3QIBA

Crystal structure of the 2b4 tcr in complex with mcc/i-ek
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
180
structure length
180
Chain Sequence
IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 30
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qibA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3qibA01
3U7YL 2BHUA 3JTTB 3TIEA 3MBXL 4LARL 1XIWC 4JFZL 5ADOH 5AWNL 2EH8H 2EDDA 2V2TB 4Y5XB 4NT6A 5GRZA 3RNKA 3BH8A 2JJWA 4HIHB 3MJGX 2R4RL 3ARBC 3O0RH 1R0AL 2CRMA 1T89C 2H6PA 4HLZG 2XI9A 5EDXA 3D0LB 1IAOA 1UWEH 2W0PA 2VC2H 2HG5A 2BOBB 2O26U 2VSDA 3N9GH 3MACL 1N2RA 1J1XH 3D2UB 3N1FC 1SEBA 5EO1B 2ED9A 1FVCA 3CSYA 4MXVE 4N8VG 4TVPE 1DTUA 1PD6A 3UTPE 2V9RA 5EPMA 5TDNA 2B1HL 2BRQA 3C5ZD 4F7PB 3RWFB 3V6OE 1T22B 1CLZH 3BP4A 2DI7A 1UT9A 1LWRA 4M1CC 4WEUD 3BGFC 4UUJA 5JTWA 3L3HA 5EOTB 2Z35A 4PJXA 5MEOA 2YPKA 2RIKA 5D7JB 1FL6A 3KYOA 3IXTA 4YHYB 3O9WB 2HT2D 2NW3A 4TNWK 3QG7H 1JGVL 1QFWM 3PWVA 1A1OA 4O9HL 5FGSA 4NRXA 5MP6L 2GY7B 4NM8L 1A3LH 1JWUB 1MCNA 1NCWL 4PJ5E 2R8SL 1YEHL 4OF8A 5I6XB 3A6OA 3O4LD 3DX6A 1PG7L 2YD3A 1J0JA 4P99A 4YE4L 1HYSC 2RHEA 3MV8D 4PJEA 2GSIB 4NUGH 4CVZA 3U4AA 5ALCL 4L4VD 5KVEH 4M1DL 3W9EB 4WW2F 5GSRA 3RGVB 4MCYB 1U2HA 3O11B 2OXGA 4LVNB 3WD5L 3EOYG 4NQSB 5FA4B 4MMXC 1CIDA 3MLWL 5I1LA 4P2QD 1CFBA 1R3LB 4AT6A 4AZ8A 1DQJA 4IRSB 3ZKMC 5LBSH 1TNMA 2XTJC 1ITBB 2EDRA 1UFUA 5C0BA 4EN3A 1YEKH 2FIRT 4KKCC 3WL9A 3FB5A 3B8YA 3OV6A 2AJVL 3LEVL 5I1CL 2BDNL 4P5MB 2IQ9H 3L3DB 4MXQC 4XNXH 5CP7B 1Z6JT 3Q6GH 1CLYH 4X8XA 3RNQA 5E2UL 3EYFA 1U8JB 1OW0A 2F5AH 4PJ9B 5EBGA 5KANI 1L0QA 1SBSH 5CILH 1DVFD 5D6DC 1YPZB 1AKJD 3CK0L 1U93B 1B0WA 4LCWD 1OTTC 1LO2L 1B0RA 2VR4A 3OJ2C 1U91A 3AS3A 2V9QA 2QHRH 4X7TA 1I3VA 3K1KC 4NKMA 5AUMA 1G7IA 3WDIA 1YQVH 2JCCA 2QKIB 3ZYZA 1KTDB 4O02L 4L3EB 1JYWA 4X4XB 5FYKE 2ZSWA 1OVZA 2XQBL 2DWDB 3KJ4C 2Q76A 3LEXA 4KV5F 4F2MB 2J88H 1FC2D 4FQXD 5KSUA 3ECBB 4KI5D 3WJJC 3DMMB 5HYJA 3IDJB 3L1OH 3UEZA 1ONQB 4LQFL 3SHSA 4CW1A 2WLYA 3ARQA 4NJ9H 4NQDD 1KLUA 4QRTA 1QFWL 4G6FD 5C0DA 4S1QL 1CWVA 3TLRA 4LHJB 5IQ9A 5LCVL 1CE6A 5FYJL 1P4LB 1T0MA 5GHWL 5D71H 3T0EA 2C3VB 4GKSB 3VXPB 1NFDA 1FH5H 3DRTA 3TVMB 1WWWX 4QT5B 1RZIB 1DL7H 2VZVA 5GS1B 3NA9L 4NHUA 5C09B 5BRZE 5C1MB 5FB8A 2C4FU 4NQXA 3RWHB 4YDKH 2H2SC 3KPLA 1KULA 3QQ4A 3WXVL 1XGTB 1NAKL 3EOTL 3U9UA 2FIKA 3I3BA 1C16A 5IB5B 5F7NC 4P2OA 2FO4A 1QRNE 3MA9L 4UNUA 3L5WA 4GMSL 1CFQA 3I6GA 1PGRB 6FABL 5IVNA 3N1PC 5I1EH 5MHSE 4LLQA 1DQML 5J9PA 3OR7B 2YWZA 2VDLL 3KPSE 2D3VA 4ZAKA 4LEXH 2HFGH 3MA7B 4Z7QF 2H3NB 2I07A 4S2SB 1M7XA 3SCMB 3FN3A 2VIRA 3FQNB 5E1AB 3O3AA 4FQJL 3CVIL 4U6TA 3GSRA 3I9GH 5DTFA 5JR1H 5I74C 4TUKH 3SKNB 1A1MA 2ERJC 4FNLL 3RKDC 1Q9KB 5DRNA 2YD2A 1CVRA 3D0VB 5D4QA 5F7YC 4LU5H 4YHOH 2VE6B 4CGTA 2BOCB 3GFUA 1BZ9A 5L2KA 4H26A 1KFAH 5DQ9A 1F5WA 2IBZY 3BP7B 4QRRB 5B3NA 3TBSB 1HHGA 4X6CA 1FAIL 1JN6B 3AU1B 4JFEE 3BT2H 2KUTA 2V7NB 3I3EA 2P45B 3R0NA 4ZO7A 4OBSA 3KXFB 3GSWA 2B4CC 2ZNXA 3K2UL 3MGAA 4JFZH 4AEHL 1UZ6F 4XPBH 1ZGLA 1ES0A 1FG2A 3ARUA 2DI9A 5DK0B 1U3ZA 2EE3A 4LLUB 1QLFB 2WINA 3HB3D 3B2UD 4WWKB 5C08A 3RWEB 4K9EC 3DUSA 4GW1B 4HGWA 4B7LA 4KRNA 4N5EC 3RWIA 4P3DA 3ZKQD 4JN1L 4M6ML 4EIZC 5I1GH 5D2NE 2J12B 1ITCA 5I18H 4QHMB 3MMEB 3MYJB 5CHNA 5I1HH 2B1HH 1T5XB 4PTTA 1W0VA 1RZJH 1PJ9A 1T2QH 1OM3L 4KJPD 4Z6AT 2VDQH 3AXLA 5FK9A 4YAQA 4M4PA 3LRSA 2P42B 1MCOH 5MEPB 4OZGB 4LCYA 4XGZA 4LCUA 3IS1X 3MRMB 2VXTL 3UC0L 2XFXB 3F7RA 2YRPA 3SOBL 3VWKD 3WFBL 1FNHA 1S7XB 4P2RE 1GZQA 1RIVH 5DDHA 4GW4A 1JGVH 3ARGA 4IIQC 3ZDXF 1BQSA 3BW9A 5MP6H 9CGTA 5B4MD 3ARBB 1YEHH 3BI9X 4HS8L 1JCKA 2VLRD 5HD8C 4J6RL 1PG7H 5F7FA 1HWGB 3TH4T 3OKOA 3SDDD 4DZ8B 4A2MA 5DJAA 2XA8H 3ARTA 2P5EA 3VI3F 1OHQA 5IMMB 5ALCH 1R5VB 5AD0A 3JTSA 4L8BB 4NBXB 2ADGB 2EDWA 4DUWA 2ZSVB 3WD5H 2DDQL 3G04A 4N0FB 1VFOA 2GY5A 5J57B 5AYUH 3MLWH 1QSEA 1CG9A 1MWAL 3MROA 3RZCC 4HH9B 3PWLB 2QQNL 1E4KC 3BGFB 4XI5D 5E2WH 5SWZB 4MDJB 1R5WA 1JMXA 5I1CH 2BDNH 4LLWB 4Q0XL 1NBYA 5T1LD 1INDL 1AJ7H 4GSDL 3W82A 4LAQL 1U8MB 1A9BA 3QI9A 4PJIA 1J1PL 3B83A 3HE7A 5C0CA 2XZCL 3QIUC 3WSQH 3UJTL 1Y0LB 2AV7A 3SDCA 3CK0H 3ZTNL 2VKWA 5IR1B 5A40E 2D0FA 2UZXB 1NCAL 1FNLA 4LIQE 4R4BA 4QGYA 4U1IB 1VERA 1NC2A 1WF5A 4XXDB 1AGCB 1F90L 1MRDL 4LEOA 2UVFA 5TE6L 2BSRB 3BN3B 3QUMB 2APTA 2Y9RT 4M7JL 1FO0A 3IGAB 3V79C 4O02H 5E8PA 4NQEB 5F7EL 1ZWIA 2X4QB 4X99B 3C2AH 3HNVL 4HK3J 1KNOA 1S9YB 2L7JA 1I7RB 2XTJB 2VWEE 1IMHC 4GKZB 4JN2B 1F4YL 5DXWA 2IPUK 2FL5A 1EZVY 3HRZA 5T1DL 3Q5OA 4XP6L 4XVTH 1VGEH 1X5AA 2BSTA 1K4CB 2LQRA 1CDHA 3DETD 1E6OL 4LKXA 2CLVB 5CBAB 1PSKH 3MRKA 4WI6A 3B5TA 5FYJH 5HYEA 3L3IA 1RHFA 5E5UB 3MNVA 4Z76A 3V9FA 2Y23A 4MWFA 4ZUWA 5IM7B 4JHZA 3GMMB 3CFCL 4D0BB 3DO7A 2VL4A 2DN7A 3NA9H 3MLRL 5I15L 5DLML 4P5KB 4WFED 3IYLW 1R3KA 2FJFA 1KC5H 1LO0H 1M7IA 3PHQB 5K9QG 1K8DA 4N90D 3WNOA 3ULUF 4LLDA 4NM4L 3FQRB 3RIFF 4D0DB 4KHXL 4PB0H 5MEQB 1IC4H 2VDOH 1CI5A 2VLJB 2FX8L 3GSXA 1ZA3B 3QWOB 2ICWA 3CLFL 4MB3A 3KJ4B 2CIIA 4GMSH 2GJ6E 4J3VA 1F3DJ 1H5BC 4FTVA 5I75B 1CGSL 3GO1L 1NC4B 1BX2A 2VDLH 3QEGL 4WUUB 1YEIL 1B0GB 4GMTH 4KPHH 