4MNGE

Structure of the dp10.7 tcr with cd1d-sulfatide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
255
structure length
228
Chain Sequence
QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGEPSYWGFPRTTRVIFGKGTRVTVEPTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISPGKYDTYGSTRKNLRMILRNLIENDSGVYYCATWDEKYYKKLFGSGTKLIITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of V delta 1 T Cell Receptor in Complex with CD1d-Sulfatide Shows MHC-like Recognition of a Self-Lipid by Human gamma delta T Cells.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Beta-2-microglobulin
total genus 54
structure length 228
sequence length 255
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mngE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mngE02
2X4OB 3QJHB 1XF3B 4ZTOH 4CU7A 4DN3L 1DFBL 1AXIB 1FRGL 5CP3A 4TQEH 1F4YL 1S8DA 4HEME 1C12B 1T1WA 4P46A 3HI1B 4HQQH 2BC4A 1BQHA 3MRLA 5FEBA 1LK2A 4BFIA 1CXKA 4KVCL 4P5TA 3V7AG 5L88H 4JFZL 5CILH 1UJ3A 4D9QE 5IR1B 4U7SA 2IADA 4J1UA 3U4BH 3K4DA 4PRHE 2VUOA 2CKBB 3WS6A 1N2RA 5E5UB 4OI8A 5T1DL 1EZVY 1S7RB 2YBRB 5D93B 4LEOA 2Y72A 4FNLL 2A1WH 1RJCA 3T0EC 1LO0H 4CMHC 3UTPE 3U9UB 3QIWC 4JZJA 3MRJB 4Z7WA 3DX7A 4U1IB 3Q5OA 2VTFA 3PWJA 1B6DA 5CUSL 5GSRB 2J1KA 5T1LA 2F5BH 4NDMA 4UTBH 3HZVB 3EFDL 2V9RA 1U8QB 2IPUK 2LU4A 2CLVA 2VL5A 1FC2D 4NNXB 43CAA 1A8JH 1I1AA 4K7PX 3B9KD 5GRWA 1LO4H 1E4WH 1YNKH 3WO3B 2PTVA 3BPNC 3WHE0 4U6HA 1OP5H 2R23B 3SDAD 1W0YT 2QV2A 3V5HB 4QHUB 5E2JA 1DN0B 4KDTA 3VD4A 1T1XB 1N6QL 4HC1L 3STBA 3VD5A 2F8VA 2ICWJ 2VLJD 4K3HA 1QSZA 1BVLA 4OT1L 3VGHA 4UQ3A 4KUCF 4OUUB 3RZCC 3NZHL 3QUZB 4XMLL 3MGOB 1TTGA 2DLGA 1HZHL 1A1OA 1MHEA 1HHHA 1NJ9A 4OF5A 4WUUD 2QR0B 1RUKL 4FTVE 3SDYL 2PNDA 4ZSOA 1FNEA 3QXUA 4QGYA 4F7MB 2BOCB 1WITA 3MV7E 1B2WL 5C8JA 3VWJB 3TO4C 4X4YA 1DSFL 4FP8H 1RZ8A 4C4KT 1AY1L 1ZA6A 3CFCL 5D5ME 5J1SC 4N8VB 3O11B 1CLCA 2AJVL 3VGAC 1D9KC 1EPFA 1ZT1B 2C3WA 1WICA 4OF0A 3LMJL 1HXYA 1QSFE 5L2JB 3VG0L 3UP1A 2NW2B 2WWKO 1HZHH 4H5SA 3WSQL 5DFVC 3L5XL 4NRZA 3DJ9A 5SWSB 2R1XA 3G6DH 2Z92B 1MI5E 2BCKB 1P7QD 4HG4J 3KPNA 4WW2B 4Z8FL 5CIPH 1MCWW 3TLRA 5CJ5A 5KANG 3MR9B 4YGAB 3ZDXE 4N5EC 5HHVL 5J7CC 5L6YH 2APXA 3BKCH 3JV4B 2NPLX 3V4UL 3MNZA 2A6KB 2IH3A 2NY5C 3ZE1F 4HKZB 4HBCL 3KPRD 4YDIL 2BMKA 3WFHA 4YHOH 4X7TA 3E6FB 4TULL 4R7DA 5ACLA 4X6DA 4S0TD 1IGYB 3PDOB 3RY4A 2DM7A 1YUHA 3IKKA 4TSAH 2IPTL 1HNFA 2RR3A 3W5MA 5I1DB 1RHFA 4EDWL 5ADOL 5DHVB 5LQBH 1P4BL 1A6ZB 5FM5M 2FH8A 4PJ8D 3K8KA 3WBDA 4R96B 5ACMA 3IETB 4MVBC 1NGZB 4G6KL 2QSVA 3KPSB 1AC6A 3MLYL 4EN3A 1CIUA 3HNTH 4EOWL 5GGVL 1DUZA 2GJ6E 3LQAH 3V4UH 1MELA 2VLKD 3QIBC 4OCYL 1YC7A 2A0LC 3BFOA 5CILL 3CZFA 4L4VE 1JI1A 5IG7A 2VC2L 4HGKC 3S3PA 2XG5A 5FUCC 4O2CA 1F2XK 5J56B 5C07B 1M71A 3WLBA 2OR9L 4LSQH 5EC2A 5KG9A 5FGCE 4KK9C 2WWMC 2DLHA 1HYRC 4NDMB 2YC1B 3H7LA 3LKPB 5D2LA 2FO4A 1WZ1L 4MXVF 2EYRA 2ORBH 4KK6C 3QQNA 5TQ2H 2FSEB 1T0PB 3FN0H 4LLDB 2EH7H 1G9MC 4H0HB 3GSNB 1KLGA 1MAMH 4KPHH 4XMPL 2Y36L 5D8JL 5JOPE 5FYJE 1EZVX 3WIHA 1MWAA 3DYOA 2AK4A 1A2YA 3SDYH 1NCBL 2OZ4L 4KRMB 5BRZA 1WV7T 3L3IB 2NX5B 3OKNB 3IRZA 4MA8L 3UDWC 4APQB 4LEOB 5EU7C 4AMKL 1BBJA 3MLTA 5HVGB 2LAGB 1J05A 4G6JL 1BFVL 2FHFA 1FLRH 1G7HA 3KJ4B 2VDRL 3W9DA 5ID0A 2XWJB 4K94L 2EXWD 4DQOH 5T1LB 2F53B 1JCKA 1X4XA 4YWGH 1ZGLA 1LP9A 1FH5L 3D39E 5D70H 1M7IB 2VL5B 1CQKA 2Q76B 2R0KL 4HS8L 4UQ2B 5EULV 1PG7X 1DLFH 4D0BB 4KI5C 3FO1B 4U0QB 2VQ1B 3QB7C 3IVKA 3QCTL 2R23A 2DI7A 1AGDA 1FO0A 4P3DB 3BKYH 3SCMA 5DQJB 3HNVL 5E8DH 3ALPA 3QPQC 2FZ3A 2NY4D 1P2CA 4BKLB 4TVPD 1J1OH 3FQRB 4PJGB 3MRMB 3GRWA 5DEGA 3SDAB 1D5BB 4OGXL 3LSOB 3IXTB 1DQLL 2X4NA 3OB0K 5JNYA 3E6HB 1CFQB 5FYLE 5IW1B 4JPVH 5KSVB 4UDUA 3QI9D 5FO8A 3B9KB 4DGYL 2F19H 2EDRA 5EWIH 3HI1A 2Z35A 3NIFE 3VXMA 5IQ9B 4LHJB 4GMSL 2JJWA 3MRDB 5F6IC 4XVTL 4FXKA 1ZEAH 4KQ4H 2VQ1A 5EOCH 3ROOA 2D7OA 4ZFZB 2EE2A 3QDHA 2ATPB 1C1EH 2YUZA 5DMIL 1PLGL 3HE7C 4HWEL 3FCTA 1T1ZA 1LO5B 1OW0C 3WFDL 1BD2D 2BVEA 3G6AB 3PXHA 5TGBA 2IALA 1UXWB 5C08D 2UUDH 1IT9L 4MD5A 1MFEL 1VEOA 5MEQB 4D0CB 1LO2L 1NH6A 4PV8B 5DUMH 2NY5H 1TCRB 3B3IB 1BAFH 4LSTH 2P44B 1WISA 3TF7C 3FQUA 1QSVA 5TE4L 1RUPL 2MKLC 3BAEL 4MA7H 1I8KA 2Q7YA 4L8SA 3O9WA 1UB5B 5CZKA 5DMYA 3FB5A 1FV1B 4DJMA 2CUMA 4MJID 1J86A 4Y5VA 4QLRA 4NPYA 4X0KB 4HXBL 4GW4B 1Z5LB 1FFQA 5A2LH 2A77L 3QQ4B 4P5TD 3THML 3UTQA 1CZ8H 4OQTH 2JJTA 4NQEB 3MRPA 1OAZL 2AJUL 4PB9H 4I3SL 4R9HA 3RPKA 5I8EA 1JNHA 3RTQC 2Z91B 3EYOA 4MLIA 5KG9B 1A6VL 1C08A 1OCWL 4NFCA 4CVWA 1RZ7L 2X4PB 2EC8A 1GYAA 4P9MH 3SBWA 1YEHH 4N0UE 3PV6A 2Z4QA 4KTEL 3TH2T 5IMKB 2D0HA 3OXSA 1SEQH 4NNPL 5ITFA 1J1XL 1IKNC 2FYYB 2K1MA 5CBAA 1IC7L 5HGHB 5F96L 2MSPA 1A47A 5EZIH 3PHQB 1PG7H 2CRYA 2VKWA 3WIFA 3TCXA 5F88A 5C07A 3H3BC 3U1SH 3C5JB 2E9WA 1OGTA 1BEYL 5EZJA 3JXAA 4QRPA 3GO1L 5IEKB 1GPOL 4N8CL 3RGHA 4XNMB 1NC2A 4DFIA 4WGWB 1IM3A 3QNXB 3UTOA 1CICA 5D5MF 1OAYL 1S5IL 4FQXB 1I3RB 1FVCB 3PDGA 3VFVA 1ORSB 1OP5K 1MAKA 3ARFB 3MNZB 1V3JA 2NY4C 3CDCA 5T5NG 5E08H 4NN5C 2CDGB 3MLWL 1L6XA 3DRTB 3FFCA 3MLVH 3TFKD 1Z9SA 1YEIH 4JFYA 4EJ1C 3QDJD 4F33A 5D72H 2DMCA 4Z6AT 4GRWF 3P4NB 3QPXH 4GKNA 1MFBL 