2DLHA

Solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
121
structure length
121
Chain Sequence
b'GSSGSSGPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor-type tyrosine-protein phosphatase delta
publication title Solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 7
structure length 121
sequence length 121
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dlhA00
4AEIH 2B39A 4F33B 1J5OL 1ZA3B 4PJCA 5KVEL 3C6LB 2CLVB 5GIRA 5IEKB 5IJVA 4O51A 4R90L 5JA9A 1TQBB 3S7GA 5J3HD 5IFJB 1NEUA 3N06B 3VXQA 5CSBA 3DGGA 3T0WA 3HC0B 1WEJH 3EFDH 5EOCH 4X9HA 2NY2D 4JM4H 4Y5VC 4TPRH 1BJ8A 4R3SB 1INEH 1MFDL 3S88H 3B9DA 3BP4B 2B4CL 3LZFL 1Y6KR 4ZAKC 15C8H 5IVXB 4I0PC 5L6YL 5DFWH 1MAML 3NN8B 5E5MB 1G7HA 1WBYA 3QDMB 2Y5EA 4IIQB 5DHVB 5A3ID 4OZIF 5F1IA 2VSDA 5DJ8B 1C08A 1ZEAH 4OTXL 4YHOH 2FO1A 1ZS8A 5C0BD 4PTTA 3RGVA 3ZTJG 1LMKA 2YRZA 5E6ZA 4YWGL 1KV3A 4B50A 3CPLB 5LCVL 4YR6B 2PYFB 2XTJE 5GGSB 3EYQC 5IVZA 5KVMC 1RUQL 3MLXL 3SDDC 2DMCA 4P4KB 3PWUB 4M00A 2VDNH 3MX0A 2SEBA 3FONA 4QO1A 2EO9A 1KIQB 2IG2L 3HE6C 1T66D 2D31B 4WW2C 1D5IL 1IVLA 2X42A 3BD5A 4U6TA 4KK9D 2V2TA 5KAQF 5FO7A 2JJTC 2YRLA 1A02N 2GQHA 1WWWX 2PYED 5FA4A 5GSRB 2J1KA 5DSCA 1YEEL 4PY7A 5TF1L 2HAZA 4AEIL 3WIHA 1O7VA 2NXYB 2LFGA 1A7OH 4BK5A 3L3HA 3O4OC 3C6SA 1J1OH 2YA1A 2FO4B 3EHBC 1RHFA 5LAXB 4JCMA 4L9LC 3HE7D 2A6IB 3DIFA 4P23C 1WEJL 5DD6A 4PRIB 1QLEH 3IDNB 5EO1A 3SDCD 3TBTA 4AENA 3EFDL 1IGFH 5EOCL 4JM4L 1LO3L 4TPRL 1AKJB 1JF1B 3LCYA 1X44A 4U6YA 1INEL 2NY1B 5F7MC 4EXPX 3O6LL 3G9VA 4YDIH 4F57L 2IAMD 2AEIT 3GJEA 2YZ8A 3B4NA 1TCMA 1BZ9A 1NANI 4PJ9D 4JREC 1CQKA 1U3HD 5DI8A 1FIGH 1ZEAL 5J57B 1AXTH 4YHOL 1UKQA 4LEOB 3ZKMD 2ZUUA 1P1ZB 4NQEA 1CBVH 2NR6C 2IPTH 3QHTC 1LK2B 4OZIE 2E7HA 3ARGD 1RHHB 2BNRE 1JWUA 3BFOA 5IHZB 2EDKA 3JWDC 1HHIA 3UDWA 1AP2B 2WQ8A 2OX5A 5HI3C 3RZCD 1XZ0B 3BEWA 4X4ZA 2VDNL 5D9SB 4RMQA 3NFPA 3ARRA 1DEEA 1EGJH 3VFVB 1T3FA 3MZTA 1IM9D 1CTOA 3KR3H 4ODTH 2VZSA 5ETUA 1U8KB 1F4YH 4MA1C 3T3MF 3MLTA 4LLQB 5JW4R 1I4FB 1ADQA 1KENL 3KJ4B 3NFNB 2AK4B 1BP3B 5I1DB 3QP3A 1KB5H 4OFIA 3F7QA 3V4UL 2CRZA 1MRCH 1A7OL 4QHNA 3MRJB 5ITBH 4PJBE 1J1OL 1I3GH 2H9GA 5TGBB 1FJ1B 1P6AB 1QLEL 2F54D 2VDKH 3RUGE 1IGFL 3QUYD 3TCXA 4GSDL 3I2CH 4TTDC 2C1PB 2X4UA 1PKQE 4WFED 3WNPA 4M3JA 4XNMA 2WUBH 5E6IC 1YQVH 4UIMA 5C6PB 4DZ8B 3HUJB 3VCLA 2A0LD 1FIGL 4MHHI 4PRHE 4Z7VB 5FYJD 2N7AA 4JJHA 1CBVL 2A1WH 2RR3A 3OKNA 2IPTL 1ZKAA 5HHXL 4YNYB 2UVEA 3QB7C 4AIZA 4NRYA 4TSCH 4X99B 4C57C 3U4EB 3G04A 1MHPL 1YEIH 5F93C 5KG9B 1H3XA 3C5ZB 4JN1L 3S34H 4CMMA 4DGIH 5L9DH 5IF0A 4FN0A 4MAYA 4Z18A 1ZA6B 4H5SB 1CFSB 1MEXH 4FQJH 1CD1B 1EGJL 4KKLD 4M7LT 5C6TH 4NQCA 1CFTB 3KR3L 5EBMB 4ODTL 4YO0A 2DQCH 2NXZD 4JFDB 1VDGA 1F4YL 3L3DA 3UTTE 1P7QA 4TUOB 4NRXB 1YC8A 3L9RA 2GY7B 5SWSA 1KB5L 4GUPB 1UJ3C 1NCBH 1MRCL 4XWOD 3OAZK 1KPRA 1I3GL 1UWEL 3ABZA 2OBGA 4JANA 1BJMA 2VDKL 5GISH 3V7AE 1RULH 1Q38A 3VGGA 3AROA 1MPAL 1ZT1A 3I2CL 4WO4B 4J3WA 1EBPA 5D7KE 1JCKA 3O6MH 5ITFA 2VUOA 2WUBL 4AMKH 3JUYA 3RHWF 4FA8A 1YQVL 3EBAA 3C60C 2FX9H 4XC3H 2Q76B 3I84A 3O8XC 4JY6A 2FX7H 1GPOH 1MF2L 1LEKB 5KVGH 5FHAH 2I9LB 3O2DH 4Y2DC 2WWKT 2KPNA 2ESVB 2VLKD 3V8CA 4TSCL 5L8JB 2RAMA 1YEIL 5GIRB 5HVGB 5IJVB 3S34L 2I24N 4DGIL 2AXHA 3BMVA 4RRPA 5L9DL 3KVQA 1U8QA 3KPPA 3SQOH 4JM2A 4H1LH 3ULUH 4FQJL 1G1CA 1CLCA 1R5VA 3MNWA 1I7ZA 1D9KA 5C6TL 4IRJC 3H7BA 1XR9B 1WIOA 4ORGB 1OTUD 4YIQA 2DQCL 3EGSA 2VAAB 4PRNA 3EOTH 2DLFH 2Q86A 1IKNA 2A74B 1P4IH 2IBZX 2DYPA 5J7CC 1WBYB 1MCIA 3MRRA 1NCBL 3X14B 1OLLA 4PR5A 5F1IB 3TJHC 3VWJD 3P0YH 3FB6A 1C08B 4W6WB 3FO2A 1WTGT 5K9JL 1MCKA 3OKOA 4Y4HB 5LWYH 4PTTB 3MJ7A 1Z9SA 1ZT4A 5DQ9B 1MCDA 4NKOB 1F4XH 4JFED 5IVZB 4OM1H 4HH9A 4OFPA 3CIQA 2XRAH 2Q7YA 3O6ML 4AMKL 1MCPH 5IUSA 2SEBB 2EYSA 2FX9L 1GAFH 4D0BA 2FX7L 1GPOL 4Y1AA 1AH1A 2V2TB 2GK2A 1FSKB 2F53E 5KVGL 5FHAL 3RTQC 5FA4B 3O2DL 1KYOK 2VL4A 4N9OB 1VFMA 5JHLH 4PY7B 5DUBA 4PJDF 4WTWA 3QG6A 4X5WA 2VNCA 4P2QA 3L3HB 1FCGA 4OBSA 4PRIE 4R2GC 1UB5A 3SQOL 4ZFGH 1LE9A 3ARDD 3ULUL 4OZGE 4RFNB 4O9HL 3MGAA 5IBUB 5D7IF 4U6YB 4HMEA 3WNLA 1NBZA 4Z7WA 1P4IL 4DKAA 2E8ZA 3GJEB 2W0FA 4H8WL 4NUJA 4YBLB 1BZ9B 5ISZD 1MCCA 1ES0B 5IB2A 3JV0A 3BWUC 4WI5A 3UCRA 5J9PA 2ARJB 5INCA 4R7DA 4QNPF 2OL3H 5LWYL 4KJYB 4OCWH 1A1NA 4NQEB 5HHOD 3P9MA 1D5XB 5IM7B 1RJYA 1N7MH 1C1EH 3BUTA 3SO5A 1VA9A 4YXHH 4CW1A 4OM1L 5GGVY 3N1FC 5HYSA 5JORA 2AQ1A 2XRAL 1REIA 1P84J 5MEND 5F8RC 1ZHKB 5DJ2A 3W5MA 4PJ8B 5D1QA 1GAFL 3WSQH 1DEEB 2Z31A 3TBSA 5F7HA 4MQ7B 4OQTA 1GL4B 1JI1A 5D70H 5ETUB 1QQDB 1YYMH 5JHLL 3MLTB 3DTXA 4PJHA 2NW2A 2YD7A 1Z5LB 3LQZA 1UXWA 3VGAC 5H37H 5E8DH 4NN7C 5SWQA 2H9GB 1YNTA 2C5DC 2VR4A 4ZFGL 4M1DH 4UDUA 5CJQH 4PJDE 4U6XB 5JNYA 5E2TH 1FFPA 5HJ3B 2P48B 1WQVT 5D8JH 1EA9C 2GHWB 3T4YA 3MRCB 5T1LA 1IGCL 4RZCA 1MVUA 4TYUA 5JPNA 2DMBA 2VB5A 5D1XD 3Q5YA 4XNMB 5EC1B 3VXPA 4DEPB 3QXWA 5TDPB 3UTSE 3VCLB 4YAQB 3GI8H 1FNLA 3DETC 3AREA 4LRIC 4QHLA 1IBGH 4OCWL 1J86A 4KVCH 2J8HA 4QWWD 1KUMA 4U1JB 4EI5C 3EYUH 1N7ML 1C1EL 2BRQA 3GRWA 3HI6H 4YXHL 5FM5M 4AIZB 5B8CA 1NC2A 2X4QA 2ZCKH 1FBIH 4QNPE 1J12A 1G6RH 5J1AA 5DJDA 