2DLHA

Solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
121
structure length
121
Chain Sequence
GSSGSSGPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Receptor-type tyrosine-protein phosphatase delta
total genus 7
structure length 121
sequence length 121
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dlhA00
3GNMH 1IL1A 4FQJL 5DHVH 2BMKB 1DQJA 4PJGF 5HHPA 3N1GC 3EO9L 5DK0B 4K3JL 3OR7A 1JYXA 2P5WA 4K9EH 4KRLB 2W9DL 4UT6L 4DFHA 1FNAA 2P5EE 4KJWD 4XCNB 2QTEA 2VISB 5J4MA 3M1BB 4HFWA 2HG5B 3ESUF 5FCUL 2XICA 1NFDF 1IAKA 4UB0L 1LO2L 5T3XD 3QEQD 2GTZB 3E6FA 3H8NA 2GK0B 2ZPKH 4LKXB 3TNMB 3MRHA 1I4FB 3NCJH 2W0FB 5TE7L 5C0AD 1U9KA 2GTWB 3S34L 1JHLL 2EDOA 1OAKH 1HKLH 2Z35B 1HXMB 3N1QC 3ALXA 1KGCE 5EU6D 4K9EC 2HH0H 3P4NB 1FGVL 4GO6B 5DJZB 3SKJL 3FCTB 1XF5A 2FJHB 1FNGA 1JNHB 1FC2D 2YC1A 2AERT 1RIHL 3TBSA 3T0EE 4S1QH 3QXDB 4NRZB 1YMMA 3JV4B 3DHMA 5CBAB 5GRJH 2Y1VA 4PJCA 2QEJA 4X4ME 4ZNEA 3VFSB 4U1GB 2X9YA 2CXKA 1KJ3L 2BRQA 1A6WH 4KK8C 1ROWA 4C56A 3GIZH 2PXYC 3FO1B 4I8DA 3D1MC 4XNZB 4D0CB 1C5DA 3HE6C 2AEQH 2YR3A 4OV5B 3VFMB 4Y4KD 1F6LL 1BAFL 4M1CC 5BOZG 4WEMB 3OXRB 4HGWA 1OWRM 1ZAGA 4NO5B 1MLCA 3CLEL 4LVHC 3PWLB 1ITCA 4LCWA 1JMXA 4LF3B 1NCAH 1XF3B 3EYQD 4I2XE 4YBLB 4YDLC 2NY4C 2H6PA 4NZUL 3OB0H 4H1LB 4UDTA 4G9FE 5HVWA 3LRSB 4G5ZH 4KRPD 1ZKAA 3C2AL 3MCLH 2HA1A 4AJ0A 3Q6FB 3KLAB 2OBGA 3MJ7B 1E4WL 3WHXB 1A2YA 3KS0J 4R96A 4U3CA 1QO3B 3JTTA 4F15B 1XIWB 4FQIH 3BH9A 2AV7B 2AV7A 2BXZA 3P11H 4XPTL 4R96B 5JOFB 3QAZB 4LSPL 3H0TB 1ADQA 5B8CC 3ZTJH 2YK1H 3C9NB 3MLSL 1T5WA 1TJHL 1GGCL 2YD5A 4E9LA 4OZHE 4GSDL 4P5MB 5FF6A 4X7EC 4FG6D 4BKLB 4HIIB 3VMNA 5JMRA 4UBDC 2CIIB 4F8QA 2VDML 2VXQL 3U7YL 3ARGC 4S1DD 3MLVH 4YZFE 3FZUD 4GH7B 2G75A 3T8XA 1GZPB 2DQGH 1PG7W 1TETL 4CVZB 5ISZE 4QRTA 5A2JH 4OGXL 1AGCB 1CLOH 4J2XA 5F9OL 1BJ1J 4PJGE 4HAGA 4JRXE 1YEGH 3NFSL 3NACH 5FA3A 3UO1H 3MZGB 3TFKD 4WFHE 3HNVH 2RFXB 1CDBA 3VH8G 5C0JA 5IK3A 3T4YA 4DUXA 4OUUB 1XZ0B 4JN1H 1CD1B 5TE4H 2BVTA 1FVEB 3TVMA 3WUZA 4N5ED 3M17A 4NRZA 2E7LC 3QXDA 1OD9A 3PHQB 5EZIH 5FK9A 1WZLA 3O2WL 4M7KL 5JA9A 2W91A 3MFFB 4CMHB 4N0UB 5DFWH 1DBMH 2OR9L 2FJHA 3KPRE 4IMLA 2NY6B 3QQ3A 4XAKE 4LNRA 3VA2C 3MA7B 3P4LA 1V5JA 4X9HA 4QKXB 5B22A 1EZVY 2Z35A 3I6LD 4OM0H 4CVXA 5GJTL 3TN0A 1MY7A 4PJEE 5FEBA 1HQRA 3MRPB 3TNMA 4Q58C 1HHJB 2VDNL 5DHYB 3JUZA 5CCKH 1IAKB 4RFOL 1EFXB 4TSAL 3E8UH 4MA3A 3W11D 1RU9H 4OLWH 3UTTE 1S78D 3I2CL 4FOMA 4NO2B 1M05A 2VLKB 2F5AH 1TJHH 5AG8A 1MHEB 2VXSH 4JGJA 1FL5A 3MLWL 1K2DB 3MYJA 4IRSD 5IKCB 2ORBL 2ATKA 1K5NB 2G9HB 1IILE 2Y6SC 4HBQA 5HHPB 1ZTXH 3QUYC 2F74A 3QA3B 1M71A 1JV5A 1DSFH 1RZIA 4JANA 3LH2L 4O2EB 5DUBA 1ZVSB 4MVBD 1D5IH 3ARFC 5H2BB 3SO3C 5IFAL 3T0EB 3RVWD 1W0YT 2CLVA 4TULL 4S1SL 5C6TH 2BC4B 5EUOF 4JVUA 3H2WA 3WE6B 4HXBL 3VFVA 4IRJC 1NBVH 4C4KT 3EDFA 3WIIH 3WSQL 2A83A 2A83B 1TMCB 4ZOCA 1ZE3C 3IRZA 4OLXL 5IROA 3SGDI 3MMEA 1X3DA 3MQIA 1WFUA 4J8RB 2DTSA 4YDIH 4Z7VA 4OCYH 5E6ID 2HTKC 1XGRA 5C08D 4BSWB 3OPZL 1JPSH 1UB6B 5ACZB 2PF6A 4R97B 1G7JA 3ARPA 4M1CD 1YMME 4LLMA 3VFGL 2CLVB 3LMJH 3VFOA 1D6VL 2R0WH 4NQSA 3T0EA 3GKWL 5ALBL 3SOBH 2AJYL 1FV1A 1O7SA 4XNMB 4YDLB 2EDNA 3DETC 7CGTA 2VDPL 4XP4H 1RZIB 3RWIA 3HI1B 1A4KB 2B1HL 4OQ1A 1PAMA 5C07D 1T2QL 3KYKH 3EHBD 4YHYC 1X5XA 1DLHB 4PJXA 4Z8FL 1S7UA 3V4PH 2H3NB 4MHHG 1CQYA 1FFPB 5EO0B 1QRKA 4XVJL 4LPTA 4MXVE 4F15C 3ZZ1A 1LO4L 2VUYA 1CLOL 5I73C 2NTFA 5DZOA 4G8GB 3BIAX 1N7ML 3EOAA 5GRYA 4LSDA 2E5EA 2OZ4A 3U1SH 3QI9D 3QR2A 4PY8I 4PGBB 5DR5H 3T2PA 3MRPA 3K2MC 3HAEA 3CMOL 4RX4A 3DVIA 4QT5A 4QY8B 4ZTPL 4F7CA 3EO0A 2C3HA 5BCAA 1QEWB 2NY1C 4RGNB 3TBVB 1BJ1H 5F7EH 3ECBA 3F7VB 5JOPD 3EIFA 3BKCH 3HAEH 4L8DB 5GSRA 5E8PB 5DJ2A 2FECI 5D2NB 3DROB 4FP8L 4XZUA 3SKMA 1YNLL 1F4AA 4RFNC 4WU5A 1Z9OA 5DEGB 3LEVH 4WNQB 2I27N 3W9DA 5E4EB 4A6YB 3M17B 3SO3B 3TVMB 1CD1A 5DVOA 4GRLD 5JR1L 1T83C 4G42B 4OUUA 3BN9D 3IFPB 1TZHA 4CW1A 1HDMA 4JB9L 3I75A 4MB3A 4LHUG 3ULUL 3PGFL 2W65A 1KOAA 1I9RL 1R5WA 3KPSD 4LVEA 4ONGH 4KVNL 1AGCA 3W2DH 1RZGB 4J1UB 3EYVB 5DJ0A 4MZ3A 1U36A 4GW4A 3QEQB 3MSPA 4BUGA 5I2IA 2J6EL 4IRZL 2DQCH 3RFZC 1D5XA 2EC8A 1QBML 4R97C 1FORH 3V0VA 5FDYA 3QUMA 3BISA 3R4DA 2GSIB 4XWGH 4BKLA 4HWBL 2YD2A 3F6LA 2JIXB 2WBJC 1MI5B 4Z7QE 3GSNB 1TQCC 3EOYG 3RDTC 1WK0A 1T66D 5DVNA 5HHNB 2EH8L 4PRBA 1DCLA 4EVNB 2YD9A 3FO0H 4ERSH 1X7QA 4FZEL 5DO2C 1MF2H 5BQ7A 6CGTA 5D72L 3TYFB 3HNSL 4NKOB 5DJYA 3OHXB 5I71B 2BY1A 3FQWB 3ME0A 2WUCL 2C26A 3OAYH 3ZL4H 2EDHA 2DWDB 1FLTX 4P9HH 3MUGA 5C0FA 1E6OL 5JMOC 4JO3L 1J18A 1X44A 2E7BA 2F53B 2OJZL 5FAAA 3DGCR 1Q0YL 3PGDB 1YNKH 4YUEL 1J1OH 1PLGL 1HQ4A 5KSAA 1PBYA 3PV6A 4Q9CA 3AROA 4HW6A 4NO5A 2P7TB 1DEEA 3GB7B 3V6FA 1WWCA 1A22B 1RFDL 5C0RL 2Z4QB 5D2NC 3WS3B 4UQ3B 4U1JA 4OV5A 1Z9MA 1C1EH 3TNNB 3G6DH 1MIEH 2DJ4A 3FL7A 1UXSA 3A6CH 4OV6F 1CZ8L 3B6SA 1ZHKB 5DRZA 5JPNA 1RVFL 5AG9A 1NCAL 3UYPA 2BX5A 5CINH 4U33A 4PJCB 3QZWG 2A9NL 1HHGA 2ZSVB 1QHPA 1YMMB 2MCPH 1LEGA 4M5ZH 3TJHD 2B1AL 4PJ8C 4ZO8A 3DI2B 2FH8A 1I1FB 1JNHA 4WO4A 3GSUA 4HJGA 3JWDL 3FB8B 1RUPH 1M7DA 4MJID 3NCCB 4FQIL 5HHME 1VERA 3QIUB 4FXLA 5TF1L 