2CXGA 3UEZA 2BCKA 5IB5A 1EUTA 2DBLH 5DHVH 2JCCA 5DEGB 1TJGH 5IHUH 3AS2A 4I9WE 4L3EE 3G08A 4BQBA 4MQSB 3EYFA 3QCVL 1QBML 4GSDH 4X6BA 3REWB 4YIQB 4HKXA 1D9KD 2VLLA 2VXUH 4G8GB 5ICZB 5C2UB 1U3HA 1Z9MA 4NN7B 3QRGH 4RISH 1CFBA 3BMVA 5GGUA 3LKNA 1A7OH 4IMLA 1BQHG 1A4JB 1RMFL 5GSVA 5D96C 1VGEH 1AI1H 2F9BT 2NY7L 2JK5A 1R0AL 1T04B 2I9LA 4KJPD 3OF6A 3T04D 4P9HC 1DL7H 5INCA 4R7DB 4GG6E 1R3KA 5FUZH 4W6YB 4F80A 4GBXC 3PWPA 3S4SB 4L4TA 4K7FA 3L5WA 1CE1H 2O5ZH 2KZWA 4NZRH 2E8YA 4OLEA 4Z0BL 2CUHA 2V2XB 1HIMH 3MRNA 2X05A 4HWBA 1Q8MA 5HY9A 1NAMB 5D2NC 4HGMA 4HIHB 5HYQA 2E8ZA 1T1XA 1EJ6A 1Q9OA 3L3DA 4HS6B 4KKCC 3TO2A 5CAYB 2D7PA 3GSNH 4LU5H 4LARH 3P4OB 1A6UH 2C7UA 2W9EH 1WSST 5IW6B 5EZOL 3AB0B 2HFGH 3BPCB 3MFFB 1CGVA 4IRSA 2Y23A 12E8L 4CU8A 4YGVB 1RZ8B 4YDKL 3VH8B 1C5DB 3OJMB 5DQDH 2G2RA 1VDGA 4K3JL 1OM3L 1QFUL 2ED7A 5D7IA 4GXVH 4L4JA 3DVGB 4YEFA 2PTTA 1KLGB 5JMRA 3X13B 4IRJD 2FD6H 3R0MA 1E4XL 1BQSA 1FFNA 4RMVA 1P84J 3C8DA 4G3YH 4M1DH 3RUGF 4YHKL 1K6QH 3HFML 4W6XB 2DS4A 5GGQL 3D5OF 2EE6A 4YNYB 1LDPL 3LZFL 2ZOKA 2LFGA 3MSPA 3M8OH 1WVZA 4IRSB 3L9RA 2GY5A 2F54A 1L7TH 5AAWA 1O7SA 3MGAA 3FAXA 4RGNB 1UCBL 1YNLL 1SJHB 3U2SA 2A6IA 1A64A 4NQCD 5DJZA 1VADA 1T21A 1MHPH 4S1DC 2P4AB 1T5XA 3ZKMD 2VDKL 2ITCA 2CR6A 5SX5H 5KTEL 4JFDE 1ZLUK 4E41E 5IB2B 2HFFB 3QUYA 1K6QL 1AD0B 3ZE2E 1A14L 4M1DL 1IC1A 1MVUA 3JV4A 4NN7C 1WFTA 3ZSTA 1ZLSL 4XP9H 4WW2F 3W9EA 3RI5F 4ONGH 3VRJA 1FPTL 1V5JA 5F3BB 2VMFA 5K93A 2BP3A 2BVOB 1TJIL 3FKUS 3GMRB 1INDL 3H9SA 1NGQL 5D6CA 4F7CB 3JVGA 1HXMA 4G7YH 1CLOH 1F3DJ 2X4QA 1KTKE 1GZPB 3RVUD 1OF2A 4PRAA 3AREC 5DT1H 2KQNA 3TBYB 4JFPB 3SOBH 1KEGH 4EI5D 3LQZA 3RWEB 3ZSSA 3HKFA 4X7DC 5CWSB 2HMID 1R3JB 2F54E 5IUSA 3CU7A 3CCHB 3ZT7A 4Z0BH 5BS0E 5DD1L 3BP4A 3D69B 3MRQB 4I0KA 2XZZA 5MEPB 1BJ1H 1CGUA 1T89C 3OAYK 5HYEA 3AGVA 2HVKA 4M7KL 1EEZB 4OF3A 3QP3A 4JKPL 3MO1B 1CT8B 4ZXBB 1NC4A 1A6WL 4CW1A 1DL7L 2X4PA 5F9OL 3VXTB 3VD9A 3N0PB 4J3OC 5CSBA 4CU6A 3QO1B 3FO0H 2AVGA 5C6PB 5GXBB 1G9NC 3IFLH 3GJEB 3MRHB 1KTLB 5C0BD 1QACA 1NAKL 1JZ8A 4RBPH 4N0CC 5I16A 3QWOB 5EUOB 2HRPL 1XEDA 3TBTB 5K9QG 1I9JL 1U0QA 2AXGB 1R3HA 4TVPL 3AY4A 2QLVB 1SY6H 3QH3A 4IOIA 5C0CD 4ZPTA 5FGCB 1KB9J 1RUAH 1GOHA 3GI8H 4OCNC 1ED3A 1DQMH 3TYGL 1RZJH 2XNAB 5IMOA 3BUTA 2QHLA 2AGJL 3FT2A 2AEQH 5FV2A 4G7YL 1KXQE 1ZT7A 5C0FB 3MRGA 2VSCA 1WAAE 4M93B 2VZ3A 5L7XH 5MEPA 5MP6L 4QRTA 5H94B 2BHUA 3K1KC 4NQCB 4NBXB 5GS2D 5J9PB 3VCLB 4RCAA 5I74B 4NRXB 1ZXQA 4ZODA 3VFWA 5FYKU 4XP9L 2AK4E 4IRJA 3STZA 2GSIA 4PRPB 3VI3E 2ZOKB 3GIVA 4TOYH 3TNMA 3OKEB 1A14H 4NHUA 2R0ZL 1MPAL 4M6ML 5AZ2L 4XAWL 5FO7B 2VIRA 1J18A 4MD4B 3SJVA 3TYFB 1BECA 1NCCH 2PYFA 5IFJB 5C0RH 3H2WA 3FFCD 5JW3L 5T3ZH 3IETA 2R8SL 4UI2A 4AH2A 1J1XH 1JHKH 1UACH 1MCFA 4X6BB 3SDDC 3IDMB 3ULVF 3O3DA 4L3EA 5HHXH 3KJ4C 3MNVA 4XP6L 3MXVL 3PGFL 4JFHD 3FRUB 2XTJE 6FABL 3DX8B 1VACA 1IC5H 3FB5B 4WUKL 1I7RA 5ANMB 3IJSA 3JTTB 4O9HH 2BFVL 4YC2B 5IJKA 4N8VG 2A9ML 5B39B 2BNQE 5MEOA 1O0VA 4L4VA 5IBTL 2NY0C 2B0SL 2RIKA 3EJYD 4ODUB 3BO8B 2BDNL 3AB0C 3HRPA 4KKAC 3TIEB 3X12A 3QFDB 1QR1B 5CEZE 4MZ2A 1NLBL 5F3BA 1S9YB 1WQVT 2FATH 4Y8AA 1KEML 1UXWA 2XZQH 5AG8A 4NKOB 2P43B 1A3RH 3TNMB 3U9PL 1HWGB 4OCXH 2Y25A 3V52L 3THMH 1HKFA 3C5ZA 1JWMA 4HEPG 5A16A 1XT5A 4EXPX 3MRKB 3VXQA 3LH2L 4Y2DA 5DQDL 1AHWC 3ECBB 3EUUA 4YDLC 2Q20A 3HC4H 3IFOB 3S96B 4KJQD 12E8H 2HG5B 3BAEH 4MA7L 4XCEA 4JDVA 4HUUB 5BRZB 2BNRE 5EZOH 1JTOA 3MJGX 5TE4H 4PYGA 3NGBB 2MCPL 4HMDA 3C5SA 4LSTL 4XVUC 3VW3H 2RB8A 3WYRA 4KK8C 1D5MB 5ICXB 4HCRA 1FYHB 1AIFB 4PJXA 3SE4C 2ITDA 1HNGA 4HF5L 2ILLA 4H0IA 3SE8L 5FYLD 5D7JA 3HZKB 2JELH 2XQYK 5I1JH 1QR4A 1ZEAL 4KQ4L 5HI4D 3VH8A 3GSQB 4AEHH 1T83A 3FO1A 1T0MA 4P5MA 4D0DB 5M95B 1XF4B 3RBSA 3LN5A 1M6OA 1AO7E 1DBKL 5EIIA 5I1AB 5T3ZE 5EU6E 3MBED 3R0NA 4ONFH 4RGMB 1AFVL 1XR9A 1A7QH 4JPVL 3BESR 4JFQA 2GJZB 1AI1L 5JIPA 5I74C 5D7IB 3PP4L 4JVPA 3QEQD 1GGIH 5E8OB 1K5NB 1J1OL 2R4RL 4XNMA 2WBKA 4OAWB 4I48A 4FTVA 3NH7L 3X3GL 1RAMA 5IMOB 3DSFL 3EJZD 5IP4A 4QHKI 4X6CE 3T0XA 4X5LA 2LV4A 2QEJA 4HPYL 3PP3H 1GIGL 4DKEH 3T77A 1XMWA 4DAGL 3LKPA 5D2LB 3IF1B 4UV7L 2W92A 3O9WC 1E6JL 2V7NA 5I8OL 4I77L 2ZG2A 2FJHB 4YC2C 4R2GB 4YXKH 2QKIB 4V1DD 5I2IB 3QH3B 3FB6A 1IM9D 1UWGH 1QSFD 3MOBH 1SYSA 2YD7A 1XH3B 1JPSL 4KHXH 3CSBA 3BVNA 3F7YA 3H7BB 4NO3A 4DGIL 1QRNE 3D48R 1TETL 5FF6B 1FG2A 1DQJB 1MAML 4KPHL 2R4SH 2IAMC 5EN2A 4J3UA 3KYKH 3A6BL 1MPAH 2R0ZH 3EIFA 5GIRB 4PP2A 1ACYL 4M8QA 4PG2C 1KIQB 4U2ZA 1AGBA 4KRLB 4Z0XA 43C9B 4PLJD 2CSPA 2ENSA 2XFXB 1DEEB 4PRHA 3DVNB 5DA0B 3U7YH 1VFBB 3DUUB 1NUNB 3S35X 5C9JA 2OR9H 4LSQL 3GZKA 1TQCC 3V7AE 5DFTA 3DXAE 4NO3B 5B38B 1L6ZA 4DN4H 4LPTA 1ZS8B 4Y4HC 2DYPA 3GI8L 3LQZB 3RWEA 1D5XA 4DZ8A 3LDBC 5BQ7A 4E0RB 4PGZA 1OQOA 4ZO6A 2BSED 3BRDA 4NQDD 3OBAA 5C7XH 3DGCR 1D5ZB 4F7PB 4BH8B 1F58L 3DV4A 1QYGL 3SKNA 4ELMB 1LD9B 1HCFX 3FQTA 4MCYB 4KK8D 4NQXB 4I0CC 4Y5XC 5ALBH 1YY9D 1MHHB 4WCYL 4LF3B 1KPUB 4KGJA 1EERB 4TSAL 5FDYA 1TVHB 1S9XB 3NIGE 5TE7H 1AP2A 4AZ8A 2DLFL 1JWSB 3BGMB 2RJMA 3C8HA 5KSUB 4IIQB 4HUXB 4MDIB 1FNGB 4FABH 1RUPH 5CGYC 2YS4A 4F3FB 5C1MB 5LCVH 1G9ML 2YD8A 4FFZL 1BAFL 4U3XA 1GGCL 5CKGA 3GI9H 