2NMSA

The crystal structure of the extracellular domain of the inhibitor receptor expressed on myeloid cells irem-1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
112
structure length
112
Chain Sequence
GIPQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Extracellular Domain of the Inhibitor Receptor Expressed on Myeloid Cells IREM-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CMRF35-like-molecule 1
total genus 27
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nmsA00
5D1QA 5D2NC 1N59A 3K2MC 2OBGA 4XC1H 5D96B 5DYOA 2CDEB 1I9JH 3O6ML 4NJ9L 4JQXC 3KYOA 4OBRA 1G84A 3O2DA 3NMEA 3TC9A 3Q48A 1CFQA 2AEQL 2VDMH 1NC2B 4PY8I 1JHLL 5TE4L 1BP3B 4LVHC 5HHVL 4JHAL 2IMMA 4WHYG 3M1BB 4Y5YA 1C5CL 4WW2A 3LKSB 2P8MB 1KC5H 1MRDH 3I3BA 2P4AB 3CSBA 3C5ZD 4XCFH 5C0GB 1MCEA 1MRDL 3V5KA 2VXSL 3PQYE 3KPNA 2R8SL 5DT1H 2P5EE 4UDUA 2YPLE 1T22B 4K3EH 3SDAA 3X13B 5IB2B 3N85L 1NCDH 3R4DA 3HI5H 1IKNC 1NEZA 3VDCA 2HVJA 3QNYB 5LGKA 4WFFD 1ZLUK 4JFED 2D7MA 2LE9A 3SDDC 4LLAA 3FT2A 4UNTA 3C5ZB 4NNXA 4X6CE 4Z76A 4YE4H 4ZOBA 5DRZA 1O7VA 4RNRB 3MGTA 3SE9H 3IDMB 3QDJA 4XPFH 4KAQL 1CDGA 3RY6C 4PUBH 2FECI 4RGNB 2DQCL 3WS6A 5T1LB 4HJ0C 2QSVA 5TFSL 1VB9A 1CL7I 2ZJSL 1IQDA 3FO0L 1WZMA 4WHYH 1JI1A 4YLQT 1C7TA 4PV8A 2NXZC 1N7MH 3F7VA 1UKQA 2QR0B 5CEXB 5T5FL 2WBKA 1B0RB 2GI7A 4YBQD 1A7QH 5C07D 4GAJH 1JPGB 1JWUB 4XPHL 2YPLB 4KK9D 3TWCH 5I66A 4NNPH 4JRYD 4P3CL 2BRRL 2XY2A 9CGTA 4JLRB 1E6OH 3MRDB 3VD3A 4ZNCD 2NY5H 2AEPL 2E5EA 2LAAA 3GRWA 1FNEA 1JZ6A 1R3JB 3QFDB 2A6DB 5JLZB 4NOBA 2FHCA 5I1HL 1JPTH 1P7QB 1EZVY 3HMXL 1TETL 3DV6A 4YQXH 1BFVH 4G9FE 1A0QH 2NZ9D 4PJHB 1IAOB 4OZIB 3SDAB 3DGGA 4GAGH 3KPSB 2ZCLL 4QHLA 3OKMA 4AQOA 3O11B 3GSXA 2NX5B 3H3KA 2F5AL 1MFDL 1YNKL 1IC7H 2DM7A 1CFNA 3FT4A 4OD2A 4ACPA 3QWOA 5CJQL 3GDBA 1HQ4B 4ODWB 5FDWB 3I84A 1V3MA 4JPIB 3TO2A 5HDQL 12E8L 25C8H 1P4LB 5CZKA 4DZBB 3VCLB 2EE2A 1NH6A 3GI9L 3F12A 4PJ8C 5DRNA 4F8TA 4I2XE 4S1DC 5TH2B 2G2RA 4PS4H 1UJTA 3HB3C 3P0VL 1KCLA 2RBLA 5HGBA 4CVXB 4O5LL 2FH8A 1QLEL 3QG7L 4U7SA 4GRWB 5TQ0L 1QKZL 2GUOB 3FONB 4X9BA 4R26L 5JTWA 3QR2A 12E8H 2Q3ZA 4K94C 3MO1B 1ZSDB 3TT1L 3VRIA 1XF2B 2X89D 1AXSA 1RV6X 2MNUA 3LIZL 4DZBA 1CZ8H 5IW6A 2C4XA 3Q6FB 4J8RA 2FX9H 3HG1D 3SDXB 1YMHA 2DWDB 5EZJB 1FZMB 4M1GH 4L3AA 4JCMA 1QEWB 1NCTA 2NYYD 3OKOA 2BSTB 1FZOA 1T66C 1WQVT 3VGFA 2DMCA 4RGOH 4F9LC 2P5WB 2B8OT 1X5KA 4C56B 2W65A 4GQPH 3E6HA 1FSKB 1T0NA 2Y06L 1BLNB 1Q9LB 3PWPA 5FO7A 3FOLB 3UXFA 1FZJA 1MF2H 4ETQA 3VDAA 3UCRA 4UT9H 3W39B 5ICXB 3BZFA 2CUHA 4KKLD 4PJIA 2O61A 3VXOB 1UZ6F 4M5ZH 4RA3A 2YN3A 5IB3B 2VR9A 3L7FA 1I9IL 5SWQB 2AI0L 1GRWA 1AO7B 5I18L 4KK8C 4NO5A 4RWYH 4QHNA 3RVWD 5ALCL 5HYIA 3PGFH 1HKLH 1WFUA 2HLAA 2K3TA 3INUL 3CFKB 5FYLL 3JZ7A 2GT9B 4WI8A 2QQNH 3CX5K 1KCRL 1QFUL 4HJJL 3KPRE 4RWYL 3S4SG 3C6SB 2FO1A 2Q76B 4FQLH 2NXYD 1AR2A 2DYPA 5DJXB 4JN1L 5FA4B 1F5WA 3D25B 3IS0X 3V6OC 1U58B 2H2SC 4WHTA 1CFTB 2NXZD 4JPKL 3TCLA 4FABH 1FYTE 2YC1B 2QQLL 5IBLC 3UTTE 1WCQA 3QXAB 4CADB 3MJ7B 5ICZB 1A0QL 3EYFA 5L6YL 3FOMA 3MLRL 1DN2A 4TPRL 1JCKA 3OF6A 3TVMD 2G5BB 2KBGA 2VJXA 2Z35B 3L5WB 2V7NB 2PW1B 1PSKH 2R4SH 2A74A 4H25A 1CXKA 2ZP0T 3QXTA 3KR3H 4LSUH 4PJXF 2BNRB 4DK6A 3R0NA 4M00A 5KVGH 2G5BA 5GSRA 2HJFA 4KVNL 4NGHH 1BD2A 1M05A 2AXFB 3WNLA 1IGMH 4BSVB 1AJ7L 1DQQA 2DI9A 3DX9B 1ED3A 3QXAA 2DLFL 1SYVA 3QO1A 1YJDL 1XT5A 4WIQA 5GGQL 5CJQH 3DVFA 3T65A 4Z78B 4GMTL 1H9VA 1G7LA 3ULSA 3L3DB 2CDGA 1IEAA 1YEIH 4APQD 1WV7T 3K1KC 2RAMA 5CGMA 1FAKT 5I74C 1S7SB 4GXUM 4NQDD 5ADOH 2V9TA 5L0QC 2VIRA 4MD4A 4LCWD 5FCUL 4KK6C 4WNQA 3WKMH 5JIIA 1IMHC 3C8KA 3L3DA 2BZDA 3WEXB 3CXDH 3LKNB 1KJ2B 4R90L 2VXVL 4ZTOH 2VDQL 5BOPA 4S1SH 5CCKL 3FT4B 4OD2B 4PRAB 1ADQH 3LHPL 2IGFL 1DUYA 3LD8C 4XB7A 2DL2A 1KB5A 5K9OA 1K5NA 3IXTB 2YOCA 1NBQA 4U31A 3QNXA 1F02I 1OSPL 4ELKB 4AL8L 1TJGH 3EHBC 5BQ7B 2R0LL 4G6MH 2JLLA 2FLRT 2D31A 3QCUL 4YE4L 1XGQA 2IFFL 5DI8B 1UWEH 4MAUH 1G0YR 2NLJB 4HD9A 1QFWH 3FFCE 2ADIB 1FC1A 1CXHA 4ZFFA 1U2HA 1X4YA 5GS0L 4LNRB 1J1XH 5DURB 3MYJA 1D5XB 4AEHL 3T0DA 2A1WH 2SEBA 3LN9A 1DBAH 3DARA 1ZEAH 3AREB 4I48A 3RWFA 4PBVC 3QJFA 4BK4A 1DBBH 4K71B 4IIQB 3T1FB 3U0PA 4LNRA 1FE8H 4LASH 1ACZA 5C0JA 2PTTA 4XPFL 2NY6B 3V95A 2DWDA 4YHYC 3BMWA 5E4EC 4HIIA 4KJYA 2PYEE 4I4WA 4G9DB 4OF8A 5EFIA 5D1QD 5AWNL 5J1AB 1G1CA 1D5IH 4XTRC 5IMKB 4WVRA 5T3ZD 5D7IE 3H7BB 5T1KA 1DL7L 2DMBA 4M7JL 5I71B 2PCPA 1BBJA 3ARDB 5SWSE 1UM5L 5MEQA 2XTJB 1UYWH 1T66D 2FBOJ 1KJVB 5MEND 3MV01 4M6ML 2GJ6A 5F3BB 2FDBP 4J3TA 1N4XH 2NZ9C 1FYTD 2BOBA 3F62A 1KJ3L 4Q2ZB 3KPLA 1RK0B 1MJ7H 3O2DH 4HG4J 2AV1B 5ECJE 3KXFD 4I0PD 3SE8L 4PTTA 3OR6A 3VGEA 4H8WC 3Q0HA 4C55A 4OFVA 5DC9B 1YMME 4OCMC 2PO6D 4M4RA 1OAUL 3D1MC 1MHEB 3O6MH 4EUPA 1RK1A 3GUTA 1GAFH 2X09A 5M94B 4H5SA 3HRZB 1PD6A 3NZHL 3O2WH 2FBJH 2ZG3A 2ERJB 3DTXA 4FQXB 2EXWC 4P5TD 4RGMB 4FQXD 6CGTA 4XVTL 3RHWF 2IAMD 4JFHD 5E8EA 2D0HA 2ZG1A 3TN0C 3KG5A 4PRNB 1JHLH 4M4PA 3G04B 1D9KD 1L7TH 4KQ4H 3RI5F 1Y6MR 1HXMA 3L3KB 2QLVB 4JO3L 2AGJH 2GW5A 4U33A 1NGQH 3PGCB 4D2NA 2DQFA 5LWYL 1R24A 1T04B 4WFEE 4CVXA 1FIGH 1IGFH 3MV7D 1I9JL 5LCVH 1TJIH 1IAKB 3HMWH 