2DLHA

Solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
121
structure length
121
Chain Sequence
GSSGSSGPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor-type tyrosine-protein phosphatase delta
publication title Solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 7
structure length 121
sequence length 121
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dlhA00
3BEVB 4JQIL 5IHZA 1OGTB 1FZJB 2EIZB 4KDTC 3HPJA 2WNGA 2HLAB 2HLFD 3T3ME 3BKCL 2W60B 4OLYL 2NTFB 3I50H 5KANG 5M7QA 1M7IA 2NXZD 1CK0L 1OARL 1KLGB 4HUVA 2B1HH 3ZKXB 2AJUH 1UJ3A 5F3HB 1INEL 1KXQE 5GS0C 1KJ2B 2ARJQ 3TNMA 4IRSD 1BOGA 5JOFA 5ADOH 1Q8MA 3QUYD 3PP4H 3H9HB 4EUPH 3K2UH 2GTZB 5A16B 3VRJB 1FQ9C 4PJ9C 1UZ8B 5SX5K 3MREB 1C7SA 3VXQA 5HTSA 2VLKA 4OZGB 1NBVL 3BXNA 4UI2A 4HMCA 4K8RC 3RWJB 3RVTD 1LO5B 3BAEL 5I18H 2QHRL 3C60D 3ILPB 4GAJL 3VH8G 1MCHA 5EA0L 3W0WA 1CFTB 5F7DA 3EKCA 5FUOL 1WBXA 3OKKB 4XMLH 3RL2B 3ZSTA 4LHUB 1F4AA 4NHUA 5GS3A 4Y4KC 1JI1A 1SJHB 2R23B 5FUZL 2R0LL 4DUXA 2FGWH 4HS8H 2IFFH 1WIOA 1S9WA 4JM4L 4C56E 1FYTE 1CL7L 5I1JH 4JN2A 4WI5A 3QNXB 4WI2A 4WV1B 4X6DE 3TNNA 3BP6B 5JXED 4OZ4B 3O3EB 4L1HA 1KIRB 2NY0D 4HWBA 2J8UA 4I3GA 1FL6B 1SVZA 1ADQL 5H94A 5BQ7A 3FTGA 3TFKC 4IRJB 3H9SE 2W0LA 2XWBA 3N1QC 4HQQH 1JPST 3QBTB 5C0ND 4UT6L 4M9OA 2D7QA 1NGYB 3H7LA 4OLXH 3FONB 5E8EB 1U8OB 2ITCA 3MRKA 4XMKL 4S0TD 4YHIB 4F7MB 3J7HA 4ZD3H 5IQ9B 1C12A 5HVHC 3C08L 1KT2B 4UB0L 3V4VL 4MXQC 2GJZB 1RIHH 3GKWL 2H26A 3OHXA 5BRZA 3TYGH 2M1KA 1QFOA 2D03H 4KROB 5ITBL 4AQOA 4D8PB 4KK6D 5E9DB 3SGKA 3DRQA 1Y18A 1CYGA 1KB5A 4ONHA 4ZXBC 4U0RB 3WJJC 4L3ED 4Q6YA 3WKNA 1U3YA 3Q5YA 4ONFH 3G5ZB 5DHYB 1F3DH 5H37H 4GKNA 3UBXB 2APVA 2A6JA 3PL6A 4Y5XB 4I4WB 5E8PB 3MACL 1X4ZA 1NCDL 3DLQR 3OAZH 1NBZB 4IIQA 1EXUB 1JZ7A 3RTQA 2CKBB 1DL7H 5HPMB 3BIBX 3T04D 3BYYA 3GMQB 2PTTB 3V6FB 4YE4L 3L5WB 3LN5B 3TBSB 2JCCB 1JN6B 1SYSA 2C1PB 1BQSA 4PJ7F 4G6KH 2Y9RT 4M7JH 3QEUA 5FA4B 5GGRA 3RAJL 4P9MH 3F7RA 4MJIB 1YEEL 4LVNB 5CD3B 3EHBC 5H2BA 2VXTH 1CXIA 1I7ZB 4MA3A 4S1SH 3JWOC 3ULUE 1FZOA 2OTUA 1FL3A 4H88L 1BPVA 1I1FA 4HXBL 5LCVH 5J89A 1MCEA 4HH9A 1OSPL 1JNNL 3MFGB 3I6GA 1UGNA 3QI9A 5C07A 1WZLA 1NLBH 2R2HA 1AXSA 3RZCD 1EHLH 2AJYL 3H3KA 3SDCB 2X1XR 1QFUL 4JFQA 4I48A 1S9VA 2AJUL 2DI7A 5K9QG 4GW1A 4R2GB 4JR9H 3JXAA 1LO3H 2AJXL 3K1DA 5GGQH 1EAPA 1S5HA 2O61B 3G08A 3B5TA 5ADOL 4KWUA 2XY2A 3O4OC 5D7LB 4MMZC 3X11A 3CXHK 3ARDA 4WW2B 1ACYL 3CFIC 3STZA 2G5RA 1RIUL 2Z91B 1R5WB 1I8IA 4JZOB 4DJMA 4UQ2B 1HN1A 3VXMA 5I18L 3PWNB 4HUNB 1REIA 4JO1H 2ZCHH 4UV7H 3KXFD 3TN0D 2WBJD 4OZHB 1CZ8H 5IB5B 1QBAA 1MQKH 4HXAL 4XMLL 4P23D 5BV7B 1GGYA 4LMQE 1VSCA 3EDKA 4PJGF 3L3OB 4FS0A 3SPVB 3WNMA 3U30C 4LNVA 4UOW0 3T3MF 1MWAB 4QT5B 1P5UA 4PYHA 4G6MH 2GTWB 4RA3A 1E28A 2AJ3B 5I75B 1JTOA 4HUWB 2AVGA 1NSNH 1IAII 1DQML 3O8XC 1WAAE 1JGUH 3V9FA 3T1WA 3OB8A 4M7ZB 4XNXH 4W68A 4MXWH 3SGEI 1S7WA 4LKCA 2CLZA 2VQTA 5IB2A 3DECA 5HHPA 4OZIE 2XICA 3WN5C 4ZD3L 1AI1H 5K93A 3NBNA 1MY5A 3BKML 4D94A 3VE0B 2A6DB 4QRRA 2W65B 2D03L 4M1CC 4R3SA 2NZIA 1HXYA 4LIQE 4HCRA 4Y1AA 2XACC 4JFXA 4V1DB 1ZT7A 3WE6B 3E3QC 3W5NA 2FEDC 1JRHH 5B4MC 1TCMA 1UB5B 5E00A 4X6DF 3KPQB 1FZMB 3BISA 4BK4A 4JM2F 4ZUTB 4GXVH 1A7NL 3U9PH 3QH3B 4TTGA 4N8VA 4DZBB 3IU3B 3LKOB 4MJ5B 2ZUXA 3ROLA 4RAUB 4X6FA 1QRND 4J8RB 4QCIB 1MFAH 2XY1A 5B21A 4XVSL 3O6ML 2VNCA 3RKPA 3VFUB 5ACMA 5JPNA 1YDPA 4RDQG 3VH8B 4G6KL 2VYRE 4N0FB 4M7JL 4NFBA 3BEVA 3NIDE 3VFRA 2Z8SA 2I5YH 4X4ME 2EIZA 2VXTL 2HLAA 5GJSH 1JYNA 2RQ8A 4XMPH 5F89A 1JTPA 4S1SL 3VWJA 3CLEH 2ORBH 3FQWB 5DRXB 4CN6A 1YEJH 1IEAB 5TGBB 4NO3B 1KLGA 3BW9A 3CVHH 4GQPH 2WBWB 3BQUB 5LCVL 1VFOA 3P0YH 2F8VA 5IMLA 2SEBA 5FKAB 4M7LH 1F5WA 1O0VA 3EJYD 4GMSH 4JRYD 1I4FB 2YEZB 4ZO8A 4KVCH 5IWLC 1NLBL 1Z0MA 1EHLL 2W92A 4E41A 4WENB 5IFJB 2D2OA 2R69H 2H41A 4XBGA 1PZ5B 4OZGA 1MCRA 2OL3L 1R3HB 4HFWA 1EAJA 4JR9L 1Q0XH 1LO3L 3DSFH 2O5ZH 3D9AL 3RWJA 1ZHNB 4XCFH 4GS7C 1K5NA 5JW3L 3MUGB 1XF2A 1AIFA 1NKOA 5GSVB 4LHUA 4PP1D 2A6IA 4OV5A 4U7KA 1W0VB 4HKXB 5I15H 5GS0D 2OJZL 4GAYB 1X5XA 3QUML 4F58H 5J6GA 3QJHB 4Z7VA 3IDNB 3ULUF 4FXKB 4WV1A 4PRDB 3BP6A 3O4LE 3QWQB 4A2LA 3AVEA 3O3EA 4UV7L 1KEML 3DVNB 3ZKSD 3QHZH 1KIRA 3PG2A 4N0UA 4PJ9D 2H9GA 2MQ3A 1CZ8L 5JUEL 1MQKL 5L2KE 4EUPG 3CZJA 4JFEB 4IRJA 5CSZB 3NCEB 3S5LA 3ZYJA 4K8RD 4G6ML 1FIGH 5I71B 1HXMB 4EIZC 1T1XB 3GO1H 4KZDH 1YYMH 3BIAX 4G8GD 5E6YA 5ECJE 5L6YH 1KT2A 2PCPA 1VFMA 2GJZA 3MJ9A 4JFZL 3C09B 3WLWC 3L3DA 3C6LB 5HBBA 4MXWL 2I60L 2MMXA 1R3JB 5SWZD 1CGSH 2I07A 5BS0D 1H3XA 3O9WA 1X4YA 1EERB 4FQXB 1U8LB 1RZKC 1YY8B 2YPVH 3TFKD 3UBXA 4H8WH 3DJ9A 4L4VD 4ZOAA 1KB9J 2G60H 3ULVE 4M6AA 4HFUH 4I4WA 1DBML 1AXIB 4Y8DC 3W2DH 5D7IA 4RA0C 1YEDB 1CU4L 1IGYA 4NQED 4PTUA 2ZUWA 3WXWH 3OXSA 3R8BB 3B9KD 4XPFL 1D6VL 2CKBA 1YPZA 4FZEH 4XPTH 3GMQA 3WIHH 2PTTA 3LN5A 5J4MA 2CD0A 1JN6A 2JCCA 2HMIC 1Q9OA 4PJHE 4UTBH 1A6ZB 3CDGB 3LQAC 4AENB 5JDJA 3U9PL 5T1KB 4PRHB 2OXHA 5K59E 1WAAF 1B3JA 3LKQA 1K6QL 2Z8VC 1S7SB 4B50A 2G2RA 4ZXBD 2XWJA 3RY6C 5EU7E 5I1EL 1MFAL 2RHEA 4KUCF 4CW1B 3FOMB 3F6IA 3ET9F 1N2RA 3RI5F 1TVDA 1M1SA 4OZIF 1A3LH 5E1HB 