3WXVH 4O2FA 2MHAA 3LRGA 1SMAA 1FG9C 1YPZB 2LQRA 1NGPH 4BYHA 3MC0A 4XBGA 2XN9E 5GJSH 3PDDA 3EOAA 3ET9F 2VLRB 2AABL 3I84A 4ONHA 1YEEL 2CLZB 2NY0D 4HIIA 1G7LB 4CNIA 4MAYB 4Y19A 1OSZA 2ARJA 2EO1A 4PGCA 4K94C 1RPQA 5L0QC 2CK0H 4S0SD 4MQ7A 3GJFH 4I5BB 2UWEF 4QOKE 4HUMB 1W72B 1LO3H 1BBDL 1U41A 1AXTL 2Z31C 4D0DA 2Y07H 2JB6A 4HK3N 1AY1H 3KPRA 2X89D 4J4PD 4OCLC 1OB1B 5AWNH 3OG6B 1D9KA 3DURA 4FFYH 5HGDB 1WFUA 4OGYL 1TCRA 1QO3A 4IOFC 5F7YC 5A40E 4OGXH 5HHOE 1JZ3A 1I3GL 4LLYA 3I85A 5IVXE 1RHHB 4IMLB 4W6WB 2EDNA 1H3UA 5AEAA 1AJ7H 4HUKB 5JOEA 1N6UA 1SVZA 4XPAL 4E41D 1MFCL 1BGXH 3CVHB 1W0VB 4OJFH 4JG1L 2CLRB 5MI0C 4K9EH 5IK3A 2DQGL 4XH2B 4QRPD 3KYMA 3QNZA 5C92A 4WEUD 4YWGL 4LQFH 5LXGH 4M7LH 3HZMB 1X7QB 2D03H 5IWLC 3H9SB 2NXYB 3DROA 2VDRH 2DQGH 4X7EC 1FORH 1QPPA 1ADQH 1I8LA 5EO9A 2HKFL 3RWDB 1K4DB 4YFLI 2EH8L 2FJHA 1QSFA 3GMPA 5GHWH 4J4PC 1MCBA 3MLSL 5CJ8A 1KBGL 5D5MA 4DGVL 3QFDA 3E6HA 1QR1A 3NTCL 5DJDA 1I3GH 1AD9A 5GGQH 1QZ1A 4ELKB 2Q1EA 2EH7L 4GRWH 5BXFA 4UIMA 1NMBH 1Z2KA 2W65A 4N5ED 1BD2E 5HGAA 3DWTA 5I0DA 5B21A 2VERN 2A1WL 4YHNB 5GIRA 4MJ6A 4HWBL 1RU9L 2Z8WC 5BS0B 3IU3A 1FN4B 4LLVB 3QDMA 4K3JH 3VXUA 3RWCB 4PRPD 5DYOB 3VG9C 4YIQA 4J3XA 2Z31D 4L8CA 3TBWA 3TN0B 3HE6C 3S36L 4KHTH 5EO0A 1ZVSA 4Y2DC 2W9EL 4MA1C 4M8QB 3TZVB 3ZTNL 5IB1B 1HINL 4RGOH 3SN6N 4XXDA 2P8PB 1UYWH 4NJ9L 5GS1A 1B3JA 4RAUB 3KWWB 3GSQA 1T2JA 3FTGB 2RAMA 1DE4B 4BZ2H 2H3NB 4MVBD 2PW1A 5GRVL 1QBLL 1MCCA 3DX9B 2XTJD 3L3HB 3O4OC 1MJ8L 3TBVB 4EBQL 4MHHI 1CYGA 2B2XL 3V4PL 4NBYB 4NKDA 4BUHA 5J89A 3HI6L 5DI8A 4Z7QE 5C0FA 4P2QE 1A7NH 3GKWH 3VXRE 3O0RL 1XF2A 3BUYB 4OAWA 3EFFB 1D5ZA 1CD1B 2VZOA 3EYOB 1RMFH 2ICEB 4DCQB 1L9NA 2IFFL 3WKML 4G43B 3MUGB 2DQHL 4UIKL 3LRHA 5EOTA 1NDGB 2VN7A 3SDCA 3JV0A 4TPRH 3SKJH 2FX8L 1OQXA 1BQHB 4GW1A 1A02N 2YA0A 3DLQR 3VMNA 4WUUA 5CZVH 1XAUA 3OGCA 5DDHB 3EOAB 4LLQA 3U7YL 1MFBH 3QPXL 3HS0A 4I8DA 4Y4HD 3WSQH 1F6AA 3ARGA 2VLJB 3SE3C 5CEXA 3LMJH 3QFJB 2MHAB 1EH9A 1U42A 5HDBE 1SJEA 5ILTL 4FP8L 4IMKC 2A73A 5HHMD 1QLFA 2CKBL 4JFEE 5EB9A 5IESH 3P0YL 5IEHA 1QO3B 2H2PC 4ZD3H 2PR4H 1U8MA 1JPSH 1BEYH 4Z0XB 3QULB 2AAVA 4JY4A 4HT1H 4ODSL 5FGBC 1DQQA 1Y6MR 4YXHL 4DUVA 2X1XR 5FKPB 4P4KB 4O2EA 4JQVC 1WIPA 1KCRL 1JHLH 3MOQA 3EOTL 4DEPB 3Q48A 2XWBB 4WV1A 5IW3A 4L8SC 4P2CG 5DD5H 4F37K 4DAGH 5CLWA 4OCSL 1SEQL 3IDNA 1ZS8A 1H3XA 4LFHG 4S1RL 2JE8A 4HFUH 1E27B 4WDIA 1FNAA 5IOPB 3HZMA 3CUPA 2C3XA 2VXTH 3L9RB 2CDFA 1JN6A 4AEIL 2BVPA 5IVZA 4V2BA 1E4WL 4XPGL 1ZA6B 4HS3A 3B9KC 5DGRA 5I19H 4U2YA 2E7LA 1FYTA 3EFDH 1N7ML 4QHKJ 1T3FA 1H3TA 1MCLA 2IMNA 2R69H 4PJ5A 1QQDA 5D1XA 1BVLB 2R29L 5D9SB 2BOCA 1KIRA 4IRSD 1HSBB 4OZIB 1A7QL 2APVA 2DIBA 5F7MC 4UT6H 5AG9A 1CBVH 2P5WE 3QO0A 1N64L 5JPMB 4MCZA 2PYFB 2P8MA 4WTWA 3MV8A 3CFIC 4ZQKB 2QADC 2YPVL 3QUYC 4Q2ZB 3CFJA 5IIEA 4UOW1 3PL6B 1MRCL 5DQ9A 1Q94A 3TV3L 4YDLB 2GTZA 4L3EB 1XZ0B 5TE6H 1LP9B 4JFQB 4KV5E 1YPZA 2XTLA 2DICA 1YY8B 4HSQA 5IJKC 4XBGB 3QQ3A 2XWJA 3T4YB 3QNYB 1MI5D 5J13C 4L3ED 4O2FB 2VITB 5KVDL 4FQXD 4ZTOL 1I1FB 1KV3A 5CEYA 3TWCL 4NZJA 2IWGA 4W4NA 4PJHB 4EIGB 3LV3B 3P40A 2C9AA 2LTQB 3K74B 1FJ1B 3WN5A 4NCC1 1NEZG 5DQ9B 4R4BB 2IBBA 2Q7NA 3O6KL 1R5IA 1KIRB 1ZTXL 4XVTH 5CJBA 1H8OA 3C5ZB 1I8MB 3QEHA 3QXWA 3MYJB 3QBTB 2YPVH 5I1DA 1KJMA 1FE8H 1G9NH 1CK0L 1MFDH 2F19L 5FHAL 4UT6L 1P1ZB 1SM3L 4OD1L 3RJDA 1DQLH 1CN4A 4G6MH 2CKBA 5DJCB 4OF7A 3QIUB 1PJ9A 5SWZA 2FH6A 4M7LT 4Z7NE 4NWTH 5F9DC 2VYRE 1UVQA 1UM5L 5BOPA 4WU5A 2AXHA 1EBAA 2EDYA 3RZCA 3NZ8B 4Q9RL 4CVZB 2A9MH 3ES6A 1XGYH 5CJOL 1X6LA 4O02L 1YEKL 2RBLA 4U7MA 4PBXA 4X9IA 1MSPA 4WUUE 3BZEA 2FEEI 2V2TB 4HFUL 1U3HC 2J8UA 3CXHK 3GUTB 5GGUB 3VJ6B 3RPIA 3OKYA 3FQNB 1J5OH 3FQWA 1K3ZA 4KI5D 4LKXA 4PTUA 5TDOA 3ARGC 4XC3L 5D70L 3ARGD 3QUMB 3DRTA 1BM3H 3RAJL 2EXYC 3DV6B 5KBNC 2LU3A 3QEUB 1UM5H 1MCDA 2P24B 4FXLA 4TSBH 2FWOA 4D9LH 4WFEE 4XHQA 5D2NE 2ZCLL 5SWQB 4FG6D 1SM3H 3RWFB 1ITCA 1JGVL 3GMPB 2W0KA 4TOYL 2YD6A 4Z7QF 4C56D 2N1KA 4NN6C 1L7IH 3T4AA 4P2QA 4ZD3L 4DOHB 2C26A 4GQPH 5KJRH 3HPJB 1UZ8A 1QHPA 1I9RH 1KJ3H 4RQQA 1P84K 3BQUA 1CFVH 1AGEA 1FP5A 5B8CB 4JRWA 5D2NA 4FZEH 5I9QB 3VRJB 3X3FH 5DJ6A 4PRAB 3V6FA 4POYA 2Y7QB 2OQJA 5ACZA 1F90H 3NOIA 2EDXA 1HKLL 4HIXL 4JREC 4PG9A 2ESVE 4OBSA 1CVSC 3MODL 5DRWA 1RUAL 2WNGA 2EYSA 4AL8H 3VFPB 3MV9D 2QHRH 4NOFA 1CL7H 1YDPB 4M5ZL 4YK4B 4H25A 4BK4A 2QSTA 3QSKB 3TPKA 2VC2H 2D31A 4PBWD 1T20B 1YJDH 2CDFB 3BISA 4YHZH 1ZA3B 4S10A 4RAUA 43CAB 5FA3A 3CFBB 3IFLL 5IIEB 3RIAF 5C0BE 1NANH 4NQUA 2H2PD 3NIDF 1XZ0A 3ARSA 2CO6B 1XGQB 4FQ1H 3I6KA 4P0DA 3PWVB 1G7LA 3V7MA 4YXLL 2V5TA 3VI3F 4EDWH 5ADOH 1HH9B 2DTSA 4DK3A 3DX6A 3MLPA 1B4RA 2IPTH 3MV8B 4QRRB 1TVDA 4NC1C 4LL9A 2W1NA 1ZLVH 4JJ5A 2PYEA 4YR6B 2XKNB 4MX7B 2XKUA 3HZYA 4CRPA 1NDGA 4Y7MA 4HX1A 1QBLH 4NO0A 4GMTL 4LPVA 1SHMA 4UDUB 3MGOA 1VENA 2WIIA 2WW8A 3IDYC 1UXSA 1OPGL 2KBGA 1UYWL 1PAMA 2XACC 5K9KB 1IE5A 2VQTA 1HINH 4LRIC 4KFZC 5DD3L 1K9TA 1FVDA 4FXGA 4NRYB 3KPSD 4KI5F 1CLOL 5T1MB 3LD8B 4M6AA 3UZVB 1OY3B 4WWKC 3LN4A 1S7QA 1INDH 3OKOB 5HGAB 4LLUA 3G08B 4XTRD 2IQ9L 2J5LC 4KJYB 4PB0L 5BW7C 2ZUXA 2C1PA 1LNUA 5C0AB 3UPRB 2KL6A 3VFOB 4WHTB 1IAMA 4XNZB 5C09A 3MLRH 2AJYH 