1NFDA 2AJZA 3F7VB 3VFUA 5DJYB 3FT4A 4XGZA 1VGKB 3WSQL 3TZVC 3IDMB 2C1OB 2UZXB 4XCCH 2WIMA 5D70L 1XIWC 1YYML 1IFHH 3WS3A 2BZDA 5SWSB 5B39A 4XP9H 3MRKA 3WFBL 3N1QC 4DAGH 1ZHNA 5F9WC 1PYWB 3LRHA 1P2CB 5E8DL 3MBEA 3RDTA 1MNUH 1JVKA 4UDTB 3TVMA 5JW5A 4YH6A 4WWKA 4HJ0C 4ZTPH 3WDJA 5E2TL 4FXLA 5D8JL 4Z7UF 3ZKSD 4J6RH 4YE4L 1IC7H 5ITFB 5MEOB 1CICB 1WFOA 3ARBA 5EPMB 5IROA 2AI0H 1UQSA 5C0AA 3GI8L 4JY6B 1BX2A 1LQSR 1NCTA 2FCBA 1IBGL 2D4FA 3WHE1 1IGJB 3SKNA 1T7YA 4KVCL 4APQD 4B0MM 2J2ZA 3EYUL 3PUCA 4PJCE 5C0IB 3HZVA 3HI6L 4NJAH 2JCCF 2NY7H 2ZCKL 1FBIL 2R2EB 4R4BA 4QOKA 3D6GA 4L3AA 1G6RL 2ATPB 3FZUD 1L0XA 3KPPB 5I30H 1I7ZB 1D9KB 3V0AC 3BEVA 5KTEL 4XCCL 5CD5D 1IFHL 1JTOA 4MA8L 4PRNB 3STZA 1HHKA 3KNBA 4ZOCA 4EIZC 4XP9L 2FHBA 2XA3A 5CEZH 1ZVSA 4DAGL 4YZFF 4QCIA 4XZUB 2VQ1A 1MNUL 3QXUA 2EIEA 1F2XK 3TFKD 3MMEA 3FQNA 2F8OA 4ZTPL 1WZMA 3ULVH 5L88H 3A6OA 4CRPA 4MXVE 2DKSA 3GBLA 1TCRA 3SGEH 2CDFB 4J6RL 1IC7L 3OKLA 1EH9A 1A7NH 4NKDA 1YNLH 2AI0L 5HD8C 4E41B 2P49B 1FVDB 4M9OA 5DD3H 3BZ4A 3PDGA 3TH3T 2Q8AH 5HY9A 3U7AA 2ZUXA 1MHCB 5F72S 2VQTA 4UV7H 1WIUA 4Y19A 5DUBB 3WO3B 4NJAL 2ITCB 4KJPD 8CGTA 4FG6D 5EBWA 3LEYH 3EZJB 4X5WB 5KSAA 1EIBA 4P2QB 5K33A 3OGOE 4V2BA 3V52L 3UTQB 2GAZA 2ATKB 1UB5B 4NQDB 2AV7B 4J7RA 2O61A 5I30L 1G7LB 1ZLVH 4XPGH 5F1NA 1TDQA 1GSMA 4GG8A 3OR7A 5D7JA 5I74B 5I0ZA 4UOW1 5H94A 3MACH 1KJ2B 1NAMA 4PJIA 5C71A 1K5NA 4PRHD 5CEZL 2IPUK 4NUJB 5BOPA 1BREA 4I5BB 4MAUH 2WBJB 1KTLA 2GTZB 3QISA 1OW0C 4NQEE 1I7TB 4RMTA 4R7DB 3RWFB 4HX1A 3DLQR 4JHAH 1K4DA 1RJYB 5IW1A 4BSWA 2VLRD 3ULVL 5L88L 3HAEH 1SYSA 4RFOH 5HYSB 3U9UA 4DN4H 3KPLA 1A7NL 4TUJA 1YNLL 3BKMH 1AD9A 3OAUH 4JLRB 4PYGA 2A9NH 3UTTD 5DD3L 1VKXB 4EN3C 2Z31B 4ODBD 1IT9H 2H6PA 1IEBA 4OCSH 1NDMA 2A73A 1T2XA 1ZVHA 2Q8AL 2XN9D 2Q6WA 5D7LD 4LIQE 4PRBA 4PJHB 2AJXH 5TFSH 4UV7L 5LQBH 1ONQA 4IMLB 1OTSC 1DBKH 3LQZB 4AH2A 3D0LA 3LEYL 5LVEA 2NY5H 3S5LB 4PRPD 1HHJB 2CIIA 3KAAA 5SWQB 4KJWD 2D7NA 2JTDA 5GJSL 4GRLA 1YNTB 4NT6A 5DA0B 2VDRH 4Z0XA 4UDUB 1G9NH 4HS3A 1I8KA 5EO9A 4JKKA 1FFPB 3N85H 5JNYB 3ROOA 3C8HA 5D7KD 5F8QC 2L7UA 4XI5D 3T4YB 5T1LB 5JPNB 1MVUB 3MACL 3IS1X 3MUHL 3MOQA 1JYWA 3FQWA 1YDPA 1ND0A 4MAUL 1DE4B 1A22B 1QZ1A 4GXUM 4MJ2A 4XPAL 4JM2F 4I4WB 3KPOA 4JHAL 4F9LA 1DL7L 3MRQA 5MP6H 2DWDA 5F1OB 5I9QC 4KKBC 1J1PH 2AJ3A 1Z2KA 1MAKA 4RFOL 5I1EH 4DN4L 1GC1C 3GSUA 5AYUH 1X5GA 3BKML 4NQCE 3OAUL 1F11B 3MRMB 4CDGC 3QDMD 2FB4H 4HWBA 4OGXL 1TZGH 4P9HH 4HFUH 3HB3D 1BQLH 5IKCA 2C4XA 5SWSE 3HMWH 1CD9B 3Q1SH 3EDFA 1UGNA 3MCG1 4ZUWA 5LQBL 4WI4A 5MI0C 1DBKL 5FECA 2NY5L 2O5XH 3BH9A 4UNUA 3MBEB 4AJ0A 3TA3A 3VE0A 4P4KD 5EU7C 1UM6H 3J7HA 2W65A 2KQNA 5JW5B 1FE8L 2VDRL 4OGAD 5J3HC 1G9NL 4HWZB 2FRGP 3N85L 2VC2H 4M02A 4Z9KB 2W0LA 4HS6B 5DJ0B 3QULA 1IEAA 4PJ7A 2NY2C 3QJFA 4F7TB 3LQAC 4BH8A 4I0KA 4HUXA 4NC1E 2XQYG 3ARBB 2F8VA 3KPRA 4G8IA 4KI1A 4LVOB 1UQSB 2VIRB 4LPTA 5A3IC 2NXYD 3BP7A 3QRGH 4Q7DA 3RL1A 1M71B 4DUVA 4GG6B 3LS4H 4KI5F 5MP6L 4GQ9H 3ARSA 5EOTB 3GKWH 2GJ6B 3FKUS 1J1PL 3GMRB 4PRID 1A64A 2V7NA 4Z7WF 5I1EL 2ZUQC 1QNZL 5L8KB 4R4BB 4JPWH 5AYUL 3ILPB 2NY1D 4MNGB 3DO7A 5GRYA 5JIIA 1T66C 4P9HL 4HFUL 4JZJC 3BEVB 5A16B 1LP9A 3MRNA 5B3NA 4RMRA 2IGFH 3HMWL 3BUYB 3KPSB 4HAGA 3Q1SL 3BD3A 4FXGA 4MXQD 4PG2C 3ROLB 3STZB 3KNBB 1WV7T 1ZVSB 3RIFK 5EU3A 3S3JA 5DC0A 4QCIB 4POYA 1DANT 4LCCB 1OAXH 4XX1G 1CGYA 4G42B 4OZHF 3VXMB 4HULB 1UM6L 1RUPH 4KDWA 2DQDH 2J4WH 3FFCA 5T3XE 3HE7C 1M7DA 2EEAA 2VC2L 3RPIB 2FHCA 4WUKH 3SDCC 3VWKA 1QG3A 3S5LG 4Y1AE 1AGCB 5ICZA 2IAMC 2YWYA 4YHKH 2ZNWA 3LKNA 4U1KA 4PJ9C 5KOMC 3BZ4B 1U3HC 4N68A 3QRGL 3BZEB 3B8SA 3V5KA 1NLBH 5HY9B 3QEHA 3LS4L 3ZKMC 4N0RA 4GQ9L 2VITA 4PGBA 3GKWL 5IMLA 3VXRA 1TZIA 1G7MA 1FNHA 5IGXH 2NW3B 5FYLE 4QTHA 1KCRH 3DRQA 4JPWL 5CFHA 4Q2ZB 1AO7B 5HHQB 3RZCC 5FOJA 4KH2A 3AAZB 2O61B 3QO0B 2AK1H 1HYRC 2R2BA 4PB0H 4MXWH 4Z7WE 4JO3H 3OR7B 2ED9A 1VEMA 3NGBC 4W4OC 5E1AB 5H94B 5I8EB 1NAMB 3TJEH 43C9A 3QUZB 3S35X 3VG0H 4RMVA 1ODAA 2O26U 2VLJA 4MJ5A 1NFDF 1JJUA 4CUCA 4JR9H 1DDHB 4HX1B 1RUPL 4GRWE 3C5ZD 2DQDL 4HCRA 3VJ6A 1FZJB 2J4WL 3DMMA 1HEZA 4BSWB 1YEHH 1VFAA 3QUYC 5JA8B 3GJFB 3SJVA 3L3KA 1RD6A 5F3BA 1JPGA 4JFDD 4MQSB 3KPLB 3CFBB 4HMCA 1NEZB 2QBWA 4JVPA 3RKDD 5BV7C 5L0QC 2DF3A 4AQOA 5CSGA 4RMSA 5CZXD 1MFEH 2H6PB 2A0LC 3P0GB 3VRJB 2A73B 4PJHE 5DEZA 1NLBL 1YC7A 3G5XB 2VLLA 2Q6WB 4ZNEA 3OWEA 4J4PD 1ONQB 2JB5L 1SQ2N 5IGXL 3DARA 4QRRE 1KCRL 2CDGA 2UWEA 2COQA 1A9EA 5C9KA 2CIIB 5IVNA 3CVHB 2GIYA 5DVOA 2GTWB 4U1NB 4GRLB 4OSUH 2HRPH 4YFEA 2AK1L 5M94B 4P5KA 5DMIH 3KLDA 4ODXA 4PB0L 4MXWL 5EO9B 4JO3L 4KKLC 3TNNA 2PUQT 5I15H 3IB4A 1Q9LB 2NXZC 3BP5A 3U9PH 3TJEL 2IH1A 3FQWB 3V6OE 2EIZA 3VG0L 1ND0B 2ESVD 1QFWH 5J6GA 1A3LH 1C16A 2FZ3A 4XWOC 1GGTA 1URLA 4JR9L 5E08H 3X11A 5E4IA 1MHEA 1WLHA 3MRQB 4Q9BA 4U3CA 4X9BA 2DWDB 4XCYA 4UMGA 1WBZB 1YEHL 4NQUA 4CU8A 1NFDE 2I07A 5T1MB 4NO2A 1KTDA 4IRSA 3ARQA 3CX5J 3BSZH 4I2XB 2VYRE 2DN7A 3CC5B 3ZT7A 1IARB 3U6RA 1QYGH 1MFEL 3ZDYE 5IIEA 4NKIL 5HHNB 3RGVD 3T1WA 2MCPL 3RY6C 4AM0A 3TNMA 1BBDH 2W60B 3DURA 3BDBA 3BH9B 1NCUA 3QWQB 1A1MA 3VE0B 3V5HA 2AXFB 4JGMA 2HRPL 