2DLHA

Solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
121
structure length
121
Chain Sequence
GSSGSSGPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Receptor-type tyrosine-protein phosphatase delta
publication title Solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta
rcsb
source organism Homo sapiens
total genus 7
structure length 121
sequence length 121
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dlhA00
4HK0A 3P73A 3PHQB 2AEQH 1MFDL 2NZ9D 2QQLL 2FX7L 4WY7L 4F37K 1ZHBA 1I8IA 4ONFH 3LKQA 5DC0A 3MROA 1UM5H 4RBPH 3C60D 3MLVH 4HPYL 3ZE2E 4X99B 3LPWA 5DURB 5FDWB 3DO3A 4PJXB 1UB5B 5T33L 2DQJH 3U36B 2CUHA 4EVNB 1MOEA 3ES6B 3T1FA 4Z0BH 1ZHNB 4A6YB 3TO4B 3VD3A 2HFTA 4LHJB 3JWOH 4F7MB 4X9FA 5KSAB 3ZTNH 3D85D 1UM4L 4X6CB 3RGVD 4RMQA 4PGDB 2J12B 1WZMA 4J23A 1FNGB 1YUHB 3SPVA 5E9DE 5I0ZA 5GGRA 5JIIA 4JG1L 3EJYD 1TQBB 1MJ8H 1U95A 3S36X 3BPCB 3FFDA 3MRCA 4PD4J 4LLUA 1VDGA 4LU5H 5C0ND 1YPZA 1GZPB 4NQCE 2XXMB 4LNRB 1D7FA 3GMMB 1DQJB 3QIUB 3S8WA 3DX6A 1NUDA 3BKJH 3T77B 3R0MA 3PWJA 1R24A 4KGLA 3BESR 1B2WL 2J6EL 4CU7A 3WE6B 4ETQB 4HS8H 4MWFB 4JO1L 4W4OA 2QV2A 1LE9A 4XC3L 4HKXB 4Q58C 1DBBL 5DD6B 4AYFA 3RVWD 4Q2ZA 4KJYA 1G7PA 4XZUB 3ARGD 4DZ8A 3DX7B 4QWWC 1ITBB 4KJWD 1BECA 2F74A 4KHXH 2EYTA 3QWQB 1E0OB 3BPLC 5F9DC 4PS4L 4PY7B 3U9PL 3MLRL 1XAUA 1IT9L 4F7PA 1UADC 2K7QA 1FBIH 5FYKH 1U8QB 1F00I 4P23B 4ONGH 3VWJC 5I6XB 5JA9A 4OIAA 1U3HD 1A7RH 1CFQA 5T3ZE 1K5NA 3KYMA 1QFPA 3G5XA 2OSLB 4OJFH 3QUMH 4HIIA 1WCBB 3IU3B 5DJ0B 3HZKA 3PABB 3GJFB 2YR3A 3ULUC 2GSIB 4UBDD 1RZKC 4FG6D 5I17A 3FQXA 1I7ZB 4MLIA 5CJXA 1S7XA 4Z7NF 2ATKA 4PLKC 4KGJA 4R90L 4R96A 4O2CB 3TVMC 4XVUC 1MUJA 3QAZC 4TOYL 3SDCD 1J1OH 1INDL 1INEH 3JWDL 5SWQB 4LCYB 5GS3A 4P59H 5ISZD 4NYLB 3CFJB 3OR7A 3CFCL 3PUCA 1CD0A 2R56H 2GY7B 4Y19A 2MKWA 1DDHA 5ITBH 4PJDF 1CICD 5DJ8B 4OBSA 4EI5B 1RJCA 4LLYA 2XQYG 3Q1SL 4YE4H 5BW7A 5DD5L 4M7LT 3T2OA 5CBAA 3QPQD 1DBAL 3DRQB 3QFDB 5JUEH 4U4BA 1WICA 5DHYA 1MCEA 2PYED 5GGQL 4WO4A 4LHUA 1MREL 3B9KD 3P4MA 3TCLA 2GITB 3WBDA 1ZLUK 2MMXA 2ICWJ 2BX5A 3WS3A 1S9WB 3NIDF 2VDMH 1IGCH 4FP8L 4ZFGL 3KPNB 4JY6B 3QDGD 3WUWA 3VGFA 3FRUA 2W60B 2YWZA 4PJHF 5HDLA 4Y1AD 1KLUA 3MV01 1NBQA 1EBAA 5C0CE 5JPNA 3ULVE 4XPBH 3FO9A 2Z91B 1T20B 1A7PL 1AP2B 4TRPH 2H6PB 3MLTA 2NLJB 5E24E 4UIKH 4RX4A 2CKNA 1SEBA 3GBNH 2VAAB 5F9OL 5L6YL 4BZ1H 2W9DL 4NKMA 1EHLH 2P46B 5GQBA 2X9XA 3HA0A 5GS1C 4CMMB 4YH6A 1LE5B 4IRSB 3ZZ1A 5EZIH 4QXWA 5C0CB 3CZFB 3T0XA 4H0IA 4JFDE 1ZAGA 3QB7C 4JFHE 2XWBA 4M7ZC 1K4CA 2BC4B 4ZAKC 1PZ5B 3E3QE 3QO1A 4PRIB 1FL6A 2M1KA 3K46A 3MJ8A 1F90L 5ID1B 3DV4B 5DI8B 4XHJC 3I02B 5DQJA 4M4PA 4WU5A 4PJFF 1F11A 2BP3A 4JFDB 3IAPA 5J6HB 1NMBH 1CXFA 3IFLL 2XRAH 5DZLA 1JMXA 1DQML 3R4DA 4K3JH 5F7YC 3LZFH 2GCYB 3FB5A 3GMLA 4XP5H 4QRSB 4IOIB 4KJQC 4ESKA 3H0TB 3HZVB 3OWEA 2YS4A 4ERSH 1P6FA 2DWDB 4GQ9L 4F2MB 5CS7A 2J8UE 1FCCA 1HDMB 2NXYD 2R0ZH 4HT1L 3SE4C 3TPKA 1JWMA 1ODAA 5EIVA 5GRJL 4Y88A 2RB8A 5C07B 3HR5A 5E9DD 4WGVB 3O6KH 3BE1L 1GGTA 4NDMA 1M6OB 4NQUA 1OT1A 3AM8C 1UC6A 4XRCB 1NKRA 4LLVB 3ZT6A 4NKQB 4PJCB 2WZPD 1RUAL 2YKLH 5IGXH 4YPGB 3F62A 4NQCD 4PJIA 3CLEH 4UILH 4WEUD 5HHPB 4G43A 4G8EB 2CIKB 4MA3B 3CLFL 1V7NL 5F9AC 4QOKA 1SHMA 3LKPA 4U1GC 5IG7B 3ROOB 4ELMA 4LCWB 2UZXB 5TE7H 1T1YA 5FGCE 3RWIB 4BQ8A 4KK9D 2EYSA 2R39A 1IGTA 4AK1A 1VGKB 2AJ3B 1KN4H 2Y7QA 4NO3B 3T4YA 4ZXBC 3VXUE 5C0EB 4TVPH 3RWDB 1JRHL 3WO4B 2J88H 3OHXB 2DF3A 2DKMA 1MLBB 4AG4L 1DL7H 2MSPA 3MNVA 3M8OL 3U4BL 2IADB 1KJ2A 4L9LA 3NCYP 4FOMA 1MNUL 3L3OA 4MS8D 3GSRA 4P2OD 3QIWA 3G08B 4J6RL 3FB7A 3EFFB 1XF2B 4YBLB 1CZ8H 2F54A 1KBGH 2E7MA 1FGNL 2G75A 1WAAE 1ZA6A 3QUZC 1NBYB 4YXLH 1NLBL 4F37F 1AQKH 5T1KD 5T3ZD 1KIUA 1OAYH 2GJ6A 1HKLL 4LIQE 3TBSA 4LKCA 4KVNL 3FQNB 3TWCH 2JJVA 1NCTA 1DBKH 4XPFH 3IXTA 4NHUB 3HC4L 2DQUH 3UTTE 2QKIB 4ODHL 3D1MC 4LLWA 4LGPB 3V52L 1EGJL 5IMLB 5CJOH 4MD0A 4HKBA 2I9LA 3DI2B 3HHRB 4J12A 5MHSE 3DX8B 1EBPA 3TJEH 3OAYK 4JVWA 4U7MA 1YPZE 4Z7VA 5FIEA 4AIXA 1JGEA 3QWRA 3IDIA 3QQ4B 5JDSA 4UUJA 5TFSL 5D7JB 3CX5K 1MQKH 2YC1A 2QSQA 5HI3C 4IMKC 4NQSB 4KKAD 3VFPB 4KV5F 4EXPX 1CGYA 4K9EH 5FECA 1PSKL 1CXIA 3N9GL 2GJZA 3B9DA 1FLRL 4Z6AT 5GGTL 5T1DH 1OL0A 2EDRA 4WV1A 5HBBA 3Q6FB 1H0DB 5J13C 3L3JA 3BP4A 5D1XB 1A6WH 3OXRB 1BFOB 3TJHD 2HLAB 4TTGA 3ORJA 1I3UA 1YEJH 4G9FE 3GMQA 3S3SA 4BZYA 5I19L 5MEOA 5I18H 3TZVB 35C8H 3P4NB 4ODXB 1H3PL 1ZT4B 3UYPA 2N1KA 1TCMA 4LPTA 3HPJB 3QXVA 3SDDC 2IAMB 3S3JA 4BQBA 3VMPA 3IDMA 4HIJA 1A6ZB 1A8JH 1JPTL 1XZ0A 2XPGB 3L7FA 3SE9H 1CYGA 4R3SB 5IMOA 4PFEA 2VR9A 3MC0A 4Y7MA 1JWSA 3CDYA 4TSCH 2GAZA 3CMOH 2B4CH 1N59A 2DN7A 1S7RB 5EIIB 4LRIA 3V0WL 4Z7WB 4R4ND 2DJSA 4PV8B 4AMKH 1FVCB 3DYMA 5E00B 5E4EC 1U36A 3EFDL 3M1BA 4X4YA 1EO7A 3ULVD 3HG1E 5K59E 4YGVA 1E4XH 3TN0B 3LPFA 3WFEL 5CD5C 5DRZA 1IFHL 1J9CT 5JW5A 3KPQA 4G3YH 1PD6A 4EBQH 3VXTB 1OM3L 1TVBA 1QVOA 3OKMB 3V5HA 1U41A 5CSBA 4M7KL 1A1OA 1BVZA 5BV7L 4YDIL 2P47B 1A4KA 4JFHD 3DYOA 3HE7D 3E6FB 5KN5B 1JYNA 4Z7UA 5FYJH 2GSGB 3ZKNC 4R4BB 3HRZB 2P4AB 5H37H 1NPUA 3O11B 4I9WE 4LL9A 5E5RB 4HSQA 1U0QA 1YN6A 2N56A 2OK0H 3D5OF 2X89D 