2CKNA 1U8MB 5F1IA 3UBXI 3MUJA 3HI5H 5HDQH 2NY2B 3MLXL 3IDNB 3MJ9A 2OTUB 3QDJA 4RWYH 1DVFB 1RZKH 2NY2D 5HHNA 2IH1B 5DXWA 2NX5A 5EU3B 3E2HB 1UH3A 3L7FA 1KCUH 3RX8A 2I60H 4H0GA 3CPLA 3RKDC 2C1PB 3BGFB 5CHNA 4L4VB 4EIZC 4M7LL 3BWAA 4TPRL 1PY9A 4U1HB 5K9JL 3SDXA 4JJHA 3M45A 3LPWA 4ERSH 3JTTA 1V7MH 1ZLUH 4GW5B 3IJYB 2DQHH 4UIKH 3KPSE 5C08E 1HOCA 2NZIA 5KVEL 2VLKE 4OGZA 1CQYA 4IOFD 4G3YL 5DO2D 1NCWL 3O0RH 3T0ED 5JUEL 4N1HB 4ZUWA 4Z95H 4DKAA 3HI6H 1MLCA 3AUVA 4WI4A 3CZFB 3G6JF 5J6HB 2HJFA 1FGNH 3IFNH 1U3ZA 4JZNA 1FFPB 5FAAA 4H88L 4QWWC 5GZNC 5IKCB 1P4IH 3C9NA 5DJ2B 2XWTA 5H37H 1QA9B 4JO2L 1XCTB 4ODWB 5BZWB 4NKDB 4PJAA 2DM4A 1NLDH 1KLFA 4NHCH 5E6IA 2YUWA 4QHMA 5LVEA 5H94A 3V5HA 2J5LB 2G9HB 4JFZH 4PJBA 1SYVA 4S2SB 5FA3B 5FA4B 4BSJA 1HHKA 3DXAA 1EFXB 2JIXB 2A6JA 3GBML 3EYQD 2QSCL 1YDPA 4X7FC 1KN4H 3O8XA 2IANE 4RFOH 4M9PA 1I1YA 4IOIB 2R1YA 1CE1L 3FQUB 1DANT 4FFZH 1TPXB 4NO5B 3T0EB 3MCLL 3CJJA 2ZP0T 1NGXB 5TGBB 5F9WB 1G7QA 5DJXB 3E2HC 2W0FA 4CN1A 3VXRA 2RHEA 2F58L 4OKVA 1DEDA 4M61A 1Q9KA 3IFNL 1A7OL 3UYRH 1CDYA 4M5YL 5JO5A 4JHZA 3L5WB 1BZQK 3JWOC 1A7RH 3S7GA 4F9PA 3SKNB 2GK0A 3QUMH 4LVNC 3L95B 3HE6A 3C60B 5C7XL 5TQ0H 2V17H 3U7WH 1V3LA 4GAGH 2NYYD 1CLZL 4TVSa 4CVXB 3JVGC 2D03L 2DLTA 1NCDL 1OWWA 4U6YB 1WFOA 4ZFGH 2P5EE 4RSVA 1R3JA 3MRMA 4LGSB 3P4OA 4JCMA 3KPRB 4XNUL 4KJPC 1B88A 3MZTA 1I1RA 4UT9H 1NSNH 1GAFH 1F3JB 3RZCD 4G80A 3TVMA 1CE6A 2EDEA 5JO5B 3WL9B 4RGMC 5E2VH 2V2WA 3LEXA 4FQCH 4OTXH 1GHFH 2JKXA 4HXAH 4O5LL 3T3MF 4ZTPH 4G8EA 1TITA 4OCRL 4WJ5B 4QRPB 3OJDA 5C0AA 1AJ7L 3UPRA 4S1QH 4ZFZA 1NFDB 2AJ3B 3WO4B 1UB6B 4K07A 1FGVL 3VXOB 5DD6B 3S3SA 4NT6B 5HDQL 3LN4B 3PHSA 4I0PA 2R4SL 4GBXB 5IQ9A 3VXMB 2IF7A 2XY2A 5D7SL 1C5DA 1H0DA 5FCUL 2AV7B 1BBDH 1LO3L 3V95A 1IAOA 4KHXL 3OAYH 1J8HA 3UROR 3GGWA 1N0XL 5E4EC 4XVJH 3RWGB 1YMHA 2X4TB 3QA3A 1A5FH 1BP3B 5I71C 1EAPA 2UWEA 3QXDA 4Z7UE 3F62A 2NLJB 1LQSR 1ES0A 4MNQD 4E42A 3KPMB 5DRXA 3ABZA 1YEHL 3VE0A 2GW5A 3CVIH 3JWDL 3L3GA 4PJXE 4CDHA 2BRRH 2YPLA 4JGMA 1U8PA 2OJEA 2FX9H 5J11B 1N3NB 1F6FB 1KXTB 1VSCA 2DQUL 2NY6D 3DUSA 5CEYB 3HA0A 1GJIA 4LCWD 1YMME 1Z3GL 5LCVL 4G9DB 1U2CA 1WT5A 4NQSA 1BQUA 4IRJB 3STZB 3BH9A 1TVBA 4O4YH 3BWAB 5EC1B 2EDOA 1RIUH 5DEFA 3HE7D 1NUDA 1C08B 2F15A 4LSPH 3NFPA 5D7KE 5EBMA 5EU7E 3AU1A 3VWKA 1JPFB 4FQJH 5IFHH 3WNNA 4WCYH 4JZOA 1DLHA 3HAEH 1XF3A 1YY9C 1Q9WB 2FLRT 3QZWB 3VFGL 1E4JA 3ALWA 3DECA 3VE0B 5GRUH 3ARUA 5DK0A 5ICZA 3G6JE 1TVHA 5ELIA 2VE6B 1S7TB 9CGTA 5EDXA 4HGWB 1KB5L 5I8CA 1IILE 3EO9H 4PJDE 3HLAA 5DUML 4HS6A 2JELL 3N1MC 2A9NH 4B50A 5HJ3B 3ILPA 3D9AH 1CXFA 3ELAT 4WHTA 4PJIF 5J6GA 4YHPA 4P5TC 4P4RA 2G75A 3DBXB 3O8XC 5JTWA 4N0FB 1C1EL 3TO2B 3AU1B 4IHOB 1ACZA 1KELH 3FOMA 3ULUD 1YYML 3BEVA 2VLJE 25C8L 3K8LA 3VXNA 1UJ3B 3CVHL 5I1LB 1UWXK 3HHRB 4GRLC 1TVBB 1CICB 2DYPD 3SO5A 2BVPB 4BZ1H 1NC2D 3MO1A 4XC1H 2CGRH 1XGRB 1FZOA 4OLVL 4RIRA 4ZFOL 1DEEA 2DN7A 2K3TA 2XPGA 5FUOL 5IHLB 3BP4B 3QUZC 3Q3GB 2O61B 5KJRL 4GKZB 3NBNA 1NGZA 1K3IA 3V52H 1DTUA 1OAXL 2E27L 4HIJA 2NR6C 1LEKA 4ZOBA 5D1QD 4AENB 4OFIA 1FG2B 4WENB 2MQ3A 4D9LL 5FOBA 5FIEA 3O2DA 2EE9A 4JFYB 3HE6B 4POZD 1DLFL 5GS3A 2B0SH 1NC2B 4CDGC 5KS9B 4NYLA 5E99L 4JO1L 3F12A 5EBWA 5JA8B 1IM9B 3V0WH 3CGTA 2WP3O 2BFVH 1YY8A 3MMEB 4KK5C 1J5OL 4DQOL 1ND0A 4D8PB 4LCWB 3RI5K 5FFLA 3O6MH 2OL3A 3MUGA 4G43A 4ZPVA 4GG6B 1IC4L 5LAXB 3BD5A 4XCYB 5HHXL 4P59H 3DSFH 2ZUQC 3S34H 4AMKH 4F15C 3O4LE 4TUJA 2AJZA 1ZMYA 4Q9RH 4QCIB 4IOSD 1GGIL 4I3RL 3F5WB 4U1JA 4WI8A 5T5FH 2WBJA 4LLQB 3BIAX 5FUOH 5HHQA 4H5SB 1W2KT 1N26A 3C2SA 1U8HB 5TQ2L 3EDJA 1DQTA 4ONFL 2VLME 2ITCB 1T20A 5BV7C 1QRNA 1ZE3C 1MFDL 1QNZH 5ANMA 5EOCJ 1UB5A 5K9KA 3ULUC 3GSRB 5ENWB 4WW1A 1S7VB 1X9QA 3O6KH 4PGBA 3X14B 3UTSA 2FHBA 2WLYA 1WC7A 4KRNA 5C0CB 3SCMB 1NEZB 1QA9A 5E00B 1HYSC 1WCBB 4Y5YB 2DQJH 3U0TA 4MMXC 5IGXH 2J4WL 4WFGE 2UVFA 2A9NL 2DQDL 3WCYA 5KVDH 4OCYH 2QQLL 3B2VH 4EUPH 2AEWA 5HBBA 3HTLX 2DL2A 3DI2B 4PJBF 3X12B 2P8PA 1P4LB 3K81A 1JNLL 3R4DA 4JGUA 5TFSL 3WE6B 3RBGA 3IDGB 4X7SH 4PJFA 3ETBF 4OIIL 3H9SE 4R96A 4NO0D 4R90L 3DVGA 2SEBA 1WEJH 2EDBA 2R1YB 4HCRH 2OS7A 1MRCH 3VI4F 2X4NB 5HDBF 3CMGA 4ZS7H 4LSPL 4JKMA 3QDGA 4GKSB 4UB0H 4WEBH 5J4MA 4LGRB 4O4YL 3QI9A 1A3RL 4L9LA 4D94A 1N64H 15C8H 1H15B 3KDMB 4NP4H 1J0IA 3QIUC 3QHTC 3VFRB 4PV8A 1Z3GH 2HVKB 2DM3A 4HBCH 4M7KH 2VXSL 3FRPA 5F1NB 4L4VD 5J3HD 5DMGC 4MA1B 4Z18A 2V9QA 5JDSB 3T0EE 3VA2C 1CGWA 5EUOA 5KZCB 3QAZC 5IBUB 4L8SB 4QRUA 3IFOA 3S96A 5DRNA 2OTUA 1S3KL 4M62L 5I17A 1U58B 5GZND 4S1RH 1D6VH 4RMQA 2A38A 2HKHL 4JM2C 5JW4N 1A5FL 1EEYB 5DD5L 3ULVH 5AD0B 3C6SA 4N9GA 4FA8A 5JOPD 4HLZG 2NXYD 3QUXA 3E3QE 5T3ZL 5E9DB 5A2JH 3VFMA 3O11A 5ESAB 1EX0A 2HJLA 3ARDA 5C0RL 4UT7L 2XRAL 1JUFB 5GRJH 1F02I 1BLNA 5F1NA 2XN9B 4Q6IC 3IU3B 5KZCD 3BWUC 3JSSA 3DBXA 1H15A 1QFWL 4ZUSB 3IDUA 3Q6GH 1MIEH 2F53A 1PBYA 5D1ZB 3LKRB 4U6VH 4I48B 1KLUB 1PQZB 2V2TA 1NL0L 1KC5H 2W9LA 4AT6A 4W4OA 4YBQD 2X1OA 3H8NA 3MNVB 2X4QB 2EC9T 2GCYB 3BKJH 4BSWA 3SHSA 4AH2B 4Z7UF 4JAMB 4OFYD 1B9ZA 4ZG1A 5E95B 3AREA 3DTXA 1OLZA 5GZOC 1FVDB 4FXGB 4F7TB 1B0RB 3LB6D 4MD4A 2DQEH 2FGWL 2NLJA 3LB6C 3Q0HA 2ADGB 2YPKA 3PG2A 1CLZH 