4OSUL 5DMIL 4HK3J 2LQRA 2XZQH 4OCMC 3VD4A 4H0IA 5I15L 4M7LH 4GBXA 1OTUC 3QJFB 2H32H 5C0AE 4LHQB 1JNLL 2E7CA 3VFNA 4XAKE 1ITCA 3MYJB 3D0VA 3PDDA 3BIAX 1QFWL 4IOIB 3DV4A 3Q6FB 5KS9A 3VWJC 4HV8A 5E1HB 5E08L 2VZUA 4OT1H 3FRPG 1B6DA 3GSXA 2X4NB 4UOW0 4QOKE 5C0GA 4OZFA 2V7NB 2EE3A 2RB8A 4NRZA 1F90H 4L1DA 2DQTH 2YEZA 4WFHE 1N4XH 3BSZL 2PO6A 3T65A 3ZE2E 1I8LC 4LVHB 5D1ZB 2P5EA 1K4CA 5DD5H 1QYGL 5D71H 1AXSB 3ZE1E 3QFDA 1OTTD 2ICWB 2VXVH 5AYQA 3D85B 2E6JA 4YHPA 3KDMA 1UH2A 4FXGB 4NQED 5J56B 5EU3B 2V7HA 1NGZB 1NEZG 3RY5A 4JDVB 4BFIA 4FQXC 3IF1A 4LKXA 3OXSB 1HNFA 4YX2H 3PL6B 3FFCB 1YPZB 2HJKB 2E9WA 3VDCA 2QKIB 2QSTA 2XZQL 4HUKB 4OLZH 4P5MA 3QWRA 4AEEA 1PX3A 4M7LL 3VWKB 2A6DB 1E27A 1Q0YH 4F7MB 1LILA 3G6AA 2DD8H 5ICZB 3UMTA 2FSEA 4C4KO 1IAMA 3B5GA 4KQ3H 3WN5A 3QG7H 4H20H 2Y5TB 4JQIH 2OJZH 9CGTA 4Y19E 1IRAY 2DQGH 4AQ1B 1IGYB 5E6YA 1QBLH 2VITB 3LPGA 4PGBB 1LEIB 3VXRB 2NQCA 1TZIB 1G7MB 3NA9H 4R6UA 1F90L 4QTHB 2JF1A 3IDIB 4RWHA 2DQTL 5FM4A 1N4XL 5EC2B 3WFHB 4HBCH 4HUNB 1B0WA 3LKOA 1MI5B 2X1QA 5B22A 2X05A 5DD5L 1H3UA 4F7PA 3QEQB 1JN6A 4PJIE 2GITA 2VXVL 4WNQB 1INQB 3MRIB 3TO2B 2CXGA 43C9B 1SVZA 2BMKA 4GFTB 4U6HA 1U36A 2ARJQ 1TJHH 4XMLH 5GS0D 4BZ2H 2UV3A 2IQAA 2AERT 4LRNH 2VLJB 5JW4N 4MB4A 5FV1L 4P2RA 5KANG 5TPWH 1E6JH 3X3GH 4YX2L 1NMBH 5DEGA 5KBNC 3QUXA 3D9AH 2WZPD 4D2NA 2N7BA 4MAYD 1DUYA 2YPKA 4MCYA 1HEZB 1UFUA 4YFLI 3V4VH 4WGWB 1PFCA 5HTSA 4NQCD 3SJVB 4AEHH 5ID1A 3HR5A 5F3BB 4X7CC 1P7QD 2DD8L 5GGUA 5D1XC 1GGCL 4G80B 4L8BA 4W68A 5SWSD 1JZ4A 4KQ3L 1X6NA 3IXAA 3QG7L 4H20L 3NCBB 4JQIL 2OJZL 3T08A 2DQGL 1HILB 5FXCH 5GS2D 2VLLB 4GW5A 4U1IB 3ULSB 3CSYA 4XH2B 2MQ3A 1ZANH 1QBLL 4PUBH 4EEEA 4QWWC 5H2BB 4ALAL 1QSEE 3NA9L 1WT5A 3ZKXC 5T3ZE 1LHZA 2EXYD 2NY4B 3V5DB 3VGFA 4WUUB 4HBCL 3K1KC 2EDYA 1EBAA 4NBYB 1OF2B 5TDNA 3MA7A 2R23B 1CIDA 4ODXB 4HW6A 2PTTA 1D6VH 3IU4H 5F9JA 4KZDH 1QBMH 1KNOB 1LD9B 2XA8H 3LQMA 4QHUA 4AIOA 4GQPH 3VRIB 2IH1B 2VZ1A 3AGVA 4DUXA 4O2FB 1F3RB 3FQXB 1TJHL 4XMLL 1ETZA 3PGDA 4BZ2L 1XH3A 4LRNL 1C16B 4MA3A 2FZ3B 4TRPH 3X3GL 4FQLH 1Z3GH 1E6JL 2OCFD 5TPWL 1EMTH 3D9AL 4WU7A 1MHEB 2FHFA 3T2PA 3ZLQC 2VN7A 5SX5K 3PWVB 3SE8H 3V4VL 1LP9F 1IC4H 1D9KD 1I1CA 2GKIA 1JZ6A 4AEHL 4BELD 2I07B 1EGJA 2B5IC 4ZUSA 3BDXA 1MCBA 4QYOA 1U8PA 1ZT7B 4HGWA 3WXVH 2HFEB 3L7EA 1KB5A 3AU1A 4TSBH 1SJEB 1T89C 3S4SB 3CDCA 4PUBL 4LF3A 1S7UB 4APQC 3MGOA 4AM0B 4BQ9A 3QDJA 5BZDB 4R96B 3OPZL 2D9CA 4FZ8H 2D9QB 3V5HB 2VAJA 3DX8A 3FZUC 4NNXB 4PJ7E 3LS5H 5DHYB 1FO0H 1S9YB 2XFXB 3CFEB 5GZND 3KPRE 4RGNB 3IU4L 5IW3A 4KZDL 1QBML 3BAEH 5CD5C 4NQXB 2XA8L 1X5FA 3RX7A 3O3DB 3AM8A 4GLRH 4EOWH 4TULH 1HI6A 5DJAA 1N5AA 1U9KA 4FQLL 1Z3GL 1EMTL 2HMID 2XNAB 4P2QD 4DFHA 4U2ZA 2D0FA 3TFKC 4NQDD 5FYLD 3SE8L 3RI5F 2APFA 3NIFF 1IC4L 5IWLA 5JUEH 3MBXH 3VXTA 1B6UA 2XKNA 3VD7A 3L1OL 2PO6B 4KJQD 3RHWK 5D7SL 1LP9E 5F9OH 2CLZA 4NHUA 3WXVL 3ESUF 3QA3A 4NQSA 2WBJD 4NCC1 3VMNA 4TSBL 3T3PF 4YHPB 1OAZH 3T0AA 2Q1EA 5ANMA 1WBXA 3BYYA 1B3JA 1A4JA 2V7HB 1RK1A 3A67H 3KPQB 4KJPC 4FG6C 3UC0H 3P4MA 4PD4K 4FZ8L 3VI3E 1A1OB 4Z0BH 4MDIB 4ODVH 1RUAH 1JZ5A 3LS5L 2LE9A 4P5MB 5D1QD 1HKFA 4XCEA 1FO0L 4X6DB 5ID0B 2Z31D 3QH3B 4LPWA 2VDOH 2XOTA 1I85C 1L7IL 2H3NB 2OTUA 4FTVA 4Y16A 2UWEF 3O2DA 4EOWL 2EKJA 1NUGA 4TULL 4G7YH 5JHDB 1KIPB 5I6XB 3VXRE 5ALBH 4WY7H 4UT9H 5GGSY 1MQKH 4YPGB 3HMXH 5JUEL 3MBXL 4OAWA 4H1LA 2Z8VC 4ESKA 4N8VA 2VXTL 5T1LD 1FVCA 4DKEH 5AUMA 2BHYA 4HJJH 1UA6H 5BW7A 3NIFE 4F7PB 5F9OL 3HE6B 5SX5H 3RWIA 3OZ9H 2GY5A 5FKPB 3ARED 5J11C 3W5NA 1OAZL 3PV7A 4R0LC 3NCCB 3MRFB 1AE6H 5F7WC 2BMKB 3R06B 2DM2A 1AR2A 4JFFB 2EH7H 3A67L 2BVPA 5DRZA 2BY3A 5HYEA 4YHLH 3UC0L 3DVGA 1NC2D 4RAVA 4XNUH 4P2RB 4Z0BL 3VW3H 3OR6B 4HJGA 1RUAL 4KJWC 1TTFA 4S2SB 3SJVE 4LHUB 3P2TA 5DLMH 2YPKB 1FZMB 4MCYB 1NMAL 3S4SG 4L9LB 3ZDXE 1F6AB 2VZOA 5JIPA 4XI5C 3O3BA 2VDOL 5ID1B 5JMOC 1A6VH 4XXDA 4NN6B 1S7TB 3PHQB 1OOAA 4OQ1A 5EWIH 3KPMB 3ZMRA 1QA9B 5HVHC 4L4JA 5KZCB 2BVYA 4G7YL 2NTSP 3CDYA 3BJLA 3IXAB 5DK0A 4ZNEE 2CH8A 3MBED 4Z7VF 3RDTD 4K3GA 1T0MA 1FG2B 3TVMD 5ALBL 4GW5B 4WY7L 4UT9L 3CSYB 1MQKL 4KTEH 2Z4QB 3HMXL 4WWKD 2UWEE 1ZTXH 1WWBX 2K7PA 5EU6B 5J89A 2GFBB 2V9TA 3EJZD 1TIUA 2P43B 3GMLB 4DW2L 4ONFH 3CGTA 4HJJL 1UA6L 5JPMA 3ARBD 5KS9F 3BIBX 3HZMA 2HN7A 2DL2A 3OZ9L 5C0JA 1WJ3A 4XAKD 1E0OB 3MUJA 1JF5A 1D5ZB 2PTTB 1I9RH 5F9JB 1DSFH 4PGDB 4MSWA 4TSAH 4MA1B 2OL3A 4BYHA 1S7WB 1T7VA 4UQ2B 3NCYP 2GJ6D 4QRSA 2EH7L 1M05A 4OI9A 3OAYH 1XH3B 1FL5B 4XBPA 3S37X 4YHLL 5JOPD 2D4DA 4MA3B 4X8JA 4XNUL 4PJXA 3VW3L 5CCKH 1JZ8A 3B3IB 4PJGF 4P4KC 3P3YA 3WL9A 4QRQB 3TWCL 5DLML 4OGAC 4K7PX 3F65A 2HP4A 1MH5B 4OFVA 1VFUA 4U1LB 2X41A 3MUGA 4JPVH 5GS1A 1A6VL 4RDQG 3KPSD 2C3GA 5EWIL 2VDPH 4LNRB 2CD0A 4HGWB 2M1KA 3IJYA 4FNLL 1L6XA 3ZHLA 5FKAB 2NXYC 1F4AA 2Y1VA 3HA0A 3VXMD 1VHPA 5D72H 3MLPA 1A8JH 2X09A 4LOUD 3MGOB 1CTNA 3BPLB 1SVCP 3QDJB 1FH5H 3PHOB 4LLYA 1II4E 3KWWA 1LO5A 2IH3A 1BWWA 5DMKB 3W9EB 4ONFL 1T03L 2Y36H 1T1XB 2NY1C 5F96L 3NPSC 2C26A 3Q3GB 3QIWA 1X5AA 4N0YH 4MJIA 1I9RL 2ICCA 1DSFL 1NFIA 1HCVA 4HIJA 3MRHA 4TSAL 4PJ5B 5KS9E 4MXQC 1NGPL 2H1PH 5DR5L 4Y19D 1LEGA 