3GRWA 1CLOH 5H37G 4H26A 3EDEA 1U6AH 1IC5L 4HJGA 5EO0B 2W0PA 4NC1E 4U1HA 5J7CC 4XMPL 3X3FH 1NEZB 3SDCA 3MYJB 3CLEL 5MHSE 1C8PA 3AB0B 2WZPD 1XF3B 4NIKB 3PWJA 1EK3A 3CVHL 4C57C 5IB4B 3MRFB 5HDLA 3SOBH 2NY7H 3U0PB 3P0YL 1NBYB 2JTDA 1A2YA 4HKJB 4MCYB 4O51B 1A6AB 2XZCH 3K4AA 1T22B 5D7LA 4KVCL 3EHBD 1LO0H 1QFWM 3ZE0E 4XGZB 4Z7NE 1IEBB 1IAIH 3QEQA 1YECH 2W9EL 3DURB 3OKOB 2R69L 4L8SB 3VFGH 4P46C 3UYOD 4CADA 4MJ4A 5F7KC 3DOSA 5D6CB 1XT5A 4JZOA 2C3VB 3H42H 5HVGB 2V7HA 2O5ZL 1CXKA 4KHTL 5CCKH 5C3TA 5ILTH 3WUWG 3Q1SL 1K4CA 5C09D 4XCFL 5TJWK 2BJML 4FTVE 2V5SA 5D2NC 5AD0A 3BVNB 5DDHB 4HJJH 1RZIA 5ALBH 3QFDA 4OZHA 2BRQA 4PB0H 5IB5A 1EVUA 3C5ZA 3BZEB 3MFFB 1X44A 2JK5A 2YUZA 3NIDF 1MSPA 3QDJE 1GSMA 3AM8A 1ZLSL 3SPVA 2HJFA 4XNMA 4PGEA 4U05A 4F58L 1BP3B 2XTJC 3GSWA 5IF0A 4KRLB 1RVFH 5BVPH 1WCBA 3CCHA 5HXMA 4OI7A 2E6PA 3A6BH 2GTWA 2AJ3A 3CLFL 4C55A 3DMMB 2Q6WA 4GG8B 3PJSA 1HHGB 3BDYH 3O6FC 5T1LA 4PJEB 3IGAB 4NN6C 2GSIA 5DO2C 2YK1H 3TH2T 1J9CT 4FQ1H 2V17L 5DK0A 3HFMH 4E42B 3I3DA 5DRNB 3EYUH 1N6VA 5JHDE 4KZDL 1YYML 5EU6E 4J2XA 4KKBD 4LCCC 4D9RE 1YN6B 2AK1H 2D7OA 4RGMB 5C0BE 2WLZA 1OGAE 1SBBA 5AEAA 2A6DA 2PXYC 1G7HB 4OLEA 3T77A 5JW5A 2ZKHH 4Y2DC 2C4FT 3FQXA 3AU1B 1ZSDB 4LDOB 1JZ8A 3RPIB 4EDWL 5KOMC 5FV2A 5IMOA 4R6UA 2Y5EA 4V1DA 4ZSOA 3O8XD 3V4PH 4I8DA 3Q2CA 4H25B 4MNQA 4ETQA 1I1RA 4WEBL 2G60L 3KPQA 4PJXE 4ODVH 3H9YA 4EKXA 5L2JA 3G6DL 1E6JH 3BX7C 1CICD 1ZANH 3IU3A 3LKOA 4DZBA 4CMHC 1PYWB 1WGOA 3IDXH 3VG0H 4QHMB 5EZIH 2DOCA 3OKYA 4TUKL 1VGKA 4QCIA 4FZEL 4PP2A 4XPTL 3Q48A 1DBJH 2E3VA 3WIHL 4KK8C 2RCSH 3GIVA 3KVQA 1UH4A 1A22B 3DETD 4X4XB 4I3SH 4Y4HC 4M1CD 3S35L 4ACPA 1RULH 3FQUB 4MA7H 3KLDA 1MAMH 2YUVA 1XCTB 1DANT 4DZ8B 5B4MD 4RWYH 2DLGA 3IDMA 4LVOB 3OGCB 5DC4B 3P4NB 3NGBB 4Y16B 3QEGH 4LHJB 5DMGD 3P9MB 4OAWA 3E6HB 1QBLH 3LKNB 1QLEH 1U6AL 3GHEH 4EUPB 1WLHA 2R2BB 5C08D 1EEYB 1ZLUK 1ES0A 2AKRB 3VXSB 3SBWA 4KDTA 3CIQA 5E6ID 5GGTA 1S9YB 3DYOA 2NY4D 2EKSA 3SOBL 2NY7L 2XN9D 4X9HA 4QRTB 3GBLA 4WO4C 3ZE2E 4DVRH 2WIIA 1J8KA 2PO6B 2ENSA 2KKQA 1IQDB 4X7SH 3LCYA 1IAIL 4PJHF 1YECL 2Z92B 2IH3B 4PJ9A 3KHQA 4RMWA 2H45A 3VFGL 2CSPA 5GSVA 5K59F 1NL0L 3MRQB 3WV0A 2X4NB 3H42L 5C9KA 5C2BH 5CCKL 2VL5B 5ILTL 4PJ8D 4FXKA 3B2UC 4WUKH 4K7PY 4PRDA 1I7UB 1JK8B 4G9DB 2W9DL 4HJJL 2J8OA 5ALBL 3IETB 3QAZB 4O4YH 4PB0L 1PQZA 2ICWB 4TNVF 3ALWA 5CSZA 4DQOL 1KN4H 3U83A 4Y4KA 4J3WA 4JVPA 1LEKB 1RVFL 1HXMA 1KBGL 3A6BL 1PLGL 1JWSA 4JRXA 5J9PA 2PETA 3TP4A 3BDYL 4DKDC 5C0IA 1NC4D 5SWZA 2XQYG 1V5JA 3FRPG 2WAHA 1CQKA 3KPLA 2BVPA 3RWDB 1BVLA 2Q3AA 1NCBH 4ZPVA 2YK1L 4G6FD 1FO0H 5BXFB 2DLIA 3HC3H 3ZE0F 4F9LC 3C6LA 4Z7NF 3HFML 1AO7B 2F8XC 3EYUL 3BFOA 1IGTA 4NBYB 4WU7B 1HEZB 1CFSB 2ZZUT 5CIPH 4YBLB 5MEPB 4M03A 1JZ3A 4MD4B 3TVMC 2X10A 4HIHB 1OTUC 4WGVB 3DXAD 3QHFH 2AK1L 3MLYL 5FEBA 3MBEB 5DUMH 3C87A 3ARUA 5DJ2B 1MREL 1CDIA 3U7AA 3MRHA 3OGOE 4UINL 1VKXA 1DLHB 2EH7L 4AEHH 4BFIB 3LRSA 3C8HA 3KLAB 4AMKH 5FECA 4PGJA 2X4TA 3DVFA 4ZXBA 2ENYA 3SDYH 4YGVA 3BIKB 4RAHA 3GSOA 3WLWD 3VWKB 4XP5L 5BMFH 1A1OB 5EO9B 5DC9B 1ZMYA 3VMNA 3VXRE 4AENA 1HH6B 1KTRL 4XPAL 4ZYKB 4WHCA 3VXOA 1ZANL 4L3EE 4QNPE 5EIIB 2BOBA 5EZIL 2BNUA 1QFPA 2XG5A 1ZGLM 2X1WL 3FOMA 4CW1A 1DBJL 1WIUA 2DWDA 1J0ZA 2RCSL 3EOTL 3DYMA 5TDPB 1C5CL 1S3KH 2VUOA 3IF1B 1CXFA 3MV9D 4MX7A 4OT1H 2G75B 4ODXB 5DEGA 1RULL 3AROA 4Z78A 1MAML 1NPUA 2XKNB 3T0EB 4P5KB 5F72S 3NVQA 4X98B 1JPTH 4MD5A 1SMOA 1XF3A 4L3AA 1DQTA 4RWYL 5GIRA 4YDJB 2OL3B 2GFBA 3QEGL 3U0PA 4F33B 3B8SA 1HSBB 4PJCE 4HKJA 2W38A 4MB5A 1WIPA 1ED3A 3GHEL 2VKWA 2BY3A 3EAKA 3OXRA 5E6ZA 4FZ8L 4PJXF 4U7MA 4DGVL 3JWDH 2J5LC 1NMCC 3OKOA 2ZUUA 2CGRH 3QUMB 1DEEB 5D6CA 4NN7B 4AZ8A 1OTSD 5I8CA 2Y6SC 3HE7A 4DVRL 3GSNH 4NM8H 3DUSB 5EFIB 2Q76A 1ZT1A 3CZFA 3MC0A 5CJOL 4X8JA 1P1ZB 2VWEE 4X7SL 5I8KH 4U1IA 5D1QC 3MRLB 5E5UB 1ADQA 1BAFL 1E6OL 3NFPB 1T5XB 1D9KB 1MELA 3BZEA 4XP9H 5HGHB 3MLSL 4OI8A 1JPSH 2EKJA 4KMTH 1A7QL 2A74B 3S36H 1EHAA 2YA1A 3DMMA 1J10A 5DUPH 4GG8A 2AXGB 2MKLC 5T3XH 1UYWH 4GT7A 4JPVL 4O4YL 3IGAA 5EOTA 2ATKB 2PYEB 2QR0A 4LSQL 5MP6H 2CUHA 3KJ4C 5EULV 4G6JH 4UNTA 4M00A 5D1ZA 3KXFE 4YFEA 1KIQA 4NYLB 3VG9C 1JZ5A 4QXUL 3PDOA 3CH8A 1GVIA 3ZE2F 2DQJL 1YN6A 3UAJC 4NQCE 4JO4H 1G7HA 4OCMC 3HC3L 3L95A 3QCVL 5KS9E 1ROWA 4NNXB 4K3HA 1IM3A 1SBSH 4R2GC 3VW3L 4DFIA 3PHQB 1ZSDA 2N7AA 1YQ2A 4XHQA 5E4IA 4G9FA 3U7YH 1KF9B 4X5LA 2GITB 2OSLB 5KJRL 3P4OA 3QHFL 3RKDC 3WN5A 2IAMB 1ZGLP 4PV8A 2E9WA 2B0SH 5FGSA 4XBPB 4PPTA 2VE6B 4AEHL 1T2JA 2VLJE 4YXHH 1PYWA 1FG2B 4AMKL 4NNPL 4QHMA 5ISZE 3SDYL 4BH8B 1SEQL 2PXYD 1U8HB 5TE6L 3S7GA 5ENWA 1AQDB 3H7BB 3DX9B 2XRAL 4PJGB 5I30H 3UYPA 4DKEH 3T8XB 2LE9A 4O2FA 3N9GH 1XCTA 4QTHB 2BHYA 1CG9A 1S5IH 3VRIA 4UOW1 1MI5B 3CVHB 5LGJA 3LIZH 1BREA 2O5XH 4NGHL 4RBPK 5D96C 4JCMA 1V3KA 1VFUA 2APWA 1CT8B 2XXCB 4OT1L 4M8VA 2Z31B 1T04A 4NRZA 1J11A 4HF5L 4F37F 4O5LH 4G8EB 5F7EL 1L4IA 1QRNE 2R2BA 4RRPA 1EEYA 2F54B 1BF2A 3AXLA 2XWTB 3IDYB 4HUKB 3VFWA 1G9NC 1RIVH 3LH2H 3TM6A 1S9YA 4ODTH 3QIBB 3MA9H 3V6OE 3RUGA 4Y4HD 4FQJL 2R1YB 3QFJA 2R4SL 1BZ7A 1T7WA 3STLB 5I66B 5J13B 4OCSH 3PP3H 5C0CD 2C4FU 