3HE6D 3IFOA 2CLRA 3TN0B 4DCQB 2YD1A 5EZOH 4F9PC 1IAII 3IVKA 2DQCL 4RNRB 1DN0A 3CLEL 3WIIL 1E27B 4QXTA 5BV7L 4M9OA 4APQC 3MNWB 3EOAB 2AKRA 3OJVC 2X1WL 4J1UA 4X6DB 1IC1A 4Z78A 5EU5A 2D7TL 2HJFA 5A16A 3BO8B 4RISL 1KIRB 2ZCHH 1N5YL 3GJEA 5DJZB 4HV8A 2ICWI 2W0FA 1JGDB 3OKDB 3QJFA 4RQQA 2FWOA 2I60H 3GSUB 4OBRA 4CN6A 4FQHA 3IXAB 3BIAX 4WV1A 5FV2A 1SHMA 3RVXD 4I0KA 3MTRA 2XPGB 3ULVE 2DYPD 3AREA 5F7UA 4QF1A 2BVYA 2VLMD 5B3JF 2D31B 2WV3A 3MLYL 1RPQA 3ARFA 1FFQA 5KSBF 3P77B 4XP5L 1NMBL 2GCYA 1U8NB 43C9B 2FECL 5H8DA 2XKNB 3RWCB 1T21A 2HWZL 3DGGA 3QFJB 1CL7H 3QA3B 4JN1H 4UDUA 5I74B 1U8IA 4M6MH 1AGDA 2ERJB 1N8ZB 5D1XD 3IJYA 4EXPX 3IJSA 4JM4L 7FABH 3PWNB 5I76A 3S5LG 1RVFL 3QWQB 4Y4HA 4JFOB 3GKWH 2D4DA 1U42A 4NQVA 3UTQA 4OV5B 1YEDB 4P3CH 3HCVB 4M48H 1IC7L 1FZJB 2ICWJ 2JB5L 3ELAT 4P9HC 4F37K 5CEZE 3W0WE 3VFPB 2HTKD 3TBWA 4PJFF 1I1AD 4QCIA 2IJ0C 4LOUC 4KXZI 1UB6A 3UC0H 3ES6A 2FHCA 5KSAD 3WFBH 5HHOB 4ZTOH 2C4FT 5EULV 4XTRD 1U8LA 3VXUB 5I73C 2WP3T 1JWMB 2A6IA 4WFFD 5K9QI 5F96H 1IC5L 4UINL 4CADB 4HS8H 2P7TB 2GT9B 2H9GB 3QHTC 4KMLB 1WT5A 4J6RH 4XCFH 1RURL 3U4BL 3IU3A 1FJ1B 3SDAC 3MV9D 5D7LE 4TVPH 4Y5XA 5HYFA 5F9AC 3TEUA 2DJSA 4Z77A 2DKSA 4ZOBA 1ZLUK 4K07A 3VDBA 1XGRA 3TV3L 3EYQD 4FFVC 2DDQH 3TYFB 5DRZA 3FQWA 3D0LA 4P23C 1U8HB 4KRPD 5GJTL 1A6UL 3O8XD 3F7YB 3RI5F 1X6NA 1KSRA 3D2UA 3CMOL 3ZYIA 1FYTD 3CXHJ 5D70H 4NZUH 3VFVB 4GKNB 4JY6B 5HI4D 3DSFH 4KI1A 4X98B 15C8L 2BNRE 3BAEH 3DWTA 3RWFA 4F7PA 1T22A 1INDH 3OPZL 5J89A 4JY4B 2AJXL 4X0KB 5J12C 3QNYA 1J1PH 4NFDA 1CGUA 4IIQB 2RB8A 1GC1H 3HC0A 5FXCH 1ZXQA 4M8QB 4JE4B 3UJTH 5LJYH 4FMFA 4XHJD 2F53E 4NO2A 3ZTNH 2DLFH 3KLHC 3QP3A 5CKAA 5D7JA 2QTEA 3X11A 4P3WA 1OGAE 3CH1A 4Q58C 3BUYB 2NY5H 3TPUA 1EEZB 3UO1H 1MRDH 3S5LA 2DQFB 4KK6D 1X5GA 4Y88A 4X5WB 3H9SA 3OSKA 1JWUA 1P7HL 2UWEB 5EBLA 1PKQA 4PRPD 1YJDL 2C1OA 3G5ZB 5BZDB 2GSIA 3ABZA 3CC5B 3RGVA 4KTYA 4MCYA 1BAFL 4LLVB 4XVSH 1M6OA 4OD1H 1QD0A 3U83A 5DJXB 5CP3A 5FA4A 2AXFB 1KG0B 5C9JB 1I9IL 4UT7L 4NKIL 5I1AB 1QLEL 1R3LA 4JPWH 3DNKA 4OCWH 5DUBB 4GG6B 1AP2A 3O6KL 5LXGL 3E1F1 5FO8B 4MAUL 3HS0B 2UZIH 4XP1H 3DYMA 3HI1B 4V1DE 4J4PD 4PLJD 4AMKL 3Q0HA 3MREA 5I2IB 4W6WB 3BZFB 4P5MA 2KPNA 2GFBB 4Z7OF 5I15H 3NTCH 2J8UB 1U8JA 3FN0H 3VRLF 1G7LB 2RJMA 5KAQF 4HIJB 4NWUL 1MCWM 5FYKH 4PRIE 1U93A 3GZKA 2QJDA 1RZFH 5IB4B 3QNXB 3EDKA 4MHHG 1FRGH 3RUGB 1IVLA 2FX8H 1A3RH 5BS0B 2VLLA 1A22B 1WFUA 3IKKA 1JRHI 1X4ZA 4I5BB 1MHEA 2IANB 1YNLL 5D7SH 1JUFB 3T0DA 1T3FB 1JZ2A 4DKFL 3QPQC 3D69B 5D7IB 4YHZL 1V3LA 3UZVB 4DGVH 1E4XL 4TTDC 1T2JA 4R97C 2BK8A 2DQCH 4HKXA 4ALAH 4F2MA 1XF5B 1KJVB 5LWYH 3CLEH 5DSCB 1RZKH 4MJIE 4BUHA 2OL3H 3DMMA 5BV7H 1GGBH 3NAAH 1LVEA 5KJRH 2UUDK 1C7TA 4WI8A 3VWJD 3B2VL 1K4DA 3QDJE 4L8DB 3ARVA 3T3PF 2HYMA 3QWRA 1IKNA 2B1AL 1FN4A 4XNYH 1L7IL 2NPLX 1S9WA 4GQ9H 3MNZB 5I8EB 1YPZF 4LHUG 1U36A 2IAMB 3V7AG 4PJGA 5GS1A 4H1LH 5C09A 1F8TL 2EO9A 2Z92B 5EORL 5MENA 4G6KH 1MIEL 4L4TB 1H5BB 1NBZB 4TTGA 3GMNB 4U3CA 3MLYH 1B88A 1OARL 2IH3B 4I18C 1XGTA 5DMYA 2E9JA 4YUEH 1KJ2A 5IB5A 3DV4A 4CBPA 4XXCA 3NCEB 4I77L 5FYJD 2AK4E 3TPKA 3SPVB 2HWZH 3LS4H 1M1SA 4HMEA 3RWGB 5DMIL 1XGUB 4HFUL 1A6WL 3LHPL 4O5LL 4W4OC 1Q9WA 4APQB 3RTQC 4BSWB 3MA7A 2P1YA 5E99L 2H3NA 4J3WA 5J06A 3EW3B 2R39A 3SCMA 1BVLB 3IDGB 3FQNA 4XAKD 3T3ME 4H20L 5D6CB 2E7BA 3SJVD 2EDXA 3MCLL 5E56A 1QP1A 5GISH 2EDHA 3T4AA 4M6NH 2HJLA 3BE1L 4PGEB 4HJ0C 3CXDL 1Q9KA 4PJXE 2HLAB 2WUBL 4DVRL 1IGJB 4NNPL 4ONFH 1GGYA 2AAVA 4MB5A 2XIDA 3DUUA 4M03A 5EUKB 4OLWL 5K9JL 3T1FA 4M8VA 5T5NF 2KKQA 3BP7A 3BN9C 2FR4A 3QBTB 3JVGA 3TBSA 1G0DA 4YHMH 2AK1H 3AU1A 3HI6H 3DLQR 4JFDB 4Y2DC 2FBJL 1RURH 5IFJB 3BKJH 3UTTB 1AXSA 2F74B 5DGQA 1HHIA 2R0KH 4E41A 1I8MB 4LLUA 1V3MA 1QLFA 2YPVL 3BEWA 4HQQL 3SDXA 3DURA 5ISZE 2VABB 3PWPE 1OT2A 3RBGA 4QRPB 2GKIA 1PLGH 4R4ND 3LPGA 3V5HA 3BEVB 1KB9J 4JM2B 5I1KH 5GJTH 3ZL4H 3MLVL 3U2SA 4KC3B 4XCYA 1W0WA 4R6UA 4Y8AA 2AVGA 2IF7A 4P5TC 3MRGA 3QRGH 15C8H 1ZS8A 1T5XA 2HMIC 4O2CB 2Z0BA 3MV01 4OZHF 1CZ8L 5C0GB 5IBLC 2FATH 2XRAL 2IQAB 3GB7A 2AERT 3HPLA 5I73B 2ADJA 4AENA 4Z0XA 4OZGA 2ARJB 1EJOL 3QIBC 4DEPC 4JZOA 2X5PA 1OD9A 4FQ1H 4OIAA 5JLZA 3MRMA 1T1YB 3FT3B 5BZWA 3SDAB 1NCCL 3MQIA 2VLKB 4MNGB 2PCPB 3OZ9L 3VG0L 3T0VA 4OFKA 4LPVA 2G75B 1UKTA 3ARBA 4PUBL 5IGXH 4OZIB 2GUOB 2Q3AA 3CDYA 3ALXA 1T1XB 3SGJC 4P23B 4MNHB 3TIDA 1ACYL 3ZKSD 4DZ8A 5E03A 3F58L 1DFBH 1R5VA 3KPPB 1K2DB 3MRPA 4MJ2A 5I0ZA 2ADGA 3C87A 3CGTA 4Z7QE 2ZSVA 2F54B 1MH5A 2E9IA 1MAKA 3HAEH 3EKCA 5J12B 2YUWA 5CEXB 4NKIH 3HG1D 2R0WL 3MCKA 4LIQH 5SWZA 2Z8SA 4EI5C 3HZYB 4MDJA 2XNAB 2MHAA 3QIWC 4AMKH 4XWGH 3TJEH 1XAUA 3GK8L 4NZJA 4WTZG 4TVPD 2DLIA 3OQ3B 4OLZH 1T7WA 4FA8A 2Z4QB 3RX8A 4YK4C 3UMTA 3EJZC 5JXAL 3LD8C 1UA6L 5IHZA 4M9PA 3NIGF 2AGJL 4U1IA 3IT8D 5CSZB 3UAJD 3PQYE 4X4YB 4XXDA 1OY3B 2FSEB 4M1GH 2Q20A 3O6FC 3QUYD 4WU7A 3UZQA 2VOTA 1UZ6E 5DD0H 1UKQA 5B8CC 3IAQA 2R1YA 1WQVT 3HN3A 4LL9A 2NY3D 1NPUA 4MDIB 2EDTA 2J5LC 4RMTA 3DXAE 4DKFH 4BSJA 2X4QA 1QBLL 5CD5C 4JFYB 2FRGP 4IHOB 4GXVL 2P8LB 1MCDA 2DQEL 1O5DT 5E08H 3MRDB 4GKZA 4JN2A 4XX1G 3C6SB 1LEIB 1NAML 4NBYB 