3EOTH

Crystal structure of lac031, an engineered anti-vla1 fab
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
212
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYTMSWVRQAPGKGLEWVATISGGGHTYYLDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGFGDGGYFDVWGQGTLVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB FRAGMENT, HEAVY CHAIN
publication title An antibody loop replacement design feasibility study and a loop-swapped dimer structure.
pubmed doi rcsb
source organism Mus musculus
total genus 45
structure length 212
sequence length 219
ec nomenclature
pdb deposition date 2008-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eotH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eotH01
3L7EB 4TVPE 3AS0A 3O4LB 3VXTB 1P4IL 2R0WL 2EDBA 5E99H 2L7JA 3SGJC 4JR9H 4G8GB 4HJ0C 1M7DB 4R8WL 5I73B 1MH5A 1A3LH 3Q2CA 3MJ8B 5EZLB 3OGOE 1RY7B 3WIHH 1F3RB 4FQQA 3EYQC 5I66B 1UXSB 1H3GA 2CRMA 3D39A 4XCYB 3JTTB 3HC0A 4AENB 3HE6B 1X6LA 4L4TA 4QT5B 5TFSL 2NX5E 4KUCD 3OKDB 3N1FC 4CL7A 4L9LC 1ZLWK 3N1PC 1Y18A 3G08A 4Z78B 2G2RB 2B0SH 4M48L 5JLZB 1S5IH 2AXGA 4NBZB 4FXGB 4CVXB 1E4JA 4MB3A 5D72L 1XT5A 2NY5H 3LN5A 5BV7L 3Q1SL 3LRSB 5I18L 4JB9L 3L95A 4K23H 4Y16D 2K3TA 2VLRE 1ND0A 2FNBA 3QYCA 4GW4A 5FGBA 3KLSA 4ODVH 3SCMD 4PJ8C 5JIHA 4K94L 4N0YL 5HHPA 1CGXA 2C3VB 2EXYD 4U05A 3E1F1 1A14L 2HTKC 1L6ZA 4XP9H 5IKCA 5D1QC 5DJ2A 1XGYH 2A0LD 1EHLH 3DROB 3WJLA 3FFCE 4AJ0A 1EVUA 4HZLA 4WU5A 1EBPA 1CVRA 1MIMH 5ETUA 4ERSL 3D2UB 3S5LB 3ULSB 1I1AC 3FQNB 2ZUYA 1J8KA 1TJIH 3V4VH 4APQB 1MHHA 5JHDE 4WGVB 2WBJD 1BJ1J 1UH3A 5E0QA 5L6YL 3RNQA 4JFDE 1I1YB 4LCCB 5KAQF 2H45A 1G9NL 3DV4B 3S88H 2WIMA 5IMMB 1R24B 3SGJA 3HAEA 2VDNL 4ONHA 3VFUB 2K7PA 4JPKL 2NX5B 4YHKL 3VD4A 5I1LA 4OSUL 4BSVA 1VHPA 2Y9RT 35C8L 2CR3A 4E41D 1NBVH 1QA9B 2HVKB 3TFKD 4RIRA 4HUXB 2ADJB 5DD6A 5CIPA 2C1OA 2VLRB 5IBLC 4L9LA 4FQIH 4PJDF 2XY2A 3RTQB 1IGTA 1J12A 2OR7A 2VDRL 3OF6D 2CDEA 3BKML 4XB8A 2XN9A 3W0WD 5I8KH 3I3BA 4J3WA 5CD3A 1UCBH 3BT2H 4J3SA 3S35H 3FQWA 1YN7A 1F97A 3MNWB 4G8FB 3V7AE 4Z7WE 1OM3L 1II4E 1CICD 1QFUH 3FFCB 5E2WL 4PJ8A 3PHOB 1EHNA 1FIEA 3CFEA 4Z0XB 1QG3A 2H6PB 4PLKD 1VFOA 1FZMB 3MMEB 3DVNA 4DGYL 5JHDB 5KVDH 3RU8L 2YK1L 1A6WL 4ZS7H 4MCZB 4JO1L 4JFDB 4NM8H 2QR0A 5E1HB 3GSVA 3ZE0F 4GAYA 4P4RA 2PO6B 3RGHA 2PYED 1I1AA 3GHBL 5HJ3A 3PL6C 3SDYH 2M8XA 1HHHB 3MLUH 4MZ2A 3RVUC 3TBYB 1FV1A 4QXTA 3B6SB 4WEBL 1QFOA 1JGUH 4OCRH 4ODVL 5E8DL 3PGFL 4IBLT 2RAMA 3NOIA 3B2VL 1WICA 2OI9B 1UZ6E 2C7UB 2Q8BH 1M05A 4K9EL 2VQTA 4OLUL 4XT1C 3WS3A 2XY1A 4NNYB 1MPAL 2D03L 4GKNB 2N4IA 3OXRA 5L2JB 3DURB 1MIML 4POZD 3WV0A 5IVXE 4XXDA 2X1QA 1AKJD 1TJIL 4PJXF 5ACZB 4P9HC 4LBEB 4HMEA 4I3SL 4YHPB 4Z7WB 3OKMA 1FNFA 1ZHKA 1BVLA 1WIPA 2H32B 3HMWH 4RMWA 1LEIB 4LK4A 4LGSB 4XNUL 3FN3A 5DRZB 3X12B 1LK3L 5DJXB 3CC5B 1XEDA 5I8OH 4ZOEA 5HSFA 3TT1H 2AV1A 4NC1E 4ODSH 3VXOB 2OZ4H 1FFOA 3CFCL 4ODUA 3W81A 4ODXA 2XKNB 3GHEH 5I1GL 2NZ9D 2VZVA 3QXVA 4NQCA 1GPOL 3VD7A 3KLAA 2AABH 1IGIL 3RX7A 3V0VA 1M4KA 5E08H 4NN6B 1Z9SA 1G7MB 1E4XH 1K3ZA 1YZZA 2CMRL 2DYPA 1QR4A 5BS0D 4OFVA 1MWAL 5L8KB 5ADOH 3FB7A 1QEWB 5CZXC 4D9LH 3S35L 1B6DA 4XPTL 3BDYL 3PL6A 1N59A 1S9XA 3OZ9H 1IGCL 2ZJSH 3QIUB 4EI6B 4G8EB 4L4JA 1Y6KR 2OYPA 2CRYA 5E00B 5DGQA 4TPRH 3NGBB 4OF7A 5EUOE 1BBJA 4G7VH 4LKXB 5IVXB 4E9LA 1JFQL 4YGVB 2IH3A 3IDXH 3T4AB 1SBBA 5DJ6B 5CEZL 1NC2D 1RZKL 4X6BB 4PY8I 1MCOH 1R3IL 3AB0C 3MODL 4WO4C 5LWYH 5DA4A 5BZWB 4NM4L 3QULA 4JRYD 3VGBA 5EBWA 3VGEA 5BVJA 2Z93A 5HTSA 3C6LC 2HA1A 4WW2B 1D6EB 5EPMA 5FYJE 4CNIB 4NRXB 5JOFB 1JGUL 4R0LB 4FXKA 1ADQA 2VITA 4MDJA 1CXKA 4JY6A 3VA6A 4KXZH 4NO0A 4MQXD 5E95B 3QUKA 3BKCL 4L8BB 4OLWL 4YDVB 1LO4H 1R0AL 5IGXH 4KUZH 1U58A 2NY4C 4TSAL 2XZQL 1BAFH 4BJLA 5DZOA 4LPVA 3MUJA 1IAOA 5ICYB 2QQLH 4HPOL 3O4LD 3HMWL 5CJOL 1IVLA 3RY5A 1IT9L 4FZEL 4TYUA 2RFXB 3HMXA 3HNVL 4HS6A 4XC1L 4Y5VB 3MA7B 5EUOB 3ULVF 3K46A 5IT2H 1WZ1H 1QTYT 4HT1L 1EO7A 3CSBA 1IGMH 3U4EA 3X3GL 1ERNA 1G1CA 3A6OA 3FFDA 5ITFB 1FNHA 2EIEA 5IVZB 5JDSA 3PWPA 4LRNL 4OGAC 1FVEB 4YE4L 3H3BC 4MVBC 1FGNL 2WBKA 5TGBB 4OD2A 4RSVA 1UM5L 3TO2B 3ULVH 1MJ8L 2FJHA 3FCTB 4WO4A 3E2HB 4OCSH 3OQ3B 4P9MH 4CAGA 4M7ZB 3KLHD 4OLEA 1U3HC 4RFOH 4XP4L 2IFFL 5GGUB 5CP3A 5T1DL 5ESVB 1F3JB 1ZMYA 4LCIH 3PP4H 3F58L 5GSVB 4NQDE 2A6KA 1J0KA 1PLGH 4ZAKB 5FO7B 3VXRE 3MBEB 1OARH 4C56D 5DJCA 4G6FB 4ZG1A 1UVQB 3BP6B 4R90H 5TF1L 4M5YL 3QI9C 4JO3L 3T4YB 5T3XE 3I9GL 1ZA3A 4D0BB 4NUGL 4JKPH 4TOYH 3RVXC 4KGLA 4JRXE 5GRXG 2CK2A 2VAAB 1MSPA 5FAAA 2X4NB 1FFNB 1DLHA 4JFQA 3QO1B 4APQD 1OTTC 2DM7A 2J8UE 4FNLH 4U31A 3ZL4L 3TNMB 1HILA 4M6MH 1IGJA 2BJMH 4XC3H 3B9KB 3QCUH 1I3GH 1NAKL 1CDIA 2VN4A 2UY6A 5HY9A 2ZUWA 3MRGB 1E6JH 2EKJA 1L0XA 3R1GH 3EYSH 4LVOC 3ARFC 3VWKC 4LCYB 2NTFB 3TPKA 4DAGH 1KPUB 1JMXA 4M62L 2NX5D 4BZ2H 2R0ZL 2FZ3B 1MCWW 4WV1C 2V2TA 2VH5L 3U9UA 5I1JH 4PTTB 5IGXL 2VB5A 1WC7B 2PW2B 5FA3A 5EU3B 2Z31C 4UOW0 4X7FC 4QHMA 1PG7L 3RGVC 2VXQL 3Q5TA 5TDOB 4YBLC 3L5HA 3MGOB 2D7PA 3QUMB 3GI8H 4XMLH 3RTQD 3L3IB 1HH6B 4H20L 4R3SB 3QG6B 5AZ2L 4NQDB 4N0CD 3VXRB 1CR9H 3QQ4A 4XMKH 2NW2B 2C5DC 5EN2A 3VMOA 3U79A 3CMOH 4HV8A 3IFLL 