3TA3C 1PKQB 2FYYA 5HYSA 5F6HJ 3O3UN 3GMOA 4HKZB 3G5VB 1D5XB 2P5WA 5IHZB 2W65A 2RHEA 4M62L 3MRFA 4ZTOH 3HZYA 3IF1B 4KTDL 1D5BA 3VXSA 2HT3C 1OTTC 2YK1H 3CH1A 1XH3A 1LDPH 3CMGA 5GRWA 3O4LB 3TBWB 1P1ZA 3EO1B 5F7EH 5CP3A 1MFCH 3H9SB 4QRTA 4U1HA 1DQTA 1MVUB 4R2GD 3VFWA 4PJAE 4D8PB 2EH8H 5FYLL 5B8CA 1T89A 3AS2A 2KZ1B 3BOVA 4GUPA 3WL9B 3LKNB 4O5LH 4X98B 3H9HB 1GC1H 3QEQE 5ERWB 1S9YA 3IKKA 3KPLB 2P8LA 2PYFA 4FQLL 2IQAA 3CX5J 1JPSH 2VXVL 1NL0H 2EZ0C 2B2XL 4KK8C 4MGXA 5IFAL 4G8FA 1R3HA 5DA0B 3BJ91 2R23B 1LO5A 1T0MB 4HWEL 1U93A 2I25N 4YXLL 2G5BA 2VDOL 2AAVA 3BZDA 4X6CF 1NMAH 4GQPH 3ILPA 3PL6A 3VXUD 3PHOB 4XCNB 3VFVB 3VGAB 4K8RH 2FIKA 5EU5B 4HC1A 1T66D 1ZVSA 1MFEH 4APQD 4NKOA 2NX5A 2Y5TB 2XA3A 4QHKI 3SY0B 5E2UL 1V7MH 1OAUL 4HV8A 3ZKMD 1D5MA 4XCEA 2R0KH 3O3DA 1W72A 4Q9RH 2WBKA 2DDQL 1AXTL 2VL4A 4HUVB 2BNUB 1P4LB 4CVXB 4P5KB 2ZUWA 1J12A 4POZC 3S34L 4TUJA 1A6AA 1WEJL 2X4QB 3JBG7 3QR2A 1I9JL 4U1MA 3D3VE 3C6SA 4GAYB 5HDQH 1OTUD 1X5LA 1P2CA 4BQ9A 4G80A 1Q72L 4W4NA 1CD1B 1EJ6A 1IKNC 4OFDA 3ARQA 1FL3A 4M43H 3HAEA 2K9UA 3UTTD 5F9JA 2AKRA 1A2YA 1Y0LA 1YN7B 3EYQC 2P8PB 2DI7A 3ARBD 4GS7C 4PGBB 1OAZH 4QGYA 4K2UH 4XH2B 4LQFL 3EDDA 1QACA 2V2XA 5K9QI 5MHSD 4J4PA 3CFBB 5DK0B 4H1LG 4X6EA 5JPMA 1WWBX 2BJMH 1DTUA 3LRGA 2Y23A 5TDPB 5LWYH 2HTKC 3VDCA 3GSXB 4LVNC 2DJ4A 2LTQB 3BAEH 2QR0A 4TULL 1IM3B 1NAMH 1EXUB 1A5FH 1KPUA 5DHXB 4ZG1A 2AJVH 2WQ8A 3ULUF 3DGGA 1U8NA 1L6ZA 2XACC 4GRLB 1OPGH 4WI2A 3C09C 1HH9B 2IPTH 3MV8E 4PP2A 2BVYA 2Q86A 4KK6D 3WN5B 5GGSY 3GUTB 3L9RA 2HG5B 1P4IH 3I6KB 4E9LA 1G7JA 4YFDB 4M6OH 4G9FD 4DZBA 4LLAA 5DVMA 4XP6L 1UKSA 3IDNA 4HMCA 4GAGL 2DD8L 4ORGB 3RVUD 1QBML 5IMMA 3T0EE 1F2XK 2VL5B 3AXLA 4AEHL 3RZCC 3E8UH 1QUNA 3O9WA 1SQ2N 2UUDK 4EOWL 5EO1B 3VFUA 1H3XA 4GH7B 3RQ3A 1ACZA 4O58H 3QHZL 2W0FA 1QLFB 5EC2A 1YZZA 3NN8B 4GRMA 3HI1B 3RWFA 4MAYC 1FLTX 1NCDH 1UM6L 3K8LA 4NBYB 3GBML 1HHHA 2BVTA 3RL1B 3DURB 3TFKC 1KCLA 3HG1D 1LK3H 3EYVA 5DR5L 1G7IB 5DK3A 2JJTA 2EIZB 5JOFA 1IJ9A 5HD8C 5MI0C 2OK0L 1A1NA 2ORBL 3N1QC 4Q0XH 1NEZB 3QUYB 5IVZA 3AREB 5DRWB 3MLXL 4JFEB 4JRYE 1BF2A 1J0HA 1RK0A 2XA8H 4LAQH 2CLVA 5ACZA 5ID0A 4H26B 2Y6SD 4IDLA 3RTQB 1I1FB 2ZUTA 4LSUH 4Z7OE 3QULB 1AD9A 3FOLA 1MFCL 2J5LB 1J87A 4HQQL 4ODWA 1I1YA 3MACL 1RU9L 3EYOA 2UVEA 1X3DA 4KZDL 3VCLB 4Z95L 1IGIL 1A14H 1AGBB 1U8IA 4I9WD 4NKDB 3UJIL 4ELKB 1MCPH 4X80H 1IC4H 2WWMD 4X7DC 5IP4A 3HMXL 2P5EB 4WO4D 1D6EB 3PGCA 3DOSA 1OAQH 4ENEC 3ISWA 1I8KA 2AV1A 1BD2B 2J6EA 3HI5L 4PY8J 3ARDB 3RY5A 1RD6A 5F1NA 4MA7L 3WLWD 2WWKO 3D0LA 5DRNB 2VLKB 3VI3E 5EU6B 4IRJB 4OLYH 4PGEB 1BJMA 3EZJB 3SKMB 1X5XA 1F3JB 3CVHL 3REWA 3WIFA 1NUNB 4J3UA 2VXUH 4LGRB 5IHLB 3KPTA 4KQ4H 3WIHH 1I7RB 1JYVA 5F93C 2V5YA 4ZUVA 5F7MC 1L0YA 3ULUL 4WWID 4XI5C 1WCQA 1RZKL 2F53A 2XG5A 3DSNA 5IQ7H 2GUOA 3QEQD 4WJ5B 4Q6IA 2FWOB 5T5FL 1IM9B 2DBLL 4Y5VC 3K4AA 4S10A 1JV5A 3PP4H 4QRRA 4OZIB 4RZCA 2VZTA 3MUGA 1XIWA 3DTXA 2CDGA 5F3HA 4TUKH 3O6FC 4PJBF 4HEPG 2BSED 1FN4A 2PW2B 1NFDE 2IH3A 3GO1H 5HYJE 1FFPA 4MQSB 4HK3N 3PWLA 4LKXA 4DEPC 1WBZB 2NXZB 4GLRI 3FTGB 4MJ5A 1CR9L 1EEQA 1FIGL 3H3PL 4I0PA 3W82A 1X5IA 1UENA 3MUY1 5I8EB 3QRGH 3ARYA 1I1AA 4TUOB 5E6IC 4BKLA 3PV7A 2I5YL 4H20L 2H32H 5ICZB 3L6FB 2P24B 5H35A 1F42A 4NO2B 4NKIH 2KZWA 4X6BB 1LO3H 2CKBB 4O51B 1FVDA 1FO0B 5TGBB 5GS2H 2UYLA 5JXEA 2QTEA 1J1PL 2RGSA 4NWUH 12E8L 1UH3A 1UWXK 1XGQB 1DBJH 1TQCB 4W68A 3SKOB 1JZ3A 4R26H 1AR1D 2GK0A 3D3VD 4JG0H 1WWAX 4U3HA 1ORQB 4Z78A 2DIBA 1CLYH 5CP7B 4U1KB 1MWAB 3T65B 2Q7NA 1QA9A 4PB9H 5E8OA 1YNLL 3GSVB 4I2XA 4PG2C 4PJ7B 1K8IA 4F7EA 5FM5M 4XX1E 3QQNA 4NNYA 1X9QA 1NDMB 2HN7B 5AYUL 3ZDZE 4NBZB 3V6ZA 1IC5H 3MBXH 1EMTH 4PRHA 1HIML 2XZCH 5D6CA 5E0QA 5C9JA 4XXDB 5TDOB 2GTZB 4J3SA 1OARH 3RNQA 2VDLL 4NBXB 2JELH 3HUJF 1QEWA 1A7OL 2NZ9C 3O2DH 1NCAL 4UDUB 3SDXB 4IIQA 3L3IA 4I48B 5IOPB 1IGFL 3C60C 3P3YA 4XPHL 4X8XA 3MV8D 2Z31A 1S9KC 1JP5A 5JHDA 1CFVH 1F4HA 3TO2A 2Q1EA 5C2BH 4KI5E 2ZJSL 4JFFE 1HWHB 3ZE0E 4OZHB 3QUKB 4HMDA 1UZ8A 3DETD 1AY1L 1MFAH 3ZKQD 2A74A 1FYHB 3RGVC 4L4VA 4X7TB 4FA8A 3T0ED 5DUMH 4X9GA 4BSWB 2XWTB 3PHSA 5IBTL 3BD5A 1BZ9A 2MQCA 3FMGL 1H5BC 4NQEA 1GIGH 1ZA3A 4UNUA 5EB9A 4GRWH 3HE6A 5HPOA 3QFJB 2HFGL 4M5ZH 5C0NC 1VSCA 1ZWIB 4I0CC 2ZUXA 4ZUSA 3T4AB 5DO2D 1DSFH 3KDMB 4JFZH 1Q8MA 1N64H 4JQXA 3CDGB 3U6RB 1S7QB 1CLZH 1TJGL 1NGQL 3QI9B 3E1F1 4LHUG 3BJLA 2VLRA 1LGVA 4DWHA 4B7LA 5SX4H 4NZTL 4U1IB 2X4OB 5D6DA 3PQYE 3RVWC 4KROD 4M02A 1KG0B 3ARGC 4JRYD 4G5ZL 1N5AA 4KJWC 4NQDA 4RFEA 3MR9A 1YNKL 2DI8A 4X7EC 3FT4B 4XMPH 4CDHA 2O5ZL 1P7QB 3BKYL 4HFWB 5ANME 2UY7A 4OKDA 2A6KB 1KJMA 3GGWA 3PWVB 1S7TA 5CEZH 5D5MF 3ARVA 3UXFA 3QIBA 1UQSA 3WUWG 3TYFA 5ADPH 4S2SB 3QZWG 3BFOA 4K94C 2EEAA 4U6XB 2P1YA 1PG7L 3LB6D 1BX2B 1U3HC 1U58B 4WDIB 4IS6B 2IC2A 4UV7L 4CVZB 5A2KH 5LXGH 2A1WH 2DLFH 3BO8B 1WZ1H 3U30B 1MCFA 1A6UL 5DJYB 1DQLL 3HPLA 1FRGH 4UBDC 2BVPB 4FG6C 3G6JE 1LO4L 1LP9F 3IU4L 1FGVL 3UTZB 5ALBH 2GI7A 4L8CA 1YEDA 2IANA 4WW2C 1NMCC 2EDDA 2XQYK 5F6IB 2A77H 4PJHA 3VA2C 1WT5C 4N8PA 1G9NC 1Q94A 4L9DA 1S8DA 3SDCC 5IJKA 1TXKA 5IB2B 4UIMA 4UTAL 3UJTH 4POYA 4QRUB 2FJHB 5SV3A 3BDYH 