3QIBA

Crystal structure of the 2b4 tcr in complex with mcc/i-ek
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
180
structure length
180
Chain Sequence
IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
source organism Mus musculus
total genus 30
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qibA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3qibA01
3SGKC 5HYQB 3G5VB 1T4KA 5HPMB 1N64H 3SDDC 4XCFL 3CSYB 3G5VA 1HSBA 5HPMA 5DJZB 5F7HA 2YD1A 1DZBA 2IH3B 4NQCD 5DJZA 2GUOA 3B5TA 2P7TB 1CDHA 3F7RA 2PR4H 4XHJD 2R2EB 3MUJA 4MA3B 2NY4D 2MHAB 1I9RL 2P7TA 5HVHC 1VFBB 2R2EA 5F89A 4MA3A 3BN9D 1FJ1A 5IGXH 4N8CH 1IL1B 2P45B 1FNSL 1X5AA 2PW1B 1LQSR 3D87B 4Y4KD 4S11A 4U1GC 1KENH 1NLBL 4Y4FB 1NGXB 1R3IH 3VXOA 2D9QB 1OPGH 3BI9X 3IS1X 2D7OA 4Y4FA 1TQBB 1NGXA 2D9CA 4TRPH 1KGCE 2PXYA 2CK0L 4GAGL 5CIPB 3CFJA 5IV2A 2NY1B 1L0QA 3TT1L 3WO4B 5GRVK 4LLUB 4OGXH 4XMLH 1HILB 5CIPA 4OZIE 1RIHH 1ORQA 4NCDA 4D0CB 4LLUA 1TJIH 2JJSC 2P4AB 1U8IB 1HILA 2O5XH 3MFGB 1RUKL 2ZUQC 2YN5A 4POUB 4D0CA 1A6TB 4ZSOB 4RAUA 1GZPA 4ELKB 4JZOB 5E2TH 4XCEB 3QO0A 2OM5A 2R56L 2Z9TA 5C0BD 3MLZH 5EU5B 3C60C 5HGBB 1A6TA 1GGUA 4ZSOA 1KUMA 4ZNCD 5T5FH 4IOSD 4ELKA 4JZOA 4CADB 4XCEA 1NJ9B 5EZJB 4F58L 4NZDA 5GS1B 1OAXH 1OHQA 2Z31C 5A16B 2AV7B 3CDYA 4CADA 4JFEE 4A2MA 5HY9B 3UDWA 5B8CC 1UWGL 4OB5L 1BWMA 5A16A 5E0QA 4NCC1 2AV7A 4WY7L 4WUUE 3HLAB 3KPLB 3QUMB 1UKSA 5HY9A 2IFGA 1JWSB 5DD1H 3ZKXB 4EIGB 5F3BB 4X7DC 5F1SA 3HLAA 1JWSA 3SPVB 5F3BA 2BC4B 4JFDE 2R0KL 5E1AB 1DQQB 5C6TL 4JAMA 3UAJD 5TE6H 4ERSL 2YUWA 1MLBB 3SPVA 1OTSC 3W9EB 2EIEA 1T1ZB 2APXA 1DQQA 5CHNA 4JRXD 5CILL 3D2UB 4HIJA 1MAKA 1MLBA 4WFGE 1A7OL 3PV6B 3I2CL 3W9EA 1T1ZA 4KRMB 1IAII 2DMCA 1H9VA 4KHXL 4NZUH 3I6LE 5FHBH 2Q3AA 3L6FB 5J06A 2X09A 1IGTB 5MENB 1OLZA 4GQ9H 1WEJL 4Y16C 3DBXB 2ED7A 3L6FA 1CDBA 2ENYA 4G43B 4PJEF 1IGTA 1YYMH 5F8RC 5MENA 3JWDL 4U6XB 3DBXA 4TTDC 1S7WB 4G43A 5E4EB 4P59H 4EKXA 5T1LD 1S7WA 3IU3B 2OQJA 1MFDH 5IMOA 4P5MB 5J12C 5CEZE 3BGFC 1I1AB 5EO1B 4HIHB 1QR4A 3IU3A 4NFDA 1A7RH 1VFMA 4KGLA 1R3LB 4P5MA 1I1AA 5EO1A 4HIHA 1YMMB 2CRIA 2ENSA 5IJKA 1R3LA 4PRDA 1AY1H 3V6FB 2VABB 4I3SH 2LABA 4O2CB 1SJEB 1YMMA 2GSIB 3VWKC 2E7HA 3V6FA 2VABA 5IGXL 4MS8D 1J0IA 1KBGH 2FO4B 2NX5B 5ACZB 4I0PC 4H88L 1SJEA 4O2CA 1BZ9B 2GSIA 4UB0L 1FNGB 4MB3A 4MA8H 2A1WH 1KENL 2FO4A 5ACZA 2NX5A 4P2RD 3U9UA 1BZ9A 1FNGA 4G8GD 1NBZB 4KRLB 1FRGH 1D9KA 4TRPL 1KB5B 4UT6H 5I66A 3BSZL 1G7PB 5FYKE 3MLWL 1FYTD 4OGXL 1G7PA 3T2QA 5I19L 1RIHL 2DTML 3QISA 4LCCC 3SQOH 4ZO9A 5JDSB 3BPCB 5SX5H 5D7JA 1K9TA 2O5XL 5C0AB 3FB8B 4WNQB 1RSFA 1RZGB 5JDSA 2WW8A 3BPCA 4WNQA 1KJMB 4IHOB 3QA3A 4PY8I 3GUTA 3AAZB 2AJUL 1RZGA 5T5FL 1KJMA 2V5MA 4FXKB 3AAZA 4CNIB 3ZKMC 2R9HC 4RISH 1HINH 4H1LB 4Y2DD 3RUGF 1EHLL 4FXKA 3BP5B 4XXCA 4GKSA 4H1LA 5F96L 4AENB 4NJ9H 1BOGB 3IVKB 9CGTA 5CKAA 3BP5A 1XGPB 3K4ZA 4AENA 5DD1L 1WSST 4YDLC 1BOGA 3IVKA 4X5WB 1XGPA 3OXSB 4RQQA 7FABH 3RI5K 5KVMC 4G8EB 2GSGA 4X5WA 5DMYA 1QSZA 4X9HA 5TE6L 1FO0H 1R24B 4G8EA 1WBXA 5ESQA 2LTQC 1JHTA 2Q86B 1MRCH 4OFKA 1R24A 5BOZG 1MEXH 5GRVL 1D5IL 3MX0A 5I73C 2AAVA 2DQTH 2Q86A 4OZHF 5E94B 3NACL 4RFOH 4ZFOL 5EZLB 1XGQB 2VLLB 5KOVC 2HT4D 4NZUL 3HNSH 4ZYKB 1JPSL 5E94A 5FM5M 1IVLA 3RWFB 2HFTA 5EZLA 1XGQA 2VLLA 3VRLE 4XVUD 5I1CH 3DVIA 1P7QA 5F9DC 4XPGH 3WFDH 5K9QG 4F9PC 3KWWA 4ZYKA 5DMJB 3RKPA 5JLZA 3PWNB 3RWFA 1AGFB 1X5GA 1KGCD 1YYML 4M93B 3B6SA 5AG8A 3LDBB 3FFDB 4WO4D 2F54D 1G84A 1S7RA 3RX5A 2ZG3A 3PWNA 1AGFA 3AU1A 5HHME 3RWIA 2ICWB 4D2NA 3FFDA 5EU6E 4P59L 1OTUC 3UMTA 2VL4A 4U6VH 3TA3C 3CFDB 2DJUA 3DGGA 4KY1H 4EOWL 3NABL 4O51B 3VXMA 4Z7WE 4EJ1C 3CFDA 5D1QC 1A7RL 1WIOA 3KVQA 1IAKA 2DLHA 3QEQE 4O51A 2QR0B 1VFAB 3OKLB 2FJHB 5IMMB 3LKQB 1AY1L 4GMSH 1CXKA 2QR0A 2FJHA 2DICA 3LKQA 2V9QA 1KBGL 3HI1A 3JVGA 5MI0B 4JFED 4RNRB 2VDOH 4MA8L 3V7AE 2A1WL 3A6CH 4LNRB 5E5MB 4WUUD 4RNRA 4K8RH 5DQDH 3OB0K 1FRGL 1TJGL 4QRQB 3RL1B 4S10A 3BIKB 4UT6L 4JFDD 5GGUA 3QR2A 4P57B 2P44B 4QRQA 3RL1A 2EZ0D 3BIKA 3S4SB 2W07A 4LVEA 4P57A 4V2BA 1K4DB 3C8KB 4YBHA 1TZHB 4P5KB 4LVNB 3VXSE 3SQOL 2DWDB 3S4SA 5C0AE 5T3ZE 2NXZC 1K4DA 3W0WB 2P48B 1TZHA 3PHOA 3BPNB 3GMNA 5TE7H 1PX3A 4PB9H 3W0WA 5GRZA 5HYJB 1MH5A 3JWDC 1Z3GH 2XYCA 1AKJA 1LE9B 3R0MA 4OLYH 5HYJA 1HINL 5ERWB 1BJMA 2DJ4A 3GSWB 1CT8B 2J6EA 2FX9H 3QXVA 2X1PA 1LE9A 5HYIA 4V2CB 5DDHB 3GSWA 1CT8A 2DQJL 4NJ9L 1T80A 3RA7H 4WGWB 1EEQA 5CGYD 5DDHA 2UV3A 1T0MB 4P9HH 5BS0D 5ANME 1MVUB 2DQHH 1LEIB 1W0VB 4EI6A 7FABL 3P0YL 5D6DC 5IROA 4XAKD 1LEIA 1W0VA 3QO1B 3U7AA 4K94H 4CJ1A 3D85D 4LAJH 1FO0L 4Y5YB 5CINH 2HFEB 3GSVB 5E99H 1JYNA 5I8CB 3L7FB 5I15L 1UYWH 1TXKA 4Q0XH 5I1GH 5T1KA 5I8CA 2DQTL 2OJEA 3B4NA 3ZYZA 3C6LB 1L7IH 5DO2D 1RMFH 4LLDB 4LGPB 1YEFH 4OCSL 3C6LA 4OCRH 5HGAB 4G6FB 2ZCLH 4KI5F 5FUZH 5I1CL 5D7LB 4ZTOH 3TJHC 2J12B 4OV5B 1ETZB 3FO2B 3RZCD 1IKNC 3FFCD 5D7LA 5D7KD 4LIQE 4KKNA 2F53E 4LHQB 4OV5A 5FYKD 3P30H 3IYLW 3EO0A 3TT3L 5BRZE 2E7MA 4G5ZH 1AQKL 3FB5B 1EIBA 2GTZB 5ADOH 5IESH 3RGVC 3OV6A 4R96B 3HI6H 2AABH 3FB5A 3F7PC 4F57H 1AIFB 2GTZA 3L3JA 3QULA 5EULV 3V5DA 2YK1H 1Y6NR 