4MNGE

Structure of the dp10.7 tcr with cd1d-sulfatide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
255
structure length
228
Chain Sequence
b'QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGEPSYWGFPRTTRVIFGKGTRVTVEPTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISPGKYDTYGSTRKNLRMILRNLIENDSGVYYCATWDEKYYKKLFGSGTKLIITD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title Crystal Structure of V delta 1 T Cell Receptor in Complex with CD1d-Sulfatide Shows MHC-like Recognition of a Self-Lipid by Human gamma delta T Cells.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 54
structure length 228
sequence length 255
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mngE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mngE02
2HLFD 2J3SA 3ZKSD 3I50L 2F5BH 2F74A 1G7IB 3KXFB 2VIRA 1CS6A 1KPRA 3U4BH 2BXYA 3LRGA 4NT6B 3CIQA 4DKAA 3VFSB 4QXUL 4C58B 2VDPH 2GUOB 4KDWA 4MLSA 5ACZA 2GTZA 5KVDH 5T5NG 4HBCH 5L0QB 1T1YA 2BK8A 3WNOA 5A43C 1P4BL 5I9QB 1MWAA 5FYKL 3VXMB 4OGYH 5KSVB 5DQJB 1A4JB 2NY0C 2YA2A 1NGZA 1G7HB 2HFEB 3GSXB 5IB5B 1YY9C 4XWGL 2X1OA 3F7VB 2COQA 5DUPH 1CXHA 4KMLB 5F3BA 3O3DA 1NAMH 3U9PH 3RZWA 2YKLL 2IQAB 4H25A 3QNZA 1QVOA 4RGMB 1NQBA 1KJVB 4Y4HD 1WWWX 1RURL 4Y2DC 3GI9H 5HHVH 1HEZA 2OI9C 2IQ9L 4MHHI 2H26B 2VZOA 2BMKB 1FLRL 4N90E 1N26A 1YEGL 3OJVC 4ZQKA 1YNKL 4J3WA 3OQ3B 3MRJA 5BZWA 1RUQH 2V5YA 1RMFH 3HI5H 4JY5L 1QEWB 3OKNB 1BZ9A 1KB9J 1F4AA 2WUBL 4JDTH 5FYJD 1U91A 1BVLB 4LLAA 4PJGB 3CCHA 3GFUA 5I8EA 3VXPA 2Q7YB 1BBJA 4IOIA 1KUMA 2OMBA 2D9QB 2DRUA 3BPLB 2ZCLH 4AM0B 3SOBL 5LG1A 1HINH 2RJMA 4EUPH 3DURB 4K94L 2NY5L 1S9VA 1G84A 2Z9TA 5GGUB 5IIEA 1I1AC 2QQNL 4JPIB 4DUWA 3KPNB 1QLFB 3PWUB 3PWJA 2H41A 3MJ7A 4MD4A 5IQ9B 3O3BA 4JM4L 2ESVE 3RP1A 4X9FA 3V7AE 2NTSP 1IC5H 5ILTH 3HR6A 4YX2L 5DD6A 3G6JE 1T2QL 2FHFA 2DN7A 1HXMB 5E5UB 4PLKC 5ESAB 2M8XA 5EC1B 4ONOA 1FVDB 3BKYH 1NLBH 1DBAL 5JW3H 4PV8B 3G5XB 2YUZA 2NY4D 4RWYL 1YMMD 1WCBA 1UWEL 2IH1B 3QUZA 1RUML 1HXYA 4LASL 3VFPA 2PYFA 2XTJE 4R4ND 2DLTA 3V6OA 4D94A 4XVUC 1RIUL 2CLZB 4BKLA 2UYLA 1G9EA 4LLMA 4N0YL 5BOPA 5B38G 1BM3L 1YC7A 5DA4A 3LDBC 3RNKA 3GHEL 2F54E 3FQNA 5HI5D 3B8SA 2O93L 4Y4KA 3U46B 4MVBC 5J57B 3KXFD 3TO4C 5I1DB 1P4LB 3N9GL 5DF0A 3WN5B 1H15B 1JHTA 1F42A 3QDGB 2JJSC 1EXUB 3VJ6B 3EFFA 1MRCL 1JWMB 3HE7A 3N85H 3ZE0E 4NJAH 3RVXD 1QFUL 3ZT7A 1FFQA 1UYWH 4N5ED 1DQDH 43CAA 3RDTA 1M05A 3DVFA 1RZIB 3OR7B 3VXMD 2Y6SD 3BE1L 4S1DC 3WS3B 3OG6B 3RKDD 1F2XK 1K6QH 4M6NH 3MPCA 3NABL 3VCLB 1NCNA 4U6XB 2E7MA 4F7CA 5IUSA 1JYWA 5I30H 2XKNA 3STLB 5IHBA 5F93C 3P30L 5IP4A 5L7XL 1IBGH 1I1FA 4I3GA 3KLHD 2CDEB 6FABH 3TBWA 2DQTL 4ZDHB 1F3RB 3I2CH 1W72H 3QFJE 5H35A 2AK1L 3S8WA 4Q58C 4XBGB 4J1UA 3IFNH 2XZQH 1BEYL 4RWHA 2FX9L 1J8HA 5CS7A 3C6LB 4YPJA 4AH2A 3PJSA 5J9PB 4A6YL 4MJ6B 2X89A 1X6LA 3IDJB 3MRDA 3RZCC 2C3XA 3LEVH 4QOKA 2CLVA 1ZS8A 4P46C 1U6AH 1FV1A 3WD5H 4PJDA 3VFUB 5J6HA 1H5BB 2FZ3B 4NO3A 1OQOA 1RHHA 1VEPA 5I6XB 5FA4B 2Z8VC 4OB5L 1MAKA 1A9EA 4JDVB 2DMCA 4ERSL 2XOTA 4Y16D 3DX6B 3MA9H 2Z91B 2NMSA 4C59B 3QNXA 4D9RD 4OM1L 4WHYG 5MEOA 1ZV5A 5FK9A 4DN3H 1SJHB 1E6OL 3HKFA 5EB9A 4APQA 3IS1X 3ULVE 3U7WL 2V9TA 3G5ZA 4LU5H 4OBRA 4QWWC 2I24N 1JL8A 3IDGB 2OM5A 2DDQL 5IFHL 2VLKE 4HGWA 2V5RA 5EC2B 3LS5H 1ZEAH 3CC5A 3MBED 1ZMYA 5ITFA 4PB0H 1A6WH 5DRXB 4AZ8A 2R9HD 1SEQH 2E6PA 2EIZA 3QXDB 4LLWB 4FABH 1E4XH 2DQGL 4KV5F 4U33A 5CKAA 3QUXC 4HG4J 2R2HB 4PYHA 2CGRH 2FIRT 2XQYG 5HHQB 1XAUA 4RSVA 1X5IA 3ARDB 1UJTA 4PJCF 1RZFL 2ITDB 4JPVH 4QHLA 5HYJE 3PABB 2C4XA 2NY6C 4UB0L 3EYVB 1K8IA 1R0AL 4RISH 1NEZG 4PLOB 5E8EA 3VXNA 1ZLVK 2X09A 4M93C 5LBSL 4G9FB 3LY6A 1MHHA 3E6HB 2BNQA 2H6PB 1I75A 3WNLA 1PFCA 1RULL 1ZVHA 5EN2B 1NMCC 4NQUA 1FCCA 5IB3B 4KXZH 1QSEE 2W91A 4I77L 2DLHA 4NP4L 2D4DA 3SCMC 1CGYA 2IBBA 5IEKA 2NNAA 1EEYA 4JQVA 4AEEA 1UZ6F 3EHBD 3E2HC 5JQHC 1I1YB 3QDJA 4I0PD 4TRPL 5I74B 1GAFH 3V8CA 4OCRL 2ZP0T 3PNWB 3K80A 2J4WH 4HKXA 1WAAA 5DT1L 2IGFL 3ZTJH 2FL5A 4JO3H 3WNPA 1ZANH 3VU2A 2UVFA 2DQHH 2Y72A 1JYNA 1OAZH 1XT5A 4NHCL 3T0EA 2OYPA 2ADGA 3FFDB 3MNZB 2XQBH 3C09C 1S3KH 2L7UA 1NANH 1GGUA 3MRIA 4PJHF 3MCLH 3MOQA 2D0GA 2C4FU 3FQRB 3FONA 5J8OA 5H94A 4M1GL 1I3VA 3REWA 5CWSB 2F53B 3QCVH 5TGBA 1HQ4A 4NQEB 2AS5M 3PQYE 5TQ2L 4X6CA 3THML 1LWRA 2AJUL 4XVTH 5D7LA 3TYFA 1LEGB 1ADQH 1KENL 3BWAA 3DRQA 4HH8A 4MJIA 4RAVB 3VXSA 4GRLC 5I1LB 4Z76A 4CU8A 5FM5O 2VUYA 4LVNC 4FQLH 1S7WA 1CE1L 4PS4H 4DGYH 3GSQB 3S4SA 4C83A 5TPWH 1RIHL 1WBXA 2OL3H 4JRXA 4NWTL 3CXHK 1FZMB 3KPQA 1HIMH 2ADFL 1G9NC 1VCAA 3RUGB 1NFIB 1HHGA 3SJVD 1TENA 5D2LF 1X5XA 1NGYA 2VAAB 4XCEA 1EO8H 4IHOA 1R3KA 5EU6E 1QOKA 2V7NB 2A77L 1BJ1H 4UT6L 3MODH 3FMGL 4K8RD 1JNNL 2GTWB 2G60H 1RZJC 2ZPKL 4ZXBB 4X99B 2E8ZA 1AR1C 1ZA3A 3G08A 4K2UH 4PRPE 1T1XB 3SDDA 3HA0A 4M03A 4HSQA 5MENB 5FHBH 4NO2B 1B3JA 3CDGA 4XTRD 1PBYA 1PKQA 4LSTL 3ARDD 1CG9A 4KROB 5IW1A 3VW3L 4LARH 2X4NA 2PTTA 4OZFH 3CDYA 1FG9C 4C56E 5CZXD 4KHXH 1R5WA 2OLDA 4FQIL 3DJ9A 3IVKA 1NUNB 3P9MB 2OS7A 2XPGB 4M7JL 4XPFL 1CLYL 1R3HB 2GEEA 3B3IB 4HIHB 2ATKB 3VXQB 1LQSR 1EEUA 3EGSB 3MOAL 1NGQH 1DE4B 4Z78B 3HZVA 1GGTA 1FGVL 4JHAL 5E24E 