3C5ZB

Crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr b3k506
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
240
structure length
240
Chain Sequence
b'AVTQSPRSKVAVTGGKVTLSCHQTNNHDYMYWYRQDTGHGLRLIHYSYVADSTEKGDIPDGYKASRPSQENFSLILELASLSQTAVYFCASIDSSGNTLYFGEGSRLIVVEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR B3K506 Alpha Chain
publication title Crossreactive T Cells spotlight the germline rules for alphabeta T cell-receptor interactions with MHC molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Sugar binding protein/immune system
total genus 43
structure length 240
sequence length 240
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5zB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5zB02
2AXGA 4X9BA 5I1JH 3MR9A 3D39E 3HAEB 5SWSE 1CFTB 1RHHB 5D6CB 1J1OL 2OMBA 3CD4A 1JP5A 4IOIA 5EBWB 2OSLA 3WJJC 1RJZA 4EEEA 3TA3A 1YYLH 4J23A 2ITCA 3HMWH 3VI4E 2ESVB 3FL7A 4ZD3H 1RI8A 5HI4C 4WV1C 4MX7B 4G5ZH 3VXTB 3RWDB 4ZOAA 4U6XB 4PRPA 1FSKC 5HVHB 1MFCL 3MO1B 1CDUA 4OLEA 2X41A 5IW6A 1QFUH 4P2CG 4XNXH 2YD3A 5MHSD 4Z7QE 1E28B 4G9DB 2AEQH 3IF1B 3NCMA 1AQKL 2GW5A 1H8OA 5DFVD 3SDDB 4EN3C 5GS2D 1FC1A 2DQJH 1BOYA 2OS7A 1GOFA 1S7UA 1DN2A 5BVPL 1PD6A 1HQRB 4HJ0C 2APBA 4BFIB 3GM8A 2IANE 1MRCL 3ZDYF 4P2OB 4WW2A 1ZLVK 1IL1B 3TT1H 2ZSVA 1A4KA 3G04B 4JM4H 4ODUB 1P7KA 1QG3A 1IBGH 1J5OH 2ZPKH 1QTYT 4TN9A 5GSRA 5CBAA 1YMMD 5C08D 3BEVA 4UQ2B 1ZLWK 3UTSA 4O2CB 3VWJD 4MDIB 1QOKA 5CEZH 4X6CA 3GSRB 1EHLH 4NZUL 4FN0A 2GJJA 5D93C 5JTWA 5I18H 2P4AB 5JHLL 3VXUE 4UDTA 2PUQT 5JPNB 3DMMC 3MNZB 3FMGH 5IBUB 7FABL 2BNRA 4F8QA 4LNRB 4J3TA 3NFPA 3PGDB 5IR1B 4D9RE 2XRAL 3EUUA 3GI9H 5E95B 5FHAL 1Q0YL 2YN3A 4J2XA 1NUGA 5IJVB 4Y19A 1MHHB 4PREB 3FOLA 3TBWA 1DQMH 4OSUH 4PR5B 2CK2A 1M7DA 3D2UB 3NCYP 2OL3L 4MD4B 1MHCA 3QHZL 1GPOL 3EO0A 1G6RH 1A02N 1RIHL 2MKLC 5F71A 1Z9LA 5C0JB 1HOCA 1XGPA 3BAEH 4JM2A 5H94A 2X4SA 3V8OA 35C8H 3QIWC 3BW9A 3QT2A 5SWZD 3RZCA 1JPST 3V52H 4HKZA 1FIEA 1FBIH 1ZVSB 3NFNB 1FYTA 3DX9B 2V5TA 1XFPA 4CVXB 5IMKB 1BJ8A 3TPKA 2E7CA 5ETUA 3ES6A 3X3GL 4Y4HD 1U3JA 4M6OL 3FB8B 4XPGL 2F9BT 3C5ZA 4WO4A 4PRID 5EBMA 3RTQB 5EOQL 1KENH 3Q5TA 4WI7A 4PJ7E 3WL9A 1J0ZA 4XB8A 4P5KB 3JXAA 4ZTOH 4WI2A 4H88H 3SKUD 4PPTA 4U6TA 1X4YA 3MUHL 2JJTA 4HUKB 5DJZA 5ISZE 2XICA 3MOQA 4P23A 1S9YA 1MFDH 4I3RL 1D5XB 1KCUH 1XF1A 3EO1B 4LNVA 1FZOA 5CZVH 2ARJB 3GHEL 4L3AA 3PXJA 4GAJH 1FZJB 3K2UH 3PQYA 2ADFL 3E8UH 2NZ9D 3BQUC 1LP9F 2CKBL 4HAFA 3VH8B 3VD4A 2RCSH 3RUGF 5JW5B 4RAHA 2DM7A 2QSTA 1H5BA 5E1AA 4HFUH 1JRHH 4MMXC 4C4KT 4MNGB 3DX7A 2YD2A 5IUSA 4JFDB 5DT1L 2R23A 2XQYG 2MHAA 3SJVE 3V79C 4LLYB 2VQ1A 4MWFB 3B5GA 4L3CA 3VMNA 3RHWF 3MGAA 5B8CC 1WAAA 3LKOA 2GSIB 2PO6D 3KYAA 1P6FA 5GGTH 4OM0L 1QO3A 2A1WL 3THMH 4XP1L 3MUGA 4I1NB 4JO4L 5IT2H 5GRYA 5D1QC 4KKAC 1INDL 3PHQB 4GUPA 3ZDZE 2WLZA 5MHSE 2CIIA 2C3HA 5DEFA 4AH2B 1A3LL 4PJBF 4GRWF 4ZOEA 3RA7H 4OI7A 1CFNB 1HI6B 2CDFA 3PP4H 5EIIB 1OF2B 4LLUB 3HG1B 4OZHF 3BPOB 3O9WA 4QHUA 3MXWL 3K4AA 3IVKA 4UOW0 1J8HD 5DUBA 3RL2A 1Z9SA 4HXAH 2FL5A 5T3XL 1BM3H 4XMKL 5FA3B 3HUJE 3QXVA 5JHDA 3LS4H 1BBJB 3QQNA 1RZGB 1AD0B 4ZAKD 4KJPD 1U91B 3RWGA 3WIFB 4LF3A 5FYKL 4XH2A 3SGDH 1KJMB 3V0VB 3H9HA 4K9EH 1Q9LA 1QFHA 3KJ4B 3HCVA 1NCWH 3KPMA 1KTLB 3ZE2F 2EC8A 5C2UB 4GAGH 4LDEB 3MRFA 5EN2A 5CBEB 4OIIL 2WQ8A 1A0QL 5BRZA 5KVGL 3TIEB 1V3MA 2WUBL 4HJGB 4ESKA 3CH1B 5F1NA 1JZ2A 4JGJA 4XPTH 5E9DB 4AQOA 5I8EB 1YJDH 3QZWG 4I0PC 4F57L 4MHHG 2YK1L 5SWZE 1C5CL 3UZEA 4ORZC 4S1QH 3Q6GL 3IDIB 4PV9B 5D7JC 1EFQA 5HGAA 1ZT1A 4R97B 3W5MA 1Q1JL 4PJIF 4HS8H 3IU4H 5MEND 3UYRL 3HC0A 3Q1SL 5K9QI 5L6YH 4WJ5A 3TBYB 3QXAA 1LMKA 3BP6B 2AI0H 5ADOL 4KDVA 4QHLA 4Y0GA 4HUVA 3CMOH 4WEUD 3ZDXF 4HV8A 3LSOB 4JFFE 5I75C 1CLYL 3RU8L 3SE4A 1E6JL 4KKBD 4OCXL 5ALBL 1YEHL 4JQIH 2R69H 1VERA 1LP9B 3S36L 5J06A 5MEQA 1RJYB 3LQZA 4TTDC 5KZCD 5EOTA 3TNMA 3BPNB 5JIKA 1MQKL 5J0BA 4U1LB 3DVFA 4D0BA 2W07A 1OGAE 2ZKHH 3EGSA 3NGBC 2XZAH 4X9FA 3SCMD 4LDOB 4P5TD 4ZUTB 2FATH 4IRSD 5B22A 3VRLE 4EI6B 1PEWA 5KANI 1YEFL 3AREB 2EECA 3IDMB 1XIWD 5DJ0B 2DYPD 4Z78A 4K94H 4GKSA 1T03H 5DRXB 2XI9A 1TETH 1Y6MR 2A9ML 5I1EH 2D4DA 2D7TL 1H0DA 3L3OA 3EHBC 1QYGH 1C1EL 4LQ1A 4QRTA 5DUML 3V5KB 4DGYL 5BXFA 1I7ZB 3LH2L 1OAKH 3FB5A 3JUYA 2F5AH 4GW5A 5E7BA 1R5WA 1ZHNB 2F54B 1L0QA 1CE1H 3HMXH 1Y0LA 1C16B 2CUMA 3WHE1 3WS3B 5F93C 4IDJL 2DLIA 1U8HB 1EPFA 3VD7A 2BSTB 1Z3GL 4N0CD 4OLYL 3SE9H 5GRVL 4GRWB 4XNZC 1T0MB 3RY6C 2W9DL 1PG7X 4OZHB 3QH3B 3FRPG 4UT6H 1UXSB 4FNLH 4MYWB 3NIDE 1U8JA 4C54A 1RIUH 2GUOA 4HKBA 4P0DA 3OF6D 1YUHA 4ZPTA 4G42A 3TO4A 3KJ6L 2GJ6B 1H3PL 2QV2A 5T3XE 4Y88A 4XBEH 2BRRH 1T6VN 5CHNA 4YE4H 2LFGA 4YH6A 4AENA 1MFNA 1YEDB 1FIGH 4P2RB 2OK0H 2LTQC 1JMXA 3BVNB 5FHBH 1EUTA 5FYKE 5EIVA 2GK0B 4WU5A 1J8HE 1KJ2A 3GNMH 5F3HA 2BX5A 1VB9A 4OCSH 5ICXB 2VB5A 4KRPB 1OWWA 3SKOB 3HRPA 2VLRE 3ARUA 2ZP0T 4HUXB 1AY1H 3WXWL 1MIEH 3F7YB 3QUMA 1AGCA 4KY1L 3B9KB 1ED3A 4RMSA 2X1WL 3VFPB 1U93A 3X14B 2DQHH 1QBLH 3WE6B 2FEDC 1WJ3A 3U0PA 4WW1B 4L8SA 2FJFA 2DQEH 2W60A 3WLWD 4NM4L 3GSNL 3BXNB 4MCZB 3F5WB 1F4YH 3DXAE 4KJWC 4U1HA 4NNYB 2GEEA 1TJGH 3MCKB 2GITA 4YX2L 