2DLHA

Solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
121
structure length
121
Chain Sequence
GSSGSSGPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Receptor-type tyrosine-protein phosphatase delta
total genus 7
structure length 121
sequence length 121
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dlhA00
3UAJD 1DSFH 4BK4A 1F90L 5CLWA 1SM3L 2I5YL 2XPGA 5BJTA 2YC1A 3T3MF 3HA0A 3P30L 3DARA 1MI5B 3GSXA 4R7DA 3VGFA 3HPLA 2NW3A 1JWUB 4MNQD 5HDBF 4XNUL 3HN3A 3REVA 4D9RD 3GEWB 4WI7A 1F4XH 4FZ8L 3BH9B 3CCHA 4XMLH 4JZJC 3RJDA 3BVNB 5GRZA 3U0TB 1A9EA 3MTRA 3HLAB 5FF6A 4JFQA 2FECL 1BZ7A 1M05A 1EZVX 4JM4H 2OJEA 1IT9L 1YNKL 5KOVC 1RQ5A 4Y4KB 1CDBA 2R1XB 1ZHKB 1FVDA 2A9NL 4XNXL 1LEIB 1CL7L 4F7PB 1LEGA 4WUUE 5FGBC 1G7HB 3V0VB 3ARTA 1RURH 2Q87A 3TYGH 4PJ9B 1B6UA 3MBEC 2NXZC 4O4YH 4F8QA 5SWQB 3E8UL 3KPLA 4LOUC 3VE0B 4K8RL 5ADPL 1PY4A 5IOPB 3CXHJ 3SCMB 3MLWL 3QDAA 3ZYZA 1BWWA 1FZOA 4K8RD 4EI6B 4OCXL 1DBKH 3BKCL 4KDTC 4ELKB 1BFVL 1FORL 3QHFH 1MY7A 4JDVA 4Y4KD 1KLGA 1TJHH 3OKMA 3L3IB 5MENA 1QFWI 3TGXA 3JUYA 2VL5A 3UCRA 3HE7A 3X3FL 3FO2A 3MRJB 1TCRA 3HB3D 5SWSA 5I74B 1RK0A 1S9YB 1T83A 5FUCC 3ARFD 1QA9A 4GKZB 4MNHB 1KB5B 1VGEL 1ZMYA 3H9YA 1R3JB 3CFKB 1TZGL 3QDMD 3OKKB 5I75C 3ARUA 4GXUM 5BV7B 3QAZC 1NGYB 3G5ZA 4X5WA 4Q6IA 1NH6A 1NDMA 1VPOL 4NNXB 4YE4H 3MLVH 3C6SB 3I2CH 4LGRB 4KK8C 5F8QC 2VC2H 3ARFB 2OR9L 4EQ2A 4XB7A 3DXAE 3D48R 1U41A 3QDMB 4P3WA 3RRQA 4M5ZL 2YPKA 3X13A 3EIFA 4IIQC 1MEXL 2P42B 1Q0YH 4Y16B 2M2DA 4R90L 1UXWB 5JHLL 1MY5A 2YXFA 3V6OE 3MXWL 2DQFA 4BSWA 3QZWA 1OSZB 4I4WB 2YZ1A 2VZ3A 2FLRT 3EO1B 2V2WA 3MRLA 1JNNL 2R4RH 3O4OB 1HOCB 2GK2A 2QQQA 2Z8WC 3FB6A 3MV7E 3KJ6L 4Z6AT 4LSSH 3LY6A 3UMTA 4L29A 1EDQA 4PREA 3SKJL 5I8KH 3O6FC 3GMRA 5HHME 2EYRB 2V7HB 2BNUB 3A6CH 3LPGA 4TN9A 3P9MB 4I1NB 1WUNT 1MQKL 3PV6B 4NCC1 2XY2A 1BP3B 3JV0A 3F62A 5C3TA 4NO0D 1CICA 4OB5L 4X98A 1OAKH 2ICEB 1P1ZB 3MRRB 1OW0C 3I50H 5FYLD 3UP1A 4KK9D 4UILL 1UYWL 4XP6H 4MAYD 2UY6A 3MGOA 2EECA 1AD0A 3K4DA 2J7LA 3TBTA 1Z5LB 3OPZL 1JIBA 3CMGA 5ABDE 2R29H 2UWEB 4XCYA 4BZYA 3ZKND 1NEZB 1OGTA 2XNAA 5KVFH 3EYSL 1BEYH 5H94B 1EEUA 1TJGL 4WNQA 3E1F1 3H9HB 3D0LB 3QUKA 5CEZH 4HJ0C 3ARGB 1DANU 4G3YH 1OB1B 4WWKA 4X99A 5FHAL 2E6PA 4PJ7F 2OZ4H 1JNLL 3SE8L 1OSZA 1A0QL 5TE4L 1E6JH 1XGTB 5I71C 3FOMA 3EO1A 2Z31A 2QJDA 5GGSB 3T0WA 1XH3B 4QXWA 5F7NC 1NKOA 3GSRB 2EE9A 4LEXH 3BT2H 4RFEA 3CSYA 3GSNB 5HYJA 3NVQA 4HH9A 4GBXD 5DZOA 5HI3C 1KENL 5LJYH 2DIBA 5KSUA 1RZIB 4G5ZL 2VDLL 2BMKA 4I2XB 4MB5A 1YEEH 4GKOA 4RMTA 2NY4D 1WZKA 4XHJC 4RAVA 4LK4A 2XICA 3VWKA 4O5LH 5B38A 4TOYH 2PW1B 2X4UA 5INDA 3EO9L 3QYCA 4KI5E 3IAQA 2AW2A 5L8KB 1A9EB 3R8BB 2ZUVA 3N06B 4NHCH 1TPXB 3DNKA 4UUJA 5I1JH 3SPVB 3BEWA 5T3ZL 5IEHA 2P5EB 2C5DC 1UXSA 1WITA 3BRDA 4KMTL 1JNHB 1RJCA 2CDFA 4B7LA 1FFPA 2HJKA 1XCTB 3CPLB 1OAUL 1U3YA 2NY4B 3WHXB 1PY9A 4ZODA 3GHBH 3K0WA 2D7MA 3OJDB 3L3KB 2ITDA 4APQD 3E2HC 5HI3D 2G9HB 3L5JA 3TZVD 4YBHA 4WU5A 4JN2A 4WO4A 4RMRA 3WJLC 4NDMA 1FJ1B 1F42A 2EDLA 4EI6A 3CLEL 3MROA 2X4NA 1Q9LA 1R3LB 4JY6B 3BP7A 4UNUA 4PJ5D 4ALAH 3BPLC 4MNGE 1TVHA 1NC2B 4KJPD 4UU9A 1YN6B 1L7IL 3WJJC 3HC4L 1WT5A 2XQYG 1W0WA 4KV5F 2E9IA 4MJ6B 5I1HH 4KTDL 4N5ED 5IB3B 2MSPA 3R0NA 2P46B 5DK2A 5D96C 1B0WA 5T1KA 4HSQA 2V9RA 3GHBL 4YDVB 4TNWF 5E2VH 2MHAB 35C8H 4B7IA 4XC3L 1AGFB 4HDIB 5TE4H 1NC2D 1FL5B 1K6QH 1F58L 2C3GA 2Y25A 3EJJX 4L3CA 1I3GL 1NMCB 1I7TA 3E3QE 4I0CC 4PJIE 3MFFB 3UTQB 5C9JB 1KIQA 1FC1A 1NAKH 1JPTL 2A74A 1R5VA 3O0RH 5D5MA 2IAND 5C6TH 2R69L 2D03H 4R3SB 4NKOB 2QLVB 2YRLA 1FLRL 2XFXA 4M1CD 2K7PA 4LEOB 1MCIA 1FNEA 2Q7YB 1MAJA 4DGIL 1A5FL 5KOMC 1FE8L 4TVPH 4OUUB 3D5OF 4C59B 1IM3B 3CFCL 1FRGL 1S7XA 1UB5A 4H20L 3I3DA 4G9FB 4XXDB 1CGSL 1FFRA 1L6ZA 2E8YA 4P2RA 4E41D 2IANB 2XWTA 1XF2B 4JPVL 1WISA 1DVFC 2R2HA 2DI9A 1C5BL 3V8CA 1CF8L 3RPIB 3EGSB 4F15B 4TRPL 1EMTL 1MVUA 1I1CA 4D0DA 3P3YA 4GBXC 1ZLUK 1ZGLA 4YHYB 4DKFL 1RK1B 5FHAH 2HN7A 1CGUA 4NT6B 2D7TL 1D9KA 2NY5C 4DN3L 4E41B 3MNZB 1X44A 3DLQR 4CBPA 5CILH 3QEGL 2V2TA 3SGDH 4GRLD 4PJEB 3C5JB 3ROOB 5HDOA 2XWJB 1AKJB 3DUSA 5KVDL 2X40A 5IV2A 4EI5C 1HQRB 3U2SB 1F6AA 4IOFD 1JGLH 2RGSA 1R5VB 3EO9H 2PNDA 4GRWH 4KC3B 3HZVA 4Q6YA 4OGZA 1JWMB 2AGJL 4HT1H 3VFGH 3CK0L 2CUMA 3MLZL 4HS6B 5EU3A 5EOCJ 2AVGA 3T0VA 3VI3F 2OL3B 4Z7UA 5GRUH 3VMPA 2PYEA 3KS0H 4X6CF 4X7SL 4I0PB 4CN4A 5D8JH 5LCVL 3TNNB 5B4MD 5IIEA 3GBNH 1P9MA 1WQVT 4JHAH 3GMMB 4L1DA 3O2DL 4P2RB 1QFPA 1MVFA 2XWTB 1WAAE 2VN4A 1XF2A 1MPAL 1U2CA 4LLYB 1KT2A 4HIEA 2C4FT 3QFJB 5A43C 4NQEE 2ATKA 3FMGH 4KI5D 5BXFB 2NY0D 3DUUA 4EDWL 4OLYL 4RIRA 5F3HA 2G5BA 3R06B 5GRJH 1ZGLM 4U1JA 5DJXA 3LZFL 1P7HL 1ADQH 4XBGB 4CVZA 4ODSL 4W81A 4OUOA 3ZE2F 4CVXA 4FQXA 3C60C 2EE3A 3BKCH 3S36H 3GSOA 3V6FB 5F9WB 2ADJB 5F7EL 4X8JB 4LLVA 5J7CC 2DJUA 5CLTA 2UYLA 5DC0A 5HDQH 5EO1B 3ARWA 4L8CA 4NZUL 3KAAA 4QRUA 3C60B 2A6KB 4JPWL 5BVJA 1T7XA 2AXGB 4U6VL 3LKSA 3FO2B 3C9NB 5CP3H 1N5YH 1F02I 3VGHA 3VFVA 2DQUL 1RZFL 3IETA 1MUJB 3O2WH 1B4JH 1N0XH 3L3KA 4OCRL 2A83B 4PJDF 1D7FA 3BWUC 5BRZA 5I1EH 2JCCA 5E8EA 1VEPA 1QYGH 1EGJH 3V6ZA 2CO7B 3UAJC 