2AGJL 1HN1A 3O81A 4GXUN 4YHPA 3F7RA 3QIBD 4WWKA 3W82A 3AAZB 3S88L 4MNQE 4Z7VA 3DUSA 3V6ZA 3LMJH 3LVEA 3TA3C 3H7LA 1Z3GL 4PIRF 4Y5YC 4NN6B 2XA8H 3S36H 3BGFC 4NNXB 5I16A 3QEQA 4N0FA 4AIOA 4K9EL 4LSDA 1A7NH 2Y9RT 2QQLL 4MS8C 3GB7A 3HUJE 4OLUH 1QFPA 3NPZB 5GPRA 1DLFL 4NRXA 3ECBB 4QRPA 4YHLL 2R29L 1J88A 2UY6A 3CXDL 1XIWD 4LSSH 3I85A 5SWZA 1UA6L 4CMMB 2HT4D 3A6CH 5J1AA 2A73B 4F7MA 3OXSA 3QQNA 4UOW0 1D5MB 3IJHA 4JRYE 1UWGL 1YPZB 1WZLA 3ES6B 3HZMA 4LLQB 2ZG1A 1D5BB 4HIEA 4XAKD 1OQXA 3ZHDA 4Q6IC 3CMOH 3L6FA 5JPMB 4JFDD 5C70A 2BC4B 25C8L 3GHBH 4YHIA 5A3ID 3M1BB 4PTTB 1KELH 1JGVL 3BD5A 2Y23A 4HULB 5A1AA 1MEXL 5LCVH 4JFPB 3SY0A 4JANA 3IAGC 2QQKL 1ACYL 1A64A 1EFXB 5C92A 3KYNA 1CD1A 2I26N 1H3PL 2AV1A 4LSVH 2QL1A 1CFVL 1D6VH 5GGQH 4V1DB 3VWJA 1HHJA 2YA0A 1EV2E 5DD3L 5TDPB 1NGWA 1CZ8L 1YQVL 1NBYA 4IBLT 1RD6A 5E6YA 4JFEE 3KR3H 1AFVH 1MOEA 2Y06L 3DSFH 2X1QA 2ZSVB 1B4JL 4M5YL 5DVNA 1ED3B 1FYTE 3DX8B 3H9SB 2R2BB 4YJZL 3QUYC 1MJJB 4QEGA 3W11D 2UWEE 1QBBA 4ONGL 3BZFA 4ZNCD 4ZXBD 1AE6L 3GK8H 4JEGB 4XB8A 3PDDA 2JCCB 4ZS6D 4IRJD 2AJ3A 3GIVA 1VFBB 3HN3A 3DUUA 4LSQL 1RY7B 2PO6D 1FFNB 5DRNA 3K4ZA 3FTGB 5EU4B 4KVCH 2HVKA 5JXED 4PRHD 4WEBH 4H8WC 3MRCA 2FD6H 5IVOA 2NW3A 4M6OL 3R8QA 4KZDL 1UEMA 1OAXH 5GJTL 4RMQA 4P3DA 1MCJA 2CKBH 2XA3A 3VWKD 5FB8B 5J3HC 3FZUD 5F9OH 3S5LG 4L4TE 5DJ0B 4QRTB 1MJUL 1C5CL 1JK8A 5F88A 1N2RA 2H8PA 3CLEH 4JY6B 3ZKMC 3QZWA 5D2NB 3B9KB 3GBLA 2YD5A 4S0SD 5E2UH 5JTWA 1A7QL 2XTJC 4Z6AT 2O5YH 4TTDD 3D39E 3CVHB 3BH9A 4DWHA 4NO0B 3RL2A 1T0NB 2NZ9C 5H2BB 1YEKL 4M7KH 1QP1A 3SKOB 5EO9A 1DQJA 1ZT1A 3O0RL 2R0LL 3BPOB 3BVNA 1G0XA 2Q3ZA 3ZDXE 4LHUB 1EK3A 1TNNA 7FABH 4U49A 2QBWA 1B0GA 1J1OL 4FZEH 4RGNB 4XC3L 3TZVB 5EORH 3F62A 2EYTA 3V9FA 4JG1L 1XF4B 5ITBH 1A3RL 3IKCA 4JO2L 3OG4B 4JLRA 4XNXH 1L6XA 5CIPB 4JR9H 2VYRE 2E6JA 4GBXD 3VXUE 4HD9A 5D1QC 5C6TL 3C2SA 3BI9X 3S3SA 5HVHC 2PR4L 3NIDE 5L88L 1LDPH 3Q6GH 4PJGE 5EDXA 4YBQC 2A6DB 3RRQA 4D2NA 4ZUSA 2FJGB 5ICXB 4MAYC 5C0AA 1KN2L 5DO2D 4YGAB 3V5HA 2QTEA 4V2BA 2EIBA 1EFXD 4TSBL 1SYVA 2ZOLB 3BN3B 5E6IB 3D85B 1IGFH 1H8SA 3KYOA 3KWWA 4PJBA 4JN2A 3MLVH 5EUKB 3MRBA 4V1DD 1KLUA 3TJHC 1OAUL 2BSRA 3QQ9D 1L7TH 1TJIH 1CFQA 1MREH 1WQVT 3F7QA 4NKOA 2C3HA 4U05A 5ID0A 5IM7A 1HNFA 4AL8H 3KPRB 4X6DA 3R06B 1N64H 1WWCA 4XNZB 5LGHH 2XWJB 3KPMA 5CKGA 3MLSL 1N5AB 1SBSH 4X5LA 1EGJH 1K8DA 3PWPB 2EYSA 4KJPD 4OZHA 4FQQA 1CL7L 3RWDB 4WFFE 4FQCL 4YC2B 4OZGF 3DOSA 2ICWI 5IBLD 3QSKB 1FC1A 5EOQH 4XXCC 3WKML 5ICYA 4FS0A 1HSBB 1AD0A 5CJBA 5F9AC 3KNBA 4RZCA 3NAAL 4J3TA 4HLZG 5CEZL 1WEJH 1RZJH 3QXTA 2IPKA 3DVNB 4M8QB 3RFZC 5D7IA 4QKXB 5E95B 4DCQA 3UO1L 1A4KB 5DFWH 2P49B 4F9LC 3ULVC 1LK2A 2IJ0C 4N8CL 4PY7B 4IRSB 4Q2ZA 1A2YA 1IVLA 1VA9A 2OX5A 1AQDB 5HGGS 1I7UB 1KGCE 3RPIB 1JNJA 1NMAL 3GMMB 3EZJB 1J8KA 4PRBB 2VTFA 4UI2A 5GRZA 4F2MA 2E6QA 4JPWL 5C0BA 1UXWB 2BRRH 1IGJB 1ZHBB 4JZJB 4HFWA 2EKSB 4PG2A 3ARGA 4MXVF 4BK5A 4G42B 4J4PC 3PHQB 5GIRA 3LN9A 1DFBH 2EXWC 3DIFB 1QFHA 4W68A 3NCEB 1WF5A 4E41A 1T1ZA 3RWJB 3IDMA 1MVFA 3MRLA 1IM9A 1KCRH 1XZ0B 3FT4A 5FECB 3TVMA 1U3ZA 3LN4A 2A6KA 3NFPA 1RUAL 3MLYL 4RDQG 3UTPE 2A9ML 1W8OA 1IEBB 3VRLE 1DQLH 4I18C 3B6SB 4JM2C 2B0SL 4KKCC 3WMSA 4WV1C 1M7XA 2VDKL 4UDUB 5CEYA 3G04B 5HY9B 3VGFA 2F8XC 3GIZL 4AY0A 1KCKA 1G9MH 2VC2H 4RFNB 2QSTA 3UPCA 5T3ZL 4ZUWB 3ARFA 4WU7A 2ZKHL 1B9ZA 5GS0D 2VQTA 3BEWB 4OI8A 4PRNB 2XZZA 3EO9H 4HMCA 3UTTA 4B50A 5E6ID 1I1CA 3D85D 5HDBF 1BGXL 2A1WL 3MLPA 2YPLA 1Y0LB 4Z7UF 1GZPA 3RAJH 1DTUA 2W9DL 4I13B 4Z7OF 1ZHKB 4DW2H 3UROR 4BQBA 4NQCA 3RKPA 1LNUB 3WSQL 3BO8A 5IHUH 3E3QC 3MA7A 4PJIB 5D2LA 4JFFB 2AQ2A 1IGMH 1BQHB 1ZT7A 4KRPC 2J8UF 2B1AH 2DYPB 3K2UL 5DVLA 3O8XD 3OJDA 4ZS7L 4UDTB 5EULV 1NAKL 3PWPD 4UIMA 3TN0C 4D9LL 4GXVH 4NUGH 5E2TL 4XMKL 1XF2A 2GSIB 3X13A 5SV3A 1EH9A 3RGVC 1ETZA 3LD8B 1NDGA 2HWZH 4ZO9A 4G43A 4KK5C 3PWNA 4L3CB 1BFTA 3QFJD 1TJGL 4UOW1 1FNSL 5T3XE 1KIQB 1EMTH 4YUEL 12E8L 2BDNL 4OUUB 1E4KA 3I6LD 1KB5A 5IT2L 2Q8BL 3MO1A 1IMHC 1CTNA 4OF3A 4KJQD 5TJWK 1CI5A 4Q9RL 3KJ6H 1M6OB 2AXGB 5EZIL 4IRSD 3JTTB 3T65B 3QI9A 5CZKA 5IJVA 1OF2A 4YGVB 1PX3A 2XKUA 4J8RB 5HHOB 1D5IH 3MREA 3NOIA 2EC8A 3IGAB 3NGBB 2W0LA 4O2CB 4NQVB 3I3DA 1YMHA 2FJFB 5DJXB 3VGAB 4R97B 1E6JH 3BDYH 3C8KA 3FB8B 1FGNH 3G9VA 4H8WH 2NQCA 4FFWC 4P9HC 2F5BL 2ZOKA 4MZ2A 1PJ9A 3U4BL 2EIDA 1OGAA 3WHE1 3AXLB 3IDXH 2VDPL 3C5ZA 1S9YB 5KVDL 4JKKA 4HBCL 4X9HA 3Q2CA 4G9DB 2P4AB 5DHYB 2VQ1A 5KSAD 3VI4E 3RIFK 1FL6A 1U36A 5F6HJ 3EYOA 1D5ZA 2VR4A 4OGYL 2OCFD 4RCAA 2F74B 1B6DA 2VIRB 2FEDD 2VLKD 4FNLH 1CGXA 4RFOL 5GRVK 3KPOA 1CICB 4OI9A 4P5TC 2HLFC 4GKZA 2NR6D 5I0DA 5ACZB 2GTZB 4MQ7A 2LVEA 5DUPL 1T1YB 2BP3A 1NAML 3U9PL 3IS0X 4UQ3B 3EO0A 5LAXB 1CT8A 1MWAB 2QKIA 4BSJA 2EEBA 3GI9L 3CH1A 5HHVL 1PLGH 1INQB 4WNQA 2ITCA 1RUQL 5HYJD 5F3BB 4OZFA 1RMFL 2X9XA 3HI5L 3EO1B 3O3DB 1ORQB 4X7CC 3WE6A 2F53E 1T89C 1MCRA 1QVOB 4HGKC 4JDTL 3WO4C 2NY3B 3WFHA 3LPFA 2ZCLL 4ZQKB 4KU1A 4YIQA 3MRJB 5BZWB 2DBJA 3FJTA 3OKOA 3QEHB 2E9IA 4KQ3H 5F1NA 1QSED 2X4UA 5HI3C 3OKMA 3ZKND 3PIQA 1BZ9B 4OLEA 1DP0A 3TO4A 1XCTA 3VMOA 1I3RA 1U91B 3G6JF 1UB5A 3CCHB 5I8EB 3UYPA 3VXPB 2JJSA 3VRIB 2IFGA 2R1YA 4WI5A 