4APQA 2IGFL 4MAYA 2G60H 4PJHF 3CSGA 4Y19B 4OLWH 4UNUA 4U6XB 4LVOC 4U1MA 1H8SA 5D1ZD 3D69A 1KGCE 1F11B 1JNNH 1LE9B 3MGTA 3BPCA 3MFFA 1K2DB 4HK0A 1MNUH 3P11H 4PJGE 5K9QI 2KQMA 1JL8A 3O3BB 3SE9H 5MENA 1OSZB 1U8IB 3TNNA 2B1HH 4M5YH 1BWWA 4M6OH 4LLUB 1TQBB 4KK6D 2CIKB 3OR7A 4DWHA 5C71A 5ID1A 5FYJH 4PJEE 4Z7WB 4S1DD 1FL6A 1G6VK 1K8DB 3TT1L 1A6WH 5E7BA 4JRYD 5EBMB 1CU4H 2BY3A 3ISWA 4HWZA 3WIIL 4Y2DB 1CGTA 1UKSA 5MHSE 3KXFE 4C54A 1WEJL 3CD4A 2LVEA 3JWDC 1PG7W 5E6ZA 3EW3B 1WAAA 4CN4A 2D31B 2VISA 3MV9E 1PX3A 1MCNA 5FK9A 4HMEA 1NFIB 1XR8A 1YN7A 1KTLA 4JB9H 1F13A 3KYMB 4N90E 1KEGL 4DN3H 4OD3H 4MNHB 1CCZA 3ESUF 3WIHL 1YN6B 4JN2A 1FFRA 4G9FA 4WWKB 5T1KD 3SY0B 5JPNA 4NQEA 5J3HC 5E6YA 1UKQA 2P8LB 2DB8A 2OTWA 4P9HH 5E24E 3VFTB 2XN9D 1FGNL 5JR1L 4KAQH 4F3FA 1T21B 1S7XA 3OX8A 4HWBH 1MRFH 3IDMA 1QLRB 3F6IA 4UBDC 5KANI 1BPVA 1FIGH 2OXGA 5DVMA 3QFJA 4GQ9H 3A67L 4YZFE 5DD6A 1CDUA 5C07E 5IJVA 5ESVB 2W65B 3ZKQD 1Q9OB 1KENL 2VZTA 4IJ3C 5BV7B 2ARWA 3I75B 4G42B 4XAKE 5JLZA 4OD2B 2CRZA 1IKFL 4KZDL 4Y4KD 5DZLA 3OJDB 1H5BA 1KBGH 2BVTA 1X5ZA 4JRYE 4YDVB 4AY0A 4F58H 3MRNB 2VISB 4ODHH 3OKEA 5GHWL 1C16B 3LIZH 8CGTA 1U91A 5HHPB 5FA4A 2HKFH 5AZEH 4KKCD 5F6IB 3KLAB 1JYVA 3CX5K 1MRDL 4JG0L 4HWUA 3O2VL 3PIQA 4N0UA 3BZEB 1B0WA 5F7KC 5TDPB 2V5MA 5L2KD 2VR9A 2CR3A 4Y0GA 1REIA 3BKJL 4UV4H 5ITFB 3VFTA 5GS1C 5J13B 2QKIA 5F89B 2NY1B 5D1QC 4J6RL 5HHQB 5KVGH 1RSFA 1CDCA 3DRQA 5AYUH 2X7LA 3HI5L 2CLRA 3ZKXC 2Z8RA 3CC5A 3BJLA 2PO6A 1EVUA 1YEJL 2CD0A 3BIKA 2HN7A 4NIKB 4OZ4B 1E4XH 1JGDB 1QFWH 3QDGE 3D85B 3RUGA 1QPXA 4ENED 2B1AH 3EYSH 3P73B 2BNUB 5HYJB 3UCRA 5EORH 4DTGH 3WDJA 4XC1L 1MI5B 3IKCB 3ZMRA 1P4LA 3GNMH 3VGBA 1S7SB 1JYWA 4MB3A 4NNPH 1LHZA 3GSOA 4J3SA 3GSNL 1YEEH 3B6SA 1YYMH 4PJ7E 1M6OB 1MCRA 4U3HA 4QF1B 1MJJA 4UQ3B 1S3KH 2D7MA 4M62H 3PGCA 4AG4L 5CGMA 4NM4H 3S37L 3JV6A 1ITBB 3UO1L 5HD8D 3I6LE 3ME0A 5FYKL 1P5VA 3WXVL 2FX7L 3EYFB 4XT1C 5HYJE 3RVWD 4FN0A 1GGCH 1EXUA 1AIFA 4PJXB 4UMGA 2WAHA 4JRXB 1G9MH 1Z5LA 4K7FB 1X7QA 4XBEH 2V7HA 3DXAD 3BN9C 3LKQB 4FQQB 5ANME 5DJ2A 5E8NA 4FABL 4FTVD 4NP4L 3WLWD 5GRUL 1T6WA 3OKKA 1CZ8L 5L9DL 2OLDA 4EVNB 5DC4B 3PV6B 5I17B 1ZVSB 3K2UH 1ZT4B 2X4TA 3KNBA 3UPCA 1QBAA 5CMAA 1QYGH 4PJ9A 2JK5B 1HI6A 4G9FE 5EUKB 4L3CB 1TJGL 4PGDA 5IHUL 2PN5A 3HR5B 3C5ZD 1BJ1J 1QRKA 3CSYA 3HUJB 3IJHB 1E27A 3B2VL 5IOPA 4JRXA 4L8DA 4EI5A 4H1LB 4EQ3A 1MCKA 4ODTH 2N7AA 2HRLA 2KDGA 3IT8D 3FB7B 1QFOA 1A4KA 3D39A 4HW6A 1WWCA 1S9VB 3NPZB 5BOZG 1CI5A 1B0GA 3MV9A 3ARDD 1TXKA 4P3CH 8FABA 5DMIH 1NQBA 2R1WB 3HMXA 5I6XB 2W59A 5CD3B 1BLNB 2D7TL 3KXFA 4J3VA 3TIEA 3FO9A 3QCUH 1W0WB 5DEFB 1HYSD 3DVFA 3ZYIA 2RCSL 4LSRL 2ZPKL 2J3SA 1LE5B 3NVQA 2FJGB 3L7EB 2E7LC 5D7SH 1YQVH 2NQCA 4YJZL 1MWAH 5I2IA 4GG6F 1GH7A 4PRHD 3M1BB 3IJHA 5F88B 4CNIB 1J12A 3A6OA 3PNWA 4GW1B 2YD1A 2L0DA 4JQIH 3LS4L 3QIWA 4XBPA 1NCUA 2CIIB 4MJ5B 3GSRA 3S3JA 4H25B 1RVFH 2BY0A 3T2PA 3WDIA 5C0DB 2VLJA 3K2MC 1XF2B 5IK3B 4R4FL 3TA3B 4P2RB 3W5NA 1IC4H 5J06A 1ED3B 4P4KC 5C0CA 2P7TB 1CFTA 3O6ML 1U8KA 3J8F7 4J8RB 3VCLA 4ENEC 1GAFL 3RWJA 4K2UH 4MCYA 3DVIA 4WW1B 5HI3D 1TMCB 4S1SH 1K8DA 5DK2B 5J11C 4D9RE 2IANB 5CJXA 4DKEL 2GJ6A 4M4PA 4YE4H 4I0PB 3RTQD 5E94A 3LRSB 4HPYH 1AQKH 3GSWA 1BFVH 3A6CH 4G6JH 1CG9B 3VXPA 3KLAA 2D0FA 2PYEB 2DWDB 1OAXH 2E27H 1BFSA 3NH7H 1HHGB 4OQTL 2ZOLB 4JFED 2ZKHH 1JI2A 1F3RB 1JMXA 1U8KB 3BW9A 4KI1A 4B53A 4LKCA 2W9DH 3LEVL 1MLCB 4CUCA 1DBJH 3FN0L 4NJAL 3VXRD 4BQ8A 4MJ6B 2X7LB 5DJ0B 4MXQD 3LOWA 5KN5B 1T66C 3QIBB 2Z91A 2EYTA 4TUOA 5MERB 2J8UB 1KELL 5FECA 4RFOL 1LGVA 4MDIA 4LEXL 4GLRI 4Y4FC 3F12B 4N8PA 3FRPG 5FM4A 1NC4B 3U82B 4HWEH 5TE6L 1HXMB 1PLGH 1VFMA 3CXHJ 4JFDB 3B5TA 3SGEI 3CLFL 2UWEE 5IF0B 5BV7H 1U92A 4QCIA 4RFEA 4TTDD 5GJTL 2EEBA 3MRJA 4JFPA 2ICCA 3D3VA 3LAFA 4J3WA 3RNKB 1IGIL 1R6VA 4MSWA 3MOAL 1P4IL 3KNBB 4RGNE 3VFGH 5KSVA 1WIOA 4IM8A 1QUNA 2BSTA 3C6SB 4N9GB 1A3LH 3M07A 5IJVB 3TIDA 3WHXB 1VGKB 3HC0A 1R24A 3DSNA 3WD5H 4M1GH 1IRAY 4MQXC 4U1NA 2F8OA 4HUNB 4Z95L 5HVFB 4M48H 3MRBB 5DUBB 5E9DE 3DO7B 5C09B 4FQQA 2OYPA 1KCKA 2FATL 1GXEA 4U05A 2BVQA 1HEZB 3BEVB 2N4IA 3FFDB 5F7EH 3QG7L 4FXKB 2Q86A 3IDIB 4NQDA 4PLKC 2H32A 5GGRA 3Q2CA 3C6LB 4IMKA 5FKAA 5IBTH 1N4XL 4PP2B 4JGJA 5F3HB 3EOTH 4L3AA 1IEAB 5HTSA 2HMIC 1EHNA 5CGTA 5BXFB 4LSVL 3CSPA 3OGCB 2D0GA 2C1OA 1LP9F 1OAQH 4XP6H 3UTSE 1WTGT 4K23H 3I50H 1G7JB 1CDHA 3QNYA 4H20H 1OAKH 4F7TA 3TN0D 3T65A 2DQCL 5EFIB 3VI4E 1IL1A 1BZ7A 3DX6B 5AZ2H 3SGEH 4LHUB 3GMQA 4P3WA 2OK0H 3PJSA 3HAEA 5E5RB 4JFFE 2NX5D 3ARPA 4Z7WE 1WLHA 5E6IC 3BH8A 2VZ1A 1R3LB 1FZJB 3PWUB 5GS0H 4QRRE 3CZJA 4YBLC 4LNRB 1EFXD 2JIXD 5HHME 5J12B 1BX2B 4ZTPL 2AV7A 3CCHA 3EJJX 3O4LA 3EDDA 3AXLB 2C5DC 5D2LF 4HD9A 3C6LA 3KPPA 2NW2A 3EAKA 4HKJA 4Q0XL 1UENA 3RGVC 3REVB 4XNUH 3O45B 5D1XC 4EDXA 5FYLL 1N4XH 1G6RL 1NCDH 2DTMH 4OIBA 3EOBA 2FO1A 2P1YA 5IW6A 2WZPD 1FYTB 5KSBE 2WUBL 2ZJSL 1KG0B 1TZHA 2O26U 4LNRA 4X8XA 3T08A 4MJ4A 2AQ3A 4LP5A 3MRLB 1LO4L 1KN2L 1I1AC 1KJ2B 4P2OB 4M7JH 2AXFA 1A7RL 2BY2A 1AR1D 1IQWH 5E8PA 5LQBL 3PJSB 3OX8B 3CFJB 4FFWC 1HQRA 2ZSVB 3VRLE 4NQVA 4WNQB 3MACL 4H1LH 4W70A 1LO0L 1JZ7A 2XXMB 1UADC 2JF1A 2WUBH 4AIXA 1CLYL 