4LLDB 5DJAB 5GGVH 4MHHG 5IW6A 3WYRA 5KSAD 3L3GA 5CCKL 2PW1A 5CEXB 1AO7D 3HNSH 3INUH 2DWEB 6FABL 1S7VB 1G6RA 4X7SH 1FIEA 3PGCB 4YHIA 3TESA 2MFNA 1XEDA 4JPVL 3S35H 5D7JD 2P5EE 5K9QI 1JRHH 1SY6L 4PJGE 5HHPB 4CBPA 1YY8B 2WUCH 1HSAB 2VDPL 1A7RH 3LN4A 3MZGB 5CEYB 3QUZD 4PRAB 1T5XA 2AEPL 3KJ4C 1M1SA 3NCJH 4LHUG 4NHUB 4NQSB 1OM3L 2FL5B 3O8XB 2EKSA 4M62H 3RNKB 3S36X 4EBQH 2Q20A 2VXUH 4CNIA 5ANMB 2PKDA 1WBXB 3G5VB 2DLTA 4PLNC 1FH5L 2NCMA 3FQRB 1RK1B 1G7PA 5BCAA 5J6HB 1KXTB 2Y36L 1IGTA 5CJ5A 2XWBA 1LE5A 4C83A 4OIAA 4MX7B 3U0WH 4RGMC 4XCEB 3BHBA 3FB8B 4KU1A 5E8EA 1T2QH 2LU4A 1DFBH 4Y16B 3QNYA 5CD3A 1JWMB 1MRFH 2H1PL 1NGXB 3P4LA 3SN6N 3BKCH 3LEVH 5HGHA 4AIXA 5I1KH 1S7RA 3GEWB 3TT1H 3HNSL 3INUL 4M3KB 2C3HA 5T3ZD 3C5ZC 4GRLD 5C08A 3CCHA 2XT1B 4X7SL 2R0LH 4OAWB 4M7KH 7CGTA 4N8VB 3S35L 2AJSH 1JRHL 4KTDH 1FVCB 3P4NB 1MJJB 2WUCL 4P49A 1CQYA 1S9WA 1A7RL 1DQMH 2EDXA 3KXFA 2JJVA 3RKDC 3H9SA 2PTUA 3NCJL 5K93A 4S1QH 3U30B 4EUPA 4QXGH 3RWIB 5CZXC 3VFWA 4F15C 4LCWA 4M62L 4EBQL 3EYFA 2VXUL 3BQUA 1B0RA 4YDVA 2FIKB 2FEDD 4NC2B 4XNYL 4BH7B 4DGVH 4OLUL 4P2RE 2I60H 4J4PC 3WCYA 3AXLA 1AFVL 4LFHD 3DVGB 3BPNB 3SE4C 4WO4C 4HJGB 1FVEA 4HPOL 1HXYA 3MV8A 4P2OA 3U0WL 4ZO7A 1QLFA 2ZSVA 3DX7A 4XB8A 1RVFH 5C0DA 1DFBL 4ZFZB 3VFOA 2EICA 2CUMA 3BKCL 3LEVL 1S8DB 1A21A 5DK0B 1UH4A 4M4RA 2C7UB 5I1KL 3TT1L 2NPLX 3TA3D 3SGKA 5HVWA 2IFGA 2I27N 1G7IA 4JDZA 1G7JA 2BOCB 2MCG1 5GGQL 2EE9A 2R0LL 4M7KL 1A7BA 1JYNA 4JRYB 3DO3A 1DCLA 4XVUD 4KTDL 2MQ0A 5F3HA 3L3JB 1EFQA 1ORSA 1DQML 4YGVA 3CFKA 4NSKA 2EDEA 2GK0B 1KJ3H 2VJXA 3F62A 3HZMB 4S1QL 4QXGL 2HN7B 5DMYA 1EUTA 3R4DA 3E1F1 4OLYH 1UZ8A 2J6EH 1P9MC 4ETYA 4MSWB 4DGVL 1NBVH 3RGVC 3P9LB 3OXRA 3BT2H 2I60L 3SKOA 3FO1B 3LSOB 1M05B 3PABA 4XBPB 3IDXL 4HAFA 1JMXA 3FJTA 4N0FA 4X8JB 4PJXB 3HAEA 1UM4H 1I3VA 1MCHA 2BRRH 3WL9B 5I17B 4MD4A 4LKCA 3GMNB 1O0VA 1DZBA 2Y6SD 3B83A 1OGTB 3EYVA 2A6JB 3TYFB 2D7OA 4LPYA 1RVFL 1TXKA 4ZOAA 3D85D 2H26A 4L4VA 4JKMA 4JZOA 2HFFA 3PXHA 3HN3A 3Q2CA 4KRPB 5C2UB 3C5SB 5HDBF 3F8UB 3QDJE 1OSZA 4ZDHB 2P8LA 4D9RE 3R1GH 1GC1H 3FFCD 1U8NA 1OPGH 4J3TA 3BW9B 1M6OA 4X4YB 4JRXA 4LLYB 4NFCA 3VGHA 4RFNC 2FJFA 3VWKD 1MCEA 3IJHA 1MWAH 1U8OA 1JPFA 3O45B 4F2MB 3N50A 3WE6A 4HFWA 1KJ3L 4LHJB 1OTTC 2WSKA 2BX5A 1XF5A 2W1NA 4HLZG 4OLYL 4YDJB 1BLNA 2J6EL 3DI3B 4HIJB 1XIWB 1NBVL 3BT2L 5E03A 1P5VA 3TLRA 3VXRD 4LBEA 5ADPH 12E8H 3BPCB 1DQQB 5F9WB 2V9QA 5FEBA 3RWHA 5IW6B 1UM4L 4JFPA 5F97E 2BRRL 3UDWC 5IOPB 1XGPA 3LQAH 1A14H 1U8JB 4LDLB 2R4SH 2FATH 4MD0A 5SV3A 4H25A 1NMCB 4PJ8C 4YHIB 4XHJD 1OB1A 3QIUA 1S7QB 1CE1H 4WI3A 4NKMA 3MFGB 4Y0GA 3VFRB 5K9KA 4CKVX 2RHEA 5FM5O 3REVA 5IJKC 1QPXA 4MJ6A 1Z0MA 1VADB 4XCNA 2CQVA 1R0AH 1BVKA 1T5XB 3L7FA 4PJAB 4E42A 5KSUA 1WFTA 2R8SH 3O4LE 2VLJD 4N90E 1JTTA 5E8PA 3SDXA 4Z5RB 3TIEA 3MCKA 1GC1L 4CNIB 1OPGL 2VN4A 5DJXA 2BVOA 3HZKB 4EVNA 3ZYZA 3P4OA 2WAHA 5ESQA 5HDBE 3HLAA 3EYSH 5DD1H 3SJVD 3V6FB 1MWAL 2LVCA 1JPST 4JE4B 2DJ4A 2H2SD 1QR1A 3SDAA 1IGTB 2XWBB 2X1PA 1J11A 3OV6A 3DYMA 3BHBB 1UZ6F 4FTVE 4U7SA 5LXGH 2AQ2A 2NYYC 3BVNB 4UB0H 3QEUB 5F70A 2ZG1A 3QNYB 1MLCA 4OCLC 3H6JA 4LCIH 5ADPL 4LIQL 3WUWA 4PIRF 5GS0C 4PLJD 3MNVA 3T77B 1HXMA 1JGDA 4WUUD 4C58B 1A14L 3VFMA 5C08B 3ULUE 1L0YA 1KT2A 1RAMA 2FATL 4MAYC 2A9MH 4XB7A 4L3EB 3O2VH 1CE1L 3F6LA 1NSNH 4KMTH 2D7PA 2HYMA 1ROWA 1H3GA 4K3JH 4WFGE 1JBJA 4JFOA 4X6FA 3QDGB 3W11D 4G9FA 2XICA 4HGMA 1R0AL 3H9SB 4EUPB 1A6WH 2R8SL 1ZAGA 5E7FA 2A6KB 5F7EH 4LCWB 1KIRA 3EYFB 3WJJC 3BQUB 2CKBH 3H42H 4U0RB 3QNZB 4WU5B 4QRUA 3IKCB 4XT1C 4S11A 3EYSL 5DD1L 4EJ1C 3S97C 3O3EB 3OJVC 2EXYC 4IRSD 2D03H 2Z93A 3MOAH 3RJDA 1BQHA 1A6ZB 5HHMB 4DK3A 2R2HB 4WHTB 5DUMH 1FAIL 3MV8B 3TN0A 3CU1A 5LXGL 2VKWA 4J3UA 3MV7A 3BI9X 5C0DB 5E2WH 5EN2A 4LCUA 1CFVH 3O6KH 4AG4L 2CK2A 1KB9J 3WIFA 5EORH 3KHQA 4QGTA 4JKLA 5KVFH 4LCIL 1CGTA 4OUOA 2V2WA 4W4NA 4OKVA 4I13B 4HUUA 1JZ7A 2D2OA 4OF0A 5SX4I 5DWUL 2ITDB 5SWZB 4KAQH 4GAFB 2A9ML 3O2VL 5BV7H 1D9KC 5CJXA 1AGBA 1NSNL 5T3XH 4KMTL 4K3JL 5F3HB 3CFJB 1AY1H 1W0VB 4JAMA 2J8UA 1AI1H 3NPZB 3GK8H 1IKNC 1N8ZA 2IADA 1RUKH 1RQ5A 1A6WL 3SKJH 4NZRH 4L8DA 5E94A 4XBEH 1FRGH 2OI9B 1UZ8B 2CKBL 2BNQB 3H42L 4MNHB 4JFQB 4X4XA 5KSVB 1KELH 4LLVB 4PJXE 5EUOA 2OYPA 1E4JA 1J0KA 1KN4H 2WANA 3PABB 1JIBA 4MDJA 2PW2A 3T0EA 2D03L 3MOAL 1J10A 4KHXH 2PO6D 5T1KB 1GVIA 5DUML 3S9DB 4WV1A 3D3VB 4LKCB 3ALXA 4OZ4A 4I9WD 4KWUA 4HZLA 4IHOA 3EYVB 2EECA 1HCFX 1QBAA 4H0HB 5E2WL 3MV9A 5GZNC 1T1ZA 5IB1A 3O6KL 2H26B 3F58H 5EORL 4L4VB 2AGJH 2MHAB 3TBWB 4LGSB 4PJFF 3OKEA 5KVFL 1T0PB 4IMKC 2QJDA 4Z8FH 4LP5A 3UXFA 1MCNA 1PY4A 2HMIC 2P24A 3H8NA 3ARFB 1OSZB 4GG6F 4I77H 3QJHA 3SE9H 3ARWA 4FHBD 2H2PC 1M6OB 4JRXB 5BV7L 3BO8B 2QQQA 3QWRD 2FJFB 5T3XL 3IJHB 1AY1L 3EOBB 1CDHA 5BRZA 3QZWB 1AI1L 5FCUL 3RIAF 4B53A 3WE6B 4XPTH 3QWOA 3GK8L 4MJIE 4KJQC 2J5LB 2EDHA 1CGSH 2P5WB 4HKXB 1RUKL 1TVBA 4ONHA 3QUKA 2OMBA 3FT3A 4L8SA 2VL5A 2WBJC 1FRGL 5JHDD 4OIIH 1MJ7H 2FIRT 4R4FH 1KELL 4K3DH 2QQLH 1KN4L 2KL6A 4F7CA 5A43C 1OT2A 1KULA 3FCTA 1BVZA 2APVA 1XR8A 3MRBA 4Z77A 1V7NH 4KHXL 5C09B 1OLZA 3QAZC 4KMLB 4R7NA 4I3SH 4MD0B 2VISA 