1KEGL 4ONHB 4X8JA 2NW3B 1RUKL 4OLXH 3GMMB 1U3HB 4NZDA 1KB5A 3S34H 2R1WB 3JWDH 3KLSA 5IMMB 4J8RA 3H0TB 3PL6D 3K80A 3FO2B 5E6ID 4YC2B 1EEZB 5LWYL 3QG7H 5E99L 2ZOLA 1TTGA 4GKZA 4H20L 3CFKB 3I75A 1I4FB 3P4LA 3GUTB 1EUUA 4HUUA 2JCCA 3BIBX 5JW4R 4NHUB 3TYFA 1K85A 4QXGH 4HWZA 3GMRA 1OTTD 3HNTL 4WY7H 4GS7B 1SVZA 4LVOB 3RWIA 2FB4H 1ZVYA 2JTDA 2YPLE 1OPGH 1BQLH 3UC0L 5HPOA 3QCVL 1AIFA 1WFTA 2NW2A 2VLJD 2XYCA 4CNIA 3PWPB 1RMFL 4KK8D 3ZE1E 1RFDH 1BMGA 1JN6B 1GC1H 1LE9B 4ZNEE 1RZIB 4YDLB 1EFXA 3BKML 1P53A 4N8VA 5L0QC 1DBKL 1XGTB 3TPUB 1BZQK 3EYUH 1ZHBB 4GW4B 4JG0H 3OKOA 1ZSDB 1AO7E 4M03A 3JBG7 5F7YC 4L4TA 1YY8A 5DHXB 4XI5C 5J11C 1YEJL 2WIIA 4G6KL 2R8SL 3I02B 4BH8B 4N5EC 5HI4D 4YPJA 5B3JE 2BP3A 2ZOKA 5ESAB 4GXVL 3F7VA 5HBBA 4EBQH 1FPTL 1IQWH 4PJ5A 1EA9C 1RJCA 3DWTA 1PBYA 2F19L 2K7PA 4NQVA 1TZGL 3KPNA 4S1DC 4HEPG 4ZTPL 3VXSD 4HIEA 4KV5E 4EN3D 2VDLL 1JPGA 3WD5H 5D8JH 3VGEA 5C9KA 4Z7UF 4DZBB 4S0SD 5LGHH 1I3GL 2JELL 3G08A 2CLRA 1S78C 3PV7A 2XXCB 4ZXBA 3NAAH 2I60L 2FDBP 3L5WA 2KZ1B 1ULVA 1XR8A 2CRZA 1CGSH 2ADIA 2AEPL 3OJMB 4JDZB 4JPIA 4Q9CA 5HDQL 2QQKH 1IEAB 4F7EA 2G2RB 1PQZB 4X5XA 1H15B 5HHPA 1H3GA 4ZPVB 1LD9A 3DMMD 4K71B 3S88H 4R3SB 1KIPA 5DJYA 1UXWA 4LU5H 4P5MB 1AJ7L 1CVSC 1GSMA 4QNPF 2DDQL 2Y7QA 3QRGL 2Y07H 5KSAC 1P7QD 4F7CA 2VQUA 3ULSB 3UO1H 3IFNH 2X40A 4FQXA 1MCPL 5IGXL 1M7IB 1A7RL 5D72L 3MA7B 4KROC 1B0GB 1JYNA 3PIQB 1IE5A 4BQ9A 4PJBE 1QD0A 4P48A 5I1CL 5I1GH 3FFCA 2FBOJ 4JY5L 4EOWL 4LLVB 5JIHA 3FTGA 2A6JB 1SM3H 2DJSA 3FO9B 3QIWD 4YGAB 2ZG3A 4Z7VB 1KJ2H 2J8OA 3P73B 3DLQR 2CK0H 3QUYA 3PWLA 1WCBA 4KQ3H 5JO5A 5E08L 1R0AH 1I3UA 1YNKL 4XP6H 1P2CA 1NC2A 1RY7B 1UWEL 3MACL 3QUMH 1L6ZA 3JWOC 3HE6B 1FGVL 5CS7A 5I2IB 2V7HB 3O4OB 1ONQB 1BFVL 4EVNB 1KELH 1WTLA 3U9PH 1I9JL 1GIGH 4EXKA 5I1HH 4Q6IA 5J4MA 3TO2A 5H35B 1WSST 4OCMC 5AD0B 1A6PA 4H25B 3KPQB 1ZLVH 4AIZA 4AT6B 2Y5TA 3EBAA 5ACMA 2APVA 2M8XA 5EOCL 2Z31D 4NO0A 1DDHB 3X3FL 1RZKC 1ZLWH 1ZTXL 3ET9F 1NAMB 3FONA 2VIRA 4L4VA 4XC3L 2L7UA 1KEMH 2VLJE 2X4NA 3VFWA 4PJIE 5C1MB 1E4XH 3P11L 3VFNA 2FYYB 4LARH 4LIQH 5C6TH 1A6AA 1D6EB 2B1HH 2LVCA 4KGJA 4M3KB 1SHMA 3EZ8A 4QCIB 2ATPA 3KGRA 4O58H 4DGVH 1X6NA 1A1OB 1KCRL 4HWUA 3BZ4B 3ZDXE 1WF5A 2ADJB 1V3LA 2ICCA 2OR9L 1UZ8B 5I1AA 5JLZA 3CJJA 4QHMB 1JZ4A 3V7AG 1J0JA 4HUNB 1FDLL 1UQSB 1PZ5B 1WVZA 4POUB 5KSBF 3VGAB 3RL1B 3BWAA 4M7ZC 3K7UA 4YWGH 2B5IB 3LOWA 1RJLB 1SEBB 5D1QD 5IBLD 4KKAD 5EC1A 2ARWA 2EEAA 3F7PC 1DJSA 2F53D 5I0ZA 3J7HA 1HXYB 5F1KC 4PJ8A 4JFQB 3D3VD 5D7IF 4UV7H 5LGJA 3LPGA 2OJEA 1FLTX 3WNPA 3C5ZC 1R3LB 2XWTB 5C6WH 4ZYKB 5I73B 5T1MB 5B38G 3KLDA 1A1NA 3MJ9A 1AGBB 3MJ7A 3QDGB 4Y5XC 3G5YB 2JJUA 3VXQB 2KDGA 5FYLL 2JJTC 4U1IB 4ELME 4WHDA 4JB9H 3VXPB 3B6SB 4JY6B 1KT2A 4JZJC 2RIKA 4P23C 3AM8A 1ZHLA 5DURD 3C6LB 1QRKA 2WW8A 4I2XB 5EU5A 5F7EH 1JV5B 3TJEL 5C09A 2EO1A 2V9QA 4MA3A 2I5YL 2PW2B 1XF5B 5F1IB 3TBVA 4QRPA 2Q7YA 5D1XC 1NDMB 3LEYL 3FQWB 1I1CA 3S97C 1BQHG 1ETZA 1P1ZB 2F74A 5C0FB 1ZGLM 3O6FA 1H5BC 2YD7A 4DCQA 3MLUL 1JRHI 3ZYOA 4FABL 2YKLL 5D7SL 2PN5A 5BZDB 4MA1B 5JQ6H 4HC1L 2EDJA 1K4CA 4I0PD 1ZHKB 4HX1A 4PJ9B 4MQXD 3MRDA 3ARFB 4ZFFB 3MLSL 3I84A 3QFDB 3LS5L 2XWBA 3FAWA 2L7JA 3L3HA 4MA8H 4M5ZL 1JGDB 4AEFA 1FE8H 3L6FA 3WMSA 5BO1H 3T0EC 4RA3A 4H1LA 4F37K 4LDLB 4IHOB 3PHOA 3VWKC 1BIIB 3MV8A 4YUEH 1LGVA 5JW4N 2J8UA 1WFUA 2ICES 3R8BB 3MA9H 5D1ZD 5DRWB 2JIXA 4URTB 5CEXA 2P1YA 4P2QA 1N59B 5CJXC 4PJHA 12E8L 3D69A 4C56B 1D5BA 1CXFA 2NY4B 4QLRA 5KTEH 2ATKB 2X7LB 3S35H 2HG5B 1GZPB 4LGPB 4TTDD 1EMTL 4YXLH 4DN4H 1FZKA 1WFOA 3CXDL 4XRCA 3RGVC 4N9GB 4G6MH 1X9QA 1NBYB 1BIHA 1U8IA 5FKPA 3P9LA 4K3DH 3MOAH 1HKLL 4DTGH 1FNFA 2PYEB 5ALCL 4W4OA 4Z7WA 1L6XA 3DO7B 1F4AA 1OAZH 3SGDI 4GG6A 3OKYA 3OKNB 1A6TA 4XVUD 5CMAA 3EHBD 4G43A 4XCFL 2FZ3A 1W0VB 3JWDC 4RAUA 4RFOH 4XCCH 1HEZA 5GHWH 5IMLB 4EUPB 5CJ5A 3FT2B 3FB6B 4R7DB 3ULUH 5GGSB 3IFOB 1NGZB 5GS0H 5KSBB 2VDNL 2PXYB 2FJHA 3OQ3B 1D5ZB 1ORQB 3ALPA 3UJJH 1A7QH 1HZHH 2VXTL 1UA6H 3WEXB 3D5OF 1UWGL 3D85A 4HPYL 5DI8B 1ES0A 4X4YA 1OM3H 3E6FA 1CR9H 2P42B 2CJUH 2VOTA 4XMPH 2PCPA 3HPLB 5D7IB 2J2ZA 1UM5H 3LHPH 2MTPA 3IJYB 4YGVB 5DXWA 3R06B 1O5DT 3HHRB 4N5UA 4IJ3C 3W9EA 5DUPL 1NJ9B 5F3BB 3FT4A 2F53E 1A14H 5GRZA 1JHLL 4CN6A 2HT4C 3O3AA 4HUWB 1GC1C 5FYLE 1JWUA 3BRDA 3HZMA 1JGUH 1I1YA 3QQ4A 5SX4I 3KXFD 3IDYB 1T1ZB 5J1TC 1WV7T 3IJHB 3BKCL 5DQDL 3OSKA 3WKNA 2IPKA 4DN3H 2NX5A 2QHRL 3KYNA 4FFZH 3CC5A 5LQBL 1LWRA 4PJAE 5F7LB 5F9AC 4OB5L 5HD8D 3LRSB 5E4EB 1NGWB 1F3RB 4HK0B 3R4DA 2C3VA 2W92A 4PY8J 4AG4H 3OAYH 4U6HB 2NY1C 4OZFB 5AWNL 5BJTA 3MRQB 1AFVH 4RMQA 1SVCP 4WDIA 3W11C 3O8XB 3U46A 3VGHA 1BVKB 4Z7UE 1WBYA 3MJ9H 2BMKA 4HLZH 4ZFZB 1L0YA 3BZEA 5KAQF 3RZWA 2LAGB 4LBEA 3F58L 4OKVB 4PJ7B 3JV6A 4KJWD 2FNBA 1N4XL 5GGSY 4RZCB 4V1DA 4MQSB 4XP4L 4NWTH 4RGNE 4DQOH 4YHYB 1FFQA 1BFTA 4X6CF 5CEZD 3T08A 1C08A 1U6AH 5DRNA 4Z76B 4JM4L 4JKKA 3BD3A 4PJEB 1J5OL 2ZPKL 4LVHB 5I1IH 4L8BB 1R5VB 3NZHL 4QYOA 4JAMB 1R24A 4JFOB 3BGMB 5T1DH 5T3ZH 4D0DB 1KBGH 3H9SB 4BKLB 2NY0B 2FEEI 4X80H 4YFEA 2H2SC 2NYYC 5HHOE 2ADGB 3FMGL 1J8KA 2Q76B 4M93C 3I3EA 2BNQB 4QGYA 3VXOA 3T0XA 3SJVB 3NCFB 4FXGB 3G6AA 1DQML 4H1LH 2V2XB 