1BGXL 2E7BA 2PCPB 1DBAH 3BP7B 4OCWL 4ZFOB 1CWVA 3IU4H 2VTFA 4X8XA 4ZYKB 2BDNL 2GQHA 2EDEA 3KNBA 4NQEB 5D70H 4N0UB 4KQ4H 5JLZA 1YJDC 4BKLA 2DTML 5E9DD 3U0WL 5DK2B 4HKJB 3EFFB 4GAFB 4LCYB 4QTIL 3QNZB 5DUBB 2NTSP 2H8PB 1NCAH 1UM5H 3TPUB 2E7CA 3OQ3B 1S9VA 3ETBF 4FXGB 5ACZB 5KG9A 1S7TA 4TSBL 3ET9F 4DOHE 3QG6B 4PGJA 2CRYA 1KEMH 1DEEA 5TQ0L 4KI5F 3BI9X 2ZCHL 3OAUL 4AZ8A 2YPLE 4QWWD 5E9DB 5K9KB 2M8XA 1K85A 5E5MA 1JPSH 2X89A 1FBIL 3GSUB 1VFAA 3TO4A 3WKMH 4QHMA 4I3SH 1CDUA 4R4ND 5KSAC 2EKSA 1C7SA 1HQ4A 1MHHA 5HHQB 1F00I 2PW2B 5CEZL 4OD1H 1BBDH 3SDXB 1NC4D 1JZ4A 1I8KA 1PLGH 3HG1E 4F9LA 4HWZA 3SE4A 1BQSA 2X1QA 1ZEAL 5H2BA 1E6JL 3BD3A 1ZK9A 5F7LB 4PS4H 4LPYA 4FABL 2X5PA 2H2SD 4L8BA 2R29L 5HGGS 4OV5A 1BIIB 1JTPA 3SDDA 2RFXB 2F8OA 4GS7B 4X4ME 4LAJH 2BXZA 3NIDE 3FO0H 3KPSD 4ZS7L 3KWWA 4K7PH 4PJXE 5F88A 1BREA 3O2DH 2ATPB 4QEGA 4LCWD 3D1MC 3FQTA 4O2EB 1BJ1H 5ECJE 1NC4B 1J86A 1PSKH 5IROC 1A64A 1G0XA 3U36B 5SWSE 2FZ3B 1YEFH 2QHLA 3D69A 3KYOA 4KH2A 5DT1H 3B9KA 4P57B 3TO2B 2E5EA 1HNFA 2QQLL 4EVNB 5D7IA 3FN0L 1DBBH 4M1CC 4HUUB 5EBMB 4GLRH 1JRHI 5TGBA 4LCWB 4PP1C 5C0EA 2ICWB 2HTLD 1I4FA 4I9WD 2V9QA 3MODH 4UT9H 5CSZA 3PWPD 3SKOB 2FEDC 3DMMC 1M7IB 3MACH 4CJ0A 1M6OA 3QR2A 2W59A 4PGZA 4E9LA 5MEOB 2Z4QB 4XCEA 1K8DB 1BQUA 4ZAKD 1U8PA 4YHML 4NC1E 3RWHB 4YDIL 5E8PA 1AI1H 5FO9B 2EE6A 3Q3GB 2Y06H 4LRNH 2VLKA 4ETQB 1DL7H 4WHCA 4ENEC 4IRJD 2DAVA 5HPMB 5D7JC 4G6MH 4UQ3B 3R4DA 4HC1A 4G43B 1SJXA 4PUBH 4MAYA 5CZKA 2NCMA 2BJML 2C1PB 4LRIA 2P48B 5ACMA 1QYGL 5LG1A 1YECH 4OM0H 1A22B 4Y1AA 3KWWB 2WBJB 4L4TB 1F45A 2Q76B 3KPNB 3EYVB 1UM6L 3RVXC 3ULUD 4FFWC 3KXFA 1IRAY 2DQIH 5GXBB 1TPXC 3QUXA 2KQMA 1OGAA 1QQDA 1RZKC 1NDGA 4IRJB 1QFUH 3ELAT 5EB9A 3WE6A 3EYOB 3AS1A 4OCWH 4LF3A 4Y1AE 4YHKL 3M1BB 3KPRA 2FIKA 5IBUG 5BVPL 4WW2B 3HPJB 4QY8A 1RZGB 3DX9A 3U6RA 1IEAB 4W4OC 2VXVL 2QTEA 2A9MH 1W8NA 1RVFH 3GK8L 3RTQB 4XWGH 1NL0H 2EYSB 2WBJD 4KVNL 2NY1B 3BQUB 1II4E 2YZ8A 4K7PL 3QNYB 1CT8B 4JFOB 2AQ2A 2OXHA 3NN8A 4HZLB 4P9HH 1KC5L 2IQAA 3I9GL 3VFVB 1FNHA 4Z7UE 4C55A 1FLRH 3ARDA 5IB3A 5BZDA 1CXIA 3LB6C 4XC3H 3FQXA 3SKNA 3RWJA 4OI9A 1G7MB 2JKXA 2XXCB 3ARSA 1HYSD 2ZUSA 4M00A 5E2JA 1JP5A 2D7OA 2NW3B 3SKMA 5HI4D 3RTQD 3BQUD 1CG9A 1IC4H 3QDGE 3QEQE 3PP4L 1NCBL 3BX7C 3GM8A 4YXHH 3BMWA 4JHAL 4H8WH 7FABH 3DGGA 4FRWA 4LHQB 4OCLC 2Y06L 4WENB 5FYKD 1U8MB 35C8L 3NZHL 3VXUE 4IEFB 1B2WH 1QLRA 1J8KA 5IMKA 2E7MA 4KUCD 2WV3A 3SN6N 4J1UA 4HX1B 4QT5A 1EUUA 3ARQA 4ONHA 4QHLA 4MNGA 43CAA 4PJFF 4GT7A 3V5DB 3QO1A 4PJXF 5DA0B 4CDGC 4ZFZA 3OHXA 1G6RL 2I9LA 1HEZB 1CDYA 3KGRA 3TBWA 4UT6L 4UIKH 1HKLH 2JK5B 4AK1A 4Z77A 2DQIL 4HJ0D 5BS0D 2BY0A 1IL1B 5KSAB 3H0TA 5E8OB 4JANA 2XI9A 4P9HC 4R8WH 1FZOB 3G5YB 2KH2B 2CD0A 3ARED 3DMMA 3MRHB 1I8MA 1DQLL 3MRPA 4Q9CA 1H8NA 1MRDH 4KROC 1Q9KB 4XGZA 5JW4R 4XVTL 1AJ7H 3MJ9H 5F3BA 1UQSA 3MV7D 3NIFE 3BPOC 2QSQA 2YWYA 3RWDB 4QRSA 4TOYL 4I13B 4YXKH 3QIWD 4JO3L 2VB5A 1LMKA 3MLSL 3I3BA 3Q6GH 3LKNB 3OKEB 1C5DB 4TRPH 3BIAX 4MJIA 3SDYH 4HIHB 2UVEA 3P9MA 4JN2B 1OTTD 1A3RL 1JHLH 1I9IH 3RNKA 3DX6A 4YBLC 3FHAA 2BSED 1N8ZB 3O3BA 4PJCA 3EDKA 4Y5YB 5DD6B 2D7TH 4PRHD 4R4FH 3DV4A 2HVJA 3ARYA 4XP1H 5JO5A 1BMGA 1J88A 1JGDA 2UWEF 2L7JA 3MV7B 5DHVB 1J5OL 5DD3H 5E1HB 4N9GA 2VDNH 1D5ZA 2XZZA 4MNQA 3V0WL 2VIRA 4KK5C 2BJMH 2QBWA 4PJ9C 4RDQG 3ECBA 4L3ED 5GRUL 4OM1L 5ICZB 1VACB 1B0GB 4X9IA 2OJZL 5IEKA 1IZKA 1WV7T 1UA6H 1YJDL 4KROB 1EHLL 4OFYD 2DQHH 1WWWX 4U1KA 5DJZA 1RAMA 4K3HA 1WZLA 6FABH 5E6IA 2ADFL 2X4RA 3RZCA 4D9QE 3RDTC 4BZ2H 5I1GH 1JE6A 1ITCA 5JW5A 1MRCL 3B6SA 3S5LB 1ADQA 4LPXA 5JHDA 3P9LB 2Q1EA 3TBVB 3GJFK 5EIIB 2ERJC 2ZOLB 1ZSDB 5CEZE 4L3EB 2AJSL 1UACH 4XC1L 1Q72H 4NJAH 2JJVA 4U0RB 5GGSA 1JVKA 3FO9B 4K94L 2EYRA 5FGSA 5EUKA 2NPLX 2JIXB 3RWDA 1WF5A 3O6LL 4NWTL 5B3JF 2Q8AL 5DGQA 1N64L 1AY1L 1LDPL 1UJTA 4QRRA 2P4AB 3ULVD 1FZKB 4GQPH 4ONGH 2APTA 4G9FA 2AXFA 1CLYL 4OLWL 5C0GB 4X6EB 3SO3B 3VWJC 4HGWA 5EA0L 4KDVA 1GXEA 1T2QL 3FT2A 3KYNA 3VD7A 2APVA 3OTTA 5DUMH 3RPIA 2PW1A 4XVUD 5C70A 1YEKH 3O4LB 3QWOA 2JIXD 2C3XA 1G7LB 1NBVL 3UPCA 1D5ZB 5I9QB 2FWOB 3EO0B 1QSEB 4KJWC 3CFCH 3QWRA 32C2B 4I2XE 4LHUB 1OVZA 3QPQC 3AAZB 3LQZB 2Y9RT 4ALAL 2F54D 3V4PL 4HS3B 4MXQC 1WZMA 1WGOA 5T3XD 5IFHL 3FQWB 1NDMB 5HHVL 4J6RH 3HC0B 3QA3B 5EWIL 4YGVB 1BQLH 2ITDB 5D70L 4NO5B 3PQYD 2BNQA 4KRNA 2AXJA 1RJZA 1QO3B 4IRJC 1CCZA 4HLJA 1NMBL 1ZSDA 3HAEG 3WFHB 5I1DB 3SBWA 4NHUB 5L2KA 2ZSWB 4HUXB 4IOIA 4J3OC 4LVHB 4NRXB 4QXGH 2AEWA 4YFLI 3OR6B 5C0AE 1W72A 2OJZH 4TNVK 4JQIH 5E70A 3FQXB 4O00A 5DJCB 1JYVA 3ALXA 5GS0L 2H8PA 4NC2B 5D2NC 4LLDB 4U31A 3BP4A 3QRFM 1HH6B 4PGBA 2HTLC 4OZFH 4JR9L 5L88H 1YNTB 1OARH 1IFHL 1GRWA 3O6LH 4OQTA 5GJTL 5B38B 1NFIA 1PG7W 3MOBH 3VW3L 5FO8B 1MI5D 1BIHA 4PG2C 5I1KL 1YECL 4OM0L 1UACL 4JJ5A 4XC1H 4HIEB 1J8HB 1IAIL 1NMAL 4S11A 4JN1L 5EOCL 5E8DH 4X5LA 4PJBB 1QSEA 1CVRA 5CMAB 1RIHH 3IT8D 3T4AB 2HTKD 4Y4KA 2YEZA 2FR4B 2C3VB 5MEQA 2J88L 4OZIA 2DLEA 1IBGL 1IKFH 3EDJA 12E8L 1HN1A 1P2CA 2GJZA 2AXGA 1J8HD 5SX4I 4LRNL 2A2QT 5MHSE 4WEBL 3WJLA 1QPPA 3WFHA 3SCMD 4QRPB 4XP4L 4NHUA 1EHLH 4MLIA 1MF2H 2NQCA 3A6BH 