2NMSA

The crystal structure of the extracellular domain of the inhibitor receptor expressed on myeloid cells irem-1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
112
structure length
112
Chain Sequence
GIPQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CMRF35-like-molecule 1
publication title The Crystal Structure of the Extracellular Domain of the Inhibitor Receptor Expressed on Myeloid Cells IREM-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 27
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nmsA00
3ARXA 2PXYA 3RJQB 1MCIA 1PD6A 2AKRB 4PJ5B 1N7MH 4YIQA 1T5XA 4NZDA 3W9EA 5EH1A 4G3YH 4CVUA 6FABH 3RPIB 3B6SA 3K46A 2Y9RT 3SKOB 1MFNA 3JVGA 1NBVL 2EE2A 1MCSA 3RVUD 3B2VL 3CDGA 3EOAB 5EUOB 2IADA 4PJAF 4RMSA 5E5UB 4NJ9L 3AXLB 3T3PE 3I9GL 4FMFA 5D7JB 1KN2H 5CGTA 4F33B 1NANH 4LPUA 3U36B 5CJ5A 5CJQH 1S7QB 5JTWA 2AJ3B 1HI6B 1NCWH 1MFEL 1BFVL 4D9QE 4LCYA 1M7IB 3F12B 2V9RA 3O4LB 1T3FB 4LAJH 1QFUH 2EDWA 4XAWL 3WS6A 2VUOA 4HPOH 3MLZL 4PV9B 1A9EA 2EH8L 4HF5L 5FB8B 2MQ3A 1IM3B 5FXCH 4U1HB 3QIUB 2DM4A 5DEFB 4MA8L 3DJ9A 1W0YT 1YEIL 5DJ8B 4GAJL 1IM9B 5H94B 5ESAA 3VXRD 5SWSE 1I8IB 2K7QA 4PGCB 4QTHB 1FNEB 3MNWB 3LEYL 4DEPC 4YDIL 3VFNA 3SBWA 2Y07H 4NZUL 5ACZA 4LVNB 1OT1A 3GHEH 2UYLA 4XAKD 1Z9LA 2C3VB 4X4YA 3LEXA 5EU3B 5TDOA 2P8LA 2Q1EA 3T0VA 4R4NC 3BRGC 1NCAH 5F7HA 1JTPA 4LSSL 2BNQD 3UDWC 2GSGA 2NY6C 4YHIB 1PG7H 4H8WH 3QA3B 1CFSA 1IAIH 3V0VA 4FQHB 2BERA 2R2BA 5GS1C 3MJ7B 4NCDA 4XPGL 2DQEH 3TO4B 4JKPL 4LHUG 4ODVL 3WNOA 5DJ0B 4C4KT 4MNQE 1BVLB 3CGTA 3QDGA 4NWTH 1AR1D 4UNVA 4DQOL 3ZDZF 1XF5A 1PAMA 1MWAL 1UB5A 3PL6A 15C8H 3FOLB 3TVMA 1T1YA 4S1RH 4DVRH 4PTUA 3HMXH 2X4OB 5D7IB 3RQ3A 4LKCA 4TOYH 1AP2B 1OTUC 4JQIH 1FO0H 4P2RD 4D0BB 2FZ3B 4P4RA 3O9WA 2KDGA 4HXBL 2X70B 4UQ3A 5ERWB 4CMHC 1TJIH 2W9DH 3A0OA 1KJ2A 4I0PA 3MLUH 4CUCA 2F58H 2IFGA 1OP5H 2Q6WB 3QQ4B 4OT1H 4DZ8A 3EDEA 2E7HA 3L3JB 4P5TD 3HG1B 4UTBH 1DLHB 4NRYA 3RZCB 4MZ3A 3CLFH 5FGRA 3PHOA 5SX5H 1DQMH 