1AXTH 2CUHA 1CD9B 2GKIA 2JELH 3VFNB 2UZYB 4GMSL 1U3HC 3TBWB 3RWHA 1RAMA 2QKIB 1UM5H 4LSSL 3TBWA 5INDA 1NGYB 2C3WA 2QKIA 4KTEL 4M02A 2VL5B 4JFPB 4AG4H 2VDOL 4HMEA 4LSPL 4XBGB 1NGYA 3A6CL 4PLKD 4JFPA 4K8RL 5DQDL 5K59E 1KCRH 4XBGA 2NY0B 4ETQB 5DD3H 1OWRM 5IBTH 1FVDA 5CKGA 1PY4A 1RJZA 4ETQA 1U36A 1T6WA 2HFGL 1JHLH 3RDTB 3K8KA 2WQ8A 4JDTH 2UUDK 2YN3A 3FQTB 3VG9C 1WIUA 3BQUC 7CGTA 3RDTA 3BRDA 3HA0A 3FQTA 1F4WL 5T3XL 4HS3A 3KPRE 1F4AA 3HCVB 5DMGD 5TE7L 2Y36H 2X05A 4PB9L 4XZUB 2UWEF 1CI5A 4MLSA 5D9SA 3BO8B 3MA7B 4P2OB 1E4XI 3UBXB 1FSKB 4KDVA 3BO8A 1L6ZA 3MA7A 3U4BH 2FX9L 2B1AH 4P2OA 4OD1H 4UINH 4AYFA 3P40A 2DMBA 4BZ2H 1T7XA 4MNQD 3DSNA 3VJ6B 4NKQB 4PJDE 2VTFA 4OKDA 4U6YA 2UYLB 1CFBA 1GZQB 4J4PC 5KG9B 1DFBH 2UYLA 3QEQD 1GZQA 5CINL 5E99L 5KG9A 5IVXA 5DJXB 1VEOA 4CL7A 1UYWL 4Q0XL 4KKBC 1XCQB 1U8LB 3O11B 5I1GL 5DJXA 3MLRH 5JMRA 2DM7A 4OUOA 5IHUH 4WU5B 2UUDH 1L7IL 2DD8H 1EVUA 5C0IA 2GJ6B 1U8LA 3O11A 4FN0A 5L2JB 4WU5A 2GJ6A 2ZCLL 1SY6H 5JW4Q 4HXAL 1A3LL 5L2JA 4RDQG 5GGTA 3ZHKA 4PJHA 4YHYC 1RK1B 1P5UA 3KPNB 2NTFB 4H20L 4QOKB 4E42B 2QQLH 5E6IC 2OYPA 2BSED 5HHOB 3KR3H 3QBTB 2J7LA 3KPNA 2NTFA 4E42A 1A4JB 4ONFH 3WMSA 2O93L 4RAHA 2VZ3A 4JHWH 5HHOA 3UCRA 1T1WB 4PJBB 3VXSD 1BIIB 1X5KA 1SEQH 1U9KA 5IESL 1U8NB 5D72L 2YPVL 3HI6L 1T1WA 4XWOC 2CO7B 3ULUE 3VD4A 1BIIA 1EERB 2AABL 3QPQD 5C0CE 4F57L 1FAIH 2BERA 5TE4H 1U8NA 4GRWB 5FYJU 2YK1L 2Y06L 1AXTL 4Q9CA 3VXRB 2JELL 1K3ZA 5A3IC 3CCHB 1T0PB 4IRSC 5IVZB 4PV9A 4PGDB 4ODSH 3VXRA 1UM5L 3AMLA 4EI5D 5F3HA 5IVZA 3GK8L 5H35B 5TDNA 3N1FC 4TN9A 3OBAA 4PGDA 3ULVF 3H9SA 4LRNH 2VXQH 5DJDA 4JQXC 5H35A 3KPOB 3V4PL 5MHSD 1KV3A 3PGFH 3BWAB 1QLRB 4HW6A 3CMOH 1RZ7H 4ODWA 1KCRL 3F12A 3KPOA 5DD3L 3BWAA 1QLRA 1BBDH 4JDZA 4I0KA 5FO9B 1A21A 2Z93B 4JLRB 1JHLL 2YKLH 3OTTA 4D9QD 5CLTA 3K4DA 3QDHA 4F7PA 3J7HA 5FO9A 2DLTA 4JDTL 4JLRA 2MWCA 5DT1H 3LEXB 1TCRB 4XP4L 1ZHNA 2FH8A 3WJLA 2GK0A 3U4EA 1RZ8B 3LEXA 4RGNB 1TCRA 4JG1H 1UZ6E 2Y36L 1OOAA 3H42H 3P4MA 3PP4H 1RZ8A 4PGEB 1F02I 2CQVA 2VXSH 2EE9A 1T66C 3REVB 2VSCA 4PGEA 4NNYB 1AHWB 1CYGA 3U4BL 1UKTA 4OD1L 3REVA 4P2QB 3LIZH 4UINL 4NNYA 5I17A 1AHWA 4OQTL 1AH1A 4G80B 4ZOAA 4JVPA 1AXIB 5EO9A 5BRZD 1T03H 2X4TB 4P2QA 4DTGL 4YK4C 1G0XA 4QHLA 1U58A 3MV7B 3UTSB 2X4TA 4RGOH 1EFXB 5M95B 4X83A 2L4OA 3MV7A 1DFBL 4YIQA 3HR5A 4CBPA 4U1HB 2YD3A 2NY2C 1PG7L 1W8OA 1J86A 1RK0B 25C8L 4D0BA 4MNGE 4U1HA 2A6IB 2AJXL 4JE4B 3HS0B 1NCBL 2P5ED 4K8RC 5EA0H 3U83A 2DD8L 2IANB 1ZHBB 3IAGC 2EDTA 5GGSB 3UXFA 4PJIE 5HHQB 1FN4B 2IANA 3O8XC 1ZHBA 4X4XB 1SY6L 4ZMAT 2Y6SC 5GGSA 4NO0B 3KPSE 5GIRA 4O5LL 4S0TD 4NQVA 4TVPE 4LPWA 4QOKE 4X4XA 3HPLB 4NO0A 4WHCA 5EORH 3UPAA 4Y89A 3DETC 3KLSA 4NO5B 1TFHA 1OT1A 3HPLA 5FDWB 1D5ZA 4ONFL 2AXGA 3BKJL 2HKFH 4NO5A 4JHWL 3RFZC 1U8PA 3ALWA 2OMBA 3HUJE 1WZ1H 4LLYB 5FDWA 4XMKL 1SEQL 5EU4A 3QG6B 1XIWB 1GPOL 4WW2A 4LMQE 1V3KA 1D6EB 4WEBL 4LLYA 4MJ2A 4GRWE 1AO7B 1FAIL 3ZDZF 2ZKHL 2VZTA 1D6EA 4KQ3H 1AO7A 3PHSA 4XNZC 4N8VB 1YEDB 4GH7B 2QLVB 3FO9A 4JQVA 4BZYA 3HR6A 3MBED 3WL9B 5D70H 4N8VA 1RD6A 1YEDA 3IDGA 3T65A 2VXQL 4PJ9C 3K3QA 3LZFH 1C5BL 5CUSL 5ISZB 3WL9A 5K9QI 2OI9C 5HDLA 3CMOL 1ORSA 1OP5K 3FHAA 1MIEH 3U2SB 5I74B 1PYWB 3QH3A 2UVEA 5DMIL 2Q20A 3S35X 4ZD3H 2HMID 4UILH 1CK0H 1F5WA 3U2SA 2W59A 5GS3A 5BV7H 4Z7OE 3UZVB 5HXMA 2ZOKB 5DT1L 5CS7A 1FGVL 4KKCC 3HG1E 4RGNE 2ZOKA 1DEEA 5F21B 1A6UL 4JREC 3SDYH 5C0RL 4GSDH 4L8SA 4N5UA 4DK3A 4O9HL 1WLHA 4QRRA 4EUPH 4ENED 1ZLVK 3B2UD 4TNWF 2EDOA 3M1BA 1WBZB 4ODHH 4HKBB 2YD8A 3EYFB 1TQCC 4FFYH 3WSQH 1UXSA 3D69B 4P46B 3LIZL 1WBZA 5SX4H 1JWMB 3EYFA 2CGRL 5I1KL 3D69A 1T03L 4M5ZH 2YRPA 1JWMA 3DPBA 3UTSE 5AG9A 1W0WB 4ONOA 3CXHJ 3G5XB 2GY5A 1W0WA 4ZQKB 1OP5H 4RBPH 2EH7H 3G5XA 1J8HA 4XP1H 5EC2B 5DJ8A 2UY7A 3DXAD 5GZOD 2QSVA 2VLRB 1RFDH 4PJ7A 4NN6C 4ZS6D 5EIIB 4WV1B 3MODH 5EC2A 3LQAH 2VLRA 1YNLL 3V2AR 1QVOB 3G6AB 4XHJC 5EA0L 3U9PH 5F7DB 3QNYB 4M7ZB 5FM8A 3EFFA 3KPPB 5EIIA 2NY4C 1CU4H 5A43C 2CUIA 4PJCF 5CJQH 3AS0A 3G6AA 5F7DA 3QNYA 4OZGB 2MMXA 3KPPA 3GZKA 4DWHA 4NQDE 3W5MA 3BN9C 4BFIB 4IM8A 1OAZH 5D2LA 3AREA 4M7LL 4X5XB 2YS4A 4BFIA 2RR3A 4NQSA 4Y4KC 2NYYD 2VLMD 5F1OB 3EW3B 1F3RB 4JFQA 3ZE1F 1G7JB 4OLVH 5F9WC 4QXGH 4LF3B 3T4AB 1CGWA 1J88A 3TO2B 2AEPH 3UTTB 1A4KB 3OAUH 3DARA 1YEGL 3U0TA 3ZMRA 2VC2H 4LF3A 4MHHG 3T4AA 5IVNA 4YDKL 3MR9B 1TETH 4JPVH 1A4KA 1VESA 3EO9H 3X11A 3L3KB 1F3DJ 1NFDA 3MR9A 1I7ZB 2XZCL 2Z0BA 3GSOB 4IOFD 4JPWH 3BP6B 5FYKH 4Q2ZB 4Y5XC 5ESAB 3GSOA 1WFNA 1CS6A 4TUOA 3BDBA 2EDEA 5D70L 1P4LB 5ISZE 4S1DD 2JCCF 3N85H 2C3GA 3LRHA 3KJ4B 3E8UH 4WTWA 5D4QA 3VW3H 5JO5B 2E8YA 1NDGB 2HN7A 4PJ8D 3PWPB 4NZRH 4YFDB 3QIUD 5JO5A 1NDGA 3IJYB 2F8XC 3AY4A 4YPGA 3T3ME 5ELIA 5FOJA 4DUVA 3PWPA 3O6FB 1ZGLP 8CGTA 1CK0L 2NXYB 3IJYA 4OLXL 2YPLE 1K6QH 5FYLD 3L3DB 1GC1L 1JFQH 1NDMB 3O6FA 5BV7L 1NCNA 3L9RB 1LD9B 3CAFA 3L3DA 4WI6A 3T77B 2OL3H 1NDMA 1A1OB 3FHQA 4YHOH 3L9RA 2RCSL 1FCGA 2EEAA 2Z8RA 1A1OA 2FEDC 3U48A 3SDYL 4Z7VF 3P77A 3VD7A 3WEXB 4JM4H 3MRFB 2VAJA 3RNQB 1QSFE 2DLGA 3VH8B 2DDQH 3WEXA 4HUXB 2OR9H 3MRFA 1H3XA 4RMRA 4FFYL 4Y1AD 4EUPG 2AJSL 3RNQA 4HKXB 