5EDXA 1BLNA 2VLJB 1SJEA 2ZUQB 1CL7I 4ENEC 4MQSB 4KHXL 4M7LH 3MRHB 3C5JB 3FT3B 2GK0A 3E6FB 2GTZA 3DECA 3I3DA 3MV9D 3QXAA 4JY4A 1AHWB 3L5IA 1IGFH 4ORGA 5ICZA 3HLAA 3KHQA 4OAWA 5IJVB 2XN9D 3FHQA 3O6FC 3NFNA 4IJ3C 5HXMA 3VGBA 1FG2A 5HDBE 5J6GA 3HR5B 5EU4B 4X4ZA 3GRWH 2OSLA 3ZKNC 1PSKL 4JQVC 3UBXA 2DL9A 1YC8A 3KXFD 1B4RA 3CCHB 1OL0A 5EU3B 3PP3H 1FPTH 3HZMA 2JF1A 1EX0A 3H9SB 3IDXL 3BPNC 1SVCP 1LO3H 1A9BA 3FFDB 4MA7L 3TC9A 3QHFL 35C8L 2NZ9D 3QWRA 3RGHA 4MD4B 2MJWA 4NJAH 1G84A 3G6DL 1CICC 4QYOA 5F7FA 2I9LB 1AGDB 2WV3A 5EBMA 4JLRB 5IBLD 1RMFH 1E27B 5I66A 5E5MB 3MLZH 4P5TA 4K07A 1D6EB 4UIKL 1C5CL 2KUTA 4V2CB 1AKJD 4JHAH 1QFHA 4LBEB 1P9MC 2W59A 1U8IB 3CLFL 1OAZL 5TDPA 4XHQA 2WIIA 1FRGH 1YMMD 4PJ7A 3JWDH 3PWNA 5I1GL 4YQXH 3I3EA 1LO2H 1GJIA 1MNUH 2PTVA 1KTLB 4OF5A 4MS8D 3HNVL 5DMKB 4HIJA 3ARUA 1U58A 3ILPB 4FHBD 3GSXA 1H15B 3QJHB 1CQKA 3TO4B 2VDKL 4UINH 5MEOA 1Q0XH 3K2UL 1A1OB 5HHOB 3BW9A 1NAMB 3LSOB 1UM4L 1KCLA 4JZOB 4NQDE 4QRPB 3VFNA 4X6BB 5FO8B 3QIUC 5F1NA 1BQLH 4K9EL 4PY8J 5T1DH 3T1FB 3C5ZA 4JM4L 4I0KA 3MRLB 3U36B 4O2FB 1CLYH 1EMTH 1B0GB 2WUBL 3CFIC 3E3QC 5I71C 1UH4A 1P9MA 2JK5B 5IG7A 1NLBH 4XVTH 4OQTL 2P5WD 4JAMB 1T1YA 1G9ML 3D9AH 1B6UA 5JXED 1H5BB 2JJVA 4LKCA 5TPWH 4HAFA 1Q8MA 5E0QA 3JWOC 3QWOA 4OD2B 3AREA 3SN6N 4N8VG 3LS4H 4TUJB 4Y4HD 1CL7L 3SKJH 1JHKH 5EUKA 1LD9B 1ULVA 3VXPA 1G7MB 1BQHG 3ULVF 1F6AB 1ZT1A 3I6KB 4LIQE 4ODWA 3HUJF 2VXTL 7FABH 4U1NA 3BEWA 4ODXA 1CICB 3QHTC 5HD8D 4PYHA 5B38G 4YXKL 4PBWD 3KR3L 5CJOL 3SE3C 4APQA 1QLEH 2HVJA 2HWZH 3TYGH 3VCLB 4WWKC 1I7TB 4NOFA 3CFDB 3TWCL 2W07A 3DTXB 2H1PH 1A1NB 1ZLWH 3UAJD 1EO8H 4E41A 1QA9B 4HUNB 3DMMB 2OLDA 1VENA 3RIAK 4ONFL 4LSTH 2FEDD 4X4XA 3RWHA 43C9B 2DQEL 2HTKD 3ULVL 1RULH 4GAFB 3QHZL 4KRMB 4HF5H 4ZFOL 2Q76B 3BIKA 5HVHB 5AYQA 4NZUH 4WFHD 1MFEH 1JZ6A 3IDNA 1QSED 4HLZH 4TNVK 4E42A 1XF4A 2EYSA 4Q9RH 3GMPA 4NKIH 5GGTH 3FB7B 1AGFB 1RIVL 1DFBH 2JE8A 2NR6C 3VXSA 2P8PB 1S7WB 1J0JA 1FNSL 4R7DA 5GGQH 4JFED 3PWUA 3VFPA 4J6RL 1XGQA 4Z78A 1TENA 1ZLWK 2DS4A 1A3LH 4I0PB 4ZPVA 2XPGB 4DW2L 3RGVA 1TVHB 2NNAB 3CFKB 3GDBA 4PUBH 4NM8L 4IOIB 2EIZA 5GZNC 2I07A 1U41A 1ZA3A 3ZKXB 4YHNA 1EZVX 2ICCA 4HJ0C 3DVNA 1INEL 2IFFH 5TH2B 2R29L 4DGVL 2YD3A 4QXUL 1J05B 4RFEB 2VLME 3L5HA 4MD0A 1HNGA 1FQ9C 2WIMA 1HSAA 4H25A 4PJHB 4U3HA 4Y4KB 3ZLQC 3VD4A 3KDMB 2VXQH 1T89C 2HLAB 2VXUL 5ITFA 3VXUB 2JCCE 1Q94A 4NGHH 1NBYB 4U31A 4JFZL 3B9AA 2CK2A 5F6IB 4YDKH 1GL4B 4LSPH 4U6YA 4A2MA 3DV4B 2OZ4L 3GRWA 3RHWK 3VE0B 2EE2A 3L6FB 4Q0XH 4D9LL 3ARFD 4O00A 1I1AD 3T0AA 2X7LA 5EO1B 1T04A 3MXWH 5B3JF 5BZDA 2PR4H 3BI9X 2VQ1B 3ZSTA 1JZ5A 1WLHA 3MJ6A 1UCTA 4Y0GA 1EJOL 5DLMH 4DFIA 1R3KB 4LEXH 3VXRB 4P2QA 3WYRA 1EERB 3ARXA 3WS6A 3N85L 3NPSB 5ANMB 1G6RB 4ZAKC 3UC0H 3H9HA 3G5VB 1KB5L 1SBSH 3GMNB 4FZEH 4JM2D 4QNPF 4Y4FA 1MF2L 1BFOA 2X4SB 5IBLC 3HI6H 4NKDA 5LQBL 3BRDA 5I8KL 1NC2B 4OD1L 1UZ6F 3EJZD 1MHCA 1HXYB 2D3VA 1MQ8A 4Y16A 3PWPE 1T03L 5FGCB 1VCAA 3OX8B 3QCTL 4OCRL 1M1SA 4KY1L 1HE7A 4MB5A 5L8LB 1T80A 3A6CL 2IANA 1XGPA 3T0ED 1KYOK 4PYGA 4FQJH 4M03A 4U2ZA 4Z18A 2VQ1A 3EOTL 4RFOH 5DD3H 5IJKC 4X6CE 3X3GH 1T04B 5JW3H 4DGIH 2W0LA 1J1OL 1X4YA 5CD5C 5FFLA 1MFBL 3L6FA 3NIGF 12E8H 5DA4A 4N9GA 3DURB 3HMXA 2B8OT 4QTHA 4KFZC 4TUOA 3B2VL 3D69A 1KSRA 1C1EL 2O5XH 3QEQE 3X14B 1OLZA 3IYLW 1OAQL 3B43A 4XB8A 1DSFL 1NBZA 5I19H 5IB4B 1M4KA 4J3VA 3CDGA 3U0WL 2JELH 1D9KC 1WWWX 2R9HC 4JKPH 1N4XH 2I60H 1HKLL 2P24A 1AC0A 5JIPA 4Y19E 5D2LF 1OY3B 3IXAA 4HJJH 5FO9B 1C08A 1FZKA 3D2UA 1CGXA 5T3ZH 3V8OA 2I07B 1EA9C 2F54D 2XPGA 2NY2C 4U1SB 3V4UL 1FH5H 4HEPG 2AJ3B 4NFBA 3RGVC 1A7NH 3UPAA 5IBTL 1BVKB 3U4EB 4N90E 1HYRC 5MENB 1BIIA 2N56A 3VXSB 1A7QL 2VXVH 3MPCA 1BD2A 1KLUA 3VXTA 3WXWL 1XF4B 3HE7B 2KBGA 5ELIA 1TQBB 4N8CL 1T1WB 1JWSB 4N5UA 4B53A 4L8BA 4CN6A 4NYLB 2GFBB 4NM4L 2DYPB 3ZKMC 2HJLA 3NGBB 1OB1B 1JPST 1EO7A 2R23B 1FIGL 2APTA 3BSZL 4HKZB 1RK0B 4KVCL 4C56E 1HWHB 3LD8B 3BD4A 4I2XA 3TVMC 4L4TA 4TN9A 4GAYA 4OFIA 3T0WA 3V4PL 4NQDD 2R2EA 3VRJB 1CFQA 1U8QA 3LEVL 4PLOB 4PBXA 3WL9B 1A1NA 1WZ1L 1RJZB 4PTTB 3GMOB 5AEAA 1B0RA 4CJ0A 1EH9A 4ODSL 2FRGP 4QHUB 4PGEB 3QDGB 3O9WB 5AWNL 1RUAH 1U3ZA 1CICA 1LE5B 1P53A 2M1KA 1S9WA 2YKLL 4ODWB 4NJAL 5IIEB 1ZT1B 3I6KA 1J87A 2X5PA 3DSNA 5F1IB 5FYJU 2AXGB 1G7MA 5I1IH 5D7JA 5FA4A 5D8JH 4K55A 4MNQB 3HG1A 4X99A 3S35H 1QFWM 5HVFB 1KN2H 5DQ9B 2D31A 2H26B 2X4PB 1VFUA 2VDKH 3HUJE 4CU7A 5E6IB 1P1ZA 5C08B 4XNYL 4K71C 4OIBA 2DM4A 5GHWH 1CVSC 3T09A 1TCRA 3HG1B 4NC2B 2FIKB 4FFVC 2VJXA 4NWUH 4FQCH 1BF2A 4NNPH 2Y7QA 5I1GH 4BYHA 3SPVB 4K3DH 5IHBA 3U9UA 4XC1L 2NMSA 2BHZA 4WW2C 1SQ2N 3RVWC 3RBGA 3P4MA 1PEZA 4LRIC 4IHOA 3NBNA 4U6HA 1X5FA 4QHUA 4X7SL 3U36A 4G6KH 4EDWL 5I1HH 3VFUB 5KSBE 4X6DE 5D72H 3U46A 1G9MH 2PETA 4OI9A 4WGWB 1UM4H 3NIGE 3PG2A 5D93B 5CP3A 4DGIL 2ADGB 4IS6B 3S9DB 1AR2A 2Q20A 5TFSL 3RL1B 4LVHB 4S2SB 5F3BA 4EUPH 1SM3H 2DOCA 5GGUB 4MJ4A 2JTDA 3L5XL 1KC5H 4XBEH 3FT4A 1YEJL 3PDOA 4XCFL 1LDPH 4GBXC 4BFGA 4FXGA 3QUXD 5FGBA 2BOBB 1A3RH 2ZCLL 1BFVL 3ABZA 5I75B 4HPOH 2JELL 1F4XL 4J3UA 3W82A 2VLRB 3DIFB 4GKZA 5M94B 3NCBB 4P5TB 4NRYB 3TN0D 