1GIGH 3KLSA 4MWFB 1AHWB 1BQHG 1A0QH 3WUWA 4P4KB 2P5WE 3L3HA 2V5MA 4UT7L 3C2SA 4HIXL 1AP2B 5JPMA 4XAWL 5EIQA 4M8QB 4LASL 4Z7NE 3H3BC 2AJXL 4GW4A 4PJGA 5LVEA 1RHFA 1TZHB 4HG4K 4YX2L 4H8WL 4NFDA 1YEDA 4JG0H 7FABL 5FYJL 3B2VL 4MCZA 5EBMA 1RIUH 3GSRA 5KVDH 4N1EA 4DVBA 5J11B 4KZDL 1U8KB 2R2CA 1IAOA 5DMGD 4OZHF 3ARDC 2V2TB 2ZCKH 4JRXA 1AXTH 1V7MH 4HXBL 3ECBB 2XRAL 3ZE0F 5E24E 4PJIB 3MJGX 1U8OB 3WIFA 2DMBA 2XTLA 3GI9H 3RL1B 3NAAH 3PP3H 5EORH 3F5WB 4YDLB 1Q0XH 4FQHB 4BSJA 4FN0A 5GJSL 2X89D 2AABL 3TA3C 4R8WL 1S7SA 5DRWB 1RVFL 1UXWA 2J8HA 1QFOA 3RUGF 3BXNA 4CGTA 4ZFFB 1MHPH 2GTZB 2PYEE 3MLXH 4LSQL 3KLAB 2ARJA 2XA3A 1JYXA 2VDRH 4OZIE 5J13C 4UDUB 2WBJA 2B2XH 2GTWB 4YO0A 2CLVB 4OGAD 4I77H 3L3JA 2C7UA 3N0PB 4F8TA 5L2JB 3T0AA 6CGTA 3LEXA 4Y19A 3WNKA 4CN1A 5IW6A 2Y23A 3SDYL 1IBGH 1P69B 5JPMB 2DL9A 1WTGT 4RMWA 2YD8A 5A2FA 3F7QA 4NZUH 3ZDXF 4XMKL 5CGYC 3PWVB 3KYNB 4U1GC 3WL9B 1K9TA 5FYJD 4BH7B 4NRYB 4M9PA 1A1OA 1WBYB 2F5AL 5I18L 3MC0A 3QO0A 1RIVH 5E99H 4OTXL 5T1DL 3NTCL 5MERB 4KZEH 1DBAL 4EEEA 1F90H 3Q6FB 3VXSE 5CZVH 5I71B 5T3ZE 3LN4B 1JPFB 1VA9A 3ZL4H 1KC5H 1BWMA 4FQ2L 4W4NA 3WFZA 4NHCL 3B9KB 4P57A 5EZJA 5CAYB 1WFTA 5HHXH 5F9JB 5FKAB 3ZYIA 1J8HE 3SGEI 1E28B 2VZUA 2GCYA 1ZT4A 3MFFA 1M7DA 1QSFE 3DVGB 3ARGD 3RIFF 3CSPA 1CTOA 4HIJA 25C8H 3QEQB 1U91A 1YEFL 4H88L 2MKLC 3HFMH 4M93B 3RA7H 4YO0B 2RR3A 3L3DA 1FORH 3WLBA 1NBYA 3VFNA 1U8NB 4HIIA 4X4MA 4QRTA 5I15L 2EIZB 1DQML 1U8PB 3B9KD 1BFTA 5DD3L 3S37X 4N0UA 3D3VE 3FTGA 2BRRL 5JUEL 2GW5A 3PWJB 4Y4FC 1NUFA 3QXTA 3GIVA 4QF1B 4C57C 3GRWL 3P77A 4WI2A 4IOFC 4NOBA 3GO1L 1UJ3A 2E7LC 1EO7A 3C8KB 3EOTL 4FMKA 2B0SH 3QEQD 1X6NA 1AQDA 3MLYH 1TMCB 4JHWL 2LV4A 1Q9OA 3L9RA 5J6GA 5AYUH 1LE9A 4DZBB 3BN9C 3B43A 1PEZA 1YEKL 1NCWH 3DROA 1RURL 3TYGL 1S7UA 3KXFB 5HYSA 2DJ4A 2X9YA 3QUZA 4JQVA 5CMAA 5ADPH 4OLXL 2VR5A 1QSVA 1SJVA 4M7ZC 5CUSL 3OKNB 5L8LB 1R3HB 4J3WA 1AO7B 3KJ4B 2P5ED 4KKLC 5GGTH 4BZ1H 2X7LB 4F3FB 2NY3B 4LAQL 3FRUB 4MVBD 4XI5C 3QDJE 4XBEH 4NWTH 1CLCA 4CU8A 5IBTH 4ZFGH 4L5FL 2MFNA 1UM6H 3KPRE 1NGWA 5GGUA 1KJ2H 4APQB 2BCKA 1XIWB 4TSBH 5F6HJ 4P4RA 3TZVB 5DTFB 3WFBL 3MLZH 1BD2D 4LSTH 2EDOA 1U36A 1T1XA 2AJVH 4ZNCD 4H25B 2VIRB 4XNZC 4DKDC 4X80H 1RZJC 4PJ5B 4D9LH 4DFHA 3VFNB 5FHBL 2BFVH 4PG9A 4F9PA 4HS6A 2NY3D 4U7MA 5EU3B 4ERSH 3BSZL 3CXDH 4OCNC 4YC2C 1Q0YL 1AP2A 5ESVB 1CXLA 4E0RA 4HZAA 5FCUL 3CVHA 3DSNA 4EUPH 2Y5TB 2H41A 2Q3AA 1X6LA 2WZPD 2WIMA 2YUVA 3QT2A 3MACL 1HHGA 3TJEL 1QRND 4I77L 3TN0C 3P9WB 3PHQB 3PE9A 5JPNA 1PQZA 5IGXH 3OKOB 1CFQA 3UTSA 2ATKB 1KJVA 4O02L 3DUUB 5JXAL 5F3HB 4Q0XH 4DZ8A 1ZLVH 3G04A 1RV6X 1NBZA 4UDTA 3MRMA 2BSSB 1FZJB 5CP3A 5I8CB 2B4CH 4RGOH 4N8VB 1FAKT 1DQQA 3QXDA 4Q9QH 2VLJA 3CSBA 1SEBB 2X1WL 1UVQA 4CADA 4NJ9H 4GSDL 3V6FA 1JGVL 4UQ2B 1DBJL 2BNUA 3H0TB 1UM5L 3ZHLA 5TE6H 3PV6A 4KJPC 5JDJA 1ZOXA 3JV4B 4MAUL 2R2BA 2A6JA 2DIJA 4QCIB 1V3JA 2COQA 2XXMB 1UCBH 5E6ZA 5D1QB 1A7OL 3QFDB 1C16B 4LCWE 4RGMB 2AK4E 4G9FD 5EBWB 4Y2DA 2FH8A 3C09B 2CLVA 4P9ML 2V9TA 5JOFA 1FCGA 3EO0A 2C7UB 2AXHA 1YC8A 4O9HL 1F2QA 1GL4B 1BGXH 4PIRF 3QFJE 5GRWA 2E7HA 1C5DA 1MNUH 4O4YL 3O4LE 1EEQA 2MPAL 5C6PB 2DJSA 5E2UL 4XAWH 4PLKD 2YXMA 5E03A 2ESVD 3T2QA 1IGCH 2O26U 1PZUB 4R97B 5D1QD 5BV7L 3MNWA 4PRHE 5INCA 4JG0L 1INDH 5BZWA 2X1OA 5IB5A 3CUPB 3QUKB 3D0LA 2YS4A 1UM4H 3ZMRA 3OZ9H 1JGDB 4NN7B 1U8IB 1BVKA 3LV3A 3WS6C 1QRNE 4U6VH 2IG2L 5IJVB 4OBRA 3O81A 3OXRA 5TJWK 4EDXB 4L1HA 3RX8A 5B8CC 2GSGB 4YWGL 1ZWIB 1AKJD 3RBSA 1U95A 4KKLD 4GUPB 1KF9B 2P49B 1OWRM 5DQJB 3QBTB 1QBLL 4LPWA 4O58H 2ZJSH 5EU5B 3PV7A 2DLFH 1MCSA 2GJ6E 1S7VB 1OAQH 4P46D 3P0YH 4LNVA 3PL6C 3KPLB 3GKWH 1JHKH 4U6XA 1T2XA 5I1LA 3MXVL 3QI9C 4Q6IC 2H9GB 3BISA 1RU9L 2VQUA 4RDQF 4ZOEA 5CZXC 4OD3H 1L0YA 4OGYH 5FECB 1KLGB 3OKMB 4LARL 3DOSA 4ESKA 1TNNA 3P0VH 3ORJA 4I0PD 4MHHI 5IHBA 3KDMB 1X5HA 4K23H 1OLLA 4Z7WF 3EGSA 2BVPA 1E4WL 3MYJB 1U8MA 3I6KB 4OT1L 2AV7B 3DX7B 4HJGB 3E3QC 3L3GB 4P46B 5LGKA 5C2BH 1T7WA 5GS0D 4JN1H 3QFJD 2FATL 1UXSB 2QQKL 4NT6A 4U6TA 4U2ZA 2IBZX 2NY0B 2ADGB 4BA8A 3H9SA 3VRIA 1A7QL 5DJYB 1GAFH 5MEPA 4OV5B 4WO4D 2UWEE 4X7FC 1GOFA 2MCPH 4O2FB 4KTYA 1OD7A 4OZGB 1V8HA 5BCAA 3QUML 4OZFB 4GW5A 1AXTL 1V7ML 4C4KT 1CGTA 3T0ED 3BGFC 2X6MA 1GGTA 4XPAH 3LQZA 5DQDH 4JO3H 2P8MB 5DXWA 3WO4C 2VAAB 2VJXA 4JB9L 2FLBT 3ZLQC 4GMSH 4WO4B 5FK9A 5CKGA 5HGBA 5CHNA 3AFLA 3IFNL 2FL5B 1OSPL 1FJ1A 2IPUG 5I8EA 3MJ6A 2BSRB 4YDVA 1PG7X 1UA6L 5GGUB 3HMXH 2XY1A 2HKFL 4N9OB 1R3KA 2J6EA 5IMLA 1XIWA 4U1SA 1D5XB 1KIPB 1E0OB 4LLMB 3UDWC 3SQOH 4M6OH 4Y7MA 4CN6A 4F33A 5LAXB 4X6DA 3UROR 4HUXA 4IOIB 4OD1L 3ZTNH 3W9EB 1I1RA 2QQNH 1AQKL 3JV5A 5F1NA 8FABA 2JJSC 5C0JA 3KLHD 1A6WH 4U6YA 1MI5A 3GSXB 3OAYK 4R7DB 3TV3H 2ED7A 1A8JH 5E8PB 1G9NC 4NQED 4BKLB 4YHZL 2BNRE 2YD5A 4R4BB 4HLZH 5C07A 1NFDE 4FQXB 3IDXH 3P4NB 3G6DH 3JWNC 2Q3ZA 1G7PA 4S0SD 1INEL 1I1AD 4LVNC 2ZNWA 1FNFA 3JWOC 1T1WA 1Z9MA 3CLEH 5I66B 1GVIA 4Z0BH 2CRMA 4JO2H 1NCWL 5DRXB 2CMRH 1A6ZA 4DK3A 1GC1L 3CFJA 3AGVA 2YMXL 2UZIL 2D4FA 5GISL 1A6WL 1INQA 5KTEH 3LS5H 1LO2H 2PUQT 3QUXB 4B50A 4LRIC 4HUVB 4ZD3H 3QDHA 4XCNA 1I1AB 3GGWA 3L7FB 