4MD4B 3MRHB 5EUOF 4E0RA 3L3HB 4MNGA 1UXSA 3FT3B 1TIUA 5HYJD 1UA6H 1U8HB 3QPQC 4GBXA 5D7SL 3V5DA 3JTSA 3SBWC 1JNJA 3B9EA 1FZJB 2UWEB 2CUMA 1ZSDB 3B9KC 4DQOL 4LRNH 3CK0L 3NZ8A 3PIQA 4UT9L 1EGJA 5EA0L 2NY3B 3WKML 1XGYL 4HCRL 5KVDL 4PJFA 1SM3H 4MXWH 1JNHA 4LSPL 1PAMA 4F33A 1NBVH 3BZFA 4MX7B 5SWZA 4JCLA 2GT9B 2P5WD 3D69B 3OAZH 2LVCA 5EU3A 4OF0A 1JI1A 1SEQH 2Z92A 4G6FB 4P46B 4PV9B 3WJJC 1T1WA 1NBZB 3BDBA 4HIHA 3FOMA 1BZQK 5F1IB 5GGTA 3RZWA 1CGSL 3S98A 2O5YH 5HPMA 1CFVL 2CJUL 4XNMB 1CF8L 4GW4A 4LOUD 5BJTB 1QKZH 3O0RL 4FQ2H 3GM8A 3VFSA 1NUFA 1NAKH 5C1MB 1U8KA 4PJEE 1OW0A 3IKCA 5DD0L 5IR1B 3VXPB 4ZPVB 3GKWH 5EBWB 1R3IL 2AXFB 3VD4A 2XIDA 4LCUA 3KXFE 4ALAH 2OBGA 2A0LD 3MRDB 2C1OA 5D1QA 4C4KT 1OGTA 2EYRA 5D2LB 1KNOA 3L3GB 3CXHK 3SDAB 4G9DB 1IC1A 4KXZI 2NY7L 3BUYA 1IVLA 5DSCB 2VAJA 3DROB 1JIBA 2PTTB 3BDXA 4Y4HB 2ZG2A 5JO5B 3W9EB 3ECBA 4KI5D 1L9MA 1J5OH 4JFFD 1TQBC 4M5YL 4PGZA 1JZ4A 1MJUL 4WWKB 1E27B 5C0AA 2J4WH 1I9EA 2QJDA 5AAMA 3UTSA 1ZANL 3SGDH 1OHQA 5AZEL 3WFCH 2NXYC 2D0FA 2PXYA 2BNRB 3MLSH 3TEUA 4PREB 4J8RB 1JTTA 3DUSB 3X14B 1F3DH 1BJ1J 4Q9QH 3QDJE 1KENH 4D0CA 4N0YH 1AGEB 4C56A 4E41B 5BRZA 1CE1H 2JJWA 3PG2A 2B1AH 4DGVH 3DMMD 2OTWB 5JW4M 1AHWA 4GG8B 5D2NA 4HS3B 3WFDL 4AL8L 2A9NH 3LD8B 2BXZA 2V6HA 4XB7A 3UCRA 3BGFC 3BHBB 4PUBL 4KRPD 3V4UH 4U6YA 1A7NH 5FO7B 1M7IB 4FQCH 2VABB 4KK9C 4OTXL 5I1LA 1NCNA 4J4PD 3IFPB 3O4OC 3WIIL 3RP1A 5C6TL 3L95A 3PQYD 3T0BA 2OS7A 1M71B 1Q9WB 1XR9B 3LN4B 3RVVD 5L9DL 1FRGL 3HNVL 4NNPH 5JIPA 3IYLW 2BSTB 3DV6A 4RQQA 3P40A 2LAAA 1SJVA 4PBXA 5F1SA 2ESVA 4BSVB 4MS8C 4P2OC 5AWNH 3OZ9H 2C1PB 3MNZA 1MFNA 4CKVX 2EIDA 1G7MA 1MHEA 1X4ZA 3P0YH 5H2BB 1Z5LA 5GISH 5JHDE 4OZFA 5I1JL 4NO0A 2D03L 4ZFOL 4XBGB 2QSCL 5CUSL 1L7IH 4FNLH 3BDYL 3PWUA 5GHWL 1XF4A 3QDAA 1FNLA 3QXAA 4ZUTB 5CILL 15C8L 4N90E 5CJ5A 3DNKA 5EO0B 5DT1H 4YO0B 2D7PA 1F02I 1OB1B 1E6OH 5MERB 4LSRL 5J1AB 2R4SH 4LK4A 3QP3A 2ZPKL 2IFFH 4LARH 4HX1A 4KUCF 3BVNA 4U6TA 1GGCL 5HHVH 5KTEL 1KEMH 1JN6B 3WJLA 3ARTA 2ZCHH 4GMTH 4M6MH 1KB5B 2WBJB 3BEVB 5DEZA 3IXAA 4N8VA 1OP5K 1IKFL 4ZSOE 5L7XH 1FNSL 2D4DA 1TTUA 4P2YA 3HC3H 3CXHJ 3FN0L 3DX9A 1L0XA 3UYRH 3KPPB 4KKAC 5LGJB 1NLDL 2D31B 3MYJA 1DN0B 4X5WB 1ND0B 2ARJA 1AC6A 1RZ8B 2CXGA 1DQQB 4GFTB 4O2FA 3V4VL 3MRLB 3VJ6B 4JM2B 5JLZA 4YUEH 2CPCA 3PJSB 4ZPTA 3LKRB 2FJFA 2WBWB 4BH8A 3OB0K 4L3EA 4NM8L 3BH8B 4OQTH 5B38A 4XNUL 2ZUUA 9CGTA 3MREA 2XTJE 5E2WL 3TJHC 3P77A 2HKFH 4H1LB 4RMTA 5JW3H 2SEBB 2MCG1 1BIIA 2O5YL 3K80A 1DEDA 4WTWA 3RAJL 4K3GA 3PWPB 1XGPB 4WI3A 1JGLH 1JWUA 3UTQA 4MA1B 1RZFL 1IQWL 4KKCD 5FYKE 1J05A 1UXWA 1J11A 4EEEA 1T6WA 1RZIA 4P4KA 4R4NC 2I9TB 3VG9C 4UOJA 3LDBB 2CDFB 2VDPH 3FFCA 4M03A 4NPYA 4DVBA 3DRTA 5DEFB 4JZJB 1U8OA 3T08A 2V9QA 3ULVC 1A4JA 3KWWA 1P7HL 2X4NA 3K8MA 3D39A 5F70A 3LQZB 1N2RB 4ISVB 2EDTA 3MMEB 2X42A 4CADB 4JZOB 4WFHE 3IFOB 3GSQB 1OAKH 5DRXA 1J5OL 2P7TB 5D7IB 4PTTA 3NFSH 1SBSH 2A6IA 1QQDB 4OZ4B 5E2TH 3KXFD 3WFCL 3HE7C 4UZGA 3E3QC 3PV6B 1TZHB 2QHRH 1T0NA 5F89B 1EEYA 4HWZA 3K8KA 3VDBA 2E9BA 3CIQA 3B2VL 2FX8H 1CIDA 1NANH 3DVIA 2NW3A 1Y18A 4PJGF 4HLZG 3BKML 2OI9B 4I13B 3D0VB 3BWUC 1Z9OA 3HAEG 4R0LB 4D9RE 1DLHB 4XPAL 3DXAE 1JGDA 1WF5A 1JNLL 5EU4A 1UGNA 3MBED 1JHKH 1GGYA 3RWHB 4AIZB 1UJTA 1FYTA 3O8XB 4M61B 5D70H 4OCSH 4R2GC 2BFVH 3EYSH 2X4TB 1K8DB 4ODUB 4PJ8B 3QDJD 3HMWH 4HIEA 2Y5EA 4K7FA 4S1SH 5FGRA 4W6YB 2X70A 4KUZH 3B3IB 1HINL 5C08B 1KCSH 2J8HA 4TPRL 3IDJB 5AUMA 3HMXA 1C8PA 2F58H 2R0LH 4RAVB 5FA3A 1S9XB 4NM4H 5HHXH 5I73B 2GTWB 4OV5B 2HWZL 3MOAL 3MQIA 3V4PH 3RNKB 1WFNA 2UY6A 3VWJA 4JO2L 5DXWA 4HUUA 1NC4A 4QHLB 2YMXL 5EN2B 1I9RH 5C0JA 1T66C 2NPLX 3CVHA 3IAQA 1QPXA 3P73B 4APQC 1KTLA 1A3RL 4OGXL 1U42A 1G6RL 2DL2A 1F8TL 1I8IB 3KJ6H 4MA8H 3ZKMC 4O4YH 1RIUL 4XNZB 3LKQB 3MROB 2EKJA 1YA5A 4QNPF 1MRDH 4XMLH 3RUGA 5JHDD 5JZ7C 4QTIL 2R4RH 1R5WA 1LEKA 1QRNE 4GKSB 4MNQA 5J56B 5I66A 3T1FB 5FOJA 3TVMA 2G60L 2QADD 2EC8A 3G6DL 4HD9A 1G9MC 4XPGH 5D72H 1OTUC 1Q0XL 4JO3L 2DLTA 3VXQA 3VFRA 1NANI 1D5IL 2NY5C 4RIRA 4N90D 2PF6A 5C86A 1BIHA 3S96A 2DQFA 3LQAC 3U46A 1Z3GH 1GZQA 4JO4L 3ARBC 1NDGA 5GGRB 4Z5RA 3ROLB 3RU8H 2VXSH 2A6JA 3FFDB 2ZP0T 1EDQA 1FIEA 4LLUB 5KW9H 2O61A 1F13A 4YNYB 2ICWI 3V7AG 3UAJD 3V79C 3DX6B 4JPKL 1S7WA 3BH9A 3MA9L 2DIAA 5IK3A 2DM3A 5D1XC 4HXAL 4UB0L 5HVFB 3PWJB 3RDTD 4HF5H 1GGIH 4KVCH 3RVTD 4E5XA 3WYRA 1MCNA 1LE9B 4TNVF 3RWGA 4KK6C 4WFGE 1DFBH 1NGWA 3NA9H 4Q2ZB 5IF0B 3TBVA 4KJYB 1G7PB 2NY6B 2VLJA 3NIFE 4WW2F 4DZ8B 1CXHA 2W0KA 5K9OA 2XTJD 2F74B 2EYTB 3MTRA 4WI4A 4X5LA 4TVPE 1AKJA 4DKDC 5ITFA 4IEFB 3B8SA 1IZJA 1Y6KR 2J8OA 3RVUC 4KMTH 4L8BA 4P3DA 1H3WM 3GNMH 3DVFA 4D9QE 2APBA 4DKEL 1AO7E 4XMKH 4N0UA 4U33A 3UPRA 2AJZB 3QNYA 1E28A 2GIYA 3IJYA 5FYKD 4ZTPL 4M6AA 1CFQB 2APTA 1K5NB 3KYMB 5A2FA 1QSEA 3G5XB 1F6LL 1SMAA 5DJZA 3PP3H 4P5TD 3P9WB 3LH2H 4Z18A 2FJGB 2FL5A 5I17B 1CL7I 4ZAKA 5GGVH 1VCAA 3FQXB 1AO7B 1ADQL 2C3VA 1S7XB 1TZIA 1EUTA 1V3JA 3INUL 2ATKB 4Y4FD 2CK2A 1CVRA 8CGTA 1X6NA 1WC7A 4LASH 4QRPE 4WFHD 5CZVH 3OJMB 1MUJB 4MCYB 3BP5A 2X41A 1MPAH 4WUUA 4LEOA 1YYLL 4M93C 1C7SA 1EV2E 1OD7A 2XNAA 3QUXA 4PJBA 3OR7B 