5H37H 1CZ8H 3MLUH 1IAOB 1WICA 2OYPA 2BERA 2A1WL 1XF2B 1WWBX 3A6OA 2G60L 4EN3B 3D2UB 1C08B 4JQIH 1VFMA 2H2SD 2OL3A 3IXAB 2CRMA 3TM6A 2DM7A 3C8KA 3VXOB 4D2NA 5C0EB 1UM6L 2ICWA 3CDGB 3K4AA 1KB5B 4L4VB 3S4SA 1BF8A 2DLIA 2J8UF 1WBZB 1A9BB 5IB4A 1A21A 1T3FB 3F58L 1CK0H 3H9SA 4JZNA 5SX4H 2X09A 1BGXL 4F3FA 4K71B 4HX1B 32C2A 3KHOA 4LASL 4ZDHB 5LGHL 3JSSA 4Z7WA 1A6VL 5C1MB 2B7DT 2JKXA 4QXTA 4P2YA 5KVGL 3KPMA 2OK0L 2AKRB 1NDGA 3WN5B 2ICEA 3CU1A 4PJIA 1T7ZA 4OGAC 4MX7A 4OZ4B 2IANB 4JY4B 2ED9A 1PVHA 3WIIL 5F7UA 5CBEA 5SWSB 5KVFL 2J88L 2VE6A 3QG6B 1F3JB 1YEHH 4YBHA 1JIBA 1SYVB 3O6FD 1FNSH 4NRXA 4PJ8A 4IDLA 4DZ8A 4J6RH 1J11A 3P2TA 3LDBC 4MDJB 3GMQA 3QUKB 4KQ4L 1JN6B 4HJGB 5DHXB 5C0IA 3QIWC 3X12B 5F1KC 3GSWB 1A5FL 3QZWA 3VXRA 5ERWB 3Q3GA 1F90L 2K3TA 1HHGB 1J86A 3WHE1 1CDGA 5JHLL 5IW6A 4ZOEA 3MUHL 3QPQC 3SDCC 2LTQC 4X9GA 4APQC 5JPNB 3KPOB 3W9EB 5F8RC 5KANG 3EGSA 3HZKB 2YWYA 3V0WL 2XKSA 3WD5L 5F6HI 4EXKA 4PD4K 5D2LB 3LKPB 1J8HA 4MNHA 1OTTC 5T5FL 2XKNA 4GLRH 4NN7C 3T77B 3N9GH 1G7PA 5DYOA 4Y5YB 3MNZB 4ELKB 4R26H 3BYTA 1FRGL 2VLLA 2VERN 1YJDL 1X5AA 3CXDH 3MRGA 3RZCA 2HLAA 1HQ4B 2DMBA 4X6DB 3SJVB 3T08A 4B50A 1HSAB 2ZG2A 3SDCD 4DZBB 4MD0B 3GK8H 4KK5C 4LCIL 2F53A 3EO9H 1N64L 3G6JF 4C56D 5FKPA 4N0RA 1EJOH 2VABB 3CC5A 1L7IL 2BY3A 5CZVL 3T65A 3FO9B 4JM2F 3G04B 3NCFB 1ONQB 2AXFA 2DQDL 4XNUL 1QFOA 3LRHA 4F7PB 5ADPH 1V3LA 5EN2B 4IM8A 5CD3B 4Y4HB 2IALB 1WBYA 2P8LA 4O5LL 1XGQB 1E4XH 3LKOB 1JBJA 2ENYA 2P8PA 5E56A 1U8HA 2AVGA 1G9EA 1MVUA 4P57A 5J3HC 4YEFA 4EVNA 4L1HA 4MA7H 5SWSE 4N5EC 1EVUA 2YPLE 1OT1A 3SDXA 3CFJA 1DBJH 4D9LH 1OAXH 1E0OB 2DLEA 2XA8H 4KTDH 4P4KC 2JIXA 1EV2E 1I8MB 2A9ML 4BELD 3BIKB 5SX4I 3F7QA 1HYSD 2Z8WC 3DRQA 2JCCF 4NPYB 1XCQB 4IRJD 5IHUH 3V0VB 2F54E 2NXYC 4JO1L 4NZTH 1RJLA 1R5IA 5IESL 5I2IB 5FOJA 3QCUH 2KZWA 5BV7C 4OB5L 4Y19D 2VQTA 3DUSA 5DGQA 5D70H 4ZYKA 1C7TA 4QXGH 2CRIA 2UZXB 3T2NH 1BVLA 4LSVL 2DIAA 3SE3A 4NKMA 1AH1A 1I7TA 2AJVH 4LLUA 4YGVA 3NCMA 4J3SA 2X4TA 2YRZA 5K9JL 1HDMB 2BDNL 4PJ9C 4LMQE 4GUPA 5H35B 3RWJB 5F9AC 3IS1X 3PP3K 4YPGA 4A6YA 4L9DA 3VXPB 1IGJB 3BWUC 1MFNA 3D25A 1KJ2B 5GGVH 2NY7L 3DXAA 4FFWD 2DM3A 2H8PB 1KBGL 1GZQA 3QWOB 4OD2A 4Z0XB 1NCWH 2RJMA 3PP4H 5D7LA 4O58H 3KYMB 1KENH 2QSCL 3ECBB 3HAEG 3CSBA 4PJ5A 3ULVH 1CBVH 5C0BD 1L7IH 5FKAA 2FX8L 4OFYA 3EYOB 3S35X 4HV8B 2ICWJ 1T1YB 1YNTA 4JQVA 3LAFA 2ZG1A 4P49A 4U1KA 1A7PL 1KCUL 4Q9BA 5BVPH 2P1YA 4O02H 25C8H 2CO7B 4K8RL 4C4KO 1YQ2A 4GXUN 4X6CB 1BJMA 1NFIB 4HULB 3EYUL 3MLSH 3SQBA 4CMMA 3HPLB 2R4RH 2VDNH 3JWOH 1CT8A 2FL5B 4JRXA 5J8OA 2I9TA 1DLHA 1JHKL 4PJXB 1EFQA 4MXWL 1UH2A 3AAZB 4L9LB 4CJ1A 4ZOBA 3MLRL 5MEOB 4WHYH 2NX5E 3LV3B 3MLYL 4KJPC 3HS0B 4LSUH 4PLJC 5SWZE 3C09C 1F8TL 4N8VA 2YPVL 3ILPA 3QIWB 1XCTB 1AE6L 5F89B 5FV2A 4LLMB 3FQXB 5F7HA 4XPFL 1G7JB 4NP4H 4K3DL 1JGDB 3QQNA 4BSWA 3KPPA 4HPYH 1B0WA 5I8OL 5E2VH 4P23A 1L7TL 3QUZC 5JW4M 4W4NA 2UZIH 3PWVB 4NQED 3ZYOA 1NCDL 1NCCH 3F6IA 4P9HL 2W60A 2EZ0D 4F7MB 3M8OH 4NN7B 3WDJA 2OI9B 5BO1L 2ID5A 1MHHA 4PRIA 3SDAB 4CN1A 2XQBL 3ZKSD 3VXUE 4PJXE 3L95B 3BVNA 2QQNH 4QLRA 5F7WC 2OP4H 3FFDA 5AWNH 1OGAD 3N1FC 3O3DB 2HAZA 1W0VA 5T3XL 3EOBA 1N5AA 2BCKB 3UC0L 2JB5H 3F5WB 1CD0A 4U05A 3RUGB 1WV7T 1DBJL 1JV5B 1P6FA 4PS4H 2X4OA 4LLWB 4MLSA 4LLVA 4DW2H 3QIWD 3MRCB 5D7LD 5SX5H 5I1CH 4YFDB 1AD0A 5C0ND 5I30H 2CLRB 5HDOA 5H8DA 3TH2T 3OJDB 1MHEA 1MRCH 3RWEB 2R4RL 3NFNB 3PE9A 1E4XI 1M05B 2V2XB 4NO2A 5E08H 5L7XL 3KYKL 5BXFA 4OAWB 5IJVA 5L0QB 3B9VA 1QD0A 3QDJE 1EFXA 1T0NA 4G8GE 2G60H 2FSEB 4S11A 3DVFA 4PJHE 1T0MA 2ZUWA 3QDGD 3HCVB 4GOSA 1DLFL 2Y23A 3FT3A 2P45B 4NGHL 4N0YH 2ZCLH 2JCCB 3HC0A 4H1LG 2PXYD 5HYSB 2GJ6B 5J0BA 3LPWA 2AI0L 4U6VH 4XP5H 4L8CA 3HMXL 2Q3ZA 4ZTOH 5I1KL 1MFCL 4GMTL 1W2KT 5IT2H 4HS6A 4POYA 2GJJA 1FNHA 1KT2A 3OB8A 3UTPE 1MHPL 4P59L 2AEWA 4TSCH 3MZTA 4HMDA 3HRZA 5F6HJ 1XZ0A 3BT2H 4FQXD 4QHLA 2CR6A 3GRWL 5JIHA 1K3IA 3IFOB 3RL2A 4MA8H 5IK3B 4DK3A 1YEEH 1D5BA 2RFXA 2LU4A 5L6YL 1QYGL 1A1MA 1KN4H 4H26B 1G7HA 3O2VH 5DJCA 1MH5A 4MQXC 4MD5A 2UWEF 1S5HA 1ORQA 1D6VH 1TZGL 3WFDH 4QCIA 5T3XH 1ZA6A 3DO7A 1VHPA 4XHJC 2QQKL 5EOTB 4JFQA 2G75B 4NKQB 4QHMA 1J0KA 3PV6B 4JEGB 1AO7D 1JF1A 4XVTL 3PGDA 4GXUM 4KXZH 4AK1A 4P2QE 4ZSOB 3G6AB 4PJ5E 4J4PD 5JW3L 1NC4A 4Y2DD 5E00A 2E9BA 4HXAH 4ZUTB 1EUTA 3QAZC 4QOKA 5DRNA 4RWYH 5EBWA 1FORL 3CZFB 4YO0A 3CNKA 3TP4A 1MJUL 1KELL 3STBA 2XQYK 5BV7H 3V0WH 3BH9B 3CVHH 3NA4A 4Y5XB 4GW5A 2V17L 4AEHH 1MJJA 5FYKU 5GS0D 3SDDD 3OR6B 3WHXA 3FO2A 1JTOA 3MGAA 1JRHL 1RUAL 2Q7YA 5LGHH 4AQOA 5K9KA 3U2SA 3AXLB 2V5YA 1YECL 3MLPA 1MI5A 5LVEA 4Z7WE 2EEBA 4KROC 2GSIA 4JR9L 4J23A 3TN0C 2DMCA 1KPRA 4UTAL 1JI2A 3U9PH 2AJSH 3ET9F 5HGGS 1UQSB 2B0SL 3EJJX 4TNWF 2E6PA 4HMEA 3EFDL 1CFSB 4JFFA 3ZL4L 4KDVA 3SKNB 5BVJA 4XI5C 1INDL 4AG4H 4MQTB 4P23C 3D85D 4I77H 1YEGL 4MCZB 3ZT5A 4LU5H 1ZT7A 3C8HA 3KJ6H 2Y36L 1VFOA 3GHEH 4CW1B 1IQWH 2BVPB 3GK8L 1J5OH 2ICWI 3A67L 4WU7B 5DQJA 5H94A 4PRHB 4Z7OE 3ZKND 3JV4A 4HBCH 4C83A 1CDCA 1DBAL 2DICA 4OF3A 2A77L 3QPXL 1ZHLA 2ESVA 5KOVC 1OAUL 1FNGB 5HGHA 1XF5B 3WJJA 5KZCB 1I1YA 4JFEB 2V7NB 3QO0B 3K74B 1KNOB 