3MV8A 1A7RL 1JHLH 4H88H 4PTUA 2JJSC 4KWUA 4Y4FC 2XA3A 3CCHA 1MJ8H 3CZFB 3B2VH 5K59F 3E8UH 2B1AH 2VITA 1BM3H 1L7IH 5FUCE 3JWDH 4S1RL 4WIQA 3KDMB 4PJ7A 5JW5B 5K9KA 4P2QA 4YO0B 4QWWD 5EOCJ 2F19L 4YBQC 5C0AE 3FQUA 4P5KA 4KK5D 4BUGA 1AO7E 3PHQA 5LGHL 2YMXH 5E4EC 4CVXA 2RQ8A 2UY7A 1D5MB 1FNSL 4J3OC 5DEZA 4Q9BA 3ZDXE 3NA4A 4FZEH 4YXKL 1G7QA 3AMKA 1EPFA 4XPFH 1DVFA 4OKVB 1IGIH 1AKJA 4W68A 1GAFL 3FB7B 4LCWA 1W72H 3E6FA 5E2VL 1MCWW 1OLZA 4WTZA 3MOAL 2CQVA 2H32H 4X7FC 1SMOA 2DL2A 4HFUH 5SX5K 3VI3E 5EZLB 4RDQF 4O5LH 4QO1A 2EDLA 1WWBX 1B0GA 2MCPH 3QXUA 3TN0A 3X13A 1Z9SA 5HGGS 3QYCA 5E94B 3LKNB 5IWLC 2D0GA 1HKFA 3FO2B 1T04A 5EU3A 4MD5B 5GZOD 1FAKT 1S7QB 2VISA 4K8RH 1Q38A 4S1SH 3W11C 5F72S 3RIFK 3WKNA 4QTHB 5BMFH 2QADD 3LMJL 5EBWB 1JTOA 3VXSD 3ULVH 4JDZA 5L9DH 4O2EB 4UIMB 4X6DA 1CXKA 2ZCKL 2WUBH 5E7BA 5JDSB 2EKJA 4ODUB 4Z7WF 1FFNB 2R56H 3TBYB 1JF5A 4I18B 3MRFB 2EKSB 2NX5B 1TFHA 3C5SB 5K9JH 2YBRB 1WZ1L 4DZBB 3IXAA 2Y5TA 4OIBA 5IUSA 3GMRB 1G6VK 4RGNC 1NH6A 3PGFH 4PJAF 2EYTB 3GMOA 3EUUA 5BRZD 3RVTC 4G8EA 3P77A 3RTQB 1HWHB 2R1WA 4DN4L 1HSBB 1OT1A 1AD0A 2YPVH 1F4XH 2IH1A 2HT2C 5D1ZD 3WUWG 2OR8A 1GOHA 1TNNA 3QA3A 2QEJA 4EKXA 4XMKH 3MRIA 2FEEI 5CEZH 4CU6A 2R2BB 4BH7B 4JO4L 4NQCB 1FZKB 3OXSB 3TH2T 3KPSD 3S35L 4G8GB 1BEYL 3PWNA 1QSZA 5D96C 5CJ5A 4QOKB 4D2NA 4U3HA 1GRWA 1CZ8H 2KQNA 3DX7B 1XGYL 2DQUL 2HJKB 4MJ6A 4FG6D 5GSVA 4OCSH 4OTXH 3VFPA 4Y2DB 1HKLH 4TSBL 4UQ3B 3ETBF 5IOPB 1K3ZA 1JNJA 1OSZB 1U8PA 4OLUL 3OZ9H 3VG0H 4QTIL 3O3EB 5DEGA 3MV11 3VXUA 3MUZ1 2APBA 4ELKA 4CADA 2P7TA 1UWGH 2D7QA 2HTLC 4WEMB 4JFED 4NO3B 3EDFA 2W9LA 4PREB 2XQYK 3IRPX 1FGVL 1UCTA 1XGQA 4OGYL 5DZNA 5CD3B 3DX9B 2DTML 1SVZA 1U8HA 1FIGH 3KYMB 3JV4B 4I8DA 2CPCA 5AZ2L 1J12A 3F7YA 4KJWC 1CT8B 5JOFB 1U3JA 3QIBB 5J1SC 4GKNA 5EUOB 3JV0A 4P59L 1H3UA 4X98A 1ADQA 3C8KB 4NRZA 4F58L 4U7SA 1XH3A 4N0UE 5L6YH 3WUWA 2OTUB 3BX7C 2MTPA 4FQXC 4KI5C 4IIQA 2OR9H 1QSFE 4KJQD 4XNMB 5FO7A 3B9EA 4G8FB 1FV1A 1MF2L 3DYPA 1BWMA 2EDEA 3E6HB 1IM3B 1MAMH 2Q1EA 2WBKA 4G3YL 3VCLA 2AGJH 4H8WH 5FKAA 3UJIL 3MRCA 1JHTA 4F7MA 2BXZA 2OJEA 3RWDA 5B3JE 3LH2L 2W91A 1LP9B 3JWOC 4JJ5A 3UTOA 2Q7YA 4X5WA 3WFZA 1ZGLM 3RI5K 1S5HB 4WJ5B 3ROOA 3VWKA 1LEKB 2YD4A 1U3HD 2VXSH 3OB0K 4MAYD 1D9KC 2HKHH 1RMFH 3OB8A 1ZLUH 3MJ9A 2VLRA 4N0CC 4EI5B 2HFFB 5GS3A 3QIWB 3MFGB 1AGBB 1KPRB 2J4WH 3RY4A 3BXNA 1NFDF 3SDDA 5DMKB 3GI8L 3PE9A 4JFXB 5C9JA 2AXFA 1N6QH 1LDPH 5DUBA 4GG6A 4LSQH 3TYGL 5FO8A 3HS0A 4R26L 5HYSG 2ADFL 3FL7A 1YA5A 4YK4B 4HCRH 35C8H 1GOFA 5HYQB 3RPIA 3MBED 3OKMB 5I2IA 3ILPA 2VMFA 4GLRH 3VI4F 5F7LB 3BZFA 1R6VA 5HI5D 4PJFE 4X9HA 4YJZL 1FDLH 4I3SL 4LASL 1KIPB 4RA0C 1BBDL 1IL1B 3O6FB 4BK5A 2FNBA 5JOPE 1G7LA 4Y16B 5B8CB 4GAGH 1FNSH 3MGTB 1SJXA 3MZGB 5GRXG 3I75B 2J5LB 4YHNB 4JZJC 1DDHB 4UTAH 2Q8AL 2LABA 4LPUA 4K3GA 1HN1A 2NZ9D 1GAFH 4X8JB 5E2VH 1I1FA 3MOAH 4ZTPL 1IAMA 2EDFA 4QRUB 4HLJA 4P4RB 4C56E 1MREL 2IANA 1JUFA 1OAZL 2N56A 4K7FA 3T09A 5D7IA 1HHJA 1HI6A 3NCJH 2D7MA 4HULB 2NYYD 3CVHB 4CRPA 1XF5A 1KJVA 1JTPA 2XWJB 4QRQA 4AL8L 5DSCA 2AJSH 3QULB 4PJ5B 1S78C 4G9DB 1CD0A 2ORBH 3RWJA 5JXEC 4Y2OA 3VRIA 5T5FH 5DUMH 1ZHBA 3HUJF 5E4EB 4R90H 4JQXA 3PV7A 3I2CH 2YS4A 2PTTB 4MA8H 4QEGA 5I8EA 4F7CB 1U8OA 2EE9A 1OWWA 4PG9B 2IAMA 2RFXB 1BFOB 4RAUB 3WKMH 1T83C 3IFNH 1O0VA 1J1OH 3MLPA 3DRQB 4KJPC 5HY9A 1RUQL 5L8LB 1ZAGA 4LNRB 3IETB 5KS9F 1MCRA 3CFKB 2JJVA 1QFUL 2BVQA 2FHBA 4WEBL 3OJMB 2V7HA 4BSVA 1P6FA 4JZNA 1V7ML 5FGBA 4DN4H 4NQUA 3RL1B 4WFHE 3VE0A 3EOBB 4QNPF 4XMLH 3X3GL 3RWGA 3E3QC 4HG4K 4ZQKA 2CO7B 2B2XH 4C4KT 2VXVH 1CGWA 2QQLL 1ZEAL 5FDWB 3IDGA 3EZ8A 5IB1A 4YBLC 2VN7A 1PY4A 3OKNB 3TA3D 4M7KL 5D6CA 3HE6A 2UUDH 3BJLA 5EC2A 4PJBA 3QXDB 5J6GA 1B2WH 3SGDH 2YPLB 4PGEA 3PP4L 3JWDC 5BXFA 3LKRB 2P8MB 2HLAA 1OP3H 4M93C 5KZCB 4RGNB 4IRZH 1KIQB 4Z7OE 1D5BA 1OAQL 2VR9A 3BHBA 2Z31C 1MFNA 4PJCB 3V0AC 4ZXBD 4RMVA 2YHGA 5HHMB 3H3BC 3ET9F 4K8RD 3U82B 3FAWA 3LQAC 4OGAC 1WC7A 1VFAB 4L1HA 3UTTA 4MD0A 4JR9L 2NMSA 3BMVA 2WW8A 3ULVD 3GDBA 4FXGB 4PJDA 1KYOJ 3NPZB 3DV6B 4B7IA 3UTSD 4WHDA 1I8MA 1LK2B 4OQ1A 1ZVSB 1NCUA 3EO0B 1AQDB 2XZQL 4Y5VA 2JLLA 1FGVH 3NN8A 1NUDA 1LGVA 5GGTH 5E24E 1CE1L 1J8HA 4QRPA 2CLZB 4A6YH 4JM2A 2A1WL 4PY7A 5DQJA 4PJ8C 1NBVH 3E2HC 1QRNB 4M62H 1OL0A 1LO3L 2AJUH 1HXMB 2P44B 4HGKC 1U3YA 1XF3B 1NCDH 2VDML 2XN9B 3S9DB 1FO0L 4UV7H 5M95B 1DQQA 4XPHH 1K5NA 4ENED 2GSGB 4QXGH 2YC1B 1YPZE 4JRYB 2PXYB 3DETC 2ITCB 1MF2H 1I9JH 3MOBH 2DMCA 1WLHA 5CJOL 4KKBC 4G3YH 3ZKND 2CDEA 3W0WD 3UJIH 3SDAA 3JBG7 1ZANL 2VLKA 3OJDB 1VESA 3LH2H 1I1AA 1CD1B 4LDEB 2ED8A 4L3EE 1MSPA 2I24N 4OZIA 5KSAA 2GUOA 3BFOA 4X4MA 3O3UN 4TPRL 5FGCE 3D6GA 5IVZB 5DC0A 3K3QA 5I17B 4MNHA 2QR0A 5FECB 3GSVA 4EI6A 5HHPA 4Y1AE 4XP9L 3UP1A 1ZLWH 1T0NB 1K2DA 3GGWB 1JV5A 2NTFA 4OF3A 2Y36H 4G6AC 3FTGA 5D72L 3VFUB 3IFLH 3GI8H 4PR5B 4AEEA 1IGCL 2PR4L 4G8IB 5CEXA 3U6RB 4FQXB 5TQ0H 3S35X 3O45B 1KPVB 4DAGH 3I50L 2VNCA 4U1HA 5ICYA 1A0QL 3HMWL 4QY8B 3K74B 3WIHL 5K93A 2A74B 1VB9A 4DWHA 1FBIL 1IILE 3EYSH 2VXUL 5GS0H 1SJEB 1WBYA 3O8XA 3MJ7A 1YEFH 3U0PB 3QDMD 2BC4A 3ZHKA 1BIIA 5TE7H 3MV7B 