3PDOB 2WLYA 1FNLA 1AHWC 1KCVL 4RRPG 1KIRA 4UIKL 2H1PH 3VFWA 2BOBB 1GH7A 3QXWA 1XGRA 5ISZA 3QWQB 4RFNC 2WAHA 2NY5L 1AE6L 4UV7H 3VFSA 5T3ZD 1NLDH 3QUMH 1MEXH 4KVNH 4C56E 3NCJH 4D8PA 1X5XA 5KTEL 4NYLA 4MYWB 4P5TB 2ED8A 4WFHE 4IJ3B 3UTZB 4M6NL 1T0NA 5CD3B 4O51B 3HRZB 4R7NA 3TC9A 3UBXI 5I8OL 4PPTA 1R5WA 3RUGE 4NN5B 4GG8A 2AJUH 4PJGB 2RAMA 4PJAF 4BQ9A 2GT9A 3OF6A 4TUJB 3TWCH 5GGQL 4GAYB 4S2SB 4XRCA 4OT1H 1HQRA 1QBMH 4WHYH 3U2SA 5AAMA 4ONGL 3BUYA 4J23A 3VFGL 3ZTJH 4CW1A 4P5TD 4U6HA 4UTAH 5CEZD 4EZMA 5F9AC 5TDOB 5A2KH 4YHLL 1IGML 1I4FB 2I9LB 5AWNL 2EXYC 2XKNA 1MHHB 5HHQA 3DX8A 3PWNA 4KHXL 3PWPB 4PRBB 1DBJH 5DO2D 1AXSB 1S7RA 4U1MB 3KPSA 1AC6A 1PKOA 2P7TB 2EZ0D 3GB7A 4ZAKB 4NDMB 3S6CA 1U8LA 4HW6A 2H2PC 2I60L 3PIQA 5JTWA 2VDOH 3LIZL 5E4EC 3VFSB 4AM0B 3E6FA 2J6EL 1RHHB 4FNLH 2B1HL 5BXFA 1T7ZA 3KPSE 3NFNB 5DDHB 4D9LL 2KL6A 3GSNH 3VFRB 3RKDD 5HDQL 2DN7A 4HJJH 2HT3C 3JWOL 4PRHA 1SMOA 1Q9WA 1H0DA 1T0NB 1WVZA 3JVGC 2L7UA 2GAZA 2X1XR 2NY7H 1LVEA 3TO2A 2O61B 2VLLB 4XMLL 4ONOA 3H9ZA 3F7YA 3RX5A 3N85H 1JMZA 4IS6A 4BZ1L 4X80L 1H3VA 1CE1H 2YK1L 3O2VH 1I1YB 3DIFA 4LCWA 5JHDD 1YPZB 5FYKL 1S5IL 1KB5H 4XVSL 1MAKA 2BY2A 1ZS8B 3SE9L 5FYJH 2NY1D 4C83B 1J5OH 3OMZA 4KI5C 3B9AA 5EUOA 5KN5B 3UJIH 5ILTL 3RWEB 1JV5B 5MHSD 1JGVH 4ODBD 4HC1H 3C5ZA 2YWZA 1IGTB 4FQCH 4XXCA 1A4KB 4K3DH 5DQ9A 3VI3E 5JHDB 3SKMB 2AK4B 3QUMB 2ICWI 3VI4F 5GS2D 5J1AA 3RZCC 3MGTB 4N90E 2AEIT 5IVXF 4X6DB 1RZKL 5HYJB 4UV4L 1MJJA 3LIZH 3QUZD 2VWEE 4QXTB 1RUKH 5IMKB 3S88H 2F54E 5ID1A 3PL6A 4JRXB 1T5WA 3MREA 4YHYC 1LK3H 2XA8H 4OZGF 4PJBE 1CFSA 1P7QD 5DFVC 3WXVH 2FIKB 4GRLC 1GOGA 4Z7OE 4WW2A 1A1MB 3WEXB 4HKXB 3BP5B 1YEJL 3HRPA 3VXOA 3LHPL 3EBAA 5I15H 3ARDD 5HYJD 3B5TA 1LK2A 4I0KA 3AC0A 1YEIL 4WU5B 5H8DA 1JTTA 4GG6B 4PJ7B 1OF2A 3GSUA 4JJHA 5H37H 2AJ3A 4HZLA 3DVFA 5HYSB 3BXNB 3EJZD 4U2YA 5DC4B 2PO6C 1IGFL 3AREB 4G8IA 5IROA 2FJHA 5HVGB 5EN2B 5F96H 4KWUA 3UC0L 3MJ7A 1P7QB 1W72H 3RVWD 3BIBX 4ODUA 15C8H 4JZNB 4X4ZA 3RWCA 2AK1H 2ZOKA 2F5AH 2E6JA 5GZOD 4LIQL 4NBYB 1UH2A 8CGTA 1MQKH 4IBLT 3QIWB 1C7TA 1OT1A 4FG6C 2DM7A 5DJ2A 4QNPE 2H26A 4C4KO 3GMMA 3BZFA 2FH6A 3QCUL 3QUYA 4I3RH 4JG1H 5DTFA 3L95B 3KJ6H 4WRLA 1IAOB 4NZTL 1G7IB 4NRZB 4L4VE 3BVNA 1Z0MA 4GXVL 2P47B 2VDRL 3GK8H 3OB0H 1U3HA 3BW9B 5SX5H 5IHZA 1FVDB 5KSUB 3VXSA 3RGHA 2ADJA 3O41B 4ZXBD 1EHXA 3GMLB 2BERA 5D7IB 1BAFL 5FO8A 3LRHA 3BGAA 3RWHA 4KROD 5C0NC 4DUVA 1S7SB 1PW3A 2AKRA 2D7NA 4LLUA 1ND0B 3WXWL 5TF1H 1T0MA 4GW1B 1TLKA 4IMLB 2VXUL 5DVNA 2ADIB 4BK5A 5GHWH 2VLJD 4TUKL 3W11D 1TZIA 2CUIA 3P2TA 4YHIA 4M5YH 3LSOB 1P53A 4K3EL 1I85A 4XB8A 2I9TA 1F4XL 4FZ8H 4HJGA 5IEHB 1FIGH 2ZCKL 4K7PX 2G60L 3C6LC 3DTXA 2RB8A 5FYLH 4PUBL 4S1DC 5F9DC 2VLKB 4ETQA 4WUKH 4KXZH 3MUHL 4HF5L 5HGDA 4QYOA 4WI6A 1ZVSB 3HMWH 5ILTH 3BFOA 3D39A 5DI8B 2YHGA 4FTVE 1CFVH 3SDXA 4KGJA 2IF7A 1I8KB 4ZO7A 5EBGA 3SY0B 5EC2A 1EAJA 2E9WA 4G8GD 2W1NA 1LHZA 3O9WB 4BFEA 3CK0H 3S35X 5EZIH 3GMOB 3REWA 3K1DA 4UT9L 4LFHD 1F4WL 4V1DB 3F12A 5BW7A 4XP9L 5BS0E 1EJ6A 2VLKD 5IB4A 3I6LE 5JIPA 1YQVL 3L3HB 3ZE1E 1G7LA 4GXUN 4MAUH 4YX2H 3O4LD 4G8FB 4DTGL 1BM3H 1NEZG 5D2LB 5M94B 3TFKC 3QI9D 1QSED 5I16A 2DQGH 3VXSB 4LAQH 4PTTA 5ALBH 5HDLA 2E8ZA 2PXYA 1PX3A 3RWJB 3ZT7A 5JW5B 3O9WD 1OCWL 5GGVH 5C0CA 4BM7A 1KJ2L 1I8LC 5HYIA 4XVUC 2F54B 3HZYA 3QZWG 4U1SB 2AJXH 3DIFB 4V1DD 1FL5A 1I7UB 2ZUQC 2OR8A 1U92A 5E5MB 1T80A 2C9AA 2LE9A 1MCOH 3PQYB 4UAOC 3MLTA 1U8NA 4XPTL 4Y4HD 2VXUH 4PJFE 3QI9B 1E4XH 4M7LT 1JPSL 1BOGA 4U3CA 3QDME 1GGIL 5IR1B 3S4SB 4FQIH 3IDNA 4MA7H 4P23A 5C6TL 1I1FA 1N0LA 2CGRH 4JM2B 1WEJL 4Y88A 1T1WB 5I66A 4X98B 4Z95H 4HX1A 4YBQC 5CJXC 1KEGL 1KGCE 1A5FH 4Y4HB 2GSIA 2Z8SA 5JHLH 1MJ7H 1MJJB 2QADD 2N56A 4Q9RH 1FSKC 3RDTD 3W39B 1U8HA 2F19H 3D39E 4KJYB 4ZFOL 3EDEA 4JFHE 4KKCC 3OXSB 2FO4B 4ZNEA 5IFJB 1YYLL 2X9XA 2CR3A 4Z18A 2YMXH 4JM2D 5JXEA 4Y2DD 3DRTB 3WN5A 2X7LA 5K9JL 1K6QL 5BRZD 5ERWA 5L7XL 4OCSH 2F74B 2XT1B 2YD2A 1FFNA 4JY4B 5FUZL 4G9DA 2QADB 3BE1L 2CDEA 1OF2B 2ZSVB 3RDTB 4F37K 3QDJB 3C9NA 1XGTA 4N1CA 2EYSA 1VCAA 4W6YB 2MOVA 3FAXA 3BQUA 2IGFH 2OLDA 4RQQA 2A0LC 1MLCA 2VQ1A 3W5MA 1HXMA 1WK0A 4NO3B 2DLGA 4Y2DB 4U49A 4AEIH 4OI8A 3CFBA 1X5LA 4DGYH 4QRPD 5D72H 5IHUH 4KI1A 5BRZB 3WKNA 2JCCB 5D4QA 3Q3GA 1YYML 1LO0H 1YQ2A 4OFIA 3WUWB 2IBGA 3EFDL 5HYQA 5IEKB 2XWBA 2QKIA 2DWDA 2ICES 5CFHA 2W9DH 3MRQA 3D0VB 3VXPA 4P4KD 5GGVL 1N3NB 3ZSSA 2ZPKL 4S2SA 3L7EA 3HLAA 2H2SC 1OTSD 1X4YA 4PLNC 4YBLB 1ZA3A 2DD8H 3ULSA 2XG5A 1K8IA 3QAZB 3AROA 4XNQA 3ILQC 5ITBH 2CKNA 1U8HB 3CFDB 3GBNL 1KPRA 4UZGA 3NCCB 2Q7YA 5L8JB 5I74C 1NDGB 3RL2A 2XZQH 5MEQB 1BVZA 2KBGA 3X13B 5DJXB 1IGJB 5F7EH 1FFOA 4LKCA 4LQFH 4CVZB 1G9EA 1B3JA 2AGJH 2P7TA 1VGEH 2GFBA 5IMOB 3GB7B 2P8PA 3MA9H 3C08L 1MCKA 1DZBA 3D87B 3MMEB 5EC1B 1MWAL 1CGWA 4PV8A 1FZKA 1ED3A 1LP9E 4NKQB 3I02B 1U2HA 5EBWA 3UPRA 3BIKA 4EIZC 3NFPA 1TIUA 1T2JA 3STLA 4KK6D 3U9PL 3O3EB 1GPOL 4M62L 1Q9WB 1KBGL 1FPTL 4CNIB 2FEEL 4PV9B 3KJ4C 4XNMA 2ADFH 1U42A 3DECA 2R1WA 1L7TH 3UXFA 3LZFH 4FTVD 1T22A 3RY6C 4GW4B 1LDSA 3CX5K 4U4BA 4FTVA 3IFOB 4WEUD 1GGIH 5E94A 1KOAA 1TVHB 2K7QA 3CUPA 