5CKGA 4FXGA 5KSUA 4Y19B 1FSKB 4FFVD 1MELA 4LLYB 3SE4A 4GBXD 5CBAB 2HJKA 2WWMC 4M1DL 1C5CH 2ADJA 2EE9A 3SGJC 5DHYB 4WO4C 3AM8A 4LHUB 4F8TA 1YMMA 3P4MB 5L2KA 4BA8A 3TCLB 2HRPH 4FXKA 3X12B 2JB6A 5E8PA 1WWWX 2ZOLA 4K94L 1ZKAA 3TV3L 5DWUL 3WS3B 4D9RD 3DXAD 4NWTL 4LLQB 4Z8FH 2XN9A 5LBSL 1JF1A 2VZOA 2FR4A 1CDIA 1V05A 1R0AH 4YWGH 1QO3A 1A0QL 1J8HA 5E2VL 5SWZD 4PRPA 1A3LH 3MLZH 2E7HA 3WUWB 4N8CL 3FFCE 4HPOL 4ZO9A 5C8JA 1I3GL 3FRUB 5KS9E 1Q1JL 3ZE2F 3ZKXC 1KLUB 5JPNB 4MCZB 3FO9B 4QGTA 2FGWH 1U8MA 3NZHL 3MLTB 1MLCA 1MRCH 2B0SL 1SEBB 4DGYL 1CL7L 1E4WH 5I15H 2AVGA 1G9NL 2DQHH 3DGCR 4YBQD 3L7EA 4NKMB 1HZHL 3BRDA 1TPXC 2DQCL 2XOTA 1BQUA 4YFLF 3QUZA 1MIEH 4EJ1C 1DCLA 1KCVH 3HUJA 2WUCH 1EJOH 4V1DA 2XWBB 1K4CB 2R15A 3KPSE 5DMJB 5LGKA 3BPOC 2Q87A 5EORL 3QO1B 5I1CH 2IG2L 5C0FA 4CRPA 3VD5A 3MJ8B 2AJSH 1DZBA 4JRWA 3C2AH 4OZGE 3FRPA 1K9TA 4MLSA 4Z7QE 1NGPH 5FYJE 5LKNA 2F5BH 1KIRA 4AQ1B 4WU5B 2CRMA 4YFLI 1F11B 3L1OH 3BQUD 3NCEB 1QRND 1JGUH 4NFBA 3IFNH 1AR1C 4OFPA 4M4RA 3QISA 3FB5B 3GMLB 1XF5B 3LKOA 3QT2A 5H94A 5GGSA 5TQ0L 3DUUA 4QHNA 1JPGA 2ENYA 2NNAA 1JWMB 1Q9LA 4OZGB 4WTZG 4RMRA 2IMNA 3HR5B 4IMKA 5FYKU 3JV6A 1QR1A 3HNSH 4NN5B 3ULSA 2HKHH 4XT1C 3VXMA 4YX2H 2DQIL 4GRLC 1AE6H 4C56D 3MYZA 5I8OH 1ZVYA 4X8JB 4PTUA 1KTRL 4PJIB 4HCRA 2YXFA 3VGEA 4N1CA 5SX5K 4G43B 4OCRL 4NRZA 1KV3A 1XR8A 3I2CH 3QO0A 3SEPA 4QOKB 3LKPB 3P4LA 1FAIH 1G0DA 2VKXA 1ZGLM 4ELMB 1ZVHA 5BXFA 1T1YB 2B8OT 3SDDA 5DYOA 2EYSB 1IGTB 4L4JA 2Y7QB 3T4YB 3MRJA 4EDWL 2CK0H 5L8KB 4WFGD 2VIRA 2V7NA 1ZV5A 2MPAL 4A6YL 1II4E 1ULVA 3QDME 4OCWL 4H8WH 4U2ZA 3MNVB 3GIVA 1OSPH 3NTCL 4P2QE 1HI6A 1KJ2B 5K9KA 3DETC 3Q3GA 4TVPD 4OM1H 3VG0L 4JJHA 3L3OB 1CFTA 3MOBH 5ADOL 3GSRB 5EWIL 5E95B 5DVLA 3QIWB 1PX4A 3ELAT 4YHYC 1CS6A 3T0EC 3HI6H 1YQVL 2F54B 5IVXA 1BM3H 5F9WC 5C0DA 4D9QD 1WIPA 2G75B 5BCAA 1ZA6B 1DLFH 3K2UL 4CVWA 3S35H 4FABH 3FQUA 1FORH 5SWSA 1MI5A 2GJ6B 1RUPH 3FT2A 4NGHL 5J57B 1CI5A 2DQEH 3TBSB 4LKCB 2V17H 4GAJH 3LIZL 5DO2C 1LP9A 4LBEA 3KYKL 2CRZA 5J11C 3IXTB 4OUOA 2NCMA 1BQHA 4LLWB 2AXGA 1OLLA 5KVFL 4MD0B 5F6HI 2I9LB 4YC2C 3NAAL 3QCVL 5DQDH 1JPST 4DKAA 2BCKA 4QRPD 2LABA 4OCYL 3WO3B 4Z7VB 3TA3A 1JGEB 3QNXA 1UJ3B 3IDIB 4GAFB 4KROC 2E6JA 5JDSB 4EUPA 4UUJB 5EFIB 4OI7A 2DB8A 5EUOA 1YNTB 2YC1B 4D9LH 2ICCA 3EW3B 3DHJA 5LQBH 3BT2L 2VZVA 1RPQA 5FECB 5MP6L 4HG4J 2GJZB 4MYWB 3ULVF 2AJUL 1CTOA 3MV9E 4KKBD 1L7TL 5D8JH 3T2QA 4WCYH 3LB6C 5IW1A 4WV1B 3GMNA 2VLJE 4M8VA 3L3JB 2XZAL 1YECH 5CIPA 1AR2A 3GMQB 5MEOB 2EDWA 1BBJA 4JDZA 2GW5A 2H2SD 3QNZA 4OLUH 1FZOA 1YMHA 1KSRA 4FN0A 3OKLA 4HIJB 3L7FB 1XZ0B 5T3ZL 4IMLA 1EFXA 5IMOB 3STLA 3UMTA 1JWSB 1KN2H 4QKXB 5I9QB 5IB3A 5C3LD 3P30H 1DR9A 3QEHA 4P4KD 4NZRH 3MFFA 1CBVL 3MPCA 3FFCD 5AAWA 3TT1L 2IGFL 4S1RH 1RMFL 2UVFA 5D9SA 4X4YB 3BSZH 2KKQA 4FFYH 1GGBH 4YGVB 1HCFX 1KJ3H 1CK0H 4JB9L 4Y2DD 4P48A 3U4EA 2Q8AH 1MEXH 1NGPL 5DRZB 1N8ZA 1MH5B 1WV7T 4NJAH 4ZFOA 1YYMH 5JW5B 3MLPA 1CXEA 3KPQB 5HHQA 3MRBA 3LS4H 3WXWH 5T3XH 4QCIB 1TVBB 3VGBA 4XVSL 1QVOB 3GEWB 4O9HH 3V5HB 2M8XA 5TPWL 2F19L 1MRFL 4PJ5A 4YEEA 4ZD3L 2FX9H 1A4KB 3KPSD 5CCKL 5JXAH 5C0IB 1KELH 2P44B 1JK8A 1OF2B 5D96C 1IAMA 4Z7UB 4XNQB 2IWGA 4Z77A 4PG9A 4OLVH 1IKNA 4OGYL 5IM7A 2DL9A 1YN6B 1ITCA 3RKPA 3I6LE 4NQVA 2FYYB 5GZND 5HYSB 5FYJD 4M48H 3GMOB 2Q6WA 2D2OA 3TNMA 2W65B 4PGCA 2GJJA 5EOTA 3VGHA 3MRFB 4JFOA 3PWNA 3HZYB 1D5BB 1OCWL 3VXSB 1QFWH 3C08L 3CH1B 1XH3B 1FH5H 2XN9E 3GRWL 1P1ZB 2GFBA 2JCCE 1KACB 1IC7L 4LSQH 3FKUS 4IDJH 2AK4A 4U1HB 4NHCL 3VFWB 2Y06L 2ZG3A 1I3RA 3G6AA 4N1HB 5B8CB 4LOUC 7FABL 3ULVL 5BO1H 1LD9A 4GUPB 3QG7H 3KPRE 3TYGL 1BOGA 1P7KA 4KY1L 2FCBA 1S9YB 3VWKD 1S5HA 1RZGA 2P8LB 2PYFB 2OP4L 2FEDD 2ICEA 2A0LC 4KWUA 4OD2A 3GIZL 2BVQA 5E8DH 1UCBL 3DBXB 4OZFG 3DI3B 1LO5B 2JB5L 3IDXH 5CEXA 1PLGH 1U93B 1FORL 2G5BB 2FB4H 2WUBL 4JREB 3H3BC 3RZCA 3KPRB 5D71L 5EIQA 4NJ9H 4KAQH 4H88L 4JKKA 1EZVY 3PL6B 1GPOH 1OP3K 1TJHH 3PXHA 2FIKB 4XAKE 4KI5C 3QDMD 1FC1A 3MV7B 4P3CH 1ZVSB 2I07A 3O41A 1NSNH 1C16A 4MAYA 4NKOB 4P2QD 4MZ2A 2NX5B 5GIRA 4K8RD 3SJVE 1YPZF 4HV8B 1D5MB 5F8RC 2LU7A 4XCEB 2R2CA 3O3DB 2DM2A 1W72B 3MLWL 3R1GL 3PGFH 4LF3A 1RURL 4G6KL 1MJ7L 5B21A 3ZTJH 4TUJB 2ATPA 1HWGB 1A6AB 3IETA 4MNQD 1UWGH 4N8VG 43C9A 4U1MB 4GG6A 4K3DL 4K7PH 1NGXA 3F5WA 2ZCLL 4KMQA 2NR6D 3DMMC 1KPRA 5ICXA 1P2CB 5HSFA 3I3BA 4G80B 2R0WH 4ZUWA 5HHME 5K9JL 4JGUA 1IE5A 3EDEA 2EH7H 1FL3B 3HAEB 3VXRA 2AKRB 1A2YB 1Y0LB 1YEIL 4KRPC 5EZLA 2VMFA 4RGOL 1XGRA 3ARZA 2YPVH 2YPKA 4JFXA 1F4XL 5IT2L 1F4AA 2L7JA 1HYRC 4OGZA 3K2MC 2V2XB 4NT6A 4J4PC 5J3HD 5IEKA 4TQEL 2OJEB 5TDNA 3UTPE 4PY8I 3EDFA 3NCFB 1FC2D 5JPMB 32C2A 3RVVC 4FTVE 3BIKA 1DBML 4YFEA 1A7QL 4XGZA 1ZHKA 2O26U 2QR0B 1MCQA 3QHFH 1S9VB 2X4RA 3MRPA 3U2SA 1U8NB 1SYSA 1X5YA 4PP2B 3MV9D 4LGSB 4G6JH 3C8HA 1G7HB 5EC1A 3ZDXF 4RGMC 2VLJD 3L9RB 5E8NA 4BH7A 2FZ3B 1G7JB 3TH2T 4DZBB 3IDNB 4UQ2A 1EH9A 4Y5VA 5IMMB 1JTPA 2VB5A 2ADFL 1NKOA 3AXLB 5DHVA 3LS4L 3GK8H 2QSVA 3O9WB 1PKOA 4LIQL 5FYJU 3O6FA 4ODVL 3H42L 1BVKA 3VFUB 4JQVC 2OL3L 2W0FB 4YXHL 2ILLA 5MENA 5EC2B 3UP1A 2NY5L 4OIBA 4GRMB 1FCGA 1G6RA 3RWFB 4PRAA 5D93B 2Q8BH 3LQAL 