4K8RC 3TBWA 1U3HA 2DS4A 1NBYA 3VXMD 1OOAA 4JRXB 3FMGL 1B3JA 1IEAA 2HRLA 2DQHL 3BKYH 4ZUTA 2F5BH 3S4SG 2J8UB 5FIEA 5GGQL 2DIJA 3QI9A 2IBZX 4ONOA 3GK8H 5GS2H 4JHZA 4JQIH 1GGCL 3MRKA 4JFDD 5ISZB 2IADB 5DJ8B 4XP5H 4ODTL 2PO6D 4KKAD 1X5FA 1ZGLM 2EZ0D 1KTLA 5HGDA 5F8QC 1X4YA 1U8JA 4P9ML 3TWCH 5D1XC 1F02I 1XF3A 3OR6B 5HVHC 2LV4A 4FTVA 3VWKA 3ARFA 4EXKA 2W9DL 3PWLA 5BOZG 4KJWC 4KZEL 3T2OA 5J13C 4H25B 4WV1A 4M3KB 5E9DD 3WXVH 2X4QB 2QJDA 3GNML 2F54D 1RIHH 3WNOA 3MLVL 2Z31A 3UZVB 4NJAL 4WDIB 4U0QB 3RGVA 1T2QH 1T1ZB 2BJML 4CDHA 2Y06L 1TCMA 3MV8E 2I9LA 1AO7E 4U1MA 4WY7L 5D6CA 1UXWB 3RUGA 3CD4A 3OL2A 4JAMA 1FE8L 2HH0H 4WWKA 4XHQA 4NO2A 5E1AA 3SE9L 4PRAB 2BNQE 2XKUA 1NSNH 1U93B 3QEUA 3VFOA 5GS0H 5AG8A 2ICES 4DEPB 5IB1A 3PGDB 1QLRA 3CZFB 1HKLH 4YK4B 1J0HA 1V3MA 1W72L 1S7VA 4OFPA 1IGFL 1BFTA 1JTPA 4Z9KB 5D1ZD 5GZNC 3P4LA 1HINL 4KJPC 1KG0B 2X9XA 3O6FD 3BHBA 2EO9A 1J88A 3MV9A 5D7IE 3IDJA 4XMKL 3F65A 3FO2B 3HCVA 3TBTB 4YC2C 3QIUD 5D1XA 3VGFA 4BH8A 4XZUB 1GHFL 1YQVH 5FK9A 3MBXH 5LAXA 5F44A 3JV6B 2JELH 1UWGL 3PWVB 5DMKA 4GXVH 4R97B 3ZSTA 3Q6GH 4UI2A 4W68A 5GIRB 3BD3A 4UT7H 3IXTB 4X4MA 3MV8B 4P2YA 1AO7B 1GGBL 4DGIH 1KYOK 2GT9A 3BQUD 5C0AA 1JPSL 2BNQB 3F62A 3FAWA 4DN3L 1F2QA 2QKIA 4Y16C 2OM5A 4BQ6A 3KNBB 3IDMA 3SCMC 1J0ZA 2EXYC 3FO1B 3R4DA 2VC2L 3BUYA 2R4SL 4KK9D 3QFJA 1AD9B 3F8UB 3S4SA 4XP1H 2X70B 1XH3B 5J11C 2A0LC 4O58H 4UT9L 2ZPKL 4YX2H 4HX1B 3GIZH 2D7NA 5D7IB 1E6OH 2BOBA 4ODWB 2W92A 3GBML 4LU5H 4PJ9D 1IM9D 2D4FA 4LMQI 1PQZA 5CWSA 4FQXB 1JYWA 3ARYA 3T0EC 2WBJC 1MY7A 2ESVE 3LSOA 3GB7A 3LHPL 4LASL 3ROLB 4K7PH 2DL2A 1RUPH 2AV7B 2XQBL 1AIFA 2DMBA 2HH0L 2Y6SD 2W0FA 4X99B 1G6RB 4HWZB 5MENA 4UZGA 1JGDB 1P7HL 4NZDA 5DYOB 5SWZE 4QRRA 2CJUH 3SOBL 3VRJB 3MLXL 1NEUA 1I8LC 1UB5B 4JCMA 2OMBA 1JYNA 1A6AB 2ZCLH 3S3PA 4LSQH 1EEQA 3CVIH 2MPAL 4Y1AE 4PJHA 4GRMB 5F96L 1Q9OB 2DQGH 5J0BA 2Q6WA 3H42H 4FP8L 5FYJD 1O5DT 3FOLA 4W4OC 5C71A 2Q1EA 3DMMD 3O3UN 1DQJB 2NYYC 1EAPB 3EHBC 1WFUA 4YHNB 2ADFH 4H0HB 4GFTB 5FGCE 3V4UH 4LSTH 5CSGA 3MA9H 5CLWA 4ZAKD 4GQPH 2HJKA 2X6MA 3MBED 3BDXA 4Y16A 3TV3L 2W65A 1T3FA 3CXHJ 4OZHA 1Q94A 5JW3H 4ZTOH 1TDQA 2FECL 2X1WL 3NPSC 4Q6YA 5KVMC 1IZKA 1FRGH 1Q9WB 2UZIL 1FNSL 4Y19D 1Z5LB 3DXAE 1T03H 1Y6NR 4XVTL 1A64A 2BX5A 3GJEB 2ESVB 3SJVE 1S78C 1FPTL 1HSBA 1CXIA 3REVB 2EDQA 3B9KD 2BP3A 1YYMH 2VXTL 4FQHB 5AEAA 3TZVB 1DSFH 5DO2D 2BDNH 5SWZB 2D7TH 3T0EA 5SWSE 4MQ7A 4AK1A 1A8JH 2LVEA 3QXUA 3U7YH 1RZIA 5HVFB 1T1WB 2OBGA 4ZUWA 1CD8A 2VXUH 4OF3A 2BNRD 5DSCB 1XGPB 5D8JH 1FLRL 4Y1AB 3FZUD 4ODHH 3QAZB 1KTKE 5FYKD 5DI8B 3TO4B 3TN0D 1DBKL 2Y5TB 3ULUH 3TCXA 4MNHA 5DS8B 1PGRB 4POZC 1CYGA 4R4ND 3MLRL 5FGCB 4Z7UE 2XTLA 3PWJA 4S10A 3VXRD 3VXNB 4ORGB 3WHE0 4WFFE 4W4OA 2BXYA 4GW5A 4ZNEE 4JN2A 3RZCB 5IJKA 3W0WA 4OV5A 1G7HB 2FGZA 4H26B 4JRXD 2OL3B 1F45A 3MRJB 5BRZD 3RX5A 4P48A 3DXAB 2VDLH 2VJXA 2HN7A 3SJVB 2FBOJ 1HXYA 1INDL 3U1SH 2O5YL 2VZ3A 3D6GA 1BLNB 4ZPVB 2A9NL 4GSDH 1TLKA 3T1FB 3OB0H 5SWSB 5JTWA 1UC6A 5GGVH 2AEPH 3LB6C 2EDLA 4P2OB 1FZJB 1UYWL 1EBAA 4ZUSA 5L8JB 1OD7A 3P9WB 4PRNB 3FHAA 4ZPTA 1ZT4A 2PKDA 3RVTD 2YPKB 2EDKA 3GMRB 2QADD 1EXUA 3OKLB 3VCLA 4MXWL 3MLYH 2VTFA 1IQDA 1IBGL 1FG2A 4HIIA 5AWNL 3CFJB 4YBQD 3KAAA 5IFJB 1WAAF 4F37K 4FFVC 5C09A 4ZTOL 4PRIE 1QLEL 2VQUA 3T09A 1T20B 2CKBB 3PQYE 2R0KH 4IRSA 2OJEB 4Z7UB 1H3XA 2E8ZA 3ESUF 3GMPB 1PY9A 3ZDYF 1EK3A 4WUUE 1W8NA 2IQ9H 3KXFD 1MFEL 3BIKA 4NHCH 2NY6C 2X89D 3NIGE 4J8RA 5LXGH 5EZJA 4DGVL 4LVEA 5FUOL 1VESA 1QFWM 4JG0H 3E6FB 2A74A 1MLBA 1NLBL 4GUPB 1RJLB 2OX5A 1G9ML 1YY9C 4KRNA 5IK3A 2P5EE 3RWFB 1ZEAH 4GH7B 2BC4B 4QCIB 5D7LA 3TNNA 3VI4F 3MOAH 3WFDH 3LV3A 3OSKA 4XGZA 4HUUB 2PXYB 4LLMA 2M2DA 4F7CB 3SDDD 4PG2C 5C0RL 3BXNA 3NFNA 1Y6MR 1LHZA 4HEPG 5L2KA 2PCPA 3QPXL 4OF0A 3QHFH 4BSWB 4CMMB 2H2PD 4UNUA 5KBNC 1HQ4A 1QYGL 4PRIB 3PQYB 3QWOA 5B3JF 2B2XH 1NDMB 4OM0H 1MREL 1K8DA 5CFHA 3H7BA 3VDAA 4TVSa 5ITBH 3DTXA 5GGSY 3PDOA 4WUUB 4K3DL 5KSVB 4PLOB 4PRBB 3WNLA 3EOTL 3QJFB 3U30C 2CGRH 1ZA6B 5EIIB 4ZD3L 2VYRE 2ERJC 1MFDL 3U36A 1D5BA 1MAKA 1EZVY 3G04B 1R3KA 3P30L 5B3NA 1YNLL 3OPZH 1DDHB 3WL9B 4LP5A 3GMMB 1QQDA 1WV7T 1C5BL 4O02H 3WSQH 2ED7A 3RJDA 1J87A 2BNQD 4NCDA 4C59B 4ELKA 4JRYA 4HBCL 1I4FA 2P5EB 3GSXA 3QCVH 2NY3B 1NGZA 4HIHA 4K3JL 3F7RA 4PRPA 3O2DL 1QFWI 1X6NA 1KC5L 3DO7A 1BVKA 1BZ7B 4LLUA 4X9FA 5I15L 4X9BA 3HI6L 3UP1A 4TNVK 4LNRB 2NXZB 1DN0A 5FYLD 3QBTB 4PJGA 3Q6FB 2DICA 5KSBA 3QNXB 1SQ2N 1S8DB 3L6FA 3JXAA 4HWEL 1X5LA 4GO6B 2MHAA 4HULB 4HUVA 1OSZB 3V52L 1GVIA 1XZ0B 4QRQA 2H9GA 1IE5A 4OZFB 4PG2A 4QOKD 3O3BB 5HYFA 1CFNA 4PRHA 4Q0XL 4HKJB 4HCRL 1QRNA 3EJYD 3GSNH 2XQYG 3MRPB 4OLYH 5I2IA 2EC9U 1AP2A 1RJYA 1WISA 3CX5J 3OKKA 5MERB 5D5MA 1F4WL 3PG2A 2VO5A 1GL4B 2F5AL 1FYTD 3G5ZA 5C0CD 2JLLA 5HI4D 3TBSA 5ELIA 5I1KL 4OZIA 2ARJA 2O5ZL 5EC2B 4HLJA 5E6ZA 4WW1A 1IM3A 4YPGA 5CMAA 3MROA 4EUPG 2ZUUA 3TYGL 1E4WH 4A6YH 2X7LB 3LQAL 1AR1D 5CD5C 1CU4L 2G5BB 1UZ8B 2LU3A 1ZLSH 2GTZB 5IFHH 3KPOA 2B4CC 3FB8B 4N0CC 1BIIA 1C16B 4NZTH 3SDAB 4YXHH 2HLAA 3H0TA 2R15A 5FDWB 4MA1B 5DVMA 3IDIB 1HHGB 3RL2A 1A0QL 2FBJL 1JZ7A 4H1LH 4HC1A 4PJDE 1N26A 5DJAB 4JHAH 3TBVB 3E0GA 2XOTA 1YEEH 5CEZE 