3QIBA

Crystal structure of the 2b4 tcr in complex with mcc/i-ek
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
180
structure length
180
Chain Sequence
b'IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 30
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qibA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3qibA01
2NY4B 4HIIB 4LSRL 3V5KA 1GOGA 3NBNA 3TBWB 1A3QA 4OF6A 2J88H 1VACA 2WIIA 3AU1B 3MLYH 1DE4A 1XCTA 4D2NA 3OHXA 1I4FB 5B39A 3ZL4L 2DLFL 1PKQA 4ERSH 1J87A 2EDJA 3S37H 3D3VD 3ARYA 3K1DA 3MBEB 5H8DA 5FO9B 1A4KB 2Q6WA 2ESVE 4ZAKB 4YWGH 1LILA 5C0DB 1JPSL 3R1GH 3X12B 4DKFL 4NUGL 5DUPH 4QWWC 2H1PH 3RY6A 3PP4H 4UB0L 4GAJL 2Q8BL 3TCLA 5K59E 3BQUC 4F2MB 3SDXA 5F7EH 2HT4C 4TVPL 2HLAA 3TV3H 3UYRH 1HNGA 4OFVA 1I3RA 2NY0C 1CDHA 4F3FB 3MJ7A 2QQLL 2IPUG 3MV9B 1Q94A 4I0PB 2PETA 4HIXL 1MJ8L 3VFNA 1UH3A 4PRDA 3T65B 4KY1L 3H9SD 3G08B 1QFUL 1CWVA 1OTSD 1CXFA 3MRHB 2FRGP 3OJDA 1LO0L 4JDTL 7FABL 4LSVL 1N8ZA 2P5ED 4LDEB 2ADIB 3EGSB 1MCDA 3C5JA 1FRGL 3B9KD 3DJ9A 1T2JA 3CUPA 2XACC 4XNMB 5C1MB 4IRJC 1G7JB 1MRCH 1MRDH 3FO2A 4AG4L 3F7RA 3MRIB 4XXDB 1YMHA 4X4XA 3GZKA 4P5KB 1CL7I 3BT2L 4GXVL 5M94B 4LGRB 1W72L 4PIRF 1ZVSB 5FYJD 1S7XA 4HLZH 5DUBB 1IAOB 4G80A 4Y1AE 4PV8A 1J0IA 5E8PA 4ISVA 4LSPL 1AO7E 4MAUL 5D7JB 5CEZH 5J6HA 4V2CB 1QR1B 4JDZA 1EHLH 5JW5A 4XP4L 3H3KA 5BS0E 3STBA 3BRFA 5ICZB 2GIYA 2X4OA 3RL2B 5E8OA 3D3VA 1GGUA 1HEZA 2QSCL 3UMTA 3IGAA 4P48A 1CIDA 2AW2A 4RFOL 5F88A 4RQQB 4ORZC 4OF0A 4OCMC 3KLSA 1KCLA 4ESKA 1LO2L 5GGSY 4E5XB 5GJSL 2Q8AH 2BSRB 3CFIC 3ZE1F 4AL8H 4XRCB 4PJGE 3EO1B 1CLCA 1NCBL 5IV2A 3REVB 4JY4A 1F90L 1SYSB 3NN8B 1F4AA 3QG7H 4K71B 4XAKE 1HIMH 1FVDB 3H9SA 5DS8A 3TN0B 3WDHA 2ED9A 4N8CH 3GIZL 4P3CL 5DHVB 1T0MB 2P5EA 3GSNA 1RK0A 2HTLC 3M8OH 1UM4L 3B9KA 1CG9B 4NYLA 1IEBA 3ROLA 1A6ZB 2XPGB 3NGBB 4LLYB 3EOTL 1YMMB 2OJEB 3DOSA 1U3HD 1KTDA 5KOVC 3LSOA 1QBMH 4XMKL 4IDLA 1T2QH 4XVSH 3H7LA 4GBXC 1JPTL 4YO0A 3LDBC 5EN2A 3TNMB 5C8JA 5B39G 1KB9K 3O2DA 4XBEL 5A2LH 3IRZA 32C2B 3EFFA 4OD1L 4J3TA 5BQ7A 3BRDA 1RZJC 3W5NA 5TQ0H 2R2HB 5ITBH 4LBEB 5CZVL 4GW4B 3IJYB 1YEEH 2XYCA 4KPHH 3GO1H 2VSDA 2CGRH 3O2WL 1U8MB 4MHHG 4KK8C 3OKMA 3W9EB 5EZOL 1UXWB 5HGHB 5DSCA 4E0RB 4M5ZL 2R1WB 1QHPA 1NKRA 2VOTA 1KJ2A 5CGYD 2X4UB 3IS1X 1JGDA 4ODUB 4KMTL 4EI5C 4QCIB 1U8QA 3ZT6A 3AC0A 2R0LL 3GHEH 2OCFD 3IB4A 3LN4A 1FNGB 1G7PA 2CKBL 2E7LC 2DKUA 2NX5D 2FX7H 2PXYB 3TO2B 4KK9D 2WMPA 1KTLA 5FGBC 2VQTA 5DVNA 3BIBX 2VLME 2AERT 5JPNB 3GBMH 3MGTA 3ULVL 3BEWB 3L1OL 1F3RB 2KBGA 3L9RB 2NYYC 1UADC 2V5YA 5GGUA 5A3ID 4MLIA 1OAYH 5CZXC 1U3HA 1YEIH 3NFNA 3ZZ1A 3RX7A 5IWLC 1A2YB 3DV6B 2FEEL 1IE5A 4X5WB 3MRLB 4FQPA 3VFTB 2CK0L 1HZHH 1XF1A 3MCLL 3ZDXE 4XNYH 3VJ6B 15C8H 3K4AA 5HHME 3UO1H 5FF6A 4PRHB 1QLFA 4OLWL 4JE4B 1T66D 1QYGL 1PG7L 5TE7H 3U7AA 4HGWB 2LABA 2EH7L 5EPMB 3SGEH 1UB6A 4JR9H 1CFBA 4NO0D 4NM8H 3ES6A 4Z7WE 2J4WH 5EC2B 1NUDA 5K59F 3HAEB 3V0VB 3MR9A 2EIZA 2JJVA 1GZQB 4KDVA 5HYIA 5F6IB 1DUZA 5K9KA 4H8WC 4Q7DA 4OLZH 2V5RA 5D9SB 4NQXB 3QEQE 1IZKA 4QHNB 5DQDH 1MQ8A 2E7MA 2F54E 2C9AA 1YA5A 3TH3T 1U95B 4KU1A 4IM8A 4Y1AD 5CCKL 3OAYH 2CK2A 1AO7D 2DMKA 2Y1VA 25C8H 3PUCA 5JORA 3QP3A 2K3TA 1P6AB 2NX5A 5DFVD 4NNYB 1D5IL 3RWIA 2PF6A 4QXTA 4XT1C 4L8CA 2IJ0C 4ZUSA 4I13B 2AJ3A 3RVUC 2HAZA 5I8CA 3BZEA 2A83A 3FMGL 2BVOA 1KLGA 2R1XA 3S3SA 2IPUK 1XGYL 2CRZA 3RTQC 3MLTB 1KPVB 3Q48A 4OCRH 1ZOXA 1KC5H 1M05A 3TIEA 1XZ0A 4OD3H 3OJMB 4XAKD 4JHBA 1XCQB 1TETH 4KVCL 3WDIA 4LKXB 4NO0A 1HK6A 3VD9A 3IFOA 5C0JB 3HZKA 3LV3B 3MA9L 3KYNA 2VXVL 4YX2H 5HDQL 4HF5H 5IBLD 1JGVH 3A6CL 3R0NA 1EHAA 4U49A 4YPGB 3QFJB 2R29L 1KJMA 2APVA 1VADB 1XGUA 1LK2A 4M43L 1WZMA 4NNPL 4LPTA 4PRPB 3FT3B 1SEBB 2NXYB 1RK1B 3WO3B 1IKFL 4Y1AA 4PPTA 4HFWB 5KAQG 1K4DB 1AO7A 1KT2B 2ICWJ 3IDXH 3WKMH 2H45A 4KKBD 4Y8AA 4FFVD 5IVNA 4KHXL 4IRZH 5E2WH 1K8DA 3F7QA 3QUMH 4LQFH 3VXOA 4CMHB 4DW2H 1KF9B 2P47B 3RIFF 4PRAB 4LLQA 1S8DB 1A4JB 3D2UB 3L5HA 1CD9B 3OZ9L 2JJSC 1MI5D 3BGAA 5I18L 4XNZB 5AAMA 1G7MB 3HS0A 2I07A 5JMOC 1UH2A 2K7PA 2VLRE 3CFDA 3GB7A 1V7NH 3RPIA 3EHBC 4PJHE 4AMKH 1KBGH 2OP4H 4HG4K 2FR4A 2Z92A 1G6RH 3CX5J 4P9HH 1YEGL 4PJGA 4KHTL 1AGDA 1OF2A 2CH8A 3O0RL 4ZNCD 2OMNA 1UWGL 1RJZB 4KRPD 2R2BB 1ZK9A 3CLEH 5F3HA 3MRKA 4PG2C 1SQ2N 4ELMF 1SJHB 1KELH 2BSSB 1DQLL 2BHUA 5E6ZA 1FIEA 3EJZC 1CU4H 4Z7NF 2ERJC 3ARFC 3CMOH 5EUOB 3H3PL 1T80A 5K9QI 1BOGA 2VDMH 3WHE0 1ZE3C 3HRZA 1KCSH 5GRWA 2GK0A 4UTBH 3MUGA 4LMQE 5GRZA 2EYSA 4I48B 4PJDA 3V6OC 5ALBH 5HHMD 4R96A 2DD8L 1CE1H 4NN5C 5EUKB 4QHLA 5ISZD 2XY1A 3BDYH 1RZKC 4JM2F 2J88L 5E1AB 4HJJH 3LEYH 4KKLC 1H3XA 3TH4T 3PGDB 1SJEA 4ERSL 5LKNA 2A6JA 4WY7H 4BFEA 2E7BA 4ZFZB 1MI5A 1IEAA 1Y6KR 3S37L 3SDYL 1JTOA 3D69A 4YR6A 3V5KB 3OB8A 1HWGB 4K8RC 4OSUL 2WIIB 1OP3H 4YWGL 1DE4B 2Q7NA 1XCTB 4OCXH 4ZFFA 3R1GL 3OHXB 1J88A 5B39B 1I1AC 1PKQB 5DUPL 1KLUB 1ZLVH 4NQSA 2H1PL 3QR2A 5EIVA 4GLRH 3GJEA 1OAQH 4K7PH 4Z7WF 3O3EA 4BA8A 1MH5A 5IBUG 2EO1A 3TV3L 3AGVA 2FECL 5ANMA 1ND0A 4H20H 3SGDH 2DQGH 4KKAD 4RNRA 3SDXB 3WDJA 1JRHI 4OZGE 1AQDA 1WV7T 1RHFA 1I3RB 3MJ7B 5D70H 2WQ8A 1QPXA 1MRDL 4OTXH 