1ZT7B 4J2XA 4I5BB 4YBQD 4LLQB 5F88B 2ESVA 4J1UB 4QT5B 2CGRL 1JGEB 5J12B 4UNVA 1P4IL 3HNSL 1ES0A 4K7FA 5IM7A 5F21B 4NYLB 4M02A 1BEYL 3FKUS 3HC3L 5D2NA 1Y6KR 4NQEA 3GFUA 3CFDA 2A74B 4J3XA 4PJEE 4FZEL 4RAHA 4K3DL 4DQOL 2VH5H 4K3JH 1XR9A 2VLME 1I9IL 1OP3K 3C5SB 4GG8B 4ZS6D 3LD8C 5E9DE 1UG9A 4I4WA 1U8JA 3TO4D 3RNQB 1G7HA 5D7LA 4PY7A 1CICD 3TPUA 3MOBL 3VW3H 5FXCH 5KAQG 2NZIA 1I8MB 3MUZ1 4NZRH 4P2CG 2CK0L 4NKMB 4HMDA 4CW1B 3B8YA 3EKCA 1VKXA 4FA8A 1F97A 5D1ZA 5D71H 3QQ3B 4PB9H 1IAMA 4Z7QE 1W72B 3SOBH 2Z4QA 3G04B 1J0JA 2ZG2A 4HWUA 4BFBD 4MD5B 3FFCD 1X5AA 5SWSD 1GZQA 2X41A 4I18B 4IDLA 3TWCL 3TO4B 3S4SA 1CICB 3PDDA 1IM3A 3WFDL 5HPOA 4X9BA 1JPTH 3FZUD 1JZ8A 3DWTA 3DX6B 1BBJA 2APWA 5TF0A 1A3LL 3K8MA 4ELKA 2C3VA 1FDLH 3MXWH 4W68A 2FX8L 3MNZA 4RMQA 4OV6F 5I1CH 3CLFH 3M45A 4MNQE 4WCYH 3ARBA 3FFCB 4X6CA 4Y0GA 5SWSB 5IHUL 4JPIA 2ZCHH 4PY8J 2X70A 3MRIA 4KJYA 3KHOA 2B4CL 2FO4A 3Q5OA 4F2MB 2I60H 3KPQB 1AR1C 12E8H 2WWKT 1J10A 2IQAB 2EDDA 2EIEA 5E6IC 3TF7C 2A83A 3KXFD 1JN6A 5HJ3B 2O5ZH 4HQQL 5E5RB 2VLLA 5IGXL 2J8UA 2FL5A 2GEEA 4OZFG 5I8EB 3RNQA 1UWGL 1NGQL 2Z0BA 4Z0XB 1AO7D 2X4PA 4HS3A 1ZT1A 1JHTA 2VZVA 5D6DA 3UJTL 3ARFA 5MI0C 4UU9B 3QQ9D 1MLCB 2J4WL 2MJWA 3PUCA 3QQ4B 2WANA 4XPBH 5CGMA 2CK0H 3GSQA 3EFFA 4JG1L 5ESAA 1EZVY 1XIWD 1JV5A 3RY6A 2WIIB 1BD2B 4ZUWB 3KPOB 2XPGB 4D8PB 1DQDH 3KYMA 4GRMB 3SJVA 4MA7L 3O2VL 2GITB 3IFLL 1Z9OA 4JFHD 3ULUH 1N64H 5DZLA 3O6MH 4TNVF 3A6CL 5T5NF 3WIHH 1QACA 1KELL 1YEHL 5LBSH 4HK3J 1I8IA 1NQBA 4K3GA 2UYLB 3JZ7A 2XQYK 2HH0H 3I6KA 3MV11 3TYFB 2FX8H 1QRNB 3ES6B 1XGYH 5DEGB 4ZQKA 3DI2B 1N5AB 4LSPH 3UYRH 5K33A 5I8KL 5IHLB 4YDJA 4EN3C 3UZVB 1P1ZA 4LHUG 4Z78A 4EBQL 1CU4H 3T09A 1FO0H 2G2RB 4P48A 3RVVD 2QQLH 2P8PB 2UUDH 4WWKD 3QNXB 2ENYA 4NZDA 2EC9T 5EZIL 3GMPB 4M5ZH 4OF8A 5SX4H 2ARJB 2HAZA 3HE7C 5GRXG 4Y5XC 4JEGB 4JHZA 3MODL 4XCYB 1PSKL 4NQUA 1HH9A 2W0PA 4DTGH 2MQ3A 3O8XC 3F12B 1M4KA 1CFTA 2VXVH 2VDKL 4U1IA 1KCRL 3OB8A 4Z7VB 5GZND 4G8GA 1IGYA 3JV6B 3B9EA 3N1PC 4HEPG 5DDHA 2FBJL 3FONB 1OB1A 4WWKB 5MERA 2W38A 1RK1A 2AI0H 5GS2H 3NA9L 3IDGA 1ZKAA 3AB0C 1N8ZA 3O3BB 4PJCB 4NQTA 3PWVA 3OKYA 4BH7A 3UTPD 3HUJA 1Y18A 4YK4C 5DJZB 1VADB 5JNYA 5AZ2H 1MCOL 3UJJL 4BUHA 1OARL 2ESVB 4G6JH 4I18C 1PKQB 5EZLB 1AGCB 3BUYB 4PJEA 2DBJA 2D0HA 3S5LA 2QV2A 4KMLB 5DJ0B 1U8IA 1BVKB 1NCDH 4PRAA 5GGRB 3CD4A 3NCJL 4M7KH 2N7BA 1XGPB 3P11L 4NM4L 1OPGH 3GRWH 4GUPA 5FKAA 2DYPD 3C87A 1RJYA 4Y16A 3UTTE 5FYJE 4M61B 2OL3A 5BMFL 3EOTH 2IANA 1DQLH 1CXKA 4L8DB 4JZJA 5GS3A 4I0PA 3VGEA 2D7PA 5GIRA 4XVTH 1V7NH 4M1DL 4YHPA 3L5HA 1LE5B 5GS1B 4PJIF 2H32H 5KANI 4WFHD 4EUPB 4WI3A 1LK3L 3C8KA 1X7QB 4KTEH 2GK0B 4HLZG 3K4AA 4WEBH 3MO1A 4XCCL 5CSBA 4AEIL 2FYYB 5EU6E 2D0GA 2DYPB 2IANE 1NEUA 4Y5VB 2QSVA 4OSUL 1SBSH 2E27L 2ORBH 3GIVB 4QF1A 3O11B 4IDJH 1CICC 4WJ5A 4TULL 3OJMB 1MCPL 4XTRC 4Q6IB 1IKFL 4JKMA 4CAGA 1F3DJ 3F65A 4QHKI 2O93L 1IEAA 3UC0H 3PG2A 5C0DA 1YYLH 3NIGF 4JPWH 3TA3A 5ITFB 3F7VB 3HI5H 4MA1C 3NH7L 2HRPL 5D2NE 1TVDA 2YUWA 5K9JH 3UTSD 1HINL 4WI5A 3BZ4B 2AK1L 2NLJB 2B7DT 4HAGA 4LKXB 1OP3H 5DSCA 4JPKH 4XCCH 1CXEA 3MLWH 4P4RB 3VXMB 4NQDD 2HT4D 5KSBF 4LP5A 2VLJE 2GY5A 5GGQH 3TIEA 2XRAH 4FP8H 4MMZC 1G9MH 3DVNB 3MRBB 4JGJA 3N9GL 3T0EB 4JY5H 1C08B 5FB8B 3FOLB 2CMRL 4UIMA 4DGYL 4X9HA 3B2VH 2XKSA 4X99B 1JWUA 3BP6A 5JA8B 1T04A 4G6JL 3IVKB 1W8OA 4JM4L 3HCVA 4HBQA 4KK5D 3GI8H 5MP6L 1SY6H 6FABL 2DI7A 2R0LH 2NXYD 4NQDB 4TQEH 1R3IL 3MYJA 1TCMA 3MLXL 3OAUH 4QXTA 3U4BL 4XP5L 1AGEB 4U1JB 5E00B 5HGHB 3QQNA 4RGOL 4XBGA 1NFKA 3V0WH 1TITA 5IW6B 3E6HA 1ETZA 2UVFA 2EC8A 4XX1G 4F7PA 3CFEA 1FHGA 3GNMH 4DCQB 1G1CA 2Y36H 4L8CB 5HHOE 1FO0A 2IH1B 5H35A 4JDTL 1J0ZA 1YEGL 3MRPB 4FQXD 1G7PB 4TVPD 1G7JB 1GGYA 3ZKMD 1KFAH 1G84A 2OTWB 1OGAE 4ZPTB 3BDYL 4XMPH 5CSGA 2Q76A 4IMKC 5C0BB 3EYVA 1U8QB 4FFYL 4NC0B 4G42B 1FV1B 3GKZA 2A6DB 3DURB 3DRQB 1LE9B 1T03H 2DDQH 4HBCL 3L5IA 1IMHC 5KANG 1YMMA 4IRSB 1CFVL 2FIRT 1M7XA 1EAPA 1U93A 2X1PA 1CD8A 1FNSH 2CXKA 1CK0H 32C2A 1F4WH 3KPRB 4CNIA 5F7MC 2JB5H 3DVNA 2AEQH 5F9JA 1R3HA 3QUXD 4RZCB 3HZKA 2BNQD 4L9DA 5EOTB 5FOJA 1IEBA 3IDIB 3DUSB 4DN3H 2RIKA 1CLOH 1CE6B 1GYAA 5E2WL 2XACC 3Q1SL 3GMQA 3O8XD 1KLUB 4UMGA 5E2TL 4FXLA 3V9FA 2Y7QB 2EDYA 3BJLA 1ONQB 5JIHA 4U1IB 4Y4HC 4LSVL 3Q5TA 3SKJH 4NP4H 1HSAB 1XR8A 2FEEI 1F6FB 2AEQL 4J3VA 3EW3B 1XCQA 3QCTH 5HYQB 5T1KB 5HI4C 3GMLA 2EH7L 2IALA 4KRPB 1KCLA 1OP5K 4PY7B 1F5WA 3IU3A 3O45B 3MRFB 3O8XB 5TQ2H 2VLRA 1NCCL 5D5MF 5KVFL 4DKFH 2WUCL 4LNRB 3V52L 3EOBB 5DR5L 3S36X 5ADOH 4M7ZB 1N4XL 1JMXA 5HHVH 3F8UB 3ULSB 5C0BE 3VD9A 3HFML 3RA7L 4YHIB 4Y5VC 1NUNB 4G7YH 3N1QC 1C5CL 4WU7B 5DQJA 4H1LG 1QEWB 3BMVA 4KQ4L 3FMGL 5T1KD 2XFXB 4KRPD 1P6FA 3ESVF 3GMRB 3AUVA 1YUHA 4ZUSA 1BFOB 1OY3B 1UWXK 3RAJL 3QXDB 3R1GL 4HFUL 5C0GA 2EIBA 4PJ9A 2BVQA 2HP4A 4LCIL 2CRIA 1CK0L 1S7XB 3G6JB 3PGCB 3WUZA 3SY0A 1IFHH 4XP4H 5HVHB 4PRPB 1F4HA 4HKZB 4LBEB 1A3LH 5HVWA 4G8IB 4BELD 1PDKA 4NRYA 1YEIH 3BKMH 1OAYL 4BSVA 2C3HA 3L6FB 4AY0A 1T66D 4G6AD 4CMMB 3U36A 2QQNL 1IGFH 1X4XA 4Z8FH 3I6GB 3BN3B 4UINH 3W11C 1Q38A 3LKRB 1T22B 3DSFL 2OP4H 2N4IA 4R2GC 2PO6A 