3ARZA 5SX5H 2VDKL 3KHOA 3EO0A 3UO1L 4G6MH 3MRLB 1MIEL 2GTWA 4JM2C 2Q7YA 2ZKHH 3MLZH 4JHBA 4UV7H 5F6HJ 5MI0C 1N3NA 2GJ6D 5E5MB 2R2HB 4UU9B 5JHLL 1NCCL 4LLWB 1ROWA 5FF6B 4JY4A 5F6IB 3IAGC 1D6VL 2EYRA 1XF5B 5JW4R 3RWCB 1TVBA 5ESQA 2LVCA 3VXQB 5JIPA 4BK4A 1R5WB 1IL1A 3ZE0E 1UA6L 2UVEA 2R29L 3KG5A 3QUZB 2DQDL 1TETL 4UB0H 4RRPG 3CSPA 5SWQA 1MWAB 5DK3A 3KS0H 2I9TB 4JZOB 3L3KA 1JF6A 1T83C 1ZSDA 2XA8L 3GBNL 1CDUA 2AK4A 3RAJL 3U0WH 3BP7B 2BNUA 4ZFGL 5DF0A 1CL7L 1CQKA 1GC1L 3BISA 3RZCD 2X4PA 1KEGL 3DGGA 5EU5A 1WCQA 1T80A 4Z8FH 4PJDB 4YHYC 4H8WL 5IB5B 2Z35A 3T65B 1AGFA 3DXAD 5E7FA 4PGEA 5KVEH 3VXMA 4FFZL 5A2JH 4PJXE 2XYCA 3OKEB 3S97C 1NMAL 4YHIB 1CF8H 2DQFA 5F71A 5DK0B 2R2BA 2EDXA 4X9HA 5B8CB 3ARDB 4KTYA 1AC6A 3U2SB 5SWSD 1KENL 4A6YL 3NACH 3T2QA 4POYA 5D1ZC 4GAJH 3ISWA 1I1RA 1YMHA 1KEMH 4XNYL 1RPQA 4CU8A 1NGXA 3WLWD 3RL1B 4RFNB 4JM2A 1DBBH 2JJUA 3O6FC 4NZUL 3GSQB 4HAFA 4MMZC 1CG9A 3HG1E 4WNQB 4FMFA 2ICCA 1A4JA 4O9HH 2E7LA 1I8IB 3L5WA 1WTGT 3HS0A 2KBGA 1HQRA 3VG0L 4XP6H 3LZFL 3IT8D 3JWDC 4L8DB 1F3DJ 4KROB 3G6DL 1U3ZA 2P5WE 2RCSH 5TDPB 4U1NA 1G7IB 3KR3L 3H9ZA 4JKKA 2JJTC 3MJ6A 1INQB 4R96A 1J1OH 1T0MA 1HHJB 4YHOL 4EUPA 3LKQB 4GMSL 4Y4HC 2HRPH 3QIWB 4NN5B 1T4KB 2V9QA 3ZTNH 1JGVL 1LD9B 1H5BB 1CVSC 1HXMA 3BQUC 1T83A 4MXQC 2EIZA 1OD9A 4PR5B 1TCRA 1LMKA 4P3CL 4PJXB 1RZ8B 5B39B 3LPWA 3I75A 1U8IA 3GM8A 4X80L 3NZ8A 4OGYH 5C8JB 2YKLL 2R23B 5FKPB 1PYWA 5EZOL 4NC2B 3DPBA 1RV6X 1MAMH 3PGCA 2AEWA 3G5YA 5E8OB 5IP4A 1OQXA 2BXZA 3BGFB 2EICA 3MUHL 3FB5A 3P73A 4PJ9C 3HG1B 3EIFA 3KPSA 1ACYH 1N0XL 5C0FA 2ZG2A 5T1KD 5CJ8A 1HHIA 2UUDK 2AXJA 4Z7QF 1KCSH 3O6FA 2P5WB 4PRID 2ARJQ 2X4RA 1CIDA 2Y6SC 4Y4FD 4Q58C 2C1PB 4GG8B 3LIZL 3MFFA 2JJWA 4P2RA 2V6HA 3OHXA 2DJUA 4ONFL 2V5MA 3A6BH 4XWGH 1J8HD 1DVFC 2PR4L 3QDJD 4KKNA 1OTSD 5I74C 2N1KA 1UEYA 4I5BB 4RRPA 1DQDH 2ICWB 2JJTA 4B7LA 2ITCA 2A6DA 5KSUB 3ULVE 4PLJD 4Y4HA 2CLZA 1P4LA 2ZWLT 2BMKA 3RWDB 3DMMC 1BFVH 2P5ED 3BQUA 1ZLUK 5ANME 2FX9H 5GGSB 2AKRB 2H1PL 4K7PY 2VL5B 1YECH 5J6GB 3V2AR 2NXZD 2JB6A 4ETYA 3S34H 4I3RH 5HYJA 3HMXH 5L9DH 1BP3B 4Y5XC 1A3RL 4XBEH 3QHTC 4HBQA 4LVHC 3UTZA 2NNAA 4YO0A 4AIXA 1J1OL 1ZAGA 4R9HA 5I1DB 4DZBB 4CU6A 4OI7A 1QBLL 1ODAA 4DZ8B 1W0YT 4P46A 2OR9H 1ZKAA 1G7PB 5K9QG 4PJ9A 5IM7A 1MUJA 4I4WA 3LEXB 5ENWB 1WBYA 1XGQA 4ZDHA 3Q5YA 2R56H 1VFAA 4ZNCD 4MD4A 3MRQB 2GKIA 1NL0L 4M1DH 3V9FA 3O4OC 3DX6A 4XPGH 3BWAB 1UM6L 3CK0H 3P0VL 2QHRH 4G8IA 4U1HA 1MQKL 2EYSB 3E8UL 2BSED 3FZUC 2VDQL 2Q20A 4OZGA 4PJCA 4U1IB 5FCSH 1DVFA 3TN0C 4BZ1H 4WEUD 5ANMB 2JIXA 3MRIA 2ZSVA 3VXSD 4AEIL 2BHUA 5BZDB 1K4CA 2YHGA 4JFFE 4QNPF 2CDFB 3NTCL 3DMMA 1TQCB 3IKKA 3VFMA 1NEZB 1WZLA 3M17A 5I8EB 4O5LH 4KKCD 4HJJH 3ARGD 2VKWA 3JWOH 1P6FA 4P9HL 5DJYA 3D25B 1JNNH 3V5KA 4KZDH 2A6IA 1ZHBB 3D3VD 3B3IA 3QEQD 3N1MC 4GKZA 4Y5XA 4KQ3L 1ADQL 2VZSA 2H8PB 2VXVH 4QHNB 3LMJL 3M45A 4D0CB 5KSAB 3RVWD 1FAIH 4OUOA 2Q8AH 4KDTC 3CDCA 3GIVA 5TQ0H 1GGYA 3DV6B 1OGTB 3T77A 2XTJE 2QADC 3QUXD 3RI5K 4D0DA 2A1WL 4XAWL 5AD0A 3B9EA 3IETB 1N0LA 5I1HH 4PB9H 1D3CA 4FQ2H 4NBYB 2JB5H 1MHEA 5HI5D 4I3RL 1GXEA 2CXKA 2DLFH 4NRZB 4PRDA 3BZEB 1OAXL 3HMXL 1KUMA 2EDDA 3EYOA 1T1YA 1MRCL 3RNKB 4O2FA 1F8TL 5C0GB 2WQRA 5T5NG 2BRRH 1IFHL 3GSWB 2PTUA 2WMPA 1KLGB 2VKXA 3AY4A 5D96C 5FCUH 1NCUA 4N0RA 4JFFB 3TN0A 2OTUA 1UJ3B 1KGCE 1TTFA 8CGTA 1RK1A 1CQYA 1VGEL 1KCUH 5GGVY 1AD0B 5F1NB 3FN0L 4O4YH 5E2JA 2DQUL 4UT6H 4OQTH 4P3DA 5DUBA 5EU7C 3GO1H 1MHPH 2NXYD 4XRCB 1KJMA 1DQLL 2VUOA 3LKPB 1RZFH 1CLYH 4G6KL 2NQCA 1FL3A 2BVQA 4MAUL 3FTGA 4LCWE 2OSLA 4P3WA 1JPST 1CI5A 2C3GA 5CEZD 2ATPA 3MYJB 4RAHA 5BXFB 5I8CA 1U2HA 2D0GA 4U6VL 4PG9B 5BRZA 4MGXA 1BM3L 5E8NA 1DANU 4UIMB 3GMLA 1ED3A 4TUKL 4D9QE 4GS7B 3RA7L 4LF3A 1JZ3A 1JHTB 2XTJB 2PW1A 3RUGF 4FFYH 3IAQA 2CO7B 5TQ2L 4QXUH 3SDCD 1XAUA 5J6HB 4V1DA 3O6KH 4M61B 3LS4H 5IESL 3IFOA 4ZTPL 4KDTA 1B0WA 5IMLA 1L7TL 1YUHA 5FHAH 4MJIA 2JKXA 5HGBB 4ZXBA 1N4XL 3AU1B 2DTML 4B0MM 4PJ7A 2BVYA 3MOQA 1MVUA 1UACH 3I50L 3GUTB 4MWFA 4KROD 2E9JA 1TJHH 2VDML 2GSGB 3LQZA 4R26L 5F88B 4YFEA 1GZPB 3C09C 4AY0A 4Y4KD 1BFSA 3QIWD 3WFBH 4OM1L 4K71B 4NCC2 1BQHA 4LLYA 3SGDI 4WI9A 4N0FB 1YEFH 3NH7L 4NO5B 1X9QA 2CKBL 4LCWB 1YEHH 1JZ8A 1BWWA 1CXEA 3MRRA 4NGHL 3KXFA 3FB6B 3IFPB 1KCVH 2UZXB 1CDGA 3FRPG 5JZ7D 1VA9A 1NC4A 1UJTA 1PY4A 1YDPA 5JR1L 32C2A 4K2UL 5BJTB 3PIQA 1DQQA 3V79C 2ZSWB 2CLVB 4NSKA 3VRIA 4FG6D 1H15B 2E7HA 4M7JH 4G9FA 1MHCB 3KPQA 3SY0A 3MACL 5GSRB 4R4FL 3WLBB 3LEVH 1KCUL 3BD4A 3UPAA 4LLVA 1NLDH 2W38A 2HLFD 5C08D 1QSZA 3MCKB 1NFDA 1MCIA 4CN4A 2DWDB 2R69H 3UTSA 3UTPD 3QXDB 4R2GC 5F9JB 3HC3L 4NWTL 3M1BA 4YH6A 3NFSH 4K3HA 2AJVL 1U8OA 4DFHA 2MCPL 3V6FA 1IGYB 2CIKB 2DN7A 3QA3A 2ADGB 1MQ8A 2P8PB 3C5ZB 2FL5A 1AR1C 1UEMA 3B83A 3E3QE 3O3EA 3TH3T 1MJJB 4WTZA 3I85A 3T3PF 2YUZA 3CXDL 3O6KL 4JHWL 3EOBB 1KJ3H 3G9VA 4N8CH 4IDJH 3VE0B 5K9JH 2GAZB 5DMYA 2AVGA 5FHAL 3OBAA 4QRSB 1YEKH 2D9CA 2J8HA 3LEYL 3ARBB 1OSPH 3NIDF 2EKSA 1EHXA 3KPRD 1IKFL 3UCRA 3O2WL 4PJHF 4KK5C 1C7TA 4JZNB 4LFHD 2AEQH 3IJSA 3QFDA 4YHLH 1HI6B 1U6AL 2VDPL 4K8RL 2VMFA 4MNQE 2XZZA 3IDNA 5AYUL 5IFAL 4J7RA 5J1AA 5FO8B 3FONA 1XCQB 3EDFA 1YEHL 4U6XB 3F5WA 