1FFNB 3NTCH 5M95B 4NN7B 1V05A 4DVBB 1BWWA 5E8OA 1G6RL 2XTJC 4M43H 4GKNB 1C7SA 1FVCA 3BAEL 2HJKA 2X2YA 2AV1A 3P9MA 4FQLL 3U36B 2P8MA 2R15A 3GJFK 4MSWB 3P4OA 1DEDA 4XI5D 2O5XL 2YOCA 1FO0A 1FBIL 1EZVX 4M1CC 2XOTA 5JW3H 1UGNA 4JPVH 4LL9A 4O9HL 4QEGA 4GBXA 4IRJC 3AS1A 2KUTA 5F96H 5TE4H 4LEXL 2QSVA 2D7MA 4EI5C 1MCOH 5KOVC 3DBXA 1X5LA 2YEZB 2K1MA 1D9KC 1D5IH 4S1DD 4F7PB 1P4BL 4H88L 3V6ZB 3WFBL 5L2KA 2XY2A 2A6IA 2AJZA 1YMMB 2HT2C 3HUJB 4Y5VB 3HZYA 5C08B 3P4NA 5IKCB 1S78D 1MFDL 6CGTA 3O41A 2YC1A 1A4JB 3B9DA 4HFWA 4OGAC 4ZUVB 4LCIH 3CZFA 3GBMH 2QR0A 1I1AA 1JTOA 3QI9A 3SY0B 4LRIA 5DJ6A 1CGUA 5D70L 3TZVA 3DVIA 4F7TA 3K2UL 3LKSB 3OXRA 2A77L 1CT8B 4PRDA 4PJFE 3KXFE 1QRND 1F6FB 5A16B 5TDNA 2DQGL 2XG4A 5BQ7A 4U33A 1DLHA 4U1SB 3V6OC 2RCSL 2CXGA 3AUVA 4XVJH 2MCPH 5IB1B 1JRHL 3K81A 5EU6B 1IKNC 2VDMH 3B9VA 3QUXA 4Y16C 2RFXB 1IAIH 1FNGA 4KROD 1GGBL 2C1OB 4P3DA 1HHIA 5L2JA 4ACPA 3ARBA 2OTUB 3GRWA 3KYMA 5HYSB 1DQJA 1A1MA 1AI1H 1S9XB 5E8NB 4Q74A 5GS1A 2O61B 1IM9A 3VXRD 2IGFH 1JWSA 4OIBA 1GHFL 2CDEA 3BRFA 1PKOA 3W0WB 3I6GB 4Y4HB 5E8PA 4N0UA 3THML 2EH8H 1T7ZA 3VG9B 4PRIB 5IQ7H 1S5IL 3LKPA 1IEHA 4LLWB 1C5BL 1G7JA 1GAFH 5FOJA 5LBSH 2XT1B 1GZQB 2AJVH 3O3DB 4NO5A 1PX3A 1IZJA 3C60A 3CFEA 4PRPD 5J6HB 3PP4L 1UC6A 1MPAL 3VA2C 1UZ6F 4ZO6A 5CEZE 1VPOH 1RU9L 2RHEA 1XZ0B 4Y4FC 4O2EA 1S7VB 5ESVA 5E5MB 2GTZB 1LEIB 4XNMA 4OZIA 4K7PH 3CDYA 4MGXA 4DGIL 3DURB 3S8WA 3GO1L 4A6YB 3V4VL 2AJUH 4K2UH 3S37X 3RKDC 2IQ9H 1IILE 5I1KH 5LKNA 2DBLH 3SGEI 3TBSA 5A1AA 4Z7OF 2BVPA 1KUMA 4HIJB 4J3SA 5J13C 1NCWL 2GAZB 3CUPB 2LE9A 1UADC 4M6AA 4X7TA 1RQ5A 3ELAT 5J7CC 1CGTA 3K0WA 3L3IA 3BWUC 4G8GA 3MLVL 1W72A 4RCAA 5DMJB 3BIKA 4LAQH 1CICB 4PJDA 2BNRD 1RK1A 5HHQB 4YIQB 3GDBA 2PO6B 1FG2A 1QSFA 4BFBD 1BX2A 2HVJA 2YXFA 4Y19D 5L9DH 1URLA 3OPZH 4XX1G 2EIZB 2CLVB 15C8L 3U2SB 4DW2H 2O5ZH 1FJ1B 3VFUA 1LE5A 4S1QL 5K59F 4BA8A 2OJZL 4XXDA 4G9FE 3QWRA 4ZOBA 4E41A 3PWVB 4JM2D 1RAMA 4EDXB 5IFAL 1D5MA 2VDPL 3RZCD 2E9WA 3CSYB 4B53A 4W70A 4LCYB 4N0YL 2AI0L 4PRBA 1FYTD 4A6YL 2MNUA 1DTUA 3CMOL 2MWCA 1WICA 4LRNL 1KPVA 3LD8B 3C5ZD 4PGDA 4WO4D 1XF4B 3VMOA 3MV7B 4FQ2H 1PJ9A 1E27A 4JQIL 1FO0H 4L9LB 4ZAKB 5BVJB 2I9LA 1F4WH 2P24B 1DL7H 4MJ5B 1IAOA 1PKQE 5LGKA 1QQDA 5I19H 3MLTA 1P69B 3U79A 4ORGB 4U1MA 1CL7H 4XNUH 2FATL 4P23D 1SY6L 2IFGA 4Q6IC 3VFGL 1S8DA 1GGUA 1MCHA 4X98B 3LAFA 1VGEH 1MCSA 3I50H 3VXMB 4GRLC 5CD3B 4K94L 4WWKC 3HTLX 4LCCC 3PQYD 5D1XD 4YDKH 3T3PF 4Y2OA 3QPXL 4Z0XA 1N6VA 4L8DA 4HS3A 1RUMH 2DKSA 1QYGL 4QY8B 1X5HA 2DWDA 3SDAC 4R4BB 5EUOA 1M7XA 5C9JB 5CCKL 5F9JB 3WBDA 3GMQB 4PGBB 5D7LA 4RWHA 1FVEB 1WEJH 2Y06L 1OTUC 4PRAB 4YPGA 1K2DA 3UTTA 1UCTA 5BV7B 4LVEA 5FA4B 3WUWB 5BS0A 1QR1B 4K55A 4QTIH 5MENB 3SE9L 2E3VA 4P4KA 5H37G 3U4BL 1OD9A 4XXCA 2ZCKH 5HI5C 4PTUB 4HSQA 4NC2B 5C3LD 3A6OA 1EEQA 4JG1H 3VWKD 5DFWH 5DJAA 4R4FH 3B2VH 3G5ZB 3GRWH 2L0DA 3NN8A 1IC7L 4PLOB 4MCYB 5I1LA 4XBEL 3RVXC 1M6OA 5CUSH 3RVWC 5KZCB 1BGXH 3DTXA 3DX8A 5HHMB 4CU8A 2XACC 2DWEB 5CINH 2J3SA 1QA9A 1RHFA 1WBZB 1HXMA 4RIRB 4P5TB 4IRSB 1CXKA 2JJWA 3JVGA 4OCSL 1EO5A 4K23L 5TE7H 5GGRA 5ECJE 3O9WD 1TVDA 1XIWB 4H0HB 3RGVD 4ODBD 1LDPH 3IXTB 4F7MB 5KJRL 1MIEL 2C3XA 4N90E 4EJ1C 1TVBB 3VG0H 5HGDB 2XKNB 5E2JA 3M07A 3IFPA 3WNNA 2BHYA 5JHDD 1KJ3L 3GB7A 4KUCF 4UZGA 3UTSE 1FZMB 3GMPB 5E2TH 1T2QH 4X6CE 3UBXA 1UEMA 4XGZB 3S4SG 2ZNWA 2JF1A 1QBLL 2VH5H 4UTAH 1V7NH 2V5SA 3HLAB 1EEYA 4JZNA 4QXTB 3VFTA 1XH3B 1T89C 1J1PL 1OGTA 1NC4B 3BISA 4KMLB 5HYQB 2BNRE 2Q8BH 1CU4L 3NACH 3PGFH 2OXHA 1ADQL 4HD9A 1MFEH 4OD3L 4Y19E 5BRZD 3NIFF 1RZJH 4OLXL 3SKMA 4Q9RH 4AEIL 3LKQB 3VFVA 1T1XA 3OJ2C 4L8CA 2HVKA 2DB8A 1VACA 3AU1A 4BSVA 3P40A 3QFJD 5HJ3B 5KVFH 4XAKD 4X8XA 4PGCA 3D1MC 3UTQA 5IQ9A 5D2LA 1W72H 2YHGA 4LSTH 1AGFA 4HIXH 1HK6A 1F11B 2MPAH 4H5SB 4ODVL 3BO8B 1AGDB 2BERA 3F12A 2HT4D 1FYTE 2AAVA 4QXGL 4M7LL 2YD8A 4YFLI 2ENYA 2COQA 2KZWA 2X89A 4NQCD 2QLVB 1OPGL 5FO7B 1AHWB 3SQOH 1A6WH 3LEXA 4NPYB 1II4E 4I18A 1QKZH 4ZFOA 2DICA 2CSPA 1WBXB 1MHPH 2WUCH 5EBLA 3BESR 3QEGH 1T7XA 4CMMB 5I8OH 5HPMB 1RFDL 3GJFA 4Y4KA 5TF0A 3OHXA 1XCQA 5INDB 2UWEA 3RVVD 2IANA 1ND0A 2HTLC 2EKSA 4HIIA 4QRUB 4FHBD 3V5DA 3TT3H 3CFDB 3H2WA 1QFOA 4NQEA 5CJOH 3STLA 2AERT 2NY1D 2HTKC 4GJTB 1BWMA 3T0VA 4RWYH 3MLWH 1TXKA 4WUUD 1UB5A 3ZKXC 3SOBH 2EH7H 3EDEA 1C5DB 4NHCL 4OIAA 5TJWK 5IB5B 1BF8A 3RWJA 3BE1H 3GSOB 4O2FA 3LEVL 4UILH 5GXBB 4YHIA 5FEBA 2VAAA 1Q9KA 2D7PA 2Z92A 2V2TB 2HYMA 3MLPA 1HNGA 5E6IB 4XHJC 4LHUG 2BDNH 4MXWH 1CFBA 4N9OB 3ILPA 1NLBH 4QRSB 4YO0B 1IGTA 2AV7A 5TDOB 3CDGB 3O3EA 5LGHL 4WIQA 1SJVA 1UB6B 5E2UL 1WAAE 1PDKA 4IM8A 3KYOA 4L9DA 4O02H 4TUJB 3PNWB 3G5XA 4RQQB 3BKJH 1KIRA 4U7KA 1Z9OA 1ZVHA 2FCBA 5HYJD 2VL5A 2BSSB 5EBGA 1L9MA 2QQKL 2WV3A 5DHVB 4XAWH 1VENA 2VLJB 5GRJH 5IF0A 4YXHL 4B50A 4H0IA 1U36A 4YFLF 4FS0A 2H2SD 3EOAB 3QXWA 1IGIH 3TVMA 4OTXL 4DKEL 2HAZA 2WM0A 3TO4D 25C8L 3HI5H 1LQSR 1EJOH 1X44A 1H3WM 3IYLW 2W0KA 4LU5L 1FNEA 1T1YB 3HRZB 3QG6A 5JA9A 2VZVA 4JANA 4JFXA 5FGCE 1R3JA 3CFIC 3U0TB 5KVEH 3L3GA 3UO1L 4OFVA 2VLKB 5FUZH 4KJYA 4JZOB 2IPTH 4S0TD 3TBTB 3T0BA 4DAGL 2ICWB 1FYHB 3RIFK 4P46A 5JHDE 2XQBH 2CMRL 1MJ8H 5F21B 4WV1B 1G0XA 