3O9WD 1KCRL 2QADB 4R0LB 4QWWC 4G6JL 2VXTH 3H9YA 3QRGH 3EO0B 1OD7A 5K93A 1NKRA 3B9KD 3VWJB 4ONHA 3HAEB 4D9QD 2V6HA 1KIPB 5GJTH 5KVEL 4R90L 3NFSH 4YXLH 4IIQA 1DN2A 5MEPA 4U6XB 3CJJA 5KBNC 2X1WL 2NTFB 4RBPK 4Y16C 2HG5A 3FTGB 4JCMA 4Z7VE 1MEXH 4G7YL 5CS7A 4Z7NE 1IBGL 3LB6D 4LEOA 4M7LL 1CFBA 1U8OB 2FD6L 4I5BB 4JPIB 5ILTL 3BGMA 3KS0H 2Q6WA 3ARFB 4P3DB 4AL8L 1OARL 4HIEA 1NCNA 2X89A 3SE4A 4OD3H 3BN3B 2MNUA 1DE4A 4PJEA 3DXAE 3BKML 3ARBA 1B4JH 1CYGA 3G6JE 2AJVL 1WAAF 2AABL 4M62L 4OCMC 4Y89A 3RDTA 1LP9F 2HLFC 1CI5A 1T2XA 4NQSB 3T3PF 3KWWB 4OBSA 4O51B 1A3LL 1UB6A 1YN7B 5ACZA 2XG5A 1QSZA 4L4JA 4Z7VB 1CDHA 1S9XA 1K9TA 3RHWF 1IQWL 5IB3A 4JVPA 1MCBA 1JK8B 4YDJB 4BFIB 5I17B 4XMPL 1L6XA 4I0PC 2DKSA 3NPZB 1RZ8B 5FDWB 5I9QC 4YBQC 4NZRL 2F53D 3A6BH 3WNOA 4PTUB 1QLRB 3I84A 2IEPA 3S3JA 3X3GL 1K8IB 2DKMA 3MLRH 3HC4H 3RIAF 3CVHL 1G7IA 4AENA 4EI5C 5I1JH 4P46B 4LFHG 5H2BA 2R2BB 1DN0A 1MVFA 3MRBA 4OIIL 2BOCA 5JDSA 4RAUA 5EZJA 4JANB 1G7LB 5IBUG 5C0BB 4ORZC 3NIDF 2VDPH 4XP4L 4YDVB 2APXA 4LCYB 4KPHL 5J12B 5FUOL 1AP2B 3MO1B 3NN8A 4HPYL 1S7TA 2VLJE 4U7SA 4UDUA 4XWOD 2IQAB 2VIRA 4YZFF 1SY6H 1F00I 3SDCB 3T3MF 1MIMH 2HFEB 4L8SA 2YSSA 2VLKA 4S1RL 3VXUD 1T7XA 2PO6A 3G08A 2HN7A 1S7XB 2ZP0T 2VDOH 5E8DL 1G1CA 3BGAA 1F58L 5L2JA 2EEAA 1N7MH 3EJYC 1HHJA 3C09B 5ADOH 1P7QB 3IU4H 1FVDB 4NFDA 1JZ4A 4WUUE 4XPHH 5EO9B 3RRQA 1FAIL 1UM5H 3MRFA 3PHOB 5DJAA 2FX7L 5DJ8A 4CVXB 3RZCC 4D0DB 2EC9T 2DQTH 3BD5A 1I1AC 3LEXB 5HI5C 4HH9B 1QSVA 3AY4A 4QRPD 4NWTL 1JUFA 2BNRE 2J8UB 1SEBA 3SHSA 3NABL 2CLZA 1XIWD 2Z91B 5T1LA 4JFOB 3SE8H 1HHKA 4U7MA 1FVEA 1F4WL 4JM2B 3O41B 4YH6A 5A3ID 5KAQF 5F21B 3ULUC 2VUOA 5C0JB 2WK2A 4WWKA 5KG9A 4JFOA 3B5HA 2UVFA 1WZ1H 3D85A 3ARDB 3RX5A 2BNRA 3MJGX 1JPFA 1J10A 3F62A 2AGJL 5ISZA 1QLEL 4ZTOL 5I1KH 1WC7A 4PRPA 1OM3L 5CKAA 4X0KB 4EOWL 4XP1H 4NQEA 1ITBB 3ZDZE 1KIUA 1FYTD 4G9FD 2X4QB 3OKMB 5I1IL 1TITA 2VTFA 4M1DL 3HNTH 1QFWH 5C09A 3BOVA 3MREB 1FZMB 1NLDL 1HZHH 3TA3A 4KZEL 1X5YA 5DA0B 2WLZA 1T5WB 3C9NA 1FE8H 4R7NB 2PO6B 2QQNL 3K4DA 5L0QC 4OLUH 3A0OA 4YFLF 2YSSB 4M61B 4YE4L 4TQEL 4DKEL 5JOFA 5D1XC 4Y19B 2VIRB 5J9PB 4GG6E 5CEZH 3CMGA 4UDUB 2QQQA 4GKSA 4X6CF 5F9DC 1FFNB 4UUJB 3IETA 4PJ9B 1FFRA 1A2YB 2R4SH 5EOCL 3MRNB 4I4WA 3KLAA 3WFHA 4ELMF 4YHIA 3TA3C 4N1EA 5ECJE 3KXFE 3Q6FA 4NOBA 3WFEL 1CGSL 4AIOA 2BXYA 5IW3A 4ZNEE 1U3HD 3BRFA 3I9GL 4HWUA 3QNXB 2H6PB 3AREC 4RAVA 3V4VH 4CAGA 1C16A 3VW3H 1H0DA 2VWEE 1YPZE 5I8EA 4JG0H 1HINH 1EFXD 3PWLA 2V2WA 2DIBA 2ZJSL 4NQXB 4RBPH 1KTDA 2VYRE 2R9HD 1WJ3A 4XVSL 5FDWA 3VFMA 1A14L 1OAYL 5EIQA 1HWGB 1JK8A 3WJLC 1LK2B 1I7UA 3O8XC 4MXQD 2AJXL 3N0PB 2HKFH 4WENB 4C56B 1IZJA 4N0FA 5HHVL 4FXKA 4WV1B 5DT1H 3GM8A 1IJ9A 2W9EL 4KC3B 4O51A 3VFSA 3NCJL 4ONFH 3SEPA 4LIQL 5CBAA 3NCYP 3D39D 4Q0XL 5BZWB 3AS3A 5DF0A 2XWJA 3PWPA 2YC1B 3X13B 1MLBA 2ADJA 4M5ZL 3ARBB 3MLUL 1CGUA 1EUUA 3MV7A 1DBBL 1I1AA 3TPKA 2OM5A 2VDOL 4QXGL 1QFUH 2A1WH 1QFWL 3MROA 1JGLL 2Z93A 4OIAA 4M9OA 4NT6B 4HWZB 1JWUA 1UB5B 3QIUD 4JPIA 3RUGF 1A6UH 3GHBL 3J7HA 4RISH 3JV5A 2PO6D 2W0FA 4HG4J 5HYFA 2CUMA 4LKXA 4ZODA 4PG2C 1FPTL 1CK0L 1MIEL 1JWMB 3K3QA 2SEBB 2SEBA 4PY7B 3QUZB 2D7TH 3ARSA 2C4FT 4F8TA 4G6ML 2YZ1A 3BQUB 1KIPA 3MUJA 3U0TA 3LZFL 3VWJA 2Q86B 1F4WH 3QQ9C 3V7AG 3VI4E 3BUYA 4PJGA 1RUQH 3IDGA 1M7XA 5HI3C 5HYJE 4XMKL 4ISVA 1ZWIA 2QLVB 4JFEA 1I1YB 4BZ1L 1I1AB 4XH2A 3TLRA 4NC0B 1MCNA 1RD6A 3MLYH 4QF1A 1PZUB 3LMJL 3D5OF 4PRHA 3S34H 1FO0H 1ORSA 4GBXD 1QLFA 2XXMB 2EIDA 5KSVA 2FH6A 1W0WA 3VGHA 1UXWB 1IM3B 2OL3H 4WV1A 1KJ2L 2QADD 5JXEA 3HE6B 1ZLUK 4GLRI 1UWGL 2VITA 2VZSA 5CWSA 3IKKA 4ZFFB 1N26A 4RX4D 3MRKA 3H3PH 5JQ6H 4UV7L 3S88H 2VAAA 1KTDB 1OLLA 1F45A 1FDLH 2GQHA 5BVJB 1IGYB 4NQXA 3WNKA 3UX9B 1U3JA 2ARWA 4FZ8L 1PY4A 3MV8E 1FSKC 3CLFH 4EN3C 2EH7L 3BESR 4YHZL 1A6WL 4LP5A 4KKLD 3E2HC 4QGYA 5C92A 1CG9B 5DZLA 3RA7L 1WEJH 4FMFA 5DUMH 4ZFOB 5HHOD 2EECA 2YHGA 4YEEA 3RKPA 4KMQA 1QG3A 3DLQR 4P5KA 5EORH 3WFHB 3ULUH 4OLZH 1AQDB 4NZDA 5F72S 3OR6A 2D4DA 1YYLL 1F11A 3AMLA 4UUJA 3UDWC 4ONOA 4GW5B 3DBXB 2KKQA 4L8SC 4ODTL 1BMGA 1Y18B 1RZKC 4Q6IB 4M61A 2R0ZL 2YS4A 2K7PA 3DJ9A 5GSVA 3VXMD 2IG2H 3EDEA 3BFOA 4UT7H 5KVFH 3S8WA 2HMIC 4KI5F 3PUCA 4PJ8D 5E00B 4NNYB 1N2RB 1GOGA 4E0RA 2B2XL 2CXGA 1LO5B 4CGTA 5BMFH 4M1GH 3OKMA 5LBSL 2IBZY 3QDMD 4NQEB 1DQDH 3D3VD 5IFHH 2AV1B 5K59F 5HTSA 5HJ3B 3R1GL 1AXTH 5BRZB 5C0AE 4G7YH 1JPFB 1Z9LA 2RCSH 2BNRB 2J8UE 2EXYD 4I1NB 1VGEL 4NC1E 4W4OC 4ZS7H 1MH5B 1UWGH 3KPNA 1OARH 3C08L 3QEUA 4JFPB 5L2KD 4GRWE 4PJBA 1H3GA 3UXFA 1XGTA 3HC4L 3S96A 1HSBB 3DUUB 5EULV 5F9JB 3QFJA 4JG1H 2WUBH 4GKNB 1I8IB 3G5XB 4I0CC 2VZUA 2C3VA 3IU3B 1RZ7L 1JGEB 1UJ3B 3BQUD 4HZAA 4HH9A 2P43B 3CFEA 3MBED 4PIRF 4BK4A 3Q5TA 4RZCB 5C0BE 1BWWA 1A9EB 4HK0A 4U1IB 1J0IA 2YUXA 1Q9LB 3I6GB 4UILL 3JV0A 2DM2A 4TSAH 5L2JB 5JORB 1EBAA 4I3SL 3WNMA 4Z0BL 3RIFK 4JJ5A 8CGTA 4X6DF 5F7LB 1S8DB 1JCKA 3EFDH 1FIEA 2W9DH 3HRPA 2HFEA 3RI5F 3SJVD 4OZGE 2CLRA 2OMNA 1FO0L 2FWOA 4TTGA 2DKUA 4GRWB 4YR6A 4WI9A 1E6JH 3MO1A 4J4PA 4PJIE 4LCYA 2IFGA 5INDB 4FQQA 5DJ6A 3RWGA 2XIDA 4XP6L 1G7LA 4UIMA 1IGIH 4PUBL 1NGPH 4LDEB 