4JGMA 3CFDA 1G7IA 1XIWA 3M8OL 5JZ7C 2ZOLA 1UCBL 1IQWL 2Z8WC 5J89A 1C5DA 5BMFH 4PD4K 2FJGA 4MNQE 3B2VL 5IW1B 1RZIB 1H15A 5MENB 2Q7YB 1F97A 2N7BA 1AR1C 2ZUVA 5EZOH 2ZUTA 1EEYA 5I6XB 5FUOH 3P4LA 1VFAB 3IFPB 4GKSA 4G8GB 2ZKHH 2YMXH 4H26B 3QPXH 3RIAF 1JTTA 3MLXH 3ZYZA 1SEQL 3EOAB 2A0LC 1T89A 3MRNA 5GGTH 4PB9H 5J1TC 5HGAB 4JY4B 5HI5D 2HJKB 4NKIH 4O58H 3PNWB 3FQTB 2FHFA 1J8HE 1FQ9C 1EO8H 5EN2B 2X1XR 4N9GB 5J57B 2OK0L 3JWOH 2E6PA 3QH3B 4PIRF 1NC4A 4XI5C 5HI4D 5C0DB 1L7IH 1FFNB 3QCUH 2H45A 3PWVA 3FFCD 1X5YA 5KVFL 2O5ZH 1S9YA 3WO4B 4P9HL 1FL3A 4Q9BA 1RK0A 4YZFE 2B7DT 3EHBD 3ARED 4K94H 3P77B 2VN7A 1LO2H 1FVEA 2CPCA 3G08B 1UA6H 3QUZC 4FFYH 1DR9A 3PV6B 1U8NB 2OTWB 3VFPB 4XNUH 5GRUL 1I8KA 2DQGL 4GRLB 4JFPA 4U6HB 2ICEB 1JJUA 4L4TA 4WCYL 3AY4C 1KXQE 4OJFL 4LAJH 5D1XD 3WFDL 1KCVH 4C56E 3NCJL 3B8SA 5GGVL 1G6RA 4RFOH 1VACA 1YEDB 2K9UA 4CUCA 2PW2B 2HTLD 1Z9OA 3QWOB 1U92A 4WUUE 2VWEC 1N6QH 4YHPA 2OL3H 4PJGE 4ZMAT 3SDXE 1UC6A 1NFDF 1I4FA 2RCSL 2WANA 4ZPTB 4UTAL 4QRRA 1EFXA 3V52L 3WYRA 5DMGC 1WCBB 3GMMA 3MXWL 1I7TA 1JYVA 3W9EA 1NFKA 4GRWE 1JTPA 1R3JA 3QFDA 5IQ7L 3NPSB 4Y4KD 4G8IA 4OF7A 3PDGA 5KAQF 3ZT7A 2IQ9H 3OGOE 3B6SB 1FBIL 3GMOB 2OCFD 3BZFB 5ACZB 3HC4H 5A1AA 5I1CL 4I2XB 1NCCL 3T0VA 5BS0B 3WIHH 4NQCE 5EG6C 4ODXA 1R0AH 2QSTA 2Q8BL 3QA3A 5ESAA 3WL9A 3EZ8A 3HE6B 4N9GA 5DJCB 3PP3K 3H6JA 4KI5E 1B0RA 4F7MB 2VDRH 5DGQA 2BERA 2BFVH 3OKKA 2IPUK 1U3ZA 2MQ3A 5F7YC 3L3HA 5AZEL 5EO0A 4TSBL 2H2PD 3H0TB 1GIGL 4JRXB 5DJDA 5DGRA 3ZHDA 5E99H 1S7XA 1Y18B 5JR1L 1OD7A 5E9DA 1ZHBB 5E2WH 4OZIE 2IEPA 4YX2L 2UVFA 3MR9B 4UQ3B 5CP7A 4NQDE 3IJSB 2VLRE 4JRWA 2EXWD 4MNQA 1DQDH 1CS6A 2XFXA 5C0ND 1UM6L 5FUZL 4JZOA 5ADOL 3KPNB 4JGUA 5KN5B 3INUH 3EOTL 5C0BB 4LHUA 5DUPH 4MNQD 1RQ5A 3X11A 5FO9A 3MRLA 1MNUL 5JPMA 3WUWG 1OAUH 5FYLD 2VLLB 2FYYA 5EORH 4L3EA 1NMBL 4Q9CA 4HEME 1UVQA 5FGCE 4JFOA 2YD1A 4AEHH 3BIKB 5E9DD 1KIQB 2C4FU 3SO3C 1S9VA 1NANH 4OUOA 4XVSL 1U8OA 2A9NH 2WQRA 4ZTPH 2EIZA 2E9BA 1IGTB 3IFOB 4NKDA 4ZFZA 2QR0A 3A67H 4KGLA 1T1WB 2YBRA 1EGJH 2ADGA 4Y2DB 3WFBH 2Q86A 1YPZA 4JPWL 1EEZA 2PUQT 1D6EA 1K8DA 3TNNB 2EXYC 5GIRB 1U3HA 1YEHL 4QXGH 3MLTA 5CS7A 1EXUA 1UT9A 2B1AH 3G9AB 2Z91A 5D7KE 1WFTA 4ORZC 4LDOB 3MRPB 5BO1L 2HFTA 4LRIA 1WBXA 3RGVD 1M1SA 4ZFOA 3RIAK 2DWEA 4Y4KA 4RFEA 4UINH 1QSFB 2HFEB 3WIIL 1KXTB 4MJIA 1S3KH 3QIBC 2GY5A 5EU3B 3SQBA 4DCQB 4WW2F 1L9MA 1MH5A 4JG0L 3VFMB 2P5EB 2ZOKB 3TV3L 3ZL4H 3AREC 3CH8A 4JDZA 3PQYB 4KMQA 5IHBA 2X4RA 4POZD 1G9NC 1QPXA 2C4FT 5CINH 4DGYH 3ZYIA 2A6KA 4HKXA 5D1XC 3DROB 5BJTA 3VE0A 1NBYB 1Z9SA 2QADD 4RFEB 4Q2ZA 3HAEG 4NSKA 3RPKA 1F6FB 1CG9B 2Y7QB 5E7FA 5IB3A 5C9JB 5CZXD 1ZHKB 4H1LG 4MQXD 3MRCB 1DLFH 3AGVA 2WBJA 4OBSA 1NDGA 2Q87A 3AY4A 1SYSB 2BCKA 2LABA 1BECA 4FMFA 3SKNA 3BMVA 1WUNT 3OKNB 3HMXH 3UDWC 1MCKA 1GVIA 4WWID 1LO5A 4WEMB 2ICCA 4LSRL 1BZQK 2Y36L 2EDQA 4HS3B 1QKZH 3D85A 2DQIL 4WFHD 1DQJA 5DD0H 1A7NH 3FZUC 4XBEH 3Q5TA 4DUXA 1T3FB 1YYLL 3ZMRA 4F3FA 1CICA 4LP4A 4PG9A 3HR6A 1D5XA 5D7JB 1KT2B 3FAXA 3D3VA 2F53D 1AY1L 2PYFB 3LS5H 3BP5B 3ET9F 2AJ3B 3FB6A 4KPHL 4Q0XH 1CGWA 1VGKA 3LS5L 5E8DH 4E0RB 4TUJB 1VPOL 3VFVA 3HAEB 1JWSA 2XG5A 1FIGL 1IGFL 1JFQH 3BHBB 3ZTJH 4Y5XB 1I1YB 4HQQH 4HT1H 3IS1X 3S97C 3FN3A 4BA8A 1C16B 4X8XA 4NHCH 1XGPA 3MYZA 4NQXA 3BGFC 1QPPA 5FYLE 1CDHA 4ZXBB 1CICB 1HH6A 1P53A 4K7PX 5F21B 3CLEL 3TO4D 4X6DF 3ARDA 4YDJB 3T08A 3NIGE 2YD2A 5GS3A 5HY9A 4HKZB 5D7LE 5T1KB 4HBCH 1QLFB 5J6GA 4MXWH 4JM4L 3WXVH 5KANG 3S96B 1CDYA 4XGZB 2D3VA 5F7KC 5I75B 2BNUB 5B3JF 4F80A 1IAMA 4AIZB 3N9GL 1HSAA 4RMSA 4WO4C 5EU4A 3IU4L 3VXPA 2Z92A 3E6FB 2ESVB 2WUBH 3GIZL 1S8DB 1TDQA 2VDNH 5HYEA 3MJ8A 3QSKB 1OAZL 1KTLA 3C9NB 4ISVA 1CFVH 4HSQA 1TVBB 4QOKA 1JI2A 2UZYB 1VFBA 2KL6A 4MQTB 3QAZB 1T7VA 2GK0A 3D48R 1QHPA 2Q8AL 1JPST 1C5BL 1RHHB 2IC2A 3TV3H 1SEBB 3HI6L 5F6HJ 4J3OC 5B4MC 4YIQA 5TFSH 3L3KA 4MNHA 4S0SD 4M7KH 1HDMA 5FGRA 3RA7L 4I9WD 5GGVH 1OF2B 3MFFA 4HPOH 2I5YL 1R5WB 4GW5A 1ZA6A 4MQSB 5EWIH 4JCLA 2ZUUA 3QI9D 1GZPA 4Y19A 1MFBL 4HWUA 3Q3GA 3GGWB 5EN2A 5ICYB 3RZCD 4E41A 2UYLA 4LSPH 3MRBB 2E7LA 5F1IA 5HXMA 4NQXB 3VFGL 2EDHA 4NT6A 5J6HA 1GH7A 4QRPE 1L4IA 3EYOB 3I9GL 5LGJB 1W72A 4V2CB 3QB7C 3QCVL 4H26A 2DQJH 2X2YA 3V6ZA 1CLYH 1R5IA 3G6AA 5F72S 1NCUA 4CN4A 5HPMB 5GRZA 4WNQB 4IRJA 1XIWC 2E8ZA 4N0UA 5FO7B 1W0YT 1GL4B 4YK4C 2KPNA 5LGJA 1BFVL 3DWTA 3QJHA 2F5BH 3ZDZF 5JPNB 3EDJA 1UJ3C 5DQDL 3O9WA 1YEJH 3QFJA 3LVEA 2H6PB 4KZEH 1KG0A 4K7FB 5C0EB 2F58H 4HKZA 1CL7L 4Y2OA 1HQ4A 4NKOA 4YO0A 2AJYL 1EIBA 1WLHA 3L7EA 2IGFH 3BQUD 1NDMA 3KYKH 2M8XA 4L1HA 5E08H 4QF1A 4DGVL 3P30H 3JWDH 3TBYB 2OL3B 3WIHA 5IHLB 4N0UE 5C0NC 4M6OH 1AKJA 5KOMC 3L3OB 2COQA 5A2LH 4GKNA 5IG7A 1SJEB 1RHHA 2Y07L 1PG7W 3ARGD 4LVNC 3FMGL 5IB5B 2ITCA 4BFEA 3P30L 1OAYL 3RWHB 5IJKC 1D6VL 1C5DB 4JVUA 1PW3A 5D7LB 4W6XB 4UV4L 4PRBB 3OG6B 4PRHB 3O8XC 2L4OA 3IJHA 2Y5TB 3RWEB 4KZEL 3S6CA 1BJ1H 2JJTA 5GGTA 4XVTH 2BK8A 3N06B 2CXGA 2GCYA 4XPHH 1F58H 4XC3H 1CQYA 1QA9B 2EECA 4PRNA 5HYQB 1A5FL 4XCCL 4HHAA 3FTGA 3WLBB 2NY0C 4HPYL 5BW7C 1I7UA 2NW3A 5L8KB 1QFHA 5I2IB 5JORB 1NCDL 3QUMH 4J6RL 3RPIB 4KVCL 5CUSH 1P7QA 4Y89A 