRA 1OGAB 2G2RA 3BIAX 2G5BB 1UB5B 5B8CC 2Y6SD 2A9ML 3CFBA 5CINL 5GRZA 5EORH 4HH9B 3NCBB 1MCWW 5IOPB 3EYUL 1SBSH 3NIGF 3PL6D 4PJBE 2PXYD 4QHLB 4XVUD 4OGZA 3T2NL 2MHAA 2VDRL 4UT9L 3WNNA 2CIKB 3FL7A 3WN5C 5JW4Q 5DDHB 5HYIA 4JFXB 1I1YA 4BSVA 4U1MA 2J88L 3L6FA 3ZDZF 2BSTB 3TM6A 4PJEF 2V17L 4OCSH 3EHBC 3QUKA 5D7IB 2XZZA 4LCWA 2A6IA 4XPBH 3BP5A 4UU9B 4GRMB 3MC0A 2W60B 5HI3C 4U6YA 5I17A 1IM9D 3SO3C 3P30L 5I1KH 1VEPA 2NY6B 4XTRD 5JXAL 1BECA 1T22A 3QO1B 4N8CL 2YPLA 1IGMH 4GKZA 1MRFL 3CMOL 3QXAA 4N68A 4GQ9L 4XB7A 5LXGL 3G5XA 4N90E 1NL0H 4PJAA 3PGDA 4ZFGH 1S7UB 2DI9A 1G9NL 4IS6B 4F33A 5J6HA 1G7PB 2EDXA 1S5IL 1IM9B 4M6ML 4E42B 2P5ED 3PIQA 3HI6H 2R0ZL 4PJ8B 3P4MB 1AJ7L 5K9JH 5BZWA 1I9IL 1U8OB 3QQ9D 1I7ZA 1T6WA 3G5VB 3MLZL 4OGAC 4OCXH 2VR5A 1DN2A 2ZG3A 3LEXB 4U1SB 3G9VA 3MUY1 4XP9L 5GSVB 1RZKL 4RAHA 4U1HA 3ZE2E 2P5EB 5E99L 4KV5E 3C60C 3D39D 2DQJL 5FM5O 3OJVC 3LKPB 3NFNA 4NQDE 1YYMH 1MNUH 4X6CE 2AVGA 4K07A 3EFDL 1JJUA 2WV3A 4HZAA 5C0JB 3MNZA 4J6RL 3GIZL 4QXGH 1ZHBA 2RFXA 3MMEA 5ITFB 4MA3B 1S9VA 2APVA 5F9WB 2M1KA 1Q94A 3OKKA 4BKLB 1MFAL 5C2UB 4JY6A 4YXKH 2BP3A 1G7MA 1JHKL 3B2VH 1QSFA 2GFBB 3QA3B 4K8RD 3MRBA 2JJUA 3OR7B 1KPUA 3WJJA 4G6FD 3TNMA 1CVRA 1ZA6A 1FVEA 3GSWB 4OJFH 4ELKA 5C0RH 3EGSA 4Z0XB 3GSRB 4HGWA 1A5FL 3MA7B 2VE6B 4WI8A 4Y1AB 3R06A 3DI3B 4X4ZA 1GGUA 5EA0L 1M1SA 1OLLA 4M7ZC 3MREB 3ZE1F 4RMWA 2J6EA 4N5EC 5DRNA 1NGXB 4JO4L 1RFDH 2DJSA 2X1PA 3UTTE 2BDNL 4NCDA 4FQXA 5CD5D 2ZZUT 5IQ7H 3MV7A 5FO8B 1EO8L 4XC3H 2HKHH 2NY5C 4KRLB 3TPUB 4OGYH 1RUQL 1OF2B 3RAJH 4JDTL 5FKPA 5CGTA 4ZUUB 5ISZA 3NPZB 2EDHA 2VDKH 4R7NB 2EE9A 1KCSH 4KHTL 1N0LA 4O51A 3ARBC 3IRZA 1JGEB 2X4OA 3WXVL 3RVWC 5GGQH 3VD3A 2YD3A 4I18A 5HYSB 3EJYD 3KJ6H 3MOBL 3AMLA 5I1AA 1FFPB 4LSUL 3RY5A 4A6YA 2ADJB 2EDLA 2OZ4H 4HS3B 1FG2A 3F58H 2JLLA 4MA7L 3W9DB 4KQ3H 1AD9A 4JO2L 4CMMB 4WVRA 1HILB 2E7CA 5FO9B 2A74B 1D9KB 3EYSH 2DQHL 4RZCA 5ADPL 4N1CA 4HUVA 3GBMH 1N59A 1QFWI 1KCRL 1CXFA 5DVNA 4NZDA 1NC4D 4NCC1 1BF2A 5DO2C 2ZOLA 1WBYA 2MTPA 3U9UA 1OD7A 2NNAA 2J5LC 4W68A 1H3VA 2XTJD 4XRCA 5FB8B 4K7FB 2X4SA 4MWFB 1E6JH 4PGEB 4TSCH 