1HOCA 1HHHB 4GRWE 3RWJB 4R7NA 4RA0C 1L9NA 3ME0A 4NZJA 3B6SA 3EYVB 2YUWA 4HBCH 4K71C 4FZ8H 5FV1L 5JOFB 2OX5A 5FO9A 4BELD 1Q0YH 5GS0H 2V7HA 4M48L 1A1NB 4WHDA 2AK1L 5DLML 5IVZB 3OB8A 3QXDA 1WBXA 4QT5B 3TBYA 5ACZB 2CLVB 5IEHA 1JBJA 1XCQA 4XCCL 5C09A 5ID0B 4PJAF 2Z8WC 4NIKB 4PB0L 3QUXD 3MXVL 5KVEH 2EE2A 3LV3A 4P46C 1A1MA 5K9QG 3IVKA 1AD9B 3FOLB 2B5IB 3MGOA 3RWEA 2ERJB 3O3AB 2YA0A 1I1YB 3EYOB 1S7VA 3GSNL 4PG2A 4PJGA 2X40A 5A1AA 1ACYL 3I6LD 4KKCC 5CEZE 4QHMB 2C4FT 3PGCB 3T0AA 4KQ3L 2H9GA 5J1SC 5L2KD 1IBGL 1I8KB 4IHOA 2AV1B 1UWXH 4DN3L 3MRGA 5F1NB 3FAXA 1R5IA 2XN9D 4RMSA 1QHOA 3X3GH 1TCRA 2JIXD 2R2EA 2VN7A 3WIFB 4MJIA 3NCJH 4ZUVB 1R3LA 5HGBA 2F53B 3C60A 5CZKA 1BAFH 2FATL 3MLUH 3OG4B 2GUOB 4BK4A 1MCOH 3KYOA 4QXGL 4Q6IB 2DM7A 3H7BA 3VGDA 4UT6H 3H2WA 4U05A 4QRRB 5GJTH 4RZCB 1XCTA 3MUGB 1XIWB 3DTXB 2X4UA 5B3NA 2CDGB 2EDXA 5F3HB 4XC1H 4X6DE 1TETL 4M9OA 4X4XA 1FN4B 2P45B 3D85A 2IH3B 3RGVA 3CJJA 1FFPB 5I75B 5I8CB 1YC7A 4LKXB 5DFVD 1NGYA 2NY4D 5HXMA 1A6VH 4HWNA 2Q76A 1H5BA 4MJ5B 3NPSB 4MJ6B 1D9KD 4I0PB 4XAKD 1U92A 2OXHA 5CWSA 3U1SH 5FCUH 1ADQA 3QJHA 4JDVA 1VEOA 1I1AB 5L2JA 3QPXH 3X11A 2PCPA 3F12A 3SJVD 4F8QA 4PJIF 1MCJA 4XP4H 2CRYA 2PKDA 5H35B 2RIKA 5E99H 3MBEC 1UKTA 5IW6A 2AQ2A 4AEFA 1J0KA 4EXKA 3RI5K 2VDNH 1UKQA 3N50A 4UQ3A 1FVDB 4X4ZA 2MQ0A 2UYLB 4OCXH 3EO9H 2V2TA 4J3TA 5ILTH 2OR9L 1WLHA 1BFVL 3ZL4H 2GK0B 5GS2D 4PJ9D 4Z78B 3P9LA 3ARGA 4OFYD 1ZEAL 1DE4A 5E8OB 5HHMD 4JRXE 4I2XB 1UYWH 4XWGL 4F7EB 3G9VA 4NNYB 5GRVK 2YD4A 1EEUA 5GRUL 3J8F7 4WGWB 3V6ZB 2E27L 4ZDHA 1V3KA 2DMCA 1I3VA 4PRHB 4RGNB 3UEZA 4D3CL 3D9AL 4YHZH 5IB1A 2V9TA 4P57A 5D6CB 5IMKA 2KQNA 3UTPD 5C9JB 1DUYA 4ACPA 2WP3O 3GHBL 1J0JA 4GW5A 3RNQB 3SCMD 3VRIA 1IQDA 4FTVD 1JHLH 4I3RH 1KYOJ 4JPVL 1QEWB 3JVGC 4L4TE 4HGMA 1EAPA 5JR1H 1WFOA 2X1PA 4IIQC 3L3IB 1IZKA 5HYFA 1NJ9A 2Z31B 1B88A 4WW2A 3DVGA 1PW3A 4LVHB 4PYHA 3TO2B 2ARJQ 2EXYD 3RIFK 1RJZA 1MFBH 4HKJA 2QADC 1UZ8B 1WT5A 1X7QA 4GT7A 1NC2D 4JM4L 4ODTL 2E7CA 5DMGD 5CEYA 2A74B 4UT7H 3B8YA 4WEMB 3FO0H 3OX8A 4L4VB 1QSFE 5JIHA 5ISZA 3T3MF 6FABH 3M17B 1BZ9B 3JWOC 3WHXA 4XP9H 2CKBH 1H3GA 1FO0H 4LVEA 4NQEB 4Z7OF 1ZA3B 1KCRH 2CLRA 1NFKA 3HRPA 3HE6B 3OKYA 4EN3D 4JEGB 3GHEL 1BJ1H 4ZUSB 4UDTA 3CFEA 3HTLX 3SBWA 3CSYB 1MCHA 3UAJC 1K4DA 2PYEA 3B9KA 1MWAH 1P84K 1JNNL 3OGCA 3RDTC 4PJDE 1DUZA 1F4WH 1KIPA 5I74B 2BNQE 4CDGC 3RVTC 3PE9A 2VLRB 1AGFA 1LO0L 4G8IA 2HH0L 2Y36L 2OM5A 2W59A 3SDYL 3V9FA 3JXAA 4Y4KD 3QDGA 1N5AB 3NCCB 4NQDB 4RFEB 4S1DD 5EOQH 3UC0L 4F15C 3MR9B 2EO9A 2OZ4L 2XTJC 1W8OA 2WANA 3HNTH 3WJJA 2APVA 2EDNA 4PJDB 5FM4A 3NPZB 4DKFH 1KJMB 2Z35A 3GGWB 1S7TB 1ZMYA 1NUGA 3MCLH 3QIBB 1UQSB 3OR6A 4HGWA 3TYFB 1LDSA 5BS0E 4XNYH 4FFZH 5CEZD 4DOHB 4XCFL 1MAJA 2APFA 2NTSP 1HSAA 1NFDF 1HSBA 3L5XH 3UJJL 5E08H 4F9LC 4P5TC 5HI5C 5IKCA 5CJ8A 3KR3H 3HPLB 4R8WL 1BLNB 2Y1VA 3TNNA 2KQMA 4LCCC 4KPHH 1B0RA 2OTUA 3WD5H 5T1LD 4L1DA 4A6YA 4L8CB 3N1PC 1YEDB 2IANB 3CUPA 2XKUA 4Y4FC 2YD7A 3I9GH 4UV4L 3E2HB 4K3EH 1JI2A 2UZIH 1T03H 2QQNL 4PJHB 3T2NL 1C5BH 4RFNC 1H9VA 3F7YB 3MA7A 1FNGA 1Q94B 5DD1L 1S8DB 2XZQH 4UTBH 2XFXA 2AABH 2N7BA 4UIMB 2IPUK 5DC9B 2DYPB 3A6BL 3EYUH 2EIEA 3ARFD 1GZPA 4E0RB 4Z76B 4R0LC 2DKUA 1YEEH 3IB4A 4FFVC 4MNGB 4S0SD 1UXSB 5IQ9A 4GBXC 1JYWA 4BK5A 5F7KC 1HHIB 3V5DB 3JTSB 3V6BR 1UACH 1ZS8A 2B7DT 5E9DA 4DK6A 4HIXH 3MJ9H 5F96L 2DQGH 5FKPA 3WE6A 4ETQA 4I77L 3W0WE 4F3FA 3NZ8B 4U1SA 3ZDZF 3PIQB 5I30H 4NQCA 2DM4A 5I1KH 1QNZL 4JPWL 4XZUA 2QQKL 4IJ3C 1ZLWK 3QXUA 4G7YL 5HHOE 3WFBH 5EZOL 1S7SA 3WNOA 2GEEA 4PJFB 2AEPL 3EOTL 4YDVA 5E4IA 1YEGL 3QJFB 1JNHB 3AB0B 4F33B 3BZFB 4U1NA 3B2UC 1CFBA 3W0WB 1I8LC 1IAOB 5EU3B 1U8QA 2YUVA 2Z92B 3D2UD 4NSKB 4P2RE 4U6HB 1ZLSL 3RJDA 1T1WB 4HIHB 5I71B 3SE3C 4DTGH 4U2YA 4JFQA 4GXVL 4KI5F 4JRXD 1HXYA 1JVKA 1OTSD 2C4FU 2CGRH 2CD0A 2I60H 3R8BB 3ZE0F 5CLWA 4FZEH 4QF1A 4P2OA 1Q9OA 4YBQC 3GJFA 2BSRA 2GSIA 4YHLH 4GW4B 2NY2D 3FB8A 4OB5L 1U8KB 3REVA 3IKCB 4KDVA 3WXVH 5FEBA 3NGBB 4JDTH 3QCTH 1J1XH 1NCBH 1ZT7A 4MMXC 5T1KA 4AH2A 4KRLB 4LCUB 1N6QH 2C1OB 2VYRE 4QY8A 1IARB 5C7XL 4L4TD 5D1QB 3MXWH 4X7SL 4OGAD 1OGTB 2EYRB 1KNOB 2H1PH 5EBLA 1T2QH 1O5DT 4YJZL 4LCYA 1CIUA 3BUYB 4KHTL 2GKIA 4OLWH 2IJ0C 1J88A 3GJEA 3BQUC 4LPUA 3ECBB 3R8QA 4PYGA 3P0VH 1K85A 3HN3A 3O2VL 1YJDH 4JHWL 2VLME 2A6DA 4JN1L 4MAYD 3TIEB 5C0AB 1BQHG 3IS0X 2PO6D 1GAFH 4Q97A 5KSBE 3UTSB 3RL2A 3ARPA 4WU7A 4YHNA 5DFTA 4J1UA 1QSFD 2PXYB 2FECL 5E1HB 5BV7B 3CAFA 4EUPG 1E6JL 1WFUA 5KZCB 4NN6C 4D0CB 3LN9A 5FUOL 4XVTH 4DK3A 4I8DA 4U49A 1INQA 3T1WA 4IM8A 1RIVL 5BRZB 5SV4A 2O93L 3L5HA 3RI5F 5FM5O 4JQIL 3BKCL 5DQ9A 1AHWB 3KPNA 3WMSA 4JY6A 5D2NB 2VDRL 5FHAL 2R8SH 1RVFH 1DQDL 2CMRH 5I76A 1KC5L 1MCDA 5J6GA 1UT9A 3G04B 2YD1A 2BNQD 5IBUG 4GW1A 5TQ2L 5I1LB 1YEHH 2AQ1A 4LSSL 3G6JF 2BMKA 2NLJA 4HGKC 1JGVH 3C5ZD 2DTMH 3GRWA 3L95B 4DW2H 5C6PB 4PPTA 5C0RH 3OB0H 3DV6B 3IDYB 4RQQB 2ESVB 3BRFA 3W9DB 2P8MA 5C0CA 3DIFB 3MNZB 4X5XA 1G7MB 1MHEB 1KCUL 2BC4A 2MHAB 1Z5LB 2EDJA 1B4RA 1LNUA 1PZ5A 1C12A 4OZFB 2D7TL 3LKSA 5BS0D 4NO0B 1J8KA 5D7LE 4OD3L 1NFIA 1M05B 5ID1A 1RFDH 1U8LA 3PWUB 4DVRH 1XF4B 4XHQA 1VKXA 