1EGJH 3F7YA 3KPLB 5EZIH 4QOKA 2QSQA 1S9VA 3QG7H 2PUQT 5EFIA 5TDNA 3W9EA 3LKNB 2YC1B 3WN5B 2YXFA 2R0LH 2YD7A 4NFCA 4M6NH 4Q9RL 1FYTA 1UKTA 5C6TL 1SM3L 2CRZA 5CEYB 1DCLA 1EO8H 4NOFA 3CSYB 5A2LH 2P8MB 2BSTA 5EBLB 4OCMC 5DJDA 1CD9B 2FJFA 4RMUA 4X6DA 4L3CB 2CIIB 4OI8A 4XH2A 3X14B 3I6KA 4JDZA 1DLFH 3BEVB 5F1SA 3KYNA 2NY1B 4U6HA 3QP3A 4A2LA 5HYQB 1U8NA 3O11B 1LK2B 4JFZH 3FRPA 1NKRA 4MNQB 1KB5A 2Y07L 1F58L 3UJJH 4QGYA 5F89A 2NY2B 2VUYA 4MLIA 3STLA 3OB8A 4P5MB 1WWCA 1UWEL 4EI5A 3IDYB 4Z95L 3RBGA 5DQ9B 1FFQA 4M03A 4NCC1 3FO9B 4KTEH 4DVRH 1T66D 3LKOA 2WIIA 3BI9X 3WLWC 3K8LA 1UG9A 2XWJA 1LEKB 2W9EL 4GKSA 1FVDB 3IKCA 4MJ6B 1AJ7L 1VKXA 2GJ6A 5DZLA 2GEEA 3O6LH 3P4MB 5C0BE 3HZYB 4OKDA 3OKNB 4AH2A 4GOSA 5ADPL 4KMQA 2GY5A 1XGRB 3BE1L 4N9GA 1H8OA 1VACB 3TJHD 5IB2B 1ZANL 3JTSA 3SKOA 1WFOA 3LH2H 1HH9A 2ATKA 1VADB 3CXHK 4RMQA 3W2DL 5C0DA 1KJVB 3IVKA 3WS6C 5JOPE 2FX8H 3GJFK 1OLZA 3AAZA 4DKEH 1HSAB 1WAAE 3PWUB 4RNRB 5TH2A 1TENA 3O3DA 4DOHE 5MEOB 5LQBL 1AGEB 4QTHB 5GRUL 1DUZB 3HZMB 4TUOA 4PP2A 1JF1A 1QBMH 3V5DB 3ZDYE 5A2FA 3K3QA 4KV5F 3V6OE 1A3QA 4UTBH 1IQWL 4L3ED 1N8ZA 2ADIB 3JVGA 4BFIA 5JQ6L 1SYSA 2XTJD 5BV7C 1S7UA 4J3UA 1MCNA 3QXAB 2DQIH 4DTGH 4JN1L 3B2UD 4JM4H 3HZVA 4ZODA 1QSFA 3VI4E 5C0BB 4L8SB 1P53A 1NCDL 1XF1A 2DQJH 1F4XH 1OB1B 2ICWJ 4KGJA 4OCYH 3VJ6B 1WBZB 1WQVT 3ZYJA 5C9JA 4LIQL 4Y4FC 1BFOB 3MRMA 2AJUH 1EO5A 2HYMA 5CJQH 5D7JA 4PB0L 2FH6A 2N56A 4N8VB 4D8PA 1OT2A 4F3FB 1X5KA 1Y0LB 1OTSC 2GI7A 4NKDB 4MB5A 1K9TA 4HS3A 3L3DA 1PX3A 4NQVB 1Z3GL 2AJZA 1ZVHA 3OG6B 3F6IA 3WUWB 1CDCA 2EDRA 3MLSH 3MRFB 3H9SE 4DOHB 4PLJC 5B3JE 4LCWD 2CR6A 3WS6A 4S1RH 4DK6A 4G9DA 2Q76B 1A1OB 4OJFL 4Q97A 3DSNA 3OJVC 1HDMA 4RBPH 4LPTA 3HNTH 4NYLB 2YA2A 3MYZA 1OAUL 4Q2ZB 4I13B 1P7QD 3BPNC 4FQLH 5MHSD 1PZUB 3WNKA 4PGDA 1XR8B 5LGHL 4YAQB 2G60L 4QGTA 3EOAB 3KJ4B 3NFPA 2DBLL 3CLFH 2J3SA 3ECBB 4R7NB 3D39E 1RIUL 1BBDH 1QFWH 4MCYA 3HE7B 4Z77A 4L4TE 4K07A 4R4BA 1O7VA 2ORBH 4RGNE 3EFFB 5T1LD 5IIEB 4U3CA 5C2UB 4C4KT 5DMIL 3REWA 2IQAA 4RISH 5T1KA 1CFSB 2IH1A 4ZOAA 4IRZH 3BWUC 5KSBF 1KBGL 1JGLH 3CLEH 4KKLC 5ERWB 1C12B 3BZFA 4Y4FA 1CK0L 4Q9QL 4G42A 5ICXB 5BQ7A 5HHOA 4FZ8H 4U1KA 3C5SA 4QHKJ 3EGSB 4F57H 1N7ML 1S9WA 5DJ0A 4YXKL 3KPPA 2V7NB 3H9SB 3UYRH 5D7SL 1DBML 3C5ZD 1B4JL 2AJXL 1J8HA 3CU7A 3KDMB 4KJYA 4Z7VA 1I3VA 2WK2A 1A6UL 5D5MF 4F80A 3P2TA 3RP1A 4JANA 1OWWA 2I60H 3C8DA 5I30H 5KN5A 1IJ9A 4OZIF 2W60A 4OFYD 1MH5B 3CVHA 3ARGC 5D2NE 2AJUL 5CJQL 1RZJH 2EXWC 1ZVYA 1AI1H 5HI3D 4FQQB 3T8XA 2XA3A 3PABB 4J12A 1AGCB 3MREB 1X5JA 3WE6A 4Z76A 3D39B 3HC0B 3MR9A 4HFWA 4L4TB 1U42A 1V05A 3DVGA 1BD2A 4RGNB 4KAQL 3GSNB 1WZMA 4C83B 2VZUA 5CZVL 1DBAH 1VFBB 4U1JB 2H26B 3RVWC 4HG4J 5FUCC 2AXGB 2HT3C 5D70H 3MRBA 3ZKND 3LN5B 2E7MA 3V5HB 3N85L 3QUXC 5F1IB 3L95B 1GIGH 4HK3N 5CINH 3TC9A 1ND0B 5INCA 3AM8C 4GW4B 1KLUA 2AQ2A 2XN9E 5HHPB 5E5RB 5HI5C 3B4NA 5ID1A 1AXSA 2FSEA 5IKCB 4A6YB 3MV7E 3RKPA 3UJTL 2Z91A 5GXBB 1U8MB 1QO3B 1MI5E 1KIUA 4X5WA 4HZLB 4MAYC 3O2VH 4J23A 4HXAL 5DUPH 3OWEA 1RU9L 2JJVA 5E6ID 3B8YA 1U8QA 3CDYA 4WWID 1S7QB 1KLFA 5KW9L 2APTA 3C5JA 4JKMA 5DWUL 2VN7A 3V4PL 2NY1D 1CLZH 5D2NB 3QDGE 3RNQB 4XWOD 2NXYC 4TVPH 3X11B 1Q9LA 3BPOC 1UGNA 3HAEB 5T3ZD 3CZJA 4ONHB 4MNQD 4N9OB 3L5XH 5KVFL 1JF5A 5DTFA 5DEZA 4NQEA 4LEOA 1EEYA 3ELAT 3IFNH 4BSVB 3I2CL 1RAMA 5KOVC 3FKUS 4JFHE 2RJMA 3HA0A 1FH5L 4RIRB 4GMTH 5CIPB 3UROR 2C1OB 5DRXA 4L9LB 3L3GB 4X6FA 3SDCC 1IGTB 5DXWA 2DAVA 2XN9B 5CD3B 3JZ7A 2NR6D 5IG7A 2BVOA 3FQWB 1YN7B 4NWUH 3MV7B 3QUXA 2FR4B 1MF2L 2OK0H 4L9DA 1MI5B 1CLOL 3WFEH 3D9AL 2AERT 2OJZL 3CFEB 2O5XH 3SO3C 4I77L 1CGSL 2L4OA 1MCKA 4BUHA 2CH8A 5D1QB 2CDGA 1A1MA 1QPXA 3DVNB 4JM2F 4Y4KC 3QDGB 4JG1L 1T7YA 4MAYA 4GRWF 5INDA 4GAYB 4P4RB 3CFDA 3MO1A 4IIQC 1I1AB 1FC1A 5HJ3B 4OFIA 4ZMAT 5GRZA 4WHDA 4LRIC 2VERN 2QL1A 1MRFH 3NCEB 5IEKA 1KACB 4QXTB 1Q38A 1I3UA 3H7LA 4HXBL 4MA8L 4OLXL 4NQSB 1UH2A 2AI0L 2Z0BA 2DD8L 1A21A 4DQOH 3GFUA 4GRWH 1QR1A 1QNZL 1NCAH 4G43A 1PKOA 5F70A 2X4TB 4LFHG 4FG6C 1ORQA 2X1XR 1E4KA 5T1MB 2BCKA 4U6YA 6CGTA 4HC1L 5DFVD 4TSBL 4HGWA 2WUBL 4Q6IA 2EDTA 1NAMH 1AQDB 2J5LC 4I48A 5MEPA 1KCRL 2E6JA 4K7FA 1ZHKB 1BVLB 4CDGC 3GRWH 1CLZL 5C0BD 5L7XL 4EDWH 3SDCA 4TQEL 3JV5A 3EO9L 5F9OL 3VXTA 4G8GA 3VA2C 2K9UA 5HHXL 1XIWD 4QRPD 4LEXH 4JFED 2AV1B 2H32H 4G6AD 1FFOB 4X5XA 5CEXA 8FABA 4ODUB 1OAYL 1CCZA 5DD3H 2BFVH 2R1XA 5JOPD 3M07A 3QDMD 4XCYA 1OGAE 4Z7QE 3KLAB 3V0VB 4UTAH 2D0FA 4Y4KA 4M43H 2BY1A 3F12A 4Z78A 2DYPB 5GISH 1W0VB 5JLZA 5JIIA 3BSZH 2DF3A 4MD5A 1FCGA 4CVXA 1G7QB 3BZ4A 3I6LD 4IIQA 1MJUH 1KELL 4XPBH 3QQ3B 5DC0A 3PL6B 2DM3A 4LRIA 1N59B 3BD5A 1JWSA 1S9YA 1P9MC 2OK0L 4PY7A 3MXWH 4AEHH 3JUYA 3P0YH 2D0HA 1NJ9B 2B4CL 2AAVA 1M7IB 4MA7H 4YHZL 4JO2L 1BBJB 3INUH 1R3LA 4LDEB 2IH3B 1RUKL 1PSKL 3N06B 3DROA 5SV4A 3VWJD 3VXPA 4S0TD 1Z0MA 3QQNA 3QULB 3SPVA 3PWPE 4QTIH 5EBWB 5JXED 5FOBA 2B1HL 4NDMA 1MFAH 4QY8A 4FABH 5BVJB 1DQML 2Z93B 3W11D 1TITA 4B53A 2APXA 4HZAA 3V8OA 1DZBA 5C08A 4N5UA 4NKIL 4MDJB 3CJJA 1QHPA 4JY6B 1F5WA 1OGAB 1NUFA 1T0NB 5EA0L 4DQOL 3QUKB 5ABDE 5EBMA 4ZQKB 1G0YR 1U58B 4PTUB 4DWHA 2BK8A 4YDLC 5GGTA 4KI1A 4JDVA 1QBBA 1AH1A 2BVEA 