5AG8A 1IC5L 3PDOA 1T5WA 4ZPVA 5ILTL 1I85C 5DC0A 1CXKA 3NTCL 1S9VB 3ZZ1A 1XGPA 4CJ0A 1QLRA 3VXRA 1G1YA 3ALPA 2DL2A 3SDXE 3BKYL 3QHFH 1NLBL 3PWJB 4WUUA 5JW3L 4MD4B 5HYIA 1IILE 3O3BB 3ZYIA 5MENE 1TJHH 3I02B 4TTGA 1XR9A 1H8NA 3ESVF 2Z31B 4I9WE 5DD6B 1UJ3B 1VADB 4HV8B 2G2RA 5DJYA 5HPOA 4Z5RA 1QFOA 2SEBA 2FNBA 2Z4QA 5F9JA 5HHOD 4Z7WE 3SDCB 1OP3K 3V52L 4ZSOB 2O5XH 5IBUG 5FEBA 5KVEH 3QUZB 2G75A 3L5XH 3QJHA 1S7TA 1LE9B 1HXYB 5CP7A 2PYFB 3VFPB 3ZE0F 2ZJSH 3FFCA 4YK4B 4Y8DC 4EN3D 4W6WB 2A0LD 3BJ91 1FJ1A 5J0BA 5DHVA 4BKLB 2UYLB 2VKXA 3N85L 4LLMB 5DI8A 3WO3B 4NJAL 5JZ7D 4Y5XC 4J3XA 1FN4A 4FMKA 4PJ5A 3VFMB 1UYWL 3OB8A 3DX9A 3UZEA 3FQNB 4K55A 4NRZA 1Q94A 5A16A 4JJ5A 3O4LA 4Y4KB 1MJ8H 1CWVA 2YSSB 1K6QL 4M6NL 4FG6D 4JREC 4NQSA 4LSPL 3EFFB 5HGBB 3MV7B 3NIGE 4MZ3A 5I30L 3S98A 3RDTB 1M05B 1NCWH 1DVFD 1IFHH 5J06A 1AXSB 1X9QA 1IBGL 2DLFH 5IKCA 4P23A 6FABL 1LP9E 3QUKB 4NQDA 3I2CL 5L0QC 1W72L 3VGEA 3V7MA 5I9QC 4F7CB 2X70B 3IFNL 2XZQL 2BJMH 2G9HA 1I1FB 4IMKC 1CFBA 2M26A 3TBWB 3BGAA 1UB6B 3LEVL 5FV2A 5FF6A 5IMKA 5H35B 3D69B 1U6AL 1QACA 1Y6KR 3BW9A 2YD4A 4U0QB 3WD5L 2VDMH 2PW2A 3PE9A 3KLHC 4G8GE 2VZ3A 1KCUH 3OR6A 4KKAD 3SO5A 1KCSH 2YPKA 1U8JB 4ZO6A 3PJSB 4MNQD 3ULVF 1WK0A 2CLVB 3BMWA 3MLRH 2X4SA 1IZKA 4KI5D 1S78C 1FV1B 1ZLUK 4DN3L 2I25N 1A7PL 4PJDB 1P69B 4U1HA 4LCWB 3BXNA 5J6HB 1RHHB 4X9GA 1CIDA 2AP2A 4P2CG 4L8CA 4P59H 1A9EB 3OKYA 3BPLC 4JGJA 4OFYD 4P2OA 3QNXB 1AHWA 3LS5L 4S1QH 5FYKE 1ZEAL 2JCCE 5MEOB 3FB7A 5FK9B 3ROOB 3CXHJ 4PB0L 1A6WL 2Z31D 4ODVH 2MTPA 4APQB 1SEQL 1IC4H 1A22B 3J7HA 5F9WB 4FABL 2EDQA 5DRWA 1E4XL 2B4CH 3KVQA 3VRJA 1P2CB 4NKDA 2J7LA 4H0IA 2WMPA 3ZLQC 2ICWB 1FBIH 3BMVA 2CGRL 1OPGL 3AMLA 3CDCA 4H1LG 4CDHA 4I2XE 1U3YA 3SDCD 5ITFB 2ZUWA 1C8PA 4JPVL 5HD8D 4DUXA 2P5EA 2EIZB 4OFIA 5I17A 4RISL 4JM2F 1M7DA 3V0WH 1OTSD 1FFOA 5LQBL 4KUCF 3D2UB 3T08A 5B38B 2O26U 2P1YA 1TLKA 1CXEA 1K8IB 3DXAE 1XGRA 4P9HH 1LEKB 4RBPK 4KVNH 4YO0A 4Q9CA 3HZKA 3MQIA 1U8LB 1MCIA 5D1XA 3LQAC 2A2QT 1F90H 2D9CA 3WFBH 2BNQB 4ESKA 3R4DA 2LU4A 1ZAGA 5K9KA 1EGJA 3MV7D 8CGTA 5FKAA 1NLDH 2ICEA 2YD3A 3H7BA 2MCPH 2XRAH 3MRPA 5EUOB 4MQXD 4RGNE 3WN5C 5BS0E 1ZANL 4P4RA 2A38A 4ORZC 3D0LA 2DQHL 1S5HB 4R96A 2NNAB 2EH7H 1EEYB 1OAZL 5ID1A 4XWOC 2XQBL 1S3KL 3QDJB 3V95A 1N4XH 3BKMH 1UCBH 4HCRH 3MCLL 3BKCH 2C3GA 4JO1H 1SJXA 3MR9A 4ZMAT 3RVWD 1DBBH 2P5WE 3MRMB 3GSVA 1NPUA 3T0EB 2ADGB 1SHMA 3QCVL 3CPLA 4ELMA 4ODHH 3MROA 3MRIB 4LFHG 2XXCB 3V6BR 1KJMB 4XVTL 2J8UA 2GI7A 1ADQL 1AI1H 4O2EA 1OTUC 4XBEH 5HHMB 1I9IH 5C3LD 1KLFA 4LVOB 4X9IA 5EOCH 3I6GB 3LZFH 4DGYL 3D39D 3FN9A 1P84K 5TPWL 5E1AA 4KK8D 5TGBB 3C6LC 1HQ4B 5C07E 5IQ7L 4NCDA 5EO0A 3HNVH 1CDCA 2OL3L 3WLBB 3HC0B 5D7LB 3TYFB 3BWAB 3VXSB 4NYLA 4JFOA 1HIML 4F3FA 2VO5A 4B41A 4X7TA 1S7WB 2BRQA 3MXVH 2XWBB 1EO8L 2BVYA 1H5BC 3S4SB 4C83B 2B2XH 5I6XC 3MODL 4PGCA 5D93B 1DQMH 3GO1H 1WBXB 4RNRA 4D8PA 2AV7A 2G60L 4Z0BH 3RVUC 1H3TA 3KPQB 3S6CA 4RA0C 2WWMC 3BIKA 5FHBL 5GQBA 1J12A 3VXUD 2RCSH 1LO3H 4MJ2A 3OKEA 5DJ6A 5ABDE 3F12B 1NGYB 4Z7QE 4IHOB 4HXAH 2CKNA 1TVBB 4R4FL 3W9DB 4PJFF 1JVKA 1YYLH 2X4PA 4FQ2H 1DDHA 4I0KA 1ZA3B 3SDDB 3O6FB 5TF1H 2PYED 4YXLH 4UTBH 1PKQB 2P8PB 1CG9B 4PRDA 3D2UD 3PGCA 3FT2A 2Z93B 2MQ0A 2PTTB 32C2A 3V6FA 2FRGP 1I1RA 4TPRH 3SGDI 3EYQD 3DUHA 3EYUH 1NEZB 3TIEB 2P8MB 3ARDC 5J7CC 1RZ8A 1JZ6A 3T3MF 3MRQA 3LMJL 1GH7A 3K1KC 5EU3A 5EOCJ 1NMBL 2ZUVA 2XA8L 4XH2B 3S36L 1J10A 4GLRH 4GG8B 3ZSSA 1A7NL 4EOWH 3HZVB 4E9LA 3RIAF 4UU9A 4OLUL 3BAEH 3QULA 1AGEB 4YHPB 4Y0GA 5D1ZB 2VLJA 2FH6A 3DUSB 4YXKH 3T09A 3V6ZB 4LSSL 4X0KA 1T83C 2AAVA 3A6CL 3DTXB 1QLEH 5C2BH 4YZFF 4K3JH 4J6RH 4CAGA 3SBWA 3ULUD 3TNMA 3F5WA 1EA9C 3MNWA 3VMPA 1HH6A 4P3CH 3QG6A 3MUGA 5I74C 4BUGA 5JW5B 3CMOL 5FM8A 4G8IA 1NBZA 3GHBL 3RBGA 3VG0H 2DD8H 2MMXA 2K7PA 3OXSB 1H3WM 4KRLB 3IJHB 1PYWA 1G7QA 5LCVL 3GSRB 2EDNA 1BQLH 4LSVL 5DEFA 2FWOA 3DYOA 4JFFE 1U8PA 4FQXB 1D6VL 1UM4H 5GGTA 1J1PL 1WWBX 1SQ2N 2ZWLT 4DOHE 3ETBF 1NKOA 3DVGA 4J23A 1TMCB 1AD9A 1BFSA 2HG5A 3HZYA 4JANB 4F37K 3VD3A 1AFVL 3K46A 3DSFL 3KYNB 1CD1B 4HMDA 1HHIA 5A3IC 4JG0H 7CGTA 3VWJB 1HHJB 1ND0A 5IHLB 3UTPD 1NUFA 1NGWB 5KS9F 1B0RA 4EIZC 1NBYB 2YK1H 3GK8L 3L95B 1CDIA 2E7LC 1JWSA 1ERNA 3GKWH 1UM5L 3HNSH 1KCLA 4M1DL 1MH5A 4XCYA 2YZ1A 2IALA 3QPXH 4L3EB 2FLRT 3PL6A 4WEUD 5ICZA 1F6FB 3G9AB 4Y19A 3QQ3A 4ZNEE 5HPMA 1NC2D 3BZFB 2F8OA 5I76A 4KVCL 1FNAA 5IV2B 2X40A 4WEBL 1EO7A 4O58L 4ETYA 4FQ1H 2FD6L 3UPRA 2AJ3B 1OAXL 3DUUB 4MAYA 2CKBL 2XV6B 1T20B 4ZXBC 4B53A 3I75B 4PRIA 1FAKT 5F9OL 3PHOA 5C08E 1KFAL 4ZS6C 4WFED 1JYVA 3CLEL 4WI8A 4LCIH 1LHZA 4KROC 4BQ6A 3X11A 2C3VA 4LOUD 3MRCB 2BHZA 5E2UL 3S34H 2NW3B 5C09E 2O5YL 3TBSA 5BZDA 3QDHA 1UCTA 4X4MA 5IMLA 4P3DB 1P7KB 3ILQD 1XFPA 3T0VA 4M7KL 3LAFA 1LO4L 1MY5A 4DAGH 4X9BA 4B7LA 5F88B 1N2RB 2H8PB 3DBXA 4OSUH 5D1ZD 3QZWB 4DQOH 4PJ7A 4KRNA 3UYRH 1IKNA 1GIGH 5DMYA 7FABL 5FA3B 3JWOC 3BH9B 3FZUC 5E00B 4RFEB 3IF1B 5T3XD 3SKNA 4AMKH 1OAKH 5EORL 1IQDA 1QSVA 1MCFA 3NIDF 1DQJB 3R1GH 1ZT1B 4PJGF 4XNXL 4NN6C 3C5JB 4JR9L 3QA3B 4HUXB 4PB9H 3DI3B 1IQWH 2F5AH 1HWGB 5FOBA 1T6VN 1LDPL 1DQTA 3Q6GL 1B0GB 5F1IA 2NW2B 2EYTB 3UTSB 3MYJA 5KZCB 3GM0A 