1KXQE 1NLDL 5D5MF 3ROLA 4PV8A 3DRQA 5EIQA 4RNRB 1FSKB 3AS0A 1GH7A 2B0SH 4IEFB 1KJ2L 4MAYC 1FC2D 3N85H 4M1CD 3G6DL 3DHJA 1GVIA 1RULH 3K1KC 3FO1A 5CZKA 2CK0L 4F2MA 1E4KA 1NANH 3A67H 3BUYA 3VXSB 4EN3B 4CN4A 4A2LA 4FQHB 4UMGA 4XP6L 3GIVB 4D8PB 1TMCB 1KNOB 3QUML 3DVGA 1QLFB 2QJDA 1N5YL 3P0GB 1KC5H 5C0GA 5BRZE 4YR6B 2UVFA 5JXEC 2EE9A 4YBHA 3MV01 4HMEA 1JHKL 4DOHB 2VXQH 3DIFB 5CD5C 1D6VL 2EDTA 3U9UB 4CADA 1EO7A 1GIGL 1FL5B 1SMOA 1G7PA 2ED9A 3VDBA 4NFDA 5JDJA 1FN4A 4XC1H 4YFDB 3VJ6A 1JPFB 3O45B 1KTDA 5D93B 4M00A 2HJLB 4GXUM 1NL0H 4JO1L 4RGOL 3OR7A 2X09A 4HWNA 4NUGL 3S5LA 1VEMA 2IALA 4N68A 3DMMB 1CE6B 4D9QD 1F42A 4HGWB 5FO9B 3ULVF 2BC4A 1HQ4B 3S7GA 3DV4B 4M48H 5KS9F 1KB5L 1R5IA 5TDPA 1CBVH 4LLAA 3MLYH 2HRPL 4IRZL 4KI5D 2J4WL 4WU7A 5HGHB 1NGXB 2ILLA 2CR3A 2H1PH 5K59E 3O2WL 5E2VH 2W65B 2XNAA 4NQTA 5K9OA 2E9JA 1IGYB 5C0CD 3HNSL 5FM5O 4Y16D 1MI5D 4DJMA 1R3HB 4L3EA 3WSQH 5EORH 2B1HL 2I07B 2CPCA 3QIWB 4O58L 4KKCC 4W4NA 4LPYA 3QHFL 3MREB 3HAEA 1CFTA 1RHHA 3BP5B 4P49A 3GKZA 4K3GA 5B3NA 5EBWA 1RZ7L 1EFXD 4TSCH 2ESVA 3PGCB 5GIRA 2AJ3B 3EDDA 5CILL 3TM6A 3FKUS 3GJFH 1NSNH 3VXTA 2X1XR 4KTEH 3RWDA 3WO3B 4U6XA 1EIBA 3K8KA 3MO1A 4L4TD 2PYFB 2EDYA 1U8MB 1E28A 1IFHH 4I8DA 1HN1A 1RVFH 4G9DA 4Y1AA 3IF1A 3SDDA 4ETYA 1ZT4B 1DE4A 1T0NB 4UV7L 4PJ5D 2UYLB 5FAAA 1JF1B 1HQRA 4BFIA 1BBDL 2XG5A 1BF2A 4P2OA 3T3PE 4K7FB 4UT7H 1OAYL 4ODUA 1QLRB 1A3RH 1E6OH 1BP3B 3BQUB 1FAIH 4UQ2A 4WGWB 4O2CA 4MDIA 3RKDD 2LU4A 3B5HA 3GSRA 1T1WB 1J9CT 1BAFH 4F15B 3MRNB 1XGYH 4WWID 2VLLB 1MREH 3C9NB 5JPNA 3HZKB 4BSWB 3BUTA 3MNZA 2BFVL 3NZ8B 4ODSL 2CRYA 4LNRA 5KVMC 5IG7B 1ROWA 3PGDA 3QZWB 3V7MA 5IR1A 4FRWA 5D5MB 3EOYG 3ZKNC 1MHHA 1TFHA 4PREA 3RY4A 5AZEH 2Y1VA 4N1HB 3WKMH 1I8KB 5B8CB 4PR5A 3D2UA 4MNHB 1PEZA 4ZS7H 4MD4A 4KDWA 3IDGA 5E2WH 1I9IH 3KPLA 5JQHC 4TNVF 5C0JA 2PTUA 4FQXD 1GYAA 1OGAA 1G7QB 5DMYA 1UACL 2IWGA 1F2XK 2IF7A 3MLZH 1PAMA 5D1QB 4KZDL 4X7CC 3MGOB 3ARBC 3DX9A 1MEXH 3GI8H 3WUZA 3WDHA 2X4PA 1FE8L 5IMKA 1IM3A 3D3VB 2X4OB 4X6BA 2IADA 5CIPB 4AJ0A 4YUEL 5F7HA 4I13B 5TFSH 3RTQA 3ZT7A 1ZA6B 5AG8A 3MA9L 4ONFH 5E70A 4CW1B 5C0DB 3TH4T 4OCWL 1L7TL 1NC2D 2F8VA 1MRDL 2IEPA 2XN9D 4KDTC 2VZTA 5KTEL 1FH5H 5DJXB 3S35L 2Z4QA 3N1MC 1D5XA 3EO1A 1N5AB 4DN4L 3CAFA 5DURB 2ARJA 3RNQB 2WBJC 3RDTC 2JJSC 1FZJA 4D9QE 3G5VB 1G9NL 1J0YA 3NIFE 3E1F1 1EHNA 3ULUD 4LIQE 4GRLD 2H9GB 4KI5E 3KHQA 5J1SC 5CAYB 4NO0D 4UBDD 5JW5A 3WLBA 2X4TA 3PABB 3MRJB 2PF6A 5LG1A 5JORA 4H26B 3QNXB 5FK9B 4I48B 4JFDA 5EOCJ 1I1FB 1AQKH 3CFBB 4XX1E 5GS0L 4I0PB 2RAMA 2ID5A 2P43B 4LLYA 3RWHB 4MWFA 3ESVF 3UTZB 4YJZL 3BP4B 5BVPH 1OTUD 3D6GA 3UJJL 1HZHL 5DK3A 5D7JB 1MRCH 3EOBB 2GSIA 4XCEA 1TTUA 1B2WL 1FNLA 3HPJB 4BELD 1OM3L 3KPPB 1ZGLB 1F6AB 2VDQL 4HDIB 1V3KA 3ULVL 4RFNB 3LHPL 4PLJC 5HI5D 4L4TE 4NZUH 5DDHB 1NGYB 3PHQA 1SEQH 3SDYL 5I75B 2X9WA 5T5FH 1OL0A 2YRPA 4AH2A 4Z77B 4PJXF 5ILTH 4DUVA 7FABH 1A2YB 1CFNA 1HI6A 3BN9C 5FCUH 1E4WH 1JGUL 5EIIA 4LLUA 3RVXD 2EZ0C 3HG1A 4Y5YC 1H3XA 2ZCLL 2YRLA 4PJ8D 5IBTH 3D0LB 4NC0B 3NGBB 2D31B 4DN3L 3L5XL 1VDGA 1GPOH 5FA3A 4JFYB 3AXLB 4AIOA 3FB7B 4JJHA 1BBJA 1UVQB 1RZGA 1AD0A 2FH6A 4NBXB 5IP4A 4E0RB 4QRRB 4NRZB 2EDLA 4QO1A 3WIFA 4M61B 3CX5J 1KJMA 1MLBB 3V0VA 4PP2B 5T1LD 3LV3B 2VUYA 1EAPB 1AFVL 1CL7I 3N1QC 2A6KA 2LAAA 4YHKL 4P57B 4ZSOB 1KTLA 4Z9KB 5FGRA 3T1FB 2YUXA 3GMLB 4YK4C 5DMGC 3X3GH 4OLWL 4M6OH 4HWEL 4FFYH 1BD2D 3U30C 1QFWH 2P5EB 3KPRB 4APQB 5DMKB 4HJGA 3CH1A 4LHUD 4J1UB 5E9DA 4CJ1A 4AEHL 2N7AA 4XNZB 4JJ5B 4XT1C 5I8EA 4CVWA 5DJ2B 3O6FD 2I27N 3E3QE 4RAVB 5GGVL 4OD2B 4OCLC 3IDIA 1NFIA 4PV9A 2HRLA 1CIDA 2J7LA 4X83A 5D9SA 4K3EH 1MWAL 5DSCB 3FFCE 1EHAA 4OM1L 3VD5A 1I3VA 1OWRM 1WCQA 3KXFB 3TBYA 3GBLA 1T5WB 3BP6A 5T1DL 5T3ZL 5DA4A 1T4KA 2MQ0A 1A9EB 2LTQB 4NKDB 3Q2CA 3DUSB 5FB8B 3LSOA 4X80L 1TTFA 5GGVY 3HB3C 5IVOA 4P9HC 2FHFA 3DNKA 2VR5A 1YC8A 4ODHL 3NPSB 4W81A 1LP9A 4UIKH 2Y6SC 2JIXD 2XA8L 3N1FC 1LO2H 5DD6B 3RUGA 1DN0B 2HTLD 2LU3A 3TLRA 4ZUTA 1F45A 3MBEC 2VO5A 3ARPA 3IDMA 2HTKD 4OM0H 3ULUE 2A1WH 5CKAA 4XP1H 3N0PB 5DRXA 2DMBA 3OBAA 4JO4H 5IJKC 4KPHH 2GCYB 1INDH 5ITBL 1U8OA 4NC1E 3P3YA 5C0ND 1QVOB 4L4VE 3V5KA 1PVHA 1I7ZA 4QRQB 3S3SA 4RMRA 2QEJA 4UV4L 5C07A 1ZHNA 1C16A 3WS3A 4XHJD 5KS9E 1U8HA 4G6FD 5GISL 4XP9H 5EA0L 1IAIM 2BSTA 3BPCB 4RMTA 1QSEB 4S2SA 3QNYB 4PJXB 4PJBA 5T3XH 1T0MA 1MSPA 3QDHA 5KN5B 2ITDB 3RWFB 4OZHA 3QH3A 3QCUL 1L0XA 1UXSA 1KCLA 2IMNA 3GBML 3D85D 5FUOH 1TCRB 4IIQC 5FYKH 4P9MH 3CLEL 2GJ6A 4AIXA 1KLUB 1QPPA 5CSZB 4UTBL 4GG8B 1M1SA 3X13B 5DHYA 4QKXB 4NIKB 1I8IB 4XBGB 1YEDA 4P2RA 3BP7A 3KPSD 3BVNA 5KVGH 4EXPX 2HLAB 2MCPL 2Z35B 2OTPA 2GK0A 2WUBH 5L0QB 1F4XL 2G9HB 4OZGB 2VAJA 4LMQI 4I18C 4NQXB 4HUXA 5FV1L 1T7WA 1XR9B 3F7YA 5FCSH 4F57H 2YK1H 5BZWB 4X4ZA 1C5CH 5J11B 3B9KA 4XPHH 1AI1L 4WNQB 3D25B 4M3JA 1F8TH 2GSGB 3WN5C 1Q1JH 3VFPA 3LIZL 3X14A 2YRZA 5BW7A 3WE6A 3UYRH 3QJHB 1OTSC 4UAOC 3Q1SH 2EH8L 4WW1A 1JNNL 4MAYD 3GZKA 1SJEA 5C09E 3OB8A 2FX8L 3BXNA 4QRPE 5JW4Q 4MCZA 3F5WA 5ADOH 4HS6B 3K2MC 4NGHL 3SE3A 2AK4D 4PJIA 1VFOA 3MCKA 4G80B 1CLYH 3NPZB 3BPLC 3RU8H 4ONHA 2R0LH 2NW3A 5IV2B 1E6JH 4MNQB 4OCXH 3QUZC 3GMMA 1U3HA 1WZ1H 5ALBH 