3VI4E 4YQXL 3OJDB 1T6WA 2BMKA 2NY1B 1N8ZB 2DQFB 3C5JB 3VFGL 5ISZA 3CUPB 1QHOA 1MRFH 3JWDH 5CEZL 3FO2B 1GIGH 2X4NA 2XI9A 4HEPG 1YMHB 4X4XB 5IVOA 1EHLL 2R69H 1A6WH 2R4SH 5FV2A 5DJDA 1OLZA 1A7NH 1CZ8H 2YWZA 1JHKH 4G80B 5E8PB 1X6LA 4ISVB 1WEJH 4HWEH 4AEHH 3QCVH 3OJVC 3ZKXB 3QH3A 3SE9H 5JW5B 2W0PA 4LVOC 5TF1L 5F97E 5HD8D 2W0FA 2X4OB 5EB9A 5E8OB 2LTQB 2A6KA 3D3VB 5SWSE 4PD4K 5FM5M 1HEZB 3QO0B 2ZPKH 2MQ3A 5FUCE 3IGAB 3S35X 3DV4A 1PSKL 1ACYH 5F88B 4QRTB 4GG6E 1U3JA 4JFPA 4OKDA 2F5BL 2A0LD 4KJWC 1OB1A 3FB7B 3IU4L 2F5AH 4DQOH 4N8CL 1MCSA 5IV2B 3M8OL 4JY4B 3K7UA 3TVMB 3L3HB 1T2XA 2VLRD 1V3LA 3T3ME 1T20A 1UB5A 3H9SB 5DS8B 1FL5A 2JJTA 1H15B 2Z8RA 4KUZL 1I9RH 1LP9E 4HIEA 5C0IA 1ITBB 3B8YA 2P5EB 1QBML 3DNKA 3GSNB 1RK0B 3P9MA 1VFUA 3BN3B 4NYLB 4XAWH 3W2DL 1IEBB 1T2QL 2EDOA 2L7UA 3P30L 5BJTA 4IS6A 3ULSB 2Y6SC 4XCNA 3EYUH 5ABDE 4TQEH 3FT2A 4XHJD 2NY4C 1KTDB 2QL1A 3LSOB 3LS5H 5HHVH 1BJ8A 3ZDZE 5C0GA 2VE6A 4NQTA 5IMMA 5TQ0L 2J5LB 3UAJC 3J7HA 5ITBL 4XWOD 4HS3A 4YO0B 3K74B 1TVBA 5EN2B 2VAJA 1X5YA 1YEEL 4KPHL 4QEGA 3GO1L 2CGRL 3MBEC 2ZP0T 4GQ9L 2Q1EA 4J4PD 1G6RA 5BQ7B 1AR2A 5GSVA 4HPOH 2BZDA 4ZAKC 2Z0BA 4MQSB 1ORQA 5MENE 3HZMA 2VQUA 2PR4H 5IMLA 1CFTA 4K3GA 4N0CC 1TJIH 3FONB 3IS0X 4TVSa 3GHEL 3QQ9C 3OKMB 3ZTNL 2K1MA 2FX7L 2Y06H 3HA0A 3SJVE 4I0PC 1ZV5A 1KJ2B 3D1MC 1JGDB 5D96B 3D0VA 3TF7C 1CVRA 1U8QB 3HR6A 2VLRA 1QTYT 2DDQH 2GJZA 1KCUH 3LN4B 1XT5A 4PJHA 4RDQF 1G7PB 4CU6A 1F13A 4JPVH 5AZEH 1RHHB 1YEIL 1KTLB 2MKWA 3HMXH 3BE1H 5J11B 3C5ZB 3WNOA 4MA8H 3SDAB 3MGTB 1CDCA 1WWWX 1CR9L 1HZHL 4GAYB 4H1LA 4RWYH 4XNYL 4PFEA 15C8L 2PO6D 3IAQA 3UO1L 2EDFA 2AQ1A 5GGUB 3R4DA 1DJSA 1A7RH 1U3HB 4JDVA 5TE7L 3MBXH 3WIIH 4JR9L 1YEKH 3HC3H 5D7JC 4NM8L 2J4WL 4M7ZC 2VMFA 4W4NA 5D7KE 5FF6B 1IM9D 1QLFB 4U0RB 3GMNA 1UB6B 3HI1A 4J4PA 4NRYA 4YHYC 4OLZL 3S4SA 3KYMB 1YNLH 4MDJA 5DQDL 4K3JH 4I0KA 4OZGF 1HXYA 5FA3A 2EIZB 2BERA 4GRWE 1FIGL 4BELD 1P9MC 5TFSL 4WFEE 3KS0J 2C5DC 1DUZB 25C8L 4F33A 5K9KB 2FBOJ 2LAAA 4MXQD 5D7LB 3QXAA 1Q0YH 1TXKA 4DKEH 5KANG 1P7HL 2O61A 3RWCA 5CSGA 3VI4F 2XTJB 5L8LB 4Q0XH 4K71C 3FB5B 4MSWA 1WZ1H 2AEQH 2N56A 3TN0C 5JIIA 1EUTA 1RZ7H 1CDGA 5DJ6B 5BRZD 5JORB 5D5MA 2NX5B 2JLLA 2AK4D 4M1GH 4U7KA 2VC2H 4CN4A 3RWIB 5SWSD 1BJ1J 3RVWC 2LU4A 4QXTB 1RMFH 4XVJH 4L8CB 1KTRL 3NGBC 3WFBH 2IFGA 4OCRL 4ZUSB 2HT2D 4Q97A 2AJ3B 3V6ZA 4GRWH 4LHJB 5T1DL 3U0TA 4X7SH 5I8CB 2PO6A 1T03H 1KC5L 3BZEB 2A83B 2BVOB 1KLGB 4JFQA 2R1XB 4PJCA 4OD3L 4PJ8D 2AV1A 1TETL 3P4OA 4UT9H 3VW3H 4BH8A 4HXAH 5CD3A 1C8PA 2I5YH 4M00A 4YX2L 5J4MA 5IBUB 1IM9A 3K4DA 4HF5L 1M05B 5IEHA 5CD5D 3TIEB 5IFJA 5AYUH 4Y4HD 2P45B 3N1PC 4U1IA 5EO9A 1RV6X 1FFRA 1L4IA 4NO0B 4ZFGH 3F65A 3LKSB 1AQKH 3HB3D 3HPLA 3HZKB 5JQ6H 1D7FA 3HHRB 5HGAA 1KJMB 2EECA 4KJQD 4KQ4L 1UM6H 3WKML 1XGUB 1OSPH 2Q7YA 5H94B 1LK2B 5FO7A 3NCYP 2F74A 3IXTA 4IRZL 3CPLA 4HK0A 2G2RA 3T3MF 3VE0B 3QUML 4N90E 2GJJA 1JPFA 2JCCE 4UDTA 5FYLE 4L8DA 4DW2L 4Y1AB 2CO6B 2HRPH 1AO7B 1LP9F 4S2SA 4A6YH 1I85A 4Q58C 5BRZA 2PXYC 1I1CA 4M02A 4CVZA 5JZ7D 1K8DB 1JL8A 4NHUB 1D5BA 2AK4A 3VXOB 3GMLA 5SWSA 3BUTA 1V7NL 5TDNA 5C0EB 1MQKH 1KBGL 2OP4L 1ADQA 1FCCA 2C3XA 1G6RL 3HC0A 4P9HL 4H1LG 3Q1SH 4NHCH 3BWUC 5CMAA 4CVUA 4LPYA 2OZ4H 5IVXE 3VXTA 2AS5M 3HS0B 2I07B 1NLBH 4GG6A 2H8PA 3GB7B 4PJ8A 2WP3O 3CLEL 3RPIB 3I3BA 3FKUS 3VDAA 2P49B 3SJVD 2FR4B 2Z92B 1KELL 5FYLH 5DEFA 5TE4L 1W8NA 4R4ND 2R2EA 4PJGB 3DLQR 3FOMA 3HZVA 2ZUXA 1AGDB 1MIMH 1OF2B 1OOAA 3ZTJG 3TT3H 1PQZA 1CU4L 1FE8H 1DANT 3CMOL 4Y4HA 5EG6C 1ULVA 3R8BB 5F3HB 3MRKB 3JUYA 1J0YA 2VDML 3PL6D 2F8OA 3EJYC 2FLBT 5F9AC 2FHCA 3S4SG 1KCSL 1KN4H 3GSOA 1NSNH 3F62A 5JDJA 1DVFB 4Y2DD 4HCRL 5DURD 1FZOB 1I7UA 5KG9A 3ARGD 5ALBL 3LPFA 5E9DD 2VTFA 1BOGB 1CE1L 4KZDH 3G6JE 4L3ED 3WNLA 3BDYL 5FA4A 4TTDD 1JHLH 2NPLX 5CILH 3P4LA 3HRZB 4BFIA 2GK0B 1INQB 3MUGB 4HJJL 3LEYL 2VABA 5ACZA 1I8MA 1BQUA 2WANA 2EYSB 3RIAF 4WJ5A 4PJDB 3UJJH 4WY7L 3HPJA 4R96B 1TDQA 3S88H 4QHLB 4F37F 5DF0A 1A21A 3H9HA 4HC1A 4O9HH 3MRCA 2QBWA 4P0DA 4WI4A 3WNMA 1F4WH 4GKOA 4E41E 4OCXL 2FEDC 1RZGA 1FPTL 3ULUE 1J5OH 2HYMA 1KPUA 3RI5K 2A6JB 1LWRA 4ODWA 4UIMA 4S1SH 1MI5B 5DO2C 1OAQL 4K7PL 3D69B 5E94A 1QR4A 4YR6B 5F7NC 5KW9L 4NP4H 4WFED 4EBQH 3B5HA 4JKMA 4H20L 4ZFFB 1SMOA 4O5LH 2DQGL 3SJVA 4NQSB 4NQEE 3ME0A 2VITB 5I8OH 4NWTH 1MWAL 3GJEB 3NA4A 3L3IA 3O3EB 1MH5B 3BISA 2A38A 3RVTC 4JPIA 4KRPB 3QWOA 4D9QE 2O5XH 3O8XB 5ANMB 4R90H 1ND0B 3X13A 4JVWA 1FORH 4LLMA 3PL6A 3BGMA 2BK8A 5D70L 3ULUH 5E6ID 4Z7UF 1N3NB 2IEPA 5C6TH 4RNRB 3TPUA 4OTXL 4Y2DA 3FFDA 5D7SH 2GHWB 1AQDB 5DEGA 1JJUA 3ARGA 2VWEC 2YZ1A 3PG2A 4JM2B 5E9DA 3MNVA 2NXYC 1J8KA 3BKJH 4L3EA 1MRFL 3WL9A 1PZUB 2YPKA 2X1PA 4NFBA 1GIGL 3BP6B 2BJMH 2R69L 1A6WL 3QIBD 2R4SL 3ARXA 2J8HA 5HYQA 2BMKB 5HHMB 1QRND 1A7NL 1CZ8L 2OBGA 2RB8A 2C3GA 2H2PC 3DXAE 1JHKL 5ISZB 5HY9A 3QAZB 1WEJL 4HWEL 4QXWA 4AEHL 1HOCB 1XFPA 3HI6H 3QCVL 4Y19E 3SE9L 2NTFA 3ETBF 4Z7WB 1NFDE 4ZYKA 4HAFA 5DJDB 3QO1A 3C08H 4XNZC 2B39A 1F11B 3NCFB 3ZT7A 3HNTH 4HUWA 2CIKA 2ZPKL 1YDPA 3MJGX 1ACYL 2OR7A 3D85D 4OCYH 3QEQB 2W0FB 3KPPB 4N90D 2A6KB 4CJ0A 5MHSE 