4P2RA 1JYNA 3SCMB 1BECA 3BVNB 1G0XA 4V1DA 5C6TL 2XWTB 1T2QH 5EZLA 2ORBH 2NR6D 5IHLB 1F58H 3ZO0A 1Z2KA 1N6QL 4LSVH 2IF7A 2UV3A 3FQTA 5DC0A 3GSOB 5IW1B 3RDTD 5KAQG 2D0GA 3FRUA 3EHBC 1WEJL 1ZS8B 3PWVA 4OCXL 4HQQH 4NJ9H 3KPRA 1LILA 3H6JA 4YDKL 1VEMA 1HOCB 4IRJB 1U6AL 3ULUE 1S9XB 5T1MB 2V5TA 1BX2A 4HUXB 4MNQE 1OQXA 3RWCB 3H9SD 1NKOA 1TJIH 3OXSB 5IEKB 4NM8H 4L3EE 4L3AA 1CGSH 1XCTA 4AYFA 2M26A 1H3VA 2Z8RA 2CDFA 5J1AA 3TPUB 2IAMD 3HS0A 1RJCA 3PQYD 2A6KA 2A6IA 4KUCD 1VKXA 4OFVA 1IM9B 1HN1A 1E4JA 1WWAX 2IPUK 1S7VB 1CT8B 4JPVL 1LO0L 4G6JH 2APWA 3IF1A 1C5CH 4XB7A 2ARJB 3HPLA 3QIBA 4CMMB 5E9DD 5HGAB 1YEHL 3VGGA 3O4OB 2FHBA 4XC3H 3SDDA 5AZ2L 2PYEB 4G8IA 2ITCB 3QCTH 4OCRH 2O5XL 3STLB 4IIQB 3GSRB 4NUGH 1KPVB 2CDEB 4V1DD 2CK0L 3HNTL 4RNRA 1ZHBA 3VH8B 1L9MA 1MOEA 4D94A 1QHOA 4HV8A 2C1PB 3VXSE 3EYOA 3K2UH 4DUVA 1HK6A 4LAJH 1AI1L 4YFEA 5HPMA 5DQDH 3ETBF 4PP1C 3SKUD 2E6JA 5D7LB 4MQ7B 2WP3T 2B4CL 4DGYH 3MOQA 4RGMB 4G8FB 1GOFA 2H8PA 1PY9A 4K8RD 2APVA 5HGHB 2X1QA 2J6EA 1IEAA 5KS9A 1ZHNA 5I1JL 1H3TA 5GGSB 1IEBB 1LP9B 3BDYH 5IB1A 4Z9KB 4J4PC 1C8PA 4M6NL 4GUPB 3U0WH 1MI5D 3LKRB 4O2CA 3T4AB 1FGNH 5EC1A 1BQUA 3KLHC 1ZT7B 3IGAA 4X6EA 4YGVB 1Q9WA 4LLUB 4XNXL 4MCZA 1RHFA 3MBEC 1S3KL 4Y5VC 1HEZA 2AAVA 4YK4B 5FUZH 2HFFA 1BVLB 1N64H 1L0XA 4R4FL 2CRZA 1P4LB 3DUSB 2GY7B 5DMJB 2QSQA 5HGDB 1NFDA 3KPQA 2LABA 2X42A 1AD9B 2APFA 3QO1A 5B39B 1Y6MR 1YNKL 4OJFH 5D5MF 1FL3B 3MOAL 1DQLH 1TQCB 1RZJH 3QIBC 1CFVH 2FECL 3WEXA 4A2LA 3M07A 4OZIB 3NFPA 5MHSE 1ACYH 3AXLA 3PL6D 2P5EB 1U8LB 4DVBA 3KR3H 1OCWL 3D3VE 3I50L 3IFNH 3FO2B 5F1OB 2A74A 5B4MC 3S5LA 3CVIL 4WY7H 1NUDA 4NO3B 2OMBA 2EDYA 2KQNA 1ZEAL 4NUGL 1GYAA 4JM2C 3VDCA 1JGLH 2DAVA 4PJCF 1UWEH 1LK3L 5SV3A 1F5WA 3O3AA 3WO4C 1Q72H 3U4BL 1T20B 4HHAB 1VACB 3U0PA 4KHTL 5E7FA 5HI4C 4N68A 3C87A 5EU5B 1MWAA 5SWQB 2DTML 1N5YL 1H5BC 1JGVH 2X10A 3MNWA 1N0XL 3THMH 3B5GA 4FQXA 1I1RA 1EGJA 1MQKL 3BP6B 5MI0C 3FAWA 2PCPA 4XTRC 3WHE0 4DKDC 4QHMB 2ZKHH 3MOBH 3O6MH 1MHPH 1D5IL 3P77B 1ORQB 4MD5B 1QPXA 4H26A 3NZHH 3MLTB 4U3XA 4GG8A 4YWGL 3IDIB 2YPLA 2ATPB 5INCB 3EAKA 1CICD 3KYAA 2NXZB 3UPCA 4KRPC 5B38A 4K3JH 1AQKL 3EO1A 1PKOA 5B3NA 4FQCL 3MV7D 4JREB 4O58L 3TBTA 3OF6A 1V05A 1F2XK 3VMPA 3MNVA 3FN0H 1HI6B 3Q3GB 4XBEL 1P84K 2B2XH 1IKNA 3QZWB 3RPIA 3QEHB 2CIKB 4KI5E 5JPMA 3X12A 4HIXL 1NFKA 1BQSA 1PKQE 4BZYA 2PYFB 2BSRB 2R4SL 4Q7DA 5AZEH 3GMQB 5L8KB 3S4SG 5IOPA 4MDJA 1OTUD 2CK0H 3BEVA 3IVKB 1I8KA 4BFEA 2GJ6A 3MV8D 5I8CB 4I3RL 5BS0B 3V5HA 4PPTA 2GW5A 3CSPA 5KSUB 2GUOB 1S7SB 2GYSA 5GIRA 1HHHA 3MV01 1VESA 1T0MB 4AMKL 3BZEB 1R3HA 4PRPD 1YUHB 4PJIF 2ZOLB 4WWID 3P9MB 1MREH 2RIKA 4XCEB 1OSZA 4AEHL 3GUTB 1BBJB 3EYQC 1OSPH 3RWEA 1RSFA 3JXAA 5CHNA 1MWAH 1TJGH 2V5SA 4WHCA 4QRRD 3T0DA 1JPGB 3O11A 3B9DA 3MRCA 32C2B 4LHUB 3RVVC 4LLVB 4NFCA 4D9RD 1A0QH 1GH7A 5CUSL 4F57L 5HDQL 4ZS7L 1LO3L 2HMID 1T7VA 3SBWC 1U42A 1N5AB 1BAFH 2BCKA 4YAQB 1AJ7L 1W0VB 3OKOA 4HS3A 1L7TH 5TFSH 3QXUA 2R1XB 3EZJB 2HRPH 1OTSD 5KVGH 1NGXB 4JY6A 2LV4A 4HLZG 2FX8H 3SDAA 4L5FL 1DBBH 1UG9A 1T6WA 4LQFH 1XF2A 1JHTA 3OKDA 4OCWL 5I15L 2DQUL 1IAOA 4LHUA 2GT9B 3DNKA 3D39E 1GGTA 1V7NL 2A6JB 2I5YH 3O11B 4JHBA 1JPGA 1NQBA 2VLRA 1JHLH 2WNGA 2D03L 3BP4B 3KPPB 5JXEC 4EN3D 5CMAA 3AY4C 4PRDB 3L3HA 3L7FB 4RQQB 3JWOL 3HMWH 4L3EB 1ZLSL 1CR9L 4DVRH 1RZKH 1NGPL 1YDPB 3FT4B 1C12B 1LK3H 3RAJL 3TBWA 5T5NF 3P73B 3PL6A 3MODL 1T1XA 3BZ4A 2ZJSH 4GAGH 5HYEA 2X4UB 5EIVA 4LSUL 3OAYK 1X5LA 2FLBT 4XVSH 4C59B 2QJDA 5I8CA 4HUKB 3RL1A 2HT4D 3TZVD 4L9LA 2J2ZA 1Q9OB 1DZBA 3QDAA 3BEVB 1UH3A 3BH8B 2FL5A 3GBMH 4KUZH 5IMMA 5E2UL 5TDNA 2IGFH 5A2IH 1B2WH 1FNEB 1LEKB 4PJHF 1A5FH 3UTOA 5CGMA 1OWWA 4U6HB 5I8OH 3F7YA 1DUZB 2N4IA 3FB6A 2BJML 3MV11 3BJ91 3LKSA 3QIBD 1RQ5A 2VDLH 4UILH 3O4LA 4S10A 4KGJA 3SGEH 3QISA 2E3VA 1OP5K 1G6VK 3MGOB 4AL8H 1LEIA 3ZHKA 1JVKA 2CSPA 2FIKA 2YPLB 1KCSH 3HPJA 4JKLA 5FKAB 4YLQT 1KACB 3KYMA 5JXAL 2J88H 4ODVH 2XKUA 4RAHA 4S0TD 4M7KH 4XMKH 4R4NC 4TOYL 4JB9H 5A1AA 3DXAB 3MRDA 2X4PA 1MJ7H 1A7QH 1DBML 2OR9H 2VXVL 4JFDA 2PCPB 4BZ1H 3S36X 2FZ3B 3X11B 4WJ5A 2BRRH 4X99B 4NSKA 3D25B 4XX1E 1CFTB 3DSFL 3BN9C 3PNWB 2AK4E 4X4YA 1W72L 4PP2A 3IXTA 4P46D 2R56L 4WI3A 2CR3A 4P2OB 3C8DA 1R3IL 1U8PB 3U0PB 4OZGF 5KJRL 3OZ9L 1G6RL 1AXSB 3SKOA 4TVPD 4NO0A 2NX5D 4HUWB 3FZUC 3HMWL 5B21A 1ZLSH 5DVMA 3WL9A 2A38A 4HEME 4LFHD 1U8QB 4ODTH 1ZANL 3VRJA 2Z8SA 2F19L 2HKHL 4GQ9L 1SHMA 4I2XB 4NO3A 5CJXC 4MNGA 5A2KH 1RK0A 1C5BL 4HKZA 3VXSD 3IDUA 4ZUSA 5D2LE 1RJLB 2I24N 1QR1A 2DQFA 1MFDH 4XC3L 4H0IA 3QFJD 2EE3A 2ADIA 4TVPL 1FL3A 3CFJB 4PB0H 3LN9A 3IT8D 1CGWA 1AD9A 3SGEI 5FUCE 2VLKD 1U8HB 3U4EA 3KPQB 5HBBA 5EORL 5J12C 4WUUD 1OM3H 2JJSA 3LKOA 3L3KB 3W81A 1WBYB 2P8LB 1KG0B 4PRNB 4F7PA 3RNQB 2AXFB 1W8OA 4PRHE 2DQDH 2HFFB 4X5XA 5CZXC 3S37L 1R3LB 1UYWL 4NO0B 1MFEL 1Q9WB 4OCWH 5GRVK 3QDMA 3CC5B 3RU8H 2VABA 1A8JH 5AD0A 5EC1B 3FMGL 3VRIA 3CFBA 5F7NC 15C8H 2EXWC 4JFEE 4Y4KC 1JNLL 2CMRH 4K2UH 1UJ3C 3V5KA 4ZFGH 5J89A 5I1DB 5TQ0H 1CFTA 3PNWA 4M1GL 4WDIA 4N0UE 4WJ5B 3VXRD 3MRGB 3NABH 1BFVH 3OKEA 3SDYH 5D1ZC 5D5ME 4ZS6C 4NQCD 2DJUA 2R0LH 4X5LA 