3EKCA 1V8HA 3SJVE 4X4ME 3EUUA 4DKEH 1D5XB 3PABB 4M5ZL 1QFWM 1MRDH 4R7DB 1GVIA 4G7YH 4Z7UF 3PABA 4S0SD 2EYRB 2XT1B 3FB7B 3MRLB 2LQRA 1JWUA 4WHDA 1DLHB 3PL6D 5SWSD 3GBNH 2OZ4H 2EYRA 4HJ0C 3FB7A 4XP1L 3O2VH 1HHJB 4HXBH 1G9NH 3MODL 2JIXB 1HHJA 5CJXC 5DUBB 3QUYC 3U9PL 5DSCB 4PJGB 3RKDD 3SQBA 2CLZB 2NY3B 3ARDD 3QXWA 2JIXA 4L4VB 4OZGE 5CJQL 3V6OE 5KZCD 5HI3C 5DSCA 4L4TE 4PJGA 1MVFA 2VN4A 3GSQB 3S88H 1YN6A 4XC3L 4L4VA 2ZG1A 3RQ3A 4RDQF 1OAZL 2AEWA 3O81A 4RMTA 3GSQA 5INCB 3IB4A 4L3ED 1EXUB 4NQUA 1INQA 2GFBB 2IPUG 4OLVL 1EXUA 4QXGL 4CVZB 3UTTE 1MI5E 4ZNEE 4PG9B 1LNUB 3HG1D 3OAUL 3QG7H 4HBQA 4OLZH 3KLAB 4CVZA 3DYOA 1VKXB 4PG9A 4XB7A 1TETL 5F7EL 3EO9L 3KLAA 1VKXA 3CX2A 3BPOC 5EUKB 3JV5A 4J3OC 4NDMB 1S5HB 2J8OA 4OF0A 4WWKB 1DUZB 4W68A 4NDMA 1BQUA 1S5HA 4RZCA 1UKQA 4WWKA 4TVSa 1DUZA 3LHPH 3N85L 3WNPA 3FOLB 3E8UL 4NO2B 4FTVE 1KN4H 5ITFB 4NZRL 4JG0L 4Y2DC 1BFSA 3VFUB 3FOLA 4F15B 3V6ZB 4XC1H 1KJ2B 1XGUA 4NO2A 5FCSH 4ONGH 1ROWA 3VFUA 1VSCA 2X1WL 1QRNE 5DRWB 4YXHL 3X14B 5IHLB 4EQ2A 3L7EB 5H8DA 1X9QA 4QHMA 1U95B 4GXUM 1GGBH 5DRWA 1JUFA 4MA1C 4YJZL 5D7IF 3WNKA 1A7BA 2OL3L 4TQEH 3X14A 3L7EA 1U95A 4I48A 4JM2B 4PJXB 4M1CD 2QADD 4JM2A 4ZTPH 2E5EA 3MRNB 1J0HA 1JPFA 3OKKB 4IMLA 4ELMF 1I1FB 1P84K 2DDQL 2AJZB 5GXBB 2OR9L 3MRNA 4MAUH 3OKKA 2WLYA 1Q1JH 3B2VH 2AJZA 4LRIA 2HT4C 1OW0A 1F4YL 1OGTB 5IFAH 3IS0X 4J8RB 3QI9B 5I1DA 3OAYK 4WFFD 3VFWB 1MRDL 4TUKH 4G7YL 3QI9A 4WEUD 5E00B 4WO4C 4YDVB 4YR6B 5FB8B 1CICD 3BYTA 2OZ4L 1IZKA 3CDGB 4YDVA 4ZPTB 5FB8A 5ACMA 2OX5A 2VZOA 4GS7B 1ZEAH 4HXBL 2HWZH 3CDGA 1OAKH 1JV5A 1G9NL 4OLWL 1HQ4B 5IW3A 3QEGL 5L2KB 1TPXC 5B38B 3MNZA 3C5SB 4KROC 3LN9A 3VMOA 4K07A 4X8XA 1IQWH 4C59B 4E41B 3Q6GH 5L2KA 1J5OL 5B38A 3V95A 1A6AB 1A02N 3S7GA 4JRYB 1GC1C 2V2WA 3UTPE 5BV7C 1I9IL 4E41A 3M8OL 1ZE3C 2D2OA 3GB7B 4MZ2A 1HK6A 1T7VA 2H2SD 4JRYA 4QHKI 5DGQA 2YPLD 3DVGB 5DURD 4Y4HD 1QTYT 2G75A 1H3UA 5D1ZD 3F6IA 3NFNB 1ADQH 2FNBA 3DVGA 3LS5H 2OTWB 3NAAH 3QG7L 3OAYH 2J8UB 3R0NA 1EJ6A 2K3TA 1WAAE 2OTWA 1DBMH 2EZ0C 4JKLA 2CXGA 4QRPD 2PYEE 3BD5A 3V7AG 4KK6D 1N7MH 3K80A 5DEGB 1Q9WB 5JQ6H 1TTUA 1GOGA 1O0VA 5GRXG 3O3AA 3GBMH 5IB2B 2ZNWA 4MQ7B 5IWLA 2YSSA 2FIKB 5DEGA 1ZAGA 4G8FB 5K9JL 4W6WB 3MNWA 3SJVD 5J1AB 2FIKA 3IAQA 4ODBD 4ORZC 5J1AA 1KN4L 1RZKH 3L5XH 3QIWD 5KVGH 1HHHA 1YYLH 3TZVC 5EBLB 3JWOH 5EUOE 4XC1L 1A6WH 3U1SH 3FRPA 1HXMB 3T0EA 4YPJA 4ONGL 5HDBE 2AXHA 2OBGA 5CZVH 4N1HB 5EBLA 3V4UH 3EZ8A 4P5TD 2VZ1A 1AD9B 1HXMA 4Y0GA 5CGYC 5MEOB 2FBOJ 1GHFH 4JGUA 3BGAA 5L8LB 5C1MB 3CXHK 1GGBL 4QRUA 5CLWA 1AD9A 4QY8B 5MEOA 4PB0L 5ILTH 3AS3A 2MQCA 1OB1A 3NA9H 2BVPB 3F62A 2I5YH 3MJ9H 4QY8A 2NZIA 5DS8B 1JYXA 4IDLA 5F6IC 1RUPH 1I8KB 4OM0H 5T5NF 4LSDA 1JF5A 4MJ4A 4ZUVA 5DS8A 5TF0A 3OKNA 4HWBA 1I8KA 2GAZB 5DO2C 4JVUA 3PG2A 3B2VL 5LKNA 1MOEA 2GAZA 4WI2A 2DQDH 5GJTH 5IFAL 3OQ3B 4L29B 2OP4H 4JY5H 5F97E 1CFVL 1MI5D 4TPRH 3RZCC 4OBSA 5E8OB 5BCAA 4L29A 1KIPB 1FZJB 3W5NA 4N0CD 2VXVL 4PGBB 4HGWB 4FQHB 5E8OA 2QTEA 1X6NA 3A67H 1FZJA 5MEPB 2D31A 4PGBA 5I2IB 1ZEAL 2C5DC 1IEBB 2HWZL 4I13B 1OAKL 4YXKH 5JOPD 2P5WA 2XY1A 3MROB 3MLPA 1CE1H 4PJFE 5I2IA 5EG6C 1IEBA 3OKDA 1LGVA 1FDLL 3LPGA 3FQXB 3MROA 4Z9KB 3F7YB 1NCDL 2E9BA 1KELL 3RVXD 1NCWH 3MOAH 1XF2B 1IQWL 3X3GL 3PXJA 3Q6GL 1J7VR 2XZQL 3OKOB 1UWXK 1E28B 3I3EA 5IB3B 2IQAB 3TBVB 2VLJA 2YEZB 5CP3H 3UZEA 4JFXB 3AM8C 1E28A 5IB3A 3MV8B 2IQAA 2WBJD 2YEZA 4BSVA 4PLKC 4HCRA 3P0VH 4JFXA 3QIBD 4OM1L 4G6KH 1ADQL 3LS5L 3MV8A 3FQRA 3NAAL 5L0QB 3SCMB 4MJ5B 5ITBH 1MNUL 4R97C 4PP1D 2JB5H 2VWEE 2XZAH 4MJ5A 1N7ML 4PG2C 1LP9B 4X6FA 5JQ6L 3ZT7A 4R7NB 3B5GA 3GBML 3VDCA 2UVFA 4H26B 3ROOA 1LP9A 5BMFH 4KK9D 4ZXBB 3I3DA 5DMGC 5D6CB 4R7NA 5I1LA 4A6YB 2A6JB 4NFBA 3QNXB 4Y19D 4H26A 4YQXL 4ZXBA 1LDPH 3MLVH 5D6CA 4M6OH 8FABB 1F4HA 2A6JA 3QNXA 4AJ0A 4OZIF 1RZKL 3L5XL 1BHGA 5KVGL 1Q94B 1UCTA 4KXZH 1A6WL 2ERJB 3BZ4B 3U1SL 2VN7A 1M71B 1G9NC 4K3JH 1ZGLM 3V4UL 3BZ4A 3K46A 5D5MF 4I77H 1UWXH 4G7VL 1ONQA 3L5IA 5EB9A 1VGKA 1QACA 4FFWD 4JGMA 2I9TB 1QLEH 1S7SB 4MHHI 5ILTL 3S36L 3RY6C 12E8H 1G0YR 3D0VB 3FQWB 3VFVB 4I3GA 4AEFA 3NA9L 2I9TA 3MJ9L 4KRPB 1AGBA 4OAWB 5E5RB 4YC2C 2ADGA 1MCRA 5JUEH 2XPGB 3FQWA 3MXWH 3VFVA 1JPTH 3CSPA 3MA9H 5AYUH 1KYOJ 1T6VN 4OM0L 3C5ZB 3GSNH 2GCYB 3IRZA 4OD3H 3WFHA 1PSKH 3IDJB 4WTZA 5FYLH 3C5ZA 4TSCL 2GCYA 1RHHA 1ITBB 2A6DB 3VFOA 1MCQA 3QDGE 1KOAA 3IDJA 3RUGB 3TEUA 5TQ2H 5F71A 5I6XB 4HUWA 1K85A 2IMMA 1GGIL 2KQMA 4XPTH 3P2TA 3RUGA 4ZAKD 5DUPH 3PJSB 3WXVH 4MXWH 4BK4A 1LILA 3AC0A 1YZZA 2X9YA 2PYED 1IGIL 3A67L 1T89C 2F5AH 3V52H 3VA2C 1QUNA 4YXKL 1OP3H 3NZ8B 2Q8AL 4GG6F 3GMMB 5CMAA 3V5HA 4U1GB 1MJUH 4O02H 2CRZA 2JJUA 3QPQC 2WSKA 3NZ8A 3RJQB 3U46B 1KC5H 1FC1A 4NM4H 3QCUL 4I18B 1NCWL 1FL5B 3MOAL 3B9KB 1WJ3A 3U46A 5GPRA 2BY0A 4BFEA 4PTUB 4DKFH 2X4NB 4Y4FD 4I18A 4EI5C 3B9KA 2PXYD 5IHBA 35C8H 4C4KO 5E08H 4RCAA 4PTUA 2AQ1A 2X4NA 3OR7A 4FQQB 1EX0A 3V6BR 3P0VL 4FQQA 4RGMC 1FG9C 4TYUA 3CFEB 4PJAB 3C60B 3BIAX 2WMPA 4PRHB 4YBQD 3CFEA 2JB5L 2XZAL 2Z31B 4N9OB 3DUSB 1T22B 4PRHA 3QQNA 3WIHA 5B8CB 2YR3A 3PQYA 2Z31A 4YUEH 3NCJL 3I84A 4E9LA 3Q1SH 1S9XB 5BMFL 