3REVB 4Y5YA 1Z9LA 4MDIA 2RBLA 2DTMH 2E9BA 3LHPH 3IDYC 4DN4L 1QSFB 3T08A 2W60A 4HH8A 1T20B 2B1AH 1ZXQA 1SVCP 4PRIE 2F74A 3VFPB 4LLAA 2XA8L 1YYMH 2Z31B 3RVVC 4KK9C 1VERA 4DVBB 4B41A 3KG5A 3NIFF 2NY2C 3QQ4A 4ODWA 4LLWB 1A7RH 4OCMC 4TPRL 2BSSA 5I8CA 1EFXD 2IAMC 3TIDA 4HUKB 5LAXA 3JSSA 4RFOH 1CXFA 1F4AA 1QVOA 2WUBH 3WIFB 2BVEA 3K2UH 2EIDA 4N8VG 3SKNB 3NPSB 1DQDL 4FG6D 3SDAB 2R56L 4JDVB 1OP9A 1T89C 2Z93B 5E9DA 3SGEH 3P4NA 2LABA 3SGJA 2Z31D 4RAVB 2XWBB 2R2HB 1KJ3L 2VZTA 1VGKB 1YEEL 4PJXB 2J5LB 1UENA 4KXZI 4G9FE 4K9EL 2AK4D 2EKSB 5I0DA 4QNPF 1NUDA 5J1AB 3BOVA 1JYNA 4PLKC 4KKBC 43CAB 2P5EA 1EUTA 4IRJA 2JCCE 4K8RH 3J8F7 5J3HD 4JDZA 2FGWL 3QUZB 3SDAD 4HS8H 2LAAA 3QQ9C 2NR6C 2WMPA 4JRXD 5ERWB 5KZCB 1QLEL 2FZ3A 3D69B 5D7SL 2Q8BL 5DHYA 5J6GB 5ACLA 1PX4A 4KVCH 4KHTL 1ZEAH 1QSFA 3WS6A 3VRIB 3G08B 5FV1L 3FQRB 4PGCB 4E5XB 3FCTA 4KK8D 1DVFA 1MQ8A 1FPTH 3FQTB 2ZZUT 4RMSA 3HZVB 4HIXH 3ARDB 1OHQA 2FGZA 4PD4J 5DF0A 4JRXE 1T5XB 4GW5B 1MJUL 3LEYH 1MHCA 2V17L 3GGWB 1FDLL 3QDGD 4YWGH 2DBLH 5H94A 1HHHA 1AXIB 1MFCL 2KKQA 5KZCD 3JWDL 3JTTB 3RGVA 1CG9B 3QXUA 2XV6B 5CCKL 4LCUA 1J1OH 1BM3L 5D7KE 3OZ9L 4PP2B 5DD0L 4PJAE 3QEUB 2P24A 4CMHB 2CJUH 1FNGA 4MS8D 1XF4B 3RX7A 4FQ2H 2DWEB 3X11B 2PXYC 4HV8A 4U1LB 4NNPH 3QDGB 3DX7A 1N2RB 5I17B 1MWAA 1BZ7B 1M05B 4S1SH 4JFXB 3BPNC 2BRRH 1ES0B 4K7FB 4L4TA 5AYQA 4Z5RA 4KZEL 1HSAA 1XR8B 3WD5H 4GMSL 2CKBA 1U3JA 1OAYH 1FRGH 1HXYA 1FZJA 4H88H 3CAFA 3G5XB 4JFFE 3C60A 4QXUH 1C1EH 4P3CL 3X17A 1VESA 3EYOA 4JDTH 3NH7H 4LNRA 3EOBA 5CIPA 1LP9F 2J8UE 2R1YA 3U79A 4ZXBB 5CP7A 3T8XA 3S37L 4YAQA 3GUTA 1EBAA 2J6EH 3HI6H 5C09A 3TT1L 1NEZA 1B2WL 1OGTB 2XNAB 4R26H 1T03L 3BD5A 4WU7A 1A1NB 1XF5B 3MO1B 4NNYA 1A6ZB 2VLJB 2JJSA 5KVEL 3VGAB 3VXRB 4YQXH 3IFPA 2I9TB 4Q2ZA 1DLFL 5ITBL 3MJ8B 3HPJA 4HS8L 2NW2A 3AY4A 5KAQF 3CLFL 2HN7B 3UYOD 3MV01 1FAIH 4WV1A 3NPSC 4ZUUA 5IJKC 5IVXE 2PKDA 1UKTA 4QYOB 5HHOA 3QHTC 4PYHA 5I76B 1ZVSA 3VXTA 3EZJB 5HY9B 3D9AH 1Y6NR 3BRFA 1CZ8H 3FT2B 2I07B 1NBVH 4NQXB 5I2IB 4FP8L 3VXRD 1RUMH 1P4LA 2VLMD 1G6VK 3TH2T 4G8GB 4OLUL 4JO1L 3FONA 2VLKE 2OX5A 4O2EA 5ALCL 4M8QA 2EDHA 5D7IF 3H3PH 1BLNA 4LSRL 3MNWB 3WFBH 5IESH 4WW1B 1MREH 5INCB 4KAQL 2VOTA 4M1GL 1N3NA 2X4UB 5INDB 1NL0L 4OFYA 5C1MB 5BO1H 2AKRB 3IJSA 1G9ML 3FAWA 5JDSA 3CVHB 1TJIH 2Y5TA 3VXSD 1FYTA 3CZFB 1E6OH 4H5SA 2GT9B 4NM8L 4TUJA 4YAQB 5CP7B 4V1DE 4M03A 1ZV5A 2DF3A 1FFPB 2HJKB 1S3KL 4OKDA 4OJFH 2IFFL 5HHPB 3GJEA 1H3UA 2ZKHH 4XGZB 2AERT 4EXPX 1KJVB 1X9QA 2YPLB 4XCNB 1ZLVK 2APBA 3FT3B 1FFOB 1IC5L 1IL1A 5KSAA 4DK6A 1NSNH 2IPKA 2WIIA 3DETC 5T3ZH 3QPQD 1UVQB 3O6FA 2BXYA 3CC5B 3SJVE 3O3AB 1Q9OB 4XXDA 3BGMA 3H9SB 1GC1H 4XCFL 4P99A 3WMSA 2NYYD 4D0BA 1K3IA 5FA4B 1J0YA 2YPLD 2A6DA 2Y5EA 3DURA 3V95A 1DUZB 1UEYA 1HHJA 4NO2A 1DLHA 3TYFA 4WJ5B 3CX2A 1PBYA 2HFGL 4MS8C 1GZPA 4LDOB 3QJHA 4LEXL 4UBDD 2BK8A 3BKJH 3QUYC 4M5YL 1D9KB 2VAAA 3F7RA 3H9SD 4F37F 2D31A 1FNSL 1F3JB 4U05A 3WN5B 1I1AC 2D3VA 4S1RH 1A14L 2CIKA 4S1SL 2GJZB 1OAZH 1RJLB 3UPAA 4H5SB 3MJ9L 5E7BA 2ICWJ 3HE6D 5DJAB 2W07A 1FNAA 3GJFH 3QNYA 2VXQH 5GSRB 4JFOA 5ESAB 2EICA 2GKIA 2P5WD 1MRCH 3QDJD 4YIQB 1EO8H 3RY5A 3BP4B 4CVUA 2LVCA 1TENA 3ZE1F 1D9KD 2IPUK 3K8KA 3JVGA 1ZLUH 1U8JB 4R96A 2BMKB 4UIMB 4QRQB 4G43A 4JZOA 4P2QE 3VU2A 3K1KC 3Q48A 4NP4L 4L8SC 4OGYL 5HYJE 4QRRB 3VXUD 5DMGC 3P77B 5FYKE 1JRHL 2VL4A 3WIIH 5JPNB 1BZQK 4S10A 4N5EC 3V7AG 1UWGH 3VD4A 5J3HC 1I85C 1QTYT 4MQTB 3NMEA 4NQDA 3SGKA 4MX7A 1F3DH 1A6AB 4DGVL 2EYTB 1RZFH 1GHFL 5DFTA 2VISA 3PABA 4YXLH 1PVHA 4RBPK 1OCWH 3LSOA 4JVUA 5JOEA 4PJHF 1MFDH 25C8L 2HMID 3HC4H 4CJ1A 2EDJA 3QCVH 2EEBA 4MXWH 5D5ME 4WCYL 2BP3A 1NFDB 2ZUUA 5C09E 2XTJD 3TBSA 4QCIA 5HXMA 1V3LA 2JTDA 2B1AL 3HTLX 4ELME 3MZTA 3FQWA 3O6KL 2EDWA 3SO5A 3GIZH 3DO7B 5J56B 3NCMA 1Z5LA 4PTUA 4PB0H 2NX5E 1UWXH 2KDGA 3AAZA 5EC2B 1KJ3H 5A40E 2IH3A 4NM8H 4XP6L 3CZJA 3MRCB 4Z7VA 4ZMAT 3E2HB 2FHFA 4OLVH 4BH8A 2XTJB 3K74B 1OT2A 4MXWL 1WTLA 1H8SA 4CMHC 1MH5B 5JW3H 4ZDHB 3OKEA 2EDFA 4WHYG 5KSVB 3VDCA 3DGGB 2CPCA 1F3RB 4JGUA 1VADA 2HRPH 4KY1L 3T77A 4FTVB 3REWB 4L4TE 3TLRA 1RPQA 1T66C 5JO5B 2LTQB 2V5YA 2WQ8A 4ZTOL 2R4SH 5DJ0A 1U8OA 4KPHL 5DRZA 3UTTD 1V7NL 4QHUB 15C8L 4S1DD 4ODVL 4WO4C 2CLZA 1PG7L 3SJVB 3IDYB 4U6HB 3VGBA 3OGCB 1EXUA 1T1YB 1MFAL 1WFUA 4Z77B 4KTEL 3PGFL 4KGLA 4NQCA 1DL7L 5MEOA 3K8LA 4RMVA 2W91A 4WW2C 4BYHA 2CLRA 1X5KA 3LN9A 3BW9A 4M9OA 2BFVL 1JNLH 4DW2H 3FT4B 4WFEE 3B6SB 2OR7A 2Z35B 5C0FB 3UTTB 4WDIA 2R2BB 2PTTB 2QSTA 5DEGA 1C16A 2CIIA 3SJVD 1H3TA 3N1MC 3JTSB 4FQPA 4ELMA 2HT2C 1MCJA 3SDCA 3QCVL 5B8CA 1A6UL 4MDJA 4P46C 4M4RA 5ISZD 2WINA 3OXSA 4OZHB 5DEFB 3IFOA 1TVBB 4HWEL 1H15B 4JFFA 2BHZA 1OWWA 4F7CA 3UO1L 1GAFL 3EDFA 2AP2A 3ZTNL 3VH8A 2EDNA 2RFXA 3C5ZD 5C71A 4LSQH 1CVSC 1RULL 2IAMB 2VE6A 3H7BA 1KTKE 4HXAL 4PLJC 4HC1L 1ZTXH 3RVUD 2XZCH 1CT8A 1MCNA 4OCXH 1T5XA 1TQBC 2HWZL 5K9QG 1U3HC 2V5RA 5KBNC 4TTGA 3RWIB 3MRDB 3L1OL 2MTPA 2KZWA 2XZAH 5L0QB 4O5LL 1RSFA 1FO0L 5IB2A 5GPRA 3EAKA 3MBXH 4HPYH 1MCLA 1MFDL 1R3KB 1DFBH 3C5ZB 2CDEB 5F9OH 2IAMD 3NIDF 1BJ8A 4ODTL 1KCUH 1EO5A 3IGAA 1NGWB 1IE5A 3PJSA 5F7DB 