2PNDA 5DK3A 4G8FA 3RAJH 3T77A 2NTSP 2E9IA 1J8HB 4MNHB 1T2JA 1EHXA 1VB9A 1FFOB 1PG7X 1SM3L 4XX1G 5F7YC 2CGRH 3VH8A 2VC2L 3KPOA 3ZE2F 2OQJA 4BH8B 4YHPB 3U7WH 2WWMD 4XVJH 4S1QL 2X4RB 1FBIL 5DI8B 2HJFB 1CE1H 3FQNA 2H2PD 1FNEA 2XYCA 5SWSD 1B90A 1H3UA 5HGAA 4Y16B 4KHXH 3QIBB 1UWXK 3SDDC 2ARJA 5KZCD 5TDNB 4YXLL 2P5WE 1IT9H 3BZFB 4EOWH 3SCMC 1S7VA 3CVIH 4WY7L 4PJ9D 1Q9OA 1ZEAH 3BE1H 1K6QH 5DO2D 1Y6NR 1BZ9A 4NRXB 4PJ8B 5JW4Q 2KQMA 5LJYH 1F3JA 3HFMH 5DUPL 4M02A 4Y1AE 4HIHB 4HXBH 3TPUA 3AUVA 1AXIB 1R3KA 3QUXC 5CZKA 1R24B 43CAA 3WDHA 4BH7B 4AG4L 1D9KD 3G5ZB 3BP5B 1CIUA 3L3HB 5T33L 3IJYB 1N5YH 3NH7L 5K9OA 3AB0B 4BQBA 4EI6B 4KDTC 4MSWB 5D7KD 1HHIB 4QXTB 3BP4A 4PG9B 5T1MA 2OI9C 4UAOB 4UBDD 1KEGL 2OR8A 3GO1H 2R1YA 3TJEH 3B2VH 3AFLA 3ZE0E 3FRUB 5F71A 3FQTB 5IW1A 3MCG1 4AY0A 2FJGB 1FGVH 3S5LG 1P7KB 3D9AL 1U8MB 4HCRA 4ZQKA 1FLRL 1A6ZB 4I18A 4FTVA 1WBZA 1DR9A 5EZLB 4RGNC 1JYWA 4V1DB 1KB5A 4L4VA 4WI4A 5E94B 1NEUA 3CXHK 4XWOC 5KTEL 1FIGH 5EOQL 4HCRH 3DVNB 4NUJA 1P5UA 1INQA 3LQZB 4K94H 2EICA 3BUTA 2Z31D 2R15A 1K4DB 2VN4A 3B8SA 2LQRA 3EJZC 3WD5H 3RGVB 4ZO6A 4PJCE 3NTCH 4NRYA 4CL7A 4JFXA 2DQGL 1F4YH 1MWAL 3Q1SL 1U3HB 2FO4A 5MERA 2OR7A 1RUKH 3MRIB 3JBG7 1F90H 2JJSC 4WI6A 1AGFA 3UTSB 5IV2A 3FB5B 4L3CB 4JJ5B 2FEEI 4XBPA 1KJVB 2W1NA 4PJAA 5J1TC 1JTTA 1UYWH 4EUPG 1ZT4A 3MRRB 4XVUC 2GUOA 4HK0B 5L88L 3ARBC 3V5HB 5BS0A 4RZCA 2ZG3A 3HG1E 1I8KB 3O8XD 4MXQC 3IVKA 2M2DA 3RWHB 1YEEL 5IOPB 2PW1A 4E41E 2J5LC 4NWUL 4GRLC 1N3NA 4DEPB 1JGEA 2DQUH 4OQTH 3VXMA 4LRIA 2C3VB 3IU3A 4C58B 2I5YL 3SY0B 1Z3GL 3VCLA 2HVJB 4FFYL 4BSVA 4Y5VB 4WW2F 3P4MB 1KB9K 5IVXA 4YK4C 1QBBA 3TBTB 2RGSA 5DMGD 5L9DL 2GI7A 3DUUA 4U1NB 4MJIE 3L5JA 4WHYG 3ES6A 3LQAL 3R06B 4MA8L 1DDHB 5INCA 5BS0E 5A16B 3IDIA 4OF6A 5DURD 1HH9B 3MLTA 5E6IC 5EUKB 5FGRA 1IGTA 3UTSD 1WISA 2W9LA 3UYRH 3QUZD 3QYCA 5E6IA 5C08A 1ZGLP 5KOMC 4OIIH 2H26A 3RY5A 4PV8B 3BP6A 4PRIE 5FYKL 5HVGB 5JQHC 4TSBL 5D7JB 1IT9L 5FA4B 2OL3L 3TO2B 2J4WH 3QUML 4HT1L 5F1IA 5IIEA 1S5IH 1BZ7A 2YD6A 2Z31B 3WIHA 1K6QL 4N8PA 2JK5A 5IG7B 3OL2A 1KB9J 2OZ4H 5HDLA 2MPAH 2X05A 1U0QA 4EDWH 4PGEA 2VL5A 1IGML 4XXDB 3Q5YA 5IQ9A 3VFWB 3O3AB 4JR9H 1QPPA 3HA0A 1RJZA 4HF5L 4PTTA 5MENE 4Q6IA 2AEPL 3LRGA 1ZOXA 5GGVL 2PR4L 4OT1H 4L4TB 3VFNB 4YHZH 1F11B 3S5LB 5CGYD 2AK1L 3BW9B 1P4IH 5E5RB 1PG7L 1MI5E 3HE6D 5GRVL 4CADA 3ZKQD 4WWKD 3L5XH 2DYPA 5KVDH 4HWEH 1S9YA 1S78C 1JWSA 2XG4A 4M4RA 4XCFH 3WEXB 1U58B 1NUFA 4ZD3L 1NUGA 1IEHA 3EDKA 2NY1B 1QACA 2XY1A 4DCQB 3HE7A 5LQBH 5IMLA 3E6HA 3QUXB 4YX2H 4KK9D 4LCCB 5E8NB 2WIIB 1QRNA 5DMYA 2GSGA 1NFDB 1KXVC 1U8IA 2EE6A 1A6VH 1P4LA 1KENL 2QSCH 4WW1A 2R29H 4DGVH 5C09D 1INDH 2HT3D 1JF6A 2EKJA 2VITB 3IGAB 4OJFL 4X6EB 3OG6B 4M4PA 3OGCA 1ZTXL 1JFQL 1RZJL 2ZCKL 3U83A 1MUJB 2FB4H 3LY6A 4QYOB 2GITB 3QB7C 5TF1H 4GRLA 4WV1C 4QRRE 5IMKB 1TNNA 5E1HB 3GMMA 2ZUXA 2MHAB 1VGKB 3WV0A 2IAND 4XP6H 3HZMB 4MQ7A 1DQTA 3IDGB 4HWBA 4QTHB 1UWEL 3U6RB 3CVHB 4PJGB 2AJUL 4K23L 2VNCA 2C1PA 5EU4A 3HR5A 1QKZH 1BFTA 1H3PH 2Y06L 5E99H 4H1LH 1L4IA 4RNRB 3GSQA 1QFUL 5DD1L 1KPVA 2CDEA 3FT2B 3L5WA 4JHWL 4AEEA 1IGCL 4Z95H 5T1LD 1EEYA 1SJXA 3ZDYF 1DVFA 4M62H 4OZFB 5IUSA 1G7QB 3FN0L 3C5JA 4FNLH 5JUEL 3ESVF 3IF1B 1SJEB 2CUHA 2DLTA 4XPGH 1CDYA 5I74B 4Y4FB 3BO8B 4DN4L 5FM8A 1M7DB 1A6TB 4G80B 3MROB 4P3CL 2A6IB 2GY5A 1HCVA 1VKXB 3MJ8B 5DZNA 4XBGA 2ADJB 5CJ8A 1MLBB 2CDFB 5J1AB 2W38A 3REWA 1WF5A 3RNKA 2GIYA 4HUVA 1IKNC 4EXPX 2ERJB 3UPRB 2ZSVA 4OZHA 1BVZA 2BHUA 3DO3A 5JR1H 1IAIL 3KJ4B 2VC2H 1QQDA 5DDHB 3HKFA 3PDDA 1I8LA 4P9HC 3JVGA 4TSBH 3V5DB 4HT1H 3DX8B 4JFFE 4NQUA 4W70A 2YUVA 1AY1H 6FABH 4JPKH 2PTUA 1UXSB 4K7PY 2JJTA 1RURH 4IOFD 3KPRB 4UQ3A 4HFUL 4WHDA 5GS2D 4HJJL 1B6DA 3GI8L 2XZQH 1DEEB 2V2WB 2YXFA 3OSKA 2NY5L 4R9HA 4LMQI 3ARZA 3S35L 5GRUL 5CFHA 1EEUA 4H25B 4Y4KA 1SY6L 1H0DB 2VDMH 1EHAA 1UEYA 4BQCA 2QKIA 1OSPL 3MUGB 5A2LH 1QKZL 5C0FB 1K4CB 1GCFA 3ULSB 3ULVC 4XI5D 1FBIH 1ZA3B 3WO3B 1V3JA 1DUYA 2Z92B 5LWYL 4ENED 4X7FC 2KDGA 5INDA 4M48L 3OHXA 2Q8BL 2AK4D 5C3LD 1L0YA 3VDBA 4PJ9A 4GKSB 4XC1H 4QRPE 4YR6B 5J9PA 2FWOB 4Y19A 5K9JH 2DQTL 3R0MA 3UTTB 2P49B 3C6SB 5FYLD 4PRBB 2BJMH 2YBRB 1F3DJ 5EIIB 4M3KB 1GPOL 5HY9A 4AM0A 2Q76A 4U1IA 3WIHH 1YEFH 2Q3AA 3GJEA 3ARYA 3B83A 1UZ6E 1MFAL 4X0KA 1R6VA 4WEUD 4XRCB 4P2RE 4OLYL 1WC7B 3WFBL 4NC1C 4RWYL 5ISZB 2DRUA 4X4XB 4Z7OF 1IAIH 5DJ0B 1RZGA 3D6GA 4LCCC 3DMMA 1UJ3A 1G1YA 2HYMA 1KELH 1MCRA 4JDTH 1F42A 2ADFL 5DK2A 3VI3E 3NTCL 2JJTC 3D85B 2HRLA 4QRQA 4X7CC 4X9FA 5E8EB 1RK1A 5IMOA 1RZKL 2IJ0C 1VPOH 5JNYB 1I3GL 1T22A 1WIPA 1TZHB 2F9BT 5FYJH 5C2UB 4G42A 1OP9A 3O41A 1BEYH 3ORJA 5JHDA 5KTEH 4PV9B 2YD4A 1UVQA 1F6AA 5GHWL 3KYNB 4MZ2A 1KIQA 4UU9B 3GKZA 2OJEB 2IPTH 2WSKA 2LAAA 2CLZB 3PQYE 5HSFA 4XZUB 3DROA 5DJ2B 1SEBB 3C5ZD 4CVWA 4I0PD 3ISWA 1GVIA 2PYED 3KPLA 5GRXG 4LLYB 3ZT6A 3Q1SH 2ZCHL 3OB0K 4LPWA 5J1SC 3H9SE 4W68A 3MRFB 5DJAB 2PO6C 3O3BB 3VG0L 5FGSA 5BJTB 3QH3B 2EYRB 4MJ6B 5J6HA 3GNML 5IBUB 4OZGB 2X9WA 2VDLL 1LQSR 4M7JH 5JHDE 1NDMB 3RJQB 4AEIL 4R3SA 1NC2D 3GGWA 5TE6L 4O2FA 5LG1A 4GBXA 5C7XH 3T1FA 3NOIA 3SDCA 1HYSC 5FM5O 2Q1EA 2IADA 