2C3GA 4PJ9D 1CTOA 5BS0A 1K4CB 3GMPA 4M8QA 1TZIB 2DDQH 3TVMA 3LS4H 3OF6D 1J10A 3ARQA 3E0GA 5H37H 2WUCL 2XZCL 5E00A 4NUGH 1XGTB 2BOBB 1FVDA 4WI2A 4M1CD 1ZT1B 2VITA 3RVWC 3TBTA 4YHNB 3MREB 1WISA 1QFWM 1YQ2A 1RUKL 1U8IA 3QRGH 4JE4B 4WW1A 4B7IA 4J1UA 5C0GA 1NEZB 5CIPA 2HTKC 2ZJSH 4JPIA 5I2IA 5IK3B 5TGBB 2EDKA 4K3EL 5I8KL 1WEJL 4OJFH 1RZGA 1CFSA 3WIFB 3GBNH 2QHLA 3BE1H 4F7TA 3OX8B 4U6VH 5E4IA 3DBXB 5I16B 3DI2B 1T1YB 2EIZB 1FN4A 3VW3L 5F93C 1IKFL 2MKLC 5HI3D 1W0VA 2X4NB 4I18C 3IXAA 4HGMA 1S5IL 3UROR 4P99A 3I6GB 2G60L 4E9LA 4R4FL 3DECA 3IDMA 4KDTC 2VDOL 5EWIL 4M1DH 2Z31C 3U4EA 2FGWH 2XACC 3LD8B 4OV5B 2PKDA 3MRHA 1G7IB 2AABH 2ZSVB 3PHQB 5IVNA 2D4DA 3QHZL 1RIUH 2YWYA 2Z4QB 1KIRA 5CMAA 5D7IA 4WO4D 3B8YA 1A22B 4LVHB 1ZHLB 2VTFA 3MA9L 1A6TA 2EDWA 2HT3C 1P7KB 1UXSB 2FO4A 1HOCA 1JF6A 4UB0L 3RWGA 2VDPL 1J7VR 4MB4A 5ADPL 4BQ8A 4FQ1H 1KULA 2XQBH 3SDCC 2OTUB 3BD5A 2P24B 2IANA 1YY9C 4LBEA 4H8WL 4I77H 1U8JB 3UBXA 1XGUA 1HILA 1K6QL 4PJHE 3ULVE 3HFMH 4RBPK 2XZQH 1Y0LA 4F9LA 4QHUB 3QG7H 2ADFL 1PKOA 1UM4L 3UTPD 4G8FB 1NGQL 3KNBB 5GGSA 3KWWB 4E42A 1MY5A 1YYLH 1DQLH 4G7VL 5J13B 4J4PA 4X7SL 1LE5B 4R8WH 4TQEL 4PJHF 1A2YA 1E28B 2WWKO 4JLRA 1WVZA 3X13A 4NGHL 3UTQA 4OCLC 3UTZA 5ITFB 3FL7A 1RZ7L 1I7ZB 4PGJA 3HUJA 4U05A 3VA6A 4DUVA 2F54B 4I8DA 3H9HB 5D7LD 3PWPE 3ARYA 3SJVD 2CLRB 1DQJB 3LN4A 2YRLA 1II4E 2XN9D 4RMWA 1Q9WA 4HIHB 1YC8A 3WJJA 3CFJB 5DD1H 4PG9B 3HNSL 3OXSA 4YUEL 1ZHNA 2CUIA 3U7YH 1XF2A 2IPTL 3DSFL 4O2FB 3DVGA 3MLPA 1E4WH 1KENL 1KLUB 3FONA 4PJCB 1AGFA 3LZFL 1QSVA 3B4NA 4HUNB 4X7FC 3IJYA 3WNMA 5D6DA 3ZDYF 4GAFB 4MJIE 4M93B 2B0SL 3RX8A 3O3AA 4KQ3L 1ZS8A 3D25A 4XVUD 1FO0H 1KBGL 3OJMB 3HMXA 5E6ID 4ZAKB 2L7UA 4C83A 5FK9A 4AY0A 3RX7A 3BUYB 3MCKA 3OV6A 1F3JB 3ZL4L 2BOCA 2X7LA 4YHYB 2KZ1B 4HV8B 1NUDA 4NQSB 3S35L 3ILQC 5DTFB 3BKYL 3SKUD 3MUHL 4HCRL 1F3JA 1KUMA 4M6NH 3HPJB 1K4DA 1LDPH 3GHEH 2QKIB 4IRJB 1A6AB 1LO0H 1U91A 4CBPA 1S7UA 3SCMD 4HFUL 4NQEA 2XWBB 2H26A 4L5FL 4WO4A 4MJIB 4P3DB 3OAZH 3IF1A 1FFNA 1A7RH 4M5YH 4N0YL 5F97E 1U6AH 5LBSH 2KH2B 4RAHA 5IF0A 5EC1B 4ODHH 5LXGL 3BQUC 1BJ1J 4IS6A 1F90L 5EU6D 1MIEL 4CDHA 5DJ0A 5E94A 2QJDA 2OR8A 1A6UH 3S34H 5C0BD 3S8WA 4O2FA 1JFQL 4ZYKA 3W2DH 4BZ2L 4PGEB 1U8OB 3ARDC 4L8DB 3VXSD 3QP3A 1WFOA 1ZVYA 4U3CA 4YAQB 1LP9E 4X9GA 3PF2A 3VFOB 4G80B 4TTGA 3ULUL 2FEEI 3L5WA 4S1QH 2AJVH 4OCNC 2D7OA 5GRYA 4U2ZA 3NA9L 4YDLB 1PKQB 1J05A 5L8LB 2XZZA 4ELMF 2OMBA 3BIKA 4X5WB 1XIWB 2ZG2A 4U7KA 1AIFA 1YY8B 4ZUWA 5DEGB 3HHRB 3W11D 1SY6L 4TNVK 1BZ7A 4EOWL 1FHGA 3I6KA 1LO3H 1DSFH 1MFCL 1HHKA 4LSRH 3ULUD 3PGCA 3SKMB 4TUKH 4OI7A 4LNVA 3EYQC 2MQCA 1VEPA 2AS5M 2Z31D 4OI9A 4OI8A 5IMLA 4K7PY 4DAGH 3F7YA 3O6FD 3ISWA 3B6SA 1BD2B 1M05B 3CGTA 3S9DB 1YUHA 1VENA 2D7QA 4PJ9A 5BS0D 4TN9A 2GQHA 2BC4A 3LPWA 4XWGH 5DJAB 1Y0LB 3WXWH 4DAGL 4CNIB 3PP4H 3EOBB 1YUHB 3WJLC 3EO0A 4NUJA 3ZKSD 4NO0B 2V2WB 4FG6D 5I1HH 3WSQL 4JFDA 1HQRA 4N0UB 4HIIB 2XXMB 5KW9L 4NWUH 1I1YA 3OKLB 5IFHL 4MXVF 5B8CC 4ORGB 3O0RL 1Z0NA 2XKSA 3FO9B 2J8HA 3CUPB 1OQOA 3DRTA 3ZHLA 4LKXA 5ILTH 2CK0L 4FP8H 1FJ1B 4LSTL 4P3CH 5I30L 2RGSA 4LLDB 4X8JB 1R3KB 4IM8A 2NY3D 1M71A 3O45B 4B5EA 1OQXA 2PXYD 4X7DC 1MI5A 3BZ4B 4LRNH 3NABL 1INQA 4CJ0A 4NBZB 3WFDH 3T2NH 1WSST 2BVQB 4NO0A 3C5ZC 4UINL 3PGFL 1IKNA 5LVEA 4HIHA 4LHJB 1BGXH 3MFFB 3FT2B 3S37H 3OJVC 1X5LA 4NYLB 2VLJD 2OL3L 4GOSA 4HS3A 3BISA 5ETUB 4P5MA 3B9AA 4F9PA 3I6GA 2R0KH 4L3CA 3DYPA 5I9QB 4MXVE 1NQBA 3BQUA 4R4NC 4KY1L 4KDVA 2C9AA 3BW9A 2OP4L 2AJZB 5FYJL 3VXTB 4MZ3A 3MJ9H 3V52H 3DPBA 2FWOB 1E4WL 1EAPB 1AE6H 5EBLA 2RCSH 5B38G 5JOFA 3UPRB 1GGBH 1KTLB 3C9NA 1XF3B 3QFJD 4P23C 2Y23A 3SDYH 1B3JA 3L5JA 2WLYA 4U6XA 5SX5H 3CFCH 2VMFA 3TBSA 5IOPB 2JB5H 4JFEE 4OB5H 4KRPB 5GS1A 1F2XK 4BUGA 2NLJA 1U3JA 2VITB 3K80A 3QEQE 4LDEB 1T83A 5D8JL 1YY9D 3B5TA 2R69L 4XP9L 4KZDL 1HYSD 5F9OL 3TBSB 1I8LA 5IOPA 4M61A 5KSAD 5ITBL 1E4KA 4FTVA 2X7LB 4NJAH 3V5HB 4UTAH 2BC4B 5TPWL 1DQMH 3VDBA 3SO5A 1SBSL 4BFIB 1MY7A 4OZFH 4YDJA 4KJPD 1ZLSH 3SGJA 4E41D 1JNJA 3S37X 1T1XB 3CPLA 4KK9C 1AQDB 5KVFH 3RGHA 3KJ6L 4CJ1A 4Z7UE 3MRIB 5DJ6B 2IPKA 2J6EH 4MDJB 4UMGA 4NRZA 3MNZA 4G9DA 4YX2H 3LKNA 3PNWA 5LWYH 5C0CD 3UMTA 1BM3H 5E2UL 3JTTB 5KS9F 3HFML 1QO3B 3THML 2Z9TA 4G3YH 2VAAB 4ODVL 4LLDA 4CMMB 3VFSB 1QRKA 5HHXH 4HUXA 5C6TL 4RMQA 4JHZA 5CWSA 4X6FA 3BPCA 4PJCE 5SWZD 4LFHD 4DW2H 1WFNA 4Y8DC 3VCLA 2V5SA 1AD9A 3SCMC 1OAKL 1QP1A 3UC0L 1A1MA 2UWEB 2EE3A 1H3WM 1KGCD 2D0FA 3THMH 5KAQG 2NY2C 5E1HB 2AK1L 3QIUB 5DHVA 4JGJA 4TQEH 3P9LA 1MHPH 4OFYD 4Y19B 1D5MA 2DLHA 3HLAA 1LP9F 3QDGE 4S0TD 1RZFL 4UV7H 5JUEL 5EULV 1MHCA 3QDME 5T1LA 3ARDD 4L8SB 3IRZA 5LQBH 5EO1B 3EDKA 1ZWIB 5EZOL 4UT7H 2HAZA 3MA9H 2BVPA 1Z9LA 4A6YA 2JJUA 2CKBB 3B5HA 4BH8A 4KTDH 3UZEA 1ITBB 1QLRB 1VADB 3RAJL 5KSVA 1RD6A 1UYWL 3V8CA 4X4XA 4NO2A 2APXA 2ENSA 5I0ZA 1LK3H 3LY6A 4N5UA 4HAGA 4LEOA 4LVOB 4MA1B 1ZHBA 4PJXE 3GSQB 1B88A 3TT3L 1N5AA 1TJHL 4Y16D 1HZHL 1HN1A 2NW3B 5JOPE 5IEHA 4KGJA 4I5BB 4MD5B 3UTTB 2APTA 4WWKC 5BRZA 1RFDH 4ZNEE 3TN0B 4QHLB 4OIIL 2DQDH 2E6QA 3A6OA 2O5ZL 3VD9A 5KJRL 1MAKA 2WUCH 2XZCH 1W72H 5SWQA 3D2UB 1JYXA 3TA3B 5EU6B 4YHZL 