1F42A 1IAOB 1QSEA 3BN9C 1K8IA 3I6GA 1JNJA 4M6OH 4CRPA 5BO1H 2VLRA 5EBGA 4EDWL 4M1GL 4JFXA 1C1EH 4HS6B 3BMVA 3HC4H 4JQVC 3SN6N 3O9WD 4EN3D 1CXLA 4QHUB 4X7CC 3H2WA 3W9DA 5ALCL 4PJCF 3MNWA 1OPGL 4OZGF 4PP1C 4XPHL 1PW3A 1P9MA 2H3NA 1MY5A 2ICWI 3FFCA 3KPRA 1P5VA 3D39D 2B8OT 5HVWA 1M6OB 5DD3L 4L4TD 5FECA 3PWPB 4RGND 2DMKA 1ITCA 2ZOKA 4QNPE 2MFNA 3AMKA 1FZMA 5I1IH 2ENYA 3RWIB 1I9EA 4OD2B 3VU2A 1T66C 4EDXB 2FJHB 3C87A 3MCLL 1N64L 3AB0B 3LKRB 3P77B 1H3VA 1LO3H 5HHVH 5KJRH 4L5FH 2CLRB 5CCKH 5FUZH 5JPMB 5DMGD 2VQ1A 1CZ8L 2A6KB 3C6LB 4KQ4L 5FYJH 1ZLVK 1FZOA 3TIDA 5DT1H 3RKDD 5EOCH 1IAIM 4J1UA 5DJCB 3T3MF 4F37F 3AXLB 1ZA3B 1JI2A 2C7UA 3HZKB 1FDLH 4OI9A 4KHXH 4C55A 1PD6A 4HMDA 2NY4B 4IJ3C 1LP9A 4JFQB 1PVHA 5L2JA 3DURA 1XF2A 3JWDL 4U0RB 1KSRA 3ZT7A 4HHAA 4OCXH 4F33A 2KKQA 1H8SA 1IGJB 3AS3A 1F6LL 1A6TA 4LBEA 4FABL 4Z7WA 3DRQA 1GGIH 1S7WB 4MDIB 5HY9B 1LEIA 4WW2C 1JRHH 1JPTH 4YHML 1UKQA 2CXGA 3S96A 4PFEA 4RWYL 2VR4A 5DD0H 5HYSG 4LLAA 3U9UB 1GOGA 4K55A 1NGYA 3NAAH 1XGTA 1A7BA 4YBHA 5FA3B 1T04B 4XCFH 4QHMB 5J4MA 1SEQH 4CVZA 3SE8H 3V0WL 3RIAK 3O6ML 4WIQA 3QZWG 5I19H 4QHKI 2QQNL 2XN9D 1G7MA 2PTVA 3NCYS 3QQ4B 1T22A 1EDQA 4NUJA 5FYKH 4YFLI 2X10A 5EN2B 1QEWA 1IMHC 3QUMH 4HV8B 1K3IA 3TBWB 1U3HB 1NBYB 3MNZB 4D9RD 1IEAB 4PJ8D 2F19H 4G8EA 4XNXH 4NKMB 3RUGE 4B5EA 5E00A 2MWCA 3BKJL 3RZWA 2YRPA 1BQLL 3L5IA 3BH8A 5T3XH 1OAKH 3QI9B 1U8LA 1T7VA 2DQTL 4HWBH 4LARH 3AREC 4CJ0A 3AGVA 4M02A 1K6QL 4YDJA 2X9YA 1FGVH 5DQDH 1O0VA 1LDPL 4YZFF 1JHLL 4JE4B 3GMQB 1I1AD 3BAEH 1KTLB 3E2HC 5HGDB 3OGCA 1U8JB 5KJRL 3T0VA 2YA0A 5IW1A 1XF3B 5DVNA 3NZHH 2HKHL 5H94A 4OLVH 4ONGH 1D6EA 4WW2A 3MV9E 4CNIA 4LOUC 4JFHD 1NUGA 3ARFB 4LVOB 4TNVF 3VWKB 4R0LA 5DT1L 2G75A 3PWLB 4ALAH 4Y7MA 5DD1L 3TT3H 4O00A 2FATL 3SGDH 4WI3A 5C2BH 3HB3C 4UILH 4WV1B 4YDVA 2HJLB 5FO9A 1F4AA 3H8NA 2DIAA 2MQ0A 3OX8B 1A2YB 2Z31B 4OGXH 1CFVL 2MMXA 2Z92A 4QLRA 3RWHB 3RGVB 4HPYH 4YBLB 2EIDA 1HKFA 5KANG 5ICYA 1AY1L 4X4ME 5MP6H 2I9LB 4U1MB 2BY2A 3A6CH 1K5NA 3RUGB 5C0AE 4TSCL 3K2UH 4UIKH 1ZGLB 4OIIH 5E1AB 4PS4H 5ILTH 4WUKH 3U9PH 5C7XL 3HNSH 1MFCL 3QEUB 1AXTL 5F7MC 3DRTB 4OF5A 4IMKC 3ZE1F 3DBXB 2GK0B 5IB1B 1NKOA 4NQCD 5KG9B 1QLRB 1FN4B 5IVZA 1SEQL 3QFJE 5IMOB 1A4KA 1OCWL 1R3HA 3AREA 4EVNA 1TTUA 1NFDF 2DYPD 4LPUA 2J4WL 3MV9B 3IDJB 3BUTA 3HCVB 5DJZA 3PL6D 4G6JH 5D1XB 1YEIH 5DEGB 5ESVA 5FK9B 5LAXB 5GSVA 5HVHB 1KJ2A 4TRPL 4W6XB 1N6QL 2ILLA 4UINH 1N5YH 5DMKB 3BVNA 1MCSA 3T3PE 1A7PH 3T4YA 3WKMH 3ZKQD 1RUAH 5J13B 2HFGH 1EH9A 3QZWA 4KVCH 2IG2H 5J1TC 3QO1A 2GT9B 5C0AB 1DEDA 3NIDE 1F6AA 2VLJD 5D2LA 5LCVL 4PJHE 3ZKNC 2QKIB 4LCUA 2F8XC 4FN0A 3MRGA 2AGJH 2P43B 1JVKA 4PJAA 3IDMB 4LCYA 1ZWIA 4NO0D 4JKLA 3O45A 3LS5H 1KNOA 3ARVA 2ZG3A 3QFJB 4HD9A 5JPNA 1G0XA 5K33A 3S4SB 4PTTA 1FNEA 4IMKA 5DD5H 3L9RB 2VZ1A 4RX4A 2BOBB 1ORSA 4WTWA 3TA3B 5DUML 2VDOL 5TDOA 4N0UE 4KVNL 5CWSB 1PQZB 3MGOA 5E6IC 3M8OH 2DOCA 1JZ2A 5FYLH 3KYKH 3QRGL 1BOYA 2DLEA 3T2NH 2FECI 3QG6A 3DO3A 3GB7B 1OP5H 1OL0A 3BJ91 2NW2A 1AIFB 4LIQE 4YC2B 2YMXL 2HKFH 5L88H 4P2QA 4YQXL 2IPTH 3T0EE 2WBWB 1YNKL 3MSPA 4NJ9H 3VXUA 2DDQH 1INEL 4DEPC 5EO0A 3PWPD 3BRDA 4Y5YC 3ZZ1A 1G6RH 2E5EA 1V7NH 4XPAH 4PJHB 2MQCA 1AE6H 3FOLB 3KS0J 5ISZA 25C8H 3KJ6H 1J0YA 4WO4D 4GAGH 2R2CA 3L1OL 5DJ8A 3VFPA 2AS5M 1KFAH 3S6CA 1BEYH 2C3XA 4HKXB 1RZGA 4YXLH 3RHWK 3RY4A 2NR6C 2VNCA 3A67L 4S1QL 3MX0A 5CHNB 4UV4H 1D5IL 2J8OA 3O41B 2Q7NA 1RUML 4Y16B 1DP0A 2W65B 4J3VA 4CKVX 5K9OA 3NA9H 3SCMB 3W0WE 1Q94B 3EJZD 2AJ3A 4K3EH 4N0UB 1V3KA 2J6EA 4HLZG 3DVIA 2ZZUT 1U8HA 1ZK9A 1AXIB 5J11B 2X4QA 4RWHA 1MCWM 4JY5H 3IS1X 3DUSA 2BSRA 1EHAA 4X7DC 2IG2L 1HSBB 1L7IH 2G5RA 5T5FH 4XAKD 5TE7H 5IBTL 2R4RL 4IOFD 4MQ7B 5LG1A 2WBJB 3JWNC 1PBYA 2FWOA 3OAYH 2Y36H 4H88H 4ZUWB 1KXQE 2AJYL 4JZJB 5I1AA 1C8PA 2A9MH 2ZNXA 3THMH 4FQ1H 4M7LL 2YPLD 4UOW1 4OT1L 3PGDA 4LSRL 4NP4H 4JFOB 5HHME 4MNHB 4Y5YA 5C09E 3WD5L 1X5HA 4MVBD 3SKJH 3FQUA 5DFVC 4L8CA 3B5GA 1WF5A 3PWJB 4UNVA 4YDIH 5F9AC 3MJ9H 4PUBL 4KV5E 1I7RB 4GW5B 2MKLC 5SX4H 3BEWB 4JN2B 1F13A 3TF7C 3W0WB 3I3EA 1I9IL 1VCAA 1TZGL 1WLHA 3TESA 1XIWC 4S0SD 4BH7A 5IV2B 5F97E 5IJVA 4GQ9L 1CICB 2P4AB 1C08B 4PBVC 3OV6A 2HN7B 1CDYA 4Z0BL 3PWVA 1T5WA 2HWZL 1HXYB 3C8KB 1QSVA 2ZCKH 4YEEA 4D3CL 3ARUA 5GIRA 2OL3H 3NPSB 5D7LE 3U82B 1VPOH 1B90A 4XB7A 3MV8A 1MOEA 1M71A 4I1NB 1OTTD 1RHHA 4ZPTB 1VSCA 1IC5L 5IHZA 1M1SA 1ZT4B 3PWNB 4ETQA 1AQKL 1EXUB 1I8KB 1S3KL 3PJSA 1LO2L 2CQVA 4P59H 3VCLB 5TE6L 4LSUH 4CW1B 1JYXA 1IQDB 1FG2B 2R1WA 4PV8A 1A7RH 4NNPH 2FEEL 3ESVF 4FTVD 3ARFD 1YYLL 2W91A 2IPKA 4LSVH 4XTRD 5L0QC 2NY7L 5BS0E 3TVMC 2EO1A 3LQAC 5HHMB 3FO1A 5C09B 3TPUB 4FQCH 2KQMA 3WYRA 2P7TA 3NCMA 2X70A 1XH3A 2APVA 2IANA 2NMSA 2Z31D 2VXSH 1KB5L 3C08H 1H3PL 7FABH 3VWJC 3RGVD 5B4MD 1UM4L 5CP7A 1NCWH 4S1SH 4GKOA 3IYLW 3VFNB 4HIEA 2Y23A 4OAWA 2EH8L 4GG6A 4FQXA 2CKBH 3BIKB 5JXEC 1AKJB 5GHWL 5F9WC 2GCYA 1H9VA 4J8RB 1P4IH 2R0WH 4WWKD 5E2VL 4AL8L 3IRPX 3H3KA 2D7OA 1DJSA 2A74B 2Q3AA 4R8WH 2C4FU 3AMLA 3IGAA 4JRYE 5IK3B 2A6JA 3GBLA 4HWZA 1JGDA 1XIWA 5D7LB 3TNNB 1CGWA 5DHVA 3UC0L 3LV3B 3H3PH 5C9KA 3VRJA 4W6YB 1RULL 1A6AA 5TPWL 3ET9F 4ZUUB 5E70A 3RBSA 3D87B 5TFSH 