3MRPB 4LVHB 2H32A 2UZXB 4LSUH 5HDOA 4XX1E 1LDPL 3MRPA 1FHGA 2R15A 5I1IL 3OF6A 3UC0H 2FHBA 3DO3A 3BKYL 4XPFH 4PUBH 5DMKB 3N1GC 3GRWH 3QZWB 4K3JL 4C83B 1A3RH 5DMKA 5KBNC 1JIBA 4UV7H 4I77L 3UBXG 1R6VA 5GRJH 4S1SH 5HI4C 3QZWA 1P4IH 1QLEL 3E1F1 5JOEA 3T0XA 5FXCH 3NIDF 5D2NE 1UQSA 3CIQA 5JUEL 4Y16B 3T08A 1JPTL 5AYUL 4XVJH 3GSNL 4ZOCA 4OCMC 4CKVX 5DA4A 1PSKL 5FYLL 2LFGA 5MEND 3DWTA 5TGBB 3K1DA 2CUMA 4KJYB 5EOCJ 4BUHA 5TQ2L 4W4OA 1HQRB 2V6HA 1EGJH 2P43B 1N0XH 2RHEA 5TFSL 3BGFB 1NEUA 5DUPL 3SE3A 1A6VL 4NBYB 1X4XA 4UIKH 5DTFB 3LPFA 1N5YH 3D9AL 1KTRL 3VWKB 1I1AD 2OK0H 3D3VB 4QCIB 5CSBA 2F5AL 1SMOA 3V52L 1OWWA 3HFMH 4WDIA 5JIKA 2JKXA 3D3VA 1IC4H 1NAMB 3TO4B 5GSRB 1MJUL 1DDHB 3S98A 2WZPD 3ARQA 4NUJA 1RZKC 3WN5C 2YHGA 1LWRA 3IDYC 3TO4A 5GSRA 1U0QA 4NM4L 4UIMB 3RX8A 2ZP0T 2J8HA 3IXAB 4PGCB 2JJWA 1EHNA 1O7VA 3C8HA 4UIMA 1TZIB 5HHPA 1D9KD 4OJFL 3A6BH 2G5RA 3MBEC 2JB6B 3C08L 3IXAA 4PGCA 5E08L 3I6GB 4Z7WF 1DCLA 5A2KH 4URTB 2JB6A 3I6GA 1BZ7B 3F58L 1I85C 4N0UB 1H5BB 2MNUA 1C08B 2KBGA 1NGPH 5D7JD 2X4PB 4PJAE 5SWQB 1BZ7A 5BW7A 2RBLA 4XPAL 1H5BA 1YY8B 4HJJL 4X5LA 4GW1A 4HBCL 2HMIC 5IB4B 4YGAB 2WBWB 4NC2B 1U2CA 5SWQA 3CZFA 1CN4A 3IFOA 1IGFL 1YY8A 1WV7T 2PETA 4FQXC 4MAYB 4NIKB 4P23C 5IB4A 2I9LA 3ARSA 3OKEB 1HKLL 4RWHA 3IKCB 4MAYA 5E8NB 5JORB 3SDXE 4YUEL 4LVOC 4OUUA 4X7EC 3MRDB 3Q1SL 2VSDA 2VQUA 2YOCA 3QDGD 2B0SH 1WTLA 5JORA 4RWYH 1IZJA 3U79A 3MRDA 4LSUL 5IB1A 4QYOB 2C26A 3CSGA 4ENEC 3B2UC 2H3NA 3U0WL 2MCPH 2FB4L 3SOBL 3QQ3B 2HJKA 4R4FH 3UC0L 1FFQA 1E4WH 4QYOA 1A9EB 4XPFL 3QQ3A 3VXUB 4M5YH 4XT1C 1A9EA 2AJYH 5ICYB 1S9YA 5E9DB 5GRJL 5I73B 1U8MB 4X6DB 3V0AC 1PKQB 2X70A 4M6NH 1S7QB 1BEYH 1P4IL 5E9DA 1OF2A 1U8MA 4X6DA 4OIAA 2Z8VC 5E1HB 1EA9C 5IEHA 4HUMB 4U05A 1NUNB 2AI0L 2XFXB 5DZNA 1N4XH 1EMTH 5F6HI 1QFOA 5GZOC 4GG8B 4DZ8A 1P7QD 4ZS6C 2UWEB 4B41A 4QRTB 1WCBB 4GG8A 3QUXA 2R1WB 4XBEL 2UWEA 2A9MH 1WCBA 1CLCA 1H15B 2R1WA 1N0XL 1BGXH 1ZWIA 4U3HA 3UJJH 5ICXB 3NPZB 3LV3A 5EWIL 4H0HB 3IU4H 3S37H 4HG4K 4GKOA 4UIKL 1ZK9A 5ICXA 3VXMD 3NMEA 2WNGA 3IGAA 2NYYC 1N5YL 5BXFB 5KVFH 2OK0L 1G7QA 2E7CA 5BXFA 2R1XB 3TJEH 5DQ9A 4X6CB 1FORL 3WHE1 2VZVA 1CLZH 1R3HB 2AP2A 2R1XA 1BFOB 3K2MC 1JGDB 4U1LB 1X5HA 5DRNB 2F58H 4IOFC 1H3PL 1R3HA 4UT9H 1NLDH 4V1DB 3VE0B 1BFOA 2ESVB 1JGDA 5C07B 5CJOH 4PJHE 2ARJB 3VE0A 4XCCH 2O61B 2ESVA 4I1NB 5SV4A 3SDAD 4R0LB 5C07A 1WIPA 4S1DC 4JFHE 2ARJA 2O61A 1YA5A 4R0LA 4YDIH 1H8OA 4N0UE 4PJ8C 3TVMD 5C08B 3GIVB 3QIUC 1EO8L 1YEIH 5ESVB 2GIYA 3INUH 5I1HH 1QLFA 5C08A 5B3NA 3GIVA 43CAB 2Y07L 4D0DB 4F7TB 4LLWB 4QXTB 1P9MC 4FFZL 1MCOH 4R26H 4U1IB 1UJ3C 43CAA 4LLWA 4QXTA 2F5BL 3NPSC 1AKJD 3R1GL 4FQ1H 1JNHB 2ZCHH 2BX5A 3SDDD 5HYJD 5K59F 3KNBB 2ICWI 2X6MA 3RTQB 3WDIA 1JNHA 2CDEA 4NKMA 1DUYB 2B0SL 1KYOK 4RWYL 1GJIA 2YXFA 2KDGA 3RTQA 2RFXA 3NTCH 1DUYA 4QT5A 2R2CA 2X41A 2AV1B 1P53A 2MCPL 4U49A 3T04D 1M7IB 2EYTB 4KDTC 3TLRA 3VXUE 2Z35A 4LHUD 1M7IA 4M5YL 2AJYL 2EYTA 1LEGB 1PKQE 5DXWA 1VPOH 3QEHA 1QSEB 4M6NL 4YX2L 1KFAH 3B5HA 1LEGA 4S1RH 4CVUA 5T1KD 3LKPB 4OIIH 3C2SA 4PRNB 5DVKA 2ORBH 1ZMYA 3PL6C 4P99A 5IMLB 1ZHKA 3P4LA 1FCCA 2XQYK 2IC2A 3LKOB 1QR1B 4OGAD 3C6LD 1N4XL 5IMLA 1CXHA 1R0AH 1U3JA 2M26A 3LKOA 4PV8B 4LCWE 3IDIB 3F5WB 1S7UB 3EYQD 3HAEH 5DD5L 5IBLD 5D7LD 2AVGA 4OT1H 2DI7A 3IDIA 1K5NB 3QAZC 3RKDC 3ARDC 2A9ML 4K23H 2E6PA 3FOMB 4WJ5B 4LNVA 1KIUA 1B88A 2VOTA 1PD6A 3RGVB 1K5NA 4MMXC 3FJTA 4KUZH 3UJJL 4WJ5A 3MV9E 3E3QE 3PWLB 5JQHC 4HUVB 2HTKD 2YA2A 2VISA 3S37L 5JMOC 2E27H 1F2XK 1QBBA 3PWLA 3ARFA 1XF3B 1U3HB 3WIFB 2K9UA 3VD3A 5B22A 1DJSA 5KVFL 3EJZD 1VFUA 5J1TC 5CBEA 2DAVA 4IEFB 1RUAH 3PWUB 1BLNB 4X6CE 3TJEL 1YPZE 3PWUA 1BLNA 4JY6A 1DBJL 3HE6C 3KXFB 5KS9B 4HUUB 2ICEA 5EU7C 4JN2B 5DZOA 4ZO8A 4V1DE 4UQ3B 3MBXL 1BD2B 1NLDL 3KXFA 4HUUA 4APQD 2W91A 3QXTA 2D3VA 4JN2A 1I9EA 4UQ3A 1BD2A 2F9BT 4XCCL 2EE3A 5LXGH 1JGLH 3ULUF 2NY0D 3BQUB 2Y9RT 3ZHDA 1I8MB 3U36B 3WJJA 4P3CH 4ZFGL 1X7QB 1ZVSB 4LDOB 1ND0A 2CJUH 2R0LL 5EIQA 4CMHC 1I8MA 3U36A 1ZA6A 1E27B 1KLGA 1YEIL 4YHKH 3INUL 5I1HL 1X7QA 1ZVSA 1J18A 3WS6A 3SO3C 1L9NA 5HGHB 3W9DB 4R26L 3U7YH 2BMKA 4HHAB 1WF5A 2EH8H 1FZOB 4TTDD 5FECB 2IAMD 4FQ1L 3O41B 4HS6B 2ZCHL 4IMKA 4HHAA 1DL7H 1FZOA 1G9MH 4MQSB 4MD0B 4P2OD 3O41A 5FECA 1TLKA 4M1CC 2QADC 2IADB 2AGJL 3NTCL 1I9JL 1YQ2A 5FYKU 4LLQB 1S9KC 2M8XA 3SBWC 1CDUA 1SHMA 2Y25A 4HFWB 5J57B 2P49B 2C7UB 1G0DA 4HFWA 4ZDHB 3DMMB 1F11B 3L1OH 1ITCA 1UZ6F 4K7PX 1HZHH 4JGJA 1NFIB 3QWQB 4GFTB 1GAFH 2C7UA 4ZDHA 1N26A 3DMMA 3OWEA 1MCPL 3VH8G 1QSEE 3SKMB 4CMMB 1KFAL 1NFIA 5C09B 4LSTL 1BVLA 1A7QH 1J12A 4CMMA 3SKMA 1FVCA 4GMTH 2IEPA 4OZFH 1MJJA 1CICC 1RUMH 2ORBL 2D7TL 1J05B 5C09A 1JF1A 5I8OH 4UTAL 3ZYIA 5CBAA 3ARGA 4NYLB 4FQJH 5FGRA 5FKPB 4HLZH 4U2ZA 1J05A 4JZJC 2GJ6D 4FOMA 3GSUB 1R0AL 5E6IB 4NYLA 1K8DB 5FKPA 3KJ6H 4GXVH 3GSUA 1GL4B 1HHGB 1N6UA 4RX4A 2B2XH 1F42A 4OT1L 1K8DA 4JFHD 1FGNH 3HAEG 3CVHL 4QRSA 5I8KH 1AR2A 3JSSA 3MRHA 5C2UB 1WWCA 3QDMB 4WFHE 5IR1B 2QHRH 4MSWA 4OI9A 3DYPA 3KYAA 4LPUA 1A1NB 2E27L 1CLOL 4Z7NE 4KXZI 2H2SC 3M07A 4G9FA 2DKUA 3UBXI 2A73A 4DCQB 2ED8A 4K3EH 3ZYJA 4AEEA 