1KCRH 3MXVH 1EEUA 3ALPA 4UV4H 4WDIB 2F5AL 4DQOL 2ARJA 1X5AA 2PTTA 1R3KA 4Q9BA 4XP9H 3DV4B 4O58H 1WC7B 2B0SH 2DM4A 3B9AA 1YN7A 3KDMB 1KPRA 4QGTA 4L8SA 5E6IA 2DLGA 2DJUA 5JTWA 4JFPB 1CGXA 1S9YA 2RFXA 1OB1B 1MCOH 4UILH 2JCCF 1I9RL 2H2SD 3MYJA 2X9YA 3L5XH 4FFZH 5T3ZE 2XOTA 4G42B 2DIBA 4K9EL 4XAWL 2KZ1B 5INDA 1T20B 1UB5B 3DHJA 5HHXH 1FL5B 5GS1B 3QDMD 4TUOB 3EYUL 2PCPA 3QIBA 4TQEL 3EDFA 4P9MH 1A6AA 5C0IB 3IKCA 4IMLB 3SE4C 5HHVL 1QRNA 3LS5L 4NSKA 1GHFH 3P9MB 4Z7OF 3CDGA 5BJTB 1T22A 4IS6B 2B20A 5C3TA 3QUMB 5IVXF 2EH8L 4XCNB 3FT2B 2J8UA 4FMKA 2AJXH 2P7TA 3CFCH 1VGKA 2YR3A 5C0GB 2DLTA 2HP4A 2VE6B 4S1DC 4G8EA 4L1DA 5KVEH 5IMMB 4QF1A 2OZ4A 2P44B 5T3ZH 4KKCC 3PHOA 2PR4L 4HS3B 1TVBB 4WRLA 4NBZB 3ULVC 3WLBB 3D85A 2HVJA 1IAKA 2DKMA 1TJIL 3O45A 1G6RB 3NABH 3HNVL 4NCC2 5GSVB 3O81A 1NMCB 4V2BA 1GCFA 1ORQB 2Y06L 3HZMB 2I27N 5GJTL 2IBGA 5IMLB 1CFTB 3RY6C 1EH9A 1UCBH 1TMCB 2FZ3A 5DMIH 3WBDA 1CDBA 1CXHA 3BWAA 2DDQL 1K5NB 1KCUL 1FH5H 1JZ2A 5I74B 1KIUA 4JPVL 4FXGA 1K4CA 5AZEL 4P3WA 3TPKA 3DTXA 5LCVH 3HMXL 4L5FH 2VIRA 3BE1L 2EO9A 9CGTA 4MA8L 4CVXA 3D0VB 1JWMA 1JK8A 3ESVF 4RWYL 2VLRB 4G6AD 1N6QH 4PJHB 3QQ4A 4KWUA 3LRHA 3QDMA 2AXFB 2NXZD 4NQED 1A7RL 3SGKA 1Z5LA 4DUXA 3MBXL 4X4ME 3BMWA 3ULUF 3WIIL 1MFDL 1YEKL 2VAAA 3HC3L 1MCHA 4ZSOE 4H1LB 2DQCH 1G9NL 4EQ3A 3STLB 3EOAA 5HDLA 1CGSH 4XMLH 4P4RA 4JDVB 2CRMA 3KWWA 2JK5B 3JZ7A 1KENH 5D4QA 3ZKXC 5CSBA 1YNLL 4K3JL 3ZMRA 3G6JA 2R2CA 2LTQC 3DRQB 1VERA 3ILQD 4N0YH 4NRYB 1I3GH 3S4SB 3RL1A 1Q0YL 3QA3A 4MDJB 4JLRA 4ODVL 5TQ2H 2GSIA 3DXAD 2MPAL 4GKZA 3ZKQD 1HXYB 5FA3B 4Q0XL 3Q5OA 3OF6D 3S7GA 3D39D 3RZCD 1WZ1L 3RY5A 1RZ7L 3QXWA 4EZMA 4X5LA 3BSZH 1AHWB 2O61B 3RWCB 1X5GA 1JZ4A 4M1GL 2VC2L 3TVMC 4Y88A 2NMSA 4C57C 1RMFL 1OY3B 3WFBL 4MA1B 1F58H 3TC9A 1OTSC 3KPMA 1JF6A 5D5MB 4X7SL 3SPVB 1T03L 2A9MH 4NQEA 4LLUA 1GRWA 3MRRA 4PJ7F 4DN3H 2X44D 1XMWA 3F58H 4PGZA 4UT9L 3VFRA 3RJQB 4HXAL 2EXWD 1MJJA 3V6ZB 4AZ8A 2I5YL 2PO6B 5EIQA 2CLRA 3T0BA 1MPAH 1OTUD 1QSED 4ELKA 5AYUL 3FHAA 5I16B 2JJUA 4MB3A 2AV1B 5B3JF 3LS4L 3D6GA 2J5LC 1OD7A 3VCLB 4ZFGL 5CD3B 4F9PA 1AQKL 5JQ6L 5IBTH 3L7EA 5T3ZD 1IM9B 4YNYA 4MQ7A 5IEHB 3L3KA 1V5JA 5IFJB 1UM6L 1TZHA 5EO9B 4JZJA 5TH2B 4QRUB 1IAMA 3HPLB 2NR6D 4TNVK 3DXAA 2DYPD 1DQQB 1JTTA 5HGAB 3K3QA 5DRZA 4ZPVA 3OF6A 3D39A 1TZGH 3RZCA 4A6YL 8CGTA 2Q7YB 5FO7B 4X6DE 2F74B 3IXTB 2AJZA 4I18A 1NFDA 3CPLB 4HK0B 2G2RB 4IIQA 4YHPA 5D96C 1A9EA 1XF3B 4G9FE 3VGFA 4MWFA 4UDTB 4L8DB 1BHGA 2J6EH 1MQKL 3RGVD 4S2SB 3KPRE 3EOBA 2VH5L 1A8JH 5DA4A 4RRPA 3RX5A 2GEEA 3Q1SL 2BRQA 4NHCL 3LQAH 4UT7L 5J11C 3C5ZC 1NLBL 2Z35A 3SDAC 1D5BB 2AK4B 1OW0A 3GMLB 3EKCA 3ARDD 2PYEE 2QJDA 5SWSB 5TDNB 5KSVB 1LEGA 1HYSD 3RWEA 1DBMH 5FYLL 3A0OA 4WU7A 4DUWA 3HC0B 2E3VA 2EDYA 1T5XA 1U3HC 2YD3A 1MIML 3VXTB 4JFDD 5FXCH 1CDIA 1QSEA 3O41A 4CRPA 1FE8L 4GG6B 3K8LA 2H8PB 2P24A 4LASL 4PJ8B 4LSDA 4W68A 5DVMA 3T0WA 2IAND 1PG7W 5EO1A 3PP3K 5DEFB 5CJBA 3WSQH 1KN4L 3HZVB 3FOMB 1NSNL 3BDBA 1PQZB 1H3VA 4MHHI 4Y4HB 1NGQH 1EA9C 2M2DA 4KZDL 1FC1A 3WLWD 2HMIC 2C4XA 1ZHBA 1F3DH 1JHLL 2A77H 3MZGB 5CILL 5F96H 2DYPA 1FV1A 3LD8B 4P4KD 1I7UB 3UJJL 5KG9B 1RVFH 3MLPA 1IT9H 1IAIL 3VFUB 1IQWH 1EVUA 4JO1H 4RGMB 3OB0K 2MSPA 2XTJC 5FA4B 5CGYC 4O9HL 1U8KA 1T1XB 4P2OD 3UTPE 1C7TA 1IILE 1F42A 5D2NE 1F4WL 2VABB 4OQTA 5ACZB 1I8MB 1J5OL 3RGVA 4MAYD 3FJTA 4WJ5B 1MAMH 2A74A 5FCUH 1K2DA 3HPJB 4S1SL 2N1KA 4KK9C 4N1EA 3PV6A 3H9HB 3DUSA 1IAII 3BD5A 3U82B 4PGJA 3C6LD 3ARDA 3KVQA 3MO1A 1RZGB 4U1JB 2VRAA 3U36A 4YZFE 1KB9J 2PN5A 4O5LL 1OCWL 4ODWB 4UIMB 5A3IC 1T7YA 5F9WB 2XWJA 1GPOH 3QPXL 4OZFA 5E94B 3FTGA 4JFDA 5HI5D 1PX4A 2O5XL 3W0WE 3OKEA 4R90L 4Q9QH 5DXWA 2DTSA 5A2FA 1FORL 4LPCA 2IANA 3SJVB 1GJIA 2E8ZA 3V4VH 3ULUL 1FO0H 2ORBH 3JXAA 2X70B 1MHHA 5C6TL 3L3IB 5D7SL 4MA3A 1Z3GH 1NAML 4JPIB 1E4KA 3QWOB 2D3VA 2KQNA 4OZ4A 1GH7A 4YHMH 4HUVB 1CXLA 4LLMB 1DQMH 3PL6B 4DJMA 3BKJL 3TBSA 3BGMB 3EYSH 3U1SH 1XGRA 2CUHA 4X4MA 5EORH 3TPUB 1A5FH 2BJML 4Y2DB 3FFDB 2HN7A 5LAXA 3H2WA 4Y5YA 4ZSOA 4P4KA 5DEGB 3RJDA 3C6SA 3OAUH 3ARGB 4U6VH 3B9VA 5E9DB 2OYPA 3MNVB 3JV4B 4L3EB 4PJIE 4XX1E 4CNIA 5IGXH 4P2OA 1ZVHA 3WL9B 2YPKB 3HI6L 5J3HD 2V7NA 1EJ6A 3TLRA 3ZYZA 4MAYA 3OPZH 5F21B 5HYQB 3VXUE 1EK3A 3C08L 3ARWA 2ILLA 4RRPG 5MI0B 2BVUA 3NPZB 1S7SA 3MUHL 4POYA 5HY9B 3HNTL 1QG3A 3C6LA 2NTFB 3PE9A 5F1NB 4ZYKB 3QO1B 2M8XA 1LD9A 1UENA 5MEOA 1KCRL 3MXVL 1LEKA 4GRWB 4MXVE 4UV4L 4HUWB 3D9AH 4XB8A 5EU6E 1YDPB 3MJ9L 1QFHA 4AEFA 4XP9L 4O58L 2B0SL 1GC1H 3QXTA 1Y0LA 3CXDH 2MTPA 1SYVA 1MAKA 1XEDA 4PBVC 4U3CA 5BZWA 4F7PA 3WIHA 3KPRD 3BVNA 1MCOL 4UILL 2ARJB 2PTTB 3L5XL 3JV6A 2PW2B 3T0AA 4FFZL 3BP7A 1YN7B 1S7WB 1KPRB 4JO4L 1DVFC 3F12A 4L8SB 4PR5B 3IFLH 5IBLC 2PYED 4WO4D 4X6DF 5HHXL 2DICA 3UTTE 1S9YB 2RFXB 3V4PH 1YNTA 3MYJB 4P9ML 3QPQC 1G7QA 1GHFL 3LH2H 4H5SA 4I3RH 1LK3H 2J8OA 2RQ8A 4J2XA 3IF1A 1W0YT 4KKBC 3QIBB 2PCPB 4FFVC 1P5UA 2J6EA 1O0VA 3VWKD 1A6AB 2AJXL 4NSKB 3E6FA 4JG1H 3O4LD 3SE8H 3T09A 3CFCL 4OZIA 1RSFA 4FQLH 5EOTB 5KVEL 3PXHA 4IRSD 1T21A 3CDGB 1T22B 4JB9H 4DGVL 5HI4D 3HE6D 2G5RA 1RURL 43CAA 2VO5A 4U2YA 1VGKB 3NABL 