3VH8A 2P45B 5D1QC 3QIUB 1RZ8A 2Z31C 5FDWB 1IAIM 1HSBA 5K9KB 5I1CH 2NY2B 3C5JB 4G6MH 4OGYH 2AGJL 1CFNA 3OG4B 1BVKB 3JWOC 4OCXH 3VXSA 3L7FB 2G2RA 4JFFD 2KH2B 3G08A 4Z8FL 25C8H 4I18A 4P2RD 1RURL 4P2CG 4CN4A 5DK2A 3MCKB 1BIHA 4I77L 2FGZA 3I50H 1UT9A 5BVJA 4PJFE 3SE9L 2QADD 2BVOB 3OX8A 4JY4A 1L4IA 5C0BB 2V5YA 4LSVH 3HLAB 4X9GA 3GI9H 1UG9A 4XPTL 4IBLT 3UPRA 1CGSL 3LEXA 4ZTOH 3PWLB 2BOBA 3CZFA 3WLWD 5H35A 4OIIL 1MJ7L 4UT7H 4WFFD 5D2LF 2Z92A 4MB3A 1X5YA 4HPYH 4R4FL 4FFZH 5E8OA 1FN4A 1ZE3C 4NCC2 4K3DL 5CKAA 1D3CA 2QQLL 4E5XA 4L4TA 2OSLA 5EU6D 3WUWB 3MNVB 1K2DA 4U33A 2X40A 5MERB 3U46A 5B8CC 3VFMB 3IFPA 5ENWA 4L3CA 5TE6H 4I3SL 2HT4D 4PGCA 4WENB 5I1GH 3CX2A 2DTSA 3KXFE 4DKDC 5I1CL 3S37H 4JGUA 2LAAA 4LCYA 1T1YB 4G6ML 4OGYL 1OARH 4Q74A 2XG4A 3BPOB 4PGEB 3VU2A 4OCXL 25C8L 5DJCB 5L7XH 5JOEA 1DANU 1U3HB 2X4TA 3MBEC 3MROB 2HKFH 1DN0A 3I50L 5IBLC 3TVMC 4Y5VA 3ULVE 1T83C 4WWKC 3ECBA 3GSOB 1IM3B 3D39B 4QRUB 5L2KA 2DAVA 3GSWA 4LSVL 3RZWA 2VXSH 1PY9A 3GI9L 2P8MA 3MV8E 3M07A 3ARGB 2V2XB 3DV6B 1MELA 2Z93B 2YD3A 4HXAH 1G9MC 3FRUA 2ADFL 4ZTOL 1S5IH 3WHXB 3ARBC 5CAYB 5IROC 2K9UA 3WNNA 3VD9A 4OD2A 2YSSA 1MCFA 2EDFA 5C0CE 4HPYL 4LCUB 1JGVH 2BSRA 1I1FB 4N0UB 3WIFB 1AC0A 2PR4H 3QZWG 4V1DA 1L9MA 1BFSA 3QDJD 4J1UB 2YUVA 3F7YA 3VXUA 1FPTH 5CIPB 2V2WB 4CMHB 4XVTH 5DJ6A 3SKMA 3NTCL 4BUHA 1P69B 4WW2A 1D5MA 2ZZUT 3GIZH 5EU4A 1KJVA 3LB6D 4NNPH 2ENSA 2X44D 3EZ8A 5TE6L 5ESVA 3D2UA 5HYJA 5IQ9A 5I1GL 3DXAE 1CF8H 1FZKB 1D6EA 5LGKA 3P40A 1Y6MR 2J8UB 1OARL 1XCTA 5IT2H 1MJUH 4PJ5D 4K7PL 5L7XL 4FS0A 5L0QB 3NCEB 1QRNA 5EOCJ 3TCLB 4L8DB 4P23A 2HKFL 4PBXA 4Y89A 5HHVH 3RWCA 2HVJA 4MD5A 4LOUC 3GSRA 5EUOB 3LHPH 4C56A 2WINA 5BQ7B 2FLBT 5I8OL 4BSVB 4ZG1A 5BVPH 3RWEA 2VXSL 2CGRH 2PW2B 3NAAH 2WW8A 1QEWA 1M7IA 3CUPA 1TZHA 4JFYA 1VEPA 2X2YA 4HXAL 3BGMB 3S36H 1FGNH 1ZV5A 5HGAB 1SJHB 1S5IL 4Y88A 4TQEH 3M1BB 4IHOB 4L4VE 3TBVA 2FWOA 4O2EB 4UQ3B 1JGVL 1U91B 1T1WA 2ZUYA 3CMOH 2PR4L 4A6YH 1JV5A 2VE6B 2BVTA 3N1GC 1FPTL 4XVTL 2A2QT 3BZFB 4IS6A 4N9GA 3GIZL 4NNPL 4JRXE 3EUUA 3F12B 2IBBA 2DQIL 2JLLA 3QQ4A 1X5KA 2DLHA 4QT5A 5DDHA 3MGTA 1S3KH 4P2YA 5D7JC 1PG7W 5BRZB 3I6LD 2D7TH 4FTVD 4Y16D 1MJUL 2XKSA 3QWOB 3BYTA 2C4FT 3QUZC 1EHNA 2ZP0T 2YPLA 3B2VH 3FT3B 4P99A 1R3KB 1WC7B 5GHWH 5E5RB 1T20B 3CFCH 4DN3H 1KB9K 4JHBA 5HHVL 2UYLB 4JN2B 1WISA 4XBGB 4M61A 5BVPL 3ZDZF 3ULUD 3D5OF 5E6IA 3LKPA 2CGRL 1EEZA 4PREB 5AAWA 5CWSA 3S36L 1YPZF 4XNXL 4GKNA 1XGQB 2BC4A 3WS6A 1FFNA 1SEQH 3QO1B 4R7NB 4TQEL 4WFGD 2VISB 4QXWA 3D25B 1RZ8B 2NX5A 4JFHE 2FJHB 4QRTA 3AFLA 3CMOL 1PBYA 3HNTH 1X5XA 1CFNB 1KG0B 1PZ5A 4ODUA 4A6YL 2DBJA 2WP3O 3SDXE 1Y18A 3E3QE 3HI5H 4UUJB 4BQBA 5C0EA 3MRPA 1RJZA 1LO4H 3LKRB 5CHNA 3LRGA 4O4YH 4K71B 5F7KC 4P57A 2BVEA 3GGWA 4OCRH 5BVJB 3RI5K 4GRLC 3ZTJH 4OZIA 5IMOA 1TETL 4DVBB 1JGUL 4NO3A 4ZFOB 3MUY1 4Z78A 1S3KL 1FO0A 3F7RA 4R4ND 2D7TL 4P5TB 3L3IA 3QI9B 4JFEB 1F97A 2DLGA 4Y4FA 3W0WB 1AR1D 5GRXG 3B2VL 2HJLA 4LLUB 4OF7A 5GHWL 4CDHA 4NDMA 1BF2A 1X4XA 1PQZB 5H35B 3BZDA 3CFCL 4DN3L 3QHZH 4M6NH 5F89A 2ADGB 5CMAB 4G5ZH 1N3NA 1IL1A 2FEDC 5JO5B 3H9ZA 3RWDB 4FZEH 2R0WH 1NGQH 4L4TB 2YKLH 3ZKNC 2DBLH 4WTZA 1GGYA 2R0ZH 4OM0H 2GCYA 4OLVH 1K2DB 1I9EA 3U46B 4K7FA 2ICEA 3DRTA 2EYTB 3GSNH 3IFPB 5BXFA 2RJMA 4PGCB 1FZOA 4MNQA 1H5BA 3UTOA 2ADJA 3VI4E 2AQ3A 3ARDB 2R1XB 3I02A 4J3SA 3ZDZE 4Y2DA 1EHLH 3QFJA 4G9FE 2F5BH 5DEFA 5DMJB 1JF6A 3IJSB 3T0DA 4LCYB 1IAII 1I1YB 1R24B 1FFOB 4PLKD 2DQFA 1DTUA 1UEMA 3EO0B 5E2JA 4Z7NF 2KZ1B 3E6HA 3HI5L 4FFYH 1H0DB 1KCSH 1N0XH 1LO4L 1FDLH 3WUZA 5I1AA 5ISZB 4O4YL 4BK4A 2X4TB 1DN0B 1XCQB 4IRJA 3PE9A 4K3HA 4OCRL 3BP6B 5ADOH 1KSRA 3QQ3A 3HZYA 4XP5L 4KUCF 3SCMA 4HKBB 5L2KB 3GSWB 3TBYB 3JV4A 3MXVH 3L3OB 2Z9TA 3SE3C 4XVUC 4LMQE 1FG9C 1CL7L 5F7LB 3TIDB 1UYWH 3MV7E 4GW1A 4KY1H 4LVNB 3NACH 4G6AD 1XF4B 4KRPD 1V8HA 1AIFA 4CVXA 3QHZL 4M6NL 3FTGB 1GXEA 4G5ZL 1YA5A 3D18B 1N64H 2R0WL 1NGQL 2YKLL 2DBLL 5C0ND 3HMXA 4JVWA 4Y8DC 5DT1L 4BZ1H 4F7EA 4OLVL 3IU3A 1YEDA 2V5SA 4P46B 1X7QA 3GSNL 3SDYH 5JIHA 5ESVB 1P5UA 4LVHC 5HYJB 3RTQA 4FQCH 2E8YA 5C07A 3UYRH 2Y6SC 1YNKL 3QIWD 1EHLL 3FFDB 3K8KA 3MLYL 3QBTB 4CJ0A 3G5YA 4M5YH 5TJWK 2MWCA 3VG9B 5D1XB 3KLAA 1L7TH 4FFYL 1KCSL 3P0VH 1N0XL 1B4JH 1FDLL 2OTWA 3DBXA 3V6ZB 4B7LA 2QR0A 1AGFA 2EC9T 3O11A 1L9NA 8FABB 5CINH 3P11L 2XZCH 3PL6C 3RWCB 3UJIH 1JGEA 4MD5B 3REWA 4Z7NE 3GSRB 3T0EE 2QSCH 1C5BH 2P7TA 2EDLA 3MXVL 2H8PB 3IFLH 4XVJH 3VWKC 4DVRH 5DHVH 1DBBH 1QEWB 3CUPB 1I75A 4GW4B 3LN5A 2QLVB 1UYWL 1QUNA 4HIEA 3T1FA 3MV9E 2FBJH 3NACL 3RWJA 3DUSB 1CL7I 3MJ9H 1CLOH 1T1WB 4UZGA 2YWZA 1T22B 4Y5XB 2VZ3A 3EAKA 1XGRB 3I75B 1JHKH 2QSVA 1N64L 4HWUA 4LAQH 3U2SB 3H9HA 4BZ1L 1AD0B 4HUWA 1SYVA 3NABH 3FO9B 3SDYL 3FN0H 3QQ4B 1HH6A 3EYOA 3JV6A 4FQCL 2XTJB 4IJ3B 3UYRL 1D5BB 5DDHB 1LDPL 5AWNH 3UEZA 4XHJC 4K2UH 4M8QB 1WZ1H 3PXJA 1BVLA 4N5UA 3BMWA 4NZTH 1L7TL 3OKMA 1F3DH 3OJ2C 3P0VL 4MCZA 1B4JL 4HIHB 3VRLF 1OGAA 1KIUA 2UUDH 3VD3A 2AXGA 5CINL 1EPFA 4AYFA 2XZCL 3UJIL 3V79C 5C08D 3MOBL 1A6PA 1HOCA 2OJEB 2QSCL 1C5BL 4APQB 5GSVA 1V3KA 2FX8H 4RDQF 2PNDA 3IFLL 3NIDE 4L3ED 4XVJL 3GUTB 5HPOA 