4GJTB 4X6EB 2XKSA 1BD2B 5D2NB 1Q0XL 3TO2B 4XWOD 1U8KB 4Z0BL 4PJHA 3P40A 1SEQH 2JK5B 5CSZA 2HRPL 1D9KB 4X4YA 1N26A 5KVDL 2WZPD 1INQA 1UCBL 4R7NA 1NCBH 4ZTPH 5EFIB 5IESL 3FHAA 4MA1C 1OGAD 1MCSA 1E4WH 3HA0A 4PG2C 1CXHA 1KCSH 2SEBA 1MQKL 4MDIA 1ZHKB 5IHUL 4HJJL 1AY1H 4IHOA 2Q86B 5JW4M 2P8LA 3UYOD 5I30L 2W9EL 3CFDB 4KY1L 4MCZB 4F7EB 4AL8H 3C6SA 4JDTH 4Y4KD 1LEIA 4PP1D 1F6AB 1JPGB 1G7MB 3MRBA 5FM5M 4JPKL 5F7MC 4ONHA 5ALBH 1CU4L 3T77A 5IJVA 3V5KB 1GZPB 3ZT7A 2DQTH 4GBXD 4GAYB 4OZHE 5EZIL 1UQSB 3KDMA 4YO0A 4JZJB 4QRRE 3B9KC 2O61B 4I0CC 5IB2A 4C54A 4ETQB 3FFDA 4V1DD 3QUZD 3BSZH 4J4PA 4JG1L 1DR9A 5K9OB 3QO1A 2JB6B 3M17A 1TJGH 4XAWL 3KXFE 4H8WC 2LAAA 4IOIB 5HI3D 3NACH 5CJBA 1EGJH 2Y25A 1N3NB 2HTKC 1LO4L 2Z91B 4NKQB 1AXTH 4PRID 1CDYA 1BGXL 4OKVA 4OCNC 4XNUH 3HNTL 4AYFA 4NPYB 3WO3B 1BQUA 4Z7NF 1A7PL 4XTRC 3V4UL 5F70A 3LN5A 4OM0H 3CPLB 5EZLA 2VUYA 2W9DL 5JHDB 4L8CB 1BQLH 4NZDA 2XWBB 2QQLH 3R8BB 3IDMB 5DHVH 1ZEAH 3LKNA 2ZP0T 2GHWB 1KTRL 4HUNB 4JLRA 5H2BA 2Z8RA 1DBAH 1S7QA 2DD8H 2HFEA 3SE3C 4NNXA 3R8QA 2NCMA 4XVJL 3PP4H 5E5MB 5DJYA 3WHXB 5C07A 1FFOA 2GI7A 5JDSA 1FE8L 3CFJB 4HUUB 1IE5A 3CDFA 4KRPC 1FFNA 1MNUL 3TBYA 3QDJD 4WDIA 3T4YB 5T1MA 2EKSA 2YBRA 3MPCA 4DZBA 4YIQA 5HI4C 2I26N 1YMME 5DJDB 3V4PL 3NIGE 3QEUB 4LPCA 1RU9L 5CINL 2OR7A 3MZTA 3GMRA 3Q3GB 2E6PA 3MJ8B 5IBTH 2E3VA 2P24B 3DTXB 4JR9H 3LKSB 1KN2L 4NGHL 4PB9H 4JHBA 3HHRB 1TETH 5JUEH 3I02B 5D5MF 4Z7UA 4DKEH 5AG8A 1I85C 1HSBA 2XZQH 1C1EH 2LVCA 3OGCB 4I13B 5SX5H 3VGFA 5AAWA 4YBLB 3UDWA 1OSPH 5H94B 4K3JH 2K7QA 1MI5B 4ZUVB 2AK4D 2VDKH 4U6HB 1TZGL 4NQCA 1FZKA 3OXSA 4UT6L 4BA8A 1CS6A 3D5OF 3NGBC 4M93B 4OJFL 1Z9MA 3H7BB 4G8GA 2IBGA 2P48B 1LO3H 1MHCB 1KCUH 2CXGA 5BW7A 5K33A 4ZUTA 3ILQD 5K59E 3O3DB 3BISA 3HZVA 2WBJD 2R29H 2Z31B 3ZDYF 2CJUL 1JZ4A 2HJKA 5DYOA 3FOMA 1DE4B 1SM3L 2APVA 1SYVA 2FH8A 2YUXA 3EAKA 4JANB 1K6QL 1WBZA 3ARXA 4WNQA 2G9HB 1AC0A 3O3BB 3RDTD 1HQ4A 5IEKB 2I9LB 3RU8L 3T0BA 3ZE2F 4OM1H 4JFFB 3U4EA 4N8PA 1N6UA 3MO1B 2X44D 4WW2C 3MRNB 5L0QC 4NN7C 4ODTL 5ICZB 1F3JA 3O3EA 1QFWI 4NQEE 4YH6A 5DI8B 5TPWL 4OZFH 1BFVL 1G7HB 2BX5A 3C6LB 1XCTB 5A1AA 2EIEA 2XTJE 2XT1B 5FUOL 4NO3A 4PREA 3T0AA 4IOFC 1UM5L 4PJ8B 3E2HB 4HK3N 4TOYH 5J3HC 1HNFA 2L7UA 3TT1H 1VPOL 4P46C 5D72H 3V4VH 1NGPL 1QBML 1IGCH 2EC9U 2M1KA 2QQKH 1J18A 2EZ0D 4R0LC 2HAZA 3KYMA 4HFWB 1ZHLB 5ISZD 3KGRA 3PWPD 5FF6A 1RJZB 1A0QH 3BKYL 5IJKC 4JB9L 5KN5B 4WHCA 3WIHH 5CJ8A 1IQWL 1BQHG 5EUOA 1FBIH 1JYXA 4X5XB 3C8KA 3NZ8A 5H35A 2YD5A 2VXUH 2X4RA 3MRQA 4OLYH 1P7KA 1J7VR 1IKFL 4Z7WE 2DJ4A 3W5MA 1DANT 3GUTB 2PO6D 1CFTB 2MQCA 3H3KA 1JGUH 3VWJC 4YGAB 3E6HA 2VLJE 3GIVB 5E6YA 2R23B 4Z0BH 2DM7A 4QHNA 5E0QA 1WV7T 3U0TB 3RA7L 1U6AL 3QHZH 5BOZG 4HHAA 1IGTA 3TCXA 4PJAE 3BGMB 5KVDH 3RL2B 5EIIB 2X70B 5DHXB 3MUY1 4I0PA 5M94B 4F9LA 2OJZL 1WWAX 3OGOE 3ZTJH 3SDYL 1GOGA 1WBXA 3ARWA 5TH2B 2Y1VA 4WUUE 1MQKH 3GMPB 5IHUH 3ZYOA 3GIZH 1F11B 1YQ2A 5CJXA 1F2XK 3SO3B 5I30H 2DKMA 4UOW0 3H6JA 4KY1H 1AI1L 3PWUB 2HFFA 3QIWA 1AGBA 4KU1A 2FX9H 4KK8C 4YEEA 3TT3L 3W2DH 3DI2B 1MFEL 3BWUC 1FL5A 4GQPH 4PJGF 1AXIB 4LSPL 1I8LC 3UPCA 2CKBB 3E0GA 3WIFB 5A43C 2CO6B 3CIQA 5IROC 1G0XA 4M7LH 5EZIH 1X5LA 4EBQL 3BD4A 4O51A 3DX8B 2X05A 2ZUVA 4JQIL 2A9ML 1NCTA 3EGSA 3ROLB 3D25B 1QKZL 3CD4A 1O7SA 4Q6IC 1KIPA 4JG1H 2PW1A 3FONB 5H37G 4EUPH 3DVNB 4XAWH 3QHFH 3BDYL 4MA1B 4Y16A 4XMPH 1MJJB 1CXEA 5DWUL 3GBML 4Z95H 3I75A 3WFEL 2ZOKB 3O2VL 2COQA 2BNRB 3JUYA 1MPAH 1LO4H 2A77H 4UILL 3V6OA 5JW4Q 4CKVX 2AEPL 1FGNH 2YUZA 5ANMB 1BQHA 4MQXD 4KQ4H 1BGXH 4P2OD 3QFJE 4X8JA 3HNTH 4XVUC 5JPNA 3PQYD 3WBDA 3BOVA 3BH9A 4YPJA 3CFBA 1A4JB 1ZK9A 2F53B 3FCTB 3OB0H 3QQ3B 3QZWG 4PRHB 2A6JA 5KSVA 3BZEB 2E8YA 2W9DH 2VZOA 4F8QA 5HHQA 3QUYA 4ZOAA 4AH2B 5ADPH 4YXHH 1T0PB 3O6LH 1KJMA 4N0RA 2QSTA 3V0VA 2ATPA 4LSTL 4PJ5A 1GVIA 5CSBA 3B9KB 4F15C 1AHWC 3VGBA 5TGBA 1T66D 5IHLB 1AQKL 1BF2A 3A67L 4BFBD 2APWA 3G5VB 1MNUH 1U0QA 2PTTA 4XRCB 4F7CA 5HHOE 2X40A 4YHLL 3FT2B 1FHGA 4M00A 4PV9B 3JXAA 5JPMB 2EDKA 4WI4A 1S3KL 2RFXA 1BFOA 4RAUA 4X7CC 2JJTC 5IQ7H 2HN7B 5C0IA 3CDGA 3MXWH 5GRUL 3DRQA 5C0AD 2FEDD 3OKKA 2LAGB 3CFKA 1J87A 5D1QC 1BECA 1KN2H 4NGHH 1RULH 3S96B 1ZT1A 3ZHLA 3INUH 3H42L 4H1LG 4UQ2B 3PL6C 1N64L 5IWLA 3RL1A 3UBXB 4K7PY 4C83A 1IEAA 3EFDL 1EJ6A 1I7ZA 1JNLL 5LG1A 3VGHA 1IJ9A 1I9RL 2OP4H 1JPST 2BCKB 4JRXE 1ZLVK 2XTLA 3N0PB 4OD3L 4OJFH 1BJ8A 4X80L 3RY6C 2L0DA 3VFTB 1JFQH 4HIIB 4LVOC 2Y5EA 3OBAA 1FYTB 3QXDA 1OAKH 5I66B 4G6JL 5EOCL 3QZWA 2EYRB 2P8MA 3VI4E 4PRBB 2I9TB 5IVXB 4DUVA 3I85A 3G5YB 5IG7B 1K6QH 3D3VB 4KDVA 3IFPB 3VFNA 2J1KA 3HR5A 4MJIB 3D85B 3WE6B 1HINH 3TJHC 5M7QA 2ESVB 4TQEH 1UYWL 4ODTH 2UWEE 1JL8A 3P0YH 4KMTL 2D03H 3ARGD 2QSVA 5DF0A 4YFDB 4UBDD 3SN6N 3LPFA 4WI9A 1I1CA 3MCG1 4Z18A 1HDMB 2X7LA 1VFAA 4LSUL 5GIRB 4DGIL 3EYUH 4FXGA 2X4OB 4FXKB 1ZOXA 5HBBA 3SKJL 2OL3A 3NGBB 1W8NA 2MKLC 5BOPA 2P5ED 3KPQA 1ZVSA 1OF2B 1CF8H 5BRZA 1H0DA 5HGDB 4PGDA 1QBMH 1ORQB 2IMMA 4U1KA 4MS8C 2G60L 2CLZA 4LFHG 4OI7A 1QSED 2V2XA 2EE6A 2NY7H 1GGTA 4OFPA 3P4NB 5T3ZE 1QRNA 2VH5H 4JPVL 4HMCA 3BKMH 4WHTB 1MCQA 2J6EL 1IQWH 