3QDMA 1JYVA 3KYOA 3BXNB 3NFNB 5E2UL 5KSBE 4M48H 4PPTA 4U7KA 1KIQB 5DR5L 2PCPB 2CD0A 1DQJA 4KRMB 3V0AC 1F2XK 5D72H 1EAPA 1MFBL 5BV7H 5D1XD 5BS0B 1PZ5A 1WIUA 3UTTD 3O9WC 4EN3C 5I18H 2YA1A 4JB9H 3LOWA 3FRUB 4MX7A 5C0IA 4HUNB 4JPVL 3QWOB 2XFXA 3PHSA 1QRNE 3HAEG 4F58L 3Q0HA 2HFFA 4K94H 4N0YH 2OP4L 4Z7VF 1WCBB 1YPZA 1A14H 5D5ME 5HDBF 3MRHB 3RVVC 1BQSA 3TVMA 2ZCKL 3RWEB 1IEBA 5C0JB 5I1EL 1BZ9A 5JA8B 4GBXC 1Q9WA 1T6VN 5CUSH 3U36B 1T7XA 1JNHA 5F7NC 3VH8G 4KDWA 1R3KB 2ESVA 4ERSH 3LPFA 1QQDB 3ZKXC 2DI8A 5EWIH 3MJGX 5DZNA 4ELKB 4J4PA 3RI5F 4F15C 4JRYB 1I4FB 3TZVA 4XBPB 3HPLA 4HIHB 3H6JA 5SWZA 4S11A 5L6YH 2NY6B 5DMGC 5IBUB 1BVKB 1G9NH 3DNKA 1NCNA 1T1WA 4LLUB 4BKLA 1V3JA 2VDNH 1TXKA 3RKDC 1DN0B 4M8QB 4JPKH 1YJDC 2Z4QA 4Y1AA 4YHKH 3ZYOA 1FNGB 1V3LA 1I9JL 4OSUH 5HXMA 2Z8VC 5KSBB 12E8L 35C8H 1QZ1A 3W5NA 4HUVB 2Y5TA 2DI7A 5DS8A 1ULVA 2FGWL 4C56E 4QRQB 2H9GB 2H41A 3W82A 3SKMA 3C2SA 4W4NA 4GT7A 2APWA 3MRCA 1QRNB 2VDRH 2YPVL 3BKMH 5IQ7L 3N9GL 5I2IB 1AP2B 1RJYB 4I0PD 2QTEA 5D5MB 5JW4M 2ZUQC 2VOTA 3DSFL 5MEND 1EEUA 1G7HA 4OZFH 3G5ZB 3O9WA 4EN3A 1N5AB 4QRRD 1OM3H 3O8XD 3TBSB 5CSZA 1SJEA 4QF1A 2X9WA 5E2WH 4NHUB 2GQHA 4WW1B 3H3PL 1RI8A 3SJVA 1IM3B 1MEXL 4OGZA 4YPGB 3SHSA 4KY1L 3RWGA 4G3YL 5I71C 1NBZA 4DGYH 3RU8H 2YK1H 1A6WH 3U30B 2YBRB 4GBXA 3DIFA 2ERJB 4JO1H 1RUQL 5E8EB 4X7SL 3HFMH 3CDGA 3KPOB 4LHUA 1BIIB 4EXPX 3GHBH 3B9DA 5IQ9B 3GMRA 2AK4E 3S37X 2VR9A 4P4KD 1JE6A 2HLAB 3H0TB 1HYSD 1NMBL 2KPNA 3MNVB 5EO1A 4DJMA 3FN9A 1QBAA 3W5MA 3CFJA 4PBXA 1J11A 4WEBH 5E8DH 5HD8C 3PGFH 1CL7I 1CXHA 1VEMA 3RPKA 1URLA 3RL2B 3D1MC 4L1DA 3B2VH 5FM8A 2BHYA 4OCNC 1SY6A 3GMNB 4K9EH 4C56B 4OLUH 5I6XB 1LILA 4NNXA 1T20A 4RMRA 4Z7UA 2OJEA 3VXME 1MPAH 2D03H 4CUCA 1JV5B 1D5ZA 5CUSL 2WWKT 5IF0A 1PX4A 1HN1A 2GTWB 4MJ5A 1YMMD 2Q7YB 5EWIL 3AS1A 2PETA 1N3NB 1QVOB 1FL6A 3RWJA 3T0ED 4I3SH 4QWWD 3BP5A 1QACA 4LSSL 4O2EB 2EEDA 4EEEA 1UB6A 4XNUH 4JY4B 1EJOL 1F90L 1ETZA 1LK3H 4K7PX 9CGTA 1U9KA 4ZOCA 1TVBB 5ESQB 4JEGB 4GUPA 1RJLA 1IL1B 2X40A 3U7AA 4GRWE 1IC7L 3CFCH 4U7SA 1YEGL 3CVHL 4CMHC 2JK5A 4MZ3A 1NCBL 4HUUA 4U3HA 3VFWB 2HT4D 5A40E 5I1GH 5SWQB 4JDTL 3KPMA 1GAFL 3L3KB 1GPOH 1ZSDB 4L3AA 3BH9A 1IGIH 1TZHA 2AK4B 3VH8A 3WHE1 2BNUB 3J7HA 3HPJA 1MCRA 2AJSL 4P23D 2MSPA 2E9WA 4PGCB 5EOQL 2CMRH 5E9DE 2X4PB 1S7RA 2NYYD 1LO0L 4MD0A 2ZUTA 3EHBD 3KLDA 5D71L 1MWAH 3DGGB 2F54E 5EO9A 3GSUA 1FIGL 4U1SB 1P6AB 4XPTH 3BDYH 4CMMA 4WTXA 1IGCH 2OMNA 3PQYA 1NGPL 4PGEB 3VXMB 1EEZA 2UYLB 2I27N 2VLKA 4M5ZL 3VI3F 3BP4A 1I1FB 5H8DA 2DQFB 3L3HA 1SJHB 1BHGA 1EV2E 5ACMA 1JHKL 1JFQH 2FEDC 2NY5C 2VL4A 5KSVA 2VLLA 4PRBA 5E6YA 1P84J 3QJFA 4XVJL 5CEZH 4Z7NF 1RZKH 3D85D 1S78D 1R3IH 3MODH 1NGXB 1HHKA 4C4KO 4JM2B 3HFML 4NM4H 3TM6A 1G7LA 5MI0B 5LGJA 3SQOL 4TTGA 1CG9B 4GRWB 1A4JB 3L5WB 3UBXG 1BZ7A 1HQRB 2YXMA 3DX8A 1JZ4A 5HHMD 1P1ZA 5C09D 2IGFL 3X13A 1NGQL 4IRSD 1A5FL 3QB7C 3BKCH 4RAUA 4BQBA 4OLWH 1NAMB 4P2RE 4B41A 1R0AH 3VGAB 4KJQC 4R96B 5IB3B 1IAKB 4TSAH 3IU3A 3R06B 4EUPB 2XZQH 5E9DB 5FB8A 1OAZH 2H2SC 4UUJA 5E2TL 2F54B 1OSZA 5M7QA 5DC9B 1HXMB 2EIZB 3TLRA 4RDQG 1TCRB 4HPOH 5CJOH 4NQXB 3GI9L 4HKJA 1IT9H 3WIHA 4FZEH 5HDLA 1LO5A 3HNVH 1RHFA 3BPLC 4XC1H 2AQ1A 4IS6A 2YSSB 1CWVA 5KS9A 3NZ8B 4YHYB 5D7LD 3IU4L 4HT1H 2WV3A 1PYWB 4QYOA 1EFXA 4RGOL 3VFTA 2Q86A 4ZFFB 3X3GH 3PGCB 5IOPA 4X4YA 4J6RH 2ZOLA 1ZTXL 2ED9A 5HYJE 3UPCA 4KWUA 3FB5B 1LGVA 3P73B 4LRNH 4YE4H 1OAQL 2XXMB 1FGNH 2X7LA 7CGTA 4Z6AT 3LB6D 2G5BA 1UM5H 5D1ZB 5L2KD 1UZ8A 1MJ8H 5C0FB 4DVBB 1HHIB 1N6UA 3V95A 3O6FB 1AFVL 1C16A 5AZEL 1UFUA 2X4RB 4XP4H 2IFFH 3SDAA 5T1DH 3KPNB 1R5VA 5FDWA 3F58H 4P2RB 3VFSA 3IDIA 1HHGA 3OHXB 1WT5A 5DURB 3ES6B 3FOMA 4ZSOA 4TULL 4FFVD 5TF1H 4JFYA 4M5YH 4JO3H 3ARDC 3I9GH 1NMCC 2YD8A 5DJAA 4NUGH 3N50A 3TBVA 5FYJU 4F7EB 4LGRB 1LE5A 1WZKA 2D4DA 1Z0NA 4PJCE 4OZGE 5L8LB 4Y4HB 2CLZB 5ICZA 1P4LB 2A73A 3MRLA 2BMKB 4RFNC 3ZL4H 5FDYA 3BQUB 5E5MA 2R2HA 3AROA 5JW5B 4PRPD 2VLJA 3IJYA 1I8MA 1N2RA 2NY6D 1NAKH 1RJZA 3C9NA 5EORL 5JW4Q 5JXAH 3ULUD 5K59F 2JB6B 4LNVA 3IDGB 4DUXA 1YY9D 4M62H 3RWCA 5HYJB 3D69A 1R5WA 2R0ZH 3EJZC 2VH5H 2YUXA 3UTZB 2NNAB 4YO0B 3BPCA 1I3RA 5CBAA 1ZVSA 4FQJL 1PG7H 5F21B 1OAZL 2VXQH 3QHZL 4JZOA 1H5BC 2HJFB 4PRHD 1QD0A 2XT1B 4PJ9B 3BP7A 1IM9B 1QRND 5IM7B 4H20H 1MUJB 1DR9A 1UENA 3CIQA 5AZ2H 3T3ME 2HFEB 1WBYB 4IOFC 1HZHL 1VFAB 4PGZA 4XX1G 4Y19E 2EH7L 5FXCH 2ID5A 4MD4B 3T0BA 2ZNWA 1HWHB 4QXGL 1G0DA 2IPUK 3DX6B 3IFLH 3UBXA 5GQBA 3IB4A 4KTDL 5KOMC 3FMGH 1LP9F 4O51B 4G8IB 5FYKU 2DQHH 1S5HA 4I9WE 3GJFH 4PJCB 4OZGB 4J6RL 4WHYH 1UQSB 5GGQH 3BGFC 1TPXC 1Q72L 3JSSA 5I74B 3ARDA 5B8CA 2BNRE 1S7TA 3CH8A 3MRIB 1GGCH 4OBSA 1FSKC 3DVFA 4XVUD 4J3TA 5LVEA 1U92B 2DQCL 4ODTH 1JK8A 1U8KB 5DK2A 2DL9A 1K4CB 1J1PL 3RL1A 5FYKE 3GSQA 4Z5RA 3DMMB 3U48A 4BFBD 3M17B 2KZWA 4WNQA 2A38A 3KVQA 4X0KB 5FKAA 2X41A 3V5KB 5H35B 2A6IB 1JWUA 2W9DH 1B88A 5TDPA 4KZEH 1INQA 4LVHB 2NY0D 5BRZE 2WANA 3GNMH 2YZ8A 3MLVH 4Y19B 3EZ8A 4NJAH 5KTEL 5GGTL 1H5BA 3GIVB 2FIKA 2W0KA 2Y06H 1Z9OA 4D0DB 4PR5A 4WY7H 3UJIL 2OZ4A 1OP3H 1T0PB 4V1DE 5JXAL 1FE8H 1RZ8A 4LLQB 1AGDA 5B39A 4WFED 2F58L 4PRDB 3O4OB 4OV6F 3SE9H 4YZFE 4XTRC 3TIEB 