1A9EA 2ILLA 1JWMB 3QIWC 4P2OC 4YHPA 2WWMC 5IWLA 4ZNCD 4POZC 5D7JB 2IH3A 3VFOB 1NJ9B 5B8CC 5HD8C 5JMRA 1CF8L 2CGRL 5DK2B 3QUKA 1G9EA 1XR9A 4PTTB 2HYMA 3BPNB 4QNPF 4JRYE 2ESVB 2X4NA 1K4DB 4TN9A 3GSNL 2MQ0A 4NM8L 4MAYB 4WGWB 2DB8A 1H5BB 4B41A 1I7UA 2VLRD 5I8KL 3MV8D 3TIDA 1RSFA 1TIUA 3IETA 1ZWIB 4Y5VB 2NXYB 3UC0H 1Q38A 4WO4D 5F9DC 1KCRL 4LF3B 1Y6NR 1JPSL 2CO6B 1HCFX 4KMTL 4X6EB 3F8UB 5DMYA 1U8IA 3UXFA 5BVJB 5EUOA 1FFQA 4HAGA 4RGNC 4U6XA 2HAZA 5DUPL 4PJCF 4MS8D 5T3XL 1QPXA 2UVEA 5CKAA 2HKFH 3RWDA 2YKLH 1DANU 4HH8A 2GCYA 5CMAA 2I9TB 5IFHH 4G6JL 5F8QC 2IH1B 3B2UD 4WU7A 1CFSA 2BC4B 4KY1H 3OR6B 3RIAF 4K7PX 4AL8H 4HIHA 4MZ3A 2V7NB 4A2MA 1FVDB 4RMTA 3AS2A 4HG4J 1M71B 5E8DH 4IDJH 4XXDB 1IC7L 1T89C 3P0GB 3F5WA 1HQRB 4NP4H 1U92A 4NQVB 3QUZB 3VFNB 3RIFF 4N0RA 3CFEB 2QADB 4LLUA 5IVXA 5MEOB 4I0CC 2J1KA 4IOSD 1WWWX 3ZO0A 3D39B 4N1HB 4NNYB 4P9HL 4WFED 4YGAB 5HSFA 3BIKA 5JMOC 2CDFA 5D5MA 4J3SA 4P2RD 5E95B 2B0SL 5IMKB 5FYJD 5CBEB 1EO8L 3GI8H 3ZDZF 1QKZH 3KAAA 5BS0E 5DRWB 4L4JA 4U1JA 1QD0A 4OM0L 1CVSC 1NFDE 1XF5B 3BWUC 1OTUD 3HZMB 3TVMD 3JV5A 2W0FB 4U1KB 5DEFA 5IW6A 5ERWA 5F1IB 4L4VE 3O3AA 1JHKH 5FYKD 1DTUA 5TDPA 4JY4B 1VGEH 4N8PA 5F1OB 5C0GB 4D0CA 4ODXA 4NQEE 1N59B 3EYFA 2PF6A 3MGTA 2HVKB 3T0EA 4P5KA 4YH6A 4MDIB 1GOHA 3RVXC 2O5XL 1MCFA 1EMTL 3FCTB 1QHPA 4CNIB 2OL3A 3PGCA 4XWOC 2Y25A 1OB1B 3ZHKA 2MWCA 1MRDH 5GRZA 5JW4R 1TXKA 3MMEB 4TSBL 1ZA3A 2YPLB 5IOPB 4WTWA 2KQMA 4HBCL 5A1AA 4NM4L 3WUZA 2D7MA 3DO7A 4ERSH 1ZHKB 1EEZB 3QUMA 1UA6H 3VD9A 2PUQT 5BW7C 1UM6H 3DUSA 5EFIA 2DICA 4L9DA 4X7DC 2AV7B 2AV1B 4OCSL 4ONGL 5GSRB 4NQUA 4YK4C 4F7EB 5JW4Q 4WFFE 1T5XA 1D9KA 3FHQA 1CS6A 3WL9B 5CJQH 1N7ML 4NZDA 4P46A 5GZOC 4KQ4H 1XGRB 4NO0B 5EIQA 4CN4A 4YIQB 1D5ZB 1YEHH 4KROD 2A74A 4HWUA 1CE1H 1U91B 5E9DD 4YWGH 2IBGA 4RCAA 5AYUL 4TQEH 2AXGA 3U82B 1X5GA 4BELD 2NZ9C 4ZO7A 1UEMA 4I2XB 5F96H 1I8KA 2VXSL 2ATKA 1HSAB 2PYEA 5F3BA 1ZA6B 4K9EL 4MNGB 4BSWB 5BZWB 5IFAH 4LP5A 1I8MB 2Y6SD 5C09E 2RFXB 5C8JB 4LU5L 2GKIA 1HHIB 3T65A 3D0VB 3ECBB 3PUCA 5TFSL 4PREB 5HGBB 2UVFA 3L5HA 1KELL 3O6FA 4CDHA 2XZAL 4XP6L 3OL2A 1BIHA 2YD1A 3PHQA 4XP1L 3IXTB 4H1LH 2DQHH 4UT9L 4KY1L 4YPJA 3W39A 3BRFA 3UDWC 4MJID 4BUHA 2GITA 3BDXA 4DOHB 4ALAH 4PG2A 4AL8L 4OF7A 1Q9KA 5E8DL 3MOBH 4IDJL 4LCCA 5CWSB 5E2VH 2HJLA 4WEMB 4WUUD 1G7MB 4CJ1A 4NP4L 1QACA 2PW2B 1RURH 4XBPA 2VE6A 2IMMA 3KYMA 4Y2DA 5ESVB 2NY3B 5ACZB 4QRPB 1Q94B 1FG2A 1NGPH 4PJBE 4P2QD 4U1NA 3UAJD 2HWZH 1KLUB 3EOAB 3X13B 3KPTA 1P7QA 1ZHLA 2DLHA 2FIKB 3KPRE 4R2GD 1RZFL 3H7BA 5D2LE 1G7JA 4WTZG 4G3YH 3MLTB 2YHGA 5DHXB 1KPRA 5JXAH 5HHNB 3CVHA 1MCCA 3RKDD 1NDGB 2YD8A 4HWZB 4JCLA 1Z6JT 4WHTA 3MA7A 4JB9H 1CT8A 4HDIB 1VGEL 4PGBB 4OSUH 3HRZA 4UUJB 4AM0A 1AR1C 3FMGH 1ZVHA 3HCVB 2FSEB 1JF1A 4DVBA 2CXKA 5AZ2H 3CC5A 3QDGB 4PRAB 2F54A 5SX4I 3W81A 4XC3H 2WQ8A 3KPSA 3QIBA 1A7OL 3EDFA 1A64A 1YJDC 1UKQA 2RJMA 4JKLA 2X9XA 2WLYA 4P0DA 5D7SL 3LN9A 2DMCA 3SY0B 3P3YA 3EJZD 1HINL 5CEXB 3E3QE 3PQYB 5LAXB 5BZDB 4GAGH 1MLBB 1JWMA 2F5BH 3MXWH 2BNRB 3OJDB 3NIFE 1PW3A 4ERSL 3D0LB 2NX5E 4PTTA 5FHBH 1FNGA 2BOCB 1NFDF 1T3FA 2ESVA 3P2TA 4QHNB 3SKJH 4OGXH 1K4DA 1KENH 4MAYA 3JVGC 4YHYC 4M8QB 3T0AA 1AY1L 1KB9K 4JFFD 4XCCL 2A9MH 4Q0XH 2X42A 3VFVA 2XN9E 3UYRH 5EO1A 1MCJA 2D4DA 3QDMA 5IP4A 1ZWIA 4Y5VA 4KQ4L 3ARGC 4DK3A 1CE1L 1U2HA 4M02A 4YWGL 4TQEL 2BVTA 5DVOA 4TVPL 4LEXL 2WWMD 4NJ9H 3TA3A 1NCNA 4POZD 1ZLWH 1FO0B 3CU7A 5F96L 1Y6MR 3FT4A 1G84A 1A9BA 3SKMB 1BBDL 1M7DB 3VGAB 5F7HA 4HKBB 2VZVA 4RQQA 4NQDD 4MAUH 3FB7A 3U9UA 2BC4A 2UWEB 3ARYA 3OR6A 1MPAH 1RHHA 4X4YB 1BM3H 1KULA 2V7NA 3L7EA 4AG4H 1FVDA 2EDRA 5C0AB 1M71A 3TO4C 4XXDA 1EVTC 4ZUUA 1J8HB 4I0KA 4ODSL 3KR3H 4NQVA 2C26A 1WC7B 4FABH 4OLZH 3MJ7B 4Y5YB 3CFEA 2DQHL 4LDLB 3QQ9D 2AEPH 4OD3H 2PO6C 2NY5H 5C3LD 4RGND 1IGFH 1X6NA 1YEIL 4U1LB 4ALAL 4OCYH 3D39A 4X6CB 1ZGLA 1U3HB 3TVMA 3I84A 3UX9B 3FT3B 3DV4B 1LP9E 1NANH 3BQUD 1RURL 2B5IC 1MFDH 5CBEA 3MLRL 3QWRD 2X1PA 1IARB 3R06B 5CUSH 5IB1A 1CGUA 1WUNT 2R29H 2W0FA 5FHAH 3MODH 1S7TB 2X4UB 3KS0J 5DMIH 4W81A 1J05A 1JNLH 5I1LB 4RFOH 5C0GA 1UWXK 1FP5A 1N59A 1YC7A 2J4WH 4JFOB 3KDMB 3C2AL 4E0RB 4G3YL 4FFZH 4WW1A 5AZEL 4RX4D 5DXWA 3RL1A 4E5XB 2HVKA 3JUYA 3S4SB 4P4RB 4PRIB 5JXAL 3NA9H 2FZ3A 4YHMH 5J0BA 1EV2E 2ZG3A 1WBZA 3O3BB 3JZ7A 3OG6B 3V5HA 4CNIA 1JGLL 2UUDH 3AREC 4OSUL 1SYVB 3MUY1 4G8FB 3NAAL 1IBGH 3VXNA 3G6JE 2WW8A 2R2CA 3MMEA 1NCCH 5MERA 3DX7B 1KCVL 3HG1D 4KDVA 4R26H 4GRLC 4G43A 5ANMB 5EBLB 3CUPB 4GRWE 2FJHA 4PJFA 3MV9E 2X4RA 4LCWA 4JG0L 4YPGB 4JFED 3C5JA 3GSNB 4XPBL 5IEKA 4WNQB 3TO2A 4FG6C 5LQBH 1OAUH 2BVOA 2MHAB 5L0QB 5DA0B 2AV7A 2F5BL 3MXWL 4QGTA 5A3IC 5SWQB 1A8JH 2EDHA 2EH8H 4C4KT 4XWOD 5FHBL 4G5ZL 4S1QL 3AUVA 1CTNA 2VZUA 4LPXA 1KENL 4NO0A 5DJ0A 1S7QB 5IG7A 1AP2B 3IB4A 1AR2A 1ULVA 4I0PA 4WJ5A 5HHOD 1LE9B 4U1GB 2A9ML 4JPIA 3EFFA 3WIFB 3G5YA 4HC1L 2VIRB 5D1QA 3L1OH 4FQXD 3SO3B 1W8NA 2J88H 3UTQA 5I19L 5E08H 4DW2L 5TH2B 3ZKQD 2AAVA 4BSWA 1M6OA 1W72L 1NKRA 2ARJB 1JGDB 3RGVC 1H15B 3MLZH 3SCMA 5DJCA 3HMXH 4F15B 1WTLA 3QT2A 5HGBA 1RUKL 5F7WC 2FRGP 1I9JH 4HS6A 5DFWH 5JPMB 3D25B 1QEWA 