4H1LA 1H3XA 1X4YA 4IMKA 1WTLA 1XZ0B 2YZ1A 4HF5L 2J8UE 1IKFH 3KPSA 1DQDL 43CAB 1EHNA 1FPTL 5L0QB 4WW2B 1OD7A 1JZ6A 4Q2ZA 5EOQL 1P1ZA 4JRYA 4JFHE 3HE7D 4PJCF 2PXYA 4ZSOE 5C0CD 2ITCA 4OLEA 2XY1A 3VH8B 3RUGE 2R2CA 4XPGL 5INCB 4NP4H 5BS0E 4POZC 5JW4N 1RFDH 1YN6B 4N8CL 5KS9E 3ULSA 4BM7A 4DK6A 2DQJL 1VGKA 1CD1A 4CJ1A 2OJZH 2IANE 4GRMB 4P46B 3NABL 2P43B 4PV8A 1C08B 4YC2B 2Y6SD 5HJ3B 4K23L 1XF4A 3RVWD 5BQ7B 2NNAB 2YWYA 1TJHL 4R0LB 4HDIA 5EC1B 1D5ZB 4OD2B 4OV6F 5HVHC 4EXKA 3QJHB 5CZXD 2E7CA 1AI1H 1NLDL 3L3KB 3AM8C 3RQ3A 1F00I 1ZT7B 4JFEA 4PJ7F 3WXWH 3TT3H 5GGSY 3VFUA 3HPJA 4KK9D 3F65A 3C60D 4LSPH 1HH9A 1X7QB 3JV6B 3ULUC 5ACLA 1KPVA 1C5CL 2CK0L 4QY8A 2FECI 3PHSA 2PUQT 4Y5YA 4JRWA 5A3ID 1CQKA 4JO3L 4OLXL 4FFZL 2O93L 2A9MH 3D87B 3L5XH 3HAEG 2IPKA 3IF1A 1S7UA 4DKAA 4L4TE 1F02I 5GRVK 3VRJB 2IBBA 3GSOB 4OIIL 3MX0A 2DQDL 5D2NA 1BLNB 5DWUH 2D0HA 3TO2A 1HIMH 1U8KA 2R4SL 1QSFD 3O2VH 3A6CH 2OTWB 2DIJA 3L9RB 4WO4C 1SVCP 1BBJA 1D9KA 1OAYL 3VXRE 1P4BH 4A6YB 5C0EB 2PYEB 5GZND 4X6FB 3EO1A 4RGOL 3EYVB 5EIQA 1ZHKA 4PYHA 4J7RA 1BP3B 2X4UA 4G9FE 1FFPA 1WK0A 2Q86A 5DC9B 4P2RA 5F21B 1IRAY 2YKLL 4KI5F 1FZOB 4EJ1C 4MCZA 2EC9T 1ZGLP 1U3HA 2EIBA 4LSTH 5HHXH 4Z5RB 4MAYA 1ZMYA 2YRZA 1F6AA 1JPGA 4KKNA 5CGMA 1TVDA 1JI1A 5D1ZC 1RY7B 2EIZA 3WV0A 1WCQA 2HH0H 3V5KA 3H0TA 1OP5K 3M8OL 2VAAB 2N7BA 2OMBA 2FLRT 3H9ZA 1UQSA 4YGVB 4YZFF 1YYML 2Z8WC 4S1DC 4ZDHA 5CJQL 3D18A 3SY0B 5FGRA 4YPGB 1A6AB 4JFDE 4PRAA 2P47B 1Y18A 3AS2A 2JB6A 5L8JB 5C92A 4HEPG 4OCYH 4IOIA 1R3JB 1JPFA 2WSKA 3M45A 3VMPA 1VHPA 3ARED 5EU6E 1GHFL 5JOPD 2NXZD 3VFMB 2W92A 2X4NB 2H26B 2Z91A 2ZG2A 3S3PA 1A7QH 2GITA 5DT1H 2A83A 3HAEA 3IJHA 2DLGA 1GIGL 5E2JA 4QRPE 5E2TL 3D39B 5DD3L 1OB1A 5ACZB 4F15B 3CPLA 4GG8B 4DW2H 3EJJX 4IJ3C 4MNQB 2B4CL 4YHPB 3TFKD 3QUXC 3IDMA 4C56D 1QFHA 2X42A 1YNKL 5F97E 4YLQT 3GMLB 1KXVC 3CDCA 3C5JA 8FABB 1RUAH 3T8XA 1F6LL 1QYGL 3F5WB 4K9EL 3GNML 4Y4HD 4ZS6D 1HQRB 5E5MA 5I19L 1E28B 5HDLA 2IPUG 3WHXA 4CJ0A 1O7VA 4KTDL 1MFDL 3NFPA 1S7VB 5D1QB 3T4YA 1XF2B 4MNGE 1DUZB 1IT9L 1PYWA 1CICB 4PY8I 4G7VL 5TF1H 2JE8A 5EB9A 5E6ZA 3PL6B 4OZIE 1YYLH 1F4WL 3QEUA 3T2NL 1DCLA 4LSUH 3S34H 2P24A 2CKNA 1SQ2N 3DTXA 4KJQC 3DVGB 4F57L 1AIFA 2ATKB 2FX7H 3SKJH 3I02A 4GRLC 4BH8A 3S88L 2F54E 4GXUN 1X5XA 4AM0B 3OGCA 4MA7L 4LVOB 3L95B 1D5IH 4N1HB 4BELD 5HHNB 2XZAH 3MUGA 4R8WH 4ZUVA 4U6HA 1YEGL 3SE4A 4WFHD 4HS6A 3FKUS 1B3JA 1JE6A 4E42B 2R0LL 4NKDB 1PBYA 4Q6YA 4HWEL 3D2UD 2J6EH 5D2LF 2GJ6A 5GGVY 3F12A 1UXWB 1XR9B 1LK3L 3ARDB 3QUMH 1Z9OA 4HWNA 5C6TH 3VFGL 4ZO9A 2DM4A 1W8OA 1DE4A 3SO5A 3W5NA 1E4XI 5B38G 1H3PH 3MJ9L 5DMGD 5C0ND 4X7DC 1W72A 5D7JD 4U1LA 4Q7DA 4N8CH 4OT1H 1AE6L 5A2LH 1R3HB 2H32A 5DK2A 4U1MA 3O9WD 4LPWA 1YJDC 2VZUA 5ICZA 1MWAB 1OGTB 5KW9L 2NY0C 4IS6A 5SWQA 4JGUA 2CIKA 4EIGB 2VRAA 5TDOA 4K23H 1G7HA 3C6LA 5TQ2H 5KVFH 3H3PL 2AXGB 5DHVB 4ZXBA 5D7KD 4Z7NE 5MERB 1N5AB 3SE8H 1DUYA 4BQ8A 4JG0L 3BWAB 1A6ZB 3WLBA 5ITFB 5F1KC 3RGVD 4LK4A 1RIHL 3IDIA 4V2BA 2BNQB 1GYAA 5ADOL 2EH8L 2G2RB 3H8NA 3BIBX 1ZHLA 4IRSD 1RJZA 2Y7QA 3D9AH 1QZ1A 1LE9A 3ZE0E 3O0RL 1MQ8A 5KG9A 4QHKI 5IMKA 4FFZH 4X5XA 4R96B 2VC2L 3P73B 1UJ3A 1GL4B 2BVUA 1J1XL 4V2CB 2YEZB 1NDGB 5DQDH 2ARWA 1WUNT 4Z7VF 4OIIH 4R7DB 3AAZB 1QUNA 1YY9C 4F3FA 2DQDH 1KTLB 5F8RC 4ORGB 4U1NB 1I3GL 3L3JB 4HUVB 4RFEA 1CLZL 2EEAA 2X4PB 4YWGH 1XR8A 1OAYH 5DFVD 4O2FB 1KPUB 4NHCL 5HVHB 1S9XB 2AXHA 2P5WE 3DVIA 4RRPA 3WHE0 2HP4A 3W0WA 5TH2A 1BJ1H 3I6LD 1JPTL 3BYYA 5D5ME 4K94C 3GMPA 1B9ZA 1EEYB 4L3ED 3PGDA 2VZSA 3QG7L 1CDIA 5B38A 4HK0B 4KROC 5BJTA 2YKLH 3JWNC 3IDYC 3VGEA 5IIEA 1SY6H 1EFXB 3WCYA 4CDHA 2ZUWA 3VD7A 4FQIL 3QDGB 3LN4B 5B39B 1S9VB 2AJ3B 3DMMD 4QHKJ 1J88A 4NUGL 1PY9A 5D7LA 5F9JB 3U30C 4XPTH 1FZMB 3W9DB 2V2WB 1QVOB 3OKEA 2NX5E 3FRPG 1TVHB 1JZ5A 1YYMH 5C2UB 5B22A 1ED3B 1JNHB 3VXMB 3TVMD 3UBXG 4WO4B 5LBSL 3TA3C 4G6MH 3S98A 3WN5C 3ZE2E 5F9OL 4HS3B 5C09D 1YEKL 3FONA 3DVNA 3FMGH 4L9LB 4XC1H 3FQXB 1TENA 3ZE1F 1LD9A 2X4TB 1QO3A 1GHFH 2ZOKA 2LTQC 4U49A 4XNXL 5INDB 2BNRA 1MRCL 3Q6GL 1CLYL 1LO5B 4LQ1A 5ANMA 2D9CA 1KB9K 3H2WA 1SBSL 5CILL 2HT4C 2ZUUA 3KYKH 4Z9KB 2E6QA 4URTB 4Q9RH 4KMQA 4RZCA 1A4JA 2F53A 3CSBA 4ZFFB 3QQ3A 4NQCE 4S11A 1H3VA 3L7FA 5CBEB 4LLYB 4XZUA 1CD8A 3STZB 2QHRL 1P2CA 2B4CH 4AH2A 1AR2A 1NDMB 1OGAA 3REWA 2PF6A 3KYNA 1YQVL 4QOKE 3IAPA 4YHKH 3FN9A 5KSBB 4M3KB 3SCMD 2WANA 5C8JB 1F3RB 2DICA 5E9DE 1GCFA 1QYGH 2Y4SA 4K9EH 3GNMH 4ZFGL 1I4FB 3VDAA 5FA3A 5I19H 2I25N 2MCG1 4Y4KA 2J88L 2P46B 1MFDH 4KKAC 1A7BA 1ZVYA 3FT2A 1IT9H 5IW6B 4PV9A 3S36X 4NJ9L 4ZPVA 1TZIB 4GBXA 1H3TA 1MLCB 4UIKH 4QRRD 4U7KA 5E4IA 2EECA 5EU7C 3BRDA 1FH5L 2BNUA 4V1DA 2A9NH 3IB4A 2EIDA 4NC1C 1S9KC 1DL7L 1R3IH 4YX2H 4F57H 3KXFD 5ERWA 4IJ3B 3FRPA 3QUXB 3VFRB 1NAMA 3LS5H 4W70A 3KJ6L 4YDKL 2AI0L 3UBXA 3V5DB 1OAXH 1KGCE 4PRIA 4FFWD 4WWKD 3P4MA 2CRIA 4LSVH 3SE3A 3SQOH 4D8PB 5C0JA 2E7MA 2BCKA 4HCRA 3FQTA 1MY7A 2OBGA 1ZTXL 3OAZK 1MRFH 1VSCA 2F58H 4EQ2A 4OGXH 4HWEH 4LCCC 4OQTH 5I1EL 1KCVH 4QHUA 4RIRB 1QLRA 2DMKA 3P4OB 5DMJB 3TBTA 2EXYD 4P4KC 3QG6B 3BZ4A 2HFGL 5J6HA 4QRSB 4WWID 2C3XA 2EYRA 3HZKB 