2IQAA 2K1MA 3EYFB 4EBQH 2ICES 2H3NA 4JZOA 1U2HA 3LSOA 5E24E 1NL0L 4FQLL 1AQDA 2ED7A 3H42H 5HHOA 4UIKH 1J8KA 5J3HD 4N1HB 4RGOL 4KMTH 4NQEE 5CAYB 2Y36H 1DQQB 2GEEA 2HFGH 3RWIB 5F9WB 1CVRA 2BOCB 2CUIA 1D5MB 3GMLA 5HYSG 2QSTA 1FCGA 1YPZA 1E6JL 3D48R 5C0AA 4CDGC 3P4OA 4LCUB 2MCG1 2HTLC 1KTLA 4Z76A 2J4WL 3OKNA 4EZMA 1S5IL 4M1DH 2NY5H 3MXWL 2X44D 4MJ5B 1MSPA 3L7EA 4M5YL 1IGYA 4LBEA 2F19H 2HKHH 2IMMA 4PTUA 5BOPA 4P2RD 2DYPD 1NCDH 1NCCL 4BUHA 1RZFL 2A73A 1U2CA 4RSVA 5I66B 4BFIA 5I17A 4ZFFA 4JLRA 4P4KD 4OLEA 3T1WA 1G9NH 5F97E 1XAUA 1CXFA 3U7YH 3O6LL 1IM3A 2UWEA 1BOYA 3V7MA 2UVEA 2W0KA 4PJFF 4WCYL 2VKXA 5I8KH 4K7FA 4WHTA 5GS0H 5DS8B 3KLDA 3FKUS 4HKBA 4P9MH 5D96C 1IQDB 1S7QB 3OMZA 4YNYA 1FYHB 1QVOA 4L4TD 3RDTB 1I85A 3ARTA 3QA3A 1M71B 2F74B 5FECA 1ZWIB 3LS5H 2WP3O 3N1MC 3ULUF 4HIEB 3CCHA 1SJHB 3G5YB 4KV5F 4NO0D 2BSED 2YPKB 4P3DA 2Q6WB 4KGLA 5D71H 2YUZA 5IKCA 3BDBA 4LLAA 1K2DA 3U0TB 4J3WA 1U8OA 1FL5B 3DYPA 1WCQA 3GSVB 1TVBB 5JDJA 1KLGB 5E8OB 3L9RA 4DUWA 4ZPTB 3J8F7 3HLAB 4XNUH 4LQFL 4PY7A 4ORGB 2ADFH 5DJDA 1KN4L 3D39B 3PGFH 3QXAB 1H3WM 2PUQT 5FHBL 3L3GA 3GJFH 3FQRA 5IHZA 1KEGH 4OLVH 4ONHB 4LVNC 5KW9L 4I3RH 3QIUA 5T5NG 4YHLH 3HN3A 4JY5L 1JWUB 1UB5A 1ZVHA 3LZFH 4HWZA 5A3IC 1P2CB 4POZD 2C3GA 5I0ZA 1KNOA 4WO4B 4X8XA 2XNAB 3PJSB 3H3PL 3HFML 5DUPH 3MA9H 3X13A 3SBWA 1A7OL 4HWBH 4PGDB 3PHQA 5FK9B 4Z7NF 2P47B 4MGXA 4GAJL 1SBBA 1NUNB 3BHBA 3FFCB 5IP4A 3AU1B 4LLQA 4IMKC 2ZCHH 4LSSL 4ZO9A 2BVPA 3FRPG 1ZLVK 3HE7D 3T4YB 1NGWB 3HMXH 4BZ2L 2C1OA 1CDIA 4EQ2A 2FBJL 1T83A 3VD5A 2B5IB 2E9WA 3V95A 2BP3A 2Z4QA 5H37G 4EIGB 3ARWA 4EIZC 2N1KA 1GZPA 1T1ZB 1AFVL 3BP7B 1UQSA 4TNWK 1W8NA 3SGJC 5T33H 2H9GA 5AAWA 3DYOA 1FYTE 5A43C 1XT5A 1NBVL 3QUYA 5GGSY 1X6LA 1YN6A 5I16A 4ZUVA 3RA7H 1BIHA 4YXKH 4YHIB 5T1KB 4QHNA 5KN5B 3MRNA 4I4WB 3H0TA 5DVKA 5DJYB 4Y5XC 2IMNA 4NKOA 3IETB 1FFNA 3BZDA 2CH8A 1XIWA 2UY6A 1QO3A 3RTQA 1G0DA 2EDLA 3W5MA 3CZFA 2NY0C 5EBWB 5FYKD 2C3WA 5IVZB 1SEQH 4ZNCD 5T1KA 5KN5A 2IAMB 2G2RA 5K9QG 4NZTL 5GXBB 1YN6B 1J0YA 2HVKB 1XEDA 3QUYB 4G9FA 4HKXB 1OF2B 3QEGL 1EEZA 4H5SA 4WUKL 4ZXBD 4OFKA 1O0VA 4MXWH 1XF3A 4UQ2B 5DHVB 5JLZB 4LSQL 1YYMH 4TRPL 1D5XB 1B3JA 1JF1B 1RUPL 4XGZB 2UUDK 3MJ9A 2F8OA 4WRLA 4QXWA 2BNRD 3B2UD 1T1ZA 1DFBL 5EOTA 4FNLL 5MI0B 1FAKT 3TVMD 4A6YH 1AE6H 4DQOH 1R5WB 1S5HB 1HCFX 5JA8B 3CH8A 4HC1H 5DJCB 4D0CA 5L2KB 4ZXBA 1QSEE 1MCCA 5I1LA 4YHOH 1A1MB 3FO1A 3SQOH 4QRSB 3IJHB 5GRUH 1I3UA 3A67H 3CMOH 4ZTPH 3IFOA 1IBGH 2NY3D 3BHBB 1Q0XL 4UT6H 1INEH 4MS8C 2NY2B 3BAEH 5D4QA 4OLXH 4YWGH 3CH1A 3I02B 5T1LB 2R0KL 3M8OL 4OF8A 4I77L 1LDSA 4HS6B 5GSRB 3AS0A 1JUFB 2J8UA 1CFVL 3WMSA 3F7VA 1P4IL 4U2YA 4OZIF 1QEWA 3HTLX 2WQ8A 1HXMA 2NY4B 4UV4H 5HYSA 3OGOE 3PHOA 4KKAD 5DJ8B 4LCWE 2JCCA 1E4WH 5L9DH 1NH6A 5CIPA 3O3UN 3R0NA 4ZMAT 2J3SA 1VGEH 3L3GB 2QQLL 3KVQA 3QBTB 1I7RB 3TGXA 2R0LL 4W6YB 2CO6B 1ED3A 3WUWA 1Q9KA 2GCYA 3DX7B 3RZCD 3BGFC 3GSVA 1MFBH 2H45A 1G9NC 2EDRA 1AD0B 1FFPA 1MCOL 1Q1JL 2P5WB 5EO0A 1S7TB 2H2SC 4OCSL 3MLXH 4XCCH 1S7UB 1H9VA 5BS0D 2YPKA 5DEZA 5DK0A 1YYML 1TDQA 2AJXH 4YDVA 2CDGA 5FECB 5C0BA 5C9JB 1IL1B 1A4KA 5EC2A 5GRZA 1J1PL 4RAUB 2IH1A 2IBZX 2EH8H 4JE4B 2ESVE 2R2BA 3MRBB 5HHQA 1FV1B 3OKKB 1T03H 4WUUA 1T21B 3WKML 5ABDE 2O61A 1EAJA 3VFOB 5C0CB 2DQHL 4NN5C 5FYLL 2IPKA 4WHTB 1VFAA 2R8SH 2BNQA 2FHCA 4JJHA 5FUOH 3WS6C 4AT6B 1XGRB 1V3KA 3BWAB 2EO1A 5M95B 4UNUA 4J8RA 3IFLL 4PJFE 2B4CC 2Q8AH 4PB9L 1RZ8A 2JB6B 1WIOA 4R4ND 1OW0C 5DSCA 2FGWL 1V7ML 4YDJA 5ITBH 4DWHA 4L5FH 5IB3B 2DDQH 3P3YA 4W4OA 1IKFL 1GIGH 1I8LC 3CX5J 4R8WH 4K7PH 4WW2B 4AT6A 4HIXH 4JHZA 4O5LH 2BNQB 1NLBL 3WBDA 1Q38A 1VFAB 2D7TL 4IRSB 3FQXA 3K1DA 5C0CA 2EDWA 2O61B 5HVHC 5JUEH 1SMAA 4I9WE 3T0BA 3MC0A 4P48A 2C4FU 2IH1B 3W5NA 3NVQA 2XWBB 3TCXA 4ZUWA 3LV3A 1DE4B 1GAFL 4PJEB 2CDGB 4KMLB 2WQRA 3ULVE 4DOHB 1BFSA 1KN2L 3EFFB 4JRXB 1WGOA 3F8UB 3BGMB 1L0QA 2ATKB 4MAYD 1MRDL 2ERJC 5DD6B 5A2FA 3SGKA 3IDJA 2IADB 4MAUH 2WWKO 2WW8A 2FYYB 1DVFC 4GBXB 3DX6A 3RWDA 1NFIA 2FX9L 5ID0A 3PDGA 3ARED 1FC1A 4MA3B 4JO2H 4KI1A 1ETZA 4N0CC 5DHYA 5MEPB 4CN4A 2X70A 1WFTA 2O5ZH 5CIPB 3FONB 3V7AE 1GGBH 1MCKA 3DX9B 4MDIA 2XTJD 4M8VA 4YC2B 5GGQL 1IE5A 1TFHA 4UNVA 4P4KB 2BNQD 4LLYA 4OLZL 4Z7UA 4R0LA 4RCAA 2V7NA 4LNRB 1A4JA 2JLLA 2WWMC 5FUZL 4IMLB 1KLFA 1I9EA 3GJFA 5DD5L 2E7LA 1ZHLB 4N0UA 1KJ2A 1R3JA 3MFFA 3IFLH 1IGCH 3CX5K 2CPCA 4NNPL 2Q8AL 3KYNA 4FA8A 1YEIL 4LNVA 5JW4R 4XPAL 4ZUUA 4WCYH 5F96H 2IBGA 2KPNA 4Z5RB 1E28B 3P0GB 3VI4F 3QDJA 2X4TB 4YDIL 4HS8L 4QRSA 4F58H 5JNYA 4P2OC 1U92B 3OPZH 1LDPL 2C9AA 4LGSB 1JE6A 1CLZH 3CK0L 5I1LB 5JW4N 4O4YH 5IROC 1MCLA 1RURL 5TGBB 4KDTA 3WCYA 4GG6A 2VZTA 4CVZA 1CFSA 2APBA 4HCRL 4XP9L 1FNLA 3NAAL 5C6PB 2XXCB 2V5RA 3BIBX 1MCOH 1BM3H 5JLZA 2CIIA 5FF6B 1KV3A 3CZJA 1RMFL 1Q72L 5IVOA 4G9FB 2FR4B 5ESAB 5DLML 4PREA 2HVKA 4C55A 2X89D 1P5VA 4WFGE 5IF0B 4LVOB 2Q7YB 3C6SA 5IVZA 1MVUB 4GJTB 2D2OA 4P57B 1WBXA 4WO4D 3UDWA 4POUB 3RTQB 5FYKH 3O81A 1MJJB 2DQHH 5FYLH 2HTLD 2HKFL 4Y5XA 4JFDD 3JTTB 5EN2A 4YO0B 1QNZH 5I73B 3N1PC 4LPUA 5DFTA 4DAGL 5DRNB 3ZYZA 2BSSA 4R4FH 2XOTA 3T65B 1JZ7A 1DL7L 