4OQTH 3A67H 1T6WA 2Y4SA 2JELL 1Z9OA 2A2QT 5ETUA 2DLFL 5L7XH 4P57B 3KGRA 5GZOD 5F7YC 4WUUA 2CR6A 2E7LC 4MAUL 5T1KD 5HGDB 3NIFF 1JYVA 5FO7B 2FX8H 1MPAL 1QNZL 4O02H 4O9HH 1BM3L 2PW1B 2KDGA 2NZ9D 4AG4L 1B6UA 3ARFC 4TUJA 4QHLB 2ERJC 4P2QA 4P5TC 1G7MA 1I85C 5F9OH 4BSVA 4AIZB 3P9LB 4MDJB 4FABL 1LEGB 4OLWL 4PRPD 3DBXB 1NMBH 4OLZL 5ESVA 3WXVL 2BVQA 1AH1A 1RPQA 1KCKA 1I1AC 3L5XL 2BXYA 4XH2B 5SX4H 4HUUB 2DJSA 3TBVA 2C1OB 3VJ6B 5TF1H 3AMKA 4PJAE 4FNLL 1KLUA 5IJVA 1FORH 1UWEH 1SM3L 5DR5H 1MFDL 2FIKA 3P30H 5GQBA 3KWWB 5HHVL 5SV3A 2BDNH 2AK4D 4DGYH 2BZDA 3HI1B 4HPOH 4KGLA 5DMIL 1QSFB 3ROOA 2EXWD 3DSNA 4PGBA 5ESAB 2MNUA 4IMKC 5IKCB 2R1WB 3PABA 2FSEA 3QWOB 5C07E 1FE8H 4WI4A 3ARTA 1KACB 1WJ3A 3GBNH 3QDGA 3L3JB 4QY8A 5I8EA 3M8OH 3BN3B 4S2SA 4GH7B 4ZQKA 3WJLC 1VEMA 1QLFA 3WDIA 1JV5B 4JREC 1IBGL 3T4AB 3SY0A 5CZXC 4NRYA 5IW1B 5CEXA 3PQYA 5BZDA 1CXHA 2UYLA 3BN9D 3MRBA 2BNRA 2DQTH 2R9HC 4XTRC 2VUYA 5I17A 2VQ1A 1SQ2N 3FJTA 3D0LA 2GJ6D 1QQDA 3BESR 1EH9A 3MLUH 4QHNA 1FFNB 4QOKB 1OAUL 5KSBF 2DQIH 3SGJC 4R4FL 5C0DB 1P84J 2EDFA 2J8HA 3QIWA 4P2OA 1HQ4A 2BCKA 4M93B 3VGGA 1D3CA 2EH8L 2X4SA 1KTLB 4GRMA 5B8CA 2F5AH 2J6EH 1XIWB 4LLAA 4KTYA 4RMRA 3ZT6A 3NN8A 1TZGL 5C0CE 1TNNA 4NQDA 4OIAA 2DM7A 1DCLA 3SE8L 5GS1B 3L1OL 2J88L 3UZQA 3G6JF 5E08L 1ITBB 5IIEA 4ZFZA 1M7DA 4XHJC 8FABA 4M5YH 1TITA 2VXVH 2UWEA 5KVDH 1WBYA 4RFNB 1HOCB 1I9JL 1QHOA 4LVHB 3UTSD 3IDYC 4OQTL 1R24B 2QKIB 1S8DB 1X5KA 4RZCA 5C6TH 3SDAC 2AABL 1WC7A 1QA9A 3HC4H 3ARGD 2FDBP 4U6HA 4G7VH 2FX8L 5F6HJ 4O02L 4ZDHA 1FFPB 4X6CA 1H0DB 3H0TB 4UOJA 1U8JB 1BVKB 3FN0H 1OD9A 5I1KL 5DMKB 5D7JC 4LSRH 1T89A 2D7NA 2V2WA 3VXRB 4Y16D 4O2CB 1MJUL 1X9QA 1NMBL 3GMPB 4FP8H 4IMLB 4XAKD 3HNTL 1YMMB 4J3VA 5JIIA 1JHLL 3OR7B 1ND0B 1W0WA 1WVZA 4IJ3B 2B20A 4JM2C 3VXSD 5AWNH 5TF1L 4Z76B 1B0RB 3VGEA 3HMWH 4L1DA 1EUTA 4PRBB 3TO4D 1S7TA 3B2VL 5TQ0H 3HUJB 5T3ZE 1AQKL 1FORL 4CJ0A 1UWEL 2BNQE 2P5WB 3GNML 5DR5L 4KJWC 5H8DA 5HGAA 3NCJH 2ZJSL 1IAKB 4D0BB 4PJ5A 2PO6D 3OPZL 3QCTH 3GJFA 2Y1VA 3S4SA 4P4RA 4DGYL 4KC3B 1WFUA 3HG1A 1MJJB 3F7YA 5FYJE 4PJCB 2ADGB 3JV6A 1IAOB 5I74B 1MCWM 4TRPH 4YR6A 2QQNH 3U0TA 1R6VA 2IANA 1MEXL 2V2TB 3VFSB 5KZCB 1FE8L 3ARVA 3LZFL 1OQOA 4OF8A 3GBNL 3X12A 3TYFB 2A6KA 4KJYB 3KG5A 2GK0A 3IJYA 5FYKE 2NNAB 2H3NB 3IDGB 3E6FB 3MV7A 5MENA 4AT6A 4H8WC 4OZGE 4NUJA 2F9BT 4YPGA 1JNHB 4QWWC 1F6AB 2DWEB 1E4XH 4NDMB 4RWHA 1IVLA 2DQTL 2XG4A 5ESQA 5HHOA 2CDGA 3KYKH 4JQVC 4OGZA 4XRCB 3UTZB 5D1XC 3ARED 3EGSB 1CD0A 4BQ6A 1MJ7L 3MLUL 4N5EC 4N90D 2L4OA 5ITFB 1AO7D 2DQIL 4NO5B 2FIRT 1IGJB 1AP2A 3B6SB 1CLCA 2XFXB 1ETZA 1LE9A 3QG6B 4BQ9A 4GRLD 4HWBH 3PXJA 5DD6B 1AGBB 3U1SL 3WIFA 3I85A 3BPOB 3ULUC 3TZVB 1J0IA 2X4QA 1FGNL 5TH2A 2F5AL 2J6EL 1FSKC 2B4CC 4FG6D 3P77B 4L8BB 2ARJA 1O5DT 1JGDA 1OLLA 4I77L 2FHBA 3VXPA 1AHWC 2FATH 4MWFB 1WFTA 1T20B 4M5ZH 3MNWB 1DUYA 3QXTA 1I7RA 4ZAKB 3A6CH 1EFXB 1BD2D 2GEEA 3MROA 4NCC1 4NQCB 4KJQD 3N85L 4PGDA 1CGXA 3OX8B 3BPCB 4P57A 3VWKD 3SQOH 3VRLE 4H1LB 5J1AA 5C70A 6FABH 1BQHA 4M5YL 4X6BB 5E9DE 2VXVL 4H5SB 4PRPA 3VXUB 1KB5H 3BMVA 5F1KC 2PW1A 3WS3A 3LS4L 4LAQH 4W4NA 4PS4H 4ELMA 2VR5A 1V7NH 2EZ0D 1QBMH 3OWEA 1XGTA 5C6TL 1FIEA 2F53B 1VACB 2HJKA 4JKKA 2VITA 5JORB 3RGVD 4U1SB 3DBXA 1LWRA 4NKOA 2CQVA 1OF2B 3GK8H 4JE4B 3IS0X 4XH2A 3QR2A 4HUUA 4APQC 1OAXH 3PWPD 1Q1JH 3CFJB 4H20H 3VJ6A 3FO9A 3M07A 3SHSA 2FGZA 3FN0L 3C2SA 2JCCE 4ZFFB 5FK9B 5IROC 2CLVA 1K8IA 2QQKH 1LE5B 2YWZA 4K7FB 3KWWA 4FP8L 4MJIE 4YHOH 4HWEH 2EC8A 3S35X 4U7SA 3BWAA 5FCSH 1YQVH 3ARFD 5AWNL 4Z0BH 3QYCA 1DQQB 4FQCH 2XZQH 4W6XB 5TQ0L 1QSFA 4YFDB 4MLSA 2YD2A 2JLLA 5ESAA 2DKUA 3MRRB 4PIRF 5FCUH 3KPOB 3BPLB 4MXVE 1YEFH 1BGXH 3QCTL 1TPXC 3VD3A 1PKQA 1FRGH 3MRNB 2NW2B 4GG6A 2Y07H 2C4XA 5MI0B 1N26A 5CAYB 1RZGB 4OFDA 3KPNA 1K3ZA 3M1BB 5FYLE 1JV5A 2GJ6A 2QQNL 3WFHA 1KLFA 3H8NA 1UCTA 3RDTB 5D7LE 1CE6A 1KJ3L 1QO3B 5IW1A 2EO9A 2AJZA 3FFCB 3MOAH 4NQSA 3O2DA 4EI5B 4NBZB 1IKFH 4F9PC 1W0YT 1FFNA 4QOKA 1E4XL 2VAAB 2OQJB 2NY3C 2FNBA 5C0DA 2P44B 5F71A 4OZHE 3RI5K 2FBJH 2GW5A 3KYKL 3EJJX 1FH5H 4L8DB 4ENEC 3FRUB 1MJ8H 2GUOA 3HI5H 5D70L 4X0KB 3NH7H 2NLJB 3N1FC 4HSQA 4ZUWA 3GB7A 3UTPE 2HT2C 5GJTH 3ULVL 3JVGA 4LPVA 4RMVA 3OAUH 3UPRB 2IBZY 2X70B 4XTRD 1DLFH 3T2OA 3MV01 1AGCA 2IAMD 1I1CA 1UH3A 3UTSA 1AKJB 5EBMB 5F6HI 4JO2H 4G42A 3CXHJ 3O41B 2LAAA 2YMXH 5CEZH 1NQBA 4P5MB 2FATL 3D2UB 4PJDB 1PKOA 2AI0H 1KJVB 4OZGF 1PG7H 3A6CL 1RU9L 2K7PA 1MRFH 4N9OB 2BMKA 4HT1L 5DQDH 1U8PA 5C1MB 2QKIA 4Y2OA 4TYUA 6FABL 4P3DA 4HCRH 4YDLB 2Y06H 1FNSH 2V5MA 3D18A 4V1DE 4PJIA 1H0DA 4LAQL 4OKVB 4PS4L 4Z7VF 4L5FL 1U8JA 3IXAB 1V7NL 4LKXB 3LV3A 2APBA 3HZVB 4JFDA 5FGRA 3MRCB 4D9LL 4XHJD 4HIJB 3MJ8B 3RX8A 1F4XH 2EICA 2C3WA 2BSRA 1II4E 3FT2A 1ZVSB 2LABA 2FLRT 1OAXL 3RA7H 1Q1JL 4H20L 3E2HC 4DUWA 1B0RA 1BEYH 4PRBA 2VO5A 1VEOA 1CXLA 4HZLB 3UTTB 1FZKB 2D0GA 2KZ1B 3SDAD 4OGYH 3L3KB 5D8JH 1OCWH 2P5WA 2QQKL 4U6TA 1BIIB 1MIMH 5DUBA 4D0BA 5C71A 1F42A 4JLRA 2CUIA 2W0KA 2BY2A 1YQVL 3AS1A 3VRLF 4AQ1B 4Z0BL 1WZMA 4FQCL 5I9QC 2DKSA 3QO0B 2QSVA 5D7JD 1CN4A 3SKNA 4NKMA 3FB5A 1AGFB 4YEFA 3QIUC 3D69B 3PHOA 1TQBB 