1P5VA 1RV6X 4Y4HC 3BD3A 3O9WA 4PJIF 5EOCH 5D1ZC 4DCQA 1PEZA 4PJ7E 4AT6A 3VXRD 3UO1L 5FKAB 4TNVK 2NW3A 5KS9E 1PG7W 3H9SD 4R90H 1DVFC 1I3GH 1YEHH 1FO0B 4KK6C 4ODXA 1R5IA 5DJAA 4PJBF 1HDMB 2BDNH 3K8LA 4M9PA 5FO7B 4EDXB 1HDMA 2PO6C 1JGLL 1F6AB 1HKFA 4PRPB 5FO7A 5LQBH 5C0EB 4GRWF 2VLKA 4P3CL 3VMPA 5E2WH 3S34H 4XNYH 2CJUL 3BKCL 3QIWC 1JGVL 3QDJE 3G6JB 4M6MH 2Q8BH 5GHWH 2DRUA 2P8LB 4OI7A 4DJMA 5BO1H 1TTFA 3G6JA 4P5TC 2P8LA 4JO2L 1E6JL 3WE6B 4QTHB 3GGWB 4LCWD 2DTSA 5FK9B 3E6HB 1YEKH 2VXUH 1OTUD 4IIQC 4JFFB 4R9HA 3WE6A 4QTHA 1OAYH 1OGAB 3DURB 3HB3D 5CSGA 5FK9A 4YK4B 4JFFA 4JQIH 2C4XA 4RFEB 3MREB 5D1QD 4P2QD 3DURA 1KCVH 2ZPKH 1ZT1B 4POYA 3MV9D 4LMQI 2YZ1A 4RFEA 3QDAA 4ZG1A 2CIIB 4G3YL 2NY2B 3QHFL 3TIDB 3O3UN 2AQ2A 3L1OL 1ZXQA 1RIVL 1HZHL 2OLDA 4CGTA 2F74B 2V7HB 3TIDA 5IFJA 4EQ3A 1QZ1A 1EZVY 4X7CC 1Q0XH 5JA9A 2F74A 4HWNA 2V7HA 3M45A 3EOAB 1A7QL 4GMTL 2I27N 4N0CC 3O8XB 1RUML 3FONB 5I8OL 1HEZB 4C56B 1XF4B 1D7FA 1UB5B 4X9GA 4FQJL 4OZFG 4XNMB 3FONA 2DQIH 3ARUA 1M05B 5SWZE 4C56A 3LH2H 4XNMA 3KJ6L 4GXVL 2DQUH 3C6SB 5KSAC 4LU5H 4Z7VA 4NO0D 1RVFH 2DWEB 4Q9RH 4FS0A 3QUZB 5HGGS 5I8KL 3C6SA 2MQ0A 3PWJB 2DWEA 3QDME 5DFTA 3QUZA 1L9MA 4X8JA 4X7SH 1VENA 3NCBB 2QHRL 4OQ1A 3PWJA 2AK4A 2BNQA 2BXYA 4PJ5E 2IQ9H 2JJTA 5LJYH 2XI9A 3P0GB 4XNZB 4N0FB 4Z6AT 2EYSA 2FSEB 4MJIB 2WBJC 3LQZB 3TH4T 4EN3B 4X98A 4I5BB 4Z7UA 2EC9T 3QIBC 2A74B 3N50A 1AO7D 4N0FA 3UP1A 4MJIA 4L1DA 1CLYH 3LQZA 4EN3A 4I5BA 2A74A 3MRRB 4NWTH 4PP1C 2CKBA 4R90L 1I3GL 1YEHL 3L3IB 3MRRA 4HEPG 5E95B 5I75C 3L3IA 2BDNL 1W72A 3EYUH 4JJ5B 4BKLB 4DK6A 2R0WH 2ZUUA 4BJLA 5DA0B 4PRPE 2DIBA 1J1PH 1JTOA 5LQBL 4BKLA 1A22B 2A6KB 2KH2B 5HYSB 3KAAA 2DLFH 2CDGB 2LU7A 5E2WL 3S34L 4HUKB 4XNYL 5IKCB 3S97C 1KPVA 2CDGA 2Q8BL 1JCKA 5EN2B 5E4IA 5IKCA 5BO1L 4X0KB 2VDLL 1NCTA 3G6DH 1IGJB 4HF5H 5EN2A 3T1FB 4RIRA 3UPRB 4X0KA 5HGDB 3P4NB 4FFWC 4QRRD 1IGJA 2FJFA 4UDUA 3D25B 3T1FA 3UPRA 5J13C 1YDPA 2OMNA 3P4NA 1YEKL 2VXUL 1ZTXH 4IRJB 3D25A 2VR9A 3QFJE 3T3MF 3ZE0F 1S5IH 2JK5A 4J7RA 1OAYL 4ZUUB 1JNJA 2D03H 3RWGB 3DHMA 4RFNC 4IRJA 5AAWA 1TITA 4NZJA 4ZUUA 2CLVB 2FX7H 3ZLQC 3RWGA 2ZPKL 1JK8B 5FCUH 4WFHD 4Y2OA 3S3SA 2ZCKL 2QQNH 4CN1A 2CLVA 1CXFA 4WCYH 3K2UL 1KCSH 4KQ4L 2J1KA 4DW2H 1MIMH 4NN6B 2AJ3B 1J8HD 2J6EH 2AJVL 2O5ZL 2B8OT 1S7VB 1IC7H 2AJ3A 1Q0XL 4NUGH 4M61B 1C5CL 3MRCB 1S7VA 5E8EB 1F4XL 1WBYB 4M61A 1T7YA 3K8MA 1QFWL 5I71B 1UCBH 2AK1H 3OHXB 2DYPA 4BQ8A 3RY4A 1BVKB 3MJ8A 4MDJB 5EBWA 1WBYA 1Z6JT 3KHOA 5D7IA 5E2VH 2DQIL 1MRFH 3MCG1 3OHXA 4PRBB 1BVKA 3CLEH 5T3XE 4Y4KB 3LH2L 5C7XL 3ARED 3FTGB 2DQUL 1ZLUK 4XPBH 1NGZB 5F9WB 2B7DT 5D7SL 3EYVB 4Q9RL 4OFYA 3FTGA 4UDTB 3EGSB 1N6QH 1NGZA 4UDTA 1ZA3B 4Y4FC 1RU9H 1QBLH 2AERT 2H9GB 4X7SL 2PXYC 1VADA 1FAKT 4CN4A 2E7LA 1MHCA 1ZA3A 1EH9A 2H9GA 2IQ9L 3ARRA 1HNFA 3BYYA 4OGZA 2EDJA 4XVTL 2XIDA 4Y5XB 2NY1C 4OZGF 3WO4C 1F00I 2E9JA 3IFNH 3OXRB 1B0WA 1UB6B 2JLLA 4TOYH 1CTOA 1CLYL 2XKUA 5CEXB 1IILE 1A2YA 1MCDA 1IKFH 3OXRA 5IHZB 5BOPA 1UB6A 4MVBD 3SKJH 5AWNH 4YBQC 5KANI 5GGRB 4ZUWA 3BHBB 1JNLL 3JXAA 2FGZA 4J6RH 5HD8D 5IHZA 1IT9H 2ZJSL 3TV3L 3CNKA 1DE4B 5GGRA 4FQCH 3BHBA 4E0RA 3KPMB 4J4PD 1J1XH 3EYUL 1DE4A 3KPMA 3NA4A 1I1YB 3PWPD 3ABZA 3UDWC 3HZKB 1GOHA 4M3JA 3RPIB 1KXQE 2ITDB 5DLMH 2WINB 1I1YA 2OCFD 2D7QA 3HZKA 3O6FD 2DLFL 1MUJB 3NFSL 2NXYD 3RPIA 1CIUA 2WWKT 2KZ1B 4FXLA 5DC4B 1Z2KA 1FZMA 3I02B 1WT5A 3U4AA 5EPMB 5L8JB 3EDFA 4F7MB 4NKDB 4JRXB 1U6AH 4D9RE 1PZ5B 4HF5L 2PTTB 4X7FC 4XX1G 1LEKA 2FD6H 4F7MA 3BUTA 4NKDA 5JW4M 1CR9H 1KF9B 4NOBA 2PTTA 4F7CB 2B20A 1SQ2N 2WP3T 2DQGH 3P9MA 1AGDA 2HKHH 5IEKB 2X1XR 2ZOLB 5DQJA 1S5IL 3OB8A 4KTDH 4NQEB 1IEAB 3MV01 4YHZL 5IEKA 4MGXA 2ZOLA 5ECJE 4X80L 5F8QC 2BNRE 4NQEA 2FX7L 4MXQD 1K3IA 3EOTH 3VGFA 2J88L 1NAKH 5DRXB 1FNEB 5FCUL 5JHDE 2IPKB 3TN0A 4QXUH 2QQNL 5A3ID 2FZ3B 3T0EE 4WCYL 2WBKA 4N5ED 2V5SA 2W60B 3GHBH 3SDCB 2IPKA 3MZTA 3VI3E 4NQCE 1MIML 2VDRH 2FZ3A 3RVVC 4HC1H 4AL8L 3EOYG 3IF1A 1UT9A 2J6EL 1ES0A 3J8F7 3SDCA 5E4EC 4ZFFA 2G5BB 3MLUL 4Z95L 1XR8A 3OZ9L 4NUGL 3S5LB 5EBMB 1ZS8B 3V7MA 1KCUH 3ZE2E 2G5BA 3P11H 1ZSDB 1UCBL 3ZDXE 1DEDA 3I9GH 1I1AC 3U82B 5IJKC 2WWKO 4M43H 3GNMH 5E2VL 1ZSDA 1MRFL 2NY3D 4L4VD 1A6PA 3CLEL 3DROB 1CGXA 1GRWA 4LPVA 1I4FA 4LHUG 4XPBL 1WFUA 4XI5D 3O6KH 3DROA 4PRIB 4M8VA 4Y5VB 4LFHD 1N5AB 3KLHD 1N6QL 2J5LB 2WP3O 5CFHA 4MYWB 3VRJA 4PRIA 4Y5VA 3CC5A 1D9KC 4GW4B 2KKQA 1FYTB 3HZMB 5KVEH 1EDQA 2QQKH 2DIJA 3ME0A 1BOYA 4OCXH 4GW4A 3HZMA 2V5TA 4Q58C 1I3VA 4LPXA 4KMTL 5A2JH 3BVNB 2XACC 1P6AB 2Q6WB 5D7JC 5C0BE 5IQ9B 4MD4B 4KUCD 4WW1B 1HOCB 1JRHH 3CX5J 1YNKH 3BVNA 4NHCH 3SKJL 5AWNL 3ARBA 5IQ9A 4HT1H 4MD4A 1V05A 4WWKD 4Y2DB 2I26N 4J6RL 1IT9L 1U8HB 4F2MA 1JPST 1J1XL 5A40E 1X44A 1U8HA 3RBSA 4XXCC 4NJAH 3ILQD 1ZLWK 3TBSB 3EZJB 2A2QT 3MNVA 5DLML 1S9WB 3ECBB 3TBSA 4O58L 4PJEE 4FQ2L 1S9WA 3ECBA 3GKWH 3QXDA 4BM7A 1J11A 2FX8H 2J2ZA 5TDOB 2FD6L 4JM2D 3QRGH 2GEEA 5I1EL 4M9OA 5TDOA 1CR9L 3DETD 1TNNA 1IE5A 3QB7C 3WHXB 2C1OB 2DQGL 4AK1A 2HKHL 1MQKH 2CDFA 4XPHH 3SN6N 2V2XB 2F8OA 4GAGH 5SV3A 3IFPA 4WO4B 3OGCB 2F54B 3REWB 1DSFL 2OXGA 4TUJB 2V2XA 4NKIH 