3IKCB 4JLRB 1ZE3C 3BP7A 5FDWA 1U42A 4EUPG 1IGFL 4FQXD 3MLVL 2NX5A 3D0VB 3U0TA 1INEH 5FCUH 4ZUSB 1T7YA 1QR1A 1L7TL 5C0AB 4HT1H 3IU3A 1MREL 1Y18A 3SO3B 1AH1A 3GNMH 4GRWB 4AL8L 1YN6B 5DQ9B 4PY8J 1N64L 3LEYH 3CX5K 3KYOB 4MCZB 4PJBB 5LGHL 1SBSL 1KLUB 4OZIB 1EGJL 1HKFA 5HBBA 2BSRB 4J4PA 3AB0B 1YEIH 3WNMA 4NKOB 4BJLA 5ID0B 1JPSH 4YHKH 1M71A 2C1PA 4X6DB 1S9WA 5D71H 2VWEE 5T5FL 3RBSA 1CGUA 3T2PA 4NN7B 4MCYB 1K8DB 4U1JA 4L3ED 4XX1G 3VXTA 1RK0B 2EYSB 1WEJL 3VGBA 3PP4L 4OZHB 1RZJL 4FQQB 2LU7A 5HYSA 4JM2A 1SEBA 4WV1A 3ARZA 2YXMA 4G8EA 1FZOA 1YEEH 2X4QA 2L0DA 1A6ZA 1TVHA 1AD0B 4BSWA 4RZCB 1J0IA 3MFGB 3O11A 4OKVA 4PGDA 1CE6B 4JFHE 1ES0A 5EOTA 3U79A 4N1CA 3CU1A 5FO8B 4RAUA 3GJFA 1LK2B 4KH2A 4Q2ZB 4LPCA 1OW0C 4NBXB 2BRRL 5JXAH 1I8KB 3SDAA 3ULSA 1MCBA 3MLWH 1U58A 5JPNA 1DFBL 1N5YH 2D7MA 2MQ3A 4LLUA 4F2MB 2DICA 1AIFA 5C0BB 1X5HA 3NCYP 1KCRL 4ZFFB 3ZHLA 3UBXG 1NSNH 3HE6D 4JZNA 4GG6A 4I9WD 5D2NC 1DQLL 3B9KC 3V5KB 2W0PA 5D7JA 5GIRB 5KSBA 2UUDH 3VFRA 3KPSA 2A83A 1WIUA 3MRLB 1IM9B 1G9ML 1I7ZA 4PJ9D 1ROWA 2AEWA 2A6KB 3NFPB 3H9YA 3BPOC 1C5BH 3AS0A 3B5HA 4XHJC 3UTSD 2Z92A 3QIWA 5FM5M 5KZCD 3NCCB 5CEYB 2EYRB 1J8HE 4RGNC 3TZVC 3RAJL 1D9KB 5CSZB 1LDSA 1JZ5A 1BZ7B 2AQ1A 3ARFB 4QOKE 4WU7B 4DW2L 1T22A 2EO9A 4JZOA 5T1KD 5C0ND 5IHUL 1Q38A 4PJDE 5TQ0H 4R0LA 2R4SH 4N0CC 3TYGH 3UTTB 1HE7A 1IGML 1S7UA 2E8YA 4NZTH 5SX5K 2DJUA 3D3VA 2YPLB 5C0CA 1GZPB 1PG7W 2JJTC 4GXVL 4NUGL 3EYSH 4NQCB 5E6IC 3BO8B 2GITA 2DAVA 2HWZL 2EDOA 4OZ4B 1W0WA 5JMOC 2FR4B 5IVXB 3AS3A 2WIIA 4IOSD 3RJDA 3MNVA 1CU4H 4P5TA 2WBJD 1EAJA 4GKOA 4GW4A 1HH9B 1EMTL 4UIMB 2C4FT 4EQ3A 4P2QD 4K3GA 4R90H 1XF2B 3MJGX 4WGWB 3X13B 4U31A 4WTWA 1C5DA 1N8ZA 4F7PA 3DETC 1NDGB 1N6VA 3NACH 4R4BA 5JNYB 4HCRA 3JZ7A 3EZ8A 3KJ6L 4G43B 5KJRH 4O4YH 4OGXH 4ZAKD 3WXVH 2IWGA 3REVA 3MSPA 4XHQA 1D5IL 4YC2C 3PV7A 5HGHA 4J12A 3H6JA 1YQ2A 3TIDA 4ODWA 5CJ5A 5ESVA 4URTB 2VH5L 1E6JL 3BDYL 3ARBD 1FGNL 4H8WL 1GGBL 1KB5B 3MACH 3MO1B 5A40E 1BIHA 3BHBB 2Y5EA 5SX4H 2HTLC 3QI9B 5IJVB 1OF2B 3BPCA 4R26H 1RJLA 3IDXL 3UTQA 4Y4HA 1YMHB 2BNQE 4PJEB 3K4AA 4JPKH 4IRSC 4DGIH 3TPUA 4FFZL 4K7FA 3MV9E 2EXYD 2ZOKB 3LQZB 1QRNE 3CFKA 4FNLL 1V3LA 5FYKD 4LKCB 4CVWA 2BNUA 3C5ZB 4HWUA 3H8NA 5E7BA 3L9RA 3MV8E 4HKJB 2VQ1B 1F5WA 1FL6B 5ECJE 3VI3E 3EYOB 2OR8A 1VFUA 4JZJC 2DQUL 1AGFB 5J6GA 3JWOH 4LP4A 1UWXH 4Q97A 1PLGL 2X1PA 3P4OA 3P3YA 4P2RE 4RQQB 3KPOB 1HZHH 4GAFB 4JJHA 4GKZB 1OHQA 3DV4A 3BP5B 3X12A 3HPJA 2CPCA 3IETA 5BCAA 3F7YA 3N1PC 1FZKA 1IKFL 1QPPA 5CEZE 5CAYB 1CT8B 4HS6A 2C26A 2QKIB 2AXHA 2XN9B 4UUJA 3CH1B 2Z8SA 5JR1H 3WIHH 1DBKH 2VDNH 4AT6A 1CXIA 5FOJA 1UADC 4WNQB 5GSRA 4LLVA 1ZK9A 3ARSA 1MFDL 4KQ3L 4PJXA 3I3EA 3LKNB 3TFKC 4M7ZB 2FJHA 1T66D 4NM8H 1F00I 3RUGF 2X4TA 5HYQB 4NKQB 4LF3A 4X6CE 1AC0A 1YMMA 1PD6A 5CP3H 3JV6A 4MJIE 4XP9H 3QPQC 4Y5XA 3AGVA 3QWOA 4YIQB 5BJTA 1J0HA 2DM4A 3OKOB 4FFYH 3NPSB 5F1NB 3WHXA 1CL7I 1T7VA 1YA5A 2X4UB 3O9WB 3OKMB 2YC1B 3PIQB 1UH2A 4ISVA 1A1OA 1K2DB 1I3RB 4JRXE 3CH8A 1IEAA 3QHFL 1UB5B 4X4YA 1KXTB 4WTZG 2AEPH 2R15A 5LXGH 35C8L 2R1YB 1TJHL 1X5ZA 1T5WB 3T3PE 2MQCA 1G7IA 3C2AH 2I07A 3KXFA 4NT6A 2DIAA 4Z7WF 1QLRB 3VXRB 1KOAA 5DVMA 3QXVA 1QNZH 1A1MB 1T2XA 3QT2A 4YQXL 4ODXB 1Y6MR 4WUUB 2P5WD 5GRXG 3H9ZA 3VXMA 3MUZ1 5KG9B 1HYRC 1PKQE 5KSVA 3RI5K 5KVEL 4U6VH 3OX8B 5DJYB 5T3ZE 1DUYB 1BF2A 4WFGE 2ZJSL 4WO4B 5IB5A 3QEGH 4MB3A 5DGRA 3F7VA 4YHZH 5F9JB 4E0RB 1P5VA 3O2WH 4HEME 2N7AA 3BEVA 1W0VA 4EDXA 2G75B 2H2PC 1CD8A 1S7TB 1J5OH 2H26A 1CXLA 5CP7B 4PD4K 2BMKA 4O2FA 3NGBC 3Q3GA 1FJ1B 1EFQA 2FIKB 3VGAC 4OD1H 4R97C 4Z7VE 3OKNA 1YNLH 4MA7H 5DHVB 5IWLC 5DI8B 3BP6A 1LP9F 1OP5K 5FUCE 4HBQA 1YPZF 2Q7YA 3DX9B 5I1JH 3CFIC 3QEQE 4O9HH 5HHNA 5K9QG 1NCWL 2FYYB 1IFHL 5A16B 4JJ5B 2DWEA 3O4LB 2DLFL 2QSVA 2B1HH 3H42L 4M4RA 4UOJA 4G8FB 4QRPE 3EJZD 4NQSB 4M7LT 3RJQB 1ZSDA 3BZDA 5SWZE 4Y16A 3PWUA 1TQBC 3CVHH 1CFSB 2BJML 2J6EH 2X44D 4YNYB 5IKCB 3FOLA 1CICC 4FG6C 1A8JH 4OCNC 4P23B 2DOCA 2XN9D 4JQXA 2WIMA 2EDBA 3M45A 3Q0HA 3PDGA 3GRWH 1FP5A 2VDML 1OT2A 4JDZA 4LL9A 2B5IB 2NY7H 1NBVH 1KCUL 2HT2D 3W39A 4BFBD 1GGIH 3JWNC 1KCSL 2Q86A 2G9HB 3MBEA 4U3CA 3G5XA 3U2SA 5AD0A 2EE6A 4FHBD 2IH1A 1A47A 2BVQA 5FF6B 5IMKB 5IF0B 5CIPH 3MLRL 2W59A 3BW9B 1VKXB 1C7TA 4MB5A 3OPZH 1U9KA 2HYMA 2NY3C 3RVTC 3I6KA 3LH2H 3O9WD 2JCCF 2CLZA 2YXFA 2YPKB 2DTSA 4P59L 1P84J 3UAJD 4OKDA 5GS0H 4J3UA 4S1QL 4LKXB 3ZT5A 4AEFA 5JOFB 1RUKH 1MCDA 2X4SB 3N1MC 4XMLH 4ODVL 3U46A 2AJVL 4KKAC 1IC4L 4H20L 2CLRA 3QDGA 3BXNB 5IGXH 5D4QA 1CQYA 1EXUA 3VJ6A 4RMTA 3HC4H 3ARTA 4QNPE 1FBIL 3K2MC 4P2OB 1AHWB 1RZIA 4LPWA 3OR7A 3FB7B 1O7SA 5T1LD 5DRWB 1VFAA 3VRJB 1QSFE 1V7MH 4NKDB 4OLVL 4PLJC 1ZLVH 5KSUB 4I0PA 2V5TA 5L8JB 1WZKA 1UJ3C 2NXZB 3V0WL 5BMFL 3N1GC 1BZQK 5FGSA 2VWEC 2P5EB 4P9HL 3K81A 5I17B 5J1TC 5IESH 4KVNL 5L8KB 1F90L 4D9QE 3P73B 4TUOA 1T5XA 3QUZC 1M7DB 3CJJA 3T1FA 3WFBL 4LDEB 5C0EA 2P47B 4YDVB 3BFOA 1A9BA 1NLDL 4YK4C 4I1NB 2MCPL 3V6OC 2XRAL 3ZL4H 1H8OA 1KB9K 1XGRB 1QFWM 3TWCH 2V9RA 3VH8A 1QBML 2DLEA 2D03H 4FN0A 4X7SH 1GGYA 5AZ2H 5D1XB 4YEEA 1H5BA 3RTQD 2EH7L 1JPST 3TH3T 4MNHB 2J8OA 5FKAB 3DX6A 3TH2T 2Z91A 2ICEB 3H7BB 1HILA 4Y4KC 3C6SA 