1T1YB 2BNRB 1KN2L 2R23A 5EG6C 5FKPA 1AGBA 4ELMF 1KN4L 1U36A 2XZAL 2YPLA 3EFDL 4XNQA 4F7PA 2X5PA 1A9BA 2E27L 5E8OA 3B5TA 4N1HB 1W72H 2AK4D 5B4MC 1BGXL 1IGFH 3TN0B 3EYFA 2OTUB 5CD5D 1OTUD 1RK1B 2ED8A 2WZPD 3HG1A 1OLLA 1HINH 2X4SA 1JWMB 4P3DB 5DUBB 3NN8A 1DL7L 4ZUVA 1JGEA 5GRYA 1KT2A 1FNLA 4DKFL 4OTXL 4WWKC 1FL3B 2P5WA 3FTGB 2GJZB 3FQXA 3NCFB 4TNWK 1GHFH 2C1PA 2E8YA 1Q0XL 3U7WL 5I8CB 3KXFE 3TCLA 5EU7E 5BRZB 3PDGA 5F3BA 4HUWA 1S9KC 3ULVC 1RK0A 1UWGH 3GMLB 1ED3B 3ZKMD 3EYVA 3IJHA 2IMNA 4JPWL 4LF3B 3GSOA 4NC0B 3UAJD 2ICWA 4L4VD 4PYGA 1GGBH 1EVTC 5KSUA 4JM2D 2J12B 4U2ZA 3ZHKA 3MUGA 4V1DB 2M26A 1JPSH 1ITBB 3DJ9A 3IFOB 3OAZH 1T7ZA 2DM2A 3HHRB 3ZE1E 2VISA 2NLJA 4DN3H 1YUHB 5JA9A 2QADB 1L9NA 3WDIA 1D5XB 2LABA 3K8KA 3RFZC 1MVUB 2FHCA 4MWFB 3U4AA 4XCNA 2DWEA 2D31A 1NFDE 3EOYG 2A77L 3F7QA 2VC2H 3LQZB 2R4SH 2HT2D 4XCCL 5D4QA 5FEBA 2R1YB 4N90D 4UT9H 2ZPKH 3EDDA 1RSFA 5CJXC 4LLYB 4E42A 1NANI 5D96B 1C5CL 3ALPA 3GBMH 3EO1B 4U2YA 1IAIL 4FOMA 5CILL 3KXFB 3LEXA 3EKCA 3LHPH 4LASH 1T89C 3MRQA 5BW7C 2XQBH 2CK0L 1NC4B 1YDPB 3MGAA 32C2B 3V8CA 4J3XA 4DW2L 3UTOA 4WVRA 3PIQB 1DQQB 4X9IA 3SOBH 4HF5L 4HGMA 3VRIB 3MLXH 2EYSA 1TNNA 5A3IC 1EJ6A 5D2LF 3G6JA 4PGBA 2MPAH 5FA4A 3KPQB 3KPSD 1X44A 3SY0B 5FYLE 1MCPL 5F96H 4FP8H 3SDDB 4PJAF 3CFIC 5FM5M 1ZT7B 4LLVB 4X7TA 1LE9A 4M7KL 4D94A 1QFHA 5I16B 2ENSA 4OQ1A 1NFDB 2DLTA 2CDFA 4I0PC 2VIRA 4P2RD 5DVOA 5I8EA 1P4BL 3S3SA 3UTTA 2WW8A 4QOKE 2I07A 5DURD 1J86A 3O8XC 2V17L 2VWEC 1BX2A 4OCWL 3TV3H 4QRTA 4P99A 2Y72A 1YY8B 1YNTA 2PF6A 3V6FB 4F2MA 5ALBL 4KI5D 3QA3B 4Y8DC 1JPFB 2YOCA 1XF4B 5F7YC 2H8PA 1FYTE 5C0CE 3C60D 2FL5B 2UZIH 1FNSH 3C09B 4Y4HD 4XVTH 3O3EB 1IZJA 4M7LT 1FPTH 5CJXA 5KSAA 1B0GB 2VZOA 4MXQD 4PV9A 4PJIA 2UZYB 2VXTH 3DV6A 5H2BB 4P4KC 2IALA 4MJ4A 3QRFM 1HYSC 4CU7A 2R9HC 3MV01 5HYJD 1T89A 1RURL 2EE2A 5BW7A 3BZEA 2VABA 1FLRH 4HWUA 3QFDB 1FBIL 5C3TA 2HAZA 1CBVL 2NTSP 1BOGB 4LAJH 3GSWA 3P0GB 1H3UA 3IDNB 1YC8A 4P46D 5JW4N 1DBKH 1PJ9A 5HGHA 4EOWL 1YA5A 5J1AB 1GJIA 4MLSA 4RCAA 1J05B 5HDQL 3FONB 3MLRH 4N8PA 2GYSA 3F5WB 3F7YB 4QWWC 4QOKB 5BMFL 4KU1A 5GS0C 3KWWA 5EFIB 3W9EB 2KUTA 1F00I 4I0PA 3MRNA 1L0QA 4R2GB 2GJ6E 3MYJA 1FYTB 5BXFA 5C0CB 1L6XA 3O8XA 2P45B 4AT6B 3V6BR 1QKZL 3LDBC 1DVFD 4UIMA 2BSTB 1KJ2L 5DJDB 3P4OA 1INDH 2HT4C 2JIXD 2O5YH 4LSPL 2A9NH 2FJFB 2E9IA 5J89A 4XH2B 2FIRT 3I6KB 2V5YA 4JDZB 1UYWH 5CGMA 1J1XL 3EW3B 4P23C 1A6VL 5LBSL 1A7QL 5EDXA 5IJKC 4M61A 4U6HB 3WO4C 1KIRB 5SX5K 1CE6B 1U8NB 4MXWH 2JCCA 4YIQB 1IBGH 2Z8WC 4P4KA 5AWNH 2KQNA 3LN4A 4NKQB 3D0LA 4NZRL 5F89B 4C54A 4JPIA 3STLB 3QQ9D 2IPUG 3QEHA 3D18A 3ARSA 3IF1A 3NCBB 1QLEH 4YLQT 5T3ZH 1GZPA 2LTQB 2YRLA 4U1GB 3QEGL 4GRLC 3LKOB 2WIIB 4PJFE 1P7KB 1F4YL 4QRUA 2QV2A 2XWJB 1YMMA 3FQTB 1MFEH 3IKCB 4GKSB 1VKXB 2GJ6B 2I24N 4X4XA 4I9WD 3C6SA 3IFPA 1B0RA 4DGVH 5FUOH 2EDEA 4AMKL 1RIVL 2XRAL 3L7FB 1NLBH 3E6HB 2F8OA 1IC4L 3WFCL 1G9MH 1A7NL 4HKZB 4IRSC 4N9GB 3TJEL 1H15A 3JTSB 1JTTA 2N7AA 3SKOB 2IJ0C 3T0XA 5IW6A 1U8PB 4XMPL 3S9DB 3CCHB 1KXTB 2FLRT 5C0RH 4MHHG 3BW9B 3WLBA 3AAZB 4ZFOB 5F7UA 4LAQL 4P23A 2WLZA 3O3DB 3QPXH 1CT8B 5BVPL 1IKNA 2EYTA 3MCKA 5DRNB 2DWDA 1QYGH 4TUOB 4PP2B 5IBUG 2F53D 5F9JA 1GGTA 3G5VA 1MREH 2WP3T 1N8ZB 4GG6F 4PJFB 2FJGB 1IGYA 1SYSB 4K3DH 5FM5O 3EOTH 2P8PA 4ZD3H 1MFDH 2BOCA 2J6EL 2XKSA 4V1DD 4I3GA 3P30H 4U6TA 1YNLH 3ZDXF 4GRLA 3HZVB 1FO0H 3D85A 3U4BL 3WIIL 1C5BH 3EOBA 1KTDB 1SEBA 4B50A 5D93C 1U41A 2XPGB 4M3JA 4MJID 4HBCH 4ZXBD 2GAZA 1Z9MA 1TQBC 3RRQA 5ID0A 3FT3A 4K3JH 3R8QA 1EFQA 3O2DH 5C9JB 4QRSA 3MRMB 1KC5H 1DFBL 1RVFL 3NABL 5EC1A 5I15H 2OLDA 3HI6H 3EDJA 3MLTA 5DMJB 4HS8L 4Y2DC 4D8PB 3FO0L 4WRLA 2DKUA 5IEHA 2QSCL 1JBJA 4HS3B 3L3DB 5EUKB 4GXUN 2AJZB 1CIUA 5T3ZL 4EBQL 5HHOE 3BN3B 4NOBA 4HWEH 5A1AA 2XZCL 3NCJL 4BELD 3CU1A 3V52H 5C0EB 1J8HE 3QDJE 4Z7VE 1XCQA 3EZJB 4XVSL 2FO1A 4Q0XH 2PYFA 5HDBE 5EU6A 3PV6B 5H37G 3KPLA 4HCRH 3VW3L 1YPZF 5DGRA 3QCTL 5E4EC 1NC4D 4AEEA 2BVUA 2GSIB 1F4WH 3QUYD 3ULUC 1FORL 1HDMB 2F5AH 3LKNA 4KMTL 1MJ7L 3WN5A 3JV4B 4MNGE 4XPFL 1HIML 5I1KH 4IMLB 2O5ZH 5CEYA 2EDJA 1I9RL 4PGDB 4G9FD 4X98A 3CSYA 2P8MA 2RIKA 2UV3A 3NFPB 5C6PB 3QDAA 4G7YL 2WUCL 4IM8A 3TYGH 5BV7B 1G9EA 4MCYB 3MOBL 3LQAH 2AXFA 4D2NA 4XNZC 1CU4H 4L3CA 4R4BB 3HR5A 5I75C 3X14A 3K74B 2QQKL 4LQFL 3BEVA 3MLWL 1MELA 3REWB 2IQAB 3UTSD 3C2AL 3PP3H 5T1KB 4NO3A 1CE1L 2X42A 3K4ZA 2FHFA 4TUJA 3O11A 1LK2A 3R0MA 1TJGL 4Y4FB 5C07D 5BQ7B 5HHOB 4U1KB 3ZE2F 5EOCJ 3J8F7 3U0PA 1A0QH 1S9WB 2FBJH 5DJ0B 3AC0A 3KPPB 4Y2DA 5C86A 3IDUA 1J8HB 3QDJB 3VMPA 4KJYB 4Z7VB 3RIAF 3X3FL 3LD8C 2VDKH 5T33L 4XVUC 1P2CA 3UO1H 2HFTA 1MIEH 4JANB 5EH1A 1FO0L 1P5UA 1H0DA 4XBGA 1HNGA 2FB4H 5KN5B 2B1AL 2XICA 4MNGB 5JHLH 1FVDA 2W60B 3DLQR 1NCCH 2YD9A 3CVHB 1VFUA 3VXSE 3F6LA 1D6VH 2GY7B 3B43A 5JORA 1I7ZA 1CGVA 3K80A 3OKNA 4Z76B 3G6AA 4MHHI 3STZB 1UA6H 2R29H 2OXHA 3BPNB 2UY7A 4NQEE 3VG9C 2DQDH 1TETH 4OLZL 2NY0C 5GRJL 2AEIT 4HQQL 2XA8H 3GBNH 3O0RL 3D3VE 3QEQE 3RAJH 4BFGA 5JUEL 4JLRA 1KJVA 3MRBB 4ZFGH 3CMGA 4RQQB 1CL7H 1DBJL 1HSAA 4JJHA 1GC1H 2I5YL 4KHTL 1KEGH 5INCB 1ES0B 5KVGL 2FD6L 1B2WL 5MEOA 2ZCHL 4U33A 4R2GD 4H8WH 3GZKA 4Z7UF 5FUCE 5F7WC 5ID1B 