4UIMB 1FYTD 4QHKJ 1YEFL 3TPUA 4OB5L 4M62H 3TYFA 4JM2D 7FABH 4R7DA 4DEPC 5EZJB 1RZ8A 3SGDI 4NT6B 2H3NA 2JB6A 3C6SA 3E6FA 3V52H 2DBJA 1BX2B 1JUFA 3TPKA 3FAXA 4NKQB 4YC2C 4Z7QE 3ULVC 3T3PF 2NXYD 3RNKB 5E24E 2R2EB 2DWEA 2R1XA 3VD5A 3NMEA 3RWGB 5DJZB 3C9NA 1QVOB 2JCCF 5IMMA 1N0XH 3X3GL 3MOAL 1YUHA 3KJ6L 1ORQB 4HW6A 1MNUH 4GRLA 1TVHA 1U3HC 2P4AB 4X7CC 4XRCA 2EEBA 5EOCJ 4BZ1L 2XKSA 5AUMA 5F7NC 5GGUA 1J18A 1FNAA 4M7KH 3U4EA 2DL9A 4EOWH 1T4KB 2PYFB 4MJ6B 2BSSB 4Y4FB 5EU7C 5F9WB 1QSEB 5FO9A 4HKZB 4O58H 2N7BA 1FH5L 1BD2A 4JFEE 1AD0B 4M1DL 3U2SA 4BH7B 4MXVF 2HVJA 2NY2B 4FXGA 3SE3C 2P5EA 3P77A 3BZ4B 4L8BA 3BO8A 4QWWD 5I0DA 3QDAA 3QUZD 3NH7L 4BFEA 5GGSA 4L8CA 4UT7L 5GJTL 2QADD 1HHJB 3NFSH 2Q20A 4NC1C 4LSDA 5B3NA 3WSQL 1DLFL 1FGVH 1L7TL 4GMTH 4YDKH 1T0NB 4I9WD 4ETYA 3MJ9H 5D1XD 1KGCE 3HB3D 2BVYA 4N5ED 3OX8A 5DQJA 3BPCA 3WNLA 1A6TB 2R56H 3ZDYE 3WUWA 1OPGH 3G6AA 4OGAD 5CEZL 2VABA 4WW2F 1H3GA 2YA0A 1FNHA 2AI0L 1T7VA 4H5SA 5HYJA 1OP5K 3DX6A 1PG7L 3V7AG 5IHBA 4LFHG 4DAGL 5DURD 3JWDC 3PWPA 2ICEB 4U31A 5DQDL 4NZRH 4KH2A 2F53A 3V5DB 1HDMB 2ADJB 4OZHF 3WO4B 3SKUD 4S1RH 1SEBB 1MCSA 1W2KT 3F58L 2E7LA 4HCRL 4Q7DA 2Y06L 1Z5LB 1VHPA 1FNSL 2NPLX 5L0QC 2CKBH 4TNVK 3CFJA 4WWKC 3U7WH 5J6HA 3CPLA 4JVUA 1F6FB 2NY1B 2HTKC 3HLAB 1FFOB 4P5TA 1U58B 2JB5L 1LE5A 1HI6B 1I85A 4PRHE 2Q7YB 3TBTB 4X80L 3FZUC 2R15A 3BHBB 3V4UL 3O6KL 1F90L 1F4YL 3VFMB 1I1AA 2VZ1A 2YPLD 4U1GC 4QHUA 1S7RA 3PHSA 1CWVA 4MQTB 4ZUSA 3SO3C 1G7QB 4OGYL 4P4KA 3MRRA 4YBHA 3GRWH 3ELAT 2DAVA 3BE1H 3DV6B 3KPOA 3SJVB 3LKRB 5DT1L 1K85A 4ZNEE 1MHPL 4APQD 3GGWB 1Z0NA 1EEQA 3MRNA 4PJ7A 4H0GA 2LFGA 3V79C 1GOGA 3EO9H 3RWHA 1SJEA 1RFDL 4JZNB 1T83C 5FYLH 2EEDA 4QRQB 3TJHD 3RDTA 1VA9A 4LK4A 1QO3A 1T80A 4M62L 2E9JA 7FABL 4A6YH 3BKJL 3FFCA 1TJGH 5H35B 1PY9A 3V52L 5HI5D 3F6LA 2XNAA 5T1MB 1WEJL 1NGZB 5F97E 4KUCD 5LXGH 1FN4A 2OR8A 2JIXB 1E4WH 4CAGA 2BFVH 4OF5A 1I3GL 1N0XL 4HC1A 4YAQB 5DD5H 3SE9H 4Z7WB 1MNUL 1VADB 4P3CL 2X89D 2V2XB 4U3CA 3L9RA 1KFAH 1W72A 1RMFH 2P1YA 1UC6A 5FF6B 4U1MB 5KVGH 5SWSB 4M7KL 4X0KA 5I2IB 4UMGA 5DA4A 3SDXA 4EOWL 1MH5B 5GHWL 3SGJA 3CFKA 4ZFGH 4PJEE 3D3VA 1MVUB 1W8OA 2FL5B 4GKSA 4QYOA 2FJGB 1H3UA 3S88H 3QZWB 4R4BB 1U8MB 1DBBL 4KMLB 4Z7UB 2EDJA 4K7PH 3QUXB 1J1OL 3EOBB 3D1MC 5ICZB 3NZ8B 3MCKA 3O6LL 4EIGB 4EDXB 4HHAA 1TTUA 4PJDA 2NY3D 1KJVA 4Y19B 4QRPD 5DJ6B 4Z7QF 3DVGB 1RZ7L 4LLVB 5E2TH 1FGVL 1CDUA 4YDKL 1BJ8A 5CFHA 1U8NB 5JDSA 4QRUA 4ENED 5BOPA 4UDTA 5C0FB 4JZJC 4OFVA 4WFHE 4G9FE 1K3IA 4AEFA 2HT2D 2VDRH 2HLFC 2OR9H 3V0AC 1R5IA 4MSWB 2X4PA 2IBZX 3MGAA 2VN7A 5DJDA 5E8NB 3IXAA 3GMMB 3MSPA 3ARXA 1NGWB 4OM1H 2DTMH 3MRCA 4IRSC 4J4PA 5DJ8A 3QUYC 1A6UH 3SDAA 4S1RL 1UACH 3ALXA 5EN2B 4P49A 3LEXA 1ZVSA 43CAA 1G7IB 5KSBB 4LCYA 5C92A 4QTIH 3SDDB 4GUPA 3FRPA 4KRPB 5DK3A 3U7WL 4U6YA 5GPRA 4HZLA 3UTTA 4QHKI 1R5VA 3ZDXE 4M93C 3L3KA 5IHZB 5D71L 1XIWC 1BIIA 3HPJB 3C60C 4XCNA 4C56A 1FYTA 2VXUH 1M7IB 3OQ3B 4B53A 5ID0A 4X6DA 4PY7B 3ZDYF 3GMOA 4HUVB 5DF0A 1UJ3B 1MF2H 3QO0A 5CJ8A 2CIIA 5GS1C 4LPTA 4RGOL 5A2FA 3QULB 2EECA 1BOGB 3BE1L 3H9SA 4YHZL 1OLZA 5JXEC 1LO2L 1S7XB 2NY0C 1CFQB 4JDZA 1JPFA 4N8VG 5EZJA 4D3CH 3VXQB 2ZOKA 2L0DA 2VLKB 5GGTH 3BXNB 4PRNA 5GRWA 2W91A 5F21B 1WTGT 3BZDA 3OKLB 5GS0H 5IT2L 1YEKH 3RWGA 3W0WB 5F7DB 4NCDA 3IYLW 1KTDA 1YNKL 3RGHA 3KLHC 1PSKL 4WI8A 4A6YL 1NAKH 4I3RH 4NHUB 4XCYA 4IOFD 1FBIH 1S9WB 4JN2B 4WI7A 5LXGL 3TNNB 3MO1B 3K7UA 3CFBA 4LNRA 5I6XC 4NKDA 5KSAB 1E4WL 2J8UB 2PYFA 5F44A 4PYGA 4F8TA 4MJ6A 1T7YA 5H94B 3SE9L 3Q6FB 3K2MC 4IJ3C 5GISH 5DJAA 1AC6A 2XWBB 4M6OH 1NAML 1BFOA 4GBXA 5C0AD 4ZODA 5JW4N 1KFAL 4F37K 1J8HD 5L8LB 4L9LC 2MQCA 2XIDA 2ITCB 3LEVL 3MUZ1 3OAYK 3QISA 1ACZA 1H3VA 1C12B 2JKXA 1HHJA 2WBKA 1X5LA 3HRPA 4ZFGL 5BRZB 2H26B 1U3HD 1M05A 2JJSC 4TOYH 3S96A 5I1IL 3S88L 3NCBB 2YD6A 2UV3A 5DS8A 1LK3H 1AO7E 2DYPB 1A6TA 3GKZA 4YFLI 4LHUG 4MQ7A 3JUZA 3KPMA 3L6FA 1P2CA 3GJEA 4ONHB 5IJKC 2R0WH 4ZTPL 4LSSH 1AHWA 3K1KC 5ICXB 2XT1B 3H3BC 3MCLH 4GKNB 2ICEA 5LGHH 4BJLA 2A6JB 1MCPH 1IGMH 1MCDA 3PL6B 2KUTA 4HJ0C 1JTTA 3FQNA 4CVWA 4ZS6C 2ADJA 5JQ6H 4OCRH 1DVFC 4WI9A 3S5LG 1BJ1H 3UJJL 1LVEA 5K9JH 3RTQB 2VDRL 4RNRA 3ESVF 3IJHA 3ARBC 4JY6B 4M43H 1HHKB 4U6VH 4MMXC 1UB6A 2IQ9H 4PRID 1QP1A 3GSVA 3MLWH 3QEUB 5GGRB 1IKNA 3QNZA 3HZYA 4K55A 3MPCA 4JQIH 4PBXA 2HFTA 1KG0B 4PJEF 1UACL 2DIBA 3OTTA 5H2BB 3TBTA 3DRTA 4CL7A 1K2DA 3BKCH 3GSRA 4MA3B 4OLYH 2ZUQC 1FZOB 3VFMA 1CK0H 1FL3B 1OARH 1GC1C 1I1FB 4APQA 3W11C 2B1AH 4FQLH 3K4ZA 1IL1B 1P84K 3QHTC 1C7TA 1RZJC 5IROA 3RIAK 2E7MA 3QI9B 3UBXG 4D2NA 4CGTA 3SJVA 2R2HB 1E4JA 1U95A 1AXSB 2VJXA 3BT2H 4FXLA 4WHYH 3T0EE 3ZSSA 2VXUL 1SHMA 4FTVD 2QEJA 1I3UA 4MJ2A 3MRPA 4JFQB 4WWKD 4GLRI 4P23C 5JR1H 4I48B 2YC1B 1S9VB 2WMPA 2EDLA 4GW1B 1MF2L 2HTKD 1IC4L 3RIFK 4Y88A 1EAPB 1S5HB 3G08B 4W70A 4WI3A 2QHRH 3EO0A 5FDWA 4M1GL 3MRJA 4QRQA 4UU9A 3FZUD 4IHOA 5DQ9A 3HE6C 4WDIB 2ZUSA 1CFNA 3C8KA 5T3XD 4D3CL 4OZIA 3STZB 1LO4L 5FUZH 2VDML 3BGMA 2IPUG 1I8IB 4Z0XA 1OTTD 2OS7A 1WF5A 3O45A 4JM4H 5T1MA 1F4WL 2VISB 1NGZA 1UH2A 4KKNA 3VXMB 3CSBA 1BBJB 5GS0L 3VFTA 2LTQB 2VDOL 4XX1E 1QFWI 