1YEHH 3T0AA 2RR3A 4LASL 5JXED 3S36H 2R1WA 5IMMA 3T4YB 4XCYA 5M7QA 3QDMD 3H0TA 4JVPA 5T3ZE 3FO2A 3IT8D 3DV6B 4V1DD 5CD5D 5J1AB 2E9IA 4RA0C 1MQKH 1EEZA 1CD0A 2FLRT 2I24N 2Y4SA 3CFKA 1SMAA 1I4FA 2NY6C 4BH7B 1DFBL 3GUTA 2ZG2A 1YEFH 2Q87A 3QHTC 3NH7L 1BHGA 1QRNB 2D0HA 2AJUL 3GHBL 2IQ9L 4NHUA 1Q8MA 4FFVC 5A3IC 4LK4A 2A9MH 2B1AL 1NEUA 3OZ9L 4EKXA 2D7TH 5KSAB 3MV8E 1W0WB 1C1EH 3A6CH 5DUMH 1CLCA 2J8UE 4F37F 4DGYH 4PYHA 4KROB 3PWPA 4P2QE 1JN6A 1DVFB 1NMBL 3C2AH 1LE9A 1RZIA 4PJHE 1RIVL 4FMKA 1F3DJ 4UDUB 3TJHD 2NY7L 3CIQA 4WTZG 3REVB 1XGTA 3TPUA 3VXRB 1ZHBA 1Z3GH 4KKCD 1CDJA 4DZ8A 5L9DL 4GW4A 5FKAB 3S9DB 2R0KL 1ZSDA 4TUKL 32C2A 1G7HB 1DZBA 3IRZA 5KG9B 1IGFL 2C4FT 3I02A 4BH8A 1INQA 4G7YL 3I6LD 5ESAA 5JPMA 4Z7WE 5INCB 5B38B 4PRPB 2GY7B 1TPXC 1H3PH 1P4LA 3L95B 1T04B 4GG6E 1F97A 5IW6B 1E4KC 4POZC 3T2QA 4PY8I 4JREC 3FQXB 4H8WH 4DZBA 1BOGB 3WCYA 4MJ6A 1FO0L 1X5JA 1F4WL 3FT3B 1WT5C 6FABL 1G84A 3NCYS 4RFEB 3WXWH 1X5KA 1QUNA 3D0VA 4X7SH 2YD1A 3JV5A 4KK6C 3UBXI 4NKMA 3TN0C 2O26U 5HHNA 4I77H 1CL7L 1JWMB 4JDZA 1BQHB 3B43A 2QADC 4PG2C 1IEAA 4DFHA 2G2RA 5DO2D 1PQZA 1ZMYA 1VGEL 5E94B 5IOPB 1H15A 5HDLA 3I50L 5EUOF 1I1AD 4UDTB 4ZPVA 3QI9D 2UY6A 4U0RC 3U0WH 4GRWH 4NM4H 4R3SA 5C0IB 3NFPB 1JI1A 3PWJB 4P5MA 2Q6WA 1BFSA 4F58H 1AH1A 2WNGA 5D71L 4YX2H 3ULSA 1M7IA 3FOLB 1RUKH 1G7MB 5DFVC 3MA7A 1B0GA 1NBZB 1M7DB 2DIJA 2Y36L 2NX5E 3ARSA 3HC3H 3PIQA 4PIRF 1JZ3A 2YSSB 5D2NB 1WEJL 4R90L 1Y6KR 4HH9B 1CLOL 2X4UB 3QUXD 1JUFB 4HGMA 1HOCB 4M7ZB 5E99H 4LLVA 4OZ4B 2A6JA 3FO9A 4NP4L 5DTFB 3BW9B 3ARBD 4Z7VA 3P73A 1IM9D 3VGBA 3PXHA 5FUCE 1V5JA 5ETUB 3ES6B 4JG1L 4S1RL 3HNTH 1GXEA 4KXZH 1RZKL 3C5ZB 5T5NG 3B2VL 4TVPH 1YPZF 3HE6A 3GRWL 1DQLL 1ZA3B 3QCTL 1WC7A 4YLQT 5I8CB 5I2IA 4Y5XB 5CUSL 2V7HA 1RMFH 1ONQA 2SEBB 3L3DB 4EVNA 4L5FL 4V1DE 3ZTNL 4X6FB 2A74B 5DJZB 2VXUH 3L9RB 4JZJB 1TQBC 4AM0B 1NCDL 4P23B 2YBRB 4NNXB 5H35A 5AD0A 4KHXL 4M7KL 3KPQA 3VMPA 4AT6A 3RDTD 3FN3A 2FD6H 1DDHA 1D3CA 1FRGL 3JTTB 4NJ9L 1PY4A 2UZIL 4JRXE 3PQYB 5D1XB 5FDWB 5JXAL 3B5TA 4HMCA 2AEIT 1NAMA 4G6AC 1B6UA 2R8SH 4NN5C 5E2TL 3ARDA 3R1GL 1RK0B 1CDGA 5D7KD 4UTAL 1FPTH 4ZUUB 1N3NB 1MF2H 5E8DH 1H5BB 5E1AB 3SEPA 5ID0B 1EJ6A 1BZ7B 3BDYL 5GRXG 4K07A 2C4XA 1TZGH 3MC0A 2FYYA 2Q8BL 5LXGL 1J87A 4ZTPH 2MHAB 1D6EA 3NACL 1JMZA 3PGFL 5J12C 4GXUN 1NEZG 1QEWB 4QCIA 3O4LD 5H2BB 4G8GD 5D2LF 3SO5A 2FJGB 1A1OA 3GSXB 1HDMB 4MD5A 3BZ4A 1CIUA 3C5JA 4TUOB 2C3WA 3LVEA 3BRGC 2J8HA 1UZ8A 1QSFD 4QHMA 4Y8DC 1UQSA 2I60H 1PZ5A 5AYUL 3T0EB 1A21A 4QWWC 3RL1A 4RX4A 3VWKB 2DLFH 4FTVD 4JKPL 3I6LE 3MUGB 1T5XB 2AEPH 1W72L 1N6UA 4PLJD 5HDQH 4D94A 1SEBA 2WWKT 2VSDA 3RQ3A 2NZ9C 4JHBA 3WNOA 3DRTB 1JIBA 3ARWA 1HXYA 4JFQA 2YPKB 4JRYD 4QHKJ 3BN9D 4CJ0A 2CDFB 2XTLA 2VNCA 3T1WA 2BJML 1R3LA 1B0RA 2DDQH 2XWTA 3SQOL 3RTQC 5T1MA 1QKZL 4JFED 3RGVB 1AGBA 4PJCF 1MCPH 5IGXH 5I8OL 3QDGA 2W9LA 5D72H 1I7TA 4Z7NE 3G5YA 1DR9A 3VXQA 2F58L 2DL9A 3WFHB 1F3JB 5L2KE 3JUZA 3BX7C 4U1IA 3REWB 2DN7A 4LEOB 3VXPA 1XGQA 3B6SA 5KSVB 4JY6A 1CI5A 4WFFE 4XNYL 3MOBL 4JY5H 5E5UB 3TGXA 5CJOL 2NNAA 3C6LA 3NOIA 4U1NB 4XH2B 1JV5A 4RWYL 3QIUC 3H7BB 2PW2A 1XF5A 5F1IA 2EH7L 2GFBB 3SDCC 3FQWA 4OUUB 3PDDA 1UH2A 5DMGD 5C0BD 5E08H 5JNYB 3BE1L 5GS3A 4PGZA 1P1ZA 5C0FA 3OAUL 3MACH 5DJCB 1M71A 1UJ3C 5F1NB 1FGVH 1BREA 5J6GB 1D7FA 1WLHA 2NXZC 3VRIB 3QFJB 1CLZL 5BZDA 3M17A 4MXWL 2FR4B 1I9JH 1S7XB 5EG6C 1ZHKA 4PJ9A 2AXFB 4ZFFA 3GMOA 1P9MA 1FQ9C 1XGUB 2JB6B 3F6LA 3VFOB 3QFDA 4LCWD 4IJ3B 4G8EB 4JVUA 1N2RB 5IB4B 3TESA 5AAMA 3UTTD 3GEWB 1JGDA 5EOCH 4O02L 2VERN 1J12A 1LEKB 1ZANL 3HC0B 5TH2B 3WJLC 4IHOA 1ZTXH 1BIIA 3C8KB 4NQCB 4YDJB 4WJ5B 2DQTL 5BOPA 1J0KA 2F8XC 2AGJH 4GQ9H 1INEL 4XC3H 2I9TB 2DJUA 5DRWA 5E4IA 3HB3D 1N59A 5F8RC 1IGIL 4C56A 3OB0K 1IRAY 3TYGH 1MCWM 2ATKA 2E7LA 2HG5A 1GZPA 3LQAH 3N9GL 2NY1B 2XXMB 3BPOC 4OCRH 4N9GA 3U1SH 3SPVB 4WUUB 5HGBB 1A7PH 3IDJB 1NBYA 3EGSB 2IPTL 5IW1A 1WFNA 3GMNB 3CK0L 3MBED 4NWUH 2OR9H 5F7NC 2PYEA 3GJEB 2XQBL 3LKRA 3EJYC 1IKFL 3H3KA 4GRMB 4EDWH 3AS2A 5C7XL 1KPRB 2CRIA 3OKNA 3MRCB 3WIIL 4PJGB 4PBWD 5C2BL 1HILB 3H7LA 1RULL 1QPXA 1W0VA 5IMLA 1G6VK 4PUBL 1I85A 4EUPA 3FT2A 3FB6A 4R7DA 3QDJB 4XCNB 3WHE0 5GGSA 4IMKC 1NDGA 3UYPA 1SQ2N 5KSBA 3TP4A 2IFFL 2PXYA 1CFSB 4NFBA 5I16B 4G8GE 1QFWI 1KC5L 1D5ZA 1ORQA 4TVSa 4Y7MA 1NAMH 4PJDE 3PV6B 3LY6A 4X6DF 1CQKA 1DBBL 5DD0L 5EULV 1QSFE 2QQNL 5DI8A 4M4PA 2D9QB 5FYLH 3HPLA 5D7IA 5HYJB 1N8ZA 1VGKB 4QOKB 1CZ8L 3IJYA 3SCMC 4YGVA 5GGRY 3R06A 4XC1L 1VEOA 4LMQE 2IPUK 1NJ9A 1HHKB 1FORH 4HKBB 5DC9B 3QIBC 3FOMB 4PGJA 4R4NC 2I5YH 4HIHB 4M93B 4E41E 4MS8C 4HUWA 3LEYH 5B39A 3QEQB 1OAQL 3SKJH 2HFTA 5BOZG 1EGJL 4BUGA 5CZXD 1S7WB 5E0QA 2H1PL 3LN9A 4KRLB 3HN3A 4PRHA 5E2VL 3MLUH 3MTRA 5FYKU 3U83A 5DVMA 3UAJC 4FABH 2XTJB 3MRPA 1IAMA 3LRSA 2B4CL 1NGWA 4HK0A 1UM4L 4HC1H 4J3OC 5DEZA 2IH1B 4U6HA 3LN4B 4Y4KD 5HYFA 3SGKC 2QTEA 1DSFL 4OZFA 2IAND 3PWUB 3T65B 1ED3B 3MRQA 2ZWLT 1BVKA 1NKRA 2YPVL 4IRJB 1EHXA 4NQED 4OCYL 4ZFZA 4UNUA 1OTSD 3Q48A 2MKWA 3DROB 4EI5B 1NSNL 3QO1B 1D9KB 4YAQB 1F6LL 4OKVA 3FN9A 4U1HB 3IRPX 1CXIA 3VXUD 4RZCA 1RVFL 4R2GD 4ZUWB 4HLJA 4N1CA 3IKCB 2QSCL 2OZ4A 5EUOE 4D9RD 5ESQB 