1EEZB 1JK8A 4DVRL 1DBBL 2CJUH 2H2SC 5CWSB 1NGYB 3QDGD 1A3QA 3G5ZA 4GKNB 3KXFD 4LRIA 3B6SA 2FBJL 2IALB 5C0FB 3H9SD 4JJ5B 5F6IB 1T7XA 5CEZD 3WDIA 3KPNA 3MR9A 4QRTB 3MJ9L 1DLFH 4LCWD 2RFXB 1CLOL 3VXSE 2EDNA 3BQUD 1RK0A 3U36A 1PZ5B 1JHKL 4LAQL 4D0CB 4FQPA 4LEXH 4GKZA 4PLJC 3NABL 2NY4C 4P3DA 4JFZH 3TZVA 3UP1A 4I0CC 3GGWB 2OS7A 3FN0L 4K55A 4OZIB 1UXSA 5IMOB 3MV8D 4P2OD 2BNRB 4NO3B 5AWNL 4JPKH 2ZWLT 4K94C 4K2UL 2YPVH 1WZ1L 5CZKA 1TVHA 1U8MA 3L3IB 4FXKB 4RIRA 3RP1A 5CSZA 4NZTL 4WHYG 4Y4FB 3W11C 3MLSH 1OAYH 2E27H 4WW2F 2HJLB 1FQ9C 3CH1A 5AD0A 1K6QL 1ORQB 4NO5B 4ZUUA 2EYRB 4L4TE 1N3NB 3MJGX 5SWZD 3KJ6H 2FX8L 1RPQA 3HFMH 5IQ7L 1F45A 1YJDH 3VRLE 1ED3A 2GCYB 4PJBB 3U0PA 2ICEB 3DRTB 1BEYH 4AT6B 4IRSC 2F19H 4PJDA 1CCZA 3RUGB 1FZOB 3H3PL 5D6CB 1H5BB 2J12B 1CYGA 3T8XA 1L6ZA 3QFJB 5DEFB 1HINH 5JR1H 1DLFL 3O3UN 1PKQB 1RI8A 5E5UB 1VFOA 3SY0A 3PV6B 3WKNA 5IR1A 1HYSD 1O5DT 3HPLA 1RZKH 2DQFB 1SEBA 5MEPA 4OV6F 3AUVA 2YBRA 4LEXL 3RPKA 3S6CA 1I8MA 4OLEA 4PRHB 5D7IA 5DS8B 1WITA 5I1AB 4QRPA 1MFNA 2X10A 4JFZL 3NBNA 5T1KD 1H3PH 3MV01 4HKJB 3HZYB 3D3VD 3SCMB 4WI8A 5DGQA 4JPKL 2YPVL 3FMGL 4GOSA 2CRMA 4M7JH 4RGNC 1YZZA 4LPVA 5FUCE 4L4VD 1QOKA 3MLSL 1OAYL 2E27L 2JKXA 4GW1B 3K2UH 4V1DE 1AIFB 4X9FA 4PP1D 1KEGH 3VXUE 3ARFD 1CN4A 3GMMB 3RNQB 3KJ6L 4YLQT 3HS0A 4X6BA 3HFML 2OK0H 1YJDL 2YR3A 4JRXD 6CGTA 4XTRD 3MRDA 5HYJE 1XGTA 3L6FA 1YEDB 4R9HA 5HYQA 1X7QB 2F19L 5FK9B 4BFGA 1U8HB 2PO6C 5DQJA 1AXIB 4J8RB 3DNKA 1IZJA 2B4CC 3SO3C 1I7UB 1HINL 5JR1L 1CDCA 2DLEA 1I9IH 4F3FA 3E0GA 3DX6A 1RZKL 1QRNE 1OP5H 1EJ6A 4K8RD 5GJTH 1R3JB 4Y4KB 2OTWB 3DBXB 1QFHA 3FN3A 1NCAH 3K74B 4C56E 5ERWA 4JQVA 1DUZA 2BSSA 1H3PL 2R1WA 5C09D 4F58L 4PV8B 1ZHLB 3DSFH 4ONOA 5HI4D 3QIUD 4M7JL 4NKQB 1UM5H 4FABH 1PG7X 3NIGE 1S7SA 2X4SB 4U2YA 1FYTA 5IHLB 1U0QA 3T1FB 5IB5B 3MJ8A 3R0NA 3ZTNH 5F44A 4PPTA 3K2UL 2HT2D 2XZZA 1KEGL 4YK4B 1ZLWH 5LBSL 5I6XC 1FHGA 1YN7A 3QR2A 2PXYA 2OK0L 4M4PA 3IAGC 1QLRA 4UINH 2YN5A 3H9HB 3RY4A 3GHBH 4Z7OE 2EEBA 1SYVB 1CLZH 3MREB 4YC2C 3SDAD 4EN3A 4Q9QL 5JMRA 3EYOB 3JV6B 3FT2B 5EOQH 5DFTA 1WK0A 2F74A 3HRPA 2OLDA 3QCUL 1DR9A 1GIGL 1I9IL 4MYWB 1BVLB 1R5IB 2YC1A 2YPLE 4GRMA 2J6EA 3OKMB 5GJTL 1KLGB 4Z7UA 5IEHA 1I7RA 1KCUH 2F53B 1SBSH 1NCAL 4X5XA 3IGAB 2ORBH 3CLEH 3I6GB 4KPHH 5DVKA 5EO0A 2APWA 4Y5YA 1HOCB 3DSFL 4UV4H 2QADC 3L5JA 2G9HA 1UB6A 2GYSA 5F7UA 2HVKA 3CFDB 5IV2A 1UM5L 4FABL 2GJZA 4NN6C 4OZGB 2NX5E 3S88L 1KTRL 2JCCA 4HH8A 4ACPA 4CVZA 15C8L 3NPSB 3ZTNL 5J06A 3GKZA 3HNVH 5FUZH 5INDB 3WLWC 2Z91B 3MR9B 2B0SH 4BFBD 4J3XA 5DURB 4OV5B 4LK4A 3BXNA 2Y72A 5KN5A 4Q97A 2YD8A 4JQXA 4HG4K 3HCVA 3D39D 4RISH 4FFWD 2BFVH 2R1YB 4Z76B 1CLZL 5TDOA 4XHQA 1U2CA 2XQBH 1FORH 2BDNH 2IANA 4G43B 1MWAA 5EOQL 4ZUTA 2E9IA 3Q5TA 2HT4C 1CGXA 1DN2A 1J88A 1F3JA 4TVPH 3PQYA 1NC4A 1CFBA 2YD1A 3MV7D 3X13B 1U8IA 2R9HD 1TVHB 1U8MB 4UNVA 4HDIA 1CK0H 4K3EH 3B2UD 3V7AG 1SM3H 4BA8A 1SBSL 4U4BA 4Q0XH 3P9WB 4O02H 1VEOA 3D48R 2ORBL 1D7FA 3CLEL 4KPHL 4ZUUB 3STLA 4NBXB 3DVFA 3C8DA 1AGEB 4U1GB 1W0WA 3ET9F 1B0GB 2EE2A 5T5NG 2R39A 2B20A 1U6AH 3U0PB 2YA0A 5C8JB 4MNQE 5ICYB 3OTTA 4ZPVB 5F7YC 4PJDB 3QFJE 1P4LA 1J8HA 1MFAH 4YDIL 3HNVL 2M2DA 1MCLA 5FUZL 4RGMB 1HH9A 3CJJA 2B0SL 4I8DA 5F7NC 1G7QA 5GS0H 5K9QG 1AXTL 3HPLB 4POZD 3UTSB 4D9QE 3BPLC 4ISVA 5B38B 1I8MB 5D7IB 4G6KH 2BFVL 1DQJA 1I8IB 2XQBL 1FORL 3O41A 4JZJA 1QFPA 3LB6C 2HTLD 1CE6B 2RGSA 4WEBH 3QPXH 3U7YH 1J05A 4X98A 1CD8A 2QEJA 1VPOH 5E24E 4TVPL 4ZFFB 4P4RA 4X6CF 2IFFH 2X6MA 1CK0L 4K3EL 4I3RH 4J2XA 3EO1A 1SM3L 4HK0B 4L29A 4CVWA 4Q0XL 4O02L 3HE7A 3QEGH 4F15B 5HSFA 5ITBL 1YUHB 3SDCA 1QPPA 3T3ME 4X6BB 4RX4A 5IWLC 1A9BB 1CT8A 1U6AL 3IDUA 1C7SA 1XGTB 3L6FB 1NJ9A 5BRZD 5C07E 4PJ9A 1KJMA 2W0PA 1MFAL 5LG1A 5IK3A 1IKFH 1ZSDA 4NQTA 1I3UA 4KQ4H 5DRXB 5GS0L 4F3FB 1EEQA 4PLOB 3WNKA 3G6DH 3ES6B 5C9JA 2ADIA 3BESR 2X7LB 3KYNA 4GO6B 2A1WL 2CKBA 5MHSE 3UPCA 3MRLA 4G6KL 3BX7C 4PB9H 3A6CH 3RZCA 1EK3A 1Q94A 4XNZB 4MS8D 1UJTA 4WHDA 1DUZB 4K9EC 4KK6D 3LDBB 4PJCB 5D5MF 5FYKH 4WEBL 4O51B 1GRWA 2BVQA 3U7YL 4YHZH 1F6LL 5HPMA 4TNVK 4LDOB 3VXQB 1U92A 1VPOL 1MEXL 3DGGB 4KV5F 1PSKH 2IFFL 4JPIA 1FYTB 2CUHA 4Y16C 4I3RL 3MJ8B 5ESAA 3VXSD 4AY0A 4ZD3H 1G7HB 5IESH 4IRZH 4ELMF 3UBXA 3QEGL 4X6CE 4DJMA 3LKQA 2YUXA 1JNHA 3IFOA 2EO1A 1ZS8B 3FAXA 3RGVB 2JB6A 1FYHB 5C2BH 4LL9A 5GISL 1JI2A 3ULUC 4YQXH 1RULL 4ODWA 1MOEA 4P5TD 3QI9D 3ME0A 2F9BT 3W0WD 5BW7C 1RIHH 1EEYA 3FONB 3U30C 3IVKA 4XC3L 1J0IA 4G8GA 5AEAA 4H8WC 3A6BH 2X4RA 5FO7B 3VFTA 2YC1B 1U93A 5JOFA 1OGAE 1K8IA 4PJAF 4Z7UB 5DSCB 5IEHB 1I7RB 4L4TD 4PB9L 3A6CL 1UH3A 3Q6GH 2BSED 5EO0B 3QT2A 3BPNC 5FYKL 3C6SB 1KJ2H 1T80A 4AL8H 4YHZL 5CGYD 1UB6B 1H8NA 5DD6B 3DIFB 1PSKL 5B38G 5IV2B 5EO1B 3TBTB 4AENB 1EJOH 2GJZB 3RQ3A 3RIAK 4R4NC 1A2YA 3EOTL 2DLFL 5E7BA 1AR1C 4ZD3L 5JQ6H 5F1KC 4UOJA 4U31A 5IESL 4IRZL 1HZHH 3P0YL 5DI8B 1Q72H 3HCVB 5L2KD 4ELME 1WAAA 4YQXL 3JVGA 5TDOB 1YEKH 1F4XL 1JWUB 1MWAB 5F7DA 1HHIB 2BP3A 5FA3A 1IQDA 3BEWB 1FL3A 1MCPL 1RIHL 1Z9MA 4OZHA 1YECH 1U3JA 4R97B 3NFPB 1F3JB 2ZOLA 5FF6A 4M93C 1T3FB 5E8NA 3L95A 4OIBA 3ORJA 2X70A 4HWNA 2VLKA 4PLKC 