4O51B 1IFHL 4M1DL 4QRSA 1H8SA 1RZ8B 5E2VH 5AEAA 2ZSVA 3JV4B 3PHQA 3E2HB 1KLUA 4B50A 3FHQA 1INQB 5I8OH 3ILPB 1IM9A 1ODAA 4KDTA 2EDTA 2ORBH 5C1MB 2HVJB 2V2TA 4JHWH 1EFXB 4I1NB 3L3OA 3F5WA 4HKJB 2OZ4L 4FOMA 5EU6E 2O5YH 2W9EH 2XWTA 4TRPH 5KVEL 1ZHKA 3T4AB 1IAIH 3B2VH 5GGVY 1JE6A 4PBWD 2K7QA 5C2BH 3QULA 3GSNB 2GSGA 4LCWB 5FOJA 2BNQA 2DN7A 5I1LB 3SGDI 3GKWH 3LRSA 3OAUL 3RWDB 3VXQA 2B5IC 2F8VA 3F58L 5JIPA 3GB7B 4P9MH 3WJLA 4NN7B 2JELH 1DVFD 4NO2B 4Q6IA 4GRMA 3BKCH 1KEMH 1BMGA 2DLEA 4XWGL 4EDXA 3BHBA 5I1KH 2P5EA 1N59B 4LQ1A 4JFYA 5F7EL 1D3CA 4P2YA 5EH1A 3MROB 3RGVA 2EZ0D 2QTEA 1SJVA 4PGCA 1ZMYA 3MRDA 4FFZL 1ADQL 4TVPL 1DVFA 3QDMB 3QH3A 4DKEL 1OWRM 4IDLA 3G6JB 3RU8H 4HC1A 2BVUA 1Q0XL 4CL7A 4FQJH 1FNLA 2GFBB 3HPJA 3HZVA 1Q9WB 4P23B 3HR5A 5HHPA 4V2BA 5EIIA 4HK0A 2JIXD 3GFUA 1QEWA 3VG0H 3G5XB 5E6ZA 2OXHA 4XCNA 5JO5A 3D5OF 3VWKB 5GSVA 3S3SA 5E56A 1RJZA 4YHLL 3C6SA 3NA4A 2ARJB 4IRSC 2CIKB 1S78D 3HE7C 5TDOA 1FNEB 5FO9B 1RURH 1FCCA 4RISL 1QFOA 1KPUB 2X40A 3RI5K 3STZB 1Z2KA 5L7XH 4GRWF 3C09C 1JRHH 2Y5EA 3UTZB 1A6UL 2ERJC 3FRPG 4FQXC 4LHUD 3O3AB 1CLOH 2CSPA 4NNXB 5E08L 5IFJB 2Z8VC 1U95B 3EDEA 4EIGB 3MJ7A 2AVGA 1ZT4B 3HS0A 3VFGH 4EZMA 3ARGC 5DJXA 3AS1A 4R4ND 1A3RL 5L6YH 4EDWL 2Y7QA 5ENWB 2QQNL 1CFTA 4OQTH 3AAZB 4DOHE 3EYVB 1T2QH 2WSKA 1V3KA 2VQUA 1O0VA 4QGYA 3H8NA 3MBEC 4HPOL 3LKPB 3I75A 3D0VA 1HILB 3LEVL 4WJ5A 2E7CA 1HOCB 2H8PB 4FFVD 2JTDA 2FR4A 1S9VB 1MVFA 4HUUA 3QEQB 4XNMB 3X12A 3TH2T 1EHLL 1LK2B 3GJFB 1C5BH 1B2WH 1BQLH 4JAMB 1I9RL 3H9SE 4ZDHB 5F1IB 3HUJE 1MCJA 3MNVA 4EI6A 3ROLB 2MOVA 4PLJC 3F65A 3U79A 3ZE0F 3B2UC 2ATKA 1F90H 5H2BB 1ZAGA 2NTFB 4NM8H 2VDQH 4RGNE 1IC1A 5IFAL 2V5TA 1WIPA 4JKPL 5EO9B 5KSBB 4EVNA 4MA8L 4Y5VC 1NAKL 4DQOL 3KGRA 3PE9A 5TF1H 2VLRA 4M43H 4OCXL 1IBGH 5INCA 4JDVA 2ZCKH 1TCRA 2K7PA 2CRMA 2W0LA 1HHHB 2H3NA 3NFSL 3ZE1F 1M7DB 4G42B 2EDJA 1K8IB 1OAZH 3T0EC 4J3VA 4R2GC 1B2WL 3P4NA 2YHGA 3HE7B 3S36H 3C60C 3EJYD 1DEEA 4AIXA 3VXNB 2DBLL 5HDQH 3C2AL 4ZG1A 1EAJA 3I02A 2OI9B 4AJ0A 3CFIC 1DCLA 2P43B 3WO3B 4JO4H 5IGXL 3QWRD 4XNYH 2J4WH 3C08L 4XP4L 5AYQA 5C09D 2NQCA 4LCCA 1HNGA 3U82B 1AP2A 3ARGB 4YBQC 3A0OA 5FGBC 1QR1A 3OTTA 4OV5A 4OQ1A 1MJJB 1Y6KR 3MOAH 1PQZB 3EO1B 2NY0D 2X4QB 1KGCE 2B0SH 4P5MB 1RULL 3Q2CA 2P45B 5IVZA 1ERNA 3O2VL 1BQHG 4IMLB 4QT5B 3MX0A 1FL5A 1MHCB 4AYFA 4YIQB 3I75B 5DC0A 4M3KB 4JRXE 4JJHA 4NQSA 5TDNA 5ACLA 4K23H 1E6OL 4HWZA 1V3LA 2R2HA 5F9AC 5DC4B 4GKSB 4JFHE 4GUPB 5IHUL 1FLRH 4LAQH 5F9JA 4NNPL 3BDBA 4IRZL 4OZFA 2LU4A 5ISZE 2A73B 4LSDA 4LPVA 3SGEI 4UIMA 2DBJA 5C07B 4AK1A 4M1CC 4F7PA 4K23L 4FQ1L 3FO1B 4NQCB 5MEOA 4XXDB 2QSCH 1BF2A 3MLZH 1HKLL 1TCMA 3IDYC 4JFFB 5CGTA 5CFHA 1CXLA 5KBNC 4YQXL 1Q0XH 3RVVD 5HI5C 2NY0B 4QXWA 4RDQG 2ADJB 3ECBB 4I3GA 5ETUA 4ZO7A 6FABH 4AG4H 3QHFL 5I0DA 4DJMA 5KS9E 4PJ8D 2APBA 1G7MA 3BQUB 4U1KA 4OZGF 4AH2A 4X7SH 1M7IB 2ITDA 4LSSL 3UDWA 3HRZA 2B2XL 4NRZB 3GI8L 1NGWB 5TDPA 1MLCA 2BCKB 2CKNA 3U2SB 2VZ3A 5DK3A 3QUYC 3OX8A 4FZ8L 1WZ1H 5DS8A 1JGUH 3QUZD 5F7WC 1BZ9A 3FHAA 3WFCH 1QFPA 4OZGE 1KCSH 3CH1B 2I07B 1WEJH 5I8KH 1CU4L 2ZUYA 3GSWA 4X4XB 4ONHA 1JPSL 3QXUA 5L2JB 4XP6L 4UI2A 4XAWH 4PRBA 2ILLA 5MP6H 4U4BA 5EPMB 5T3XD 3SDCD 4RAVA 2P8PA 1WK0A 4M8VA 3QNXB 5ABDE 1NC2D 2BHYA 4OCRH 2X9YA 1NCAL 1Z3GH 1TVDA 2X4SB 3GMQB 3GM0A 3LEVH 4N0CD 4PJAE 1D5MB 5T1KD 4NJ9H 3TBWA 5T3ZE 3B9DA 4OZIA 1XGYH 2YRPA 3O6FA 4PJEA 3M07A 3TO4B 4LRIC 4PJBA 3HN3A 1MJ8H 3JV6A 2C3VB 2KQMA 3MLYH 4ZSOE 4X7EC 1JHKH 4EI5C 5IB1A 4UT6L 2MCG1 1HCFX 1NUFA 2NNAB 5DYOB 1EZVX 3REVA 1AD9B 4M9PA 2ESVD 1RZIA 3DMMD 5DEFB 1BX2A 5FECA 4PG2A 3ARBA 1A4KB 3BSZL 4HUWB 4WTXA 5HHMD 4OT1L 5DK0B 4K8RL 2BNUA 3D9AH 5D1ZA 4RISH 2VDML 2AW2A 3QUML 3N85H 2X9WA 4P9ML 4PJBB 1RJZB 4OGZA 4PYGA 1OT1A 2GKIA 1TLKA 2QQKL 3B5GA 2HA1A 4RRPA 5IBLD 3STLB 1R3IL 2HKFL 1FAIL 3TESA 1QSED 1FNFA 5T3ZL 2F54A 3DTXB 4NKOB 4YO0B 4RIRB 2X70A 1FAIH 4Z8FL 3OKNA 4HJGB 1DE4B 4OZHA 5ISZD 1OAXL 5D1ZB 5TH2A 5J7CC 3VWKD 4PY8J 5F9DC 3W9DB 1IILE 3S36X 5DO2C 1P4IL 4I3RH 4UOW1 3V0WL 5D96C 1Q9KA 2FJHB 5D6CB 4NNYA 1A6WH 1RZJH 2P46B 1PLGL 4FQHA 2NMSA 2PYFA 1QACA 3C8HA 1F4HA 4FQ2H 2BDNL 1TVHB 3WUWB 3BUYA 2VQ1A 4OUUA 4QYOA 5C7XL 2DQGH 4FZEH 5AZ2L 1RUQH 4DN3H 5HBBA 1KPVB 4UBDD 4GG6E 4X4ME 1L6XA 2F74B 2GTWB 4JHWL 5I8EA 1ZS8B 1Z0MA 5H94A 5EDXA 1IJ9A 4CKVX 4J3SA 2F58L 4JRYB 5I1KL 1FFRA 4FMKA 2A6IA 4KRPD 5KSUB 3RVVC 4BQBA 1JP5A 4ZAKC 3WS6C 1A7BA 2YPLD 3GK8H 5EOTA 5D93C 1CR9H 3UZVB 2AXFA 3BKML 5FFLA 5F7NC 4HHAB 3RFZC 1X5HA 1UZ6E 5J1SC 4K8RD 3KS0J 4NZUH 4Y4FA 4NP4L 2ZNXA 4M93C 3KDMA 1E4KC 2O5YL 4KKLC 3RDTB 5ERWB 3RQ3A 3GKWL 1JZ4A 2DOCA 4LHUG 4MJ2A 4B7LA 4N8VB 4MYWB 4X99B 3I50H 1Q1JH 2NY1B 5DK0A 4LLQA 4BSJA 3P40A 4WHTB 1AH1A 3CMGA 3VE0B 4LSPL 4YFLI 1AD0A 3O6KL 3IDXL 4XP6H 4I3SL 5IV2B 2IH1B 2OZ4H 1HSAB 1EJOH 1A6ZB 5ESVB 5EA0L 3U2SA 1CLYL 2FJFB 1ZSDA 3T3PE 1QBMH 4Q74A 4WUUB 5AAWA 4NZRH 1PX4A 4LMQE 3IDGA 4P46B 3O6LL 5HGDA 3G6JF 1ZK9A 4MQ7B 1R6VA 2EYSB 4WY7H 1Q38A 1GZQB 1QSFD 2OSLB 2YSSB 3TA3D 3JXAA 1BEYL 3P4OB 3IKCA 2FZ3B 3OGCB 3RWCA 2XICA 1QR1B 5C6TH 3PJSB 1NLDL 4JAMA 4OM0H 5CJ8A 2VNCA 3V7AG 4MXQC 3PV7A 