5E24E 4TYUA 1EMTH 3IKKA 3P30H 5D7LE 1LO3L 2XFXB 3P2TA 4Z76A 1EXUB 2UVEA 3CXDH 2BVEA 2DKMA 1TIUA 1E6OL 5BS0E 4PJEA 2AJSH 4LFHG 5HDBE 2FIKB 4LPVA 1X5XA 1BECA 1HKLH 1I8LA 1R5VA 3OTTA 4L8BA 1NCCL 1PYWB 2JCCB 5ALCH 3K4DA 3BGMA 4JFOA 4D0DA 1LNUB 5IHUL 2V5MA 3LB6C 4FFVD 2AK1H 4BKLA 4WFEE 2EDKA 5D96C 1QFPA 4RRPG 1CTOA 1K9TA 2Q76A 2BNQA 5C0CB 1KG0A 1GGIL 1UJTA 2NW2B 1MI5B 4Y16B 5C86A 5CLTA 1UWXK 5F9WC 4MJ4A 2V2XA 1FFNA 1U8KB 5DVOA 4ZS7L 5E2WL 4DVBA 3FQNB 3PL6C 1YPZE 1UWGH 4HPYH 3ZYJA 1X5YA 4GKNA 4KRPC 2W0FB 5ISZD 3U36A 4MJIB 3PDOB 4MSWA 1CDYA 5IWLA 1HHGB 5LAXB 3QDAA 4P46D 3AROA 4X6DB 5DUPH 3O6KL 4X9HA 3V95A 1NBVL 3GI8L 4MA7L 1J7VR 1CD9B 3F7VB 4I0KA 5BW7C 2VC2L 4PJ5B 5SV4A 3EYOB 5TFSL 2IAMC 3BKCH 4Y4FB 3ZLQC 5HVGB 4F7PA 4HHAA 3V6ZA 2AJXH 4Z8FL 3SE3C 1YDPB 2QHRH 4E42B 1RZ8B 1YMMA 4Y5VA 4FZEL 5LQBH 4GMTL 2EYRB 1FH5L 1MJJB 5IKCA 4OB5H 4CDHA 2CLRB 1A4JA 4X0KB 2GT9B 4ZUVA 2MOVA 4KK6D 4EUPH 5MEPB 1Z2KA 2KPNA 4FZ8L 1AC0A 2ZCHL 3TN0D 3VGDA 3SY0A 4X4XA 1FFOB 5AWNH 1YNTB 5J13B 2QADD 3LKSA 3P4MB 5D2LE 4KFZC 1CT8A 2OCFD 5BCAA 1S3KL 5A16A 4FXLA 4R96B 4YQXL 4U1SA 5E7FA 3F58H 4XWOC 5IB1A 1KIPB 1N4XH 1EDQA 1OT2A 1N0LA 4JHAL 5EU6A 2AW2A 5C0AB 5HYIA 3VCLB 4XP4H 1KCKA 5CJ8A 1LO4L 3P0VH 1N26A 3TFKD 5JR1L 4YZFF 3OKMB 5D6DA 2VXVL 2OTUA 2UWEE 3OXSB 3MCG1 1S9XA 5E8NA 1ORSB 4YBLB 3HE7B 1PFCA 2O61A 4L3ED 4DUXA 4HF5L 5JOPD 4DWHA 3EYVA 4NQEE 1IARB 3W0WA 3I6GA 2J6EA 4Y4HA 1ZEAL 3HI1B 1VCAA 3IDNB 4LKXA 3NZHH 4KGLA 4PRIA 3ZZ1A 2DQCL 1F3DH 2OI9C 3L5JA 3PWLB 1WCBB 1SEQL 3IJSA 8FABA 3GKWL 1GZQA 3DETC 5T5FL 3O3DA 1MJ7H 2XN9B 5ILTL 4TOYH 5J6HA 3ZKQD 5FCUL 4OZFH 1E4WL 5HGGS 3LRHA 2OYPA 4LVNB 4MVBC 5J57B 3IU3B 1IGCL 1XZ0A 4Y1AD 5IBTL 1NUNB 3SDDD 1EVTC 5E5MA 1OB1A 5JW4M 2GTZA 1LEIA 2AKRB 4Q6IB 5CP7B 3S4SB 3P77B 4ZFGL 1OSPL 2GJZB 3UXFA 3DURA 4CU7A 3HS0B 4PBXA 4A6YA 4GRLB 1MJUL 3SHSA 1YYML 5EFIB 4FQLH 4WWKB 4LCCB 4JQXC 2FGWH 1MFBL 1R3IL 3EDJA 3IS1X 1BEYL 3C6SB 2O5XH 1CDBA 4G6AD 1PGRB 2X4QB 2MQ3A 3MNVA 4OUOA 4HIJA 5IIEB 1JZ8A 3T3ME 2GAZA 3CUPA 3EYSH 5JOFB 4O9HH 2DQIL 3SDAB 1X5ZA 3UPCA 4LEXH 4JDTH 4UU9B 4FFYL 1QFWL 3QULB 4YEFA 4YHZL 4LSDA 1SY6A 1CICA 5HHQA 4YIQA 2XQYK 2PO6A 4BK4A 1P4BH 3I6KB 4XP5L 4JFFD 3WFBH 5ICZA 3CFCL 1OT1A 2V7NB 3ARGA 4Y89A 2BY0A 3QA3B 4D9LH 2IMMA 1AR1D 3MROB 2EIZA 2CLVA 3UDWA 3U2SA 4Y2DC 3OKKB 1FJ1A 1FV1B 1JCKA 1UYWL 1KB9J 3O11B 5DWUL 1F00I 4QWWD 4K3EL 4TPRL 3WO4C 1KTKE 5TGBB 4HJJL 3ZSSA 1OGAD 2Z31C 4Q9QL 2QL1A 4V2CB 5D70H 4EDXA 3RIFF 4YHOL 3CSYA 2P45B 1OAXH 2A77H 1OCWL 1S7QB 2P5WB 3MUJA 4LCYA 1IC4L 2DQGH 4X99B 1KB9K 4NOFA 4ETQB 1QBAA 4NNPL 1DQQB 2R9HD 4KXZI 4TQEL 3DYMA 1XF4A 2VXSL 3MV7A 3RTQD 1YEIH 3V0WL 1ZLUH 2VLMD 4L9LA 4U2ZA 2YMXL 2P24A 4UIKL 5BVJA 4MJ5A 3WV0A 1MH5B 1GGBH 1KFAL 1LO2L 2JB5L 3W2DL 5GS2H 4WFHD 3OKEB 5T1LB 3SN6N 4ORGA 3RX7A 1HE7A 4M9PA 5K9QG 3Q3GB 5ABDE 1GHFH 3G6JF 2CIKA 2K9UA 3VXMA 3QIUD 5CD3A 4I4WB 1BD2B 4XPAL 1S5IH 1WITA 4MA3B 4KVNL 1XF3B 3SDCD 1MRFL 1WQVT 2ZG1A 2Q7YB 4LHUB 4KPHL 3BD5A 1C5BH 5IBLC 4XHQA 2CO7B 1GGYA 2VISB 1A47A 3NVQA 4QY8A 1AGEB 3ARDC 3UPAA 2YD6A 4PFEA 1G1YA 4R4BA 3TV3L 5T3XD 4X7EC 5C9JA 4NSKA 1MPAH 5F9JA 1PG7W 2D7QA 3NCBB 4PGBA 4E5XB 1FVEA 2NXZD 3VU2A 4PRAA 3DGGB 2ZUSA 1RU9H 5KANG 2VWEE 4JFDD 4XP9L 5FYKD 5FA4A 3WUWA 3QEHB 4L3EE 5JOPE 1F13A 5MENA 5CP3A 1KOAA 2K3TA 2MSPA 4PP1C 4DGIH 3GO1H 2VLRD 1JGVL 3V4VH 4PTUA 4FQIL 3VE0A 1ADQA 5FUOL 4P9ML 2ESVE 3ZE0F 2H26B 2W59A 4K3JH 2EIDA 3MCLH 3PHSA 2VKWA 2D2OA 2WAHA 3NA9L 3VI3F 3I3DA 3H6JA 3LPFA 1KXVC 2J6EH 2DWEA 3MLVH 4Y1AE 2FSEB 2VDRL 1WBZA 2NCMA 4U7MA 4RIRA 2BSRB 3DXAD 4P5TA 4IRSA 3RIAK 2JLLA 3NA4A 4ZQKA 1I7RB 2NLJB 4HQQL 5JOEA 9CGTA 3IXTA 4F7MA 4RGNC 3ZKXB 1DANT 4LSQL 4MQXC 5HGDA 1U58B 2XKNA 5FKPB 15C8H 5J89A 3TH2T 5L88L 4ZNCD 3QNZB 1AD9B 4XPHL 1FZMA 2OJZH 1F8TL 3GMPA 5HY9B 3K1DA 2H2PC 3EJYD 4XGZA 2VZSA 4UUJB 4CL7A 4Z7WB 1MIML 3IAPA 1MCRA 3HLAA 4QXTA 4YNYB 5IFAH 2VDPH 5SX4H 1NC4A 3O6MH 4NZTL 3DVNB 5HYQA 2YZ8A 4N0YH 5ICYB 4RAUB 5T1KD 3MV9A 4A6YH 5D1ZC 5IFJB 3NMEA 4LRNH 2R0LL 2YPLD 3OG4B 1WZ1L 1K6QH 2K7QA 4LGRB 5ANMB 4KRNA 2I26N 4IMLB 5E9DD 4LFHD 3RNKB 3D85B 1NFDF 3BFOA 1YEGL 2WK2A 4OGZA 5HJ3A 3OF6A 3TH3T 1SY6H 1F11A 1P9MC 3VFGH 3WNMA 1KF9B 4H5SA 1QZ1A 3BO8A 2Q3AA 5DQJB 1L9NA 1AO7D 1U42A 3QIBD 2WWKO 4R4ND 3V4UL 3KPSB 1EVUA 4MS8D 2HFFB 3QPXH 4XBPB 4XVTL 5FO7A 4XVUC 1AHWA 3EZJB 5E56A 4CU6A 4KHTH 4NPYA 3D18B 5LVEA 2WINB 2EEBA 2VLME 1ZXQA 3A6CL 1EAJA 2J5LC 1WBXA 1U8PA 4CMMA 3G6JB 5HPMA 2FO4B 2IPKB 4XZUB 1MHEB 3OB0H 3C2AL 5CCKH 5INDA 2Z8SA 2OQJB 4WFHE 3CC5B 2Y06H 4NYLB 3UAJD 3HKFA 4QRUA 2DTML 1RUPL 3CFDA 5A2JH 4XPFL 2NY3C 4KWUA 5J9PB 5I17B 3UX9B 4B7LA 4MAYB 5ADPL 3U4BH 3CLFH 1F5WA 2YXMA 2DQUH 5F7UA 5IB5A 1X4ZA 2AK4B 2RB8A 3GSOA 3U6RA 2N1KA 3EYFB 5FM4A 4LBEB 5GGUB 1IC7H 2BY3A 2EE6A 4X5LA 1HSAA 3ESUF 1FL6B 1IZKA 3QDMB 1SBSL 2V2TA 1VA9A 1T22B 2VITA 3JTSB 2WBWB 3AMKA 1GRWA 3B9EA 4JFDE 4TNVK 5IM7B 1NMCC 4HULB 1T20B 4QRSA 4YHPB 2P8LB 5C07D 3RAJL 4H8WL 3U7AA 4K7PX 1UB6A 1UH4A 4K23H 2YD5A 3CPLB 1W8NA 5HD8C 5KJRH 3KPTA 3NCCB 5DR5H 2EC9U 4X7SL 1HKFA 2JKXA 4TUJA 4OI9A 4IS6B 3MRHA 4RQQA 3OJDB 4QYOB 4I77L 1KJ3H 3B4NA 