1DUYB 3CPLB 4X6FA 5I16B 1NJ9B 4D3CH 5L88H 4ODHL 4ZG1A 3ULSA 1L6ZA 1EAPB 2OK0H 2NY3C 5ILTH 1CGVA 1PSKH 3CUPB 2BFVH 4OCYL 1CS6A 1AQKH 3SJVA 1KB5H 2BRRL 2XQBH 3V4UH 4JFDE 2YMXH 1MLCB 5M7QA 1RZ7H 1TPXC 3FAXA 4RFNB 3OXRA 1FHGA 5DMIH 3DO7B 3CAFA 1T89A 5FUCC 1NBQA 4FFYH 1G7PB 1IC5H 2F8VA 2XKNB 2MSPA 1G6RH 1C5DB 1G7HB 4JKWA 1MCWM 3B9EA 1ZV5A 4W81A 4Y88A 1AFVH 4KJPD 3G9AB 4OF7A 1QRNE 2GJ6D 3MV8A 4W6XB 3V6OE 1VPOL 4XMLH 4ESKA 1YY9C 4NHCL 5DDHA 1QQDB 4U1GC 5MEQB 3RQ3A 5HI3D 3E3QE 2WWKT 1QSFB 3OG4B 3KPSB 3PIQA 4GMSH 3QEGH 1KCKA 1A14H 1KT2B 3MJ8A 4MJ2A 2WBKA 4Z6AT 3GSWA 3FCTA 4Z77A 4JO2L 5GS0C 5DJZA 3PWJB 5I6XC 1A6TA 2YD1A 4JDTL 3IRPX 3P4NA 3H42L 3AMKA 3BO8A 4MMXC 2XZZA 4L8CB 4QRRA 1CXHA 4L4VE 1TETH 3QG7L 3QDHA 3HC0B 1I7ZB 5IHZB 3QG6A 4R26L 4WFED 2MFNA 3FQRB 3GBLA 3WXVL 3D39A 4M7JL 5T1KD 1EEYB 5T3ZL 4MA1B 4CU8A 4ZPTA 3FRPA 4UMGA 1GGIH 2V2XA 3PXHA 3GSQB 2VR4A 5E6YA 4XCNA 3KGRA 1TVBA 3OJDA 4M93B 1YEIH 2ZUSA 3RTQC 1A6UL 5F96L 4DKFL 1T6VN 5SWZB 3V52H 1CIDA 2CMRL 5E8DH 4CRPA 1VFBB 5AYUL 4GT7A 5I1EL 3O2DA 4WI2A 1DQJB 4PS4L 2X4OB 2O5YH 4PLNC 4KMTL 5D2NE 3F5WA 3QWQB 1KIRB 3VJ6B 2MHAA 3EOBB 4NHUA 3JTSA 3GSNH 4RGNE 4LPYA 4OSUH 2HT2C 4FMKA 3HG1D 2BY2A 4XPGL 5E70A 4UTBH 1MUJA 4S0SD 1JZ3A 5TQ2H 5EFIA 3LS5L 4WUKH 2DD8H 4LK4A 1RUMH 1N59B 3ARQA 1LWRA 4JFHD 4F7TA 3DRTA 2W60B 2BVQB 4LSRL 2RHEA 4XNYH 5DRXA 5FO7A 2A2QT 3IDYC 4HXAL 3L1OH 2NY1D 5HYJB 1WT5C 4WEBH 3L7EB 2GSGB 1QRND 4L4VD 2MOVA 4LCCA 5E8NA 3O6LH 1CLCA 1OP3H 2YKLH 3GIVA 4LVNB 5HHMD 4KPHH 4YHOL 1FSKB 5FHBH 3RWFA 3RJDA 3P9LB 4R4BB 4J3XA 1YPZB 3MXVH 2A0LC 3HUJA 1PGRB 3JZ7A 3RY6A 1D5MA 3GMLB 3MR9A 4M5YH 3TEUA 2QHLA 4P2OD 5I1HL 4CADB 1IC7L 2Y07H 1RZFH 3K8KA 1QSEB 3TF7C 2AW2A 2HH0L 3TFKC 3AAZA 4EI5B 2WINA 2XZCL 4OF0A 5IWLC 4P46C 1TTUA 2I9TB 3HB3D 4OCSH 1Q0YH 3L3IB 1GGIL 3U46B 1HILB 1XGYH 1CFNB 1S9KC 4KWUA 4PLKC 1KXTB 1IC1A 3V6ZB 5B3JE 1WUNT 5C2BH 2IGFL 4OLUL 3VFWA 5CEXA 1TZGH 5DUML 3C6LB 5ICXA 4AEFA 4KKCC 5TDOA 4F33A 4GRMA 2UY7A 2Z31A 4D9RE 4GXVH 3LPFA 3P30L 4U49A 5BJTA 5I1AB 3O3BA 4M93C 2LAGB 4TUKH 1RU9L 4OLWL 4PV8A 5D6CA 4JO1H 3RGVD 5F93C 1A6AB 3QI9A 3I50H 3IFNL 3IJSA 4GAGL 1LP9E 4F37F 3MUZ1 5FM4A 1OGTB 1A7RL 2E27H 5EUOA 4K94L 1IGTB 2D31B 2VDQH 5DQ9A 1KC5L 4XCCL 1FVCA 2OJEA 1MCQA 4F2MB 4V1DE 5A16A 5ENWA 3MOAH 4HUUB 1P4BH 1UVQB 5FGCE 1A7PH 1KCUH 4PV9A 3P0YH 3GMRA 5D7JC 1R0AL 5IJKA 4JHAL 3UZEA 1FYTB 4X80L 3HHRB 1T22B 2FHFA 3QDGA 4FFWC 4Y5VA 1XMWA 5EU6B 4JRYB 5F7MC 3S36L 2RCSL 4QRQB 4NKMB 2IAMC 3GMOA 2B1HH 4JZJB 4KQ4H 5DK2B 3ZE1F 4XAKD 3ZDYE 2ZKHL 3MOBL 1J9CT 2R2EB 3SGKC 4HMCA 4ZYKB 3MRQB 5IR1A 4LIQH 2V5MA 2WZPD 5LGJB 1KCSL 2V9RA 1DQMH 4GQ9H 5FYJL 4DJMA 3MV7E 4PJ7E 1GHFL 2OX5A 1OB1A 3GJEB 3WLBA 3REVB 4FFZL 3TBYA 4NPYA 1J0HA 2GFBA 4NYLA 3V8CA 2QADC 1JP5A 1YEKH 5HY9B 4PJBF 4LPCA 5HGBA 2NXZD 4XBPB 1BQLL 3W11C 2XI9A 2AK1H 4L3CA 3HI6L 5CEZD 1PG7H 4JRXD 1BD2B 1KLUB 1CLYL 2OP4L 3GHBH 4YFLI 1BIIB 4KRNA 5IB5A 4OGXH 1WFOA 1U91A 2ZUUA 4HS8H 1J1XL 3ROOB 4F58L 1LE9B 4J7RA 3VG0H 2IALA 5CD3A 4GXVL 1NSNL 1QR4A 2EO9A 4YC2C 3G04A 1DANT 4OGZA 2VAJA 1K4DA 3JV6B 1INQB 3LQZA 4OI7A 4N9OB 2VOTA 5TE4L 1KYOJ 5FO9A 4XP9H 12E8L 2MQ0A 2P4AB 4OFYD 3DMMD 5GGTA 5CSZA 1T5XB 2P48B 1WAAA 3PHSA 4X6DA 3BPOB 4NQVB 5KSBA 3FOLA 3TIDA 3W39B 2ZCKH 2O5ZL 4NQCB 3D69B 2FJFA 3MNZA 4ELKA 1G0YR 3QCVL 1IGIL 2EXYC 5F7DA 5CJOH 2DQIL 2PXYB 1UENA 4N9GB 3LKPA 4XAWL 4H20L 4IBLT 4HD9A 5DXWA 4LDLB 3DX8A 4PG9A 5DVLA 1UFUA 3HNSH 3W9EA 1FJ1A 1CE6A 1FL6A 3RY4A 3D0VA 5BO1H 5ESQB 3AC0A 4BH7A 2AJUH 4K23H 3UPRA 1PJ9A 1IAMA 1R24A 4ODHH 3RNKB 3MTRA 3LEYL 4GQPH 3FMGH 5GZND 4LLDA 3U30B 4WTZA 4XBGB 4OCXH 3UZVB 2B4CH 4DGYL 1Q1JH 4JZJC 5D5MA 5F1SA 3RVTC 4L29B 1HXYA 4OUOA 5C0IB 1MHCB 1PW3A 2PW2A 3QUKA 4NKDB 3WNLA 1BFOB 2X4SA 2BSTB 2BSTA 1EVTC 4DZ8B 3IU4L 3GMNA 4NKIL 5GGTL 5B8CA 2GJZA 4NN5B 2FX7H 5I74C 4Y4FC 2VH5H 1AC6A 4ONGL 5ANMA 5D5MB 1XH3A 2F54B 3FQUA 1XIWC 1CXIA 2VSCA 2WUCH 1G7QA 3EBAA 4WIQA 4OZFA 4NZRH 4IIQC 2VB5A 1B88A 2HT2D 4FTVD 3LS4L 1NGQL 1EXUA 1EPFA 2H41A 2XV6B 2IH3A 3VI3F 5DC9B 3O2WH 1RUQL 4MVBC 5ESQA 2ICEB 3F12A 3QNZB 4OI8A 2BFVL 1FJ1B 3O9WC 4NNXB 5DEFA 5EO1A 1AO7B 1I3RB 4N1CA 2F5AL 1X6NA 3NH7H 3QCUL 3U82B 1FFOA 1U93B 1CGTA 8FABA 3Q48A 3VE0A 3MBEA 4LAQL 4ZDHA 3O0RL 3G6JB 4FQ2H 4UI2A 5B39G 2K9UA 4U6YB 3U6RA 1NGZB 2DIJA 2FIRT 4JZNB 1YY8A 3QNYB 5D7IE 2NY0D 5F9WC 1VGKA 4NQVA 1T3FA 3GMMB 4WDIB 2OCFD 1J05A 1T5XA 5CSZB 3E0GA 4FN0A 3KYOA 4XAWH 5C0EA 2GITA 3O2DH 2EDEA 4R0LC 3JV6A 5IQ7H 3OGCB 4M3JA 4Q6YA 4IOIA 1R3LA 2NNAA 2OXHA 4HDIA 5EBLA 4X5XB 1YEDA 5GJSH 3MV9B 3VGDA 4FQ1L 3RNQA 3O2VL 4I0PA 4MJIA 3DIFA 4GKZB 5JXAH 3GO1L 4LCWD 2NY6C 1IKFH 1GIGL 3QQ9D 5I6XB 2EEDA 2R69L 5CEZL 4U7KA 3E6HB 3QUXA 3S6CA 4DCQA 4BFBD 1NMBH 4FQHB 4F37K 5HGBB 2AK4A 4ZAKB 3ULUD 5D96B 2V9QA 3PXJA 2EDKA 3TBYB 1HIML 3WLBB 4JO4H 5KJRH 4S2SA 4GFTB 4ZUSB 3TZVB 3ZSSA 3LQMA 1T66C 2ADGA 2XN9A 2Z0BA 4IS6A 3HC3H 1CD8A 4NIKB 1JZ2A 3VFUA 3DTXA 5JW5B 3L1OL 4H88H 2J1KA 2BNQE 4XXDA 5IB2A 1AHWC 1ACYL 3K0WA 1WIUA 4K3HA 4D8PB 4OSUL 3K80A 4NP4L 3IXTB 3O6FB 2CKBB 2Y7QB 3NZ8B 1AKJB 5I19L 3VGEA