1U8LA 4QTHA 1A14L 1ZA3A 1AGEB 3JVGC 2FIRT 4HF5H 3ZLQC 5BCAA 2F54E 2R0ZH 4MJ4A 4ZNEA 3KPPA 1UXWA 4P46A 3FAWA 4C56A 1KPVA 3GMPB 2J12B 4PJCA 5K9JL 4OLUL 4N0FB 4I5BA 1Q94A 1J8HB 2WIIB 2IAND 3OL2A 1OSZB 3BT2H 2D0GA 4JY5L 3D18A 4YNYB 1J12A 1I85C 1KCUL 2MTPA 5DD6A 4Z7WE 4M6MH 4UNUA 4JY5H 1HI6B 3MREA 4G8GE 1N64H 3FO2A 3N9GH 5T1MA 5GSRB 5IB4B 1AGBA 5IMOA 2NW2A 1WF5A 3V4PL 5EBWB 4OAWA 3UTSE 4HCRA 5BV7B 3MUY1 4OLXL 4QHNB 4N8VA 2HT4C 3SKOB 5ITFA 3QDMA 1YJDC 2EH8H 3Q5OA 3FJTA 3U7WH 5JW3L 2APWA 1ACYH 5IM7A 2VDKH 4YGAB 3IJSA 3WXWL 1CDUA 4Z77B 4G9FB 1WBZA 3KPQA 5HTSA 3TBYA 3S88L 4UAOB 3W0WD 1YEFL 3E8UL 2QQQA 1NFDB 3D0LB 2JCCF 4X0KA 1A9BB 4X6EA 4M7JH 3IB4A 3DO7B 1XAUA 3HG1E 3A6CH 2E9JA 1MCHA 4G7YH 4NQEE 1FDLL 3KS0H 4PP1C 4POYA 1SM3L 4HIXL 4DGIL 5EZLA 5CBEA 2CDFA 2Z8RA 3DRQB 2VLME 3GJEA 4XPTL 5DMIH 1E6JL 4OKVA 4DGYL 5HGGS 4M48H 1AGEA 3VXUB 5IJVA 4LRNL 4GRLD 2J6EL 1LD9A 2AJVL 3ARTA 1ZT4A 1JWMB 4IOSD 3MRQB 3U7AA 1N6UA 2ICWB 4MHHI 5FHBH 3O3EA 3DSNA 4E41B 2JJWA 3UJTL 3WHE1 2R0WH 3WHE0 3BI9X 4BSVA 3MBXH 2YPLA 4PJ7F 4ALAH 3KHQA 2DIBA 4NO3B 2XOTA 1GPOL 1CD0A 1M7DA 1MPAL 2XG4A 4G42A 4Y2DA 1SQ2N 4YJZL 2OXGA 1CGXA 1SHMA 4GXVH 5EU7C 4KU1A 1VKXA 5DJDB 2R2EA 1A1OB 2CMRL 2VXUH 3VXMD 4LL9A 4Q97A 3KYNB 1I7ZA 4FQCH 4G5ZH 2VXUL 5DWUL 1GXEA 2VE6A 3QDGB 1UEMA 2ESVE 2ADIA 1KJMB 4PJEF 1AI1L 4EVNB 1XR9B 2MCPL 1IL1A 2CD0A 1UB5A 1H3XA 5DZNA 3IT8D 3FFCB 4XNQA 3OKEB 4XGZA 1AKJD 1PBYA 1QFWI 2I9TB 1VDGA 3HI1A 2QBWA 4U3HA 2F54D 3TA3C 1OAXH 4YDVA 3J8F7 2PTVA 5ID0B 1D9KB 1UACH 1DQDL 3GBML 3LHPH 4OF3A 2AQ1A 4MNHB 2HFGH 3QNYA 2J3SA 3V9FA 5IHZA 5A43C 1QSEB 3HLAB 1QBLH 2R9HC 3WJJC 3SBWC 3T04D 1YEHH 3MJ6A 2XKNB 4YFLF 1UACL 3GBMH 4G8GD 3QZWB 1T0PB 2NPLX 1T5WB 1FFPA 1NJ9A 1UJ3B 2YUZA 5DVMA 4QTIH 1RUML 3E8UH 3FO1A 3T0WA 4GSDH 5HYQA 1EGJL 3KLSA 5H35B 2ESVA 4F15B 4I0CC 2MFNA 2X05A 4ZQKA 4U1JA 1EFQA 3D69A 3QQ3B 3BGMA 3MV9D 3UBXI 5F96L 1Q9OB 4PRIA 4LFHG 5F3HB 3FT3A 1QHOA 3PP3H 1EMTH 5H37G 4HFUH 3DMMB 4G7YL 4KROD 3KPOA 2XT1B 4G6AC 3BRGC 1NEZG 3ELAT 2ZOLB 3X14B 4JREB 2OX5A 3X3FL 5D2LF 1C08B 1FRGH 3DXAA 2J8UB 1I9IH 2L0DA 4LP5A 1CBVL 2JKXA 4LLUB 3FB7A 1OW0C 1XH3B 4TPRH 1NMAH 4GW5B 2J5LC 2YA0A 3LN5B 4CN1A 4AQ1B 3NH7H 1RK1B 3GUTB 4YXHL 2VUOA 4Z5RA 2IWGA 4DKDC 1OP3H 5FA3B 2GFBA 2PO6B 2VB5A 3KYMB 3SDCA 5FXCH 3HZMB 1HCVA 1FO0L 4OCRL 5HDBF 3OR6B 1DBJH 4MLIA 1UM4H 3OAUH 1SBBA 4XCNB 3O45A 5JO5B 3VXPB 4AEEA 3LKSA 4JFFA 5GZNC 1JGVH 4I0PB 4KMTL 3ULUH 4R7DB 1K6QH 2OLDA 1FO0A 3GSOA 1NGPL 2BMKB 3IDNB 3T4YA 5DJYB 2HTKD 3C60B 3H42L 1FYTB 2BSSB 2VZVA 3VXSB 2C7UB 3AC0A 4OCYH 3DLQR 1K8IA 2A77L 3LH2H 1EJOL 1ZGLA 3MCG1 2Z92B 3MBXL 5HHQB 2XTJD 4HH8A 1H0DA 5IB2A 3QQ4B 5IVXE 4JM2B 4O2EA 3GMNA 3ARXA 1FYHB 1PG7L 3ULVC 3QIWC 5FA3A 5F9WC 3T0EA 1MCIA 1WBYB 5FHBL 5EBLB 3UPRA 3KPRB 3PABB 2ATPB 2NY1C 5HHOD 2DM3A 3RWDA 5B39A 1F3RB 1EVTC 3WS3B 3CLFL 3EJJX 4GG6A 1J0JA 2AXJA 1DANT 5DMGD 4Q6IB 4PJAA 5IESL 1R5WA 3KPMB 1AR1D 5GRVL 5I1JL 1D5ZA 3L95A 3F7PC 1J9CT 4ONHB 4CVUA 4WY7L 5MENE 4O2EB 3HPLB 1X4ZA 4D3CH 5I76A 4CU6A 5CEZH 1PG7X 2IQAA 3IJHB 3RVUC 5I17A 4OZGB 2X4OA 4NFCA 5J3HD 5FAAA 4JREC 2YEZA 5DRWA 3FCTB 2NY7H 4BQ6A 4OGYH 2IQAB 1T4KA 4KQ3H 3P0GB 1KTDB 5DD6B 2AKRA 4K3JL 2YD4A 2P47B 1M7XA 3V0WH 4U1NA 1BBJB 4LMQI 1YNTB 3D85D 3F7QA 5FYKL 3AS2A 4QF1B 4XX1G 2XA8H 3DURA 2EH7H 2FYYB 3DETD 3BT2L 1A2YB 4PRHD 2UY7A 3PWLB 2HT4D 3TN0A 2I24N 4QRTB 1OHQA 3QEHB 3QIBD 4AENB 5C7XH 1U42A 5EC1A 1QRNA 1A6WL 1RZJL 5K9QG 4LVEA 4C58B 3C60A 2AJXL 1DUYB 1FNGA 1A4KA 3MZTA 4JANB 1U8QB 5IBTH 1FNSH 5F1NA 5F70A 1NCBL 3PDOA 3OB0H 2XN9B 2AABL 1P69B 1TPXB 4R2GD 2PYEA 4NQDB 1EEZB 5C0IA 4KRLB 3P73B 2NXZB 1ADQA 3EJYC 3ARVA 2EC9U 2I25N 4IRSA 5EC2B 5FDYA 5IBUB 4NM4H 1RJLB 2Q6WB 4PV9A 4Y5VA 1YMHB 2NXYB 1KIQA 2ZUSA 2Y4SA 1R3IH 2HKFH 2EDXA 5JW5B 1F00I 3VFTB 5DDHB 4WTZA 3CSYB 4WFGD 2HFEA 1JF5A 4JFZH 1IC5H 3TBWB 1SMAA 1WWAX 5GGRA 2BNRD 4WV1B 5IKCB 4PGCB 3O6FC 4L8SC 1DL7H 5L9DH 1QVOA 1J18A 5LAXA 2FO4B 3LKQA 1OT2A 3ARWA 1NGYA 3V5HA 4OCSL 5C0AD 4P2QD 3O9WC 5EUOB 2C3HA 1QBML 3TO4C 5TJWK 1EEYB 3S4SA 1J1OL 4BSWB 3NACH 3KYKL 4D0CA 1U3HD 5MEPA 1MREL 3VFNA 3WHXB 3TFKC 2CH8A 4G8EB 5DRWB 3RUGF 5T5FH 3MBEA 3O3UN 4JJ5B 4K2UL 3NACL 2HP4A 3UBXB 3ARBB 1JZ5A 1T20B 4I0KA 2FD6L 3OZ9L 2ARJA 5GRVK 1FZMA 4ONFH 5FDWA 1DN0B 3JTTA 2EDYA 3OPZH 1JL8A 4D0BB 3RP1A 5FUCC 1MAMH 2FECL 2MJWA 4D9QD 1OP5H 3BPOB 3DO7A 2FSEA 3FB8A 5MHSD 4RGMC 2ZPKL 2CXKA 1VEMA 4XZUA 3SE4A 4RFNC 4XP5H 2EC8A 1AO7D 1TJGL 1XGTA 2DM4A 1TTFA 3G5YB 1NGZA 5DRNB 1RI8A 4UQ3A 3UZQA 3OPZL 4L8BA 4OTXL 1AO7A 4Y4HB 3FOMB 4GO6B 5AWNH 2O5XL 1DEEB 3SDAC 1XF5B 1UWEL 3U48A 5L7XL 1BOGA 3L3JB 3NABH 4HMCA 3SOBL 3HAEA 3HNTL 5I16A 5E2JA 3IFLL 4FQIL 1W8OA 3GMLB 3FZUD 1NLBH 1MLBB 2J8UE 3QPQD 3K8KA 5ILTL 4KVCH 4X5LA 4Y5YC 1G7QB 4KI1A 3WV0A 1YN6B 3JUYA 4K3DH 5CBEB 5ENWA 4CU8A 4Z0BH 5D7JA 3MMEB 3RGVC 3ZSTA 3KPSD 1FG2A 2XZAL 1NBZB 1OVZA 3LMJL 4B53A 4PYHA 2DD8L 4PJ9B 4OF5A 4BH7B 5HDOA 5C08A 2HMIC 2Z4QA 5CMAB 4XPGL 1DN0A 1IZJA 4OGAD 5D1QC 2RR3A 3O3EB 3EGSA 4PJFF 1KJMA 4LQFH 3VXOA 2VH5L 1IC5L 2D4FA 1WIUA 4UIMB 4MGXA 2EDEA 1GC1H 4QRUA 1LK2A 3GJFA 