2FWOA 4KRLB 4G8EB 5JUEL 5C08D 4OZFG 4QF1B 3PHOB 1OAUH 1UCBL 3LKRB 3D85B 2HVJB 2GI7A 1DQTA 1IAKB 5DMIL 3AM8A 3UTPD 3O45B 5HYJE 4KRPC 2P8MB 1EXUA 3O8XC 3KPRA 5HVHB 5I15H 5LCVL 5GIRB 4L5FL 1BOYA 1HHIA 1FNEA 1RZIB 2FZ3B 2W9LA 4ZUVB 2UYLA 4ZO8A 4WHDA 3BWAB 2PYEA 4JQXA 4WO4A 5C9JA 1N6QL 3EYFA 4JM2C 1K4CB 4XTRD 3DTXB 1XR9A 5IW6A 1A7BA 3ZO0A 2VIRB 2XZQH 4L3CA 4JO3H 1DEDA 4CVXB 1JWMB 4X6EA 2HFGH 1JK8B 2UWEE 5FYKD 1OQOA 3N06B 3TA3B 5CGMA 2DRUA 2DQCL 3WD5H 2HT4D 3QQ4B 1CGSL 3QJHB 3QDMB 4MJIE 4R7NB 1U9KA 3RAJH 3THMH 3QJFB 1RU9H 2OMBA 4Y16B 1Z5LB 3VWKA 2BNQE 1UEYA 2BVEA 4W4OA 3QAZC 2VDNH 3UC0H 4AH2A 1KENL 5LXGH 3O4LA 4HG4J 4YZFF 2VAAB 1BD2E 5F1OB 3HZYA 2FYYA 3BH9B 4IRSA 3N9GH 3MV8E 2VZSA 3MQIA 1HINH 4HS8H 4P4RB 3HE6A 3QYCA 4EEEA 2D2OA 4X6FA 3GMRA 5HBBA 3KWWB 1DLFL 4N0YL 1JMZA 1I3GL 4I5BA 5C08A 2P5WE 4NJAL 1PKOA 3QEHA 2C26A 3G6JB 2RHEA 1M6OA 4YDJA 2DQJH 5IW3A 2J7LA 3BSZL 3RL1B 3DIFA 3QA3B 3VXUD 2Z93A 4JLRB 1T4KA 3QDAA 4OZHE 2R39A 2GSIB 5IB5A 4B50A 5F7DA 5M7QA 4HWBH 4GKZB 2R23A 3RU8H 4KKAC 4Y4FB 2ZZUT 4BQ8A 4LVHB 2YUZA 3I6KA 4PJIF 5CEXB 1X5IA 4BZ1H 2A9ML 4X4YA 1IL1A 1U91A 1RJLA 1C1EH 4DN3L 4X9BA 3F58L 5SX4I 4PGCA 1OSZA 4HKZA 4RBPH 3T1FA 5GS1C 2XA8H 5EU6D 1HSBA 3O2VH 1SY6L 2EDTA 5E2VH 2NXZB 4NQEB 3KLHD 1MPAL 3MRRB 4HH8A 3KAAA 5KSUA 1QNZH 3ALXA 3I6GA 5IMOB 3VFRB 3V52H 3M17A 5E24E 4ZTPH 3VU2A 1MJJB 1WFNA 2KUTA 4JGMA 5F44A 5IBTL 2IFFH 2CLRB 2V6HA 1DFBH 1XF2A 3QUZD 1U6AH 2HTLD 4ELKB 2ZCLH 2ZNWA 5TGBA 5F3BA 3LQZA 1SBSH 3BEVA 1SJXA 2ICCA 2BFVH 1E4XH 3OKOA 3L7EB 5HD8C 4MQ7B 3L3KB 1TZGL 4P9HC 4OT1H 4M03A 1A22B 1NMCC 5GGTH 1J1OH 1TZHB 4FTVE 4JZJB 3QCTH 3W39A 5IM7A 3WYRA 3PQYE 3VXUA 1OAXL 4O2CA 3DXAB 5AYQA 4ZPVB 3A67H 3D39B 2FHFA 43C9A 1KXVC 5DRNA 5I74C 3BDXA 1H8OA 2A0LC 4M7LH 5AWNH 4Y19B 3U4AA 3LQAL 2WWKT 1WISA 4KQ3H 2AJZB 4I18B 1NFDB 4IIQB 4YHPB 4LSQH 3BW9A 1A9EB 5FCSH 1YEFL 4MWFB 2HFTA 1FNLA 1R24A 3KPNA 3QRFM 3LPWA 3EOBB 4UOW0 1DBML 1DDHA 3BKYL 5EU6A 5E00A 4YHOH 3ISWA 4YHZH 3L3JB 4X7TA 1WK0A 1MFEH 5C09E 2FNBA 1JZ7A 1KEGH 1ZGLM 2ID5A 4WU7B 5GS0H 3RUGE 1U36A 2DL9A 3BKCH 4HD9A 3WSQL 2XIDA 1T5XB 2D0GA 4PD4J 3VGAB 3VH8A 1PFCA 3QUZA 1QSEB 5ERWA 2P24B 1U93A 1NGQL 3O4OB 5C0AE 5CUSL 4ZOAA 2J2ZA 4XWOC 2DWEA 5EO1B 4AEIH 1JN6A 4V1DE 2XXCB 1FAKT 2A77L 5EZLA 5F96L 5T3XL 3TT1H 5CZXD 4J4PC 1QP1A 2X4RA 1PDKA 4EVNA 1RVFL 5CSZA 1IQWL 4A2MA 2VZ1A 1ZHBB 1KJVA 1ACZA 4ZS7H 1F00I 2DYPB 4PJXE 4KFZC 1FV1B 1BD2D 2NY6B 1WFOA 2UY7A 1MAML 4BSWA 1SMAA 4NOBA 3IETA 5FCUL 3MV8D 4JHAH 4UTAH 1G9ML 1AHWC 1OP5K 1MCLA 4I4WA 3JBG7 2L0DA 4Z7VE 3X11B 3LEVH 4PJEE 2YD5A 1U8KB 2XNAB 4MA1C 2WBJD 2AKRA 1I8LC 1MEXH 2P5WD 3RGVB 1K2DB 3MSPA 2GY5A 4C56E 4UQ3A 4NDMB 1GPOL 3PV6B 1HH9A 1Z6JT 4WFGD 3DUSB 1NCAH 3ARDB 4Q9QL 3MO1B 2WUBH 2YUVA 3U36B 1E6OL 3JWDC 2PO6C 4XVTH 4RAUA 3V4VL 1FO0L 2ORBL 2XWJB 3FTGB 5FGBA 1AC6A 1CFSA 2XG5A 3O11A 4LLVA 1JNHB 3OKEB 5J57B 3N50A 4I0CC 5EBLA 5L8KB 2PNDA 3F8UB 4M61B 4RWHA 5EDXA 2IANB 2LVEA 3U1SL 3VDCA 5DC4B 5EORL 2ZCKL 1MHHB 5D8JH 1A5FL 4K7PY 2UWEA 4OZHF 4G8FA 3OAUL 2DAVA 4U6VL 3GSWA 3WMSA 4A2LA 1AI1L 5KANI 4NFDA 3TBSB 3H7BA 3P3YA 4LPWA 5HXMA 4TSCL 4Y2OA 2HN7B 2IQAA 5LAXB 1BD2A 4Y5YB 4ZSOB 4P4KB 4OF5A 4XMPH 3C6SB 4MXQC 3MV8A 3CSYA 1NJ9A 5F6HI 1KULA 3Q2CA 3NCCB 4FZEH 3EJJX 4CNIB 4P2OB 2V7NB 3NIDE 4XPTH 2WBJA 1YUHA 5DGQA 1ZLWK 5H37H 2P5WA 4MAYB 3LN9A 4IHOA 1M7DA 4L4VE 3U4BH 1EMTH 2E5EA 1S7SB 5DD6A 2X4PA 4Q6IB 3HLAB 4W81A 4FTVD 5FKAA 5FUCC 1IGCL 4RCAA 5F7FA 2HT2C 3LKOB 3CXDL 2I9TB 1LD9B 4YFLF 5MEOB 4S1RH 1LEKB 2BSTA 4XCEB 4ZTOH 4PJ8C 4HHAB 5IJVA 3VH8G 2FO1A 3LKPA 3FT4A 2CLZA 5INCA 2OM5A 4N0UA 5C0CE 5J0BA 4MZ3A 1Y0LB 1ZVYA 2YC1A 3IFLL 4ZG1A 5CD5C 4UU9A 5BZWB 4F7PB 2CQVA 4H88H 4Y4HC 3BVNB 2YBRA 2Y72A 3V4PL 3RWFA 3EHBD 4QRPE 5TE6H 2F8VA 3JV6B 3HB3C 3LH2L 3BP7B 4I3RL 1CQKA 2OL3H 3F12B 4OF3A 1ES0B 3LD8C 5AZ2H 1SM3H 4XC1H 1T04A 5I1EH 4KJQC 5KSBE 3IVKA 1YNTB 4RGMC 1DQJA 4ZUWA 3K1KC 1G7QB 4JG1L 3SE8L 2E6PA 1PZ5A 5DLML 4TNWK 2HRLA 3UJIL 2ADJA 2C4FT 3IF1B 3BUYA 4JB9L 4CMMA 3TESA 4ZOCA 4G3YH 3GRWA 1E27A 3MRFA 4HDIA 1DLHA 5JZ7C 3E6FB 4M93B 4X5XB 4FXKA 1T21B 3T8XA 4FTVA 5J1AA 5DD1H 1OAUL 5F9WC 2IBZX 5DA0B 43CAB 4F80A 5CBEA 3FQXA 5I15L 4KKLD 5IHUH 3QHTC 1QBBA 4DKAA 1EGJH 1P53A 4R4NC 4PTUA 1E4WH 2YD1A 1U2CA 3F7VA 4AY0A 2FO4B 3PGCA 3KPRB 4WW2F 3CSBA 3LKQA 4AYFA 1IFHH 3PL6C 4C56D 4PJXF 5IP4A 1I1AD 2XZQL 1HHIB 4H0HB 4JO3L 4ENEC 4FMFA 2UYLB 4Y2DC 1EJOH 3RFZC 2PYEB 1BF2A 1FN4A 4WO4B 5C9JB 3EYFB 4RZCA 3ARGC 4U33A 4M48H 3RAJL 5GRUH 1XR9B 3THML 1RU9L 5IW6B 5LJYH 2JIXB 3RUGA 3MCG1 1B0RA 4L3CB 2BVYA 2VDNL 4TTDC 3UC0L 5LXGL 4KGLA 1J18A 4X6EB 2VDLH 2W0KA 1INEH 1IQDB 4YXKH 5IG7A 4M7KH 3N9GL 4O2EA 2IMMA 1HINL 1GZPA 1YY9D 4HS8L 4DZBA 3D48R 1F6AB 3RKPA 5MI0C 3X14A 3Q6GH 1HNFA 2EICA 3VWKB 1JNJA 4AH2B 1XH3A 3O4LB 2VQ1A 4M62H 4XCFH 1JYNA 3L3OA 3MNZA 1GGIH 3LKNA 3HZYB 2FYYB 1ZANH 5EU7E 4IRSB 3K46A 3OKDA 2DKSA 3HE6B 4G43A 3G04A 5IFAH 3GMRB 4LCYA 2FB4H 4BQ6A 2DQJL 4M6NH 4JKLA 4I5BB 5C08B 4XNUL 3LRSA 4OCLC 5I1KH 2V2TA 2R0ZH 2V2WA 3QEHB 1F3JA 4ZDHA 4HWBL 3OXSB 2DBLH 4Z7VA 4PJEA 