5J06A 3A6BL 1RIUL 3QPXL 4R26L 3BYYA 1NCUA 4DOHB 1E27A 3LRSB 3TIDB 2ZSWA 2H6PB 4I18A 3OR6A 3U4EB 2C4XA 1VENA 1H5BC 4ELMB 1WAAA 3ZKMC 4F80A 4YHOL 5DLMH 2W0FB 5J11C 3U7YL 5FYLL 3MREB 5CJQH 2Z9TA 2A9ML 1AIFA 3K2MC 2F58H 4CVXB 4CVWA 4GAJH 4QO1A 1AE6H 5D7KD 5DVLA 3DROB 2DKSA 2YOCA 2C1PA 1J1XL 3MRIB 4A6YL 3LPFA 4NPYA 1OTTC 4NSKB 4F7EA 1XIWC 1ZHKA 3EOAB 3VXRA 3H8NA 2HG5A 5DWUH 1SBBA 1PZ5B 1KPVB 4KKNA 1ZHNB 3U9UA 5T1DH 1O5DT 3IETB 1MUJA 3K4ZA 3BKJL 2W9LA 2NXZD 1WBXA 3U46A 1SEBA 4CADB 5DS8B 5FM4A 3J7HA 2O5XH 1R0AH 3MFGB 5T1MB 4QY8B 3U6RB 5I1GL 3OX8A 4QHNB 2VN7A 1V3MA 5LXGL 2WLZA 2GCYB 3G6JA 4KDTA 4KKAC 4GAGH 4NRXA 1ZA6B 2X4SA 4P2YA 2VXTL 1D5XA 1KIPA 3FB8A 4P5KB 5DK3A 3QI9A 5FUOH 4X0KA 1JFQH 5EA0H 4HK3N 2E27H 1EEYA 4KUZH 4X83A 3W5NA 1M1SA 3GBLA 4RAUA 2IADB 5KN5A 1MH5A 3BZEA 4L3AA 1LILA 3WDJA 3ARPA 4LCCC 3FRPA 3OAZH 1ROWA 2V2XA 5CJXA 1CFNB 1EVTC 1KCUL 1BJ1J 5LGHL 2YD9A 3R1GH 4HFUH 1Q72L 4L8SB 2F9BT 5C07E 2A73B 4NOFA 1WC7A 1YNLH 4OCYH 5D71L 5CEYB 2F15A 1KGCD 5D2NB 4NUJB 1AGCA 4NKMA 4ZQKB 3BKYH 5E6YA 5K9KA 2EH8H 4EDXA 3FL7A 5D1XC 1HIMH 3SE9H 2YPKB 2JJTC 1IAIM 2FECI 1WWAX 2LU3A 3HAEB 5IG7B 3TESA 1MAMH 4F7MA 3LCYA 2HKHH 1A7BA 1BFSA 4PBVC 4Y8AA 3MOQA 1T0MB 4GW1A 3NABH 3T0EE 4AQ1B 5D1QA 5C86A 3PXJA 1AR1D 5LKNA 2EH7H 1L9MA 4M61A 5JW4M 2DLTA 1HH9B 2G75A 3IKCB 3M8OH 2F53A 3RY4A 3KLAA 5DT1L 1GGBL 4JQXC 3QIUD 1NMBH 3EYFA 2VDLH 3NACL 1HHIA 4X0KB 2CR6A 2IMMA 5F3BB 4FZEH 4DWHA 4P3CH 4H0IA 1S7WB 5D7SH 3LQAC 5DJDA 5IQ7H 5TE7L 1LO4H 3MJ8A 4Y4FB 5DD1L 3R8QA 5L2JA 3H6JA 4N8CH 5IK3A 5C7XL 4P5MB 1YZZA 3RUGB 4LHUA 3MJ7B 2BOBA 3GI8L 3QJHB 3E8UH 3D0VA 3VXPB 4XVSH 1AC0A 4PGDB 1A02N 4KKBD 4M48L 3WUWG 1JZ7A 1XF3B 1S9WA 1CD1A 2BY1A 1NCBH 1KFAL 4PBXA 4DFIA 3T0DA 3HI1A 5EO9A 1AFVH 4AG4L 1RU9H 4GAYA 2KPNA 3U0TA 3VGAC 5DHVA 4XNQB 5C9JA 1JZ3A 4IHOA 3TP4A 1U6AL 2I25N 1GPOH 1CFQB 4XPHH 4HKBB 3UEZA 3UTSB 5CGYD 5DD0H 4BQCA 3HE7D 2ZWLT 5FGBA 4LMQE 4K9EC 2D7QA 2BOCB 1DBML 4RGNC 1OM3H 3RIAF 1FNEB 3BDYH 4XMPL 3MX0A 4UT6H 3VFTA 4JANB 3VXMD 5IMMB 1YPZF 4WWKC 1JWSA 1HCVA 3LKPB 1EGJL 2VDNL 3SCMA 2V5SA 3MA9L 1HI6A 3OG6B 4AEEA 1UQSB 4JRYD 3UZQA 2P24B 4NNPL 5FM8A 5IESL 1JF5A 3IFLH 3CVIL 1MOEA 3HE7B 1W72L 1BOYA 3O3UN 1WWCA 4GRMA 3KYMB 4PY8I 2MKWA 4YNYB 3U30C 1FYHB 3QG7L 4QOKA 1X5JA 1L4IA 5I73C 2NXYB 2OQJA 4BZ2L 4U0QB 3MLSH 5JA9A 1QLFA 2VABA 1JBJA 4AMKL 5JQHC 1FVCB 3BZDA 5MEPB 3OKKA 3P0YL 5T1LA 5LWYH 4JB9H 3SGDI 2VSDA 4EN3B 4Z7WB 1MFCH 3M1BA 4P5TC 3X3GH 1E4KA 1KCVH 4J3UA 3FCTB 5A2LH 2R4SL 2DQTH 4UUJB 2WP3T 3P4LA 5CJ5A 2OTWA 4L4VD 3V4VH 4NWUH 3O4LA 4PD4K 3CU7A 3NN8B 3QG7H 3FQUA 3B2UC 4L9LA 5HYSG 1T0PB 1UM4L 5C0BD 2E3VA 2DQUH 5I19H 1TTGA 4OLWH 5FK9B 2DS4A 5ENWA 1IT9H 5FO7A 4IRSD 3S35L 4E42B 3TBYA 2DL2A 4ZXBC 1NCNA 4OLVL 3DVGA 4PTTB 3KPRD 1RZJL 4UV7L 1A7RL 2XTJE 4WFFE 4NN7C 2BNQB 4HEME 4HWBA 5D1ZB 2J1KA 4F57L 3RJQB 1U95B 1FL3B 5JNYB 3TZVA 3JBG7 3BKML 4PBWD 3VA6A 4HG4J 5EUOB 3ZYOA 5L9DL 2EIZA 1U8KA 1KJ2A 4G8EB 5MI0B 4R97C 3OR7A 5C9KA 3NPZB 1MNUL 4YDIH 1M7IA 2VDML 3DVIA 1UCBL 4M7JH 1U3HB 2VUYA 4W4OA 3EJYD 3HI5L 2G5BB 3R06A 4JGMA 4Z7VE 1SYSA 2BVOA 1A7PH 5BRZE 3S97C 5CJQL 1OAQL 2OBGA 1MCPH 2VXSH 2FB4L 5D1ZD 4UTBL 4OIIH 2CXGA 2JJUA 1OW0A 2DIAA 3IF1A 5GZOC 3RKPA 1H3PL 1ORSB 5CBAB 1G7QB 3TCLA 4G80A 3LQMA 3T8XB 1F6LL 3CDFA 4FQLL 4X7SH 4TVPE 2PTTA 3TBTB 1F8TL 1L7IH 3RIAK 4F7TB 1I8IB 1U3HD 1SMAA 5GGRA 1NLDL 2W65B 3ARRA 4KJWD 1HCFX 3WDHA 4TVSa 4PLJD 4EUPA 2ORBL 4DUXA 5TDOA 1K2DA 3IFPB 3L3JB 3Q0HA 4XPTH 5EIVA 4X6FB 2GFBB 3KR3H 4WNQB 1HWHB 4YHZH 4OAWB 1SY6L 1C12A 1IEBB 3IDIA 5ETUB 4WVRA 4MSWA 1CFBA 1QFWM 1WCBA 1NGPL 3BIKB 5IB1A 4ZFOA 1AGBA 1BVLB 4XHQA 3DETD 2L4OA 5I1JL 3PWUB 1ZT7A 2SEBA 5H37G 3IFNH 3MV7A 1HHKA 4X6BB 2NTFB 3V5KA 3QUZC 4JQVC 5C2BL 4ODUB 3NAAL 2VUOA 4JZNA 4U7SA 5EORL 3UTZA 4PRPD 1MFBH 2DQEH 1SM3H 2I5YH 3HRZA 4P3DB 3GSNA 3VGDA 3RZCD 2Z8RA 4RWYH 4XP9H 1HK6A 4XPAL 4OI7A 2NY7L 3LQAH 1B0GA 1YNTA 3AB0B 4P4KA 4WY7H 2ZKHL 3R0MA 2H3NB 4L4VA 2AQ1A 5IW1A 4UBDC 4XNZB 3U0PA 4XNYL 4XX1E 1GSMA 1UCTA 3KPPA 3WNLA 4J4PD 2WBWB 1AGDA 1RZ7L 5CUSH 2KUTA 3QG6A 2Q86A 2Y36L 5I73B 3I6LD 5I1EL 5F1NB 5EG6C 4L9LC 5C8JB 4NKIH 2JB6A 4LDEB 1QSFD 2B8OT 4F7TA 4M6OL 1GJIA 1MHEB 1IAKA 1A21A 1JL8A 2LQRA 4AEFA 1T21B 2EDQA 5E8NA 5E4IA 4OGXL 1TNMA 2VXTH 1MAML 4X6FA 3OKLB 2ICCA 1SJEA 3HS0A 2JK5A 5MP6H 5GSVB 1EFXB 1J1PL 1ZLWH 4N0UE 3BP6B 1S78C 4GRWE 3WIHL 3TFKD 5I9QC 4YPGB 1TJGH 3INUL 5HD8C 1YY9D 1H3PH 5D7IE 5J57B 1RIHL 4ZUTB 2EDRA 3RHWK 1D5MA 1HI6B 5DQ9B 1OQOA 3QH3B 3VFWB 1ZHLA 5IBLC 2NMSA 1Q9LB 4JY6A 5B39B 1NCDL 1UC6A 3AXLB 3PWLB 1A9BA 1EHAA 3V4PH 4DAGL 5DMIL 1D5IL 3U83A 1BF8A 1O0VA 2EDTA 1ADQL 2JJTA 4S1RL 1HHJB 4AQOA 4ZSOA 1FZMA 4AL8L 3LDBB 2EDXA 4OZ4A 3CFEB 2XN9A 4A6YH 3DO3A 1UB6A 2D9CA 2WINB 4JKKA 5ISZE 2HVKB 4TVPL 1QFUL 4X9FA 3D6GA 3KPMB 1CGYA 4RCAA 3A0OA 1F3JA 2EZ0C 5HVHC 4X8JA 4YFDB 5D9SA 1QPXA 5D8JL 5C0BA 3QDJA 1UKSA 4YGVA 1EPFA 3QIBA 2R0WH 5KVGH 4AT6A 5F70A 3VFPA 5I8OH 3C09C 1ZHBA 4APQA 4G6AC 4IRSC 3NGBC 2HFFA 3RWFB 5JW3L 4XCFH 4RGMC 2WW8A 1IILE 43C9A 5J89A 3MYZA 5AEAA 5IKCA 2Z92A 4H1LH 4LIQE 