1AXSB 2FSEB 5E8PA 1TVHA 3V5DA 2Z91B 4FFZH 2DJSA 3QO0B 1NMAH 5GZOC 4X5WB 1Q0YL 3KJ4C 2YD2A 4DCQA 1K4DA 4BSJA 1CFQA 5F7EL 1KENH 2YD5A 1U8QB 2V7HB 1OTUC 3WHXB 4UAOC 4KPHL 3QXAA 3VXSB 4X5LA 4XNYH 4F7TA 3TGXA 4NZUH 3D0VA 3MGTA 3WUZA 1NDGA 4WJ5B 5JNYA 2WM0A 5DTFB 1F4HA 4NQEB 3ARGB 3ZT6A 4LEOB 3VG0H 1Z2KA 1YEDA 4KK5D 3LZFH 1YEJL 3BX7C 1HCVA 3G6DH 4EI5D 4EKXA 3KR3H 3ZKMC 3D3VB 3HAEH 3QEQB 1A7OL 4YHOH 3UAJC 3FAXA 4WHCA 1WAAA 4GMSH 1JUFA 5DRXB 4I18C 3PNWA 4X6FB 3WFHB 1JGVH 2FB4L 3VI3E 2XXCB 5GJTL 2E7LC 2BVOB 2HMID 2GK2A 1I7UA 4P3CH 1KPRB 2XI9A 3QUXB 4WCYL 5DEFA 5DLML 3SDXA 5CIPH 4H1LG 1OW0C 5ESAA 3GKZA 1KIPA 4XNMA 5B38G 4Z7NE 3T0AA 4X80H 2DQEL 3VFGL 2WINA 2YKLH 3SE3C 3FQRA 2Y5EA 5EZOH 2HT2C 3OR7A 4IOIA 2BY0A 1K2DB 1XR8A 4YAQA 3DOSA 2O61A 4MAYB 5CGTA 2MCG1 3ECBA 3CFDB 3QNZA 3MO1B 4R7NA 3HN3A 3HE7A 4GLRI 1VEOA 1PKQE 1N0XH 3R8BB 3CPLB 2NXYB 5F9DC 3LRHA 3EYUL 2DLHA 1CFSA 3LIZH 3SE4A 2V2WA 4X8JA 5ERWA 1QR1B 4G43B 4ONFH 4MMXC 1WGOA 2XNAB 2PR4H 4LLDA 4NKOA 2BCKB 3GKWL 4U6YB 4ZO7A 1BWMA 1PG7W 1SY6L 4PREA 5MEPB 1YJDL 4YJZL 3MXVL 1QSFD 4K7FB 2FDBP 5D2NC 2IMMA 4L4VA 1Q8MA 4I18A 5KS9F 1KOAA 3SDCB 1GCFA 2HG5A 1UWXH 1D5MB 1RJCA 4HFUL 4P5TD 4LPCA 3SO5A 2H1PH 5D7JD 4PJ5D 1HE7A 1OW0A 4X5XB 1NPUA 5CEXB 3QIBD 8FABB 3TP4A 3PABA 1NFIB 1ZS8A 3FHQA 5C08E 2R1XB 1A3RH 1AGCA 1A47A 2APBA 2J2ZA 3MREA 5EU4A 3SE3A 5J12C 1ZGLP 3SO3B 4WI8A 4KI5C 3UTPE 4Y88A 5DRWB 1FHGA 3ZMRA 4AEFA 3C60C 1PKQB 4Y4KB 3GSNA 1QBLH 2UVFA 4C83A 3F12B 3IS0X 4G5ZH 1VFBA 4U1JA 2H26A 2ICEA 4MD5B 4NPYB 3RHWF 3BZ4B 4IIQB 2GITA 1P84K 3V5HA 1QSEE 4Q9BA 5F1IA 3NCCB 1VGKB 1Z9LA 3GGWB 1JWSB 1S9YB 2WQ8A 4YDKL 5M94B 3WXWH 1NL0H 5BCAA 4PY7B 4YUEL 1RMFL 1KV3A 1UM6H 4MA3A 3P0VH 3LY6A 4HIJA 1R3LB 4U1LB 4JREC 4A6YA 1VENA 2AP2A 5ACLA 1MQKH 3E8UH 2QSVA 5GJSL 1U8MA 2VDQH 1QO3A 5K93A 4XI5C 3OJMB 3KPRE 3VXPB 4P46C 4HSQA 2GHWB 1FFPB 3SPVB 4ENED 5K59E 4AEIH 1S7QA 4QY8B 4NDMB 5FOBB 2J5LB 1S7SB 5D2NA 5DFWH 4HIXL 3NTCH 3X11A 1MNUL 5IW3A 4H1LA 5C08B 4KKBD 2XWTA 1R5IA 4POUB 1XCTA 5B38A 5HHOD 3UX9B 1CTNA 4P9HH 3DX7A 4G80B 5EBMB 15C8L 1ZHLA 1YC7A 2WWKO 2GUOA 4KQ3H 4JDVB 3GSRA 1ADQH 1JNLL 3U46A 1HOCA 3MPCA 2BSSB 3LMJH 1QSEB 1K8IB 2E3VA 3I6GB 5J3HD 3C60A 5TE4L 4WEMB 4BZYA 4DUWA 1BIHA 3L3GA 1LP9E 4JFXB 5GGRY 5E99L 4IRJD 5C6WH 4AIZA 4JR9L 3W9DB 4UDUA 2A1WH 4XAWH 2D9QB 4RA0C 4DKAA 4S2SA 3MV7A 3HR6A 1A3LL 2FR4A 1U95B 4X83A 1MI5A 3K4AA 2H3NB 3WIHL 3KPRB 1OAXH 4UOJA 3O3AB 1A1NB 3QQ9C 4F8QA 1MRCH 2IAMD 3P4NA 1LVEA 1F8TH 5FECB 1BD2D 2ZOKB 5D1QA 5GRVK 4RDQF 1IFHH 1PEZA 4WHTA 4ZYKB 1FP5A 3QDGA 5IR1A 3WEXA 1C7SA 2B0SL 3OXSA 4G5ZL 2VLME 1U91B 1S5IL 1VGEH 4X6CA 1FL5A 3FN0H 5A43C 4L1HA 1LNUA 2DQUH 2NY5L 2VE6A 2Y1VA 3PHQA 4K23L 1DQLH 3GJFB 2VQ1B 3CFKA 4G6KH 3WXWL 4ODBD 1FZOB 3TIDB 1UCTA 4MAUH 1BF2A 3BGMB 4KKLD 4J1UB 4NQSA 1CFTA 4XP9L 4U6VH 4IHOB 5CP3H 1BM3H 1XGYL 1EHLL 3AY4C 1A6PA 2X4TA 2LQRA 4TUKH 4UQ2A 4PBWD 1LP9B 3RA7H 4YDLB 3HI1B 5T1MA 2O93L 1DUYA 1X7QB 5GS1C 4HKBB 5I9QC 1XF2B 3FT2B 4HHAB 2ITDA 1BQHG 2LE9A 4F33B 2E9BA 4WI5A 3V4VL 1A6TB 1AQDA 1DE4B 1GRWA 3HRZA 4JFPA 3DRQB 5TQ2H 3S98A 5C0NC 1F11A 4BK5A 3QJHB 4M93C 5IESH 4ZTPH 4LVNC 4ELME 1L7TH 3S88L 3Q3GB 3S96B 4NQED 1N4XH 2DTMH 2NW3A 2EXWD 3I50H 1NGYB 1XGTB 1W0WA 2VDMH 1QLFB 5CBEA 4R26H 4CVZB 1NBVL 4DFIA 5J9PA 4PJBA 4OM1H 1TTGA 2HP4A 4HDIB 4OF6A 4LKCA 2QLVB 4FQIL 3NH7H 4YFDB 1W0VA 2HT3D 4L3EE 1T22B 4NUJB 2XIDA 5I8KL 1G7QA 1UCBL 3BT2L 4KDVA 1VERA 4ZXBC 4NGHH 3QQ3A 4Q74A 1D9KC 4AM0B 3P9MA 4K3GA 1QFUL 2P8LA 4HJGA 1W72B 5JR1H 5HBBA 4K2UH 1NJ9A 1M7IA 3BH8B 1JRHI 1UKSA 1U8LB 4YNYB 2Z9TA 5KVDL 4YDJB 3VFVB 4MAYD 2X44D 4FFWD 2OTWA 4ZS7L 4NN7C 4IJ3B 2ARWA 1XGUB 3GMOB 4NM8L 4ELMB 4KMLB 5GS1A 3MACH 5B21A 3CFBB 3OGCB 4R4FH 5D9SB 3PDDA 5HGAB 5F7HA 4WTZG 5HHNA 5IW1B 3SDYL 5HHQA 3LKSA 1HYRC 3MLUL 5H94B 4XCEA 5K9KA 4OCRL 3QUYC 4XHJD 3W39A 2G75B 2X4UA 1NANH 1OGAA 3HC3H 3ME0A 4NWTH 1T0NA 2Q8BL 5FO9B 1DEEA 2AJVH 4ZQKA 2F53A 3ZHDA 4R7DB 4PTUA 2MCPH 3N0PB 5E7BA 4L3EB 5I76B 3TYFA 2Z92B 4U0RC 3UTQB 2CUIA 1WWBX 2FLBT 5A16A 3JWOC 3SKNA 5MHSE 3HLAA 2GFBA 4HK0A 5EOTA 5IROC 3CXDH 4JHWH 3UMTA 1K5NB 1KPVA 4G8GD 3QXWA 4QHUA 5D2LE 3ROOA 1OF2A 5I8OL 3LEYH 3G6JF 3TT1L 1IKFH 1D9KA 4OCLC 5D7KE 4C57C 2YR3A 3O2WH 4ODSL 2OZ4L 4PJAE 4KRLB 3RDTC 1M6OA 2BZDA 3HE6D 3GHEL 1U6AH 2VDPH 5K9QI 1J18A 4K8RH 3DX9B 4WU7A 1BREA 2AABL 1A4KB 1R3HB 3AREB 4LDOB 4EVNB 4RBPK 5AYUH 3RWIA 5IFAH 5E08L 1E4XL 4EDXA 1SMAA 4JO4H 3LKRA 5DJZB 3ZYIA 3P40A 3P77A 1GOFA 5ADOL 4YFLF 2V5RA 3CUPB 5HPMA 4D9LL 4P5KA 2CLRA 5JPMA 2MJWA 1R3JB 3OZ9L 1W8OA 1YQ2A 2ZJSL 1DN2A 1KJ2B 3C6LA 5HYSB 5F3HA 1ZLWH 4TPRL 3QUYA 1U3YA 3BVNB 4Q9RH 3AXLA 4UBDC 4G7VL 5C6TH 2VSDA 1SM3H 4P2QE 3HZKA 1P7QB 3G5XA 2PTTA 2SEBA 3VFRA 3IDXL 4PJIF 4TVPD 3VXUE 1R6VA 4JRWA 3D2UD 3L3JA 3QZWB 1MCOL 1F6AB 5LWYL 5D2LB 2R2EA 3V6ZB 1SHMA 3U0TA 4LCUB 3DUUA 1A6ZA 1S7WA 1T5XA 5DHXB 5ISZE 4MDIA 5IROA 4BM7A 5T1LB 4KRPC 4V2CB 4OFDA 4PJAB 1ZWIB 2FO4A 1M7XA 1T21B 1T2JA 1E28A 1A22B 3O45B 1I7TA 2D7QA 4R6UA 5I0ZA 1KNOB 2Y07H 1F58H 5JPNB 1HEZA 4AG4H 1LO4L 5E94A 5C07A 1FNEB 4KUZL 3U6RA 3ILPA 1T04A 1UWEH 4C58B 4Z95H 1BAFL 1ORSB 3RDTA