1PG7L 2R0WL 4YZFE 3LB6D 3MUZ1 5GSVB 4PY7B 4WHCA 3ZDYE 5BV7H 1IT9H 1T83A 4LCUB 3EOAA 4N8PA 5FGBA 4NO2A 1J1PH 5CP3H 3U0WL 1N0XH 4NO3B 4ODTL 4JKLA 3DPBA 3VXOB 3KDMA 1JBJA 1T1YA 3HRZA 4F58L 1CU4H 3AAZB 3HG1E 1ADQH 3U0TA 4OD3H 2R0ZL 1VEPA 2VLKA 4AEIH 5JMRA 3K3QA 5L7XH 4Z7VF 3MV11 3WJJA 3HC3L 1CXHA 2XPGB 1MUJB 2W0PA 1F58H 2EC9T 3MRKB 4WV1A 4KRPD 1CVRA 1NPUA 2HJKB 4OT1L 4RNRA 4TNWF 2P8MB 3QB7C 1ZV5A 2XIDA 2BSED 4KC3B 4ODVH 1A6VH 5DEGB 3VXSA 2G5RA 4M7LH 5CSBA 1DQDH 1NFDB 4MXVF 5CSGA 2Q86B 4FQHA 5AYQA 4D8PA 1KNOA 5CJQL 2HKHL 4ENED 4D0CB 1QLFA 3DBXB 4TVPL 3F62A 3TC9A 2IAMD 4YR6A 4I9WD 4W68A 2J1KA 5E9DE 2X05A 2HWZH 3DIFA 2C3GA 3U9UA 4EUPG 2VXUL 1FL5A 4DVRL 5J56B 1JPFA 4HFWB 3O45A 4CVUA 2HFEB 2HJLA 2IBBA 3D9AH 5I66B 3PJSA 2X44D 1Q94B 3HZVB 2FD6L 3DMMA 3NABH 2ZJSL 2M2DA 4HGWA 5DJ6B 2HFGH 5FO9A 4F7TB 1GJIA 1BZ9B 1HQ4A 5E00B 3DV4A 4G8IB 3HI6L 3EFFB 1I8LC 4NHCH 1G9ML 4KTDL 1WZMA 5HGHA 1OD7A 1NGXA 5I30L 3LEVH 4XWOD 5E8DL 1MF2L 1MNUL 2A6DA 1OAUL 2W65A 3SBWC 3J8F7 2VZUA 5ENWB 1JJUA 1JF5A 3FN0L 1PY9A 5L8LB 5IFHL 1UWXH 2JE8A 1LP9E 1R3HA 2F5BL 5B39G 4NBZB 4ERSH 2I07A 1J05B 1NAKH 4JN2A 3QIWA 1UCBL 1HHIB 3VDAA 1DLFL 3ARBB 3RUGE 3BP5A 5E2UH 4OF7A 1T3FB 1X5GA 3SGEH 4G8FB 5T33H 3PGCA 4UIMA 2AJ3A 2DLFL 5I6XC 4N0UB 5C6PB 1FNSL 5DGQA 5FECA 2QKIB 4U6VL 1RV6X 4MXQD 5F9OL 4AY0A 1U8MA 1G7JB 3MLRL 4YXHH 2OR7A 3VRJB 4OZFG 3DETD 5K33A 2D03H 3LN5A 4NO5B 4OTXH 3FQUB 4DKEH 4WI6A 1ZT4A 1QNZL 25C8H 4W6YB 1T0NA 3F7QA 2UYLA 5EWIL 2VDKL 2CH8A 4MVBD 5C07E 1JF1A 2R56L 2R39A 2F54E 2R2BA 2WBJB 1EBPA 4LLQB 3RDTB 4K7FA 4UOJA 1QLRA 4M9OA 2WZPD 3ZO0A 2NY5H 2AABL 3WYRA 3OGOE 3BQUA 4XNMB 4OZIB 4GRWE 5GRWA 4DAGH 3D48R 4Y5VC 2QQLL 5DFTA 1ZWIB 1T80A 1UKTA 4GSDH 2CMRH 1NLDH 3MRRB 1T1WA 4OZHE 4NQDA 3MRNA 3GFUA 5HXMA 3O2DA 1CK0L 2VLLA 3C9NA 3HZKA 4BSWA 1AP2B 3G6DH 1ZGLP 2GJ6E 2BHZA 1U8LA 5IG7A 5JMOC 3AY4A 2P49B 1HYRC 3TA3C 3GBNL 3ROOB 5C0EA 5D5MA 3JZ7A 1TVHA 3O4LB 5F7DB 5TQ0L 1N5YH 1VESA 4P2RE 4NCC1 5B8CA 3ZE0E 4MNHA 1YQVL 3SDXF 2FWOB 1JHKH 5EO0B 3HC4L 1NQBA 3ZE2E 1D6VH 2G60H 1P5UA 1FHGA 4FTVB 1G7QA 1J0IA 3U7YL 3VI3E 1MCWW 4OF6A 4K9EC 4Y2DD 5D1QA 3VFUB 4TVPE 5GZOC 1SJHB 4JO1H 4RGOH 2D0GA 4PTTB 5I71C 4NUGH 1MAML 4WW2C 3U82B 4KMQA 4F9LA 2PW1B 4JRYB 1L7IH 3D3VA 2X4OA 1CD1B 1JNHB 3ZHDA 4JLRA 1D5MB 3C5SB 3QP3A 5CIPA 1KB5H 2P44B 4XWGL 2DKUA 2FGZA 2HRPH 4Y5YB 3VG9C 2AGJL 2A73A 4GQ9L 4IRZH 2J4WH 4JFEB 4I9WE 5B4MC 5DC0A 4CW1A 4JFPB 4WHTB 5C0DA 1K8IA 2KKQA 1YJDC 3O2WH 4HCRA 2EDNA 1V3JA 1KPVB 1FLRH 1U95B 1HH9B 3TYGL 1XCTB 3V6FB 3VI4F 2Y9RT 3HE6D 5IK3B 5KS9A 3HNSH 4HG4J 5EZOL 5I15H 1N5AA 3LQAL 1IAOB 1H8SA 3RNQA 3VW3L 2KQNA 4J4PA 2N4IA 3QHFH 4OCRL 2IC2A 3U1SL 3MLTB 2HA1A 1A7PL 1A7BA 3G5VA 1S7RB 1RZ7H 4KJQD 4NWUL 5FGSA 5JDSB 4CDGC 3L3JB 4YK4B 5C0BB 4HG4K 2H9GA 5CILH 3U30B 2VN7A 3WFEL 4EDWL 4JM2C 1HWGB 3PABA 3MRJA 3RZCC 2E6PA 4Z0XB 1S9VB 1CGXA 4H26A 2EO9A 3QNXA 3CZJA 5FK9A 1C12B 5EO1B 3ARDD 4I48A 1X6LA 2D3VA 3CFBA 1DBMH 1NH6A 3BGFC 4I0PA 5FYLD 3T8XA 3RWHA 3PWPE 3GIZL 4RGMC 3UTZA 5CFHA 3NBNA 3BP4A 4QXWA 4WO4C 1NCTA 5IVNA 4JFHD 4LCWB 1NAML 5IVXB 5D7JA 1BBDH 1I3RB 1CICC 3EOBA 4U6YB 4GAFB 4JN1L 1K2DB 1K4DB 4UQ3B 3UTTB 1OAYH 1UG9A 4NRXB 3KPOB 3KPPA 1Q38A 3ARGC 2OTWB 4K94C 3GGWB 1ZGLA 1F6AA 1RZFL 4PP1D 4HKJA 4HDIA 2DM2A 5AEAA 2PR4L 5DDHA 5KAQG 1P5VA 2YUZA 1FORL 3MBXL 2ZUYA 4RX4D 4Z77A 2BFVH 4ODSH 5B21A 3SKJL 5I1LB 1QHPA 4CVZB 3RBSA 3QRFM 4TRPH 1A9BA 1MWAA 3DTXB 3I3BA 3W39A 1JK8B 4B5EA 1KULA 3D0LA 5IW3A 2D31A 4HK3N 1OP3K 3MBEB 1IGJA 2EDBA 2APTA 3T0DA 4JFYA 3AXLA 8CGTA 3FB7A 1UVQA 3ILQC 5E1HB 4QRRA 3BT2L 3M1BA 4RGND 4NRZA 1KCVH 1UACH 3IAGC 4M61A 1MLBA 4PJ7F 4PP2A 2AXJA 3PWNB 4QTHB 4KZDH 3LV3A 4YXKL 4P57A 3SDXB 3IXAB 2H2PD 4P3CL 2D4FA 3T1FA 3DHMA 5F97E 2AXHA 3C6LD 3RY5A 1XF2B 4JZNB 3ZMRA 3FHQA 2XA3A 2P5EA 3KPRA 4APQA 4LLDA 5FIEA 1ZAGA 4Z0BH 1TJIH 5HHOD 4OCWH 4PJEF 1L7TH 3BJLA 1MRDH 1U8NB 4JJ5A 3O2DH 5DJ2A 3SKMB 2ZSWA 2GKIA 4I0CC 4RAVA 4QF1B 2YR3A 1JZ5A 2C26A 1HINL 4OD2A 3TIDB 2BVOB 3P30L 3SKNB 3ECBA 4GKOA 4IIQB 4WEBH 3D39B 3O9WC 5SWSB 5DSCA 1CS6A 3B8YA 2AJSL 4HBCL 4PJ9D 1G9NH 4MAUL 1A7OL 4RMVA 1T5WA 3Q0HA 4NDMA 4Z7VE 1Z5LB 4J12A 2AK1L 1A9EA 4NKDA 3DUSA 5FB8A 2H32B 4R7NB 1J1XH 1LK2B 3QO0B 3KNBA 4PB9L 4ZFOB 4DKFH 4DEPC 3GJFB 4WCYL 5DD6A 1U9KA 1DN0A 3RX5A 4C56D 5CIPH 2IANB 2NY4D 3WN5B 3T4AB 3MRBB 1A8JH 1B2WH 2NY3D 4NUJB 4UAOB 1QLEL 2VDQH 5FYJL 3W81A 4OV6F 3MFFB 3ULVH 4QHKI 2DD8H 4OAWB 4CRPA 2GCYA 2PYED 2BHUA 4U1JB 4P3WA 3VXUB 3SDYH 3BPLB 1QVOA 5F6HJ 4GAYA 3QUZB 1M4KA 2VRAA 4ZO7A 3HUJF 5F88B 4QRQA 2H3NB 1JHTB 2YN5A 2OR8A 3LDBC 1Q9KB 1I8MB 4JFHE 2ZCLH 2AJXL 5KSUB 5MI0C 5GJTL 3BPCA 2VZ3A 4U0QB 1QSEA 2NY6B 2PXYD 3OKDB 5F7MC 4PJXA 3V8CA 3SE4C 3TCLB 3L5XH 3M8OL 3RVVC 3O3EB 4AQ1B 1Q72H 3CU1A 5DVNA 4WEMB 5KN5A 1GGTA 4J6RL 2DQDL 3RWFA 4J3XA 1OVZA 1TCRA 4A2MA 3IAQA 1Q0XL 2A9NL 3EJJX 3G5XB 2XV6B 3S6CA 4Z18A 4GW1B 3MRIB 4RDQF 4YHKH 5CSZA 4AZ8A 3A6BH 4GG8A 1NCAL 1H3UA 3MZGB 3X13A 2XY1A 4XBGA 1I8IA 4OLWH 1BFOA 1TDQA 4HWEH 1TJHH 1HHJB 4PS4L 1TITA 1IC5L 2Z35A 3OV6A 3WS6A 3DX6B 4F33B 2G9HA 4OZGA 1IC1A 1K8DB 1DEEB 2DTSA 1IQDB 4JANB 4JFXB 1R3JB 3L3GB 