3N1PC 2C7UB 2JIXA 1J86A 5JHDD 5EU6D 1WCQA 3ZDXF 1NAKL 4I3RL 1ADQH 2IG2H 2OI9C 1J0YA 2ICCA 3DIFA 2VXQH 12E8H 1OGAD 4NPYA 1FBIL 2VDQH 4UT6H 4MYWB 2P48B 3T1FA 4F9PA 5I2IA 1DEDA 1J1PH 1E28B 4BA8A 3QQNA 2QL1A 4K8RL 3JV0A 4Y7MA 5EUKB 2V9TA 2EC9T 3C08H 3WS6C 2FCBA 5GISL 4JHWH 4JQXA 2ZUYA 4NO2B 5IUSA 2PYEE 4M61A 2VDLH 2FH6A 4ZTOL 2MTPA 1OWRM 1KXTB 1S7WB 3BDBA 3QZWA 4LKCB 4R4BA 5EZLA 2CLZB 4FQIL 2MCG1 5ITBH 3QUXA 1GGIL 3NZ8A 1GGUA 3G5VA 2KH2B 1CGWA 4KTEL 4X4MA 4LLVA 3VDBA 1VCAA 2ZSWA 3QPQC 4QRRB 4TOYL 1BFSA 3TBWA 3V6OC 1LK3L 1NCDH 5HJ3A 1HXYB 4QKXB 4Y1AB 2R0WL 4JFXB 2DQUL 1ZT7B 5E56A 3L3HA 4CVXA 3I3BA 4MSWA 4YE4H 3TESA 5E00B 3K8LA 5FM5O 5LGHL 5J06A 2K3TA 1MCPL 1IGML 1A5FL 2XYCA 4J1UA 3QA3A 3LEYH 3GZKA 4L4TB 2E8YA 4N8VB 5JQ6L 4OCRL 2A73B 3ROLB 2IQAA 4X6FB 5K9JL 4PB9L 5EOCH 2ZCLH 1GHFH 4LPWA 4U6VL 3SDDA 1Z9SA 1AJ7L 4G7YH 5JPNB 1IJ9A 3OB0K 4HXBH 3HZKB 3MLWL 4PFEA 2ZCKH 5IK3A 4O2EB 3QP3A 3S34L 3VFRB 4JKMA 4PJGE 1IQWL 1MCOH 5AYQA 1XGQA 5F89B 1EGJA 2AJYH 3BH9B 3VWJB 4UAOB 5ADPH 1QFUH 1MI5E 4PY7A 3O4LA 3BW9B 4PP1C 2B1AL 3G9VA 2FEEI 5IMLB 1DDHA 4FQLL 2SEBB 1OHQA 2AJXH 2X05A 5L2KA 2D31A 3QULA 3BT2L 1S7XA 3PGDB 2F54E 3C5SA 3IDIA 1CFQA 4E41B 3SQBA 1ACYH 1FVCA 5JR1L 4XBGB 1YN7B 1MAJA 1RIUH 3WFBL 4HFWB 3JWOL 4J6RL 4M48L 3E1F1 3ZTJH 2P49B 3HA0A 1XIWD 1MLCA 3OKLA 3QIUA 1OT2A 4ZUVB 4F8QA 1K5NB 1A1MA 2NY5C 1XF2B 1F3JB 1AIFB 1MCQA 2DI9A 4YDLC 1IM9D 4HXAH 1GOFA 1SY6L 4LLQA 2A6IB 4OV5B 2OMBA 4YBQC 1MAKA 1L7IH 4JGUA 1QLRB 5J6GB 1ZLWK 5JA9A 4Z7VB 2ESVE 1AGEA 3UPAA 3VXTA 1CD9B 2X09A 4W4OC 3MO1A 1G7LA 3MZTA 4N0UB 5KSAA 2H9GB 1DQMH 1FC1A 5L9DH 1E4KC 2IG2L 3Q6FA 2VXQL 12E8L 4N1CA 1BWWA 3S5LB 1G6RL 2VDQL 3H2WA 5I73B 4GW4B 4ELKA 1P4IL 3ZKMC 1G0YR 1J1PL 3KYNA 2HRPL 4JPWL 3V8OA 3B9KC 1S7VA 3KLHD 4X7FC 2PCPB 3BJLA 4PR5B 3BKMH 4MCZA 5GS2D 4JHWL 3L3DB 1HKFA 2VAJA 5IVNA 2VDLL 4CMMA 2ZPKL 4M6NL 1EJOH 2DYPA 2K9UA 3VXRD 2I07B 5HDOA 3O9WB 4KUZL 5ICXA 4AIOA 1YMMD 15C8L 3FAWA 1TVBA 2FYYA 4OFYD 1GYAA 3RQ3A 1A7NH 5D7IB 2D0HA 4XWGH 5ABDE 1GCFA 1IGYB 3RWEA 2O26U 2V5TA 4PTUB 1K8DA 3OXSB 1YPZB 3IDJA 4HEPG 1QR4A 3D39E 4XVSH 3O6MH 1HZHL 4X5WA 4JY6A 1HHKA 4I9WE 1URLA 2XA8H 5EB9A 3BRGC 1Q9OB 3GBML 3IFNL 1RZKH 3CU1A 3HAEA 3LEYL 3LKQB 1KG0A 3ARQA 4EQ3A 2G2RB 4F3FA 2XWJB 2DJ4A 5EOCL 2ZCLL 1GHFL 5KZCD 1JFQL 4DUVA 4AH2A 1N2RB 1P7KA 3RZCB 2X7LA 4FQQB 4G7YL 4FTVA 2AQ3A 3HR5B 4WWKA 3TV3H 3EW3B 4HJ0D 1QUNA 2ZCKL 3CDCA 1IL1A 1XMWA 4H26B 1PX3A 2CUMA 4ZS6D 4HJGB 3KPPB 1MCOL 3QDJA 1DVFD 4U1HB 3LQAH 5CP7B 1OP9A 2NTSP 1QFWH 2YPKA 3ARBD 5ADPL 2QSTA 3PWJB 1FPTH 2YC1A 2B2XL 4ISVB 2OL3H 1A2YB 1P7HL 3KHOA 3D9AH 1PEZA 1CD1B 2CMRL 4DFHA 2CK0L 3ALPA 3QEQB 4A6YB 2YSSB 5JW3H 1N4XH 2YPLE 4WDIA 1WISA 2WBJB 5B3JE 3W11D 4CADB 4X9FA 2OJZH 1V05A 4RMUA 4Q2ZA 2V7HB 3QUMH 4XB7A 5C0BA 2VISA 2AEIT 1G9MC 3WDJA 4GW5A 1K4CB 5TDOB 1BBJA 4MHHG 5AD0B 1KEMH 1RZIB 1HCVA 4KKBC 4LLDB 3QFDB 2EEAA 2C7UA 1UFUA 3C5ZB 4YXLL 5JUEH 2JK5B 4ZAKD 4LSPL 1NAMB 4RAVB 4WHYG 3TT3L 3V6ZA 1L7IL 4NQCD 2HJFB 4XNMB 4PGEB 3KNBA 1NEZG 3GSWB 5IF0B 1P9MC 1QRKA 5FAAA 1WCBB 1T1WA 2VMFA 3CCHB 5CLWA 4HUXA 4X7EC 2Q6WB 3PJSB 4NZTL 5EUKA 3BMWA 3HE6D 4EZMA 1T2QL 5T1LB 4N1EA 5BO1H 5L9DL 4QRSB 4R0LC 1GGCL 4J3TA 3JTTB 3TEUA 2GSIB 4I2XE 1NCAH 4JFZH 4JJ5B 4NO2A 3BGFB 4NN5C 4B7IA 3G04A 5DK0B 2I60H 4MNGE 2OTPA 2LAGB 3PDDA 1CICC 3LRGA 3F65A 4HIEB 3AGVA 5FOBA 5FGBC 2VLJD 3C8DA 1H8OA 5ISZD 3DO3A 2ZOLA 4CVUA 1VFAB 3T77B 5JW5B 5CLTA 1U2CA 1WZKA 3DETC 4CVZA 1DBMH 3FQXB 1EJOL 1R3IL 1CU4H 4K71B 1LK2B 3T2QA 1KJMA 3OMZA 1RUAH 5KVEL 5GGRY 5IMOB 4OCXL 4XPFH 4TTDD 4ZSOB 1D6VH 4KKLC 4HGWA 4DOHE 4MNQB 4AIXA 4Q6IC 3WIIL 4ETQB 4OUOA 5C7XH 5DMGC 4YNYB 4XPGH 4BK5A 4K94C 4IDLA 4L4TA 5L2JB 4XWGL 4EVNA 2VN4A 5J11B 1JMXA 1K6QH 4QXGL 2R0ZH 2A73A 4ZS7H 4LVEA 3EYSL 4QRPE 1VGKB 5I1EH 4PP2B 4B7LA 5CEYA 2NW3A 5E6IC 2XA8L 3GIVB 3QPQD 1WZ1H 2NY4C 3BGAA 2CIKA 3HZKA 2AGJL 1RZKL 1YMHA 2R4RH 2ZG1A 4O2EA 5JTWA 1F00I 1IC5H 2HFFA 4IRSA 2AEQH 1ZLUH 1BMGA 3CMOL 5JLZA 3QUYA 4XC1H 5KTEH 1HWGB 3BH9A 1A7RH 1A6PA 4X99B 1XR8B 4DKAA 3MOQA 3IDMB 1NCWH 2HFGH 1EZVY 2VLLB 5EBGA 1IT9L 3TV3L 1FC2D 2EC9U 2GAZA 4OAWB 3T09A 4EI5D 4ONOA 4PJ8C 3ES6A 1ES0B 1PDKA 3LQAL 1QFWL 3RU8H 3QDGE 3PGDA 3C60A 2AP2A 2W9EH 4R96A 1FPTL 3VGHA 4AYFA 5JOPE 2EKSB 1YN7A 1P4BL 2WIIB 4KHTH 2WP3O 3Q1SH 4RSVA 2BJMH 4ZUVA 4R4NC 1X4XA 2XV6B 2OJEA 3PQYE 3WEXA 1N4XL 5JXEA 1F3JA 1OAKH 2BNRE 4PJ9B 4X9GA 2BVEA 5F1NA 1ZLSH 4ZOEA 2BY0A 2FR4B 1QLRA 1AKJD 1U93A 2P8PA 5T5FL 4EN3C 3CLFH 2NR6C 4NWUH 2APXA 3D2UD 2NY6C 1PQZB 2CO7B 4G8GB 4FA8A 4RRPG 1G1CA 3LKSB 1RUQH 1EFQA 1KUMA 2V17H 4Y4KB 2EDBA 5E4EC 3QXUA 5T1DH 1MHEB 4GW4A 1V3LA 1JWSB 4JRXB 1GZPB 5J9PB 5E70A 3MRDA 5C0IB 5SWZB 3I2CL 5BO1L 4PR5A 4L3EA 4U33A 3KPLB 2BVPB 1BVLB 1B2WH 2X4OA 4YBQD 4ZPVB 4F57H 1NCAL 3FB6B 4JHAH 4OFYA 5SV4A 1IGTB 2CRYA 3CX5K 5GRVK 5FA3A 4ODHH 5B3JF 4PJFF 4EDWH 2UWEE 4FQ2H 5C86A 3ZHLA 2P46B 3NPSC 1PAMA 5KANI 5D4QA 5C0AE 4WEBH 2P43B 3MRHB 1VKXB 1J8HE 1BOYA 1I9EA 4D0DA 4YDIL 2JJSA 4XP4L 3LRSB 3G6DH 3ZKMD 5GZNC 2EDQA 1RUAL 4JVWA 3VA2C 5FECB 4TUKH 2X4TB 3JV4B 5EU4B 4ZXBB 5IJKA 