5CJ8A 3MRPB 1N4XL 3BKML 5DWUH 5J4MA 1UCBL 4KPHL 3IDNA 3GMRB 2D3VA 4HCRL 1UH4A 4QCIA 1SJHA 3BKCL 4XC1H 5CD3B 4JO1L 4P4RB 5DEGB 1QQDA 3D0LB 4R96B 1QFWH 1DBBL 4XX1E 3ME0A 3RDTC 1OAYH 2VLLA 3SJVA 4WW1B 4ODHL 1D3CA 1F11A 1TCRA 5C08D 5EC2A 4EDWH 5C0AE 1AI1L 4NKMB 4XBEL 4HHAA 1I9IL 2YZ8A 3VD5A 3MR9B 5EOCL 3LZFL 3CFBB 5C09D 2Q6WA 2VABB 3GSVB 2VKWA 4PJBE 2R2HA 5H37H 3CPLB 4ELMB 1BREA 1MCPH 3ARDA 4U1SA 4O2EB 3BSZH 3PABA 2AABL 3ZT6A 3MCG1 5C1MB 1FFPA 3EYVA 2HFFB 3MXVL 5B21A 2CO7B 4GS7B 2B2XL 3CGTA 3G5VB 2Q87A 5E1AB 3BD4A 3VXOA 1MCOH 1MFAL 1XCQB 3GO1L 3D9AH 5EO0B 5I1KH 4CNIA 1N6QH 4Z0BL 3S35X 2H6PA 4OZHE 2ZNWA 4KV5E 5EN2A 2LE9A 4IOFC 5JOPD 5HDLA 1RJCA 2RCSL 1LO3L 4KK8C 1L4IA 1T83A 3DROA 2YEZA 2BXZA 2EC9T 4PJCE 1IC7H 5F1SA 3QIBA 1EVTC 1YYLL 4RNRB 3QIUB 4FQ2L 4OV6F 5HXMA 2AV7B 1M1SA 4LLDB 1E27A 4BSVB 5D7IE 5TF1L 3BIKB 4YXLL 4APQC 2ZSWA 3OKEB 2NXZD 5F9WC 2R56H 2XXMB 5J13B 5FHAH 1FL3B 4U7SA 2X4PB 2CR6A 1XIWA 1DUZB 4TPRL 1DDHB 4GMTH 3EYUL 4OM0H 1CD9B 2JJWA 5JIPA 5ETUB 5AZEH 3PG2A 2BSED 2FCBA 4DVBA 1FQ9C 1K4DB 4PRDB 3V79C 4YFEA 3PGCB 3EKCA 3FT2B 2E27H 5E2WH 2EDYA 4EOWL 4U1LA 4BFGA 3FQRA 3BAEL 3RWFA 4PJAA 3HRPA 3MFFB 4JFDA 3IDYB 4CUCA 2NLJB 4N8PA 4AEHH 1RZ8B 4MHHG 3UBXI 4YXKL 3B9DA 1LEGA 4E41E 1FNEB 1MHEB 4CRPA 2IF7A 1KTKE 5C2BL 1QLEL 4LPUA 3TPKA 4X7EC 4NFCA 4PJHE 5FFLA 3WUWG 4K3JL 3QULB 4KJWC 4J7RA 1WC7A 1O7VA 2VLJB 2CSPA 1YUHB 5DD0L 4G7VH 4U3XA 4P3CL 1PZUB 4BQ9A 3LKRA 4PP1D 4GW5A 1P1ZB 3C08H 5B8CA 3RUGA 3VG0L 1RU9L 2DD8L 4PJIF 1WVZA 2QHRH 2VAAA 4X4YB 3B2VH 4KTEH 3TNMB 1BQLL 4JQVC 4WI4A 2CJUL 4B5EA 3M8OH 5DD1H 1HH6B 3QG6B 5IROA 3KDMA 5JDJA 1UM4L 4MYWB 4ZXBA 1MWAH 1F13A 4X99A 1IL1A 1NBZB 1JN6A 3ULUC 1NC4D 4IRJA 2EEDA 4K3DH 2WP3T 4HG4K 1VHPA 2PO6A 4XPTL 3T0EC 5FGBA 4YAQB 5DEFB 2ERJB 4BH7A 2FWOB 2L7JA 5D2LE 1U8PB 4P3WA 4JG0L 3PGDA 5JXEA 1JPGA 4IDLA 4PRHA 1MCWM 2V7HB 3DVGB 1AD9B 3P9MA 2HG5B 4LVOC 3HZYB 5FIEA 2YK1L 3CX5J 4QTHA 1E4XI 3N50A 3VWKA 3LIZL 4WW2A 4ENEC 4LHJB 1HHIB 5GS1A 1NCCH 2D7NA 3GKWL 3HNSL 2LAGB 4K07A 4OIAA 1QSZA 3QPXL 1JNHA 1ND0B 2YBRA 3QIUD 3UZQA 3IDUA 1FVEB 1KXVC 1J0YA 4XPGH 5CD5D 4XCCH 3O41B 5IHZA 4G6KH 4CADB 3V7AG 1JWSB 5HGAB 1J8HD 4FQ1L 3WIIH 5D93C 1A14H 5AAWA 3VFNA 4Y4FD 2IALB 3ECBA 1XH3B 5EWIH 3PL6B 5ICZB 5HPMB 5DLMH 3QAZC 15C8H 4LLYB 4Y89A 4KXZI 4LCIL 5SWSE 3CX2A 2VL5A 3UPRB 4M3JA 3S34L 5LJYH 2J2ZA 4GAGH 1OGAE 2GK0B 3SDDC 3O6FC 3ILPA 4GBXA 5GZND 1PQZB 3PHOB 4QXTA 4X8JA 3D6GA 5DQDH 4DAGL 3LRHA 4OSUL 4S10A 3VE0B 4PTTA 4JFQA 4JY4B 4DQOL 4MXQD 3UYRL 1HCVA 3GSNB 1GIGL 5IMLB 1EFXA 4AMKL 1OAKL 5F7HA 3PXHA 4V1DA 1U93A 3R1GL 4OF6A 4P2YA 5DFVD 1O5DT 1BD2E 3DBXB 5GHWH 2AEIT 4L4VB 5I73C 4PB9L 1IQWL 2F5AL 1G1CA 4M43H 1A6PA 4XI5C 3MBXH 3RY4A 3EOAA 2WSKA 2ZSVA 2NYYD 1OTTC 1MELA 1JMZA 4DEPB 2XKSA 1SM3H 1ZLWH 5FUCC 4LVEA 3VFVB 3CSPA 5DMIH 2YOCA 5EBWB 1INEL 1KIPA 2OJEA 2KQNA 5F1IB 5FCUL 4LCCB 2JB6B 1I4FA 4M6MH 4LFHD 4HT1L 3BN9C 2VSDA 3MLXH 4M62H 4ZUUB 3C9NB 4NGHH 2CK0H 3STBA 5C9JA 3BP7B 5E9DE 1U2CA 4ODSH 3KAAA 3MV9D 1BX2B 4BYHA 3LEYL 1QRND 3FTGA 5EBLA 2EECA 2NX5B 4ALAH 3VFTB 3MLUH 2EDKA 3L5IA 2HTKD 3MV8D 1E4WH 2CIIB 1YEIL 2G5BB 4OIBA 1JFQH 1KC5H 3K8KA 3SGKA 1JPSL 4YHKL 4R2GB 3ZYZA 5DTFB 3NFSH 1U8NB 3JVGA 5D71L 1B0WA 4PRAA 5DJ0A 4QRTA 4FFVC 2HKHH 5GGRA 5HGDB 5IB1A 4P2RD 1Q9KA 1NUGA 4JY6A 3DECA 5D2NA 4C54A 4WUUE 4HS8H 4JFYB 2NXYB 1JJUA 1XGTB 5CEZD 1KJ2B 2J6EA 3VWJC 4U1GB 4WWID 3ARED 1MF2H 4PG9A 1S9WB 2WZPD 5HI4D 3SKOA 3FOMB 1LEIB 2H45A 2RIKA 4KUZH 4OBSA 2E9JA 4U1JB 3GRWA 4HFUH 4ZFGH 1GZQB 1SEBB 3MJ9A 4RMVA 1X5LA 1YEDA 4YDKH 2CMRH 1MCEA 4G8EB 3VA6A 2X4QB 4MD0A 1XF4A 2EZ0C 4BSWB 4HH9A 3FFCE 3O11B 1U8HA 2HRPH 1X7QB 3DMMD 5EOTB 3SKMA 2ID5A 1I8IB 3MLWL 1NBQA 4RAUB 3ARUA 3GJFB 1N5YL 4PJ5E 3LV3A 3IJSB 1K9TA 3GGWA 4Y1AE 1BWWA 3JXAA 2I9TA 4QRSB 4I3RH 1NSNL 2ZOLA 5K9QI 5DZLA 3SDAB 5E6IA 3MRHB 3D85A 5F70A 3ULSB 4YH6A 1U58B 5EUKA 1M7IA 1INDH 3WL9B 5JPNB 4L4VD 3OL2A 3V4UH 5CJXA 5D6CA 2IAND 4YLQT 1IAIH 2YMXH 2QADD 4NQDE 2DKSA 2N56A 2V17H 2AXFA 4GG6B 1C5BL 1ZWIB 5GRUH 3KGRA 3O8XA 3RGHA 3TBVA 5T3ZD 5JUEH 1N5AA 2X1XR 4J3VA 5KSBB 3VFRB 5DJZB 2AK4B 2CK2A 3PWPA 4H5SB 4IIQA 5FV1L 5ISZD 3KPSB 1KYOK 3LOWA 3UJTH 2IPTH 5I8KH 2JIXD 1G6RH 1T1WA 4PJDF 1YEJH 5EBMB 3FRPG 2RQ8A 1HSBA 1L7IH 1UZ8A 3QIWB 3QFJA 2AJYH 5MI0B 5TQ0L 1YEHH 2R4SL 3TYGL 4QRRD 3DVNA 3IFLH 4M8QA 4WWKD 1OY3B 3ULUH 4JRWA 2XACC 4KK6C 4PY7A 3KPPA 3EYSL 4JZOB 4IRSA 3QEQD 1BPVA 4OZGE 1AQDA 1F4YH 3TC9A 3K1DA 3EDEA 3RPIA 1S7UB 4U3HA 1EUTA 1B2WL 3D3VB 1MHCA 1P7QB 1CU4L 4QRPD 4EIGB 2NZIA 4HK3N 2RAMA 4LQFH 3O3AA 2HJKA 4MAUH 2AERT 4PRBA 3SO3C 4R90L 3GMPA 1MFEH 5BRZD 2VMFA 2JELH 2FB4H 2GITB 4JZJA 1T21A 3NACL 1T4KA 2HN7A 2D7OA 2JK5B 2WIIB 2YD8A 4O4YL 5F21B 1E4JA 3AB0C 3L5WB 3WXVL 5KSAA 4GW4B 1IEHA 1I8LC 2FECL 4N8VA 5EIQA 1N8ZB 2HT3D 2VLKA 4WHYH 4XRCA 4F7PB 5GZOD 5MP6H 1XZ0A 3MACL 4O02H 4ORGB 1RUPH 4DZBA 4R4BB 1ZGLA 1OSPH 5E1HB 3V2AR 4KMTH 4N0UE 5C6PB 1U0QA 2GY5A 4LNVA 4R26L 1TQCB 5INCA 5EUOF 3SN6N 2H2SD 2OZ4H 4NKIH 4ODWB 3TIDB 4M02A 5ESVB 2IMNA 4ZFOB 4QRUA 5J89A 4DGIL 4PGZA 3LRSA 1MCWW 2HMID 4M1CC 4XBPA 4M5ZH 4LDOB 4NOBA 3BEWA 1OVZA 4PRNA 