1M6OB 1GOHA 3RU8L 5ID1A 2LAGB 5JR1H 2FDBP 4YDJB 3DVNA 3LN5B 1WF5A 3T3PF 4GXUM 2VLJE 1NCTA 2I24N 2IH1B 3AS3A 4QTIH 4BZ1L 1AR1D 1T7XA 3DIFB 4F7TA 1F5WA 4DVBA 1T4KB 4C56A 1C1EL 1NBYA 2XZCH 5IB5B 5F7DB 3FQRA 1I1AA 1R5VA 3UTQA 2R23B 4L8SC 4K3DL 2XV6B 2DLEA 1QSFD 5EBMB 3H42H 1TPXB 2XA8L 4MNGA 1AH1A 2YPVH 3I6KB 4YIQA 5E2VL 1WSST 2EDQA 4WI7A 4X4YB 3UTSE 1U91B 5K9JL 4RMTA 4JFOA 2ATPA 3RQ3A 4PGCB 5AG8A 1QNZL 1OSZB 4HKZB 3T1FB 5I1DA 4K3EL 3V52L 4ZTPL 1HSBB 3WUWA 3QIBC 4P23D 3CIQA 2IFFL 1DFBL 2G60H 4UNVA 2ZJSH 1U6AL 1A7OL 1G0DA 2AI0H 4LPVA 5KSUB 1SBSL 3STZA 4UOJA 3M17B 4QRPD 3VRIA 3WKNA 4TSAH 2EZ0D 2BFVL 3NACH 3EW3B 1FNFA 4R7DB 4H0GA 1KIRA 1XF2B 4OT1L 3V7AG 1DTUA 5TGBB 5GGTL 5F3BB 1J1OL 4X6CF 3QCTL 1RPQA 4R3SA 3BEVB 3U7WH 2FHBA 4MNHA 2Y6SD 3IDMA 4U6TA 5GZND 3OKOB 1V3JA 4L4JA 4QYOA 4WUKH 4HV8B 1NLDH 2JTDA 3E2HB 5HVHC 5CHNA 4M7LL 4OLEA 1E4JA 5AWNL 5EO0B 3W39B 4KQ3L 5IM7B 1KV3A 5JW4N 4YGVA 3VXUB 1IJ9A 4LSQL 1RUAL 4WCYL 2UV3A 1O7VA 5IQ9B 2YXFA 4O2CB 4F15B 4EUPA 1J0KA 4PJAE 4WTZA 3GMPA 43C9B 1QSFA 2FGWH 4M1CD 5DRNB 2GT9A 4P2CG 4YHOL 3PNWA 2H2SC 4NJ9H 5I1IH 2OXHA 4YHZL 2CD0A 2XWTA 3BW9B 2AJYL 2B4CH 4EI6A 1MFEL 3KPNB 1R24B 3TA3C 2XICA 3QWQB 3TJHD 3LOWA 2CR6A 1A3RH 3ZYIA 4YFLI 1DDHB 1KEGL 1SEQH 5EU6B 5GS0L 3BKMH 3I50L 3BKCL 4DWHA 5E00B 4P23A 2YPLD 3SGKC 4Y16C 5GXBB 4PRNA 5DQ9A 5HGDA 5E8EA 3WFZA 1UM5H 4PREA 2RIKA 4WI9A 4AEIL 4QRPA 4M7JH 3TT1L 3O3AA 1F6FB 1U2HA 1ED3A 3VH8B 3QUZB 4NBYB 4OGAD 4KDWA 5ERWB 4MQTB 3UTTB 3LY6A 4GW1A 5KSBA 1T1WA 3FOLA 2DWEB 4JVPA 4NZTH 1RFDH 2ZWLT 1JN6B 5ICXA 5EZLB 2I26N 4ZS7L 1C16A 4PBXA 1ZXQA 3UBXA 5I1LA 2X4RB 4JFFE 1EGJA 3TBWA 4ZODA 2ENSA 5CSZB 4JHAL 5D7JD 4EVNB 4UTAL 5GGVH 3AU1A 4NC1E 4WHYG 1KJVB 3EDJA 4WFHE 3MUJA 5JOEA 2ADFH 1CK0H 4Y4FC 1VHPA 1MEXL 1U3ZA 4LVHC 1NQBA 3ZSSA 3ULUC 3IETB 5KVGL 3PGFH 4OIAA 4I4WB 1VESA 3ET9F 3Q0HA 4YBQD 3BPLB 2LQRA 1PY9A 1NCAL 2NY5C 2AKRB 2AGJL 5F7YC 3H0TA 4G6AC 4LDOB 5E56A 4NKOA 4YDKH 3QRGH 4KGJA 5BW7A 3B9DA 4OV5A 2NXZC 4I2XE 4UQ3B 1JPSH 3P11L 4XVTL 3WUWG 2YPLA 1UCTA 4DKFH 5F1IA 1HH9B 1DCLA 2Q8BH 3GNMH 3RP1A 2VLJD 3DMMB 2YA2A 4LF3A 1MCEA 4D0BA 4RAUB 2DF3A 4B7LA 1WICA 5D8JL 1N0LA 1CFSB 1CL7H 4HIXH 1MJ8H 3RVWD 4LLVB 4NQCE 2QQKH 5HHOE 1V7MH 1G7JA 3CXHK 1QBLH 3CDCA 5EBLB 4F9PC 4P5KA 2N4IA 4F8TA 3UP1A 3RVVD 1EFXB 2E9JA 4HX1A 1FVEA 1FRGH 1IAOA 5A2KH 2UWEB 3ILQC 4JZJC 4G8FB 4XMPL 1W0VB 4ODHH 3S36X 5D7JA 3AMLA 3GSWB 1S9KC 1CLYH 3KPOA 4FZEL 2DL2A 3H7BB 3Q5TA 3SO3B 2QSQA 5ICZA 3VFVA 4W6YB 1L0XA 1VFOA 4PJFA 4XPTL 2IQAB 1BD2B 3BYYA 4YXHH 4EUPG 4KI5E 4X6BA 4LSTL 3MV8B 4I18C 1TTGA 3CSYB 2BY3A 4IIQC 3U4BL 1EMTL 5T5NF 4U1LA 1Z2KA 2F9BT 4GT7A 4ZUUA 2WBJB 1YUHB 2W0LA 1P9MA 5FHBH 2P5WB 5DRXA 3UPRB 1CN4A 1KIPA 5KZCD 3V0AC 1M7DB 2BSRA 3Q6FA 3VMOA 4S1RL 1OW0C 4ZTOL 5DD6B 5HDBF 1H3PH 4XXCA 4QXUH 5FKAB 3ARTA 5ITFA 3LPGA 4JM4H 2VLJA 2EXWC 4K55A 2EDHA 4OCNC 5A43C 4BJLA 4RGNE 1VA9A 3VGAC 1OTUC 2VN7A 2BSTB 4HWNA 4H88L 1F90H 5IJVB 3O4OC 5TE6L 1LO5A 4WTWA 1VFAA 2CLZB 5INCB 4HUNB 3ARBD 5I8KL 5IEKA 4N0UB 1X5FA 4KK5D 3QEUA 4HJ0C 1QACA 2OL3L 3T2PA 2YC1B 3G5ZA 4UU9B 4XC1L 3OWEA 3WJJA 5I1EL 1UM4H 1UEMA 4XBPA 2YBRB 3UBXG 3RWFB 2X05A 1IGFH 2OTWA 2WV3A 2V7HA 3ARVA 4U31A 2NR6C 4R0LB 1NFIB 1M7IA 2NY6C 4D94A 1T04B 32C2A 5ICYB 4XMKH 5FKPA 1TQBB 3IVKB 4G3YL 4UDUA 1DQJB 1NH6A 1JPTH 4ZUWB 5JIKA 3ROOA 1S7VA 5L9DH 4ODTH 3RGVC 2ADJB 4JZNA 5DD1L 4FXLA 3BUYB 4CMMB 4OD2A 3SKUD 4XPGH 4YHLH 5D7IF 1ZGLB 3MX0A 4HDIB 1DLHB 2K9UA 3H3BC 4XGZA 3LB6D 3VFOA 5CWSA 4U1GB 2OR9H 3VRLE 2YD8A 4JFFD 3ARDC 4QCIA 2OX5A 4FXKB 4JO2L 3T8XB 4FTVB 5IHUL 1D5ZA 1BECA 1PGRB 3T0VA 4UOW1 4KH2A 1TTFA 1P7QB 1E4WL 5D1QB 5EZOH 5DJXA 3UZEA 4M5ZH 3TO2A 5IR1A 1B90A 4LP4A 2EDKA 4PJAA 3FQXB 2R0LH 5IVZA 1IFHL 1T7ZA 4HAGA 2CKBH 3ARSA 4LGPB 1ZT4A 3ARBA 2DMBA 5ESQA 1XR8B 1EJOL 4Y89A 3F7VB 2WIMA 3PGCB 2XKSA 4M48L 5GRUL 3LKQB 3WLWC 2DM7A 2WM0A 2MMXA 2VDLL 4UAOB 1MCBA 1INEL 4YXKL 3REWA 4WEMB 1FN4B 4P4KC 3EO9H 4RZCB 5J1SC 3HKFA 1WWBX 5T1MA 3MCLH 5E8DH 3RUGB 3Q6GL 4Z9KB 1B0RB 3HAEA 3C8HA 4P2OC 4M62L 4NOFA 3ARPA 4XCFL 4S10A 1JIBA 1GGIL 1B88A 2EH7H 1HHHB 4Z6AT 4DZBB 4NQXA 2XXMB 1R6VA 4V1DB 4K94C 4PRPD 3X14B 1YYMH 5KVFH 3MROB 1HHJB 3SQBA 4Q6IC 2FB4L 1XH3B 1BFOA 2VQ1B 4M6NL 4N1HB 4FG6D 4XWGH 4G6JL 4JFFA 3BZFA 4FABH 5I1KL 1S9WA 2R0ZL 1KGCE 1Z9MA 4CGTA 2DWDA 3OKDB 1OM3H 4BZ2H 3R8QA 5J12B 4LKCB 3L5IA 4LVNB 2DBLL 4G43B 4F9LA 4WW2B 4D0DA 1WFUA 5JR1L 4LCYB 5C70A 2ZSWA 1LHZA 5HI5C 3MYZA 4PJXB 2W59A 4KI5D 1CIUA 3LRSB 2VXUH 1TNMA 4XZUB 2V2WB 1J1XH 2XZCL 3X3GL 1F3JB 3VFSA 2FJGA 4Z7VB 4KMLB 4PJEB 5ID1B 4ZO9A 1WTGT 3LHPH 1A0QH 3DVNB 4NZRH 3VD3A 4TNWF 4JZOA 3SKOA 4IDJH 4F7TB 5KS9E 4DVBB 4C56B 1NBYB 5C0ND 1R5VB 3UTQB 3CAFA 2HJFA 3MV01 1AJ7H 1AGFA 3ARZA 1D6EB 5CJXA 1I7RA 1KFAL 3S35H 1JNNH 2BP3A 1W72A 4YIQB 2G60L 1FLRL 2ZJSL 3FL7A 5KOMC 4RGND 2AI0L 2ATPB 3LV3A 1QFWI 5I1DB 5J3HC 1CLZH 3WUWB 4TSAL 3NACL 1J10A 4KVCH 5FOBA 2QLVB 3OAZK 4PRPA 3FT3A 4M93C 1SEBA 4J6RH 4JFYA 4L1HA 3ZE1E 4OAWA 1EAPA 3STZB 3U7WL 4YGAB 3WO4B 1KT2A 3VRIB 3DHMA 5C6WH 5JPMB 3MC0A 4GKSA 4WUKL 2IF7A 1CICD 