3IRPX 1QBML 2OI9B 2Y6SD 5D93C 5GRJL 2P8MA 4N0FA 5FO7B 3OV6A 5I1LB 2R69H 1P4IH 3GSVB 3HNSH 1N6QL 1NCAL 1FAIL 1A4KA 3TIEB 2Y72A 1SJEB 3HS0B 1WZ1H 4J4PA 5E6IB 5C0IA 4JM2F 1RIVL 4K94C 1HE7A 1J05B 4XWOC 3V52H 3UDWA 5ADOL 3VG9B 3FOMB 4HUNB 3OL2A 1S9KC 4WEMB 4HIJB 3D2UA 5FA3A 4JJ5B 3DX8B 3PWNB 4M7KL 5IR1A 1RHHA 4HH9B 2ZNXA 7CGTA 5IQ7L 1CDHA 4FXKB 3T65A 3OSKA 3DV6A 4P23B 2VXQL 5E6ID 2AABH 1CF8H 3HMXA 1CQKA 3ESUF 5EPMA 3PWJA 1OGAB 1QQDB 4W70A 1S5HB 4LCCB 5FGCB 5GZNC 3MBEB 4PJGF 3SBWC 1L9NA 3WNNA 4NQCB 2GJ6A 2XYCA 1F11A 4OLUH 4Z9KB 1A3QA 3GMNA 4XH2B 3ULVH 3THML 1EJOH 1AQDB 5IW3A 3WFEL 3SE3A 4XNYH 3PHOA 5DMIH 2XG4A 2C3WA 3NA9H 5E99L 3ROLA 1L7TL 1AO7E 4WY7L 3QEGH 4N90D 4NGHH 3O3EA 3FZUC 4AIZB 1J7VR 3MBED 3UJJH 3STBA 1AHWA 3NZ8B 4MA8H 4YFEA 3QIWA 5F1SA 4QTHB 4U3XA 4DEPB 2H26B 1A2YB 4HXAH 1K4CA 5ANMB 3UJTH 3T2PA 4U1NA 5F71A 4HT1L 4ZUVB 3EYUL 1KTLB 4B53A 4UAOB 5FYLE 5A16A 5BZWB 2C26A 3PWUA 1HSBB 2H32B 1CE6A 1IC5H 3L7EB 1O7VA 3ZDXE 3L5WB 2OI9C 5I1CL 4O58L 5GGTL 1HNGA 1NGXA 1KPUB 3KXFE 2UZXB 2HT2D 4P2QD 2OK0H 4Z7UF 4FNLL 4XAKE 3TBWB 4FQXC 1MIEH 3STZB 1R5WB 3HNVL 2R8SH 4FQJL 3QISA 2FD6L 4PGEB 1VDGA 2V2WB 1BQLL 5T33H 4BFIB 4MX7B 2EEAA 4RX4D 4YPJA 4JFQB 4YHNA 2GTZA 3QRGL 3LS4L 4MD0A 5CILL 3LDBC 4R3SA 3DTXB 3THMH 3S98A 4L29B 3N85L 4PJBA 1U93B 1Q94A 3WNPA 5GRVK 5LBSL 4NN6C 4XPBL 4F3FA 4NZJA 3UYPA 4N8VA 5FKPA 3NCYS 3WEXA 4Q97A 4ODVH 4OTXH 2H6PA 4C54A 4YDJB 1A6TA 1XT5A 4AEHL 3MRNA 3V6OC 3RWCB 2WM0A 2LU7A 3VCLB 1K4CB 3SDCC 4UOJA 3RNKB 3B4NA 4MA1B 5DD5H 3BGFB 2VDQL 2W0LA 4NN6B 1T2QH 4QXGL 3ZDZF 1EGJA 3PWLA 4YDLC 1D6EA 4WFGD 1OD9A 2OL3H 3QXAA 1IKNA 1S7QA 4EJ1C 3HAEH 4GS7C 3HG1D 2Q8BH 4OZ4B 3MRDA 5F96L 4FQQB 1UB6B 1ODAA 4M43L 4QOKE 5J9PB 2IJ0C 3W81A 2JCCF 3ILQD 4PRIB 3MCKB 4U33A 5DO2C 5J4MA 1QFHA 4UB0L 1JI2A 4HPOL 2HA1A 1MCDA 2FNBA 5CINH 4YFLF 2BVTA 4GXVH 5JR1H 1R24B 3BZ4A 5C07D 5EO0B 1EH9A 4P9MH 3SE4C 3LN5B 3I9GH 5E8DL 3MUY1 3DPBA 3T2NL 2R23B 1B4RA 5KSBB 2CKBH 1G0DA 2OL3L 3MA7A 1I7RA 3OX8B 1DN2A 3BSZH 2XTJC 3HI6L 1XF1A 3CSYB 1DSFL 4MZ3A 3QQ3A 1NUGA 3HE6B 1KXTB 5DEZA 2JIXA 4BUGA 5CD5C 4G6FD 5JQ6L 4ZAKA 4J7RA 2AAVA 3S7GA 2P5WB 2PYEB 3MCLH 5C07B 1EJOL 4IRZH 3WFEH 1J87A 1LO5B 2L0DA 1CQYA 5CBEB 5IVXA 3QHZL 4Z0BL 4PJDB 4JVPA 4X6EA 3FN0H 5C0FA 2B2XL 1ORQB 4JO1H 3SDDC 2Q7NA 1E4XI 2J8UF 4G7YL 4HF5H 3RI5K 4QRRD 3G6DL 2C1OA 3VXUB 1J11A 1D6EB 5E00A 5HGHA 3B3IA 1EV2E 2BHYA 5T1LD 1JUFB 1H3WM 1MJUH 2BSTA 4Y8DC 4G6FB 5HGDB 4TTDC 5CWSB 1A7OH 2DQCH 1FQ9C 5IVOA 3IXAA 3X3FH 1JGUL 4F2MA 1CTNA 4MDIB 3GZKA 4XZUB 2VLRE 4NKDB 2XQBL 4PLOB 3U1SL 4Q2ZB 2ICEA 3CIQA 3C8DA 3LS5L 4DW2L 3HE6C 3HUJE 1V5JA 3ARBB 4X6CB 2DLHA 4I48B 1YMHB 4EVNA 4PJCF 5F7KC 1WBYA 1ZAGA 2HYMA 5ID0B 4HUUA 1UFUA 4NCC2 1GGBH 5F89A 3VFUA 4NNYB 1D5BB 3VXTB 4JRWA 2UWEA 2R0ZL 1IEHA 3RWEA 1IGIH 3RU8H 4AIZA 3V6OA 4LVHC 5TE7H 3LN4A 4JLRB 5K9OA 2XZCL 5IB2B 4ODTH 3VD3A 1X5ZA 2O5YL 1YNKH 3H9HA 1QLEH 2H9GA 4AENB 1S7WA 5D1ZC 2Z31C 3FRPG 3IJHB 3E0GA 4WTXA 4R7NB 1BPVA 1I7ZB 4JFDE 5KVMC 3VDAA 3GMQB 4X7TB 5FDWA 4HDIA 1PKQA 4RRPA 5CEXB 1E28A 3LEVL 3FO1A 5F44A 2IALB 1UZ6F 4HFWB 4RNRB 3EYSH 1HHGB 2HT3D 4IRZL 3VWJD 1FL3A 5HHXL 3L5XH 5T3XL 3IJSB 4LLQA 5DGRA 3KNBB 2RJMA 4LSRH 1DDHA 4KU1A 1JYWA 2VR4A 4RX4A 1KPRB 4R90H 3RFZC 1JK8B 1KN4H 4Z7NF 3FN9A 3X11A 4KHXH 2F5BH 3CSGA 1KYOJ 1QBBA 1WLHA 4Y5XA 9CGTA 5CZVL 1LNUA 1X3DA 3GO1H 4I2XA 5I1IL 1PLGL 4X6DE 3O8XA 1MJ7L 4MHHG 5IMOA 1QNZH 5I0ZA 1SJHB 2CKBB 3FQNB 4RA3A 1S3KH 3SHSA 2OMBA 3PP4H 1A7NL 3SO3C 2W0KA 3VWJB 1IAII 5CBAA 3A67L 4ZPVB 4G80B 5C08B 1LO3H 4OFKA 4Z7OF 4GG6A 1G9NH 4PJ7A 1G1YA 3ILPB 4ISVA 1ZLSL 1CDCA 4OFDA 4OLXH 3NFPB 3ULVE 3VJ6B 3QXVA 5F1IA 1FVEB 3VA2C 1VPOH 3S5LG 1P7QA 1HOCA 1N7ML 2PYFB 3LVEA 2VDOL 4RQQB 2ZOKB 4OFPA 3VXQB 4PV9A 4XNMB 3OKNA 1W0VB 4Z7WE 2UUDK 4TSAL 4P59H 3JTTA 4Y2DC 1MRFL 5GGRY 4TYUA 2X4TA 3L7FA 1G6RB 1KYOK 1HYSC 3KYAA 4B0MM 3BZFB 3G5VA 4QLRA 1RY7B 4JCLA 2RHEA 1G9NL 1S9XA 5EBLB 2XIDA 2VR9A 3WIHA 5D72L 1BHGA 4EUPG 5ISZB 4D0BB 5BQ7A 1ZA6A 4LFHG 2NNAA 4Z7WA 2PETA 4NO3A 5C0ND 1W0WB 4U7KA 4E41E 1UH4A 5GGTA 5DYOA 1J12A 5CJ8A 5DUPL 3MLUL 4WTWA 1K5NA 3U7AA 4JFYB 1QSEE 5CZXD 3VFMB 1FIEA 3GBMH 5F93C 1MCBA 3G9VA 5JOPE 2DKUA 4WIQA 4OCSL 5C0IB 2G5RA 4M7LL 1T04B 4WGWB 2IPTL 4L4JA 2CIKB 2EEDA 1OP5H 4Z7QF 3ULUC 1NJ9A 5C0CB 3PNWA 4Q0XL 1JHTB 2NY1C 1JJUA 2NX5A 1FYTB 2YPVH 3CZFA 3LD8B 4PJFA 2ZUYA 3MLVL 5JOPD 1H8OA 1XZ0B 4HJJL 4PJXA 3T1FB 3DI3B 1CS6A 1JZ6A 2I26N 3JTSA 4F58H 2BVPB 3MRGB 4JO4L 5D7JD 4K71B 1ULVA 5TDPB 5SWQA 2LFGA 4DCQA 3BESR 4WV1C 2FHCA 2JJWA 5IJKA 1AD9A 4JFEA 1TVBA 3EJZC 5C0CD 2EO9A 1H15A 3VXNB 4UQ3A 1CFSB 3MNVA 2BVQB 4PJGE 1FYTD 5EO1A 3B83A 1FH5H 2UZIH 3NCFB 5IF0B 4GOSA 3ZDZE 4X6DF 4JAMB 2HJLA 1G7QA 3WXVL 3EJYC 4MA8L 2NY3C 2Z91B 3S96A 3LKSB 2GUOB 4D9RE 1D9KC 4S0TD 2BX5A 5JXEC 5IK3B 1T7YA 3ZO0A 4LGSB 2HVKA 4ZSOE 2Y07H 2DQDH 2EO1A 3ISWA 3WE6B 3KHQA 3I6GA 3W2DH 3WSQH 1JNJA 3V79C 1A2YA 1IQDA 1KENH 2JB5L 1GZPB 3LKOB 4I3RL 3VMOA 4XHJD 3LQAL 5SV4A 3WHE1 4X5XB 3VH8G 1DBBL 3IGAB 5JXAH 2NXZB 5KSVA 1AKJA 5F7WC 4LPVA 1HSBA 1T20A 1XH3A 2H32A 3HNTH 4LQFL