3MNVB 4XAKE 1F13A 4PJIE 4Z7UA 3VFWA 2Q7NA 1BLNA 1SVCP 4ODWA 2FSEB 3LN4B 4F33A 3WBDA 1JUFA 4WFGE 1RIHH 1P4LA 4LSVL 2NX5D 2IBGA 3KR3L 1C12B 4RFNB 4Y4HD 2R1WB 1FVEB 3ZKNC 3EDDA 1NL0L 3DIFA 4S1QL 5IR1A 1CFNB 3EYUL 5D2NE 2VC2H 3G6DH 3G6JE 2HLFD 5IM7B 4AMKH 4NRYA 5DJ0B 5E94B 1C7SA 1RZKH 3CAFA 2C5DC 2PXYC 4TVPD 4X6BB 5IROC 1QRND 3RZWA 4OFPA 3LOWA 4PTUB 1SJHB 5F9OH 5ITBH 5KVGL 4JM2A 4D9LL 2Z93A 4MNGB 4XBEL 1N8ZB 3SQOL 3CDCA 1CLZL 3BZEA 4NT6B 3STZA 1DDHB 4WI9A 4KKAD 3R0MA 1YPZE 4HXBH 1F4AA 3C5SA 1U6AL 2C1OA 4IEFB 5LBSL 3P4OA 1A1NB 2JE8A 3TPUA 2P5WE 3GMMB 1PG7H 4GBXB 1ND0B 1YPZB 3QO1B 3QI9C 1AIFB 3O8XD 4L4VD 3ARZA 1MRCH 4YAQA 3AU1A 4PJDF 2B4CH 3V5DA 1A02N 1U8PB 2I26N 1JPFB 4GT7A 3MCKB 1YC7A 4TUOA 3O3DA 1MELA 4B41A 2LQRA 5BV7C 3WMSA 1HSBA 5DK2A 1A6PA 5GQBA 5FKAA 5E8OA 1FG9C 5BV7H 2J8UA 3HR5B 1OGAD 1EEQA 2DQUH 4YH6A 4JKLA 1A21A 4LKXB 3WN5B 4Y4FB 1A4JA 1INDL 3OXRB 1JNNL 1FVDB 1JZ8A 4NQEB 4Z7WF 4QNPE 2W9DL 3D2UA 2BXZA 4X5XA 4XI5D 4UT7L 5TDOB 1U3HC 2IAMA 7CGTA 3JSSA 1QR4A 3DURB 3V6FA 2YD9A 5K9OB 4QHKJ 4IBLT 3L7EB 2BHZA 2FGZA 4P57B 5FM4A 4JR9L 1V3JA 4PRHE 1G1YA 4M3JA 3QZWA 1K4DB 5FM5O 1V7ML 1M71B 2CDFB 3BEWB 3H42H 1FLRL 3KPSE 1A3QA 1ZLUH 1ZLWH 3LQMA 4GQ9L 3BP6B 5IQ9B 4OFDA 5KVDH 3FO9A 4PRAA 1G9ML 4Y88A 1RZKC 4JFFD 1RUMH 4ZFFB 2EEAA 3EOYG 4ZUUA 3AB0B 5EU5A 1I8MB 4PJFA 1CGYA 3WN5C 4P2RA 2WZPD 5DD5L 3B83A 3EYOA 3IU3A 1I1FA 4FA8A 1TZIA 2GJZA 4OSUH 4Z7OF 4D9RD 1T0MA 3K8LA 4KV5F 4AG4L 2O93L 1M6OA 1GGIH 1GC1L 1YMMB 3UO1L 4ODTH 1QUNA 3N1MC 4GSDL 5GRJH 2EZ0C 5J9PB 2V7NA 2BNRE 1QVOB 4GAGL 4K8RC 4P2CG 4PGBA 1T7WA 2ZCKL 4R97B 1BJ8A 2DQIH 2P8PB 5KSAA 2GITB 5E5MA 3MRKB 3N1GC 2NTFA 4ODSH 3S3PA 4MD0B 1XCQB 3BPLC 5ELIA 4KTYA 2BSSA 4X7CC 1QRNE 2J1KA 2VAAA 4OCYL 4CMMA 5DUMH 2X4OB 4Y7MA 5JHDD 4TNWK 2ITCB 2Y36H 1C1EH 1FL6A 4LK4A 3IRPX 5CZVH 4O2CB 4ZSOB 3JVGA 5FYJE 2NNAA 3MRGA 3MUZ1 3OB0K 3KDMB 1VFMA 2CDEA 3HE7D 4OQTA 1P6AB 1VESA 1I1AD 1MFAL 3PWVB 5SWSA 5BJTB 1N5YH 1WT5C 1AHWA 3NOIA 3EO0B 1FNHA 4D9QE 3TJHC 3BP6A 5IQ9A 5I1GH 1GGUA 3QO0A 4MMZC 1AGDB 5JOPD 3NPSC 4Z7VE 4PJAB 1L6ZA 1REIA 3CSYA 1MAML 2VLJA 3RWIB 3U36B 1H8NA 2LTQB 5IESH 1LE9B 2HWZL 5DHVB 5AG8A 3MUGA 4QCIB 5I8CB 5EPMA 3QUYB 3WLBA 1AO7E 1GJIA 3SPVB 5MERA 3VH8G 3T4AA 2DBLH 5FOBA 1S7TA 3BRDA 4I13B 2PR4L 1MI5D 4XVUC 2OYPA 4G5ZL 4LCWA 1M6OB 2UVEA 4G6JL 1QTYT 1H0DB 4U1JB 4NQDA 3VJ6A 1U9KA 1ZKAA 2GAZB 3BPCB 4JHAH 5HHVH 1CD9B 3OR7B 2UZIL 1KN4H 2X9XA 4LGPB 3NFPA 5HSFA 1T5WA 3EW3B 3QEQD 3QIUC 3CU1A 5D72L 4UNVA 4GUPA 1DE4A 4PJ7A 2HRLA 4PJ9C 3VI4E 3MRKA 1UWGL 1K4CA 4EQ2A 5GRUH 1MUJB 4FQPA 4WTZG 4TUOB 1FORH 3DSFH 2C3VA 1S5HA 3A67L 5CHNB 1LO4H 2YA1A 5KS9B 2FIKB 4P2QB 4ZO6A 4BJLA 5TE4H 4PV8B 2DQEH 4LPWA 4MLSA 1BIIA 4AZ8A 2FH6A 3IDJA 4GMSL 4R97C 1HH6B 4RMTA 4ZPVA 3VRJB 3BFOA 3GSOB 4H20L 4GRLA 4JFFE 4U6HA 5JHLH 1MEXH 2YPKB 3FOLA 1CFSB 4MZ2A 1ZHNB 1FFOA 1IT9H 3FQRB 1XZ0A 4KJQC 4KTDL 4FTVB 5E9DB 4OQTL 4HUVB 2AXHA 5F89B 2DLGA 4UOJA 4D9RE 4OCSH 3LSOB 1ZGLM 4ZOAA 1MJUL 4C59B 5CBAB 5TE7H 4U1MA 5C0DA 1HINH 4PLNC 5DJYA 3RBSA 1YEEL 5D5MB 1R0AL 1RSFA 2VDLH 1AKJB 1D6VH 4L1DA 1G9NL 1JIBA 3DV4A 3W0WA 3SJVE 3DRQA 2BX5A 4QRPA 5INDA 1J5OH 4DWHA 3U7WL 3ZHKA 3ARFC 1AP2B 3FRUA 3DV4B 3QDMD 2HT3D 3S34L 4F7CB 5DJ8B 4H88L 1UZ8B 5FGSA 1FVCB 1MJUH 4I3SH 5IBUG 1GGYA 1L7TL 3WNKA 4Y1AB 1H3UA 5CBAA 4OLUH 1IM9B 2EKJA 2RQ8A 3Q6GL 1T21B 4WEBH 1CGUA 3BYYA 1NPUA 2P5WA 1XF5A 5IJVB 3ZYJA 1I8LC 1JRHI 3NCMA 3WFEL 1JPGA 4YFDB 2LTQC 1GAFL 2QEJA 1YEGH 2E27L 3ZDXF 2R2HB 3T77B 1NAML 1R3LB 4WDIB 4HLZG 3F6LA 3SCMB 2YD7A 3RIFK 3RY4A 1JK8B 5ERWA 4MA7L 4QY8A 3HUJF 3CZJA 2JB5L 3MLWL 2VRAA 43C9B 3NTCL 1E0OB 2R2EB 2A6KB 1IAOA 1CWVA 4HKBB 4DW2L 4P2OD 3O4OB 3QUKA 3IETA 1I1CA 4RX4A 3D18B 5ANME 1PZ5A 4GAYA 4NN6C 3BIAX 1BEYH 2OJZL 1MH5B 1J8HA 2M1KA 4BZ1L 1WC7A 2JELL 1P5UA 4F9PC 4DFHA 3MRCA 4FFWC 4RBPH 3PV6A 1IQWH 4NCC1 3ESVF 2IFGA 3P0YH 4WFFE 3MRRA 4FS0A 4FN0A 2G9HB 4XH2B 1P4IH 2VIRB 4MD4B 1AHWC 4KUZH 3CSGA 5FGCB 4Y1AD 3B9KD 4O00A 3IKCB 2R9HD 4N9OB 3OB8A 5F44A 4HBQA 4DFIA 1RZFH 4UIKH 5T3ZH 1ZLVH 3JWOL 4L4TE 1KIPB 3TIDB 3AAZA 1KCUH 3H9ZA 1SVZA 1C12A 2NY3C 5L0QB 2NXYC 3S5LB 5FCSH 5D5MF 3P0YL 5DXWA 3UYRH 3LRHA 1N8ZA 3SDXA 4HULB 4R96A 2OQJA 5T33H 1CYGA 3CFDB 5KSAC 1I3GH 2A9MH 3QEGH 4Z7NF 3G5ZA 4OLEA 3NBNA 4L3EB 3LKRB 3ZT6A 3L3JA 5J12C 3WO4C 3H3PH 3SKMA 1U91B 3GJFK 5GGTL 4G8EA 1CDJA 1PLGH 3OJ2C 3W9EB 4RX4D 3LKRA 1RUPH 3CVHL 3SKJL 1JNLH 4PP2B 3OBAA 2ENYA 1HINL 5BZWB 3ROLA 3QUKB 1MEXL 4E5XA 5I76B 1OTTC 2Q86B 2OR9L 4LCYB 3QEQA 2VN4A 1CF8H 4JFXB 4IDJH 4URTB 1XR8B 2CRZA 1AGBB 1RPQA 3V4PH 3DROA 1JNHA 5DD3L 3S96A 1S7UB 1BVKB 4YWGH 3DIFB 4DKAA 5EA0H 1LILA 2XQBL 2D7TH 3L3HB 3ME0A 5ADPH 4APQC 3O11A 3UO1H 2WNGA 3SGEH 1HWGB 4KK8D 4U1SB 5D8JH 5BXFA 5ID0A 1BF8A 5CSZA 5F89A 4LLWA 5ID1B 4YHMH 1LO3L 4OB5L 4QRUB 4KVNH 2CJUH 1T22A 1NDGB 4PJGB 3E3QC 1YY8A 2D7PA 3GO1L 1AHWB 3ARFD 1P4BH 5FGBA 4UAOC 1MCRA 4P2RE 4NQTA 3LQAH 4OM1L 3V4VH 1U8QA 3G5YA 1D9KC 1A64A 1HHJA 2C26A 1YN7A 4D0DB 3U0WH 1IM3A 3OKYA 2IADA 3LRGA 4K55A 4OZHB 4QLRA 3VWKC 2BY3A 3BP7B 1DBBL 4N1CA 2UZIH 4F7EA 1KB9K 2R56H 2DQHH 3GBLA 3T3ME 