1U92A 3OF6D 3K74B 5ADOH 3T0WA 5DK0A 3LN5A 4ZO8A 5BQ7B 2JKXA 1WAAF 2X41A 1AGBA 2XICA 5KOVC 3JWOL 2FDBP 3CFKB 1DSFH 4WJ5B 1QSEA 2GJZA 1HZHL 2DQCL 2BNUB 2ZUQB 4GAYB 3AY4C 3TBYB 1QSFD 3JBG7 5TE7H 2GSIA 4LPVA 4PG2C 4FQPA 3FKUS 5JR1L 3WIHL 4Z7UE 1DBKL 2VDNL 3DV4B 4CVXA 3X12B 5IR1A 3HPJB 5ESQA 3AM8C 4OT1H 2BNRB 3F7YB 4S1RH 5TE6H 4NM8L 1W0YT 4ELME 4HS6B 3AFLA 2PXYB 3T1WA 1KIRA 3BYTA 3CSYA 2J8UE 4UUJB 3QBTB 1EIBA 1J05A 3KYKH 4XP9L 3HMXH 4TVPE 4XMPH 4F9PC 4LPYA 4YXHH 4FFYL 3TLRA 4PJXB 5HHOA 5JQ6H 5D72H 2X4TB 5I75B 3IGAA 1D9KC 4LF3B 4S0TD 2NY4B 4WI7A 1NGPH 3ARFC 1A3LH 3JV6B 1P7QD 3QCUL 2AEPL 3QDME 5IWLA 3GBMH 5LXGL 2PCPA 4ZUVB 5BJTB 3T8XA 1QHOA 4EN3A 3C2AL 3WHXB 1M4KA 1Y6NR 1AGCB 1AO7B 3AXLA 1FZJA 1A1OB 4LIQH 1QNZL 43C9A 2FGZA 5I15H 1L0QA 4G9DA 3EJJX 5DHYA 5FUOL 2VXSH 1BQSA 3B2UD 1MCCA 1R24A 4H0GA 2I07B 1WBYB 2ENYA 4FTVE 4U6VL 2CDGA 1CICA 2UZXB 1S9KC 4QRQA 5K93A 5BOZG 1WZ1H 1XR8A 3QEGL 4GJTB 3WS6C 4YHZL 3HI6H 5IOPA 1VGEL 3PWLA 4UQ3A 5I19H 3O2WL 5LAXA 1DVFA 1AY1H 1BP3B 1QTYT 1J5OL 3KS0J 1INQA 4Z7VF 2W38A 5E8OB 2X05A 3EO1A 1RHFA 1ORQA 4OD1L 4MA7L 1YNLL 1E4KC 3HG1D 3BEVB 1W0VB 3QH3A 4ETQB 1LMKA 4EDXB 3FT3B 4GFTB 4OLXH 3BT2H 3IU4H 5I1JL 4O9HL 3QI9C 4O2FB 4P57A 4PJ8B 3MZGB 3S37X 3S9DB 2B1HL 4ZD3H 1OD9A 1BBDH 3QEHA 3Q3GB 4L8DA 3SGEH 3U9UA 4FRWA 5C7XH 2NY0B 2IBGA 3BP6B 4MNQA 4QXWA 2Y4SA 1V5JA 3CAFA 4G80A 5C6WH 1FO0H 3VRIA 3CVHL 5IFJB 4MNGB 4PV9B 5HHNB 2J6EL 4BH8A 4OGAD 5FO9B 2DWEB 5JHDB 3C5ZC 4ZG1A 1CF8H 1U8IB 2P43B 1TZGH 3QUMB 3GRWL 2VE6A 1ZSDB 4FQJH 3V8OA 4Y16B 1PAMA 4OFYA 3U83A 2VQUA 1R5IA 2BNRD 4HJJH 3HC3H 2NY7L 1GGIL 2PXYD 3I02A 2NCMA 2J1KA 3FOLB 3LB6C 5F6HI 2Z31A 2GK2A 1UJ3A 2P46B 1VADA 4HV8A 4AJ0A 4QHMB 2R0ZH 1JV5B 4HLJA 4KTDH 3OPZL 4JDZB 1BOYA 3CFDB 3LH2L 3UC0H 3U6RB 1JF6A 3SDCA 3W39B 3ARGD 4ZSOA 3MBEB 2Q86B 5AD0B 2ZG3A 3CNKA 3U2SB 5JIHA 4GQ9H 5KVGH 4BFIA 1LE9A 5GS0L 2GAZB 2BVQB 3FQWB 5B22A 3QDAA 4E41D 1RUKL 4M7ZC 4XMLL 3WIFA 4QNPF 3I9GH 5F7UA 4Y5VA 3I6KB 2FGWH 1AO7D 3FQXB 3TVMD 5IGXL 1KT2B 4QF1B 3HC4L 4MWFA 4L8BA 3T2QA 4XNQB 3VFMA 2YD9A 4I8DA 5HYEA 5BO1H 3Q48A 3NPSC 4GRWH 5C86A 4M8VA 2CLRB 2YSSA 4R3SB 1FC2D 4GOSA 4Y19E 4JKWA 1RZKC 5HGBA 3MUY1 3MV7A 1R5VA 2UWEA 3Q5OA 4PBWD 2ZG2A 1F4XL 5E4EC 2KBGA 1FE8H 1AXSA 3QUKA 1TPXB 3QJFB 2R0WH 3P40A 3FQUA 1T7ZA 4XPBH 4OD3H 1VFAB 4PRIE 3LDBB 5IESL 4Q6YA 4PBVC 2X70A 4I0PB 1OCWL 2KKQA 5FYLH 4EQ2A 4ZO7A 5FCSH 4WO4C 4I4WA 4C55A 1UB6A 3S7GA 4FXLA 4LSRH 3TWCL 4PJ8D 3D69A 5C0IB 4KKLC 1K5NA 2D03L 4X7SL 5AZ2L 3QYCA 5DHXB 3BISA 4TUOB 1T5XB 3T1FB 2NY0D 1U8JA 3Q5YA 5C0EB 3WDHA 4PJ7E 3OB0H 1A9BB 4LRIA 2UZYB 3TO2A 4H26B 5IMMB 1YY9D 5B3JF 3D39A 1X5AA 3VH8B 5JHDD 4XP4H 1V3KA 4LCWA 1QFWL 4Y2DD 5IB2A 1OAYL 1HILB 1K85A 3C6SB 4FZ8L 1KJ3H 4GRWF 1RJYB 2DI9A 4P4KB 4EDWL 2VL4A 2GFBB 1MI5B 1C08A 3IDNB 1GGCH 4LVHB 4QCIB 5SWSD 4PJBF 3ROOA 1BFVH 4MA3A 1N59A 2QR0A 1A6VH 1QQDB 2BVEA 2VZUA 3HMWH 1P2CA 2BVOB 3RZCB 1CYGA 2VLLB 5E8PB 2ICWA 5A2KH 4P23C 3SJVB 3VXUA 1F11B 5DUBB 1MCPL 1TCRB 2ZCKH 4X6DF 1F97A 3BSZL 4HHAB 3BD3A 1I1AD 3EAKA 3L5JA 1H3GA 2Q6WB 4OZHF 1BF8A 2B5IC 1T03H 3HLAA 1JPFA 1MCOL 5EZLA 2PYEA 1UEYA 3D9AL 2PF6A 5I1KL 1N6QL 1I3GH 1CLOH 4XP6H 4MXWH 4U1SB 3D2UA 1BD2D 1J0ZA 5B38A 3FAWA 4PLKD 4RRPG 1FFPB 3MLZH 5DR5H 2YS4A 1LEKA 3GMNA 1IC7L 5D7IF 1A7OH 4K94H 1V05A 3VXOB 1U8LA 4PGBB 4CNIB 2J8HA 2QQNH 2VXQH 4WGVB 5DMGC 3HI1A 2R23A 2APFA 4LGPB 4G5ZH 2VUOA 1AXTH 5EUOA 2YD2A 2FX8H 5AUMA 4LSUH 4XVUD 3DROB 1G6RA 2YEZB 3L3OA 2R56L 4Q7DA 3QIBB 5FHAL 3S35H 4KAQH 1CVRA 2F9BT 1S5HA 4GMTL 5B39G 2DMKA 4OM0L 4P2OC 1E27B 2IC2A 1AHWC 5E9DD 1X5JA 5AZEL 4MDIA 2ZSWB 3PWVB 1GHFH 3CU7A 2E27L 5E2WL 1J7VR 1UKTA 3TV3H 1XIWB 4K71B 4HLZH 3MRMA 4UV4H 3E3QE 3J8F7 2AKRB 2EO1A 1KB5H 4S1DD 1KJMA 4DVBB 1FIGH 4OCYH 4U1LB 3E2HB 3I6GA 1V7NH 4D0DA 3SE4A 3RWFB 2VLME 4PJAB 3FO9A 4JFDB 1A6AA 4X8XA 5JIIA 1MSPA 2ZUSA 4FP8H 4G7VL 3WLBA 3HC0A 3QXAA 2R69H 3LSOA 5L6YH 2DQDH 4HPOH 4G6JH 5CJOL 4HUVB 4P4KD 5D1XC 2XWBA 2QHRL 1MI5D 3B2VL 3S96A 4JVUA 1WC7B 3UPAA 3M8OL 3LKRB 3GKZA 4ZFZB 1MWAL 3RZCD 4GW5B 1OL0A 2VLRD 5B8CB 1J11A 4X80H 3RHWF 1LVEA 4P46D 3BDBA 5L7XH 1SMOA 2OZ4A 3WV0A 2XZCL 3F12A 5IVXF 4W4NA 1KF9B 1LO0H 4F7EA 1TVBA 4TULH 3W9DA 4Y1AD 3RU8H 4X5WB 1AKJB 1NC2A 5BW7A 3KDMB 2EH8H 5C8JA 4OJFH 1IL1B 3D3VE 1JTOA 1JN6B 3O6FA 1BEYH 5C0CE 2PKDA 4XNUH 2VNCA 4IRJB 4JFZH 1AGDA 1UG9A 2P8PA 3HB3C 3OXRA 2Z93A 5E4IA 2PO6B 3RL1B 5F8QC 3O2DA 3ZYJA 1NCCL 5FYJU 4ZODA 2I60L 4BH7B 4K23H 2KZWA 4I0CC 3PGDB 1NEZA 1JPGB 3TIEA 4PRHB 2P8MA 2W9EH 1DCLA 4PJFE 3O3EA 3ZE2E 3H2WA 4XPGL 2WP3O 2PUQT 4XH2A 1CGTA 4QTHB 4XCCL 4GG8A 1EHLH 4G6KL 3E0GA 3VWKB 4WW2B 4GS7C 5GS1B 3QUXD 3WIIL 1A14L 2PTVA 2H1PH 1AGEA 2EKJA 5D1ZA 1AP2B 5EWIL 3UP1A 1IRAY 1JNHB 2YBRB 3RX7A 1WV7T 4QHNA 5L2KB 5DLML 1KULA 1RZKH 5A2IH 1DEEA 5HHXH 5IHZB 1WTGT 3DTXA 3P9LA 2APTA 3T3ME 4JHZA 2C5DC 1TTFA 3VFNB 4FXGA 3HMXA 2VISA 3OHXA 4ZYKB 4GAGL 3FO1A 3BUTA 5B4MC 5DQDL 5JW5A 1BJ1J 1G9MC 3BYYA 2ED7A 4NC2B 3SCMD 5J13C 2VL5B 1MHPH 3RPKA 3GSRA 1G0DA 3BH8B 4RA3A 5ALBL 4GBXB 3ILPB 4YZFE 2OQJB 4QXTB 4X8JB 4FQXA 4KTYA 5EU7C 5GHWL 1EAPA 3TJEH 2C7UB 2Y36H 4JFQB 4QT5B 4LCYA 4BZYA 