1D6VH 1KC5H 2Q20A 4HFWB 4ONFH 2P8MB 4NRYA 2H1PH 4WHDA 3EFFB 1IC7H 2AW2A 3BH8A 3DARA 3RDTC 4F57H 2W9EH 1N3NB 3HR5A 1KLGA 3MX0A 4D0DB 1QHOA 4KJPD 1NCTA 3HNTH 3FFCA 1OLZA 3O8XB 4XVSL 3UYRL 3ULVC 2Y5TB 1JF6A 1J05A 3PHOA 5E70A 3EBAA 1MJJB 1W0WA 3RVUD 5KAQG 1IKNA 5C07D 3M17A 2BRRH 1HHIA 4NN5C 3MOQA 2I27N 4X80H 3IDGB 2OL3B 1QBML 3BUYA 3KPLA 1ZHKA 3MXWH 4L9LA 3ZYIA 1N6QH 5MI0C 3Q48A 2R0WH 3TO2A 4OZHF 1DVFA 3QB7C 1D3CA 4JFEE 5I2IA 4Q58C 2NY2D 4OGXL 4X4XA 4PD4J 2WIMA 1ETZA 1FIGH 4UIKH 3FCTA 3KPSA 5C07B 4OB5H 4LQFH 3QI9A 4MQ7A 5C08D 5EZLA 1CCZA 2NY2B 4J1UB 5SWQB 5IMKB 4WDIB 4PJBB 2NX5A 4UTBL 1J0ZA 4AENA 4OLUL 3BZFA 1U6AL 4U1KA 2X1OA 1KG0B 4PGCB 1N4XH 4LPCA 4P2RD 2CGRL 4I2XA 3QEQA 1MY5A 4Z5RB 4K94L 1J11A 2X7LA 3Q6FA 2EDYA 5CD3A 2VO5A 1KIRA 2BK8A 4LRIC 4U6HB 5HD8C 1N8ZB 1EMTH 2BSSB 3MFGB 4WWID 1HHJB 3NABL 4L4VB 1BIIB 1QRKA 4YHIA 1HWHB 4LSPL 1HSBB 5T1LA 4OFKA 2R0LH 1N7MH 1HCVA 4P4KC 2F5AH 3MLRH 5FFLA 1FDLL 3BDXA 3V52L 4LVNB 4P5TC 3LMJL 4CAGA 1PD6A 4OD1H 5ICXB 5ETUA 2G9HB 3KLAA 3CSYB 3IJYA 3ULVH 4HUMB 4Z7VF 3GUTA 4L29B 5L0QB 1BZ7A 4WHTA 5IJKC 1ZHLA 2I60L 4LGSB 3QHFH 4X6DF 4L5FL 3LB6D 4JDVA 2GJ6E 5HHXH 4NQDD 3DROB 2DTML 4QTHA 3UTSE 3OTTA 1R5VB 2F74A 3MCLL 6FABL 2JB6B 2LU3A 4ELMA 1XF3B 4K8RL 1KENH 1YDPB 1IGFH 1U8HA 4N5UA 4FMFA 1KN4H 4X83A 5EOQL 4GW5A 4L3CB 3VFOB 4X6CB 5F7HA 2FX9H 4NKOB 3CH8A 1NUDA 4HFUH 4WEBH 4YHYC 1IGIH 3EOTH 1I7TB 2CRIA 2YK1L 5GGSA 1KACB 3BKMH 4HK0B 3DYPA 4FQHB 2EIZA 1H8NA 3LRSA 2WP3T 4PRNB 1NUGA 2D3VA 2IALB 4XCCL 4PV9B 1MI5E 4YDLB 4EUPH 4CJ1A 3VFGH 3GMMB 3O11B 4LCYB 4FQLL 3ULUF 2MQCA 4EN3B 1H3UA 3UTTD 4WEMB 2R9HD 4HMEA 2NY4B 4YIQA 2GQHA 3O9WB 1YEGL 1A6UH 5DD6B 3CLFL 1U8JA 1MAMH 2IQAB 5JW5A 4GAYA 4MGXA 4WIQA 3CZFA 4DQOL 5DVOA 1I85A 1F6AA 1MWAH 1OAXH 3ET9F 3HMWL 1VGKB 3IJHB 2XXMB 4JKWA 5HGGS 3SDYL 4GMTH 4F3FA 4EIGB 5J12B 1IL1B 3VMOA 5AZ2H 1DSFH 2E9BA 3JBG7 5DQ9A 1ZLWK 1OARL 3L5XL 5E7BA 3FTGA 3U46B 5JIPA 2ICWJ 3Q0HA 3LKNA 1GGBH 1HQRB 5L6YH 4XXDB 1IQDA 1T7XA 4OCNC 5HJ3B 2B8OT 4M5YL 1F02I 1NDGB 3TO4C 1GYAA 1JZ3A 1MHHB 3WNOA 2BXZA 3T3PE 3WNMA 4QF1B 4OD2A 1PQZB