4PRBA 2I9TA 2R1XA 1EXUB 4NFBA 2R0ZL 2GK0B 3I9GL 4MJIA 1H8SA 4TUKL 3TF7C 1KB5H 1LP9E 1AE6H 5FFLA 1PQZB 4LLMA 3L6FB 3KPRB 4JVWA 4GRLB 1QQDB 5KW9H 3QDJA 1I85A 4LU5L 4YHOL 4OCRH 2NXYC 3RX7A 2X6MA 3U7WH 3MUHL 4S0SD 5DD5H 1I1YB 3ARBD 4FQCH 4NO0B 2FGWH 1HDMA 1KFAL 4MA3B 3H3PH 4YDVB 5T3ZH 2M2DA 3F6IA 3U48A 4GLRI 2FYYB 1FSKC 4FFYL 4NFCA 4HKZA 2VQ1A 3ZDZF 1NGXA 4JO2H 2H1PL 4MSWB 4U2ZA 1OF2A 1DJSA 4JG0H 3UJJH 5HGDA 5EWIL 3ARSA 4I4WB 3TBVA 2P49B 1RIHH 3HFML 4KH2A 1A02N 4XPBL 1KN4H 1ZLVH 1U8QB 2MPAL 1QOKA 1AGEA 3VJ6A 4M1CD 1RJYA 3P4NA 1JF6A 1P84K 3G6AA 5ETUB 5IB3A 1QA9B 3LKOB 5IVXF 2AK4A 4WHTA 4NOFA 5SWZD 1CN4A 2X89D 3Q6FB 3CMGA 3KLAB 4MLSA 1D6VH 2FGZA 1JYVA 43CAA 4HKBB 5I1GL 1TQCB 1V3JA 4N0YH 4UOJA 5E8OB 1VEMA 4RAVB 2GTZA 3GJFK 5JNYA 2NY0B 2H2PC 5I18L 5I1HL 4LSSH 1MVUB 1I3GH 1QR1A 2WBJA 3VH8A 4C57C 4X9BA 1RZJL 5INCA 5ITBH 1RJLB 1T2QL 2HT3C 4D9RE 2VDQL 3SQBA 2DQGH 1HH6B 4NHCH 3WO4B 1YN6A 1HYSD 1MCOL 5CZVH 1MIMH 3L7EA 3RDTA 1B4JH 3S4SG 2AEWA 4LVEA 2CDFA 5CEYB 2LV4A 2MMXA 3OG6B 3TZVC 1C08A 2MNUA 2GW5A 3OKLB 5J7CC 1JPTH 4JHWL 1ACZA 4NRYA 4NQED 1EX0A 2I27N 1RIVL 3G6DH 4H25B 5EC1A 4OD2A 1JZ8A 1TTUA 3QJHA 3ZKMD 4Y19B 2XTJD 1HHKB 5IJKA 1JGLL 3L5HA 3UTZB 1ZT7A 4FQIH 4TUOB 3ZSSA 5HVFB 2JIXB 1KELH 1VFMA 3BP6B 3BVNA 4YDLC 5D8JL 2XA8L 1DLFL 2JTDA 1NGZA 3AMLA 3J8F7 5ESQB 3BJ91 2VQTA 1BZQK 4K3HA 4Q9CA 1YC8A 5AYUL 1OTTD 5ISZA 4R3SB 3PWPA 5JORA 1Q9OA 5F9OH 1NGQH 3VRJA 1UB5B 5E2WL 3GSOA 5GGQH 2AQ1A 5DA4A 4XBGB 5JMRA 1F3DH 1TVBB 1AJ7L 4K3DH 1L6XA 2PO6A 1ROWA 1MRCH 4I2XB 3L9RA 5GS2H 2VLJD 4KROB 3IS0X 1KLGB 4XCNB 3IDYB 2VERN 5GGTA 3WSQL 2IADB 4U1GC 4A6YA 5C0EA 5FHAH 4X6FA 2X4SA 1HOCA 3GM0A 1EHLH 1NC4D 4ONOA 3FFCB 2GEEA 3Q5TA 3GMQA 5ID1A 3U30B 4WUUD 2CDGB 3TN0D 5JIPA 4JDVB 4GUPB 4Z5RA 3LV3A 2YPLE 3S4SA 3C2AL 1T20B 5J1TC 1I8KB 4ZFGH 1KACB 1DBKH 5FGCB 1LEGB 3TA3B 4RGNE 3WN5B 5A2IH 1UEMA 2XG4A 1YECH 5SWSB 4Y1AB 5IKCB 2CGRL 2VAAA 3LIZH 4XVTL 1VGEL 5DEFB 5DA0B 2H2SD 1DBMH 1S7RB 2LTQB 1S7WB 5EIVA 4OB5L 1EAPA 3MXVH 4PJCE 5HHME 4YPGA 1PSKL 5FM5O 4QLRA 3RVUC 1A6AA 1ODAA 4BKLB 4HWBL 3O41B 4CMMB 4P9HH 2G5BA 3J7HA 1F42A 5TDPA 3Q1SL 4NJAH 1R3JA 2CR3A 2CRZA 3PV6A 3VG9C 1IAIH 3O4LE 2GAZA 3VFMA 4O00A 2ZG1A 1KC5L 5FYJU 1LO0L 3KJ6H 3KHOA 5E8NA 1MHHA 2E9WA 1HHHB 2AI0H 4YXLL 4U6XB 1IARB 1G9MH 3GSQA 1EIBA 4L4VE 4L8SA 4PB0L 5JOEA 1NANI 4XBPA 5E6IC 3WEXB 4NSKB 5DJ6B 5ACZA 3QFJD 3X17A 3LQZB 1IC4L 2VDOL 1YMHB 4G43A 2OQJB 4UT9H 1MCIA 1ZTXH 3PQYA 3RKDD 4BZ2H 1G7PB 4NO5A 5EO9B 2EDNA 1HSAB 2XN9E 2AEQL 2C7UB 2E27H 4HGMA 2IG2H 4LKCB 3N06B 2JF1A 3OL2A 2QV2A 3H7LA 4GMTL 4KPHL 3DXAA 4HXAH 3RRQA 5I1DA 4JRYE 1OP5H 3F6LA 1HQRA 5EZOL 4IRJA 3KPMB 1E28A 1DLHB 4ODXB 5C7XH 1WICA 5FO9B 2R0ZH 3L5IA 3OXRB 1XF2A 4J8RB 1CICA 4I3RH 4EN3C 2C1PA 2ZKHH 5HHOD 4I3GA 4UDTB 3VXUD 2ZCHL 4A2LA 4OZHB 2W60B 3FB6B 2EDQA 4N5ED 2I60L 1OW0C 4FFYH 2C26A 3DJ9A 1LDSA 1N59B 3HR6A 3TNNB 4GW5B 3UROR 3S8WA 5C0AA 2H1PH 1H8OA 1G7JB 2X1QA 4U6YA 4LCCB 5EWIH 4IMLA 1AO7A 4AM0A 4J2XA 4P4KB 5HHNA 3HFMH 1I3UA 4KI5E 4MQ7B 2MPAH 2NY2C 4MXWL 4KXZH 2IMNA 4NQDE 5FKPB 2XXMB 2QLVB 2C3GA 3FO1A 2AV1A 1CL7L 4RMRA 4U1JA 1ZV5A 1UXWA 1XR9A 1FYHB 3ARDA 5IBUG 3EYOA 3MV7E 3VU2A 1BD2E 1CDGA 2ICES 5HGBA 7FABL 4KKLD 1EGJA 2NXYB 4DTGL 3EDDA 3WJLA 1NMCC 4OFVA 4R2GC 4PRNB 3GKWL 2PYFB 3RVVD 4P3CL 4M48L 1FSKB 1JWSB 1R3HA 4QXWA 3T0EC 3G9AB 3NFSL 1FL3B 4JHWH 1WTGT 1PG7W 4UOW1 3ZZ1A 1GGUA 1XIWB 4N9GA 1F97A 2AXGA 5DHVA 1SJHB 4ZTOL 3X12B 2RR3A 2IFGA 2BMKA 2N1KA 1YMMB 5DD6B 3RAJL 4LBEA 4P48A 3FOLB 5F96L 1JGLH 1RQ5A 2H8PB 3BWAA 4WI7A 2RCSH 4XCFL 2EC8A 2CR6A 1UM4L 4P2OC 3LCYA 1QNZH 5EBMB 4OZFG 5CSGA 1EO8L 5D8JH 2P8PB 4TVPL 3MFFA 1DLFH 1TTFA 2GJZB 5IEHA 4FQQB 2F5BH 25C8L 2MFNA 1P9MA 1SJVA 3K80A 4EVNA 1WCBB 4YBHA 5LGJB 4DN3H 4ZAKC 1BVKB 5T3ZD 4R96A 3GRWH 1I1RA 1LE5B 4KJYB 4UAOC 3V6BR 2YEZA 2MJWA 4NZRH 4D3CL 1U92B 3AAZA 4TSCL 5D70L 4NZUL 1UZ8A 4ORGA 3DSFL 3TZVB 3BAEL 2R2EA 4HUVA 3AUVA 3CVHL 4AIZB 1OQXA 3ZKXC 5ID0B 1XFPA 1BZ7B 2HA1A 2X9XA 3V6FA 1T80A 1GC1L 5L7XH 4J3XA 1XMWA 5BS0D 1BMGA 2DLFL 4WU5B 5JHDE 4O58H 1JNNH 4YDLB 2ZUSA 2DWEA 2IAND 2NY5L 3UO1L 2R69L 3LB6C 2V5SA 2HVJA 2OZ4H 5DJ8A 2R2HB 2YD9A 3CFEB 3P9MA 3LN4A 3QUKB 5B39A 1S9VA 3VGGA 2AJ3A 2F8OA 1Q94B 2GK2A 1UJTA 2XQYG 4X83A 5D2LE 5AZEH 5CWSB 1RIUH 2NY6C 5CZKA 2K1MA 1IGFH 3DVFA 1FZMA 1WAAE 2CGRH 1TDQA 1B6UA 4ISVA 1JI2A 2V2WA 2LE9A 4XVSL 5C71A 4OD1L 1FP5A 5ESVA 2QSCH 3C60A 3N50A 1HEZA 1JNHA 4OB5H 1JRHH 1J5OL 3VXMA 4JPWL 1R5IB 4OCWL 2IAMD 4K7PH 4EDXB 4KFZC 1XCQA 4HWBH 4RMUA 2GYSA 4PRDB 2UZIL 4HS3A 4XP1L 4OZFA 4RMSA 3E3QE 4U1GB 1MCFA 4L9LA 3GSNB 1UACL 5DURD 3Q1SH 3FQXA 4L4TD 5I16A 1CFSB 4BQBA 5DFTA 3NTCL 3QQ9C 5BO1L 4G7YH 4N0UA 1M71B 3L3OA 4Z7WB 3FN0L 3G6JF 5A2KH 1A14H 4Y7MA 3ARRA 4YXLH 5FYKL 3LEYL 1MI5E 1QSFA 4EUPG 3TIEB 1RZFL 4G80A 1KXQE 1U95A 5E70A 2AJYL 4NT6B 5DRXA 3RNKB 4BJLA 5CBEA 2NZIA 3ARGC 1FRGL 3BH8B 2A6KA 2OX5A 3Q48A 1A3RL 4JPIA 1TJIH 4APQD 2VDRH 3WIHA 1NDMA 5E1HB 5JQ6H 5CGYC 1J8KA 1DP0A 5FYKU 1C12A 2H6PB 4PJAB 4RWYL 1PG7X 2AEQH 5SX4I 2UYLA 2HG5B 3MRJA 5D7SL 1N2RB 3LRHA 4GAJL 