5IJKA 3BXNA 1NLDL 3ORJA 1JVKA 2OTUB 1ZTXH 1AXTH 1IKFH 4R3SB 4PRAA 2RCSH 2VYRE 1DBAL 5C71A 5BV7B 1J8HE 4MNHB 1A4JA 3F6IA 2YN5A 3IDMB 2YXMA 3WEXA 3UJTH 4Z0XB 4KHXH 4QYOB 5SV3A 2YOCA 2FGWL 3V79C 3HR5B 4Z7QE 5CHNB 1RZJH 4HMEA 4OI8A 5I1IL 4KKCD 3GJFH 3TYFA 2M26A 2C1PA 4YGVB 4PLNC 4LFHG 4L4VB 3AS0A 3ULVD 2B4CL 4BQ9A 4EUPB 3QQNA 2I9LA 4WO4C 3GMPB 1A3RL 1QSFB 1RJZA 2GT9B 1SEQL 5FO8A 4OFIA 3BKML 3PNWB 2Z4QA 3HMWH 2E27H 3I85A 2Z31D 3GBLA 2FL5A 4X98B 1WLHA 5IROA 2XWTB 1BJ1H 2BSSA 1UM5L 4KHTH 1P6FA 3V5HA 3HAEG 4EI6B 4PG9A 4M7JL 1NC4D 4P23B 3VRLF 1LQSR 5GS2H 1BGXH 3VWKC 2X4QA 4PRNB 4W4OC 5DQ9B 5HGDB 5E8EB 1R3JA 4PREB 4EXKA 2YUWA 4IRSC 1WT5A 4CU8A 2YRLA 4NZTL 4QRPB 1RFDL 5HI4C 4AIXA 3HE6C 3WS6A 2BCKA 3O3AB 4RMWA 1MCKA 1CICA 4EKXA 4K3HA 5GGVL 2IBBA 4GW1B 2MQCA 5KSBB 1T1WB 1FAIH 3FOLB 5L6YH 5IOPA 5ICXB 1IZJA 2H41A 3OKLA 4HKBA 2ADFL 1CK0L 3B2VH 3UBXB 5I1LB 5HYEA 2CKBA 3Q3GA 1IM3A 1OWWA 3PGFL 3UPAA 1ZA6A 3IXAA 1UYWH 2CIIA 2EDLA 1B0WA 4FHBD 1KLUA 1UJ3A 1J0ZA 2ADGA 1P4BH 3O6FD 2CUIA 2FSEA 2XZAH 1KG0B 4PY8I 5FAAA 3SDYH 4G9DA 1TPXC 2V2XA 2IQ9H 4YDKL 2BY2A 3QRGL 3DARA 5SWQA 3BP5A 4OSUH 4XTRC 4EDXA 3U9UA 3RWDA 2FD6H 2ICWI 3UZQA 1UC6A 1IC4H 4XNXH 4JY6A 4NBXB 1JRHH 2Z31A 1TNNA 2NW3A 2AXJA 1FYTE 4NQDE 2EDXA 3GNML 3H0TB 4NKOB 1QFOA 3RWHA 5SX5H 1Z9LA 4DVRL 3FQTA 1NC4A 5FK9A 4DZ8B 4OV5B 4M6OH 3ZKNC 2YPLB 4U6HA 5F1IB 5CEZE 3TVMD 1CL7L 3DX6A 3PJSA 2QQKL 1V7ML 4LF3B 1QBLL 2EC9U 3M1BA 1CD1B 4D0BB 3OX8A 2DTMH 5DZNA 3RGHA 1DUYB 1F6LL 3NZ8A 2DQFA 3QDJE 4FQHA 1LNUA 4Z18A 4ODHL 5JXEC 4NKMA 1CLYL 1JNLH 2YK1H 5BVPH 3QXDA 4YQXH 5E5UB 4QTHA 4HX1B 1FVEB 2ZUTA 3E2HC 1GC1C 3VFGH 5KS9F 3U7YL 4LL9A 4YXHL 3DURA 2VXQH 4QT5A 4M7ZB 3KPOB 3QXUA 4F15C 3VFVB 5HJ3A 3O6FA 4PJFB 2BVQA 3RDTC 1I8KB 5FHBL 4G6FD 1UJTA 3QO0A 5HHQA 4X6BB 5J56B 4YHYB 4P46B 3K0WA 3C2AH 2XA3A 1HH6B 1BFTA 5TF1H 4U1LB 1B2WL 1VEOA 1QOKA 1H3PL 4QXUL 1A64A 4QRTA 5IHLB 4ZUUB 3IYLW 4JM4L 2E8YA 2BHZA 5DRXB 1KIPB 2DMCA 5E4EB 1GGBH 3FB7A 2D7QA 4BSJA 4OGZA 3Q6FB 5B8CB 3KLHC 1PSKH 4OFKA 5DJAA 5ACLA 5I2IA 5EWIH 3TVMA 1U8OA 1FFNA 3L3HA 1OVZA 2CRIA 5DMJB 4J8RA 4KC3B 5IMKB 5ITFB 4YE4H 2VLJB 3DI3B 4Z0BH 2F5BH 1H15A 3IU4H 4GQPH 1X6NA 2DQDL 3I3EA 4FFYH 1Z0MA 3QUZC 3C5ZD 4DUVA 2GAZA 3SDAD 4K23H 3I02A 1A6VH 1NEZA 1IGFL 3JV0A 4O02H 1LO5B 3ULSA 4BKLB 1VFAB 4LLDA 5E08H 5IEKB 2G75A 3QEUB 4KUZH 3UTSB 4PP2B 4Z7QF 3ZHKA 3VGDA 3V6OE 3G5ZB 5A1AA 3PXJA 4XBPB 3W2DH 3RRQA 3P30H 1TCMA 2OTWB 2CDGA 3SKMA 5T5FH 2V7HB 1CE6A 2FCBA 4HQQH 5L9DL 2E7CA 1M7IB 4ODTL 5D6DC 2FATH 5FKPB 4HUXA 4XPGL 4UDUB 2JB6A 4YHLL 3ROOB 2P8PA 2HMID 3BPLC 4NC0B 1S7VB 1NGXA 2OR9L 1BQHA 4ELME 1HI6A 1A7QH 3FONA 4GQ9H 2APXA 4U0QB 4JZNB 3HRPA 1H5BB 2C3HA 4LGSB 4OD2B 5FM5O 5D7LD 1U3YA 2DJSA 5FGRA 4PRIE 5KZCB 5J1TC 4Z7NE 1C08A 3K2MC 3FZUD 4XGZB 2XTJD 3VFOB 5CWSB 1RZKH 3HTLX 5E6YA 1OLLA 4MX7A 3DMMC 3BP4A 1D5ZB 5C0BE 1EZVY 5DHYA 2VKWA 3ZTNH 1RHHA 5DJXB 2W38A 2AXGA 3C5ZA 5IR1B 5F8QC 4PJAB 3SDAA 4JREB 2ESVD 3P0VL 4GAYA 5IVZB 1IKNA 4U4BA 5E95B 3PDGA 1ZT4B 3ARBB 4WEBH 1HILA 4TSBH 5ESQB 2W91A 5I71B 1VCAA 4QRRE 3V8CA 3TO4D 4NQDD 2WP3T 3EO9L 1CGWA 4AT6B 3L3GA 1CR9H 5E8DL 3SO3C 4KDTC 5CEZD 3B43A 1NMAH 1JWUA 4KXZI 2Z9TA 5E99L 1C5CH 1OARL 4FOMA 3REWB 5D2LF 1UXSA 5T1MB 5SV4A 3LRGA 3KYMA 5KVFL 1YYML 5I66A 2WBJC 4XWGL 1Z0NA 4FABL 4BUGA 1FGNH 3BPNB 1OM3L 4BZ2L 3FB6B 1MLCA 2UUDH 5D7LA 4JQIH 3VFMB 2ZUYA 1BFOB 1EBAA 3TIDA 4JRYE 5KVMC 3FB5A 4JFFB 5IB1A 3BZFB 1FIGH 5C3LD 2VXUL 5TFSH 1S9WB 3QHFH 1J1XL 2DWDB 5DJ6A 3DO7A 2XY2A 5BS0D 1CTOA 4C4KO 4D0DB 4D3CL 2WSKA 2ZSWB 4GOSA 3LHPL 1NL0H 1A0QL 4MZ2A 4NZRL 4HEME 5J9PA 2DN7A 4IDJL 3QSKB 2ESVA 2BOCA 1WBYB 1NEZG 3VFSB 1A9BA 2DM2A 2FJGB 4RMVA 1AJ7L 2C3WA 3TO4A 4NQDA 4HKJA 3B2UD 2CR3A 3O9WD 3S35L 1YPZE 2APBA 1JNNL 2VNCA 3IDJA 1UT9A 4JZOB 3SKOB 1GGCL 2C7UA 3MACL 4I2XB 4X9GA 4L8BA 4R0LC 3TNNA 5T1DH 2HJFB 5BO1H 1HQ4A 1AGFB 5GRXG 3SEPA 4HLJA 4GH7B 1NCUA 1I7RB 2YHGA 1TQBC 4NCC1 1CLZL 3WFHA 2YA0A 2YZ8A 1W72B 2AJUH 5IIEB 5F7KC 5KSAD 3LKSA 3QB7C 4J6RL 1DVFD 1KB5H 3IDYB 5E1HB 4NQCB 1BQHG 5HHOB 5H94A 5FOBB 3LQMA 5JHDE 5FM8A 1I75A 3QPQD 4KAQH 4PY8J 4U1GC 3QNZA 3VE0A 5BVJA 4JFYB 2WZPD 1DL7H 1ZTXL 1AXTL 3KNBA 1NCCH 2UVFA 4OAWB 1EAPB 2RCSL 4LCCA 5ENWA 4KQ4H 4O4YH 5CJOH 4K7FB 5D1QC 3OR7A 3ELAT 1BFVL 3UJTL 4GKSB 2VN4A 1MJ7H 5BS0A 1KJ3H 2A1WH 2P8LA 3BXNB 2NY7H 4D0CA 4NHUA 3S3PA 1PBYA 1RZJL 5EU5A 5C0EA 4HBQA 1WWCA 4PJ9D 3WEXB 4G6MH 1I9EA 5DGRA 5I8EA 1FBIH 4PUBH 3O9WA 3HMWL 2E27L 3TYFB 2C1PB 5I1GH 4UAOC 1RIVL 2I9LB 5I76A 3B8SA 3FO0H 5I30H 5FO8B 3O8XD 4QHMA 2E7HA 5FHAL 2Z4QB 1BGXL 3EYOA 4HS6A 2FL5B 2V9RA 5LGKA 5TE4H 4RGNB 5KSAA 3NTCL 3KHOA 3V5HB 2VLMD 1DVFA 3GBNH 4W6WB 5HHPA 1P1ZB 1FZOA 1YJDC 4PG9B 4L9LA 4QLRA 4Y5VA 4JM2D 2X4QB 3VXPA 1TIUA 4QRRD 1P5VA 1R3JB 1INQA 2ITCB 4HCRH 1JF5A 3BYTA 2CJUL 1FAIL 1FNHA 5J12C 5L6YL 4LVNC 3T04D 4NRXA 4PRBA 4WW2C 2BCKB 3SHSA 3B2VL 3GIVA 3NAAH 1CICB 3EYVA 3MLXH 1N2RB 1ZLUK 1UYWL 4J7RA 5IOPB 3G5YA 3VG9B 3WE6A 4JAMA 5FECB 4PJ9A 2H26A 1P4BL 3OKLB 2GJ6E 4HKBB 2XZAL 5J7CC 1MFNA 1CXIA 2LE9A 5E7BA 2IQ9L 3GKZA 4ELMA 2CKBB 