4X6CE 4YGVB 3GSOB 4NCC2 2FEEL 1ZE3C 5C7XL 4XPGL 1TTFA 4PD4K 1O7SA 2E27H 3S35H 3VXOB 3TF7C 2R0ZL 4RFEA 4ZS7L 2BOBB 2BNUB 3ZZ1A 1DBAH 4KPHL 2OX5A 2ZSVB 4LLMB 2DWDB 3RZCA 3M17A 4FQQA 4S11A 1WZ1L 3HR5A 4MX7B 1JGEA 1OTSC 2R4RL 3TLRA 5DEGB 1VDGA 3QEHB 3KPPA 1L6XA 4Z78B 2AEQL 4Q58C 5CP7A 1QOKA 4XC1L 5KTEL 1A7RL 4MD5B 1NUGA 4PRIE 5GIRB 1NCWL 2HFGL 4OCNC 4EI6B 1WWBX 4K3GA 1TCRA 2GFBB 3L3IA 1A02N 4WFFD 4ISVA 4PBVC 5TE4H 2DM2A 1HIMH 1CD1A 1ED3B 4TSAH 3OKMA 3V5KA 3MRGB 5LWYH 1Q9WB 3GMLA 5FM5M 4HMEA 4XT1C 4XNUH 3RU8L 4JGMA 3OXRB 2YSSA 4A6YA 5K9OA 3KXFA 5ANME 1J0HA 3TN0A 3WDHA 2WBJA 4Y4FD 1NL0H 1A4JA 1QSED 3FO1A 4U2ZA 3SGEH 4P23A 5I8CB 3HE7B 4I18C 5TDOA 2Q76B 1ZT1B 2H2SD 3CZFB 3D85D 4X8JB 4LSTH 5KS9A 5KW9L 2W9DH 4U1IB 4IIQC 4R97C 4LLDA 1MCNA 2DQDH 1OAKL 5ICYA 1ODAA 1MY7A 3RHWF 3INUL 4XNZC 4RAVA 1NAMA 4QLRA 4DQOH 5C0JB 1KBGH 5CZVL 1PLGH 3LS5H 2XPGA 4OV6F 4NWUL 4XNQA 1FVEB 5T3XE 1TETL 5HYQA 4JDTL 3UMTA 1JWUB 4I5BA 3BP5A 1A6VL 2VLJA 2IMNA 3N1GC 5EOTB 4OF6A 4QRSA 3NZHL 4IEFB 3JTTA 4K2UL 3TCXA 4JJ5A 1U8QA 1RUQL 2QR0B 5K33A 5T1DL 3U30B 5D1ZB 1KIQB 3PWUA 4HIEA 1HNGA 2PR4H 2BSTA 5HYEA 1H3PH 4CBPA 3PDOB 1Z9LA 3U4BL 2NQCA 5FFLA 3MLYH 1ZHBB 5DD3L 1R3LB 1B2WL 4F57L 3O8XB 3LD8C 1MREH 4GJTB 4XAWH 4HPYH 4XX1G 3NFNB 1VFAA 4JHAL 1A7PH 3L95B 2AXHA 4UINH 2HP4A 3QNYA 1FDLH 1LEIA 1IM3B 2EH7H 2NY1D 1NDMA 4YQXH 1JHTA 3KPRD 1LK2A 4G9FB 4ODHL 2YD7A 4FQ2L 4J23A 3WBDA 3FQTA 4ZG1A 3P4OB 4Z9KB 3U6RA 5CKGA 3Q5TA 3WN5B 1QRNA 3IS1X 2AXFB 2DIJA 1CDYA 1R0AH 3ARDC 5K9KA 3IRPX 4XP5H 4PV8B 4Z5RA 2GT9A 4YNYA 5K9QI 4XPAH 2ADFL 1UG9A 3O11B 4M7LT 5FYJL 5IQ7L 3MUJA 3TT1H 3EO1B 1F3DJ 1T5WB 1MHCB 1CLYH 3EOTH 3KYOA 1VESA 4RBPH 1C5CH 3K80A 5ENWB 1WWAX 4HK3J 5KAQF 2E27L 5FYKL 4BQBA 4O2FB 4JRYA 4KKLD 1CG9B 1DBAL 5C08B 1XGPA 3VRIB 1N6UA 3BD3A 5LGJB 4X99A 3NTCH 1XR8A 3GIZL 4UBDD 2VLLA 3PV6B 1NC2D 1QSFE 2UWEF 1T04B 2YBRB 1IGIH 4NRZB 2NX5D 1EUUA 2IGFH 3L3GA 4NZUH 1EDQA 4R7NA 4LAJH 2V5RA 3FKUS 5CHNA 4BYHA 2MFNA 4MD0B 2GHWB 5E1AA 1CLZH 3AXLB 4FZ8H 3VFWB 1UM4H 1XZ0A 4DGVH 2FX9L 3MV11 3RUGB 2X44D 4N68A 1KIPB 3QFJB 5TE4L 1X5AA 1BZ7B 1HIML 4X6CF 4TSAL 1KYOJ 5LWYL 1A21A 4F7TA 5CJOH 5SWSD 4XNUL 2RB8A 1A9EB 4YHPB 5E5MA 1CL7I 4IM8A 1BAFH 4MS8C 1E6OH 3LMJL 3RX5A 3W9EA 1EZVX 3QUKB 4HK0B 1XR9B 3MLSH 5C6WH 1G9NH 2FR4A 1JYXA 2FB4H 3NCCB 5JA8B 3BP7B 4QOKE 1A7QH 3TBYA 3BEWB 3LB6D 4LSTL 2DRUA 3TIDB 3GUTA 4GS7B 1X3DA 2WIMA 4KHXL 4JPVH 2DQDL 4LLWA 4G8GA 3S37L 4Y19D 1UKTA 3LKSA 5FGCB 4OFKA 4LSQH 4ZFOL 5IVOA 4G6FB 1GZQA 4MA1C 1MHEA 4LGSB 1U8IB 2R39A 5E7BA 4K3DH 3LS5L 5EUOB 1GZPA 4R4ND 1EHXA 4U6XB 4QXUH 3NACH 2FHFA 4W4OA 5F70A 1CQYA 5BS0A 1D6EA 2DQJH 4OJFL 3VWJC 3RP1A 4M4RA 1C16A 2J7LA 3DXAB 2NYYC 1NFDA 2XXMB 1E4KA 2Y7QA 3FB6A 1I1YA 3QCVH 5EC1A 3ZKXC 2GCYB 5CMAB 4L4VA 3LOWA 3VW3H 4LSUL 2CH8A 4HV8A 1YNLL 4EN3D 4OQ1A 2PR4L 2NR6D 1H3PL 4P59H 3R0NA 2H1PH 3BH8B 4NQEA 5KJRH 2NY6D 5C0EA 3BUTA 1QFHA 3B9KA 4HBQA 1PG7X 3F5WB 2C3GA 4HPYL 4KRPD 4XAWL 5F8RC 1U92B 4HX1A 1A7PL 1FDLL 3WLBA 3VGBA 4YQXL 4LLUB 1UEYA 5EBWA 1T0MA 2OMNA 1BLNB 5IVXB 3FN9A 4NNPH 5GRJL 3JV4A 5EU4A 3WJJA 3IU4H 1AD9A 2YR3A 1R0AL 1SEQH 2CDFB 3F7QA 1ONQA 5D5MB 4HULB 2M8XA 1IFHL 5TE6H 2YS4A 1EJ6A 2XRAH 2YZ1A 4U1JB 2C3XA 1MUJA 4WV1C 1YMME 3I6LE 3TT1L 5DEFB 5IW6B 5ERWB 2ZSVA 4LLMA 1CLYL 4NGHH 3O3AB 3HUJE 4D0CB 4IRJC 2P5WE 1LGVA 3W9DA 2DM3A 2GJJA 3HNSH 1MHHA 3EYFB 4HF5H 5GZND 3QEHA 5F7EH 2MPAL 3MGTB 3QQ3A 2ITDA 3WKMH 5CBAB 3T4YB 1ZLVK 3W0WD 3GJFH 3NTCL 4EI6A 4HMDA 3PGCB 1IGIL 4FQJH 2Q86A 1N5AA 4O00A 1T21A 2IGFL 2R4SH 4GKZA 4CU6A 4X4ZA 4NZUL 3WFZA 2GYSA 4KROC 1C5BH 1ZA3B 3MRGA 1Q9WA 4OTXH 5EPMA 3LKPB 4LFHD 5C09A 1ZEAH 5B39A 3O81A 3IKCA 3GI9L 1CLZL 4X5XA 1MWAL 1SY6A 3GMNA 4U0RC 1UM4L 5J1TC 5HDBF 1YY9D 3UCRA 1CF8H 3DO7B 1YYLL 2AJVH 3RNQA 3CFDA 2F19H 4Z8FH 3QXDB 1UXWA 4Y5XC 4YDVA 1TLKA 3DI3B 1GAFH 4IOIA 4LRNL 4WY7L 2EXYC 1G6RA 1EIBA 4LPYA 1I3RA 1KTKE 1G9NL 3RJQB 2IPKA 4P46B 5KSVB 1KCRH 4NQXA 2FB4L 4LGPB 4OZFB 2R8SH 4JFYB 5C0JA 4NUGL 5DI8B 2N1KA 3P4MA 5INDB 3B9VA 1FVEA 4YEEA 4FFYH 2PNDA 1A6WH 1CGVA 1JWUA 1NCUA 1UADC 1X5JA 4LVNC 5D2NB 3ZDZE 1I8KB 3L5JA 5F3BB 1G7PB 1MFCL 4PJBA 1JF5A 5BCAA 5EWIL 4TPRL 3RWIB 4DWHA 4FMFA 2XTJB 2DI8A 4JGJA 1P9MA 3T65B 4K3DL 5CJ5A 5IGXL 3SO5A 3NACL 5D2LA 5DVKA 5CINH 3RTQD 3MR9A 3O6FB 5DZLA 1ZHBA 3SDCC 1IC7H 1VERA 1R3LA 1XCQA 3G9AB 1T1YB 3O8XA 4QEGA 3NFNA 4NN6B 4BFGA 5BJTB 3A6OA 2E7CA 4U3HA 1OW0C 1OAZL 3W39B 4UTAH 4P59L 2H1PL 1CICA 4TNWF 3VXUE 2FLBT 2VOTA 1PGRB 1Q9KB 5FGBA 4P9HH 2AXFA 4LCCB 2HJLB 4TVSa 1CD8A 4WW2C 2IPUK 3LN4A 2PXYB 2F53E 2DMBA 1EO8H 3MUHL 2APFA 3KYMB 4Y2DB 4N5UA 3QXWA 2I9LA 1QR1A 3O11A 4ZOBA 1VPOL 3EYVA 3QI9D 4OM0H 5C07D 1OSZB 5CJBA 4U1NB 1S78D 3EO1A 5E03A 3IU4L 1T5WA 1MHCA 5I1DA 3C5ZC 5BV7C 4KGJA 2IALB 1D5XB 1I9RH 1P7QB 2CRZA 1ZHLB 4Q6IA 3VDCA 3ARWA 1L0YA 1G7JB 1NC2A 3K3QA 2WWKO 4JAMB 1N0LA 3EJZC 1YNTA 4JRWA 1KPRB 4CMHB 5C08A 2WM0A 5I75C 4UDUA 5FDYA 1EMTH 4JFHD 4NFCA 4RIRA 4WHTB 3HNVL 3ARDD 3MA7B 1VFBA 3PV6A 3CH1A 5E6IA 4GKOA 3HRZB 2G9HA 2YBRA 1I9IL 2E9BA 4AM0B 4M7ZC 2XN9A 1F6LL 3HNSL 4LGRB 3E8UL 1JF1B 