4XAWL 3RIFF 32C2B 3BJLA 1OSPL 4UQ2B 2BOBB 4HSQA 1RY7B 4QXUL 4TUJA 3H3BC 4HLJA 2GHWB 4HIXH 4PJXF 4UQ2A 4M93C 4UNTA 3RAJH 4OZIA 3JV0A 4F37F 1G7MB 1PGRB 1ZVYA 5C8JB 1N59A 5EC1B 3TWCH 2EDLA 5KSUB 2MPAL 4XCYB 5I0DA 3P11L 3EO1B 3UJIL 4F58H 3B9DA 4BSWB 4YWGH 3DV4B 3I85A 1HYSD 4PBXA 3MLSL 4M43L 4XCYA 5BV7B 3GNML 5F9JB 3EO1A 1UWGH 4CJ0A 4JFEB 4BSWA 1U8OA 5L2KD 2EDKA 2LAAA 1GOFA 4HX1B 3AB0B 4P2RE 5F9JA 3WV0A 1HIML 4RA0C 4WUUB 4G8GE 4JFEA 5FV1L 2IMNA 3JVGC 4HX1A 3O6KL 2NNAA 4WUUA 3CDFA 2ED9A 4K3DH 2BSTA 4AY0A 4JFDB 5ETUB 5FHAH 4EUPB 4NN5B 3I50L 2APWA 4ERSH 1FYTE 2Z8WC 1MCEA 4JFDA 5KVEL 5ETUA 4EUPA 4FNLH 5K93A 3H7LA 5CILH 3ZTJH 2QQKL 3P4OA 1A7OH 5LGJB 1BX2B 4OCXL 3I2CH 4D9RD 5GGTL 2YA0A 2XTJD 3HNVH 1BX2A 1F3JB 5IW1B 5E8PB 1AQDB 3B8YA 4QHNB 1X5JA 1AI1H 2LVEA 1F3JA 1YNKL 2DM4A 5IW1A 3BW9A 1WEJH 4L5FH 4HT1L 4OBRA 4WHTA 3MUZ1 3JWDH 5JXEA 1R3KA 2BNRD 3ZYOA 4GG6A 4Z76B 5HYQA 5KTEL 3LRSB 4OZHE 5JHDD 1AR1C 3H3PH 2J8UF 5HVFB 3T0ED 4NJAL 3CSYA 1JZ7A 5BS0B 3SKUD 2FECL 2QBWA 4Q97A 1FFPB 1JGUH 5BJTB 2IH3A 3BEWB 3ARTA 3GKWL 1FC2D 2VERN 1JHKL 5BJTA 3BZEB 5F70A 3BEWA 5IROC 2MHAA 3QFDB 2EKSB 2FX8L 3ZDYF 1CL7H 1VFBA 5GGQH 3BZEA 3ARVA 1T5WB 3NGBC 3QFDA 2EKSA 4H88H 3QRGL 4UB0H 4Q6IB 2R0ZL 5J6GB 1IL1A 1T5WA 4YH6A 2PW1A 3BEVB 4Q6IA 1MQKL 1MSPA 2OS7A 3MUGB 4LLMB 4XPHL 5J6GA 2ADIB 4NQXB 4OGAC 3RZCB 3C6LC 3QNZB 5F7UA 3MUGA 4L3CB 4LLMA 2F54E 3BSZH 2ADIA 4JDVB 3MLWH 1Z0NA 4NKIL 4NQXA 5IJVB 5CZKA 3EYQC 4B0MM 5IBLC 2CIKB 4JDVA 3WIIH 3CH1B 5I19H 2DTMH 1MLCB 4HIXL 2HG5B 1BFVL 3CSBA 4YAQB 2CIKA 2M1KA 3CH1A 1MLCA 3RAJL 1PVHA 3ESVF 2HG5A 3NCEB 5DYOB 1U8IA 4YAQA 2HTKC 2AJUH 4R4BB 1LMKA 1R5WB 5DYOA 2P5WD 3TWCL 5IB5B 4F7EB 1KB9K 1R5WA 5EU5A 5HGBA 3RVUD 2W38A 4YWGL 3B9VA 5IB5A 1EHLH 3EJZC 4RAVB 4UUJB 3T3PE 1NJ9A 4JPKH 1CIDA 1D6VL 5EZJA 5F96H 3NCMA 1RZJL 2FR4B 5GS1A 4U3CA 1I7UB 4I2XE 4RAVA 2OL3B 4UUJA 4PGZA 2ATKB 2VLJD 3ELAT 1UA6H 3KPLA 3QUMA 1XFPA 3HMXA 4ONHB 4K3DL 2Z92B 4PFEA 4APQC 3R06B 4HQQH 5FHAL 2P47B 2FEDD 3S6CA 4ONHA 2GT9B 3MV8D 2BC4A 5E1AA 2Z92A 5IK3B 3AMKA 4M7KL 4ZO7A 3OJMB 3R06A 2FBJH 4FNLL 1XAUA 2PN5A 4EIZC 2NY0C 2GT9A 5HVWA 5IK3A 3LKSB 2X5PA 1D5IH 4GRLB 1U3ZA 3D2UA 3NACH 3HNVL 3PV6A 4HGKC 3RDTC 1URLA 4Q6YA 4J3XA 4GRLA 1JPSH 4M4RA 1INEH 5DHXB 1AI1L 4NOFA 5FYJD 1KTKE 1RUQH 3QSKB 2EECA 4O2EB 1P4BL 1UG9A 5DWUL 1M7DB 4L5FL 2DIAA 2MKWA 2C4FT 4Z0BH 1OQXA 4O2EA 1M7DA 1J1OL 2IAMC 3A6OA 4PY8J 4HJ0D 3ORJA 4U6XA 3H3PL 2QSCL 5HHMB 3TPUB 1PW3A 4P2OC 4U1SB 2RIKA 5EU6B 5BS0E 3DIFB 3O3EB 4EOWH 3NABH 4GBXB 3I75B 3TPUA 2NPLX 4U1SA 1SJXA 5EU6A 3BP4B 1WTGT 4JJHA 4Z7WB 5IBUB 5L9DH 4DEPB 1JGUL 3DIFA 3O3EA 3QUYD 4UI2A 4XAKE 4GBXA 3I75A 3MOBL 4F3FB 1LP9F 2DBLH 1FE8H 1FZKB 4CRPA 4MCZB 3QEQB 1XGTB 4Z7WA 2FJGB 4GOSA 5HI3D 2FIRT 2VDML 3VFSB 3K1KC 1CL7L 3QEQA 1XGTA 1TNMA 3QJHB 2NLJB 4F9LA 4LSQH 3ZSSA 5GGQL 4ZS7H 5C6PB 1KN2H 2FDBP 3ET9F 15C8H 5GGVL 1XGYH 3QJHA 2NLJA 3W39B 4NO3B 2IG2H 3FN0L 1D5MB 2EXYC 3W39A 2GJZB 4NO3A 1TJGH 3SKOB 5E2JA 5TDPB 3FFCE 4AQ1B 1D5MA 1NBZA 3BZFB 3GEWB 2GJZA 5D7KE 3PDDA 2V17H 3SKOA 1KLUB 1KB5A 1SM3L 1UWEH 3WIIL 1C8PA 3EJJX 1KLUA 1EK3A 1FNFA 2X4RB 4G6MH 2NMSA 3VXSB 4JFZL 1CWVA 2MOVA 3FAXA 4OTXL 3O3DB 2H6PB 2X4RA 3UZQA 4DOHE 5EZOH 3FB8A 5C0AA 3TCXA 3DJ9A 4AEHH 3EFDH 2H6PA 3MGAA 1BQHG 4IHOA 2IJ0C 3Q6FB 2EIZB 1JBJA 1C5DB 3Q6FA 4JPKL 4CNIA 2EIZA 1FQ9C 1V7NH 3CX5K 5DJYB 1U8JB 2DQJH 3T0DA 2L7JA 1C5DA 4I4WB 4GXUN 1U8QB 5DJYA 1JN6B 5DI8B 2O5YL 5ANMB 1UA6L 2YUVA 4F33B 1NMCB 3P0YH 1U8QA 1PBYA 1JN6A 4KAQL 5DI8A 5ANMA 4MCYB 3OXSA 4HQQL 4F33A 1ZT4B 4PR5B 3DVNB 4DQOH 1MCJA 4RRPG 4MCYA 2FBJL 1OD9A 4PR5A 1UADC 3DVNA 5I15H 2H26B 4NNXB 4BH8B 3SE4A 4MX7B 5AZ2H 3BPLB 4PRHD 2H26A 1U91B 4BH8A 4OCSH 4MX7A 3RRQA 3HRPA 1INEL 3PQYD 3RHWF 3WJLC 1U91A 1RUQL 3GMLB 5DK0B 4WI3A 3EHBD 4LK4A 4Z0BL 3GMLA 3LPWA 4YBLC 5DK0A 5HHNB 2F53B 4HIIB 1CGVA 3HI5H 2OR8A 1TMCB 3OF6D 3OAZK 3TT3H 4MNQE 1IARB 4F37K 1XH3B 2F53A 4HIIA 4PJAF 1DANT 1AQKH 3THML 5BRZB 2D7NA 3HB3C 2ICWA 4HGMA 1AHWC 4KK5C 1I3RB 1XH3A 2FEEI 2ZUVA 2WK2A 5L9DL 4P49A 1U3YA 4IRZH 1MAJA 1BF8A 1I3RA 3E3QC 2DBLL 3RNKB 1FE8L 3K7UA 1QPXA 4KROD 2D7MA 5F7NC 1SBSH 1RZJC 4XP9H 3RNKA 3OKLA 1VFAA 4LSSH 5IMMA 2VXTL 4LSQL 1AD0B 1MFBH 2V5RA 4ZS7L 5KSBE 1KN2L 2P5EB 3RWEB 1A7PH 15C8L 4KTEH 1WUNT 1XGYL 4HZLB 4NCC2 2EDDA 5I30L 1AD0A 3DHJA 3IJSB 4LSPH 4LKCB 5TPWL 2IG2L 3DX6B 4NBZB 3RWEA 5IM7B 2HVKB 2APFA 4HZLA 2BRRL 2NY6D 2ZSWB 4LNRA 5E5MA 5M7QA 2HVKA 1J0JA 2ZSWA 2V17L 2XXMB 1QHPA 1VGEH 1XT5A 2HFGH 1UWEL 5JIIA 5LGHH 4DKAA 3B43A 1F8TH 3DX9B 3SGDH 2BZDA 4G6ML 5CP7B 2ID5A 4EXKA 1F4WH 3C8KA 1A64A 3IKKA 3KDMB 4U7KA 5T3XH 3T0VA 3DX9A 4P5KA 2DWDA 2IALB 5CP7A 5C86A 5EZOL 3KPRB 3KDMA 3JV4B 4AEHL 1NGQL 2UZIH 3IDYB 3EFDL 3MV11 3D3VD 2MTPA 4WW2C 3WLWD 3KPRA 3BH9B 3DRQB 3TO4D 5C3LD 3TZVD 1NC2B 5TH2B 3BH9A 1A5FH 3MBEB 5ERWA 3CUPB 1I7TB 1V7NL 5J1SC 1NC2A 2XOTA 4JQVC 1TCMA 5MHSE 3CUPA 1I7TA 4JFYB 4HPYH 4PJDB 3RJDA 2DQFB 4KI5D 3VFGL 4JFYA 1T0MA 1MVUA 1T83A 2HT3D 3OB0H 1OLLA 2DQFA 4YEEA 3O4OB 4D9QE 1X6LA 4DQOL 4DVBB 3FMGL 4M48H 4U1JB 4LLVB 4YFLI 3HE7B 3QO1A 