3Q3GB 4JFZH 1NGWB 1IM3B 2FD6L 1ZA6B 1IC4L 3IXAB 1FPTH 2CIIB 4XNXL 3HUJF 3MRQB 4ODSL 1JRHL 3QEQD 4LCUB 5IHBA 1UJ3B 2F54D 2ADGB 1C7SA 2DBJA 4HLZG 4PJ5E 2VITA 2FSEB 4YFEA 2FX8H 1G7IA 2YUXA 1HHKA 2V2XB 4G9DB 2CUMA 3DYMA 2V9QA 1U8HA 5KW9H 1N0XL 5SWQB 3BP5B 3O8XA 4EDXB 3U9UB 3RWDB 4M6OL 3G5XA 1F4HA 4IOIB 4JY6B 1QVOA 3B6SA 3VMPA 1U0QA 2Z31B 4OM0L 2NW3B 5JDSB 3C09B 3S3JA 1MWAH 1N3NA 4BZYA 3CSGA 3RWHB 1F3DJ 4JHWH 5H35A 1TVHA 1YY9C 3FQTB 1NC4B 5FK9B 4NQVA 4JM2A 2DTML 3RBGA 5AUMA 5DRWA 1NEUA 5DHVH 4U6HB 3MLVH 4HT1H 3TBVA 4QRRA 3DX6B 3P4MA 3PJSB 3VDBA 3WO4C 4DGYH 3GHBH 3BP6A 1JNLL 2YK1L 3S97C 5BVPL 3DVFA 3IU3A 3M1BB 1IGIH 1P84K 3OX8B 2F15A 3NZ8B 2OK0H 1J0HA 4FQHB 4OV6F 5IT2H 1LNUB 1UWXK 1HOCA 4QRSB 2VXQL 4NKMB 4DKDC 5BV7C 4FP8H 4NRZA 3BN9D 3QXDB 3RX8A 4Z7WA 2V5MA 5FM4A 5JIHA 1F11A 1YPZF 4G7YL 4QTHB 1UGNA 1UZ6E 3EFDL 4HPYH 3MRGB 3DURB 4U6YA 1AR1C 3C2AL 3HN3A 4QT5B 4DK3A 5CP7A 1ROWA 3OJ2C 4OQ1A 2F53E 3DECA 3QEQA 5T33H 2F54A 3KPPA 5HJ3B 3O6FB 4U1HA 2BVQB 4IBLT 5HHQB 4WDIA 1GGBL 2R15A 1F45A 5ETUA 1WC7A 5EWIL 2ZKHH 3KDMA 5DD5H 3CCHA 4KJPD 4YE4L 2AXHA 5FDWA 4Z0BL 4P23C 3L6FA 3QUYD 4FQXD 1K8IA 3BHBA 4FFYL 4LU5H 3V4UH 3GKWH 4R6UA 5DJAB 4K23L 5I2IB 4N9OB 4G42A 1U8OB 1FFNB 2R1YB 1A6VL 4C83A 5F7UA 4J8RB 4O02L 1YPZA 3QDHA 3U46A 5GS1A 5E08L 2EZ0C 4TUOA 1I7TA 4WFFE 2WLZA 1X5XA 4IMLA 2GAZB 3U48A 4I1NB 1LE5A 3I02B 4K9EH 3U83A 1NEZB 1ZGLP 1ONQA 3QUMA 4LLDB 5T5FL 5GZNC 2BY0A 2G75B 2NY3D 4HQQL 4LDLB 1GAFH 3CVHH 1FG9C 2FATL 4AEEA 2IGFH 2NLJA 4RMSA 2OTPA 1IGMH 4P57A 2CDGB 3KYOA 3SKMB 4F8QA 2EH8H 4K07A 3ZHLA 4FQ1H 1CE6B 3WLBA 3I75A 5ID0A 1M1SA 1E6JH 1A7QL 1I3VA 4M1CC 3KXFE 4HUXB 4P49A 4G6FB 5EFIA 2JB6B 3FQWA 1T5WB 2FH8A 3P0YL 2P8PB 2BHYA 3BO8A 3H8NA 1NGXB 1RZKL 1BQHB 1HI6B 3P4NA 3TJHC 4ZFOL 3VXME 1K5NA 4RAHA 2W60A 3HNVH 5BW7C 4DOHE 1FVCA 4U2ZA 1JWSA 5GJTH 3QUYA 4FQXA 1C08B 4U6XA 2GJ6D 4TTGA 4BQCA 4MA7H 3N1GC 1G0XA 4K8RL 4MX7B 3NH7H 1YC8A 3T0XA 4HBCH 3BP4B 3HI5H 3EIFA 2XG4A 1AD9A 3ABZA 3QFJE 4WEBL 5DHYB 2AXFA 4TSBL 1WAAE 4HCRA 4WU5B 4PJ5D 2O5YL 4OCSH 5JW4R 2AXGB 3K8KA 2V9TA 4OGAC 2BOBA 3WHXB 2B1AL 4P3DA 2ICES 4WGVB 1NUFA 4HUMB 3STLA 4HXBH 3GSQA 4ZOBA 1NMAL 1HILB 1D9KD 1C5CL 3FN0H 3AUVA 2NNAA 1P4IH 5EOCJ 2JK5A 3FRUA 4GS7B 1CDYA 1MFDH 3EUUA 3L3GB 4I8DA 5SX5K 1G9NH 1CCZA 4M4RA 4PGEA 5GRVL 1NAKH 1JWUB 3DRQA 3LAFA 5D1XD 4M1DL 1R3LB 4LAJH 1FGNL 5EU7C 4BSVB 4OIBA 4P46C 1UXSB 4PYHA 2EDWA 3DGCR 4JQIL 2VR4A 4BH7A 5I66B 4QHKJ 1YECL 4YBQC 2CXKA 4M9OA 3N0PB 5C2BH 3QEGL 3QHFL 1OT1A 1AGEA 5E4EC 1R3IH 1MLCB 4Z7UE 1LO3L 1AD0B 1MWAA 3MRNA 5B8CC 5F7LB 1AHWA 3AFLA 4ODVH 1PEWA 2YD9A 2GJ6A 1NL0L 1WTLA 4HZAA 4XXCC 2MPAH 2YSSA 4PLKD 3TIDB 3N85H 4MNQE 3KLAA 5IB1B 2D9QB 5GS3A 1I8LA 3WIFA 3DO7B 3SPVA 5JO5A 5EUOE 2F53D 3MLUH 4PJ5A 1G1YA 1WIUA 4XCYA 5L0QB 4HUKB 1G6VK 5J9PB 4LOUC 2ESVB 1OGTB 2BOCB 3OV6A 1H3GA 1KYOJ 1UZ6F 1A9BB 4M7LT 5BO1L 3RVVC 5I19H 4Z5RA 1T83C 3WJJC 1D9KA 2HJLB 2EKJA 1AXSA 3CX2A 4OCWH 3TO4B 1Y6MR 4HKJB 4NQDB 5I16A 5I9QC 1A6PA 5F7HA 3IDJB 3QIUD 4OZGA 2AJUL 2GKIA 3VCLA 3W11D 2HT3D 2D7OA 2C7UB 4L8BB 3TNNB 1CGYA 1HQ4B 4O00A 1KB5L 2ZUSA 2YRPA 5D1XA 1UH4A 3KPSE 1JV5B 3WFHB 1BAFH 2MQ0A 1I8IA 1WGOA 3LS4H 1GXEA 5TH2A 4WFFD 3UCRA 4KAQL 4QRUA 5ESAB 1H3UA 1DL7L 3N1MC 3QIWD 1DQQA 1NCCL 3QDJB 3U9PL 1H5BC 2B4CC 4RFEB 2GK2A 5CJOL 4O4YL 4TUJA 1UQSA 2QQQA 1A3LH 1MJ7L 1KJ3L 4PBWD 3P0GB 2A1WL 2N7AA 4F7MA 4XH2A 3QNZB 5BVJB 1XF3A 2NY7L 2L7JA 3CXHJ 3KNBB 3P77A 3T4YB 4ODBD 2DS4A 2AJSH 4LCCB 3BRGC 5ENWB 2VZ3A 3OR7B 2XKUA 5BS0B 2F53A 2GTWA 4G6ML 2P8LB 4NKDA 3E3QE 4D0CB 4JREC 1FBIL 3AMKA 1PJ9A 3KXFD 4PUBL 4BFGA 2W1NA 3BH8A 5EU5B 4LLAA 1XF5A 4RAVB 3VXNA 5KSVA 3QFDA 4Z7OE 5C9KA 5MEND 1SBBA 2VH5H 3NIGE 3ARBC 1X44A 5EU3A 4KK5C 5I71C 2A9NH 3OR6A 5I1GL 2GTZB 4UT7H 3FO0L 1LO4H 1QQDA 5I8EB 5I30L 4LNRA 3VXMD 1Y18A 1MHCB 2FX9L 3O9WB 1D6VH 3QIUA 2VERN 3NFPA 3FCTA 4Z8FH 1EHXA 4UNTA 5I76B 3GBNL 2IG2H 4LASH 4QHMB 3EYOB 4HS6B 5MERA 3PWLB 1LP9A 4ZO6A 1YY8B 4ENED 5KSAB 1BFSA 1NDMA 1JGEA 3QIWA 3CFJA 3CU1A 5I17A 3P2TA 2YA1A 5SWZE 5HHPB 4F57L 4RDQG 3BPNC 4L9LB 1AGBA 4MXWH 4Y5VB 2RJMA 3VFUA 2PTVA 3K80A 1FP5A 3VXPB 3NAAL 5ELIA 3LB6C 5F7WC 2WUCH 2KL6A 1T1XA 3QHZH 4K2UH 3MLXL 4FQ2H 1L7TH 1WAAF 2UY6A 2LU7A 5D7KD 4AIOA 4NC1C 1IAIH 4NRXB 4F9LC 4PRBB 4X9IA 3SGJA 3GIVB 1NBQA 3EYVB 3MUZ1 1K3ZA 1EO7A 4JFZL 1G1CA 3KXFA 3HMXA 4U1JA 4U7MA 3G5YB 3WE6B 5MENA 3H9SE 4JAMB 1TJGH 4PJ9B 2H26B 3MODH 2FX8L 2HVKA 1IAIM 5K9OA 1ORSB 2DQEH 4ELMB 2P5EE 2UVEA 4MJ2A 3VXMA 5GGVY 3KJ6H 4LLWA 1JBJA 1OCWH 2R9HD 1ZWIA 4JRXE 5CJXC 1G7IB 1HHKB 3GMQA 2X70A 3QPXH 4MNQD 1FQ9C 4PB9H 4RGOH 3OAYK 3BGFB 1U8HB 5TJWK 1OPGH 4JHWL 3VXQA 5FDYA 3I6LE 4IJ3B 4HUVA 3G5XB 5DC9B 1QVOB 3MLVL 3B6SB 5E2UL 4PLJD 4HT1L 2XWBA 3UDWC 2WNGA 3IDYC 4DGYL 3GHBL 1ZKAA 3PDDA 5A16B 1NAMH 1EUUA 5H35B 1JI1A 1TVHB 5D1ZB 1IGIL 1YNKL 4NQVB 3VGEA 3OGCA 5DRWB 5AUMB 1U58A 2QKIA 2OK0L 1MNUH 4N5UA 3JV4A 4QRRB 3TBVB 5IT2L 3KYKH 3P4MB 2IMNA 4FG6C 3NMEA 5EUOF 4FP8L 4Z95H 3LEXB 4XI5D 3IU3B 1PEZA 1VDGA 5IJKC 1ZMYA 1XIWD 3P9WB 5DI8A 4L29B 4HPYL 3KPSD 2IADB 4KI5C 4PJ7E 1SJVA 