4DVBB 4Y4HB 3VXMD 4TSBH 5HY9B 1HE7A 3CC5B 4F80A 5I76B 2EE3A 3WKML 3N50A 5HYSA 5D9SA 4MD0A 2VLMD 4Q9BA 1NLDH 4HBCH 4NM4H 3KPSB 1NUDA 1PVHA 1KIPA 4PJIF 3S3SA 1KC5L 1P69B 1C5BL 3RVUD 1N64H 4OTXL 4PJ8A 5IESH 1ZEAL 4ONGH 4C83A 3G5XA 2E7BA 2BY1A 2VLRB 3FFCE 5LVEA 3IAGC 1FNEB 3FO0L 3MV8B 3OZ9H 4DCQA 3O2DH 5DJYA 2AJVL 1NFIB 4HK0A 1FNGB 1T3FB 1N7MH 1UXSA 2F19L 3CNKA 1N3NB 4Z8FL 4AEEA 1LHZA 2YXFA 3BP7A 4YHKL 4WO4B 5DRZB 5CEZD 3BEWA 4MVBC 1GAFL 1RD6A 3L7FA 1LDPH 5AYUH 3HUJF 1QTYT 4EQ2A 1XF4A 3VFVB 4NC2B 5EO1B 2VXSH 1NC4A 3QDMB 2ZWLT 2R0KH 1GIGL 4K9EH 1PFCA 4QRRD 4S0SD 4XVTL 5DYOB 2R8SL 3ARZA 4LU5H 2LVCA 1LP9A 3QQ9C 5TFSH 4WRLA 2X9YA 4Y1AD 3VI4F 2Q8AH 3TA3B 4FFYL 1A6WL 4EN3A 1KELH 1TJIH 3FT4B 2XZAH 3GMRA 2HH0L 3DUUA 3DXAA 3B3IA 1A9BB 3HTLX 4XP6H 4Y89A 2DDQL 3BQUC 5GXBB 5I8OL 4RQQB 3U36B 2X9WA 5E2WL 4EXKA 1PX4A 4XP1H 3FB7B 3U9UB 4UT9H 3AS3A 5KN5A 4PJDE 1RHHB 5IBLD 4NJAH 3BH8A 3RBSA 3L7EB 5CINL 3SBWC 4OLVH 3H9ZA 4JG1H 5D72L 3RJDA 4ZUUB 3OBAA 2CRMA 1ORSA 3PNWA 3JTSA 5T3ZD 5TDNA 3WNOA 1JRHI 4PG9B 2BNQD 4P2RB 2H2PC 1P4LB 2EYSA 2BSED 4UTAL 3P73A 1BLNA 1TZIA 3B9DA 3ZLQC 4UNVA 4ZMAT 1ZGLB 4J12A 1NEUA 3G6JA 3TVMB 3VWJD 4CU7A 4WIQA 2VL4A 2NYYD 2VERN 5KAQG 4J3XA 1P53A 1RZFH 1UWXH 3MV9A 1VENA 3EYOA 3F7VA 5IB1B 2I27N 1CGTA 4LSVH 4E41D 3IVKA 3UTTE 1J05B 1I9RL 1D5BA 5I1CH 2VZSA 2PN5A 4WW1B 3RL1B 1WV7T 5I71C 2VSDA 2OZ4A 5CBAA 3T4YA 2FZ3B 3RY6A 2O5YL 5IVZA 3MLVH 1WBZB 3U0WH 1IZKA 1Q9LA 2DQGL 1QYGL 3V5HB 2HN7A 3MNZA 4LHUD 1A7OH 1K9TA 3T0XA 3C09C 2YD4A 4WVRA 3C6LC 3VXNB 5D7SH 1SMAA 1A3QA 1V3JA 3PV7A 5MERB 1HINH 2RGSA 2P8MA 3BD4A 3DROB 3LKPA 4G43B 1NLDL 4PLJD 5JZ7C 35C8L 2FJHB 4PJFB 2E6JA 4FQXC 3EUUA 2X4RB 4LCWB 5IW3A 3D48R 3C5JB 4IRJD 5IEKB 3TO2B 3ARSA 4LCIH 1UKSA 2BVOB 3QXDA 3MRIB 2GQHA 2XQBL 4WCYH 1AY1H 1N64L 5IESL 4XCCH 2CLRB 4GFTB 2LU4A 1J0KA 3OZ9L 3WHXB 3RWFB 4D9QE 3O2DL 4ZFOB 2FO4B 2J5LB 2QQLL 1NMCB 1P6FA 3S4SG 4LEOB 1CI5A 1KCUH 5KSVA 1INDL 5DJ0B 4OZFA 4JFYA 1YJDL 5IG7B 5DI8A 2HT3C 4I0PB 1B0GA 4I18A 4WJ5B 1RK0A 5B38B 5INDA 4JPIB 3EFFB 1LDPL 4TVPH 3H3PL 4LEXH 5EC2A 1GRWA 3O9WD 5D2NA 3T2NL 3G5YB 3OKEA 5D1QB 1QSEE 3UTQB 2P7TB 3IT8D 4G8IB 1DR9A 1G7PA 2R0KL 5E8OA 3UZVB 1BBDH 3VFPB 1M6OB 3KYAA 3RWIA 4PJAA 5DHVA 1UQSB 3SCMB 5DJCB 1JNJA 2Q8AL 1CBVL 3MLPA 2KZWA 4HS6B 1TJIL 2EXYD 5IR1A 5HDQH 2AS5M 4MB3A 1QEWB 4F2MA 4TUOA 3AB0C 2YRZA 1JPGA 1T1YA 5ETUB 4ODSH 4WUUB 5BJTA 3WO3B 1WQVT 1NGXA 5GRUH 2DQFA 3KJ4B 1YEIH 4JHBA 2CJUH 4NJAL 3VG9B 3HKFA 4TUJB 4OLVL 1X7QA 4JG1L 4URTB 4P2QB 2BP3A 3V0VA 5DVLA 4IS6A 3REVA 4PGCA 3LY6A 1JGVH 1TTGA 3I50L 2F74A 1OP3K 3LHPH 4L8SC 2EXWC 4BSVB 3WCYA 2PXYA 3MLRH 5FM8A 2B1HL 1B4JH 3UJTH 3HE7C 4KXZI 2BVQB 4Q97A 1NGQH 1DN2A 3TBVB 1OSZA 3PP4L 1TNMA 3SDCD 2ADIA 3Q5OA 3K2UL 1JZ4A 1BF8A 2IALA 5F93C 3SDXF 1D5XA 5IJVB 4YO0B 5FKPB 5FYLD 3C2AH 3X14A 5AZEH 1JI2A 3ZE1E 4JAMA 5IEHB 5D7LD 3B5GA 1I7TA 3QSKB 3PIQA 3DMMC 3U48A 3BN9C 3QEQD 1BQHG 5DD0H 4LSVL 4GXUM 5KVMC 3PGFH 4JO3H 3ROOB 2Q87A 2V9RA 1C1EH 1JGLH 1GH7A 4PJDF 5I1CL 1MCLA 3NAAH 3GEWB 3PABB 2OCFD 2FGWL 4HS8L 4Y4HA 2IFFL 3MNVA 5DVNA 3SJVE 5HY9A 5D1ZC 2JJUA 1KCVH 5I76A 4KAQH 5I1JL 2EYTA 2P42B 3IFOA 1AGDA 4QY8B 4JANA 5I8EB 3MLVL 3U0WL 5C0CA 4S2SB 3FQRA 3C5ZD 4RGMC 4JG0H 4XPHH 4ZQKB 4XPBH 5D96B 5F7UA 1QLFB 1LD9A 4B0MM 4LOUC 4HQQL 4NRYB 4LDEB 4L29A 3UTPD 32C2B 5TPWH 1KIUA 2UYLB 3MRBB 5TF0A 4OLXL 4JFFB 2VLRA 3EYQC 1FNEA 5I17B 3MJGX 3MV8A 2VQ1B 5T1LD 4XI5C 3P0VH 5DTFB 1QQDB 5L88H 1NFIA 2P24B 4G5ZH 4S1QH 4LCIL 1N3NA 1RIHL 3TYGL 3OKDA 4WCYL 4WO4A 4LMQI 5DRZA 2H32A 2I26N 4N8CH 1VB9A 2KL6A 2D7TH 1SJXA 3MGOA 4HC1H 3QIWB 3AAZA 4P2OB 4Z7WE 1HQ4B 2BCKB 4BQCA 5I19H 4DW2H 2X4SB 3Q3GA 1V3MA 3PWLB 4GRMB 5B8CB 5IB3A 4ONFL 1KCUL 1W72H 1B9ZA 3TH3T 5DYOA 2E9IA 3NN8B 5SWSE 3R4DA 4NQDB 5CGYC 1RUKH 1N8ZB 4OIIH 4V1DD 4HIIA 3HS0A 4OIBA 4GXUN 5IIEB 1DL7L 2JELH 4MNQD 2DLFH 4LVOC 1F13A 3VCLA 4ZFZB 4Y16C 3NGBC 8FABB 4Z7UE 3TIEA 1TDQA 3U36A 4DN3H 3O3DA 4MVBD 3RWCA 1DQJA 2BNQA 1QNZH 1QSZA 2X1OA 1B4RA 1WBYB 5TE7H 4P9ML 4Y19E 4RGNB 1OGTA 1FZJA 5HDQL 3QQ4B 1U42A 2W60A 2NTFA 4RZCB 3LQZB 5F7FA 4Q9RH 1QA9B 4KRMB 4OLWH 4F9LA 4PG9A 4P2RA 1JF6A 5GRUL 1P4LA 5F3HA 4U6HB 3WXVH 1KJ2A 3L5XH 4ZDHB 2GSGB 2CJUL 1LNUB 4YLQT 4BFBD 3H9HA 4FNLH 1JGVL 2GTZA 3VRJA 5A16A 5T5NF 2V2WB 3LHPL 1UZ8A 1SM3H 3S9DB 3MREA 5HHVH 1B4JL 3UJTL 2VQUA 1MCIA 1NGQL 4FRWA 1W0WB 5GGQL 1LO5A 1MIEH 5KSBE 3UEZA 3ILPA 2M2DA 5TQ2H 3QAZC 1CFTA 4WHDA 4WWID 3RX7A 4LASH 5HGAB 1T66C 3OKKA 3RL2A 2EDDA 2H2PD 1SJHA 2R23A 1MFNA 4PJ5B 2Z35B 1WWCA 3GJFB 2Z4QB 1CFVH 3DYPA 4X8XA 3QNXA 3HG1B 4JO1L 2ZCHL 1H8SA 2IF7A 5DD0L 4OZ4A 3PGFL 4JO3L 3F7YB 3JV6B 1C1EL 4YR6B 1FL6A 3U0TB 2IANB 1KPVB 4OCWH 4B5EA 3X12B 3DROA 2A6KB 4KAQL 4YBLC 2GK0B 1NGYA 3IJYB 3FONA 5E8EA 3CVIH 1U8OA 4BKLB 3CAFA 4N0CC 3MV7B 1NSNL 4YHIA 2VLKE 4AT6B 4F7MA 5MENB 4NUJB 5IQ9A 3MBEC 4XPHL 1PEWA 4P99A 1JGUL 1T2XA 4Y4KD 3MRIA 4XNXL 1WFOA 3CJJA 4R4FH 3W0WE 4JRXD 3HI6H 5TPWL 2CLRA 1EEUA 1QZ1A 1Y6KR 5ESQB 5E9DA 4D8PA 5HHOB 2CDGB 4QXWA 4KJQC 1RV6X 3WHXA 3NCMA 3RWFA 2FWOB 3P0VL 4ZFOA 1AI1L 3ZE1F 2FO4A 3ARPA 5L88L