4AEHH 4NQXA 5F7KC 4MQTB 5ISZB 3P0VL 3QDGE 1AKJD 3N50A 2DQFB 4PRHD 5BZWA 1TNNA 2CDGB 3E2HC 5GGVH 2E8YA 3WHXB 2KBGA 4WNQA 3D25A 2ICEB 2GSGA 4U1GC 3L7FB 2R2HA 3OL2A 4QNPE 1MWAH 4JRXA 1KGCE 3EAKA 4OM1H 3QJHA 3QUKA 5DD5L 1BVLB 3U4EB 3ZT5A 3IDXL 4HS6A 5AG9A 4P59H 4G80A 4JREB 3VRLF 1MJ7L 5IV2A 4TOYL 4MNQA 3TO4C 3ZHLA 43C9A 4ODHH 2Z9TA 3A0OA 5TQ2L 4JEGB 4ALAH 1F90L 2APWA 3LMJL 3T4YA 3ZYZA 1LHZA 1U3ZA 2XZQH 1WISA 2XA8H 3DV6A 5J1AA 4M5YL 1ITCA 3TN0B 3PE9A 4R0LB 3MMEB 3P0YL 2QADB 4BH7A 3CSGA 3O3BB 4GQPH 3VFSB 1A5FH 1QRNA 5FF6B 3OR7B 1YN7B 1W8OA 4JGMA 4CMHC 4U0RB 2FGWL 1QR4A 3IFLL 3MRGB 3ARQA 2BC4B 3B3IB 1DUZA 2OZ4L 2PTTB 5EU4B 4KK5C 5DVLA 5ITBH 5KSAA 1NEZB 4FA8A 1W0WA 4G9FD 3EYSL 2UV3A 5GGTA 4C57C 4WU7B 5DK2A 2NY0D 4JDTL 4EZMA 1IEBB 4UV4H 5FYJE 1DVFA 2XNAB 2V6HA 4L8SC 4G7VL 5K9OB 4C56E 1OY3B 2BNQD 5I0DA 4UDUA 3TNNB 3REVA 5GISH 3UTPE 5EA0H 3VXRA 3WDJA 2C7UB 5FKAA 5M94B 4D9LL 4M7LT 5CEYB 1G7HA 3VWJB 5KG9A 1YC7A 3QCUH 2PYEE 2XWJB 5GIRB 1TZHB 3MSPA 4PYGA 1I9RL 3GSUB 4K8RL 3CLEH 4XPBH 1PLGL 3MRLB 1VADB 5INCA 3O81A 5B38A 2PTVA 2OL3B 4G6JL 4U7SA 1Z0MA 1OAXL 3L95A 1T04A 4UTBH 1MCBA 4KI5C 4L1HA 1RD6A 4Y1AB 3RRQA 1DE4B 5KSBE 1TQBB 1F4XH 3FQXA 2FHCA 1YEIL 1BOGA 5A2LH 3FT3A 5EZJB 4DK3A 4RFEA 2BNUB 1S5HB 1T6WA 1ZS8A 3DI2B 1VFUA 5SWZB 4QXUL 1EZVY 1JWMA 4NN5B 5D7IE 1BQHA 4M6NL 4HAGA 3OAZK 1MCDA 4ODXB 5DA0B 3LIZH 2EYTB 5E94A 5IOPA 1UENA 5JUEH 4YBQD 1NUFA 3BMWA 1JNNH 3HR5B 2FX8H 3B9AA 5IESL 2E8ZA 5C0IA 3TA3D 3PWJA 1Q9WB 4N0FB 5IB3A 2NY2C 4NGHH 2GTWB 5J12B 4JFFB 4O5LL 1DBJH 1GL4B 5IHZB 1G7MA 5JZ7C 1NBZA 3GSQB 4LASH 3RVTD 4PRHE 2YSSA 3IDGB 2CKBB 5D2NA 2CLZB 1KPUB 2EIEA 5EU6D 3KPLB 4HH9A 1YA5A 2X4UA 1OSZB 4IDLA 1JUFA 3MXVL 4MD0B 4OZ4A 1OGAB 1RUAH 3BN3B 1QSVA 4HXBL 1DFBH 1TLKA 5DTFA 5DZNA 2YD4A 5GZOD 2D7NA 3NH7H 4PGEB 2LQRA 3ZE1F 1PX4A 3CCHB 3GHBH 4N90D 2QQQA 3BZDA 2X4PB 1S7TB 2WSKA 1IM3B 4P99A 4ZXBC 2VZ1A 4X6BB 3W0WD 2IADB 2B1AH 3OZ9H 3BMVA 4KVCH 3UTSD 1CFQB 2I25N 1ZA3A 3F65A 5IVZB 1OQXA 4K3JL 3K8MA 3MCLL 5B4MD 5I8CA 3GK8L 4Y5XA 5K9JL 3DUUB 2SEBA 3L3DA 3SE8H 1NMBH 2J6EL 4X6FA 2A74A 4M1GL 1X3DA 1RIVH 3RJDA 2R4RL 2PETA 3L9RA 4NFCA 2W0LA 4JZJA 3DYOA 4AM0A 1N6QL 4FQJH 2NY7H 2Z4QB 2YBRA 1YEEL 4NNXA 5B3JF 2BOBB 3ZTJH 5DYOB 4KQ4H 1ZT7B 1G7LB 2FRGP 3QIUB 2R0KH 4FQXC 4TUKH 3JTTA 1HNFA 3E3QC 3SDCB 5D1XA 5FDWA 4PJEE 5DK0B 3HMXA 3TF7C 4KV5F 1IGFH 3S37L 2R4SL 4G7YH 5FM5M 5MEOB 1RK0A 1HCFX 5DD3H 4N8VG 1U3YA 1UJ3B 3H9SE 5ID1B 2VMFA 1HHHB 4ZUUA 1N3NA 3WLBB 4F15C 3BD4A 2X4TB 5ID0A 2IG2L 1BZ7A 2VDOL 5MERB 3O6ML 5JORB 2DOCA 2NXZB 2BNQE 1CFVL 4FXKB 2E6QA 3QUYC 3AY4C 1FCGA 3MQIA 1BLNB 1J8HB 1TENA 1QEWA 2MJWA 5H2BA 1S9WB 1WZLA 3H3PL 2FJGA 4ZDHB 2E7MA 4JO2L 3GSXA 3W9DB 1HDMA 1U8QA 1K6QL 1Z6JT 1G9NC 1CICD 2NQCA 4TUOA 2VLRB 4XCEB 3DO3A 4LPWA 6FABH 3KWWB 5CLWA 2H6PB 3T0EA 3ARGD 4NT6A 1S7SB 4YDVB 2HN7B 3VWKA 3X11B 1T5XA 1Y18B 2VE6B 3BOVA 4CGTA 3LPWA 3ULUC 3DRTA 2HT3C 5F89B 4PG9B 5CJXA 2VABB 5GS0C 2YPKA 4UBDC 4F9LC 3DXAB 3INUL 2EKJA 3VGGA 2BVQB 4KHTL 4BM7A 2EXWD 4NC1C 1VFMA 2Y72A 2E7HA 2ICWI 4LSUL 5D71H 3RGVA 4U4BA 3ARRA 4JO3L 3B2UC 2G75B 4BZ2L 3JWOH 2AJYL 2Y36H 3WFHA 1F3JA 4BQ6A 4XNQB 4FQCH 4O4YL 4F3FB 2X10A 2YA1A 3REWA 3ULVC 4R90H 1YMME 3MV7D 4LEOA 5C08E 3ILQD 5KSVA 4R8WL 1CLOH 2HP4A 5DJ8B 2P7TB 4NKOA 1T66C 2DF3A 4DKDC 5DRZB 1NCBL 5C0RH 4NP4H 4U1NA 5GGQL 4U3XA 4J4PC 3H7BA 4TTGA 1A3QA 5KW9H 1F4HA 2GFBA 3CLFL 2A6KB 2DQUL 4OUUA 1FL3B 4X9IA 5T1KB 1DQTA 3KLAA 1CG9B 3OR6B 5JNYA 1QBBA 4XMLH 4S1RH 2F8OA 1MCEA 3VXMD 2YPLB 5DJCA 1RZKH 3JWNC 1Q9OA 4JE4B 1DQLH 4OF5A 4JPKH 3QCTH 2Q3ZA 3S36X 5J6GA 3MODL 3RPIA 3L7EA 2ED8A 4RMUA 5EU6E 4L5FH 3VRIA 3QFJA 3ZTNH 4DKAA 3I9GH 4PJ8C 5C8JB 5EUKB 2FR4A 1S7XA 3SCMB 2AXFA 1NCDH 4KMTL 2JB6A 1XGUA 3NFSL 1YPZA 3VFOA 3Q6FB 4G8EA 3BH9B 4KHXH 1NFIB 2BCKB 4M7KH 3MGTB 3QJFB 1N2RA 4UINH 5IB4A 2DYPB 5D9SB 1AO7B 3QIBB 5DR5L 1OLLA 1Y6NR 1FRGH 3SO3C 5CWSB 4NJ9H 1LEKA 2UZIH 5JXAH 5TH2A 3QEUA 3BEWB 3W0WE 3C8KA 1P4IL 4NQCA 4YDJA 2BVUA 2DM3A 5HTSA 4PRIE 5E6ZA 2Y23A 4RFNC 1QP1A 1T4KB 3R1GH 2I9TA 3AB0C 4H0GA 3B8SA 3AM8C 1HSBB 1B88A 5BV7L 1JPTL 1IT9L 1RURL 5EZIL 3BDYH 1N0XL 1E4JA 3OX8A 2CR6A 5LXGH 3MYZA 1XGRB 1MLCA 4L29B 3SGJA 2EXYC 5HHMD 2CKNA 3RUGB 3OAYK 4WUUA 3SPVA 5HGBA 5L7XL 3O6FC 1OP3H 3IDJA 1KACB 1EGJA 3GMNA 4O51B 1DBAL 3BKYH 3GJEA 1FVDB 1H9VA 1F58L 5AYUH 2Z91B 1JVKA 1I75A 4JKPH 4GRMA 4NQSB 2HJFB 1I7UB 1KPRA 3MZTA 4OQTA 3FQTB 3MRCA 1J86A 4PJGA 4BUHA 1HILA 3I2CL 1U8OB 1LO0H 1A6VL 3S3PA 4XCNA 3QDJA 1DQDL 3K8LA 5AUMA 3CMGA 4ELMF 1CFSA 4X6EA 4LQFL 5I16A 5C07B 1AXTL 1ACYL 1YMHB 1NC4D 5LCVL 2BJMH 5EPMA 3WFCH 4C55A 4APQC 3VXNB 3PV6A 4AK1A 4F9PA 3MV9D 4FP8H 3RKPA 2B39A 2HWZL 4S2SB 2F58H 2WANA 2ERJC 4PJBB 4LKCB 3GSNB 5HYJA 1VGKA 4QOKA 1KIUA 4XNYH 1B0WA 2OP4H 3MOBH 5D96B 3D9AL 3RJQB 1HHKA 2A83B 1B6DA 4PJCA 4MHHI 3NABL 4HLZG 3UEZA 3FOMA 2HFGL 4HIHA 2C1PB 3QEQA 2HKFH 1CTNA 3LKNB 5F9WB 5DHYB 1S7WA 1AXSB 5C0NC 3OAUH 3E6HB 3R0NA 4W4OC 2HLFD 3BP7B 43CAB 3PL6B 3MV7E 4HW6A 2R1YB 3DSNA 2G5BB 3NPSC 4M7JH 5GRUL 1CLZH 4ERSL 1NAKL 2IH1A 3LN4A 1YEKL 4OBRA 3PWUA 3T65A 1JNLH 5EU3B 4FQPA 4Q0XH 4IRJA 5T33L 3MYJB 4TULH