2NY3D 5DVMA 2OR8A 2WV3A 4HIIA 3C2AH 5JDSA 3Q6GL 1I1RA 3ZHKA 4WVRA 4QHNB 4P46D 5JDJA 1KJ2L 4AL8L 5HYJD 4JZNA 4QRRA 3JZ7A 3JTSA 4X6EA 5GGTH 1WSST 1K8DA 5GS1C 3VWJA 2X4UB 5JQ6L 4JY5H 3BN3B 4UIMB 1QRND 4G6AC 1HH9B 4KRPC 1S5HA 2CKNA 4XNQA 3TYGH 3GRWH 1BJ1H 1HZHL 1G7QB 2Y7QA 1YMHA 3V6OA 1Q72L 5D7IE 1GZPA 5H8DA 2OL3L 4QRPE 1ZLVK 4U1HA 5GPRA 3LRSA 5IG7A 1A6AA 3OKNB 5C0NC 1A6UH 2NLJA 3LV3A 1YEKL 4NRYB 4EI6A 3G04B 1EHXA 5I8KH 1UADC 4CMMB 1WCQA 5IF0B 1YECL 4MAYB 4PGZA 1T0NA 4X98B 2N56A 3GJFK 3QIWC 4NQCB 1AQKH 1F5WA 3RA7H 3BWAA 4YO0B 2VQUA 4FQXA 1E4KA 3L3DB 1P7QB 1T5WA 3L9RB 2XPGA 3C2AL 3QIBA 4DGYH 3SQBA 5GZOC 1KPRB 4N8PA 5A2JH 2QQNH 1G9MH 2XTJD 1KPVA 5GGTL 4JANB 2VSCA 1DQDH 4M1DL 1NMCC 5CJQL 1ZGLA 1EAPA 1SHMA 2PN5A 1ZT1B 5L8LB 1N6VA 1WWAX 1KLFA 4JY5L 2YPLD 3TYGL 3D69A 2DI7A 3UTZA 3OF6A 2ADIB 3PNWA 3PP4H 5EFIA 5IBUG 5T33H 1H8OA 1A6UL 3CDGA 1YMMA 3SKUD 1Q94B 4YDLC 4X7TA 4LLMA 3LD8B 5BZWA 5I8KL 2BVQB 5ACZA 2CDEA 1U8QB 4JM2B 1U92B 1FYTE 3MNWB 1R5VB 1RIVH 3H7BB 2AABH 2JJWA 1AQKL 5EZJA 4YIQB 4ZS7H 3ELAT 3EGSB 5ESAB 2BY2A 2Q86B 1AQDA 1LO2H 2DYPB 5B4MD 1R3HA 3W81A 4DGYL 2DQUH 3MRRB 2IMNA 4PR5B 4LPXA 1KFAH 3FB6B 3H0TA 3FO2B 4C59B 5FB8A 1G9ML 2DQEH 3OKOB 2JB6B 3K8LA 1ZT4B 3MJ7B 2BNRD 1DQDL 1E4XH 3IFNH 4QHMA 1NPUA 4NPYA 4RNRA 4NNYA 4ODWB 2VWEE 1OCWH 2V5RA 1CR9H 4GKSA 5E99H 1HIMH 5C0RH 5I76A 3SGJC 1FNGA 4HH9B 4PJEA 5D2NA 5IMKA 4Y4FD 2Q7YB 1KACB 2R15A 4U1MA 2EYSB 5I71B 1EAJA 4D0BB 4Y1AB 4KVNH 1EVTC 4DCQA 4Z7UE 1WTLA 1RZJH 3BQUC 4NHCH 1N0LA 4MWFA 1K8IB 1IAKA 4U0RC 4C55A 4JRWA 1E6OH 4JDTH 3QG6B 2NY7L 2DI9A 2YOCA 4ZYKA 2A77H 2BHZA 4XXCC 4MNQD 2V6HA 1N26A 4P2OC 1LE9B 2OXGA 3QFJD 5FGCE 3OMZA 2JCCE 4L5FH 2YD2A 4ZS7L 2BNUA 5JXEA 4DK6A 1NBZB 4Z7WB 2MPAH 4PG9A 4A6YA 1LO2L 1S7XA 1DBMH 2W0FB 2DQUL 3I9GH 2MNUA 4P48A 4UT6H 5IB2B 1KFAL 3BRGC 3GJFH 5J9PB 5I1LA 3NZ8A 5INCB 3BE1H 2DQEL 3ALPA 3SCMD 1A1NB 1E4XL 3P9MB 1HWGB 2XYCA 2IANE 3IFNL 4YZFE 5LJYH 4GRWB 3V9FA 2KKQA 5F9DC 4D9LH 1OCWL 1U3YA 1CR9L 4CW1B 5E99L 1HIML 5JORB 1IQDB 1RUMH 1PD6A 3PQYE 1J87A 3QAZB 1CDYA 1ITBB 3IDJA 5EH1A 3HRZA 5DJ2B 1X5LA 5D1QB 4F80A 5FF6B 4KVNL 3TBSB 5E8NB 5EU7E 3IS0X 2OI9C 1RZJL 3CVHH 3DTXB 3OJDA 2NW2B 1X6LA 2OZ4H 1E6OL 4MLSA 1UXWB 1P4BH 1W72H 2V5MA 1FL6A 1QSEA 2A77L 2J3SA 1DVFA 2WM0A 4HBQA 4QRRB 5C07D 3JTSB 4WI7A 4X6EB 2PF6A 4XWGH 4XPGL 4L5FL 1J8HE 2AV1A 4RZCB 4FP8H 2MPAL 3UPAA 3N0PB 3VXPB 1DBML 5A2IH 4RRPG 4Y4KD 3I9GL 1OL0A 1S5HB 4UT6L 5EZLA 2Y7QB 1ZVYA 4RBPK 3CXHK 5I1HH 4PP1C 1ZLUK 1GZPB 2O5ZH 3AREB 3ARFC 3BE1L 1J7VR 4QHLB 1PG7H 3OHXA 1EUUA 5IG7B 3HI1A 1QSFA 3FL7A 3TPUA 3GMOA 1G9NC 4YUEH 1Q0XH 4HWBH 4D9LL 3NCFB 4XTRC 2Q7NA 1PX4A 5B8CB 1NC2B 5I8CA 4EI6B 2X4QB 2PYEE 1RUML 4LQFH 5J1AB 1BFOA 1EERB 2J5LC 1NFDB 5DJDB 2AJZB 4MMXC 3VFUB 1T0NB 2A9NL 3FT4B 4XGZB 3C9NA 2Z8SA 3HG1A 1IT9L 4OCSL 3RBSA 1N2RA 3P77A 3BWAB 4PRDA 5J12B 3CVHL 3M17A 4MVBD 4K8RC 1F13A 3WS3B 1OD7A 1T5WB 2AJXL 3O3AA 4BM7A 5TFSL 5B39B 3QIBB 2OZ4L 1FLTX 3MRKB 1ZHNB 2DS4A 2YD6A 5DUPH 2EXWD 1P4BL 2NNAA 1W72L 3RDTB 1NBYA 1BZQK 1XGUA 3TVMB 1I85A 1NKRA 1HK6A 1GHFH 3GSNA 2Q87A 1KPVB 3PWPA 4WWKB 4XWGL 3OQ3B 3M45A 5HI4C 1E28A 1VACA 1EAPB 3QIUC 1ZGLB 3FOMA 1MLBA 3HC4H 3CDFA 4P9HC 3VGEA 1IMHC 5ILTH 3NOIA 1ZK9A 4CADA 1UVQA 2F53D 5C0AB 1OGAD 2B1HH 1BX2B 2CLRA 2HT2C 5I1HL 2VLRA 4S1SH 3UTZB 2O5ZL 3NCYS 3E3QC 5KSBF 1PG7L 3FB7A 3PNWB 3SKNB 3E6FA 3IDGA 1Q0XL 3FQTA 4FQQA 3HZVB 4X9IA 3B5HA 4LLMB 3SDAC 3SGDH 1DQTA 4QOKB 4IOSD 2A83A 4U1SA 1N59A 4QHKJ 3DROA 4GS7B 2XN9A 1PVHA 5D7LA 2FB4L 4NUGH 1TZGL 4YFDB 3AY4A 5AAMA 2C3VA 3G6JF 1BQLL 4Q6YA 4KK9C 5DURD 3U1SH 2VTFA 1WAAF 3FOLA 1V05A 1M4KA 4PRPA 5EA0H 2XY2A 5HYSG 1WCBA 1HHKB 1R3HB 4OD1H 3TM6A 5DUPL 2O5XL 2VQ1B 4LLAA 4AEFA 3ARZA 4WFEE 1T21A 5FYKU 5FB8B 4M43H 3MMEB 3FQNB 5GXBB 4EDXA 2RIKA 1S9KC 1CVRA 1OVZA 4QHMB 1BBJA 1A3RH 4NNYB 3AMKA 3RIFF 1TCRB 5ILTL 1FNGB 3PP3H 5D2NB 4F33A 4G8GE 3OKLB 1ZA3A 3BPOC 3C6LA 4NKDB 2CLVA 4U1MB 5DZNA 2WK2A 5IFJA 2B1HL 2HFTA 4S1SL 4HMDA 3CSGA 2VR9A 3VA6A 3EDDA 4R3SA 1W8NA 3ZSTA 4Y19B 4FFWC 4QLRA 2AXJA 5IVXA 2V17H 3ARTA 2ZG2A 3NN8A 5E5MA 5EBWB 3ARGC 3QDMA 4YFLF 5KSBE 5KSAB 4IIQA 5DHVA 1WFNA 3CU7A 4HZAA 5DJ8A 4KI5E 1V3LA 4RBPH 2GAZB 4WI9A 1ZLUH 2P42B 5FGBA 2E6QA 2APBA 5F1NB 3PGFH 4GG8B 5D7JB 2R9HC 3CPLA 2HWZH 2IGFL 3MJ9A 4YR6A 3U1SL 3TGXA 5GRUH 5GGSA 3UTSD 2VDQH 4PJIB 3UROR 3MYZA 5EA0L 4PG9B 3B2UC 1K5NB 4A6YB 1S7XB 4P4KA 4OD1L 3PWUA 3S98A 4CMHC 3OKYA 1OAXL 1KTLB 3G6JE 3L5WA 4LP4A 2BCKA 2FECL 3OB0H 5I1LB 3O6FA 1WAAE 4M43L 1K4DB 5IW1B 4TTGA 5GSRA 1A3RL 1TQCC 4ZO9A 4WUKL 5B39G 4OZHE 1SYSB 4DOHE 3U9UB 3QHFH 1BAFH 4J3OC 4TUJB 1B88A 1AD9B 1YEFH 4NOBA 3ARPA 2WQRA 4YHKL 2C4FU 2FO4A 2VLKE 5LAXA 2HFGH 1IEBB 2A6IA 1NDMB 4PFEA 4CN1A 5I18H 1RZ7H 1UACH 4POZC 1MREH 1AKJA 1JF1A 4PRBB 2Z8WC 3OJDB 5D93B 4K94H 4LDEB 4AH2B 3HPJA 3D0LB 4HKZA 1QSEB 3BKJH 2HTLC 3FQUA 4UBDD 1DVFB 4NT6B 4Z0XB 4XMKH 4HQQH 2E5EA 1P1ZA 1I8KB 4HS3B 4UTAH 4WIQA 3ROOB 5FAAA 1QFUH 2HWZL 2D0GA 1LK2A 5GRUL 4I1NB 1MIEH 1RHHA 1ZGLP 5IHZA 1AP2A 4KRLB 1XZ0A 1YDPB 1RZGA 1TFHA 5EZLB 5L2JA 4KDTA 1GJIA 4PD4J 3VFVA 3KPOB 