3HS0B 1H5BB 5C08A 3ULUH 2FR4B 3LSOA 1UWXH 4XPFL 1I8IB 1TIUA 5C0IB 4X80L 2DBJA 2XTJC 5JW4R 3HG1A 5L88L 1S5HB 3C09C 4PUBL 3CXDL 1NAML 3W39A 1ZLWK 1V8HA 2DIJA 4ZMAT 4FQPA 4OFYA 3NACL 2WWMD 3RNKA 1CL7L 5JHDA 1F4YH 4R8WL 4TQEL 5D7JC 3ARGB 4AL8L 1DFBH 1MCOL 4PJDA 4WFFD 5I1KH 3L5XH 3V6BR 3CMOL 3K7UA 3K1DA 3KJ6L 3DV4B 1ZT7B 2JB5L 1KULA 3QXAB 4YH6A 4JY5H 3K0WA 4TUKH 3DUHA 3ULVD 5AAMA 1YEDA 4EI5C 1CS6A 2P48B 2APBA 4AIZB 2OK0L 1T5WB 1B2WH 4G7VL 1F3JA 3ZT6A 1EO8H 3BSZH 5E2WL 3GMNB 4ALAL 4MXWH 4YFLF 5IQ7L 2HWZL 1X5AA 2C3VB 3P4MA 4RWHA 1RULH 3DARA 4PRDB 4X6FB 3TEUA 3IS1X 1XCTA 4ODWA 4XP4H 3FT3B 2W60B 4L5FL 3P9MB 4EUPA 4A6YA 3FQXB 3VDCA 4XMLH 5E6IB 4J3TA 4I9WD 5KVEH 1AQKL 4ZOCA 2VDLH 4RGND 1JVKA 4JM4L 4X83A 2ZCKL 3IYLW 2MQ0A 2YKLL 4TSBL 4UZGA 1FZKB 4P2RD 1T2QH 5BO1L 2Q87A 1MCHA 4GUPA 2VDKH 1YEDB 5HGHA 5F7UA 2OX5A 2DWDA 1NAMA 1KCSH 1T0NA 1VESA 5KSAA 1S7UB 3OZ9H 1IAIL 2WINB 4XNYL 3NFPB 4Z7UA 4HC1A 5E94B 4LSUH 2ED9A 2I60L 3QEQB 4YFDB 5CGYD 5SX4H 3VWKC 3I3DA 4YHYC 2PYEE 1JE6A 3TT3L 2Y6SD 3TFKC 4LVEA 4RAHA 1HH6A 1RZKL 4JM2A 3ZE2F 1CGXA 4NWTL 2C4FU 2EIZA 2Q8AH 2AJXL 5IROA 2V7NB 3F5WA 3PQYA 4FFYL 4ZQKA 4DKDC 4GRLB 4N1EA 2IQAA 3UTTB 1A3QA 4RDQF 4GUPB 5SX5K 4PG2A 2YD9A 2FIRT 3ARDB 2RCSH 5C0BA 4XCEB 2H26A 3OWEA 4F57H 5CSGA 4LRNH 2DQFA 5BZDA 3U4BL 3ECBA 1R3IL 4KVNL 1ZLVK 4PRID 3L5JA 4UILH 4XWGL 4XXCA 2AABH 5CKAA 3CPLB 4ODXB 5IV2A 3NA4A 1FL3B 3MRIA 1MCIA 4OZGA 1DVFA 3H3KA 5DD3H 4G8IB 5J57B 2ESVA 1ZHNB 4JFXA 4R2GD 2IALB 5KS9E 3WMSA 1QFWI 3GMMA 3V6OE 1UC6A 4NZUH 3B2UD 4JAMA 1QVOA 1A6TA 2IAMB 1II4E 3LKSA 4NJAH 1Z0MA 2WBWB 4MAUL 1B4JL 5DVOA 1DBJL 5CBEA 2NTFA 3TV3H 1T7XA 1DN2A 1I3VA 4KGLA 4RNRA 1UM6H 5ALBL 4U7KA 4PR5B 1D6EB 4FQ1L 5FUZL 1NBYA 3BPNB 4U49A 4NYLB 2PKDA 3Q1SL 3PUCA 5IMMB 4JCLA 2NY7H 1W0WA 1VGEL 3M17B 5FDWB 3A6CL 2EKJA 1ZWIB 3UTTD 4PJFF 5IVOA 1OF2B 1U8JB 3OKMB 3NCMA 2X4OA 4YHZL 1KGCD 5KVFH 2FX7H 4N0YL 1FL5B 4S1SL 4XCFL 2Z4QB 5SV3A 3PGDB 5GRVK 4ZS6C 3S37H 1Y18B 5CSZA 1EEYA 2D7NA 2O93L 1LILA 3P9LB 5AYQA 3PL6D 1G7HB 4NSKB 1HHJB 1KTDB 4C58B 2WBJC 2YMXH 4HIXH 4FQHB 4OF8A 3ARZA 1FFNB 4LMQI 4DFHA 3U36B 4OI9A 5SV4A 1MCEA 1A22B 1U3JA 3MUHL 3X3FL 2ZUWA 4OLYH 2XZAH 4LLWB 4P2OD 1S7VA 1G7PB 4RAVB 4P2OC 4L8BA 1CFVL 3OKKB 3SGDI 2B1AL 3EYSL 4HT1L 1YQVL 3RWIA 1PFCA 1CDIA 1TETH 5T1MA 1IM3B 3QNXA 4WFFE 2ZOLA 5DUPL 3DMMD 5IVZB 1BQLH 4PJEF 4M00A 4URTB 2KH2B 1JGLH 1NBVH 4PJ9C 3QWOA 3U2SB 2CQVA 3LVEA 1T7WA 5ETUB 2D7TH 3IB4A 5FM5O 4U1JB 1CFSA 1BJMA 1D5XB 4IS6B 5CZXC 5I8OH 3RDTA 1S7TA 1IC7H 3VWJC 1W8NA 1TFHA 2HYMA 2YN5A 1SJXA 1Z9LA 1J11A 1NPUA 1Z0NA 1L0YA 2PXYC 1CTOA 1HN1A 1KJ2H 4PRDA 4X6FA 1BVKB 5CP3H 5C9JB 3DRQB 4PLOB 1M1SA 3GSVA 2EZ0C 4CBPA 2EIZB 3LN9A 4GH7B 4O2CB 5AZEL 3RIFF 3BIKB 3CFKA 3OMZA 3QWRA 5CJOH 3MJ7B 3FT4A 2YHGA 5FM8A 4XX1G 4H1LG 5E00A 3PQYB 2BY1A 1EV2E 4LHUD 4J4PA 3RVVD 3EOYG 2H6PA 3L5IA 1A6VH 3CU1A 3U4AA 3RGVA 4M8VA 3IU4L 5DSCA 2DLIA 2I9LB 4X7CC 4ZXBC 2VDOH 2O5YH 3UAJD 3GGWB 5F9WC 4MNGA 1KENH 3KXFD 2AJ3A 3TH4T 4OD1H 3EDFA 4X4XB 7CGTA 5TDPA 4Z7VB 3MA9L 2VDML 4H26A 5EIQA 4HIJB 3Q1SH 2P5WA 5L0QB 2CMRH 1X3DA 3QEQA 4XGZA 5SWSE 3UTZA 1MRFL 4Z7VF 5DMKB 2H32B 2PW2B 4JY6A 5GGRB 3PL6C 3K46A 1F4HA 4PGEB 4LF3A 4X6DF 4PJ5E 1T03L 2DI9A 4NWUL 1FYTE 5C08B 2FR4A 3PWPD 5D5MB 1BD2B 5T33L 1FN4A 1V05A 4FQIH 4Q6YA 2ERJC 3GK8L 3UO1H 4HF5H 3W9EB 4OZFA 3IGAA 3WLWC 3G5VA 4AG4H 1AGCA 4JO4H 3QUXC 1S9WA 3SQOL 4I4WA 4B0MM 5CJXC 1NMCB 3U46A 4KROC 3VW3L 3WNOA 4NNYB 1WAAF 1YN7B 2P5EB 3DPBA 2A6KA 1Q1JH 4XPBL 1OTSC 4QOKD 4BH7B 5KW9H 3QXAA 2OJZL 3TO4B 4ODXA 1NMCC 5EU4A 4XWGH 4HLZH 5F1KC 3C5ZC 2FWOB 1RZKC 4YEEA 1RY7B 3MCKB 5JORB 1BREA 3V9FA 1RI8A 3I9GH 4OZFH 4HDIB 4M1CC 5DURB 3ZHLA 1KNOB 3AXLA 3ZHKA 3RWHA 3T1FB 3O2WH 1JJUA 4M61B 1CFQA 4JFDD 5KVGL 1ZSDB 4JFEA 1LEGB 2VAAB 2Q8AL 1XGPB 5CINL 2DJ4A 1OSPL 5IFAL 3P11L 1MNUL 1OT1A 2GAZA 2GK0B 5I1LA 2VXTL 4PD4K 4RZCA 1VKXB 4LSUL 6FABH 1DN0A 2I26N 4ZNEE 3G5ZB 2G75B 2DJSA 4HHAA 5C6TL 2AXFB 1OW0A 3O9WB 1VCAA 3JV5A 1JHTA 3LQMA 2ICES 1KCRH 3LN5B 1N8ZA 2PUQT 4QHUA 1EJOH 3SKOB 4YLQT 4EI5B 4FZ8H 5TPWH 3QQ4A 1FNLA 1DBMH 4M43H 2ADGA 2YPKB 4JG1H 3SCMD 2A83B 4IDJL 1JPST 3RP1A 5E1AA 4MA8H 4F9LC 1BGXL 1MFCH 2CJUL 2X2YA 4QYOB 4U1MB 2ERJB 4OLUH 1B6UA 2D9CA 3ARYA 4OCMC 4EZMA 1OP3H 3RWIB 5JIKA 3BSZL 4ALAH 5IQ7H 3AMKA 2V2WB 3LEXB 5EO1B 4G6AD 4DZBA 1RURH 5MP6H 5A43C 3SGKC 1K4CB 4WJ5A 5EBLB 3EYUL 2XT1B 1J8HB 1VEMA 2PW1B 2AEQL 1SVCP 1A21A 1R3KB 4K55A 1XGTA 5F3HA 2NYYC 4QRSA 1D5IL 2AK1L 1RJLA 4X9BA 4JB9L 2J8UE 4NQDB 2FHCA 2H9GA 2KPNA 1ULVA 3TBWB 4U1IA 4Y2OA 3SKJL 1IMHC 5I6XC 5MEND 2HJLB 2DKMA 4QWWD 3L3OB 3MRFB 2FRGP 3BDXA 1N2RB 2YZ1A 4EI6B 3QXDB 1S9KC 3LQAL 4XCNA 4P46B 3CDGA 3MV01 1URLA 2C1OB 2IFFH 5I30H 4HS3B 2BNRD 4LOUC 2Z9TA 4WO4D 4EN3C 4O00A 1A6TB 4NFBA 5LWYL 3HG1D 1P7KA 4DVBA 4MNQA 4LASL 3P2TA 4JN2B 3QIBA 4LLMB 3RY6A 4O51A 5JZ7D 4R0LA 2ZWLT 2BVUA 5LGJA 4Z7VA 5GGVY 1H8NA 3V4PH 4KMTL 1S9WB 2A2QT 4GRMA 1FBIH 3EYQC 5DDHA 3DVNA 5DD1H 1IEBA 3C60A 1NCAL 3WKNA 2P47B 1CDGA 5HHNB 2P49B 2KZ1B 4JPKH 43C9A 1MY5A 4C4KO 3IDYB 1WCBA 3EKCA 4OLWL 2HT2D 3B8SA 3D2UD 2B4CC 4OZGF 4BFEA 5FGRA 3GHEL 4MDJA 2WWKT 