2F8VA 3LKPB 5CIPH 3VXOB 3B9AA 4DGVL 1I4FA 1FVCB 3CSYB 3VXTA 5BVJA 5TDNB 3NH7H 2IGFH 3NVQA 4ALAL 5LWYL 1YDPA 1RZKL 3BP4B 4JFFE 1X9QA 2DOCA 1NUGA 2OL3L 1HCVA 4KUZH 3NAAL 1GGBL 3VG9B 5KJRL 4Z7VE 4LPXA 1XT5A 1IAKB 3L3HB 1NL0L 2Z35B 3IKCB 2YPKB 4PD4K 3PDOA 5MEOB 4XNYL 1FL6B 4GQ9L 1CDUA 1J05B 4HX1A 3VFWA 4JFDD 5E6IB 4EOWH 1NGYB 2NW3B 4OSUH 3QI9C 3P30H 3B6SA 3PWVB 1A1OB 3UTTD 1N4XH 4NRXB 1DQTA 5FCSH 1EO7A 1M05A 4PJFA 3SDCC 3VFRA 4ZNEE 3WFCH 5CS7A 5ACMA 1DN2A 4G6KL 4WRLA 3DX6B 3SBWA 5FOBA 2P4AB 3BQUA 4PJEB 4DOHB 1RHHA 4ELMF 4OAWA 4YUEL 3H9YA 4D8PA 1J8HD 4QRPD 4MXWH 4NUJA 4XNZC 4P57A 5F1NA 5GSRB 4JM2D 3CAFA 3RVWC 3MRRA 1DQLL 3LS4L 4ZS7L 1X44A 3FB8A 4U0QB 1GPOL 5CZXC 2HLFC 4LOUD 4C56A 4EUPA 2I5YH 4OUUA 5C0BB 2UVEA 4EN3B 5CMAA 3P11H 3WL9B 3NCCB 3MLXH 3L3GA 4DTGH 3HC3H 4N90E 1EXUA 1A4KA 5KAQG 2GK0A 1OTSD 4QHLA 3S3JA 5GISL 4C59B 4M6NL 3RNQB 1N7MH 4ACPA 5HXMA 5EU4A 3ZE1E 3SDAD 1PQZA 3L6FA 1T6WA 2VLKD 3NFSH 1B0RB 4ONFL 1U91B 3U9PH 1IM9B 3T08A 4N8VB 4NO0A 4X7TB 4YDVA 4FFVD 5IW1B 5I1JL 5I8OL 3MRLB 4NKMB 1KEML 5AUMB 1G7IB 2X10A 4N68A 4P23D 2NY2B 1G9MC 1N6VA 2JCCB 1P6AB 4YHML 2AK1L 3HI6L 3RAJH 5C6PB 5HHVH 1H15A 3AS1A 2PTUA 2BVOA 2D2OA 4I4WA 5CGTA 1I7UA 3BKJL 3JWOL 1UM4H 2X9WA 3JTTA 4UI2A 2DKUA 1EO8H 2F54D 3QPXH 4MYWB 2Q76B 2R0KL 2V2TA 3BPOC 25C8H 3WS6A 4HIHA 5HYJB 4NYLB 1FCCA 5FV1L 4R2GB 3KR3L 4CW1B 4QRTB 1KLUB 3WFDH 1PLGL 3Q6FA 3KLHD 2BOBA 2A73B 3RJDA 2WWMC 5I1KL 4YR6B 5IQ9B 3ZL4L 1CE6B 4HKBA 1T0MB 2V17H 4RAVA 5EO1A 4PLKD 3T0EB 4D3CH 4JRXB 4Q9QH 4W6YB 1NFDB 4TSCH 3DRTB 3QRGL 1MVUA 4Z8FH 3CX2A 3CVHH 5KTEH 1IEBB 4NHUB 5ANME 3GHBH 4U31A 1HILB 2EYSB 1KUMA 1CGXA 1QRKA 1HH6A 2FATL 3HNSH 1RUMH 1F13A 4ZD3H 5EOTA 3K2MC 3QQ4B 4MQTB 3WLWD 4PRHE 1FFRA 1C16B 4FQ1L 1A7NL 4MB4A 5GGRY 2ZUTA 5ILTH 2A0LC 4XCCH 3O9WA 5HPMB 4H25A 2R69H 1UM6H 4MX7B 1CBVH 5I1IL 4LLQB 5J9PB 5IGXL 3ARFC 4ZAKB 3OAUH 3KNBB 2JIXA 3BP6A 4DGYH 3RZCB 5HDQH 2I07B 4UAOB 2VIRB 5FYLE 1DFBL 4MZ3A 3V7MA 3W9EA 3GSRB 5DTFB 2FLBT 3O11A 1KB5B 1Z3GL 1A1MB 4NQSA 1J5OH 3DHMA 3ZKXB 4IRSA 4ZFOB 3GJFH 3QIUB 5T5NG 4LIQL 3S37H 1BZ9B 5L2KB 1UACH 4H26B 4Y4HC 5J0BA 4XWGL 3TJEL 4WFFE 3L3DA 1MFCL 1HHGB 4X6CB 5CP7A 3HUJB 5BO1H 3QR2A 3T04D 2YK1H 1VEPA 5DUPH 4OLZL 4PJ9A 1KLGA 3GBLA 4XCNA 2VR5A 1YPZA 1YEEL 4TTDD 3LEYH 2ID5A 4ZSOB 1FG2B 2AJYH 4CDGC 1QBAA 3TC9A 1CXLA 4PS4L 3DIFB 1QFPA 4MGXA 2NY6B 4M1GL 4WGVB 3CZJA 2WINB 5C08B 5KS9B 1WFNA 1WT5C 1IBGL 4RWYH 5DD0L 3RWIB 2QKIA 1KTDA 4JDVA 1SBBA 1FYTE 3N1MC 4L3EA 4X4XA 1EAJA 3QCTH 4DJMA 2RBLA 4GAJH 1I8KA 5T33H 5IVXE 2DWDA 5CHNB 5E08L 1NSNH 3D3VE 5F8QC 5SWSA 4Y1AA 2EO1A 1T7ZA 5IKCA 2XYCA 5DEFA 3ECBA 1BFSA 4NC0B 5C07D 3IDJA 1JHLL 4H88L 3AXLB 2ESVE 1S7WA 1ONQA 3DGCR 3EDEA 4YAQB 1MJ8L 3C08H 4PGZA 3LRSB 2NX5D 3SGKA 4JQVA 1NL0H 5ABDE 5DD1H 3E8UL 4LCYB 4XGZB 1P4LA 4LCUB 1BM3L 4CMMA 1YC7A 3JWDL 2C3VA 4GKSA 2RAMA 3VXPA 3TVMA 1CDJA 4QT5A 1RZIA 1GZQB 4GW4B 1KIUA 3QRFM 2B39A 4PRPE 1EUUA 5GGVH 5DMGC 3RTQD 4TRPH 3FZUD 2YMXL 3RWHA 1RD6A 1HHHA 4KZEH 4LNVA 4U6XA 2AEIT 3OKOB 4FZEL 4FQLH 3WEXA 5DJAB 3LQZA 3NPSC 3LQAL 4XPFL 5AD0B 1IGIL 1W72L 3QO0B 4HJ0D 4NQCD 3VXRB 1G7PA 1DQLH 5EO9A 3G04B 1P7QB 3GI9L 4ZS7H 1P5UA 1YUHB 2C7UA 2DLHA 4G8GD 3OR7A 2CUHA 1GPOH 3MROB 3BDXA 1VFBB 2EH7H 4K55A 4KZDL 4QOKD 1MCBA 2MCPL 1R5WB 4NWTL 4S2SA 3RGVC 4G9FB 3KPMA 3BN9D 2YA1A 4OCXH 2ZJSL 5E1AA 1NBYB 4K8RL 1PZ5B 4S1SL 3TP4A 3UYPA 4Y2DD 5BMFL 4ONGH 3QI9B 4JGMA 4PJIB 3SKNA 3QT2A 3ULVL 5T1KB 1J0KA 5L9DL 4W81A 3T0WA 3SDCB 3P2TA 2X09A 3D0VA 3O2DH 2VE6A 4QGTA 2R56L 4LSRL 2BOCA 2DQIL 1NC2B 4OZHA 4RMWA 5C0RH 3ULVF 3QEHB 4LEOB 5I1JH 4HBQA 5I8OH 5I9QC 1KEMH 4QRRA 1C5BL 1MUJB 3LPWA 1N59A 2IPTH 4U7MA 1JN6A 2ADIB 5F1OB 4HT1H 1G7JA 5E8PB 1ZWIB 2V7NA 2DLEA 3PGFL 3JWOH 3KVQA 1KNOB 3KXFA 1MAJA 1FLTX 4BFIB 1J0YA 5EU6B 2HMID 4MHHI 5DK0A 2FL5B 3CFIC 3HRZB 1I75A 4LPYA 1ZHNB 3KWWB 5GJSH 4DK3A 2BSTB 1F4XL 4WWKA 4FN0A 1L7TH 1J11A 4L4JA 4GW1A 3RWEA 3KR3H 3NIDF 4KUCD 4HMDA 4XMKL 3QIBD 3O6MH 4KV5E 5CEZL 3MRKB 2C3HA 4B41A 4LPTA 2KBGA 4KVNH 2BY0A 3MNVB 4Z76B 4OF7A 4QHMA 3MMEA 4ZUWB 3KPNB 3MLUH 3MYJA 3QEQB 3T65B 3WHE1 2FJFB 3HKFA 2E7LA 1M7IB 5C0FB 4P2CG 1IKNC 1JWSA 3B9VA 4OCSL 4OTXL 3DOSA 2PYEE 5MEPA 2CKBL 1FL3A 1HKLL 3P3YA 4TSAH 1EMTL 4I0PD 1A7NH 4MJ5B 4WVRA 4LVHC 2XFXA 3GSXB 1XIWA 2ICWB 5EG6C 2VSCA 1S7XA 4TN9A 2CIIB 3BPOB 4FTVB 5I1IH 1YMMA 1BX2B 4D9LH 1S7SB 3FOLA 1T89A 3V0WH 1H3WM 2H8PA 1MHPH 1UWGL 4EI5D 5GRYA 3IFOB 3QIWD 4HPYH 2CLRB 5EBMA 2IFFH 1A9EB 4XXCC 3AC0A 2P8PA 1XF1A 5IMMA 2GJZA 1DN0B 5MI0C 2WQ8A 4L8BA 2PETA 4QXTB 5LGJA 1Z3GH 4N0FA 4ESKA 1LMKA 4J1UB 4MVBC 1FIGL 1LE5A 2MKWA 4HH9A 3PWLA 5EU5B 2HJFB 3T1WA 5A16B 1HZHH 3MJ6A 2X89A 1U92A 3GJEB 3O6FD 3CU1A 2W0FB 3TZVA 5J1AB 4PBXA 3QJFB 4RQQB 2FWOB 4LLWA 1MFCH 4Y16D 5IFHL 4E9LA 1U8MA 5L6YL 3SKOB 3UTPD 2OR9L 3GHEL 1EDQA 3D39E 1Y0LA 1YEEH 4D9RD 3H9HB 3ARFB 5IR1A 4WU5A 3G5XB 1MAML 4MNQE 5FYLL 2GCYB 4H8WL 5L88H 3JVGC 1FNAA 4NQTA 4PS4H 2MWCA 1AGCA 3QCUH 2J6EA 1T21B 3DGGB 2R2HA 2BSRA 2L4OA 1X5JA 1IBGH 3QUMA 2ENYA 3IGAA 4UDUB 4NQEA 3CFEA 2VXSL 4X99A 4K3EL 2VYRE 4PJ5D 1S9YA 