4NRZB 1DQDH 5F1NA 5LG1A 1VPOH 4ACPA 5T33L 1RIUH 1RIHH 4JKKA 3DYPA 5EA0H 1JGUL 1MCWM 4U6YB 5F89A 5CP7B 4Z7UA 4Z76A 1MREL 5B3JE 4EQ2A 2BSED 5C0NC 2ZKHL 5DD5L 3UX9B 2HA1A 1NDGA 2F54B 5FYLD 1RUMH 4U1HB 4MNQA 3PHSA 4AIZA 1ZSDB 2X10A 3MJ9H 5IROC 4LU5L 1KJ2H 3V4UL 2PW2A 3G9AB 3GKWL 4RGNC 5ETUB 5HDOA 1WZLA 5KJRH 1S7WA 4M6MH 3CCHB 3DETC 4PR5A 1MCRA 2H3NB 4GRMA 4XP6L 4YEFA 5J6GA 4ZO7A 5FDWB 1X5ZA 2GITA 1VENA 3L6FB 1K8IB 3BHBB 3C5SA 3BI9X 2Z91A 4JO4H 1WT5C 3TA3D 4C83B 1YPZB 1JUFA 3U46B 3LIZH 3WS6C 1I7TB 1A1MA 4UBDD 1AIFA 4Y16D 1GAFL 1CGUA 3BIAX 3CVHL 2VSCA 4A6YA 1CICC 1XIWA 2IGFL 3WNNA 3NIGF 1LE5B 1T1YA 1WQVT 1IGML 5EOTA 3KPSA 1NPUA 5DYOA 2VL4A 1ONQB 1LGVA 3VG9C 2OSLA 4FQ1L 3OKKA 1SHMA 4YDVB 1E6JL 5GSRA 5BXFA 4CN6A 3UTZA 2NX5E 4OB5H 2NLJB 5SWZD 4FFWC 1KSRA 3DPBA 4P57B 5ADOH 2FLRT 2Y5TA 3KYOB 2CRYA 7CGTA 4DGVH 1UJ3C 5JHDB 1A47A 3LKRA 1MIEH 3I2CH 3I75B 5ID0B 1RURH 2ZG2A 4HGKC 5T1LD 2JCCA 4POUB 5FB8A 4EN3D 3VD4A 4AM0A 2P8MA 4ALAL 5JUEH 5EFIB 3FQWB 2MCPL 2VLLA 5GIRA 2Z31C 5JW3L 3WFEH 3BO8B 4MA7L 3C09C 1RZIA 3NH7L 4Y4FD 4ZUVA 4HBCL 3P4NB 2A2QT 3HI5L 1D5MA 2APFA 4E41D 2W60B 3F7YA 3ULUD 4LRNL 1FVCB 3NCJH 1JWSB 3QUYB 4FQXB 4U6XB 4X0KB 4OCSL 1TJHL 4Z78A 5IVXA 3MRJA 5MEQB 1FG2A 3TA3A 3WJLA 4HXBL 1OP3K 1AD9B 3QJHA 4R7NA 4WWKD 3QJFA 2D4DA 3FN0L 1ZLVK 4JRXD 4Y16A 3WHE1 1P4IL 1JE6A 2C1OA 3GMOA 4KRMB 2VUYA 2BOBB 4YJZL 2ZCHH 4P3DB 3BH9A 4D9QD 4OF8A 3I6LD 3GSQB 2VDOH 1NAKL 1NBZA 1GOFA 2NY3B 4MQXC 2NNAB 3TYGH 3FRUB 4N68A 5DT1H 3GMMA 5SWZA 1FC2D 3LVEA 3GSUA 2IH3B 4PGEB 4POZD 2VXTH 3O6FC 2K7QA 4WEUD 5T1LA 5C2BL 2EE3A 4ZNEE 4HSQA 5MEPA 1DLFH 3S9DB 1JZ3A 4LRIA 4EN3A 1R3IL 1HCFX 4NJAH 3RNKA 4ODXA 4BH7B 5I1CH 3JUZA 1F8TH 5AG9A 3N85L 1UKSA 5GGRA 4NGHH 2EDRA 3SKJH 4Y4FA 1JZ6A 1AGEB 4E41A 4EIZC 4KRNA 4Y19D 2HJKA 2VZVA 3OTTA 5CEXA 5SX4H 1MWAB 3MRNB 3MLUL 2XFXA 5FFLA 3ZKSD 4DTGH 2LVCA 1NAMA 2GJ6B 4RIRA 2YSSB 2GSGA 3KLAB 4Y0GA 4JFHE 4D9RE 5DJ8B 2H32H 3WIFB 4EDWL 5JO5B 1NUGA 5I19L 4WWKA 5KAQF 3VI3F 1JYXA 4JRXA 4PJ5B 4OCWL 5MHSD 4XCYB 5IMOA 4WVRA 1R0AL 1SY6H 2AJVH 4QY8A 3JTSA 4PJDE 4Z5RB 1J9CT 1D9KB 1FSKB 1AXSB 1BAFL 1BWMA 5GISL 2HLFC 4EOWH 1DANU 4OZGB 3L95A 2GFBA 1CS6A 4HJ0D 3KR3L 2EEAA 5D1XB 3HE7B 1MI5E 4TULH 3MTRA 5IFHH 5BZDB 1I8IB 3OKNB 1S7QB 1WVZA 2QTEA 2KPNA 1A3LL 1DR9A 1JMXA 4LPUA 3KYAA 4XNQA 1TCRA 1MY7A 4XVUC 1FFPA 3MJ9A 3G6AA 4WI6A 2AJSL 3W5MA 2NY6D 3NCEB 1ZHKA 4PJ7A 3S98A 4TUJB 1UQSB 1WBZA 4Y19A 4HFUL 3GK8L 4GFTB 5ANME 4F7MB 4YDLB 1JFQH 3MNWA 4XH2B 2F8XC 4RA3A 4LSSL 5KBNC 1MFBH 1OAXH 3P77B 2GY7B 3TBTA 1RD6A 3JWOH 4X7DC 4C58B 2A9NL 5D93B 5DDHA 2W9EH 1ZHLA 2F53B 2PYFA 2GTWB 4J3XA 4NKDB 5DJ0B 3L3JA 4R8WL 2B5IB 2AK1L 1LO4L 2XRAH 5E5MA 1N64H 1YEFH 2EE2A 3CMGA 2EDDA 4UNUA 1D6VL 3BH8B 1IKNC 1JF1A 1NBVL 4KROD 1XF5B 3VXNB 3QFDB 4HULB 5T3XE 3BKYH 5EU3B 1IGYA 2ZUVA 3MRDA 3MV11 3OR6B 4Z8FL 5TDOA 3CD4A 4XPHH 4FQJH 4DCQB 4U3HA 4GS7C 1QQDB 2IG2L 4LNRB 1Y18B 5ISZE 3K2UH 3CVHB 4GW5A 3QIUB 3NFPB 3FCTB 3IRPX 1HSAA 1QO3A 3O6MH 4QRQB 1BIHA 4LPXA 1JPST 2FEEI 3BOVA 4NNXA 3MFFA 3PIQA 4X9HA 4E42A 2HFFA 2ATKB 4MXWL 3E1F1 5CUSH 5MERB 3L5WA 5DJZA 4WW1A 1RULH 1LP9B 2VISA 2WUCL 5C2UB 1NDMB 3QHZL 4K2UL 1JGEB 4FQ2L 5T3XH 2Q76A 1Q38A 3CFJB 3QIWB 4M4PA 1L7TL 2CDFA 4JY5H 5I17B 1YEDA 3OKYA 1AGBB 2X40A 1QRKA 3CVIL 4RX4D 1T0NA 3D87B 3X11A 1WCBA 4NC2B 3FZUC 2ENYA 1AY1H 2X1QA 3VWJD 2XNAA 2ZG1A 4MVBD 1MHPH 3GUTB 3J8F7 1UZ8B 4S0SD 4NO5B 4G7VH 1TJGL 1G9MH 4KJYA 3G6DH 4Y8DC 5J13C 3TM6A 1PX3A 3MODL 4YXLH 3V5DA 3X3FH 4NDMA 2DQEL 4XPBH 5HGGS 2VDKH 5L0QC 3N1QC 3KXFB 3KJ6L 5LGJA 3RIAK 2PW1A 5CLTA 5MENB 4MB4A 4CVWA 4PV9A 3MLWH 2HVKB 4XP5H 4F37K 5K9OB 3D0LA 1II4E 4RGOL 4PB9L 3TO4C 1OPGL 3QUXB 3VXMB 1JNHA 5DZOA 5EU4B 4DOHB 3CZFA 4LLWB 4M61A 1E6OH 4ZS6D 3UYOD 1ZWIB 4OIIH 2VLKE 3GMQB 4M5YH 4TN9A 4ONGH 1T7VA 3QI9D 3VXQB 4JFHD 4D9RD 2DI8A 2BNUA 4ONHA 3GSNL 4PJGF 5HPMA 1MNUL 1QSVA 2XWBB 3KYKL 1DBBL 4NPYB 4AENB 4KI1A 1G7HB 2ZCKH 4NUJB 5IUSA 4Z95L 2HKFH 5B4MC 3OGCB 4RX4A 5FYJL 1U58B 1AI1H 2QKIB 4LCCC 4TSCH 3VWJA 5DJ2B 1DQDL 1VPOL 1EEYA 1RIUL 3O2DL 3GGWB 2B8OT 5DI8B 1RIHL 2YKLH 2H32A 4Q6IA 3BZ4B 1MHEA 3HLAA 4ZNEA 5EA0L 5EOQH 3BPCA 1B0GA 4PJDF 3DVIA 1C5BH 2UZXB 5DWUH 3LKOA 4JFXB 2ZOKA 3CSPA 1VFMA 3C2SA 2I9TA 1IC5H 4JEGB 1RUML 2BC4A 3AROA 1SY6A 4XCEA 3B2UC 4HHAA 3O9WC 3WFCH 1FFQA 2R4RH 5F89B 1IGCH 3NZHH 4OLYH 4Z7UB 4Z76B 1KJ2L 3JV5A 1QA9A 5KJRL 5L2JA 4G9FD 4M6ML 1NDGB 4N8PA 1N5AB 4MNQB 4P59H 4QHUA 4J3OC 3U30B 4AIZB 4OLVH 3QI9A 4H26A 3E0GA 4HJGA 2ZG3A 1CBVH 5KSAC 1AXIB 5L7XL 3RY4A 3C8KA 4WI5A 5BMFH 3DSNA 5ALCH 1ES0A 4GRMB 3C8DA 5J6GB 4TPRH 4L9LC 3I84A 4Y5VC 3LIZL 1BQSA 1X9QA 2GITB 3IDGA 5T3XD 1FZMA 3WN5B 4FQQA 5T1KD 5JHLH 2JIXD 3ZKMD 1JTPA 3C5SB 1EERB 5CGTA 4D8PA 3RI5F 2Z91B 1QSZA 4B53A 5DK2B 4H1LH 1EHNA 1V3MA 4LCWE 1JUFB 1QLRA 1A1MB 1N7MH 1N4XH 3SDCC 3MLYL 1AIFB 3MCKA 5F70A 4A6YB 2GCYA 4OB5L 1XIWB 2VKXA 5EZIH 3SO5A 2X7LA 1T1YB 4OFYD 5DLMH 3KPSB 4X5XA 3EAKA 5ADOL 1V05A 3UJIH 3ZDXF 1DP0A 5DYOB 3ZTJH 4PJ9C 2OSLB 3O6LH 5AEAA 1VACB 3OKKB 1MIEL 3I2CL 1PD6A 5BXFB 5GSRB 5D5ME 3UTZB 1L6ZA 4KVNH