2RBLA 5DC4B 5DXWA 1IAKA 4M43L 4TOYL 3BIAX 2FEEL 3MBXL 3IDYC 1MFBH 3A6OA 2ADJB 3WUWB 1CQKA 3C8DA 5DHVH 1U93B 2CUIA 1SM3L 2DS4A 5JORA 2NY2B 2MHAA 4DK6A 2V5SA 4NDMA 4BZ2H 5DMIL 1RAMA 4OCXH 5F7DA 3B9AA 3L95A 4TRPH 4Q6IB 3EOAB 4M6ML 1KYOJ 4JN1H 4MJ5A 3MLXL 2ARJQ 4DZ8A 4M62L 4NGHL 2CK0L 4L3EA 4ODSL 3INUH 1AKJD 4GRLD 1NUDA 5SWQB 5IV2A 1YMME 4TQEH 5EA0H 4ALAL 3CFJA 3H9HA 3MLUL 1GOGA 1KIPB 2OJEB 1Z5LA 3SBWC 5CSBA 4WI9A 1I4FB 5AAMA 5KS9E 1E4WL 2GJ6E 3IB4A 1EDQA 3HPLB 4ODUB 4MB4A 4GRMA 1T20A 5C9JB 1HCFX 1OAQH 3NFSL 3I75A 1A7BA 3L3DA 1FPTH 3T2OA 4HWNA 2HKHL 5EBLB 4DKDC 1I7RB 4UBDC 3NMEA 4NHUB 4HS8L 1KN4H 5I1CH 4POZC 1FO0A 2ERJC 4YE4H 4NPYB 1P7KA 3G6DH 3KXFE 4NCC2 3BP4B 1AR1D 4XAWH 5T1DL 1MF2L 2GT9A 3RIAK 4OUOA 1Z9LA 4PRAB 1IT9H 1BOGA 5IB1B 5GGRB 3ISWA 1OP9A 1HWHB 1Q9KB 3DWTA 4KUZL 3B9VA 3OKDB 2E9WA 4HXBH 5F97E 5J1SC 4HFUL 5TDNB 4YBLC 4R6UA 3SDXA 5L2KD 2CRMA 2DI8A 3VXME 4YDKL 5FA3A 5E00A 4RFEA 3IF1A 3RNQA 2ESVB 1JGLH 3HE6A 2EDTA 4PG9B 3MUHL 3G6JB 3S97C 2R8SH 1OSZB 3PF2A 4DUVA 2VDQH 2HRPL 3C5JA 3QA3A 4HUXA 3O6MH 2DBLH 1K4CA 5JLZB 1YEDB 4L1DA 4PJ9A 3EYFA 5EIVA 2NW2A 4K7PX 4MD0B 2X42A 3PL6C 3W0WD 5ANMA 4HH9B 3UTSA 5LGKA 3QDMD 2CRIA 2BZDA 3TA3D 4RX4D 2XTJB 4I3RL 4OTXH 1U8HB 5C0JB 5K9OB 3PGFH 1PEZA 3LKSB 2OBGA 3RVVD 2L4OA 3SKMB 4MS8D 3D0VA 4LRNH 1INDL 3EUUA 4YHOH 2WLYA 3LV3B 5CUSH 3V4UL 3GGWB 2YPVH 5T1KA 5C3TA 4MA1B 1A0QH 4NIKB 4WHTB 2I9TB 2F54B 1IAIL 5MEQB 2YMXL 1EZVX 1JI1A 3ARXA 3UEZA 1YN6A 5DQ9A 1JMXA 4H88H 4MCZA 1KPVA 5GRUL 3SE8H 4FTVD 1M7IB 5JUEL 1TFHA 4WENB 4OZIA 2NY2D 1H0DA 1Z3GH 4LHUG 3HAEG 4W70A 5D6CB 3GM8A 5FGCB 3UJTL 2YRLA 5I8KL 4L5FH 1I8LA 2OTPA 1KEGL 1YEJL 5D1QB 4GMSL 1V3JA 3C5SB 2AQ3A 2AXFB 5F7FA 1L7IL 4Z8FH 3O8XB 4U6YB 3TBVB 2AJYL 4MCYA 1IKNC 1FH5H 4PBXA 4IIQB 5I1AA 1RK0A 4P2QA 4G6MH 3IFLL 1UA6H 1DBMH 1BAFL 3RWEB 1T1WB 3ULUL 1T80A 4F15B 3O4OB 4DEPC 1YECH 2X9YA 2W0KA 2OR7A 1UZ8B 4ZAKA 3QFJB 3ZSTA 4N90D 1F4YL 1CE6A 5CINH 2KDGA 3NH7L 4LCCC 5MHSE 3ARBA 5FO8A 2DM3A 4LQFL 1HDMB 3UX9B 4MAUL 3KPPB 1ZTXL 2CQVA 1MEXH 2DQJH 3QUYD 1MFEL 2QQQA 5I1IH 1T7XA 2JELL 2FB4L 1I8KA 3NA9H 3L7EA 3SKJH 4NN5B 3QDGE 3SDYL 3DSNA 4Z95H 3ZKXB 3S5LA 1MHCB 2IADB 4GKSA 3O3AB 2HJKB 3L3HB 4TVPH 5INDA 3GMOA 2IBZX 3AY4A 2CUMA 3GMPB 3PXJA 4R2GC 5MP6L 4ZFFA 1UVQA 3BRGC 4O02L 2ESVD 1ACZA 1RUPL 1T21B 4HK0B 1T4KB 2HN7B 1OSPL 2VOTA 4PGEB 4KMTL 3V5KA 2NXYC 4PY8I 3OKLB 4FQHB 5DS8A 3SEPA 5KSAB 1U3HB 4DFIA 3AM8A 1JNLH 4N8VB 2OZ4L 4NKIL 4U1GC 2YWYA 4E5XA 3QWRD 4XRCB 2VLKB 4U7KA 2W92A 1OB1B 4DZBB 3R8BB 4DFHA 4M5ZL 1ZGLB 4F80A 4LGRB 1ONQB 4F9PA 3U30C 4CBPA 2XTJD 3V5DA 2MSPA 5INCB 5ADOL 1U95B 2EYRA 3AU1B 1A02N 2NZ9D 2OR9H 4QRUB 1D9KA 3CSGA 4G7YH 5CSZA 4ZTOH 3H0TB 2HJFB 3LRSB 1BZ7A 4J2XA 4XBPB 4YBHA 4WI6A 5HYJB 4B7IA 1DSFL 2F54D 1U92B 1ZKAA 3WJLC 4W81A 1JHLH 2E7CA 5DK0B 3HFMH 3LN5B 5F9DC 2EC9U 5DJCA 3QO1A 1AGBB 3T0BA 3X14A 5TE7L 3MRNA 5GS3A 1XF5A 5GRWA 3IYLW 3SDAC 1WSST 1IZJA 4XCFH 1QSEB 2GJZB 5D1QD 1GXEA 4ELMF 1YJDH 4HKBA 4OZ4A 2FR4A 5IVXA 1LO5B 4ACPA 3AMKA 4YBQD 4OT1L 1MFCH 3O0RH 3EJYC 3Q6FA 5TE6L 3LPWA 4S1RL 1HH9A 3SJVE 3GI8H 1N0LA 3UCRA 3WS6A 1JYXA 3U1SH 1X44A 2YD1A 2R1XA 3KYKL 1NDMA 3HMXL 2ZCHH 4XMPL 5D7JC 5JNYA 1X5KA 2MKWA 4YXHL 4CVXB 2B4CC 4TUKH 3TJHD 5ESQB 5IR1B 4KY1H 5C0RH 3EIFA 4JO2H 1UKSA 5JQ6L 5D72L 2P5WA 3HCVA 1KIRB 3DHJA 2R2CA 3RA7H 2MPAH 5DSCB 1NGPL 3CSYB 1A3LL 1J05B 4UMGA 4X7DC 1A21A 3GBML 4K3EH 3QIWC 3BHBA 5MI0C 3TESA 4NUJB 3O6KH 3TN0B 4KWUA 1MLBB 1ITBB 3OGOE 5HHPB 1BQHG 1CXFA 1QA9B 4POYA 3RGVB 4G9FE 3WYRA 4LIQL 5K9JH 3MGOA 5I15L 1YY8A 4PJEA 3FB6B 5GS2H 2VXSL 4LMQE 5LWYH 2PCPB 4X4ZA 4NZJA 3IXTB 3T8XB 4EN3B 1T3FB 3LQZA 4R0LC 5CGYD 1GCFA 1S5IH 5GGTH 4LKCA 3B4NA 2PETA 5DMKA 1R6VA 1FZJB 1WZ1L 1D5XA 5GISH 1WISA 2C1OA 43C9B 3ULVD 1HYSC 1FFRA 4HKJA 3HI6L 3NBNA 1P9MA 1U3HD 5I19L 1HK6A 1VENA 3BQUB 4U2ZA 1AY1L 1R24B 3IDIB 1AGFA 4DK3A 5T1MA 2CDGB 4RQQA 3M07A 5EU6B 4QRQB 1A6TA 2FATH 3B2UC 1XR8B 3BP5A 3SE3A 3UDWA 5IOPB 2EIEA 3PWLB 2CIKB 3CFCH 1IJ9A 4EVNB 4TSAH 2E7HA 1DVFB 4HIXH 4PRPB 4NC0B 2W1NA 4OLXL 2XN9A 3GSOA 3IU4L 2PNDA 1JZ8A 2MJWA 4A6YA 2YWZA 4ZD3L 2EXWD 1BBDL 1TQCC 3O45A 4LMQI 3UTOA 3LKNA 3DV6B 4Z18A 2OXHA 4C56B 2V2XB 3OMZA 4NQEE 5C7XL 5HYQA 2ED9A 3QH3B 3GMLA 1OGTB 1TVDA 3VMNA 1FO0L 4M48H 1TITA 1CR9H 3BWUC 5CGMA 3GMQA 4P57B 4KKCD 4JM2D 1HINL 1QG3A 4OFDA 3RQ3A 3OAZH 3EOTH 4L8DB 4Y4HC 3LKQA 1CF8L 1UQSB 3O9WA 1TZGL 2YC1A 3U9UB 2J5LC 4KUCD 4FQJL 1K2DA 4MNQB 5CBAA 4G80B 3S37H 3GSNH 2FX7H 4X6FA 4HJJL 3HC3L 2DF3A 3T2NH 3WFDH 2Z0BA 3RUGE 3NCFB 4BH8B 5KTEH 1Q9LB 5JW4M 3I3BA 5EO1A 3HUJB 3BESR 2ZUQC 3V4PH 2R39A 4NZUH 1X6NA 2R0ZL 2VE6B 2KZ1B 1EERB 1ZLSH 1A1MA 3U0WH 4KTDL 2D7PA 2F58H 4ODXA 4WRLA 1R5IB 3BZ4B 2UUDK 3UC0L 4HIIB 3TCLB 4WY7H 1YEFH 1HI6A 4L9DA 5KG9A 2WINA 1KG0A 4MA8H 4GQ9L 5T1LA 5KVGL 3OX8A 4KRPD 1DUYA 4WO4A 3MCKB 2PXYC 3TN0D 3I9GL 4E0RA 4PRHE 2FGWL 5F72S 1TCMA 3RGVD 5I71B 3PQYD 4BFIB 2A6IA 4KK5D 5BO1L 1I8MA 3OV6A 2VXUH 3FN3A 5I75C 3PP3H 5E94A 2FECI 3WIFB 4EI5B 2NY4C 4Y5VB 4AYFA 2FIKA 1WLHA 2CO6B 5C0FA 1A6UH 2XIDA 4LEOB 4MWFB 2APWA 4R4NC 4L8BB 4ZS7H 5HDQH 2EDRA 1DQDL 5SX4I 4G6FD 3BQUD 2FYYA 