4HWBL 5I1IL 2C7UA 3QXAB 1WITA 2R1XB 3HC0A 3STZA 4JFDA 4S1QH 4YHOL 5JHLH 1ZGLP 3HE7A 3NH7H 3RIFF 4JGJA 4YQXL 3GMPA 2HJFA 1UACL 3OF6D 1N0XH 3SKJH 3HZVA 2OR8A 4F2MA 3QQ3A 1DVFD 4HX1B 1HDMA 5F72S 2X89A 1H3VA 5IHUH 1FQ9C 3EOBB 1KIQA 1LILA 4XRCA 3VI4E 3IXAB 4N8VB 1JZ5A 3E0GA 4LSVL 3DX9B 4KTEL 2FEEI 3MV11 4WTXA 3MYJB 3OSKA 2EDQA 5A2IH 4YHKH 2ARJB 5HHPA 2J8UA 1F3DJ 4O2FB 2XWJA 5JLZB 2YPLE 4KKBC 1YY9D 2YD9A 2HVJA 2ZCKL 4ZPTB 1N7MH 2YEZA 4BH8B 4K9EC 4L3EB 1MJJA 5B38B 4OD1L 5F3BA 4OT1H 1RIHH 4NO3A 2ZNWA 5TE6L 5I1GH 3AFLA 4PJEF 3K0WA 1BIIB 1PG7W 2H2SC 5JIKA 4TYUA 4AEIH 2IMMA 2W9EL 5HHOD 3BGMB 1GCFA 5BOZG 1CLOL 4M7LH 2NW2A 5KG9A 1OSZA 3UTQB 3CSGA 4YHIA 2XTLA 1LWRA 3MLYL 3T0VA 2VH5H 1J05B 1UXWB 2LV4A 1RZIB 4IOFD 2CDEA 5I1HL 2VDKH 1CD8A 3SGEH 1IAIH 4P2RD 4NPYB 4DVBB 3DRTB 2B4CC 4GKOA 4PJXE 4HFUL 5HGAA 1U8OB 3F58L 4GSDH 5GRVL 3RWCA 1S5IH 1A4JB 3KWWB 4Y2DC 4APQA 4R4FL 5EPMA 3D39B 4ONOA 4PBVC 4MJID 3VRJA 2NTFA 2PR4H 5IFHL 4X6CE 2NY1D 1BGXL 4JY5H 3P4OA 1F58L 3FO1A 4PTTB 1WAAA 2A6IB 3C8DA 2DQTH 2MQ3A 4QXUH 1KB5H 4GO6B 5E6YA 1BQLH 2BY2A 1I9IL 4IBLT 3BN9D 5F7LB 25C8L 1RQ5A 2OL3A 1VB9A 1T0NB 1VEPA 4U0RC 1EEYB 4HWZB 1BHGA 2JE8A 2WIIA 2IQ9H 3QWOA 4MVBD 1RUKH 3A0OA 4ZS7L 3UO1H 3UTTA 4F57H 3ARBA 2NW3B 1M7XA 1Y18B 5GZNC 1FZKA 4AM0B 5LGHL 2AS5M 4NQSA 2VXTH 4Y16B 5FCSH 3EBAA 4NN5C 1CGTA 3K1KC 5T5NF 2VLMD 3RA7L 4H1LH 5D1ZD 1JGDB 3Q6FA 3C6LD 5D1XA 5EU4B 3B5GA 5JNYA 1IGYA 2DBJA 1JFQH 4O02L 3TT3H 1FYTB 3HLAA 4JHZA 1HH6A 3KYNA 1YEKH 2EDBA 1K6QH 5AZ2H 4OF5A 3HPJA 1U8PA 2VERN 4JVPA 3VH8A 4HIEB 4NZUH 4YAQB 4OSUH 4OIIH 4K7FB 1QBLL 3VWKC 3D18B 3GSNA 2X70B 1S7RA 2W0PA 4XVJL 1MCWW 2FEDC 2WQRA 2Y4SA 4G9FA 1GC1C 2ZUQC 1RZ7L 3BPLB 5DMKA 5AUMB 4HJJL 1OP9A 5HYQA 3MCKA 5FA3B 3W39A 1IGJA 3B9AA 2E9IA 5L8LB 3CXDH 5KVGL 4NUGH 1SY6L 2G2RA 5JQ6L 3AGVA 2HFFA 4LSTL 5FHBL 3VWJB 1FFNA 1NC4B 2VDQH 4JLRB 4WFFE 3G9AB 5C0JB 4U6VL 1BBDH 1P53A 3OJ2C 1QHPA 1KTLB 5JHLL 1F4YH 1EX0A 4K8RC 1VGEL 1FZMA 3NBNA 3WSQH 1SJHA 3HG1A 1HN1A 3MSPA 5JORA 2RQ8A 2VISA 2OTPA 2E7BA 3LOWA 1FDLH 4NP4L 4BZ2L 1CG9A 3LRHA 1LEKB 1R5WB 2BOCA 3BX7C 3KLHD 5D7LD 2CSPA 5I66B 1SMOA 3A67L 3TVMB 1KEGL 1QFWM 2K3TA 1PEZA 1HKFA 3QAZB 2NR6C 1UJ3C 3VXQB 2NY0D 4WW1A 3GI8H 5DVNA 3VFRB 1A6PA 4RMWA 4RIRB 3OAUH 4RWYH 3S96B 1T7ZA 2DQFB 2VR4A 1WSST 2ZKHL 4XCYB 3U46B 3R06B 1GZQB 3EJZD 3BWAA 2KBGA 3CVIH 1NDGB 4CGTA 1AFVL 4UAOC 4TSBH 4PIRF 2A6JB 3EO1A 2YZ1A 5J3HC 5ACMA 2O61B 4M9PA 4FQXD 3SGJA 5CINL 3DSFL 1KGCE 1XT5A 1S7WB 3BH9B 3THML 4EQ2A 5IK3B 3L5JA 2BDNL 5FF6A 1QYGH 4XAWL 1BP3B 1P6AB 3BD3A 2P43B 3P11H 2CXKA 5HGGS 1T21B 3HFML 4E5XB 1EZVX 1NCWL 2YPLD 3RWGB 4KKLD 4JE4B 1MIMH 3PNWA 4U7SA 1NGWB 3NACL 3U7WL 3EOAA 4GMSL 4P9HH 4PJAA 4YR6A 3RKDD 4P0DA 5K9OB 3QZWA 4MNHA 1WIUA 2EECA 2AEQL 1AKJB 3QEQA 5ITFB 5C0GA 4OUUA 4ONHA 4P3DB 4ONFL 1TJIH 1UM5L 3MLVL 3RPIA 4QRQA 2X5PA 4N0UB 4PRIE 4KJPD 4BFEA 3UPRB 3QNYB 3S7GA 1E28B 1DP0A 3IJYB 5J8OA 4MXQD 2DQJL 1QSEB 5GS1B 5DJZB 4Z0BL 5F1OB 5DURD 3JWOL 2FL5B 1B0GA 5TH2A 3MJ7A 1X5JA 3ZTNL 2IH1A 3GB7A 4M7ZB 4ZAKB 3E6HB 2C3VB 2Z8VC 3TO4D 4F57L 1TZIB 4GOSA 4L8DA 3P9MA 5KSAD 1WC7B 5KBNC 3V95A 2PW1A 1T5WA 1MJ8L 3OPZH 3TPUB 4LEXH 3GZKA 4JKMA 4LU5L 5C07E 3BP5B 4KZEH 4M1GH 4WUUB 1BEYH 4LEOB 4G7VH 4XH2A 2Y07H 3BKJL 2X9WA 2YA1A 3NCBB 4PJCE 4X7CC 1JTOA 2XNAB 3QUXC 1EUUA 2OJZH 3D3VA 4PJBB 2X4SA 1CDCA 3TM6A 4FXGB 1QP1A 1P69B 4MZ3A 3QIUD 1A22B 1YEKL 4HS8L 3GMRB 1PQZA 2HJKB 4RCAA 4Y5XC 1HHKA 4XPTH 5E7BA 4LCWE 3LEXA 4B50A 2ADJB 3D6GA 4TSAH 3V8CA 5LCVH 2VZ3A 2MJWA 1YMMB 1HHJA 4ZFZA 4F80A 3NFNA 4GRLA 4I3GA 4KHXL 4LLMA 1HH9A 4FXKB 3WHE0 2JB6B 5E8PB 2ZOLB 2D3VA 1OAXH 2PTVA 2Y72A 5ESVA 1FBIL 1JF1B 3I6KA 5FYKL 2FR4B 4U1GB 5CBEA 4ONGL 1HHGA 1BQSA 3MUJA 1QO3B 4MSWA 2EE6A 1J8HB 4UMGA 1KJVA 5C9KA 2OZ4A 4PRPB 1A7RL 1TTGA 4RMUA 4XB8A 4OJFL 3MV8A 1MSPA 4P23D 3QUML 4ZXBB 2F9BT 4YK4C 3OKKA 3LHPH 5GJSH 5BVPH 1OWRM 4JR9H 2X1WL 1U8MB 2G9HA 3J7HA 1N4XH 1BF8A 5CFHA 2QEJA 1VADA 4LCIH 1FDLL 1WZKA 3BZ4A 4GJTB 4HZLB 1RUMH 1S3KH 3L7EB 3T0EA 1CFNA 3LS5H 4XBEH 5DFVC 3DARA 4MAUH 2NY4C 3QUZB 3G5ZA 1CU4H 1J1OL 2ED8A 1D9KC 4B0MM 3HUJB 1INEL 3X17A 1FE8H 4M7JH 4V1DB 1SJXA 5T3XE 4P59L 5I1DA 1FVEA 4P4RA 4Y5YC 3W11D 2R56L 2VKWA 5DRWA 5C0FB 2CLZA 5ITBL 1KTKE 3EKCA 1Q9KA 4YE4L 1ED3A 1URLA 3N1MC 1PY9A 3S36H 3S37X 3LMJH 1I8MA 2X2YA 5JUEL 1KIRB 2BHZA 3AU1A 1HXMA 4EI5D 3DJ9A 4LVOC 5EU7E 3FONA 3VCLA 4ELKA 1U3ZA 3OL2A 1KOAA 1NCCH 4PJ9C 3MRIA 1OY3B 2R29H 5DK2B 4JRYA 3LKOB 1WIOA 2AI0H 2VDML 5H94B 5GGSB 1IGCL 1JPGB 3SGKC 3NIFF 1AC0A 1VA9A 2NNAB 1Q9LB 4NQTA 4NN7C 5JW4N 4RAUB 3JV6B 2FD6H 5DRNA 5EU6A 3ULSB 3VXMB 3NA4A 1RULH 3BIAX 2RJMA 5DJXA 1F3JA 5IB5A 1MY7A 4PTUB 2X4PB 5J13B 4WHCA 2AJXH 1KGCD 1P5VA 4PLJD 4XPBL 3SCMC 4Z7WE 4NRZB 3MOQA 4PBWD 4TRPL 3LPGA 1T2XA 1XR8B 4CN1A 2K7PA 3QO0B 4X7FC 4UIKL 1IL1A 1GL4B 2DMKA 3GBNL 1D3CA 5BXFB 4BZ1L 3SDDB 2FDBP 5DYOB 4HDIA 1EHLL 1B4JH 2H26A 5M7QA 3U0TA 4BFIA 4ZYKA 2V5RA 5EZIL 2NMSA 1FFOB 2VIRB 1GHFH 2V7NB 3N85H 2EXYC 2B1HH 4XWOC 4NZDA 3GIVB 3MGTA 5MEQA 1HI6B 5C3TA 5A3ID 4IRSD 5K9KB 3Q3GB 3HS0A 5D5MB 5DMGC 5C0CD 1CGWA 4JN2A 