4M8VA 4LLQA 2AJ3B 1I4FA 5I1DA 2AK4A 5I8CB 1FYTD 3VFPA 3QHFL 3GSUB 1BAFL 3T0BA 3X17A 3MRJA 1YEFL 3WJLA 5TGBA 2HFGL 3UX9B 4NYLA 4LMQI 5I18L 2OMNA 5FV2A 3P77B 5IKCB 1RZ7L 2PXYD 2G5BA 2XG5A 1MREL 3M17B 3CZJA 3O3AB 4JG1H 4ZUWB 2C1PA 1G0YR 4P9MH 4PJEF 1HQRA 5FECB 4MS8C 5EUKA 4DZ8A 1N5YH 4KK6C 3BKJL 1NBYB 4GT7A 3TA3B 3UJTH 1XGUB 1MFCH 2W65B 3GSNB 4Z7VA 4XMKL 4HQQL 4XPBH 1VACB 4UTAL 3UAJD 1QFUL 4Y8AA 3QULB 3B8YA 1IEAB 4PJ7B 2ED7A 4WDIA 3WFEH 1MIEL 2EDBA 4BH8B 3FB5A 1J5OH 3U9PL 3U4EA 1G9EA 4HUXB 1MY7A 3KPRB 1UVQB 4G8IB 4EXKA 3C5ZA 3T2NH 2CLRB 1A3LL 1ZA6A 4H5SA 4K71C 3BP7B 1CD1A 2YHGA 1CFTA 1YMME 3FB7B 5MENE 3RL1B 5EBMA 2M8XA 3IETA 5MEQA 1U3ZA 4POUB 3CXDH 5E2UH 5FUOH 4JFDA 1NANH 4TUOA 4NRXA 2V9RA 4E0RA 3FQTB 3QXAA 4XP4H 4YEFA 1I3RA 3LH2H 3RGHA 4GUPA 4P5TC 5BJTA 3QI9C 3DO7B 2FJGA 3ZT5A 2OR9H 4Z95H 4PJGA 1NCWH 2N1KA 3WEXA 4IDLA 4J23A 1LP9B 3MRNB 4W6YB 1ZLSH 2FR4A 5LCVH 5J8OA 4YEEA 1NUDA 4X80H 1FCCA 4WO4A 4JG1L 1BBDL 3D87B 3IDYB 4KXZI 4P9ML 1N5YL 1D5IH 2IAND 3UJTL 1KC5H 2Q76A 1T21B 1MFCL 4PV9A 4B41A 3TC9A 1LEKA 4XPBL 2I9LA 4U7KA 5CGYC 1M7DB 3ARDC 4PJEE 4M48H 5D2NE 3EDJA 1NC4D 1YEEH 3PQYD 4X83A 4KZEH 5F6HJ 4Z7QF 3WFEL 3S96A 2ESVA 2AEWA 3ALWA 2XACC 4WEUD 2UY7A 3GM0A 1V7MH 4CU7A 4M7ZC 3T2NL 3LKNB 4U1KB 5HYIA 1MCRA 5I16A 4BQCA 2EC9U 3V5KB 4OT1L 1XR9A 4ENED 4KC3B 2YA2A 5F21B 3QEHB 3TH2T 4ORGA 2C9AA 4PTUA 1QFWI 1LO3H 3CXDL 5E2UL 5FUOL 2VAAA 5IMLB 4XP4L 2A74A 3O6LH 3LH2L 4F57H 2PCPA 4LSDA 5DJZA 1OWRM 3X14A 3DRQB 3GBMH 4U3XA 1J8HD 2DICA 1QBBA 1P9MA 4LVNC 2OR9L 4Z95L 5FUCC 1NCWL 5F1SA 4Y4HA 2R2BB 5D71L 5DQ9A 1KCLA 1R5WA 3I85A 1ZLSL 4LFHG 5TF0A 4NKOA 4ELKA 4X80L 2NY3C 3BKYH 4RGOH 3L5WB 3M8OH 2BCKB 4MJ5B 1KC5L 3QXDA 1TTUA 2CIKA 2VO5A 1OT1A 3O6FB 4P46C 1H3WM 3OJMB 4M9PA 3VJ6B 2YMXH 3DMMB 1Z6JT 5D96C 3B43A 4O58H 4PJBF 4OLZL 4M48L 4RWYH 5GGRA 4KZEL 1VFAB 2B7DT 1KENH 3EW3B 3L3KB 1DBJH 2JJSA 1GOHA 3H3KA 1Q0YL 3RUGF 3V4UH 1JPGB 3MXWH 4HSQA 2VKXA 3VG9C 1V7ML 2P46B 2XXMB 3FN9A 4LSSH 1A47A 4S10A 1EZVY 4Z7QE 4WWID 3BJ91 2WWKO 3B9VA 3DWTA 1X4YA 4YBQD 3JWDH 4GSDH 4RX4D 4D8PA 1CFQA 3HPJB 2LU7A 3MA9H 4HKZB 2CDGB 2UWEB 3GBML 1A9EB 1ES0A 4K23H 3FQUB 4E9LA 1NH6A 2ARJA 4P5KB 4KJYA 3NH7H 4LAJH 1D5XA 5IM7A 1HE7A 3TNNB 5HHXH 4Y5XC 1EHAA 3BKYL 3BP5B 3DVIA 4RGOL 1MHPH 1VCAA 3TO4A 3MLUH 4JN1H 1RZGB 2EIZB 3M8OL 1ZHKA 5J6GB 3WFZA 4PJ8A 5L2JB 1QSFE 3KYOA 3RFZC 1NMBL 3X11B 2YMXL 4IEFB 4MQ7A 2XTJC 3Q5OA 4IJ3C 1F6FB 4F9PC 4XCYB 4JM2D 1QQDA 4O58L 5IJKA 1R3LA 4RWYL 1MCSA 1DBJL 1Z5LA 3PF2A 1KTDB 4IRSB 3MXWL 4NO2B 3VFPB 4Y7MA 3R8BB 3HG1E 3GNMH 1ZOXA 4LSSL 2DYPD 3OGCA 3U6RB 1UWEH 3IKKA 4LU5H 4L9DA 7FABH 1R6VA 5HGGS 4Q6IA 4NYLB 4U6XA 5IIEB 5HJ3A 5T5NF 3W82A 2G5BB 3JWDL 4JO1H 3MRCA 1MPAH 1ZANL 4KROD 3H3BC 2DJUA 4XAWH 3TNMB 5EC1A 1HQRB 2ZSWA 3MA9L 3W39A 1RV6X 3DURB 5EUKB 3PWPE 5T3XD 5TDPA 1A1MB 4YAQA 4K23L 1EXUA 2GW5A 4C4KT 3GHEH 3SEPA 4KKCD 3WS6C 1MF2H 3BRFA 5T1DH 1OAUH 3AS3A 2VOTA 4B5EA 3NH7L 5F6IC 4G8GD 4KK8D 4Y1AD 4U1JA 5B3JF 2BXZA 2XV6B 1D6VL 4GBXB 4WDIB 4C54A 3FB5B 5IVXF 2VLRE 1UWGH 3DVNA 3VFNB 3MLUL 3C09B 3D0VB 5DQDH 1BHGA 1BOGA 5B4MC 3F7VA 5DJYA 3DV4B 4TRPL 5KS9B 4LVEA 4HV8B 1VGKA 4KK5D 3IDMA 2C1OA 4WTXA 3IETB 3GSXB 4RFEA 5MEQB 2ZOKA 4JVUA 3FHQA 2B8OT 4E0RB 4AK1A 5C0GB 3QXAB 4XRCA 2NY6B 4KI5D 4OZFB 1BFTA 1I3RB 2YUZA 2Y9RT 1WICA 4NRZB 1LDSA 2VERN 4OFKA 2XN9E 5BJTB 1PYWA 5D7LE 1OAKH 1P2CA 2EH8H 2Y06H 2YEZB 1HNGA 3WJJA 4Y4FC 3GNML 5CS7A 3T65B 3OAYK 5C6WH 1SBBA 4UDTA 4QF1A 2FJGB 5K9JH 2P5EB 1K4CB 2WBKA 4PJGB 4LU5L 3SO3B 7FABL 3WEXB 3QFDB 3O9WA 4PRPE 3ESVF 2FR4B 3K4ZA 4JO1L 4K9EH 3KDMB 1M7XA 4UAOC 3O4LA 4XAWL 4XVSH 5MEOA 1CICA 5EPMA 4BFIB 3IF1B 4LKXB 5BS0A 3GHEL 3QDHA 1XF3A 4PV9B 4CJ1A 2N4IA 1F42A 5T1DL 4U6VH 1OAUL 1H5BC 1IGJA 2G75A 4ONGH 3T4AA 3W2DH 5C0IA 3BAEL 4HF5H 4OZGF 3S96B 1E27B 3RVWD 1C7TA 2H45A 3G6AB 1UWGL 2R2EA 2DTMH 3C8KA 4ZS6D 5DQDL 2FSEB 2ATPA 2VZTA 5ELIA 3KS0J 3WN5B 4HLZH 5B3JE 5I16B 2RBLA 3MLRH 4O9HH 3HHRB 4PTUB 5IVXE 4ZSOA 4QRRD 3SCMC 3QDME 1J1XH 4IOFD 5CUSH 3RX8A 3VMPA 3LY6A 4S1DD 1JMZA 2PCPB 1BIIA 5DJZB 4H8WH 5J1TC 4YC2B 4QGYA 4XZUA 3EO9H 4YHYC 1OAKL 2EH8L 2Y06L 3JV5A 4GAGH 3E2HB 3U0TA 3LKOB 4I3GA 1JN6B 1R5WB 2GITB 1CXFA 3WO4B 4K9EL 4ZO6A 4ELKB 2W38A 2CDFA 4U6HB 4XVSL 2BY0A 4FMKA 4KTYA 1U58A 1PDKA 2IQAB 4FQHA 3AS0A 4N0CD 4E41A 4TVSa 3QXDB 3T3PE 2CIKB 1FVDA 1U41A 4ODVL 5DEGB 3QUXB 1GGIH 4U6VL 1DUYB 4WRLA 2QADB 1MSPA 4ONGL 5GGRB 1MHCA 4IMKA 3W2DL 3I3EA 4HF5L 2EDJA 2FD6H 1KCVH 3HR5B 2ITCA 3F7PC 4FQXD 1BGXH 1V3MA 2YZ1A 5GGUB 4U7MA 4OCYH 2DTML 4XP1H 4L8BB 4NFDA 3HUJF 3UTQA 3QIBD 2ATKA 4Y4KC 4NQDA 2AV7A 4JFXA 3MLRL 1G7LA 1X3DA 2MOVA 4LARH 4GLRI 1Q9KA 3WIIH 1GOGA 2KBGA 4BZYA 4OJFH 1IGCH 5IB4A 1J1XL 1KJ2A 5CUSL 3QXVA 2LTQB 4D8PB 4MZ3A 5D6DA 1CFQB 2AJVH 1S78D 3DHMA 3EO9L 1A0QH 4I5BA 2WBJA 4GAGL 2GTZA 3OG6B 4DKEL 2E7MA 1I7TA 4KGJA 3MQIA 4KKNA 4W70A 1OHQA 4WGVB 3RWFA 5TDNB 3MA7B 5C0AD 4CVUA 2XWJA 3VXNA 3OF6D 4YK4C 1CWVA 1WUNT 3HB3C 4OZFG 2DQJH 4QHUB 1AE6L 4MVBC 3TO4B 5EG6C 3OAZH 1YMMD 1ETZB 3PGDB 4JLRA 1CU4H 4AZ8A 2EXWC 3KYOB 1VKXA 1GGIL 4QOKD 4WU7B 3GO1H