1FE8L 1N3NB 3K3QA 1UACH 4D0BA 2OK0H 4G8FA 1WICA 2R0WL 4XPBL 4OD3L 3RTQA 1FYTB 3P4NA 5EU6D 5DGQA 2DJSA 4PR5B 5HI5C 3GUTB 1R5VB 4LHQB 4FFWD 2UWEB 1MRDH 3QG7H 4FA8A 1CFSA 1KJ2H 1MJ7H 5FYLL 4N9OB 4PRPD 4YNYA 3QCTH 5TE4H 1S9XA 3RVXC 3FQUB 1YPZE 2GKIA 1MAMH 2I9LA 4LSRL 4N5EC 3RWGA 5GGVH 1YN7A 4PJ7F 4TNVK 2Y6SC 5KOMC 5C08A 4C56D 1CCZA 3RKDC 2GQHA 1AC6A 4PP2A 1G7PB 5EH1A 4GKNB 4I4WB 5D70H 2X5PA 5C09A 5IF0A 4X6BB 4AQOA 4XP4L 1VKXA 1K5NB 4RGMC 5DRZA 4V1DE 1PSKH 3DYMA 4L4TB 3QISA 3GJFH 3X3GH 5EZOH 4DJMA 3L1OH 4PJ8C 4KJYA 3MA9L 3TO2B 1KJ3L 4LKXA 3D39B 5JOFA 4ONFH 1GGCL 2JF1A 4M61A 1BFVL 3H9SE 3MC0A 4RFOH 1V3MA 1A6VL 4LU5L 3DX7B 3UJJH 3HMWL 5L8LB 1X4ZA 5IB2B 5CHNA 1HSAB 4W4OA 4TNWF 1X5YA 2ZCKL 5J12B 1C08B 5KN5A 3ZE1E 4MQTB 5HI3D 3HRZB 4MA3B 1UWXK 1N59B 2QR0B 1RI8A 1WIOA 2Y25A 4Y16C 4JRYD 1EEZB 1T03L 5KSUA 5I66A 1CGSH 4P9MH 1J0KA 3VXUB 1I3GL 2JLLA 4JQXC 1CLOL 4XP6L 4MXWL 3IFOB 1F8TH 2WQ8A 3MLZL 5DR5L 4Z9KB 4GXUM 1J1XH 2GW5A 3HLAB 1A7OL 4JKLA 1JPFB 3MBEC 5EZLB 2PYEB 4EI5D 3C60B 3P73A 2R9HC 2VN4A 3NZHH 5D2NE 2VXQL 4G3YH 3V0VA 4YDVA 3KLAA 2HA1A 4U7MA 4WHCA 3KLSA 1I7TA 4G5ZL 5CZVH 1AXTL 4PREA 3OKKA 2FX8L 4LSUL 4U1IA 4JFED 3GMNB 1BECA 2WAHA 2IG2H 1LK3H 4KAQL 4LDLB 3S35L 3NTCH 2GHWB 5E08H 3ARPA 1FYTD 4X4XB 2HFGH 1Z9SA 3N1QC 5DC9B 3CLFH 4MNHA 5D5MA 3HI1B 1Z9MA 2R23B 4TVSa 1GAFL 3X3FH 5AUMB 1G6RB 4NRYA 2J4WL 1I9RH 3GMRA 3L3OB 1GHFL 5CD3A 4JO3L 3HHRB 1J18A 5DEGA 3TV3L 2KQMA 2Y1VA 1JUFB 4LAQH 5IVZA 2GJ6D 5I1GH 4UV4L 1QRKA 4WUKH 2Q8AH 3GBNH 3B5TA 4JGUA 4HWZB 4WW1A 5F7NC 4MDIB 3A67H 3V52H 1KB5L 1TPXC 2ICES 4GG6F 4NKMA 1FIGL 3D48R 5KSBF 3EHBC 4OCYL 3L3IB 1V7NL 3CFBA 1NJ9B 4I0PC 4KZEH 2VABA 4JQIH 4F33B 4KRMB 1OLZA 4D3CH 4FP8L 1CDJA 5FO7B 1NC4A 4L4TD 1KACB 4UNVA 1RJZA 2ED8A 3UMTA 2R69L 5L6YL 5FGCE 2DQDL 4YFDB 4HPOL 2ENSA 4G6JL 4FOMA 2X7LA 4FQLL 2DI7A 4PS4L 2HFFA 4D0DB 4EKXA 1Q0YH 3KPRE 3FO9B 1A6AB 4OD2A 3G5VA 2V2TA 4OCSH 3RWIB 3IAQA 5FUZH 5EZJA 1XCQA 3B43A 3EOYG 3PWPE 4LSPH 5D96B 5IMOA 3QXAB 3LSOB 4X80L 3S96B 1Q0XH 5FYJH 1LO0L 4TULL 2W0FB 1CLZH 3WJJA 3RU8L 1XEDA 3QIUA 4LLDA 1W2KT 2EH8L 3SPVA 4OJFL 4K2UL 4P4KC 4BSVA 3GEWB 4AEIH 3E6FB 5CSGA 4LVHC 2VJXA 3I6LE 1S78D 4XNUL 4H1LA 3FHAA 3ARVA 3PHSA 4JFZL 4N9GB 3D25B 4UINH 4Y4FA 1TZIA 5IW6B 1EPFA 2XNAA 4LARL 3WXWH 1FL3A 2VITB 5AEAA 4F7EB 3JV5A 3BUYB 3RX8A 4JHWH 3ZE2F 1DUZA 1NC2B 3K0WA 1C7SA 1PGRB 4K23L 4KHXL 5C8JB 1UT9A 4HC1H 5ETUA 5CILH 2W9EL 3EOBB 1LILA 3C60D 3P0GB 3WUZA 2P7TA 1DLHB 1NFDA 4K8RC 1AGDB 3JUYA 3OXRB 3GSWB 1K4DA 2ADIB 2D0FA 2WBWB 4X6EA 4RAHA 1ORSA 2VDRH 1S7RB 1EHLL 3D18B 4OAWA 4R7NA 1NGQL 2X4OB 5D9SA 2H9GB 5JA8B 3S4SG 2OMNA 2H1PL 3MFFA 1A7PH 4XTRC 4WEMB 3PUCA 1XGQB 2VDLH 2NLJA 2AJXH 5LGJA 1R3LA 2CDFA 1RZKL 3O3EB 4UAOB 1S7SA 4HUKB 4YFLF 1FNEA 1GPOH 1MHEA 5CZXC 2WK2A 1TIUA 5HHXL 4WFFD 4F58H 2OSLA 1DQQA 1BJ8A 1TZHA 5JW4N 1IGTB 4LP5A 1YUHA 3UXFA 1WITA 4QHNB 5B39B 3B8YA 1DEEB 2YUVA 3VD7A 1SJEA 1P1ZA 2BOBA 4NSKA 1OPGH 3P9LB 3QIBC 4M6AA 1MHPL 5MHSD 4EXPX 4FXGB 4ZOEA 2VISB 3OHXB 3P4MA 3MJ8A 3FO1B 1HHHA 4F8TA 3TJEL 2Y36L 3QDGD 1KGCD 5HTSA 1KELL 2DJ4A 1FRGH 5LQBH 1XIWC 1RIVH 1HKLH 3E8UH 1QFWI 4K71C 4O51A 4M9PA 3MV9A 4XWOD 1T0MB 1MFBL 4PJIE 4YAQA 2HT4C 2IH3A 1QRNA 4HZLA 5GGQL 1D7FA 4Q9BA 5C0GA 1EAPB 3EDDA 3OJ2C 2V7HA 4BZ2L 4LCYB 3MV8A 4B0MM 1R3JA 1IAKB 1F3JA 2EDEA 4OCXL 3KR3L 3NIFE 5J56B 4PJXF 2FO1A 4DTGH 4YR6B 3MMEA 4ELKA 4JN1L 4P2RA 3ARQA 3O2VH 5JORB 1HOCA 2MHAB 3INUL 4NDMB 1OTUD 1FVEA 5TFSH 2BY3A 3U4EB 2AEQH 4TQEL 5EA0L 3O41A 5F7DB 4CADA 4HQQH 4M7LH 5HGAA 2VB5A 3P2TA 2RFXA 3AREA 1JGEB 1VFMA 3HS0B 3C6LD 3QUMH 2QHLA 4MJ5B 4DZ8B 3Q1SH 2A6JB 3WLWD 5BV7B 1XH3A 3W81A 1OLLA 2DM7A 1OAQL 5HHOE 5K33A 1RV6X 5B8CC 1FPTL 2FSEB 2BY0A 1KPUA 3VD9A 4LLYA 5TF0A 4DKFH 3CFJB 3H9HB 1Z5LB 5F3HA 3WEXA 4PUBH 2RB8A 4NZRH 1KN4L 3W11C 5I1CL 5IG7B 1KNOB 4YE4L 1EO5A 5IROC 3G6DL 4GRMB 1A5FH 3RVUD 3DMMA 4XAWL 5ACMA 2GK0A 3L7FA 3L3DB 2WWMD 1PQZA 1IT9L 3MRGA 4IRJC 1KCVH 2GCYA 1CDBA 1DL7H 3SQBA 1JTTA 4HXBL 5IQ7H 2LV4A 3VE0A 5GRYA 4HEPG 4JY4A 4Z0XB 2PO6C 2KUTA 1YNTB 5ERWA 3GSNA 5FGBC 1FO0B 4NCC1 3UJIH 1JGLL 5JXEC 2GT9B 1BOGB 2R8SL 4L3AA 3KPTA 4QHKJ 2VDQL 2DWDB 1N6UA 3QXUA 4L4VA 5HYFA 4NQTA 3O6ML 2EDHA 1Z0NA 2DBLL 4OLYH 3SDXB 2LQRA 4QY8A 3VFWA 3VWKC 2IANA 4WW2C 5GS1C 1IGYB 3RNQB 4FZEL 3HE6B 3G5YB 1SYSA 5ITBL 3T4YA 4IRZH 4R4FH 4OTXL 4TTDC 1LO2H 5ISZA 3PGFL 3VFVA 1K4CB 2ORBH 2X4RB 1VEMA 2JIXA 4LRNL 5DDHB 4Z7WB 4PJ9B 4YHOL 3EYFB 5EBWA 4JB9H 4LCCA 4G9FD 5CUSL 1Q9OB 2DLGA 2JB6A 3GZKA 3MV11 2YPVL 4U1MB 1A0QL 5ANMB 4ZUUA 3C9NA 2WANA 2D4FA 3RWHA 4QRRA 2BSSA 1BX2A 4H88L 4K7PH 3SE8L 1FVCA 3QZWG 5DK3A 3VFTA 4P0DA 3UZVB 4OI7A 4A2LA 1NMBH 4IEFB 5KW9H 5T1KB 5ADPH 1TJIL 2CIIA 4L5FL 4KI5E 2G5BA 2BERA 2B39A 4GBXC 3RVVC 3U4AA 2DQFB 5DTFA 9CGTA 2H3NB 3F6LA 1U8NA 1PG7X 4Z8FL 1KPVB 5HGDA 1CFNB 4HS3A 2NTFA 5DO2C 1F6AB 1FH5L 4JFYA 1H0DB 2K7QA 4O00A 3GJEA 1XGTA 4G6ML 1U41A 2PW1A 2OTUA 4XNYH 5BRZA 1DBML 5EOQL 1KJ2A 2F15A 2R1WB 1NH6A 3L5HA 1YECL 1LP9B 2NY2C 2QLVB 2BOCB 3FOMA 3QQ9C 2I5YH 1JP5A 5M7QA 2WBJB 1LEIA 5I1AB 1GZQA 4P2QB 5CINL 4PLNC 1JF5A 1VESA 1OWRM 4QGTA 4ZSOE 4KMQA 3UYOD 4D0CB