4N0CD 1HYSD 5EOCH 5DJAA 5IVXB 5C0DB 4TUOA 3KJ4C 4PRID 1NFDA 1MF2H 5SWSB 5HYJA 1KLFA 1NMBL 2XRAL 1MI5B 4EN3C 1BVLA 3FT2B 4K3JL 2E9JA 1ZHLA 1MHHA 1PKQE 3LZFL 5IBLD 1W0YT 4QYOA 1REIA 4XP5L 3F7VA 3JSSA 4N0FB 3MODH 5HHNA 1LP9B 3QCUH 4LBEB 4JFDD 1G1YA 4ERSL 4X6FA 4PR5A 4OLXH 4POUB 1ZTXH 2R0ZL 1EA9C 1P5UA 3SKOA 1BQHB 4JHAH 2CRIA 2AXGB 5TJWK 4MDIA 1RUQH 3S88H 3CNKA 5CP7A 3O6KL 1LEGA 4L1HA 4TVSa 3X3FH 4ZFFA 1M1SA 3O4LE 2BCKB 4NC0B 3Q6GH 2YKLL 3H9SE 3TA3B 5C07D 5IGXL 3QNXB 3LRSA 1JF6A 4Y4KC 3CLEL 2HN7A 5C0BE 4UILL 1JJUA 4EUPB 2VZ1A 4PGJA 2FBJH 4N9GB 4S1DC 1X5KA 5EUOB 1T04A 1F97A 4ZMAT 5IIEA 1OQOA 1U6AH 4XNXH 4P99A 5TE7L 5CSGA 2HMID 1I4FA 4JKPH 1KN4L 4FQJH 5TF1H 3VFOB 5EULV 3P2TA 4BYHA 1UEMA 4LCWD 5IW1B 3GMNB 4TVPL 5C0BB 1HNFA 2A83A 2Y25A 1AGDA 2J88L 1XGTA 1EO8H 4AENA 3WDJA 1DL7L 4HLJA 5CIPB 5KVMC 3OXSA 3SE8H 4IRZH 5TE4H 1KJ2H 5IJVA 1BBJB 3QNZB 1FZOB 2XXCB 4WEBH 3TESA 3OKLB 1CZ8L 2IF7A 4IMLB 1EFXB 1KBGL 2AJYH 4XBPA 2H3NA 4FQIH 3S6CA 4YIQB 5IB3B 4RFOH 3CSPA 3QEHB 5KJRH 1AQKL 1FE8L 1OAYL 2ITDA 5FM8A 1J18A 1TVDA 1E4XI 4Z7QF 4F7CA 5D9SB 3TWCL 1E4KA 1DBKL 1S78D 4JFFA 4XPFL 3BPNC 4C55A 3QEGH 5F7HA 1PGRB 3U4EB 1OGAB 2DQUL 1H15A 2D9CA 2MFNA 3ARFC 3LMJL 2DQDH 3CFDA 1N8ZB 4ZFOB 3T4AA 5CJOL 1UWEH 5FKAA 3LEYH 5HHQB 3WCYA 2AGJH 3MRBB 2VTFA 1CQKA 3TJEL 1CXLA 4YDLC 4HWBA 1UEYA 2A9MH 5JZ7D 3K4DA 4OAWA 3EYFA 2IALA 4Z0XA 2ITCA 5ESAA 4PJ5B 3ZO0A 3GI9H 5L0QC 1RV6X 5T3XD 4CVUA 5I0DA 1MQKL 2PN5A 1FJ1A 2BVUA 1JK8B 3DMMA 4Z77B 3LSOA 4K9EL 4PG9B 3H7LA 3AS1A 5D7JD 1QLEH 2E8YA 5IM7B 2DLHA 4NO5A 4P9MH 5T1DL 5IESH 4NQVB 1JZ2A 4GS7B 3WFHA 2JK5A 2Q6WB 1A6WL 5F7UA 4PGCB 5EOTB 3UYOD 1YEJL 5AD0A 4S2SA 3PWNB 2DI9A 4WI8A 3PQYA 5I18L 35C8L 3O2WH 2BRRH 3O3BB 3BMVA 5D1XD 1T4KA 1G9EA 2V2WA 3V8OA 4LVNB 3RPKA 3SE9L 5HVHC 1ETZA 1OTSC 2EDHA 2ZWLT 3TZVD 2AK4B 5ANMA 4TSCL 3CMOL 2B4CL 3JUZA 1I3RB 2BVPA 3G6AB 2IAMD 2NY2C 2B1HL 2Q7YA 5DMIH 3C09B 5GZOD 1C1EH 4AMKL 1BOGB 1T1XA 3RUGF 5DUPH 1S5HB 1RZGB 1VACA 4JHBA 1VFMA 1E4XL 2ICEB 4M1CC 3PDOA 4MXVE 4L5FH 1JMZA 2BVQB 5A2LH 4OGAC 3BP6A 1BWWA 5FB8A 3G6JA 4PRDA 4G3YL 3RZCB 3W2DH 3TN0D 1MAMH 4EBQL 4HXBH 2F5AH 5KSVB 4JQVA 2O5XH 1TZGH 1A6TA 4XP1H 2I07B 3C8KA 3O41B 1C16B 4BFBD 5GIRB 3S37H 3BEWA 2PO6C 4JFEE 1G7QA 1FZJA 1RUQL 5FYJL 2HFEB 4YDKH 1BFTA 4K07A 3BYTA 3UBXI 3FHQA 5TF0A 4H5SA 4LF3B 3RRQA 5MI0B 3I50H 3VMNA 3NCMA 1JHTA 3FHAA 1MHPH 4AZ8A 3GFUA 3IETB 3AS0A 4L3CA 5KANI 43C9B 1RHFA 3WHE1 4ZTOL 1NGXB 1V3LA 5E8EA 2QL1A 5ICXB 1KPRB 1VHPA 2P5EE 2YK1L 3ZHLA 1LDPL 4ZUWB 3WNNA 3VW3H 1RSFA 1BD2E 3V6OE 1EO5A 4I3SH 5F7EL 3CSBA 4P46A 4PV9A 3VXRB 5GRZA 5CP3H 5EZLB 4O00A 3OMZA 1LEIB 1XGRB 3MRRA 2YPKB 1K2DA 4JFXB 2VLKE 2EH8L 5EU6E 3MNWA 5IV2A 4PLNC 3O4LD 5FFLA 4NT6B 5IEKB 4O5LL 3H9SD 1GC1L 3C5ZC 3QG6A 5TDNB 1F2QA 4DGIH 1D6VH 4JANA 32C2B 2EEBA 2YZ8A 1PJ9A 4XNMA 1JPSL 1LO2H 4XGZB 1NL0L 1ZHKB 4XXCC 1VPOH 4MDJB 1ES0A 2WINA 3VXPA 5I1EH 4ZPVA 2QBWA 2X4RB 3MRPB 2VITA 3U2SB 5L88H 4OZIE 1SYSB 4F58H 1GOHA 1NMAL 2RCSH 5EBGA 3SO3C 3SO5A 5E2JA 4LNVA 1AIFA 1IAKA 2WM0A 4GKNA 4K8RL 4RDQG 4BH7B 2A73A 2J1KA 4G9DA 1KXQE 4HC1H 4G8GB 1MFEL 4PJEA 5LAXA 3O6LH 3EGSA 1V7ML 1JPFA 2DLGA 4HBQA 4UQ2B 4ZOEA 4Y5VB 3W9EA 1SY6A 2R0KL 3T3PE 3KXFA 1YEFH 5DHVB 4BM7A 4Q9RL 3VMOA 1W72H 1E27A 1TNNA 1DJSA 1O0VA 3O6FB 3SOBH 1BVKB 1RZJH 2OLDA 4D0BB 5MENB 1DVFC 4DEPB 1G6RB 4I18C 1KFAH 4PRAB 1K3ZA 5HDQL 3O6MH 1HOCB 4LDOB 4HLZH 2R2BA 3IGAA 4ZO7A 4QLRA 1IGMH 4LFHD 3B6SB 5F71A 4M43L 3PXJA 5E6IB 5FO9B 5I8KH 4R97C 3HAEH 1OAZL 4YPJA 4K2UL 4GG8A 4YZFE 3MBEA 2E5EA 4PJ7E 1YY9C 2JCCF 1FPTH 4MQ7A 5GS0D 5BMFH 1WBXB 5FO7A 2BJML 2XQBH 5IEHB 3QDJA 1XCQB 5C09B 2VABA 5LWYL 1QFUH 1AQDA 4NC1E 4WUKH 1V3MA 1N5YH 3PDGA 4QXTA 4YHMH 3BAEL 3LV3B 1A1MB 3IVKB 4N1EA 3MGOB 3RWEB 1NAML 4UINH 5I71C 1A5FL 2XT1B 4OKVA 2AJVL 3VH8G 4G6MH 1OPGL 1BWMA 2IPTL 4PJGB 4JFPA 5C6WH 2ICES 4BSVA 3QH3A 1BZ7A 3SDXE 2C1PA 4NRYA 5ENWA 1P4IL 3IRZA 2H9GB 3U7AA 1P4BH 4GRLD 4IHOB 4IOFC 5HGHA 3C2SA 4K23H 4M6OL 3MRGB 5FAAA 4DAGH 2H8PA 1R5IB 2WP3T 1YY8B 1JCKA 5FA4B 4EDXA 4OZHE 1ZOXA 1TCRB 3LEVH 3JVGA 2R2EB 3E8UL 3CPLA 1Y6NR 1AJ7H 5FUZH 5CJQH 1XGUB 4O58L 3TH3T 2NY1C 2MCPH 1R3LB 3RVXD 5HGBB 3C60B 3U0WH 1MFDH 2HTLC 5AEAA 2QQLH 2FX7H 3GDBA 1NCDL 4WY7H 2LE9A 3H7BB 2BVOA 3QFJE 1LK3L 1CFSA 1XCTB 2X4UB 3BN9C 1CT8A 1VFBA 3KNBA 2WIMA 3L3DA 4Y8DC 3SN6N 1JN6A 2QSTA 4X4XB 3D85B 5T33H 3U0PA 3RGVB 2VOTA 4Q0XL 1KF9B 4MVBC 1NGYB 3DO7A 2Q76B 1H5BB 1FNEA 4CAGA 4LAQL 2XA8L 1UM4H 1DN0A 5CWSB 1UB6A 4CU6A 3VJ6A 5HI4D 3QUYD 4LSUL 3ARED 5D1ZC 3X11B 4D0DB 2PCPB 3MUZ1 3F12B 4JFED 3C6LC 3RTQD 1A14L 4ZSOA 5IW6B 1MCPL 4X80L 1IC4L 4UQ3B 3RDTA 5LG1A 2SEBA 2V2TB 2AERT 1OAQL 5J12C 1IAIM 4WTZA 4C58B 4MMZC 2AEWA 4QO1A 1B2WH 2J6EH 1UH4A 5CD3A 3P9LB 3ARGB 1T3FA 4E42A 1YC8A 2P5ED 1EIBA 3L3KA 4OLYL 1DE4B 4JO1H 4XC3H 1BD2D 1DBBH 4DFIA 5FOBA 1OD9A 2VXUL 3ARDD 1GVIA 1OVZA 4KQ4L 5DEFA 3WIHL 3GSWA 1Z9MA 2VLKD 4M00A 4CJ0A 5EU6D 4IRJD 5JMRA 1ORSA 4GKZB 3RFZC 4ZDHB 3ZDYE 2AEIT 2L4OA 5GGUA 5IQ7L 1AH1A 5IB1B 4PS4H 4P57B 5IVXF 3U9PH 1U3HB 2VWEE 3MLRH 1IT9H 3OJDA 3MMEA 4GW5B 3VRIB 1IQDB 1WBYA 3PP4L 