3BKCL 1HH6B 4A6YB 4HJ0D 5E5MA 3L6FB 3O3EB 2J7LA 3ZTJH 3WUWB 5F8RC 1OGAE 4C55A 4Q0XH 1NGQH 4LHUG 4NKMB 3WHXA 5GPRA 1TJIH 1QLFB 2HTKC 3G6DL 4Y5XA 1WBXB 5ERWA 5DZNA 2VO5A 4IEFB 4MX7A 4ONGL 1RU9H 5HPOA 1FLTX 4GLRH 1FSKB 1W72L 3MV8E 1XGQA 1UGNA 1ZLSH 3OTTA 2QQNH 4JHBA 1AGFB 3P0VH 2X1QA 1T83C 5IF0A 4I1NB 5HHOA 4P57B 4MJ5A 3T77B 5DTFB 2X10A 1JF1A 3BMWA 5FV1L 5T5FL 1EJOL 1CFSB 5EO0B 2G5RA 5IB1A 3WUWA 4C56B 1OAKL 3ZYOA 1J05B 2IPKA 3SCMC 1TQCB 5GGTA 1ZANH 32C2A 4QY8A 4MDJB 3RGVB 2EDWA 4LCWA 3INUL 3S88H 4YHNA 3MBXL 1TZGL 4X6DB 5D1QB 4LQFL 3LKOA 1IM9A 3V0WL 4PY8I 3SY0A 5JPNB 3RWJB 3QO0B 4JO1H 2QL1A 2YRPA 3C08H 1J88A 1MVFA 1UJTA 3MUZ1 4HC1H 1CG9A 1YQ2A 3WS3A 5FOBB 4JQVA 1NGYB 2X89A 1HHIB 1OD9A 2PXYA 4OJFL 4WTZA 1DUYB 5EU3A 2R2CA 1I7ZB 1G1CA 5CWSA 4PTTB 1UQSB 2C3VA 2R4RH 4K71B 2GITA 4CMMB 5AUMB 1M05B 1FL5A 3FZUC 2D4DA 1QFUH 1OM3H 1JFQL 2PCPB 1JWMB 4OGYH 3VGAB 4MXQC 2E6QA 2VR4A 2YD5A 1CT8A 4ZXBA 3M17A 5SWQA 3V6OC 2ATKB 3RX7A 5TFSH 2WSKA 1J10A 1MFAL 4Q7DA 2XOTA 4DZ8B 5I71B 1VADB 1UA6L 2KUTA 3CLFH 4BUGA 4PJ7B 3QYCA 2EEAA 4Z7OE 2YD3A 4QRSB 4KVCH 4Y5VC 3SE8H 2Z35B 4JO4L 3T0VA 3T1WA 1FZOB 5BVPL 2HH0H 1IGML 5GJSL 2R0WH 2VAJA 2MOVA 4R4NC 1NGPL 5EBLA 5T33H 1OTTD 1KT2B 3S5LA 3DUUA 1AQDA 5IB2A 5I1HL 2O5ZL 2X9XA 3KS0H 4Y5VB 3QIUA 4WU7A 4AQOA 1V3KA 1HH9A 3B9EA 4KY1L 4K3EH 4PJFB 2CMRL 3CFDB 2APTA 3ARFC 4JFFA 5EIIB 5TE7L 3QUKB 2HJKA 3KLDA 3JZ7A 1MCWM 4JM2D 1T6VN 2VDOL 3QHZL 1XR8B 3QUZA 4CN6A 1NFDF 2X09A 4HFWA 4OB5H 2OP4H 4XXCC 3QT2A 4NN6B 2VZSA 2QADB 4M6NH 3UJIL 4YR6A 5F1OB 3DMMA 4YQXL 1CVRA 4MHHG 5EBGA 3SQBA 2DQFB 5BZDB 1ZAGA 4M3KB 3OKDB 2QQKL 4PJCB 3B5GA 4MJIB 5GGTH 3H9YA 1HEZA 3MCG1 3OKNA 1KJ2L 4QXUL 4HUXA 1VFUA 5F7DB 3V5KB 4U1KB 3GMLA 5DMJB 1AE6L 4OZGE 5L2KB 2UZXB 4QF1A 4MA3B 4XCCH 3IXTA 5JNYB 4NQDE 1IC5L 4WUKH 2UZIH 2WBJD 5CJQL 4JFOB 1EAPB 2UWEB 2ZSWB 4ORZC 1CIDA 3QDME 4KKNA 3VXUE 3CH1B 4FFVD 3V6ZB 4BKLA 5GS0D 1JK8A 5C6WH 1GPOH 3FT3A 4N8CH 5F72S 2D3VA 5DUPH 4ZDHA 3SO3B 4Y1AB 3L3GB 1Q94B 5E03A 1IBGL 1CFNA 1NCCL 2QTEA 5LAXA 4ETQB 5JW5B 3BN9D 5DWUL 1IAKB 2AEIT 3WFEH 1G7IB 2DAVA 1U3YA 4LCCA 3O2DL 3VXSB 5DRWB 1F45A 1H3PH 2IMMA 5EZIL 1MWAL 4NCC2 4S1QL 3VXTA 5D7IF 4KK5D 3SKMA 4DGIH 4PGEA 3WV0A 4X4ZA 4APQC 4R4ND 5FYJD 4NGHH 5DD0H 2APWA 3N1PC 3VA6A 3CVHH 1KIQA 5I75B 3UTPD 1UWEH 4KJWC 4OTXL 2I27N 3HNSH 3QISA 4XPTL 4X4XA 5HDLA 3VG9B 4HZLB 3QHFL 2XFXA 1BIHA 3S9DB 4GO6B 4KRPD 4I77H 1M7DA 1NSNL 1KFAL 5ESVA 2P8MB 1CD9B 4XCCL 2FBJH 3E8UL 1KCVH 4P9ML 4D9QD 1AE6H 3WEXA 1EGJA 1UZ6F 4QXUH 3F58H 4ZFGL 1YZZA 3MCKA 4N0YH 1RK0A 5JORA 3I3EA 3ARBA 3ZDZE 2JCCB 3LQAC 1DUZB 3HMXL 3RWHB 4Q9BA 1LD9A 3RRQA 1RJZA 2GHWB 3VD7A 5JHDD 2HRPH 5D93C 1CFNB 4GXUN 2JJVA 3QA3B 1FSKC 4FQJL 3QEHB 3QHZH 1XGUA 4LBEA 2IBZX 2GITB 4PJ9D 4BH7A 1K8IB 1A9BB 2F58H 1C5CH 4L1DA 1AFVH 4NZTH 1KJVA 3KPQA 3KPRE 3O3AB 1U93A 3C8KB 4QOKA 3BGFC 1A9EA 3QPQD 3D87B 5DVKA 4PV9A 3I6GB 2Z92A 4U3CA 4OM1H 2X4SB 4Y19E 3P77A 2EEDA 3W11D 4OIAA 2FB4L 3VD3A 5LG1A 1NFIA 1LK3L 2HH0L 5H2BA 1PDKA 2FBJL 5H35B 1IQDB 1VACB 4JHAH 2V9TA 1SBSH 5E1AB 2E7MA 5B3JF 4QNPF 3VWKB 1XIWB 3SGDH 4D0BA 1EEQA 2W0FB 3FHAA 3LDBB 3UTSD 2OL3B 1UWEL 1OHQA 3GSOB 3QO1A 3UZQA 5CBAB 4A6YH 4PJ5D 2AW2A 3EJYC 4ZFFB 4NO5A 2F53D 2BHZA 3DI3B 3ARFA 4RMUA 3SJVE 1T7ZA 3GB7B 3MROA 4NO2A 1F00I 4HHAB 3LH2H 5HHOB 1DLHB 3L95A 1JGUH 4PJ5B 2DM2A 1WBYB 2HAZA 3VXRB 1C7TA 1EAJA 1IBGH 4MAYD 4G9FB 4WWKA 4WI9A 3U9PH 4JDVB 1NCWH 4JVUA 2BERA 3EZJB 3HNVH 5CD5C 2FECI 3W82A 1YNTB 2AV1A 3W2DH 5AYUL 1JF1B 4MLSA 4U6XA 3BOVA 4NSKA 3T2NH 4K7PH 3OZ9L 2VLRE 3HAEB 4HUUA 3CSYB 1VFOA 1NEUA 4UT9L 4WHYH 4DEPC 1FCGA 3C08L 5D1ZA 1FAKT 3RL2A 3EFFA 1B0RA 4ERSL 1TZHB 1FZJA 3CH1A 1A1MB 1T2QL 2VOTA 4G6FB 5KOVC 1D7FA 3TO4D 4O9HL 2UV3A 1EHAA 4JRXE 5ID1B 4JG0H 4RAVA 5A2FA 4JFHE 1YJDC 4GAGL 5B22A 5CEZD 5ADPH 1QLEL 1ZANL 1JYNA 3PGFH 1ORQA 4YQXH 4F7MA 1UH4A 3DMMB 1U8OA 2X4RB 3C09B 4L5FH 3GJFK 3QUML 3MRRA 5E0QA 3UBXB 1PSKH 3REVA 3QULA 2L4OA 2R8SH 3PWNB 5IKCA 3MQIA 1PKOA 3QIWB 2OP4L 4ODHL 4PTTA 3I6LD 2J88L 3RNQA 5GGRY 2GT9A 2I07B 4HJGA 5GRZA 3UXFA 4JPIB 1ODAA 2YXMA 3MGTB 3CLEL 5F1SA 4LLMA 3PWPB 1NFDA 5DHXB 5M7QA 5F6HI 3P0VL 4ELME 3MRPB 1MJUL 3R8QA 4UIMB 4KY1H 1CL7I 4WWID 3Q6FA 4HLJA 4JDZA 4KK9D 5ITBL 1BOYA 3OHXB 2XZCH 4RRPG 4OFDA 4HUWB 2IADB 4J1UB 4RZCB 3AROA 4XHJC 3GBMH 1M7IA 4UQ2A 1A1MA 1I1AD 1J0KA 3CXDH 3DETD 1S78D 5ESQA 1TJHH 4KDVA 5IV2B 3TYGH 3D3VD 4PJ7A 3B8YA 3ARBC 1MLBA 5GSRA 1GOFA 3HNTL 1SY6L 3VGGA 1MFAH 1X4YA 2FZ3B 1I9JH 1TLKA 1F3DH 3LKQA 4DKFH 3H7BA 1BVZA 1VPOL 4X99A 2E7CA 4PJCF 3WFZA 3QDJB 4NZRL 2VDNL 5SX4I 4P46C 4EN3D 1P4BH 1MJJB 1JFQH 4NUGL 5SWSD 3GSVB 3RHWF 3V4VL 5DJ8A 1NBQA 4OGAC 2IPKB 1KPRA 5JOFB 3TT1H 1S7WA 4N0RA 5EU6A 4I5BA 3U30C 4WEMB 5LWYH 3T8XB 3OB8A 1R0AH 4LDEB 3U46B 3IDJA 3BEWA 2WINA 1ORSA 5I15L 4LAJH 2NW3B 4C56A 4PG9B 3TA3C 3O45A 4MMZC 4GSDL 4YPJA 2X5PA 2QJDA 5HHVH 1Q9WA 4Q9QH 1ZV5A 1Z6JT 2DD8L 4A2LA 3BZDA 2WV3A 4WI7A 3GJEA 3MRHA 2HA1A 5I1GH 4IRJC 1P5UA 3C87A 4OUUA 4E0RA 5K59F 4YX2L 1D5IH 2GJZA 1ZA3A 5HXMA 4GRLA 3OGOE 1FZKA 3QQ9D 1TTUA 4Z5RA 1Q0YL 1WIUA 3QQ9C 4KXZH 5K9OA 5E08L 5HYSB 1DSFH 2YEZB 2BRQA 4N0UB 4NQCA 