3IJSB 1I7RA 2HKHL 4OFYD 1RMFL 5CWSA 2J7LA 1V7NL 2J4WL 3OMZA 4NQVB 1BHGA 3N85L 1K4CA 1N6QL 2BHZA 1LDPL 1VKXB 5KANG 2CLVA 1R5IA 1C8PA 2MQ3A 1ZSDB 4NKOB 5CBAA 4LSQL 1J0ZA 4QCIB 5D6DA 2FD6L 5IP4A 4HCRL 35C8L 1TQBC 3U1SH 5IM7A 3GMMA 4D0BA 5IMOB 1X5IA 1FDLL 4NC2B 1QG3A 4EQ3A 3X14B 1BFTA 1M71A 4Z7WA 4D0DA 3FQRA 4GAGL 2QQQA 3IU3B 1IZKA 1XEDA 5JMOC 4KTEH 2R9HC 4FXLA 4CUCA 3QXVA 5MEQA 3LQAH 3W11D 2VLJA 1WFOA 4UTAL 3OTTA 3QWOA 1ZA3A 2NY4C 4Z77B 1X5FA 4HZAA 4R97B 3AB0C 2OS7A 5HGHB 1XGRB 4U0RC 1ULVA 3HG1E 3DUHA 4PJAA 4HSQA 3GI9H 5DRZB 3FQWB 5FIEA 3WJJA 2NY1C 1NC4A 2P5WB 2O5ZH 4U6VH 2BVEA 2BY2A 4KZDH 4WUUA 5TFSH 5D5MB 3TO4C 3DYOA 3LKPA 3NCJL 3VXOA 4DCQA 4HAFA 4NWTH 2YPLD 5FYKD 4RNRA 2ZJSH 4JO1H 4RSVA 5E00B 1G9NH 2AJSL 5KZCD 1E27A 1KENH 4RGND 3TCLB 3QNYB 2ORBL 4HIXH 1G6RH 4RFNC 3HC0B 3MNWA 3EOAA 5T5FL 1IAKA 3RVTD 3BDBA 4XC3H 4NO2B 5DUML 4FRWA 3IKCA 1L9NA 4KGJA 4R90L 4MA8L 3I2CL 3BO8A 1FVEB 1J05A 1KIRA 4LSRH 5HHMD 3X11B 1ZKAA 2DQIH 1MFAL 5DJZA 3VA2C 5E5RB 3WDJA 1UADC 5E6IA 3CH1B 3TPUB 5DJ2B 1NGYA 3S5LB 1JGDA 2APXA 3NPSB 3OKDA 3GSUA 4RMQA 4M6OH 1SY6A 1C5BH 3WKML 3C5ZC 3H9SB 3IFNL 1J1OL 1KTKE 5EBLB 1PKQB 2XPGA 1E6JH 2D31A 1T1ZB 2C1OB 2BNQE 1ZLSL 4M3JA 4P9ML 1RAMA 2V5TA 1A6TB 1U8NA 43C9A 1A7OH 1H8NA 4YFEA 2XKNA 2IALB 3RWCA 1M6OB 3QFJA 4XMLL 3X3FH 1QRND 3U0WH 3WDHA 3ARYA 1NCNA 2B2XL 3T3MF 1MCHA 1AP2B 2VXVL 3QISA 4UB0H 1N8ZA 5F7WC 5MHSD 2XN9D 4XB8A 5I8KH 3BPLC 1AR1D 1A6VH 4WUKH 4O4YH 3MREB 4PJXF 1CLCA 4ERSH 2FZ3B 4JRYD 5GQBA 1MCJA 1TITA 5JIKA 2PXYD 1SYSB 4JFOA 5IW3A 3KS0H 1B2WL 4ZG1A 5I9QB 4OV5A 1YEDA 5E9DB 2HTLD 3HCVA 1FZJA 1P4IH 4PIRF 3U36B 4FABH 4PP2B 1CFVL 4KRLB 2CKBH 2OK0H 4IRZL 3MUJA 4XP4H 1IM9A 1EMTH 4DFHA 4OLVL 2CMRL 1X5KA 1II4E 4N8VA 3LSOB 2C4XA 4AY0A 3ULUE 3G6JE 1I3RB 4FOMA 4LMQE 2VLLB 4PJEF 5HHOA 5IW1A 5LQBH 3MRLA 3N1GC 4S0TD 1NJ9B 1MJ7H 3HTLX 3R0MA 1DBJH 3VDCA 1JWMA 1MHEB 3Q2CA 5JQHC 3QDGE 5JA8B 4KJWD 4BK4A 2GT9A 2H9GA 5CIPB 3SGEH 1T03H 1FJ1A 1DVFC 1INEH 4HKXB 1Q9LB 3VXSE 1ETZB 1BJ1J 1UEYA 3GEWB 3VFSB 5I75C 4P5TB 3MLZH 5HTSA 4NYLA 2W38A 4IDLA 4POUB 3FO0H 5GGTL 3VXME 3TYFA 4A6YL 1K4DB 2A73A 3TN0C 3C09C 2PN5A 4YR6A 1FN4B 1KBGH 1NBVL 1S9WB 1QHOA 1FC1A 4JRXA 4DEPB 3VFVA 4M62L 5KVMC 4JY6A 1NMAH 1X6LA 2AJUL 3MV7D 1BD2D 3HMXL 4LFHD 4PJGB 1NCDL 4AQOA 2A2QT 4LVHB 1IEBA 4JY4A 4X0KA 5IFHH 3MODH 4UV7L 5JIIA 1HILA 2EYSA 1U58B 4XPHL 4LGPB 5MENB 4QXGL 1BREA 4D94A 3K4DA 5CFHA 3GHEH 1D9KD 4J3SA 4HC1H 4M8QA 2JCCF 1I9JL 3MOBL 3P0GB 3STLB 4N0CD 1XGPB 1KJ2B 4R4FL 5FYLH 3DV4B 2Q87A 7CGTA 3BUYA 3ZT5A 1EEZA 5HPMA 2PNDA 4OQTA 2CUIA 2DQFA 4MX7A 5KSBE 2DS4A 5MI0B 4ELME 2DM3A 2UWEA 4P2RD 3VXQB 1Q9WB 4LDLB 3KNBA 4K3EH 5CAYB 2O5XH 3G5ZA 4BQ9A 3RZCA 5FEBA 5BZDA 1E4KA 2DF3A 3CC5A 1KEGL 2OMNA 2ZPKH 2X1PA 2Y36L 1V7NH 5F7HA 1RZ8B 2VXQH 3T4AB 4LLVA 1S8DB 2HJLB 2Y07L 3N85H 1KB5A 3IFLL 2J8OA 5DJXA 1KG0A 5GGSB 5AAMA 5I1AA 5TQ0L 4ZFOA 4DAGL 4U05A 3QIUA 2FD6H 3DUUB 3HI1A 2BVTA 4PGBB 3LD8B 5DHYB 2CXKA 3T1FB 4GRWB 4NZTH 5TF0A 3EYSL 3IU4H 5GS0L 2FR4B 2GFBA 1NLBH 1YEFL 1U9KA 3HUJA 4XBEL 5TE7L 5CUSL 2J8UA 4HIJA 3DECA 3U7YH 1AXSB 1MVFA 3MBXH 4LARH 4U1SB 4ZSOA 5IB4A 5AWNH 3QNXA 4ODHL 1HHIB 3F7PC 1SEQL 3RUGA 4E41B 1S78D 4LHUB 3NIFF 3DIFA 5BS0A 5JXED 2G5RA 2R4RH 5JHDD 3BEWB 3SDXB 3DURB 1R0AH 1NCBL 5KS9A 1WITA 2K9UA 4I5BA 4F8TA 3V5HB 1E4WL 3MACH 1KCSL 1T3FA 4Y4FB 3ZO0A 3D69A 3U2SB 1AY1L 1D6EB 4XCYB 1W0WB 3MRGB 5HGAB 1ZS8B 5LKNA 4N1CA 1TQBB 4JDTL 4PPTA 1MCEA 3VD3A 4ODBD 1K8IB 3HB3C 3GB7B 3B2UC 3KPRE 3HPLB 1OOAA 2ADJB 4AENB 4Z0XB 4L8DA 4X6CF 5ALBL 4JZOB 5JHLL 2DQTL 2W59A 4WENB 5JLZB 2AP2A 3MNZA 2AJZB 5BZWB 1MFAH 3DI3B 5DJCB 4KKLC 2DJUA 1EH9A 4O9HH 2NY4B 4NM8H 3BSZL 3AB0B 1NCWH 2R8SH 2Z92A 4KAQL 4XT1C 4U0RB 4L4TA 1TJGL 1H5BA 3REVB 3RVVC 1NBZA 3I6KB 3GMNA 2NY1B 1RK1B 3NACL 4X6BB 5EA0L 3VD5A 2IH3A 4YE4H 1ZLSH 3TIDB 4NNYB 1EGJL 4P9MH 1FVDB 2YSSB 3TO4B 1AXTL 1MI5D 1ZE3C 4M1DH 1WEJL 2UV3A 3MRPB 4WY7L 4F9PA 3QO0A 4XNUL 3SPVA 4CMHC 3VWKC 3VXRA 1MH5B 1Z0MA 3OX8B 1P7QA 1T7YA 1YUHA 3VFOB 3I84A 1XGUA 5BVPL 4OM0L 3GJFB 2GJ6D 4KVCL 1VFBA 4RFNB 5B4MC 4APQA 2XY2A 1BQLL 3MCKB 4BSWA 1U2CA 2MHAB 2Z31D 4G9FA 4CN1A 2AJVH 2E7HA 3LEVH 1BVLA 3SDDC 1FNEB 1DBAL 4ODVL 4UNVA 1PZ5A 2DD8L 3K8LA 4OGAD 5E2UH 4WI3A 4LAJH 3BZDA 4JFFD 5T1KA 3C5ZB 3AFLA 4LF3B 1IGJA 1LO2H 1CFVH 1QFOA 3RIAF 5IHZB 3IAGC 4OLVH 2CMRH 1KT2B 4XI5C 5EUKA 3VRLE 3QEHA 1GH7A 1VA9A 2BZDA 3C6LD 1X5ZA 4WU7B 4Y19E 3A6BL 4YNYB 3ZT6A 1MUJA 1H3GA 2R1YB 1CK0L 2ADIA 2HVKB 4JFDA 4PJ8D 1WVZA 2ZOLB 1N0XL 3MRHB 4CL7A 1WIUA 5IFJA 5IBTL 4LGRB 4PB9L 4M5YL 1EBPA 2XQBH 2F74A 4BFIA 2EEDA 2W1NA 5EU6A 1TETL 5JUEL 3O4LB 3BPLB 3PXJA 5JA9A 2AQ3A 4DKEL 1ZHNA 3KWWA 1QEWB 3MV8B 1C1EL 4PTUB 5D96B 1OSPL 2VABA 4JFPB 3CCHB 4K3JL 4LQFH 4L4VB 1QFWH 2VDKL 4S1QH 3BEVA 2CK2A 4AG4L 4KKBD 5LCVH 4PJIF 2VITB 3GM8A 1V05A 5GHWH 1G9NC 4TUJB 3F7QA 4PJ7B 5K9KB 2IBZX 4P2QB 2Z8VC 3ULUL 1KCUL 3KPNA 1L0XA 3QEQA 4M4RA 3HMXH 4M02A 3T3PE 4I2XE 4O2CA 1UVQB 3FQUB 1H9VA 3T65A 5C0GA 2R29L 3D48R 5C0FA 2QL1A 1KCKA 2NR6D 4CVXB 2IQAA 5GRWA 1RZGB 4JQXC 2OSLB 5L2JB 3BMWA 3WXVH