4F9LA 1MCBA 2WAHA 3OKDB 4P5TA 4FQQA 1EAPB 4PD4K 4TUKL 5EUKB 1I75A 4HUXA 1IM9D 4JZNB 1A9BA 5KOMC 3GO1L 2R1YA 4N5UA 3QUMA 4LCCA 4C54A 4GRWF 3L5WA 4HWUA 1QTYT 1NJ9B 3TIDB 4WW2B 3DVGB 4Y4FA 1NMCB 4PRBB 3KLHC 5EO9A 2ADIA 4QHUA 3WLBA 2FH6A 1RJZB 5JMOC 3QRGL 4HKJB 1X7QB 1DANT 2NXZD 5DJ2A 3SDCB 2NY0C 4R90H 2UWEE 3CC5A 2FNBA 2HT4D 3OX8B 2JJUA 5T1MA 5ISZB 4K3HA 4NKIL 2YN3A 1LO3L 4M3JA 3EJZC 3WHXB 4TOYH 4R0LA 4OM0H 4CBPA 3AVEA 1INDH 1CICB 3JWDH 4NWUL 4I0KA 2CLRB 1DBJL 1S7UB 4J3WA 4R26L 3CFCH 4JG0L 1O7SA 3CFEB 3EDJA 4FQXC 4FQHA 1CLYL 1K4DB 2PYEB 1L4IA 2HAZA 1K8DA 3B9KB 3Q1SH 4CMHC 4ODSH 5DD5H 4PB9L 2EDYA 2WSKA 5J9PA 4FS0A 1DBAH 1R5VA 3DXAA 1DUZB 4G42B 3KLSA 1KIPB 4Y8AA 5GGQH 5SX4I 5BVJA 1MREH 1N6VA 1GXEA 1IC5L 3MBXL 1EMTL 4NUJA 1AGFB 4G8IB 4KKLC 2XZCL 3IDJA 4BUHA 4DCQA 4FP8H 3RKDC 3QDGB 1I8LA 1OARL 2FSEA 2JELL 1CN4A 3DYPA 4ZFGH 4ZO8A 3O2DL 4Y1AB 2ZOKA 2Z35B 5FUZL 3SE3A 2VQ1A 5EN2A 2ZUYA 3OR6B 4HGWB 1ZLWH 1HNGA 3U0WL 1GOFA 2XYCA 1N26A 4KJPC 4YBHA 5D2LE 1MCRA 5C2BL 4X6DF 4MXQC 3RIAK 1A7PH 1HSAB 4R6UA 3JTTA 1HSBB 2YSSA 1HCVA 5IKCB 5L6YH 5F9OH 1MFAL 1ZT1A 2W9DH 2HT2D 3VE0B 5FDYA 3MRQA 5LVEA 3TNNB 4W81A 1KB9K 4GKSA 4OBRA 5DUML 1B0RB 2OTUB 1QD0A 1IILE 1W0VA 3MRKA 3TO4C 3CUPB 1VFAA 3W5NA 1GIGL 5KSAC 3BD4A 2OQJA 4KU1A 2BNRE 1NEZG 4M5ZL 4X83A 1C08B 2X1XR 3MA7B 5HDOA 3U9UA 6CGTA 4WI9A 3Q2CA 2XFXB 3BQUA 1DSFL 4JFZL 4Y16C 1QRNA 1F90H 4LPVA 3ROLA 1RJYA 1ZXQA 1N64L 3QFJD 3VFMA 4E41E 5GSVA 1CLZL 2HVKA 4YNYA 3QIUC 2C26A 3DLQR 2W91A 1QZ1A 1EEZA 3IFLH 4L8SB 1CGUA 2NXYB 1DQMH 4FHBD 3WKNA 5IQ9B 2R1WA 1ZS8B 5E9DB 4HHAA 3QI9D 2F15A 4GQ9H 4OLEA 5FKPB 4HT1H 4F3FB 5GRJH 4U1SB 3TBTA 4XMPL 4NQCB 5DJ6A 2ADGB 3BE1H 5IF0A 4TNVK 5CEZL 3KGRA 1RUAH 5FV2A 3BGFB 5B22A 1S7SB 5ADPL 1U9KA 3CCHA 1P7QD 4YDVB 4RMVA 2CO7B 1LMKA 3KPOB 4U1NB 1XFPA 4M6NH 2I26N 5LXGL 3CLFH 2A1WL 2DLFL 1V7NH 3BISA 4P23C 1WZ1L 3O4OB 4NCDA 2DICA 3ALWA 5I2IB 5I6XC 3MFGB 1MCSA 2AJZA 4JFQB 3H9ZA 1X5HA 5ALBL 1HXYB 3IS1X 2EDKA 1KPVA 2C3XA 3FB6A 3FCTB 3PGDA 3UTOA 4QF1B 4P2OB 1JRHH 1Q9OB 3NOIA 2FJGA 4KKNA 2BSRB 5EH1A 3EHBD 2N7AA 5E03A 4AG4H 3M8OH 3U4BH 5IWLC 2A77L 3FB8B 3REVB 5BZDA 4OCNC 5B4MC 1AO7A 1MNUH 5FK9A 1ZT7B 4J6RH 5T1KB 3UJTL 4AH2B 2Z93A 3U7YH 3ALXA 3O3EA 4QY8B 1FGNH 5DD3H 1WQVT 3W11C 4GG6F 3V0VA 4MCYA 4OM0L 1NLBH 3U83A 4YHPB 5A43C 1UA6L 5EBLB 1HKLH 1EK3A 1FG2A 2L0DA 4KVNH 3ARWA 3B4NA 3ARXA 3GJEB 5IROC 4EI5C 3HC4H 4QRPA 4LRNL 4ODSL 5J7CC 2A6DB 4ODHH 3SGDI 4RNRA 3V52H 1EGJH 4WFEE 1KB9J 3RL2B 1GH7A 4WU7B 4YHNB 4J1UB 5HDBE 1PYWA 1P9MC 4C83A 1X4XA 2WLZA 4LPXA 2DMBA 3C9NA 3X12A 1SM3L 2W38A 4MXWL 4WI6A 2NY3D 1NBVL 3VXNB 4LLQA 5TFSH 5FXCH 1WZLA 3BRGC 1SEQL 1INQB 3PWPE 3KLAB 4O2EB 2XV6B 2W1NA 3VRLF 4MJ2A 3W81A 4RAHA 2MKLC 4PLJC 5DQ9B 1W2KT 1C5DA 1PSKH 3N9GH 4U0QB 4Q7DA 3PP3K 2EDFA 1FLRH 3H3KA 1CD9B 5GGTH 1VFUA 5I76B 4J2XA 4G6FD 4P46D 1HILA 4XX1G 5J6GB 1VEMA 4MCZA 4GW1B 2MOVA 2DWEB 1QKZL 2X1QA 4FQ2L 1NAKL 5I19H 2BMKB 1B6UA 1KLGA 1H3PH 5CGYD 3GKWL 1JPTH 3VG9B 4ALAL 1JRHI 5D7IE 2EDOA 4IRSC 5A3IC 5KS9A 5DS8A 3CDCA 1IEAA 2P8MB 1BREA 4H8WC 4PRNA 3V0WH 4N0CC 2X7LA 1HYSC 4Y2DA 4X5XB 3VXOB 3FZUD 1LNUB 4G6AD 3HCVA 3EFDH 1C12B 3LKSB 4N0RA 3SQBA 2IBBA 1NFIB 3SDAD 5EBMA 5DUBB 5F7DA 1U8LB 1KT2A 3WFEH 2J4WL 3I75A 5IBLC 1VKXB 1IFHH 2C7UB 3HC0B 5DJCB 4Y4HD 3STZB 4DUWA 4W6XB 3KPSA 3HE7B 4V2CB 4NNXA 4TNWK 4WWKD 1OM3H 3MLSL 2YBRA 4WNQA 3GMPB 4M7KH 1XF5A 2HJFB 3T2PA 4Q9QL 4LP4A 5BV7H 1DANU 4YDIH 1KENL 3QQ3B 5E94A 1A21A 2BNRD 4N0YL 4OZGA 4HUWA 1CE1L 1AGCA 4HH9A 1ZLVK 2B1AL 4DGVL 1X4YA 1KIQB 3V0AC 1GRWA 2WW8A 3T0WA 2A9NL 3DUHA 4E41D 5GGVY 3GJFK 4X8JA 3V4UL 1A7NL 5DJDA 4H0HB 5FGBC 4FQCL 2HMIC 5J0BA 5C08E 2J8UB 4M6NL 4M62H 2XWJB 4X9HA 5CGTA 4KTDH 2HVJB 5HY9A 3TCXA 4R2GB 4S0TD 2YEZB 3C5SA 1MJJB 3BYYA 5F3BB 4NNPL 1SJEA 5HGDA 4X0KA 3B5HA 4HUKB 2Z9TA 4KDWA 5FYLH 3VWKA 4XTRD 5AWNL 3OZ9L 3WO4C 5CSZA 3P0YL 2NW2B 3OGOE 5KG9B 5GISL 1OSZB 4YHIB 3IDGA 5FGCB 4OZFH 4FQLH 4MD5A 2VXVH 2D7NA 3ARSA 2CDEB 1L7IL 4YBLC 2B2XH 1I1RA 5IFAH 4FNLL 4HS6A 3U7YL 3CGTA 3VXUB 3RY6C 1ZE3C 5DD3L 5HGAB 4HWEH 4EIZC 3QDMA 3ZHKA 3RWCB 1S78C 1IRAY 2VDOH 4HK0B 4APQB 4P2QA 3RIAF 5EPMB 5DT1L 3JV4A 3QEUA 4ZUUA 1ZHBB 3VRJB 1E6OL 2IBGA 2R4SL 2NTFB 5KSBF 3MRNA 4JVUA 3QXWA 2IFFL 4LARL 3P4OB 4ZNEA 3FO1B 4ZOCA 5E2UH 5HHVL 1KEML 2YD2A 3UX9B 1OAUH 5F7WC 2ZCHL 4GMTL 1QR4A 3I3DA 4M6ML 4PLOB 2JKXA 2DDQH 3N06B 4WENB 5L7XL 1AXTH 2PUQT 3HC3L 2FO1A 3UBXA 1T5XA 3S3PA 4YXKH 3UYRL 1UJ3A 2OL3B 3S34H 2E6QA 1WEJH 1U3YA 2W9LA 5D7JC 2WBJD 1I9JH 2WIIB 3QWOB 5EFIA 2IPKA 3OG6B 4QTHA 3UTTB 3C5JA 1YNTA 1HQRA 4YUEL 3SPVB 3ARBB 1JE6A 1FZKB 5DTFA 4OQTL 1Q72H 1T7YA 1QFHA 5EU7C 3WS6C 1U95B 3MRCB 4JM2D 2HKFL 5JW3L 1YPZB 2YUXA 4HEME 2ZSWA 3AY4C 4WFED 3V6FA 4LQFH 5JNYB 1IGYB 1R24B 2HA1A 4HAGA 1EAJA 1JGLL 3HLAB 3TZVC 1HH6B 2BOBA 3BGAA 3KYNB 4HAFA 1U8PB 2XZZA 2IAMC 3VH8B 5GZOC 4B7IA 4FFWD 3MV9A 1X5ZA 4ZO6A 2VDPL 3PWPD 4TULH 1NAMA 1WJ3A 1PEWA 3GSNB 4NQXA 2HYMA 2C3GA 1D5ZA 4DN4H 4G9FB 3M45A 5E5MA 5DMKB 5HYQB 1ZLUH 5DEGA 3MCKB 3W39B 5I1AA 1IGJB 1RY7B 4F7PB 4TTDD 2CR3A 1PY4A 3FL7A 3TN0C 2G2RB 1OAKL