2CLZB 3QYCA 1BOGB 3LRSB 4XNXL 5F9WB 2W9LA 4G3YL 4ODVH 4X6EB 1AFVL 3EO9H 4YK4B 1MCPL 2R29H 1RJYB 3D39E 3RWEA 2R0WL 5I1GL 2R23B 4H25B 4MAUL 1H15B 1KLGA 3LB6C 3FKUS 1F11B 5HHNB 2BJMH 1NSNH 3DVNB 3MRJB 1W2KT 4OZIF 1HKFA 4I3RL 3MXVH 1JNNH 1ZEAL 5KG9A 3TYFB 2YC1A 2YR3A 5D1QB 1J1XL 3HG1B 1G7JA 4P48A 1DZBA 2VDNL 4N0CC 2GTZA 4HDIB 1JGDA 5J8OA 1S5HB 5FM5M 1FGNH 2FX7L 5I1DB 5F88A 5DTFA 4F7PB 4MD0A 1O7SA 4K3GA 4MD5A 3EIFA 3KWWA 3ZSSA 5F7LB 4QRTA 1RVFL 4XPBH 2VLJB 3D39A 1NFIB 4P5KA 2N7AA 1AXIB 4XBGA 3RNKB 1W8NA 1GGBL 5KVDL 1F3DH 4F37F 1MCFA 4DN3L 5C2UB 4OT1H 3T0EB 4XPTH 1T5XA 2HKHL 2GTZB 3KJ4C 5JW4Q 4NWTL 1ACYL 4YDVB 3X11B 2GJZB 4EN3B 1S9YB 5ESQA 3ARGA 5JA9A 1U95A 1EUTA 1MHHB 3BVNB 2RFXA 4YC2C 4ODUA 4RA0C 4HUMB 2X4NA 4TTDD 1WGOA 3BPNC 4R7DA 4DKFH 1PSKL 4IOIA 3VFTA 3VFOA 4Q0XL 4G9FD 4KPHH 1KBGH 1S7TB 4J4PC 5KTEH 4PLKD 1RMFH 4YWGL 4QGTA 4KK5C 1UJ3A 3RJQB 3ZKMC 3BAEL 2J8OA 5CAYB 3HE7A 3PL6A 1K8DB 1YEIL 4FQHB 1OTTD 1T2JA 3O9WD 3T2QA 2AJYH 5DUML 4UU9A 2J88L 1MCOL 4XX1E 2GK0B 1YJDH 2D7NA 5TF1L 4A2LA 3QNZA 3K8MA 1IQDB 4AT6B 2N56A 1P7KA 1UXSA 2HG5B 5D72H 1C8PA 2WWMD 4NM8L 3SY0A 2W92A 3AU1B 4X4YA 1QBAA 4H0HB 1N6QL 1ZWIA 5I1EL 3VFUA 4UOW0 4K7PL 2GHWB 5IEKA 1U41A 3DX6A 1T04A 3SY0B 5GGSY 4YC2B 3JV4A 3DGCR 2J4WL 3C08H 4ZQKB 1OWWA 2DI7A 2H9GB 3EGSB 2MKWA 3TVMB 4OGAC 4GLRI 5FKAB 1JGLH 3ES6B 3LEYL 1CICC 1JGEA 1MJ8L 2P7TA 4NZRL 5IFAH 1M7IA 4L8CA 4H8WH 1NFIA 1XFPA 3QIWA 2HWZH 4LARL 2H41A 4ZS7H 3PUCA 5EO0B 1FGVH 1JHTA 3JV0A 1G6RH 5C09A 5HI4C 2BP3A 3QWRA 4HGWB 5FECB 5FYLH 4F33B 4JEGB 5DEZA 5F1OB 2E6JA 4S2SB 3HC3L 2Y06H 3DX7A 3DUUB 3QFJE 1A1MB 2UWEA 3CH1A 3SE4C 1LVEA 2PO6C 4J1UB 3IDIA 2AV7B 1KIRB 4JZJC 1B4JL 5DS8B 4BQ9A 1QA9A 4YHIB 5SV4A 4KUCF 3F5WB 3VWJA 3W2DL 4BZ2H 1RAMA 3ZE2F 5E1AB 1S78C 2OJZH 4KUCD 3SEPA 4GG6B 4N90D 4L8BB 4UUJA 2R56L 3WDIA 1W0VB 2Y72A 3V6BR 4XB8A 4XCYA 1VSCA 2EICA 3MGOB 1YA5A 1FG2B 3BWAB 4HAFA 5DLML 1X6LA 1H3PH 1DUZB 2D03H 2FL5B 3TO4A 3B3IA 1F42A 3O4LE 1VA9A 3MRPA 4X6DB 5DMIL 4PJAF 4YXLH 3T2PA 1OSZA 1RURL 3H9YA 5E6IC 1J86A 1FNAA 5FKPB 1JTOA 4ONFL 3QHTC 4ZD3H 1FP5A 5J0BA 1ROWA 2P42B 5CSGA 4GW1A 5IEKB 3ABZA 4M7LL 2AEPH 5ALBH 4ETYA 4Y19E 3V0VB 3ILQD 4WW1B 3BWUC 1CD1A 1W72B 3MR9A 4H88H 2F53A 1N0XH 2ZUWA 5BRZE 2YUXA 1BVLB 3O8XA 3GRWL 2M26A 4L4VA 3U9UA 3GSXB 3LDBB 4DEPB 4LGRB 4OIAA 1QLFA 4AM0A 2DD8H 5DVKA 3DUUA 3RY5A 2W1NA 4UV4H 4JVWA 3MRLB 3VD5A 4JY4A 1MCOH 2HLAB 4POUB 5E99L 2X5PA 1MLCB 4RWHA 4MCZA 5DRXB 5L2KB 1GIGH 4PB0H 5IVXF 4MA8H 1KNOA 3VXRA 5KANI 3CFBB 3EYVA 3RX5A 4X7TB 2E8YA 3VD4A 2BVQA 2EO9A 3I2CL 1MWAB 4XP5L 3NZHH 5DA4A 1ETZA 1TPXC 1VFBB 4Q9QH 2BNQE 1JHKL 1E4XH 5D2LA 4OKVB 4OFKA 5IB5A 3ULUF 1RIHL 4Y4HA 4KJWC 1YEJL 4X6BA 2JIXA 4PJBF 1H8OA 5EUOA 1NGZB 4PP1D 1EAPA 1Y6NR 3FN0H 5JOFB 1PKQA 1MAJA 4ELMA 4AEIL 1ZVHA 3CJJA 4YNYA 3VMPA 4PLKC 3MO1A 3TPUB 1IGYA 1UQSB 3G5XA 4CN6A 1FCGA 1KFAL 3O6LH 2P5ED 1F3DJ 2F5BL 3NZ8A 4P3DA 3AMLA 3BSZH 1CGTA 4OLZL 2NY7L 1AC0A 1IEHA 4MX7B 15C8H 1YEKL 5F7HA 4LLQB 4OLZH 5CP7B 3M17A 2IBZY 5HYJB 1T83C 1H3TA 4JPVH 4KKNA 1FE8L 3QG6B 4LASL 4UILL 1RY7B 3LV3B 1CD8A 5DHYA 3CFJA 3T65B 3VU2A 3QDGA 4OAWB 3LQAC 4RGND 4Z78A 4PR5B 3SE9L 1TCRB 2MHAA 4UILH 3WKNA 2PYED 3VGHA 1FGVL 4P23A 3VGGA 5CJ5A 3OKKB 3QDJE 4P4KC 5TQ2H 3K0WA 1OB1A 2CUMA 2HN7B 3ORJA 1I8IB 4NO5B 4U6YA 2F8XC 2IG2H 2CJUL 5FV2A 4XMLL 5HJ3B 4JM2C 3L3IB 1E28A 2DQDL 5C07E 1N6VA 1RFDL 3NCEB 4PV9B 1QSFE 1U93A 2XKUA 3L5XH 1EX0A 5JW4M 4PGEA 4PRHA 3IJYB 5IVXA 2QSCL 2GUOA 3MLZL 4UDTB 1CU4H 2XA8L 5DF0A 1U3HB 2NY4D 1RUQL 2W0FB 4OF0A 3I02B 5GXBB 1X7QA 2R1XB 5EZLB 4HZLB 2AK1H 3KLDA 5BVJB 4XPAH 3I85A 4WI5A 1TVBA 1CGVA 3F6IA 4QOKB 3FB6B 1UZ8A 4HX1A 4OZHE 4LU5L 4PB0L 5BRZD 4U0QB 2H1PL 3LKQB 5L88H 4MAYB 1NBZA 2BSTA 3L9RB 1N0XL 3IU3B 1P84K 3OJDA 1IAIM 1IE5A 5EB9A 1RU9H 4U1HB 2QKIA 1HXYA 4KQ4L 3U6RA 4KV5E 1YNLL 3BAEH 5INCB 1U8MA 4JRXD 2D7TL 3RAJH 3PQYA 3MCLL 3D85B 2DLFH 4H1LB 2DB8A 3B2UD 1J1OH 5JW4N 3O2WL 4LPCA 5CJBA 4DGVH 5EU3A 2ATKB 4DCQA 1CN4A 2BY0A 1MCNA 3SKOA 1Q0YL 3UTSD 4CMHB 3GIVB 1PKQE 1DVFB 3DVIA 2F15A 1ZA3B 3TIEA 4WUKL 5EBWA 4DN4H 3IAQA 3IF1B 4P57A 4L9LB 5HHOA 4JM4H 3GHBH 1F4WL 1KN2H 5SV3A 3C2AH 1WBZB 3KPQB 1UWXK 3FFDB 1LEIB 1KJVA 4QXUH 5C9JA 1G7LB 4K8RH 2EDRA 4NKMA 4QRRD 1MCCA 2DWEB 4Y4KB 2YPVH 5JOEA 3NIFF 4OGYL 2X4UA 4Q6YA 3NFNB 4Z95L 4UQ2B 4YDIH 5C09B 2C7UA 2DYPB 2YUWA 1JF1A 1J05B 4OLYH 3MUGB 5IMOB 3HUJB 3NFNA 1R5VB 1J88A 2AV1A 1B4JH 1X3DA 5D5MA 3TEUA 1A1NA 2VLMD 3LDBC 4DEPC 5J11C 1FGNL 2FX7H 4BKLB 1HK6A 2V9RA 4NYLA 3IFOA 3U4BL 4LCIL 2EDOA 1MRFH 2Y25A 3V5DB 3QUXD 3AREA 1MCDA 4Y2DC 3QDJB 3QIWD 2A74B 1BPVA 1R24B 1ND0A 2J8UF 4GBXA 3FFCA 2WUBL 5JQHC 3TN0D 3PHSA 3GB7A 1B6DA 3HC3H 2AEWA 5GRXG 1OLZA 5IB1B 2YA2A 3MLWH 35C8L 4JN2B 1I1FB 5F7FA 1KOAA 4NWTH 1RZJC 4U49A 4Y16B 2LU3A 4CAGA 3MZGB 4UU9B 3QI9B 4K9EL 3B3IB 4U1HA 1CE6A 4PJFB 3F7VB 2V17L 4PRID 3RKDC 3T1FA 3U0PB 3HTLX 2DJUA 5I8EB 5F96H 1CK0L 4OFIA 3HE6A 1XCTA 1ZANH 3NAAL 4NZTH 3MLSL 1FFPB 1C1EL 5CZVL 3EDFA 3VG9B 4JB9H 2VDLL 1Z5LA 4JKPH 3KLHC 2YKLL 2X4RB 4NOFA 1JGVL 4KMTH 3H0TA 1JRHL 2HT2C 4HWEH 3IGAA 2BDNH 1LEIA 1JUFB 