3GMRB 4GAFB 4DVBA 3UTQB 4Y5YA 2HFEA 3GSVA 4U1JA 4LLVA 3HE7A 1E4KA 3L7FA 4LASH 5IUSA 3N9GH 3OG4B 5AZ2L 5D1XD 1HNGA 3UTQA 1T1XB 4L9LB 1NCUA 1G6RB 1V7ML 1D5BB 1NCCL 5TQ0H 3LKNB 4LLDA 4L9LA 4QGYA 5GRUH 1G6RA 1A3LH 4HXAH 5FAAA 5MEQB 2CH8A 1P69B 2BOCB 5HGAA 2B5IB 3VFRB 4L8SC 4PLNC 4LFHG 1B0GB 2XA8L 4H20H 5MEQA 1ETZA 3FO2A 4NZTH 5CJ8A 2BOCA 3ZKNC 2ZUYA 3HI5L 1B0GA 3RWDB 3EDJA 1UACH 3Q5TA 4KMLB 4WIQA 3LEVL 2LU4A 1NQBA 5CGMA 3RWDA 4M7LT 5F9OH 4K71B 5D72H 2YPVH 5DFVC 5IFHL 4L8CB 4IRZL 5C0CB 1CD1B 4Z5RB 1E6OH 4R96A 4L8CA 2Y06H 3MQIA 1AIFA 1SBSL 4XP9L 3DXAB 3QQ4B 5C0CA 4Z5RA 1DBAH 2YUZA 3VFNA 2RB8A 4UNUA 3GK8H 2P5EE 3OPZL 4X7TB 1MFBL 2SEBB 3GJEB 2O26U 3QQ4A 1Z5LB 5CP3A 1A7PL 1WWAX 2B4CL 2SEBA 5EFIB 4FG6D 3ZO0A 2YD5A 3V4PH 3L95B 5GJSH 2VL5A 5C0FB 1JRHI 3QUXD 4LGSB 3DLQR 1LK3H 2D0FA 4PGJA 4TSBH 2WUCH 4M7ZC 4X6DF 1VGEL 2W9LA 3VFPB 3PHQB 1G1YA 3AREC 5HI5D 5LGHL 4CN6A 1F8TL 1LO3L 3VFPA 3K74B 4XP4H 4HWBH 2AXFB 3ZZ1A 3IDMB 4G6AD 3ILPB 4U1MB 1Z9MA 2RQ8A 1KXVC 2QL1A 3IDMA 2VZUA 3ILPA 2UZIL 1IEHA 2YC1B 3HCVA 3IJHB 4XZUA 2MKLC 2MCG1 1OCWL 5JW5B 3UBXA 2KL6A 4JPIB 1A5FL 4F8TA 5JW5A 4OQTH 1H3WM 3AVEA 4JPIA 2XTLA 4DTGH 1IC1A 2ESVD 4MVBC 5DFWH 3EBAA 4PJ8B 1LVEA 1IMHC 1SJHB 2DM3A 4HPYL 4U0RB 5KVDH 5HD8C 4NNPL 3ES6B 3VJ6A 1EJOL 3MGTB 4LOUD 1SJHA 1U8KB 3GSNB 4KVCL 1U42A 3KJ4C 3EYSH 3MGTA 1NEZB 3AY4C 4K3GA 4M48L 1PG7H 1B4JH 3GO1H 4X6CF 1UJ3B 5C08D 3WNLA 4M3KB 25C8H 3T4YB 4HK0B 4MNGB 2AJXH 3FCTB 4POZD 2BSSB 1DQLH 1FLTX 1NCBH 3O6FC 4LASL 3JV6B 3UTZB 3N9GL 2NXYC 3T4YA 4QNPE 4MNGA 1XCQA 2BSSA 5KAQG 3GIZH 3HHRB 1H8NA 3FO0H 2YD2A 1BBJB 3KS0J 1QFUH 4GAJL 4PJIB 2FHCA 5TQ0L 3WFEH 1PQZB 4LSRL 5GRUL 3MCKB 4HCRH 4O5LH 1BBJA 4WI7A 3KPSB 4PJIA 5HYSG 1PQZA 3MCKA 3RTQD 4Y1AB 3FO1B 3GI8H 3LN4B 3KPSA 2VDPL 4NZTL 4YLQT 1RK1A 3VGDA 4QOKA 3FO1A 4O4YH 1UACL 2YD9A 3BKJH 3ULVD 3LN4A 2ICES 5IIEB 2FL5B 3S35H 3EDKA 4PJCE 1A4JA 3HUJB 4XMKH 5F9OL 3Q2CA 4JKPH 3NFPB 1JYWA 1YJDH 1GPOH 2FL5A 5FYJH 3SE8L 2Z91B 4PJBA 4WEBH 4MXQC 3HUJA 1K8IB 5I76B 3MRIB 1E6OL 2ZKHH 3MRBB 2Z91A 4AIXA 1K8IA 3DXAE 4N5EC 4KDWA 2W0KA 1DBAL 4BQ6A 3MRBA 4CU8A 1XZ0B 3CCHA 4Y8DC 2OSLB 2ZUWA 2F8VA 4JHAH 2NY5H 5CUSH 1XZ0A 1C5BH 1JZ4A 3QAZB 3ARZA 3ARDB 2OSLA 3UTOA 3QEUB 5GJSL 5KZCB 4L3AA 4QWWD 4MJ6B 3TIEB 3ARDA 5CGTA 1LK3L 5FA4B 3NBNA 1CGSH 4MJ6A 3TIEA 4TSBL 2WUCL 5DMIH 5FA4A 2NY3C 2VLME 5KW9L 2NW2B 2Z93A 2YXMA 2JCCE 4I3RH 2FO1A 3BJ91 4XI5C 3ARFD 1FGVH 4HWBL 3VDBA 2NW2A 5EOQH 3HG1B 3KLHC 2BSRB 3X3FL 4UBDD 1A6UH 4X6EB 5C0RH 3WDJA 3HG1A 2BSRA 1IAIL 4OIBA 4O9HH 4X6EA 1BF2A 1NGWB 1JNNH 1MF2H 4GKNB 3GRWA 3MLYH 1QNZH 2PNDA 4NC1C 2CGRH 2VQ1B 5I1KH 4I8DA 3LCYA 1BD2D 3D5OF 2XKNB 4LDEB 4UAOC 5HI4D 2EEDA 4WWKC 4G80A 5KVDL 4CMHB 1UVQB 5I9QB 2JE8A 4LEOB 3UTSA 3WXWL 1UVQA 2ARJQ 5FYLE 3WS3B 3EYSL 3SO3B 1EFXA 1KG0B 2DOCA 2ZUXA 3D39E 4DGYL 1B4JL 3GO1L 4LEOA 1NCAL 4AQOA 3ILQC 4AEIH 3VA6A 2X42A 2B4CC 1F13A 1KG0A 3HRZB 1CD0A 5KS9F 4J1UB 5E6ZA 1DQLL 1RK0A 1YNLH 1P84J 3QWOB 2GW5A 3HRZA 1K2DB 2P42B 2A6IA 5KN5B 1TVHB 3GIZL 1EGJA 1T20B 3HS0A 5FOBB 3FO0L 3QWOA 1QFUL 4PD4J 4KGJA 3WFEL 3BE1H 5H37H 1TVHA 1BJ8A 4HCRL 1T20A 4I0CC 5FOBA 1KLFA 1FN4A 5HHQA 4NQDB 4BQCA 1B3JA 4Y1AE 4M7LH 4U4BA 4JM2C 1BM3L 3GI8L 3X13B 4M00A 4NQDA 1C12B 1S8DB 5CJBA 4O4YL 3X13A 5J9PB 2PTUA 1C12A 2UY6A 3S35L 2XWTB 4LRIC 3WIHH 1OW0C 4UOJA 1YEGH 4JKPL 1YJDL 2LVCA 5FYJL 4M8QB 4YHLL 4YDKH 2XWTA 3DMMD 4QGTA 5J7CC 5SWSE 1CICB 3QG6A 4EDWL 2AEQH 3Q3GB 3QI9C 1XIWA 3MTRA 4M8QA 2H32H 3Q48A 2XZCH 4MD5B 1CICA 1JF6A 5E8DL 4JZJB 3Q3GA 4MD5A 3ARGD 4NSKB 4OZ4B 4LPCA 2VDNL 4JHAL 2NY5L 4EZMA 4XRCB 4OZ4A 5CEYB 4YDJB 4GS7C 4RX4D 5ISZA 4XRCA 1FFNB 3WHE0 1I1RA 5FGCE 5HHXH 5CEYA 1Q0YH 4YDJA 1HYSC 1EFQA 1CGSL 5DVNA 1MAML 1FFNA 4L3EE 5E03A 1MELA 3OSKA 3S5LG 4OLXH 1FP5A 4B50A 1PYWA 3P73B 2YPLB 4XNXH 2JTDA 1GC1H 4XH2B 5DURB 4Y4HB 2EXWC 4FQXD 1LO0H 4P23D 4MQXD 4I3RL 3PGCB 3TYFB 2BFVH 3P73A 4G9FD 2YPLA 4XH2A 2Y1VA 3PDOB 1L6XA 5ID1B 4XB8A 5EOQL 3WNOA 2RCSH 3PGCA 2G9HB 3TYFA 3O9WD 3MJ7B 3F7VB 3PDOA 2L7UA 5ID1A 1AC0A 4QRPB 5EU7E 2G9HA 6CGTA 3MJ7A 3VRIB 1UM4H 3LEYH 5F7KC 1SBBA 1QSFB 1JNNL 1MF2L 2XTJC 2AJSH 3EIFA 1JZ6A 1QSFA 3MLYL 4HKBA 1QNZL 3SJVB 1X5ZA 3LS4H 2GK2A 5IWLC 1XGRB 2WIMA 4P46A 3C5JB 3CU1A 4L1HA 4X4MA 4P4KD 4LCYB 1H8SA 1XGRA 4OF3A 3C5JA 5C0DB 2VLKD 4NRXB 4ELME 5H94B 1UXWB 3OG6B 4UU9B 4NRXA 1QSVA 1H0DB 5H94A 1UXWA 3T0EC 4ZQKA 4AEIL 1IM9D 3R8BB 1H0DA 5IF0B 5DJ0B 4LQFL 2EEBA 2EC9U 5IF0A 5DJ0A 4WV1A 1WWBX 5GZND 1QVOA 2GI7A 3BE1L 1UJTA 4L4TB 4XC3H 1SVCP 4OZGA 4NWUH 3V6OA 4K3HA 4JFFD 2H2PD 4L4TA 4QO1A 1FLRH 1ZLVH 5CD3B 5C0JB 3H3KA 1MWAB 1F45A 4X5XA 4WFFE 3G6JF 5CD3A 1MWAA 4D8PB 5FUCC 3WIHL 1MI5B 3OX8B 1G7JA 2D4DA 4HEME 2QQQA 4D8PA 4Z7QF 3TO2A 3TNNB 3UTTA 1MI5A 3OX8A 4ZNEA 5F7EH 2AEQL 5EBGA 1XR9B 3TNNA 2B1HH 2WIIB 4AH2B 3L3KA 1REIA 1XR9A 4K7PY 1I7ZA 2VITB 2WIIA 3BP6A 4AH2A 3RI5F 1DTUA 4Q2ZA 1QP1A 5IW6B 1S9VB 5ESAA 2VITA 1KJ3H 4C56D 3EDDA 1I8LA 3UPCA 5FEBA 1P4LA 3WFBL 5IW6A 1S9VA 4KKAD 4DN4L 4JG0H 4MXVF 1VERA 4FTVB 2KUTA 3RVUC 5HHXL 1Q0YL 4H5SB 4R2GB 3LSOB 4FTVA 2CK2A 4H5SA 4CVXB 