3VMOA 3T0AA 3EYVA 5JXEC 2M1KA 2AV1B 1S5IH 5JW4Q 1N59A 4NO2B 1WFNA 1OOAA 1INEL 1OL0A 2EO9A 3O41A 3NGBC 4TNVF 2ARJQ 1LE5A 3MLRL 3WN5C 2NY6B 4L8CB 3L1OL 4H20L 4JVWA 4ZUUB 5D6CB 1GGBH 3F65A 1DVFC 1A1NB 3FO9B 3O6FB 3RWGA 3EO0B 4P2RA 1BJ8A 4QTHB 1J7VR 4PS4L 4U1GC 3ARBB 1X5HA 5F96H 5EZLA 4NQEE 1F8TL 4UT7H 4OT1H 1IAOB 4PPTA 5KTEH 2W07A 4LSSL 3DV6A 3TBYA 3VFMB 2BNQA 4BZYA 4QO1A 3BKML 4N9OB 4U6TA 3WNPA 3RFZC 4RA3A 4QRQB 4F7CA 1OD7A 3W0WD 4KTEH 4F2MA 4HKZA 4MQTB 3IAGC 5IHZA 2FJFB 1YNKL 2VLMD 2WQRA 3MFGB 1RFDH 3TJEH 4MWFA 4XHJD 3IF1A 3LZFH 3WDHA 2P7TA 3NCFB 5HDOA 3WD5L 4EN3B 5DFVD 3VJ6A 1CGSL 3PWPE 3S36X 4JRXD 4MZ3A 2GT9B 2I07A 1C7SA 1D9KB 3DURB 2AJUH 4G8GD 1F4XH 4JN1H 2D2OA 4LNVA 4X5WA 5DJYA 2FEEL 2VE6A 2ZCHH 4JKWA 1RHHA 4LBEB 2NY3C 2V7HB 4GXVL 5JDJA 1ZTXH 4HXBH 4JFFD 2PTUA 4PJGA 4U33A 3FOMB 1JWUA 3EOBB 4MA3A 1W0VA 2VXVL 2OJZH 3AREB 2A74B 1G6RA 3H3PH 4ZUTB 1Q1JL 1JNLH 2CH8A 3SDDB 3SE3A 1A6UL 2HT3C 4WI5A 4MJIA 2FGZA 1KF9B 1NDMB 3RL1A 3I02B 1LO2H 5E8PB 1UG9A 3NABL 5DJ0A 4Y4FD 2EIDA 1K2DA 4GXUM 2ZSVA 4L8DB 1JWSA 3BGMA 5KSUA 1DP0A 5EOCL 2HLFD 4NWUH 2GEEA 5DRZB 2DWEB 2F53E 4I2XE 3BZ4B 4KDWA 4F15B 3OR6A 5E56A 1FNSL 4QRPE 3QI9C 4L9LC 4DGYH 4LGPB 2HN7B 3L3KB 3HB3D 4Z77A 3DO7A 4MD0A 1DBML 4M43L 2R29H 3L3DB 4N90D 3V6ZA 1T4KB 4YAQA 1H0DB 1DBAH 2IJ0C 3BI9X 4NQCE 4RMSA 1EHXA 1G7MA 3HUJE 4YE4L 3CX2A 3D0VB 3IU4H 3RTQA 5E2UH 4ZSOB 4RISL 4Y1AA 5HYJA 5I19L 1LEGA 2VAAA 3GBNL 4YBHA 5DK2A 3KR3H 1EBPA 1JGDA 1QOKA 3AVEA 3GBLA 3QCTH 2GJ6D 3MUY1 5BJTB 3I02A 4GJTB 1BZ9B 3FB8B 3RVXC 3IFPA 4OCSH 4O02H 1MEXH 2YWYA 2R15A 3FHQA 1MQKL 5C2BL 3QZWG 5EUOE 3JUYA 4BFIB 1S7RA 4NQED 4OZIE 3H9HA 3LS4H 4LPYA 5HI4C 1BZ7B 1I1CA 3RX5A 2OL3L 3RIFK 3ZKXB 1JF6A 1N6VA 4YHYB 1OAYH 1A9EB 2GFBA 1NBYB 5HHMB 1IEAA 3RUGE 4HMCA 3GKZA 1P2CB 2OZ4H 1CF8H 4XP1H 5AD0A 2CLVB 3CFDA 3GO1H 1U6AL 3BXNA 3ALXA 4C83B 3FFCB 4F8TA 3T0DA 1D5MA 4OM0L 2Y36H 5IG7B 1S9YA 1QSED 3BPOC 3PWJB 1U8JA 4W4OC 3FB6B 3EGSA 5IESL 3OHXA 3P4NA 2XZAL 4OLVH 3U30B 1P7HL 1GOGA 5KN5A 1IGYA 3PDOA 5IB5B 3WJLC 3BN3B 1Q0XH 3F7YB 3OAZK 4JFDA 4OZIA 3VFNB 3TZVC 3TWCH 5DJAA 3U0TB 3ROLA 4HUVB 1O5DT 1U92B 2I24N 3AM8A 3VFUA 5F89A 2ZG3A 5MEQA 3ZDXF 1J8KA 3D25A 1PKQB 3UJJL 3QG6B 3HB3C 1TZIA 4F2MB 3KS0J 2P5ED 3IDGA 3KYNB 2AQ1A 3NN8B 1R24B 1I9IL 3D18B 3BRFA 2FJFA 4U1LB 1K5NA 3WKMH 4JFOA 3GHBL 1P7QB 5F97E 4G6KH 4H8WL 3QFJE 1QFHA 1CBVL 1OAUL 5DK3A 1VA9A 4FQXC 2R69L 4E41B 4KKAD 4IS6A 1U8LB 3IDJB 2OI9B 3BP7B 1MJ8H 4XXDB 5FYKH 4FHBD 1RIVH 1Y6NR 3MBEA 2RGSA 2H3NA 3PABB 1K85A 5I8EB 3CFEA 4F7EA 3F8UB 4Q9CA 2LE9A 4X5XB 2HT2C 4GAFB 1OP3K 4MJIE 5F6HJ 4LLVA 4QTIL 4KHTL 5HD8C 4WV1C 3PWLB 2ZG1A 3FMGL 2EDDA 5DYOA 4PRNB 5GISH 4GOSA 3GSUB 1IFHL 4PJAF 3BDBA 5J8OA 1GC1C 4QHMB 3TA3A 3PHQA 4YXHH 1R3IH 4KVNH 5TF1L 4HAGA 4NKMA 3TPUA 4F57L 1N0XH 3C6LD 5D7LD 1NBVL 4GMSH 4L4TE 3L1OH 3VG0H 4PLNC 4OQTA 2PR4L 1FO0L 4DVRL 1MF2L 1EDQA 1JPTH 4PJ8C 4Y89A 5EUKA 1FHGA 4GG6A 3FOLB 3UPAA 5I76A 4PJEA 5C09D 1QVOB 2IAMA 1HSBA 3GIZH 4R3SB 1YYLL 2IAND 1DVFD 5E8EA 2AJXH 5FO9A 4LDLB 4PV9B 5FYJU 3TBVA 4DGVH 1U2HA 2P45B 1X5LA 1X5FA 4PJ9B 3U9UA 4BSWB 3KPQB 2YWZA 3MV9B 2EDKA 2HG5A 4MJ2A 3HUJF 1T7VA 2E6JA 4ETYA 4ISVB 2UVEA 5CD3A 1GC1H 1YECH 3NZHH 1XCQB 1FORL 2JCCE 3FCTB 3BQUB 5LKNA 1U8IA 2VABB 1IAIH 3S98A 5I1EH 3F7QA 5IMMA 2DD8H 4DUWA 3G6AA 4Y16C 2Q6WB 3LHPL 3LV3A 5INCB 4KKBD 4MB4A 3KR3L 5BO1H 3BHBB 4F58L 2VDPH 3FFCE 4JO3H 4U0RC 1RZFL 1T5XB 5E2UL 1I1FA 3ZDYE 5DFWH 3B43A 4JM4H 3TYFA 5FO9B 4P2RE 1Y18A 5CSZB 3T0BA 4N68A 5TQ0L 3IJYA 3WS3B 4XMKH 1RD6A 4X99B 3WHE1 4G8GA 1ZGLM 4XP4L 2R56H 1NCBH 1FNSH 3O3UN 4PRIE 4R7NB 2FL5B 1F6AB 1RULL 2YUXA 1MVUB 3IKCA 3MRCB 3DROB 3S37X 5E2WH 1EO8L 4HZLA 4UTBL 4BM7A 2VDNH 5B39G 3N9GH 3O6FC 4MAUH 2Q6WA 1JZ4A 3WJLA 2AI0H 4DKFL 5D1ZC 4WI3A 2DJUA 3MCLH 2JB5H 5DJDB 1MY7A 2IH3B 4RGNC 4OD3L 4LCCB 5HVHB 5I1KL 1JNJA 2BVQB 2ESVB 2YPLE 3ZTNH 1AR1C 3FONB 3KDMA 3B6SB 4TRPL 2QSCH 1DR9A 1OB1A 5HGDA 4OZGB 5I66A 1HHGA 1NAMH 2LTQC 5C9KA 5E8NB 1E4XI 4TRPH 4HX1B 3ZE0F 3F7VB 1MI5A 1ZHNA 4JFXB 4C56E 2M26A 1IZKA 2XZCL 3IS0X 3ULUL 3ZTJG 4LRNL 3PV7A 1NBZB 3JTSA 4QRUB 3ZZ1A 4U4BA 2ZCHL 3BDYL 4JQXC 1QKZH 4GKOA 4ESKA 1U91B 3KPTA 3N9GL 5FYJL 1NMBL 2A83A 3ARWA 5GS1B 1GZQB 5DRZA 3MA7A 3I2CH 4C59B 2B1HL 1X44A 3RU8L 3CIQA 1A0QH 1U8NA 2JB6B 4PGBB 5JUEH 4TULH 4X6EB 3HE7A 3L3HA 3BGAA 4EQ2A 4PJFE 4YHOL 2VZVA 4K71C 2EH8H 4UTAL 1DQDL 2ZJSH 4J2XA 2HFEB 1ADQL 3OKLB 1HDMB 5FECB 4KMLB 1I75A 3P4MB 4WGVB 3HMWH 3QJFB 1A6AB 4LHUA 1OARL 3ARED 2VDPL 4JO3L 2NCMA 2PETA 1SEBA 4E5XA 2D7QA 4CGTA 3ZLQC 4LSSH 5BCAA 5HYJD 4UOJA 1E0OB 3JWNC 3P77B 1UZ6E 3WFBH 4ZUVB 3RVTC 1VFBA 1IGTB 5EU4B 2BVOA 1MH5A 1P9MC 3SJVD 4XNZC 4YO0A 1EK3A 1KSRA 3BZFB 3Q6GL 3B5HA 1G0XA 2AJVH 1QFWM 4XVSL 3RDTC 4Q6IB 3OV6A 4P2YA 2FDBP 1CICD 2DYPB 2GYSA 3QR2A 3IDIA 4G7VH 5IROC 3KYKL 2Q86B 2R9HC 1FVEB 2IAMD 4DW2H 4L9DA 4LMQE 4YBLB 3RA7L 4HH9A 5F44A 3S5LG 1AKJA 2DQCH 4X6CF 3NIGF 2FCBA 2P42B 4N8VA 1UWGL 5EU6D 3AS1A 2ESVD 4ZUVA 5IR1A 3ZKND 3MRQA 3O6LH 1SBSL 4NM8L 1IFHH 4LSVH 1E6JH 2Z93A 1JZ5A 4Q9QL 3PHOA 4NN5B 2CK2A 1NGXA 4GAYB 1LP9E 2NXYC 3OPZH 1CDBA 3RZCB 1N6QH 1DE4A 5EN2B