4HMEA 4JM2F 5DEFA 4GH7B 2Y9RT 3GJFH 1LK3L 3MV7A 2GJJA 4KROB 4GG6F 4JG1H 3RL1B 5IG7B 1X5IA 3BO8A 3CDYA 3EYSH 5LCVL 2EIEA 4U1SA 5HHME 3KLAA 2WINA 4XCEA 5HGHB 1M4KA 3CZFB 4Z0XB 3H7BA 1QBBA 2JK5B 1AXTL 4P5TA 5F7DA 1FRGL 4KI5D 5JXEC 2YN5A 1OGTB 4XWOC 3BX7C 2PXYA 2E9IA 5D1ZC 4CVZB 3WS3A 3DBXA 4RGNC 1AGDA 5LG1A 1NMAL 5HPOA 5AYUH 4R7NA 5L2JA 5T3XH 3CX5J 4WI3A 4CW1A 4YPGA 1NCNA 5E8PA 4LGSB 3QJFB 1KJ2H 4EI5A 4MS8C 5BVJA 2NR6C 1I85A 1RUPL 2GJ6D 1HHGB 5AZEH 1MJ7L 1SJEA 4Y5XC 3GSQA 5J6HB 5HD8D 4NNYB 5EZIH 1CCZA 3MTRA 1LO4L 4LCWE 1NC4B 4XTRD 4V1DA 5D5ME 4RSVA 1T21A 5J13C 4HS8H 5JMOC 5I1JH 4QRQB 2EDFA 4NC0B 5KSAB 2CKBA 4TVPH 4BH8B 1FL3B 1MNUH 2MCPH 4HQQL 3WCYA 3DXAB 1HQRB 3NA9H 1VFOA 2H6PA 2JCCB 4QWWC 2GCYB 4OZHF 5FO8B 3WE6A 5EBGA 3GEWB 5E8DL 5CJXC 1V5JA 3HNTH 5DJAA 1WWCA 1N5AB 4X6FB 5LGHH 3VA2C 4X5XB 3RUGA 1Q9OA 4KHXH 4G6JH 4PRIB 4YXKL 1G7HB 2DI8A 4IDJL 4X8JA 3O4LB 2YD6A 3MOBL 4WHCA 1OARL 3F8UB 3CZFA 5T1DH 5D70L 4LPUA 2G9HA 4XH2A 1NSNL 4HKJA 3TH4T 3U9PH 5DRZB 1PY4A 2DMKA 4ORGA 4G8GA 1OCWH 5DHYB 2XIDA 2BMKA 3TGXA 3RWHA 3VD7A 4QXGL 3U9PL 3FQRA 1ZANL 3QAZC 4YHZH 4UT9L 5IWLC 1WWBX 4FQCL 5D70H 3B9VA 5E8EB 2CLVB 3SDYL 3WLWD 1P7HL 4M02A 1PGRB 1KXVC 3EFDH 3K74B 3OKDA 3NCFB 3VGBA 3QXWA 4X7TA 3UX9B 1L9NA 5HYFA 2AJZA 2UY6A 4NN6B 1I1AB 5DO2D 2ORBL 3QISA 4NZTL 2R0LH 4DGIH 5HGDB 5I73B 4GW4A 5C6PB 3RWJB 3CFBA 5EUOF 1JWUA 2IALA 4L9DA 5AUMA 5GRJL 3ZDXE 1WTLA 4HLZH 4WUUA 2VLLA 2CR3A 4HGKC 4G6KL 1F4XH 1YQVH 3GHEL 3GSUB 4OZ4A 3EUUA 2SEBB 1MIMH 4YR6A 4RNRA 1FDLH 4XNZC 4QTHB 3MCLH 3CDGA 4LDLB 3VFNB 1KLGB 3WHXA 5KZCD 1BIIB 3PJSA 4X99A 3QNZB 2OJEB 2ZSWB 4LCUB 1IFHH 4LSVH 4Y2DD 3NCJH 3MV8B 1OW0A 5GGQH 4EDXB 1BD2D 2EXYD 2OR9H 5GS0D 4NQVA 2H1PH 5HVWA 3UP1A 1P4BL 25C8L 5DD3H 1K85A 3UJTH 4ZPVB 4WFHE 1BAFH 5L2KE 1B6UA 4F57L 1GOHA 3H3PL 1KG0B 4K7FA 4EI6B 1U0QA 3QBTB 2IANB 2BVYA 3IETB 1YYMH 1TJHH 2VDPH 1FJ1A 3MRMB 4EBQL 43C9A 5JXED 4OZGA 3LSOA 3W0WB 2X4TB 2UUDH 3MV8E 4X9FA 3B9EA 3G6JA 1TETH 4OLWH 3GO1H 5ESVA 5T3XL 3BH9B 3WFEH 4NSKB 3CVHA 4LPYA 4R8WL 1NGXB 2XN9A 5D2LE 4S1RH 2NY4B 4NRYB 2IJ0C 1KV3A 5IIEB 5LQBL 3OKMB 2YMXL 5D7LA 1YYML 4PG2C 1S8DA 1GZQA 4L9LC 2QADC 4KUZL 5JXEA 4CGTA 4C4KO 4J8RB 2KDGA 4ZOEA 2HLFC 4PGDA 4X6DE 4KRMB 1P1ZA 2LU7A 1FORL 2P8LB 3HS0B 5K93A 3BKCL 4Y4FD 3FQXA 1B4RA 4NN5B 1J8HD 2DQUL 4QY8B 5C0CB 3KPMA 4PGDB 3DUHA 3IAPA 5ALCH 4CADA 4LLYB 4M7LT 3STBA 3D9AL 2X4QA 5FYKD 2R4RL 4PGZA 2B4CC 5FEBA 1D5IL 1OAQH 4JJ5A 1IEAB 2ZCHH 4HXAH 3C87A 1NLDH 4OM0L 2UWEF 3TNMB 1PVHA 5CEXA 4TUJA 4OLYL 3S4SB 3C5JB 3D3VB 5HYJD 3BZDA 1HSBB 1QLRA 1VADA 2MPAH 4R6UA 5KSVB 4IRJC 2WWMC 2MWCA 1MRFL 3QT2A 2V7HA 4IIQC 3C5JA 3HNSH 4K94L 3JV6B 4PRIE 1DQQB 1Q94B 1FZKB 2WIIA 3DX9A 1PFCA 2Y6SD 4G6FB 4C56D 5I8OL 4U1IB 4P46D 5IP4A 2P5WD 5LJYH 3RUGB 3S5LG 3VWKA 5DT1L 3C09B 4WUUD 2PCPB 1VCAA 4KFZC 1JMXA 2YS4A 4WUKH 1DLHA 1SBSH 4NUGL 1N26A 3D87B 2EYTA 2XWJB 3RY6A 2YXMA 1AE6L 4OLVL 4P9HC 5FB8B 2MPAL 3FQUA 1W72L 2DF3A 2VR4A 2Q3AA 3GBNL 1RZKL 1KJ2A 4L9LA 1PJ9A 2VC2L 1QSFA 2EIDA 4QRPD 3QO0B 2G75B 4EUPH 2O26U 1WZKA 2NY1D 3DVGB 3LV3A 3LPFA 4HLJA 4UDUB 4PTUA 2XRAH 5CSZB 3GSVA 5JW3H 3ETBF 3VMNA 1RU9L 1P9MC 4X98A 1R3KA 3RDTD 3KXFE 3BGAA 4ZO8A 3BDXA 3MJ8B 5D1ZD 3E2HC 2AK4D 4TOYH 1GC1C 3QEUA 5ESQB 1BD2E 2FHBA 3DMMA 2NY3B 4P2RB 3V7MA 3OHXA 4XNMA 4KY1H 2DJSA 1FSKC 3V4UH 4H1LA 1NBYA 4CW1B 4MNGE 4ZFZB 5JHDB 2QL1A 3NTCH 2IMNA 1UH2A 1U8PA 3QXVA 1YNLH 5IFJA 2GSGB 3GHBL 1G7JB 1OAYH 1A9EB 4HPYH 1YMMA 4QNPF 2L7JA 3ZE0E 3LQZA 3PL6B 3KPTA 4C54A 1U2CA 4JN2A 4NZUL 5J9PA 5GGRY 1IZKA 1EXUB 4M61B 5CJXA 1P7QD 4HX1B 3ALPA 4KJPC 4NKIL 1J5OL 2YUVA 3P4MA 1LP9B 1XGPB 1OL0A 1E4XL 1UH3A 2NCMA 1BQHA 1YECL 1FO0B 2NYYC 2YD8A 5GGSB 3G6AB 3O3DB 4N68A 2EH7L 3RZCC 5IFHH 4MSWA 5DJZB 1OPGH 4HK0B 5D7SH 1T0NB 3OKEA 5HDLA 2DICA 1G0DA 5E5RB 4EI5D 4ZTOL 2VSDA 5MI0C 2XZQL 4ETQB 5C3TA 4OZFB 1KN4L 2CIKA 3PP4L 1MQKL 1EHXA 2BY2A 1XH3A 1CT8A 1VGEH 1G0XA 3R06A 4L8DA 5FIEA 3FO0H 3QWQB 4Z5RB 3L1OH 3R8BB 5DZOA 4OD1L 1KELL 4ENED 4LLMB 4R0LA 5ISZA 4TVPE 3EO1A 1S7WA 1I1AC 3WLWC 3G5VB 2B2XH 2X4UB 2B1HL 3PDOB 4YXLL 4A2MA 1IL1B 4YHOL 2FCBA 5EOCH 4HUXB 3QQ3A 1SY6A 4LARH 4P5TC 3GIZH 3HC0A 3STLA 1UH4A 5JNYA 1UWGH 4LLWB 5ID1A 3U1SL 2DIAA 2I9LB 3QUZB 4N5ED 3BESR 4YHPB 5GZOC 3OJDB 5AAMA 4PJ7E 2VAJA 3CFCL 4YZFF 3BKJL 5JHDA 2BSRA 4L4VE 1E4JA 1CK0H 4BKLA 1GHFH 2WLZA 1JPSH 1LD9B 3ARBD 5D4QA 3QCTL 2YWZA 3MMEA 5DLMH 4Z7NE 2IFFH 4IRJD 5I1EH 1WIOA 5AD0A 5EOQH 3VXME 5D2NA 4DVBB 2I5YH 3OG4B 4OF6A 3MGOA 4NRXB 2VISB 2OP4H 1GGTA 1OP3K 4OV6F 3RA7H 2AJUH 2FJGB 4HEPG 3UEZA 5B39G 1MI5E 1WTGT 2R0KL 4Y4FC 4K71C 3BZEB 1QSZA 1MFBH 2VWEE 1DBJL 1S7SA 2EIBA 5F3HA 4X9HA 3ARPA 2VKWA 4KHTL 2MQ0A 1C16A 1KCSL 3P77A 1HHKB 2FD6H 3FMGH 4HZAA 4BFBD 4GMTH 3OAYK 4NQCD 1Q9LA 3PWPB 5DMKA 5FM8A 1XGRA 4GBXD 3L6FA 3O81A 3OXRA 3FQNA 4BQCA 1WZ1L 4M8QB 3FQTA 1RMFL 1HNFA 4IMKA 4LEXL 3QUXA 3TIEB 1NL0H 5DJ2B 3BKYH 3SE3A 1DFBH 4U1GC 3MRNB 1G6VK 1G6RB 3GI8H 1ES0B 4I0PC 4XNYL 1Z5LB 4MCZB 1L0XA 5C8JA 4XT1C 3O9WB 3HCVA 3C6LA 2XTJC 1T1XA 3CPLB 1EVUA 2DS4A 1AJ7H 4R2GB 1I7RB 3DGGB 4YFEA 5T5NG 4O9HL 4BELD 3T3PF 3ULVD