4YXHH 3QUZD 1QRNB 5C0NC 3NCYP 3MMEB 4J3UA 4XNXL 2D4FA 1JI1A 3LSOA 4RMSA 5DVLA 3AXLB 3D39D 2AK4D 2WBJB 1LO0L 1LO5B 2BNQD 3BH8B 4CVXA 1QRNA 2BFVL 3MMEA 1AJ7L 4GQPH 2X89D 2N7AA 4D9LH 3BH8A 3KHQA 1LD9A 4XCNB 4CAGA 1EEYB 1Q9OB 2EDXA 1MCSA 3IDXH 4FMFA 4FQLH 3GBLA 3T77A 4QRPE 2HVJB 2ZZUT 5DVMA 1CFNB 3IDNB 4XCNA 4EN3D 1KTDB 3MRKB 5IMKB 2E8ZA 2HVJA 1H3TA 3FT3B 4NPYB 1UM4L 3LEYL 1CFNA 3IDNA 5I75B 5BZDB 1KTDA 3FQNB 3LQMA 1RJYB 3MRKA 4WUKH 2DL2A 5IMKA 4RA3A 3FT3A 5HYFA 3VH8A 2BY3A 5BZDA 4HUXA 1F4YH 1RJYA 2X4OB 3QQ9D 3LS4L 1YJDC 5LVEA 4Y19B 5J89A 4HKXA 2IPTL 2X4OA 3MLXH 1A6ZB 4JFOB 1D5XA 1LO4H 4KV5E 4R7DA 3SGJA 2R4SL 5LGKA 4QF1B 1A6ZA 4JFOA 4X4YB 4XP5L 2R8SL 1FL6B 3MRLA 5FV2A 3HAEB 1DLHA 4X4YA 2DJSA 2NY5C 1RURL 3SGDI 1CDYA 2ERJC 1O5DT 3CXDL 3HAEA 4LAQH 4MA7L 4OLWH 5J13B 3QEGH 3VXNB 1KCKA 1N6VA 5DUBA 1R3JB 3VG0H 4RFNB 5KAQF 5C9JB 1J5OH 2CLZA 5D71H 1NBQA 1R3JA 2EO1A 4PREB 4BELD 4NWUL 1I9IH 1I3UA 3M8OH 1XCTB 4KRPC 1FLRL 1TTGA 2FHFA 1OL0A 2MQ3A 1DN2A 2KZWA 1XCTA 5INCA 3C5ZC 2VO5A 4E5XB 3AUVA 1HSBB 3QXUA 3E0GA 2GFBA 3KS0H 4ZAKB 4E5XA 4HAGA 4N0RA 2GUOB 4ZAKA 4PBVC 1M7XA 1LNUA 5TF1H 3RVWD 5I6XC 1ZOXA 3HE6D 2PYEB 5F7WC 2B1HL 4OF6A 1WAAA 5F89B 1MREH 2PYEA 5JOPE 1WK0A 5EUKA 2DYPD 3HZYB 1E4XL 1FJ1B 3ULVH 5K9JH 3L5JA 1KJ3L 3SE9L 3KYKL 3HZYA 1JZ8A 1KSRA 3VXOB 2BVTA 3O4LE 1JTPA 1CGUA 3VI4E 2IBZY 1B4RA 4OFYD 3VI3F 2PXYB 2X10A 4P9ML 5EUOB 1ULVA 5ITFA 3ULSB 4M62H 2WUBH 3PIQB 3V6ZA 3CFJB 5IV2B 1MY7A 2C3VB 1CBVL 1KJ2A 3SHSA 4I18C 5EUOA 5B39G 3CVIH 3B9KC 3ULSA 3PIQA 4ESKA 2C3VA 2XN9E 3ZE2F 1ORQB 4PB0H 4D9LL 1V3LA 4L4JA 4XP6L 3ZDXF 2DLIA 4U0QB 3LD8B 4FQLL 5L7XL 1C7TA 3IDXL 3MO1B 3U30C 4RAUB 1GZPB 4QHKJ 4XNUH 2I60H 1RJCA 3QO0B 4PJXA 3MO1A 2X7LB 2CRMA 4DKDC 3FAWA 1YUHB 5HJ3B 5D5ME 2BHUA 5BVPH 3ARWA 4WUKL 1EHXA 2X7LA 5HJ3A 1YUHA 1I1FA 5DEFB 1OT2A 4PD4K 2EDHA 1C7SA 5D93B 4Y19E 4HWEL 5LG1A 5DEFA 4OZFB 3MLXL 1OGTA 1CFVH 4J8RA 3EHBC 5FGBA 4JB9H 1LO4L 3BRGC 3VFWA 1RHFA 4OZFA 2DQEH 1RQ5A 2VXVH 4LVHC 2IH1B 5E00A 1D3CA 5C9KA 4JAMB 1FYHB 3FKUS 4YR6A 3O2DA 2IH1A 5CHNB 4HIJB 4LSVL 4ZPTA 4DGIH 4K7FB 2GQHA 3SY0B 2XWBB 4LAQL 2EDBA 4JKWA 4JO3H 4PJFB 1MFCL 3RPKA 2CD0A 2CRYA 3MLTB 1FDLH 4K7FA 4HKZB 3SY0A 2XWBA 1HQ4A 4FZEL 1NCDH 4PJFA 1KELH 3VG0L 3MLTA 4EVNB 4HWUA 3X3GH 4HKZA 5D71L 2XZQH 3C5SA 5IBUG 4EVNA 2CKNA 1JJUA 1A6AA 2R4RL 4NQED 3RWCB 4GG6E 1MCBA 3IFLL 1MCWW 3GB7A 1MCWM 3TN0D 4X6BB 2NY6C 3RWCA 4YZFF 1ZVHA 2HAZA 1Q72H 4OM1H 1N64L 5SX5K 4W4OC 2W92A 2OQJB 4JHBA 4X6BA 5IMOB 2AKRB 3MZGB 3NFNA 1PFCA 3ZKQD 4TNWK 1MNUH 5TF1L 3SDCD 2XXCB 3BXNB 3SE3C 1WFOA 4YFEA 2AKRA 2EDNA 2J8UA 3TESA 1DVFD 4CUCA 2PR4L 4PRDB 2YD4A 3BXNA 4BFBD 1MREL 1UENA 4JVWA 1QFPA 1Q9WA 3ULVL 4KWUA 2PO6D 5IB2A 4MQ7A 4YQXH 4P48A 4N8CL 1ED3B 4EEEA 4G8FA 5F7YC 3WLWC 3U9UB 1LE5B 5FM5O 1ED3A 3I3BA 3DV6B 3ESUF 3TO4C 1D9KB 1R3IL 1LE5A 1I7RB 1OPGL 4M62L 2WUBL 5I66B 5T33H 3DV6A 3EDEA 4PRID 5ALCH 1I7RA 3EJYD 3G04B 3CVIL 4M03A 4G7VH 3DI3B 5B4MC 1BZQK 2HLFD 4S2SB 1VHPA 3DUHA 2COQA 1AGEB 3G04A 4KI5C 3GHEH 3S36H 1QRKA 4XMLL 5D7JB 1GCFA 3TNMB 2HT3C 4S2SA 1YC8A 1AGEA 5A2LH 1TJIL 3BZDA 3HPJB 3T0AA 2NZ9C 4XNUL 1YMHB 3TNMA 2I60L 3QA3B 3GUTB 2BVPA 4K55A 2R2BB 5BW7C 4ZSOE 1H5BC 5IP4A 3HPJA 1YMHA 1WVZA 3ARBD 5E2TL 5BVPL 3U6RB 1ACYH 2R2BA 4TSCH 3MLZL 4KU1A 4W6XB 2K7PA 5D1XC 3U6RA 3QDGB 4GKSB 1PX4A 1EV2E 4MAYC 1OAXL 2K7QA 4JCLA 1GGIH 5KSVB 3NIDE 3QDGA 1ZT7B 4OCWH 4PYGA 5KSVA 3F65A 1IAMA 4JB9L 4PPTA 4MB5A 4RQQB 2DN7A 1ZT7A 1CF8H 2DQEL 2I07B 1EBPA 2GSGB 2Y7QB 1IGIH 3MGOB 1KIPA 3RL2B 5ADPH 5ESQB 1WBXB 2I07A 4HGWA 4FQHA 1EO5A 2Y7QA 1JHTB 3MGOA 5DEZA 3RL2A 5MEPA 3H8NA 2Q8AH 4DGIL 3GMOB 3DUUB 4JO3L 5KSAD 1YEJH 2ICCA 3GMOA 2L0DA 2CPCA 3DUUA 1LHZA 3QCUH 3BMVA 2N4IA 3FQXA 4U3XA 1P7QB 3F7YA 3O4LD 1EUTA 3KWWB 1XF2A 5FHBL 2NR6D 5JLZB 5MENE 4XNQB 3FQUB 1QD0A 1G1CA 1L0XA 3B6SB 1NANH 4GQ9L 1IBGH 4HG4J 2HRPH 1UH3A 3OKOA 1S7RB 4UOW0 4XNQA 3FQUA 4FG6C 3AU1B 3TBVA 3RWIB 3QUXC 5KOMC 1Q72L 2XN9D 3CZJA 4U1NB 4NBXB 2EDQA 3DGGB 3V79C 4YXLH 3VXMB 5GRWA 1Q9LB 4U1NA 1MFDL 1KIRB 1S7XB 1IAKB 3SCMA 1Q9LA 5HI5C 1KIRA 1S7XA 1YMME 4G6AC 3NCJH 1HH6B 3E6FB 2A0LD 4I3SL 3HI1B 4J12A 1HH6A 3E6FA 2NX5E 2R39A 4A6YA 3DRTB 5I1IH 4J3SA 2E7BA 1S3KH 3BKYH 8FABA 3DRTA 3SDAB 4JANB 5GGUB 3VGAB 5T33L 3TFKD 1Q94A 5LWYH 5ALCL 3SDAA 1MQ8A 4HK3J 1M71A 4JANA 3TVMB 3VWJB 2LE9A 3GHEL 4R0LC 3TVMA 4LOUC 3VWJA 3PHOB 3UYRH 1S7SA 3T3PF 4WFGD 3GMNB 5D2NB 3D0VA 1BQSA 4N90E 2CO6B 3PGDB 1MH5B 4OAWA 5D2NA 2XPGA 1AKJB 2JF1A 4POZC 4JR9H 1ACYL 3I6LD 3SDDB 3SGKA 3PGDA 2X4SB 5JXED 3PF2A 3SDDA 4RISL 3TBTB 2X4SA 2A6DA 3TC9A 5TFSH 5E7BA 3TBTA 1VACB 4ORGB 1A6VH 5DHVB 4OCWL 3MYZA 4BSJA 1NH6A 1X5LA 3RTQC 5HVHB 5CSZB 4EI6B 1VACA 4ORGA 1CF8L 5DHVA 2A83B 2Y72A 3D9AH 3PJSA 1GYAA 4LHUB 5CSZA 2CKBH 1IGMH 4LL9A 5CEZD 5ADPL 3ULVC 2V5YA 2A83A 3NGBB 4LHUA 1T7ZA 2X4UB 1VA9A 3KGRA 1W72H 3VMNA 3CFCH 2VE6B 2XZZA 1NMAH 2C3XA 2FH6A 2YRZA 5T1KB 2OJEB 2X4UA 1IC5H 1MRCL 1TENA 1YEJL 5LCVH 3GMMA 1MEXL 2VE6A 3DSFH 4LEXH 3NVQA 1T2XA 3STZB 1CZ8H 4RFOL 3GMQB 1FL5A 3HNSL 4OJFH 2C4FU 3STZA 3C08H 3K81A 2A77H 3GMQA