3EHBC 4M6OL 5GZOD 1FQ9C 1UM5H 4LIQL 2PYEA 4QOKA 4YHOH 3BKJL 5D6DA 5E00B 1ZLVH 4K23L 4M3JA 5E8EB 4RAVA 1VKXA 1KOAA 3RGHA 3GSQA 4NQEB 1ZTXH 3GJFH 3KHOA 1A6ZA 4Z6AT 3IFPA 5IBUB 1P2CB 3CX5J 4F57L 4JPKL 2Z92B 1VDGA 3TN0A 4ODBD 2WUBH 5C08E 1E27A 4DJMA 1WBYB 1MLBA 3B3IA 3E1F1 4JO4H 3G08A 4PJAE 4QGTA 4OCSH 5JW3H 3WHE0 1ETZA 3P9LB 4L8SC 4QRQA 4DKFH 4LDOB 4F8QA 2JF1A 5KSUB 4Q7DA 5E8DL 1MFDL 3O3UN 4BSWA 4LQFL 5IWLC 4RDQG 3T4AA 4U05A 3G5VA 3QEQA 2C4FU 5H37H 4OZ4A 4KAQL 3MBEB 2X6MA 5IB3B 3WS3B 3O3EA 4AT6B 5EPMB 1X4YA 1BPVA 1T80A 4ENED 3NMEA 1RIHL 5EUKB 4X98B 2ENSA 3MGTA 4UQ2B 3RWFB 1MHEA 1DE4A 1TTFA 4ZTOH 4M7KH 3AS0A 4RCAA 1NDGA 1WV7T 4LVOB 4NO0A 3B4NA 4ZODA 3RUGF 3X3GL 1YY9D 4XNZB 2BNRE 5KTEL 1FIEA 3QH3A 2P8MB 5IJVB 3OV6A 1A6AB 4JFEE 1MH5A 3I2CL 3C6LA 4Y1AA 3DUUA 5KW9H 3U7WL 3B9DA 2FIKA 4AIZB 5DLMH 5E9DA 5F1NB 5EU7E 4JFFD 3X3FL 1NL0H 4QHLA 3BP7A 4NKMA 3TPKA 3VXNB 1YY8A 3MROA 1PJ9A 4I1NB 4JPIA 1RVFH 3GGWB 3MCKA 5C3TA 4N5ED 1R24B 5E94B 3TA3B 4OLEA 2AQ3A 5A16B 5ALCL 1S9KC 3OGCA 2Q87A 2HYMA 3ZTNL 2X4TA 3FB8B 1KIRA 5L8LB 1NC2A 3KPRE 2A6KB 3QEHA 4OLXH 4OF3A 5DQJA 4KK6D 3EYOA 4HCRH 2FLBT 3HB3D 4F7EB 3EOTH 2F8XC 4G9DB 4OLVL 3EIFA 2QADB 1GIGL 4Z0BH 5T1MA 5I71C 1P9MC 4L4VB 1BQHA 2IGFH 2D7NA 4LQ1A 4MA7H 1TJGH 3DROA 5I8OL 1V05A 1U91A 1J7VR 3T77A 3C8KB 3KYKH 5GGTA 2JIXD 2AJXL 1OTSC 4H8WC 4R26H 5FDWA 2Q3ZA 4PRBA 3ZDZE 5DQ9A 1IC5H 1SM3H 5HHNB 3WN5B 4R6UA 2VXUH 1ZVYA 2EIBA 2XZCH 4HJJH 1XEDA 4MMXC 3KWWB 5GIRB 3BDXA 4ALAH 2NLJA 3EDFA 4IOFD 5C07B 1J1OL 4FQQA 3EDDA 2YSSB 4Z7VA 4TUKH 3BWUC 4X5XB 3MJ8B 5DA4A 1QLFA 4HAFA 1C5BL 1DL7L 2E9WA 4JY5H 3SDDD 3PGDB 3PF2A 1ZA3B 2DJUA 1MJJA 1V5JA 1WWAX 1NFDB 3LH2L 1S9VB 5D72H 1C16B 5DMKA 3RVVC 1OGAE 2ED9A 1UXWA 2HTLD 2GITB 4MAYA 2W0FA 4XXDA 5DWUL 5LXGH 2WBJD 2VAAA 2CLRA 4BUHA 1S7UA 1UENA 4K2UL 4OGXH 1EMTH 3T1WA 5EZLB 5CFHA 4XBPB 3FQRB 3MRIA 4YX2L 3VXMB 2B1AL 5L0QC 1IC1A 4WFED 4IMKA 3OXSA 2VJXA 5FM5O 1IQWH 3VFOA 4O2CB 3UJTL 2Q7NA 2RFXA 4OV5B 3D3VD 1P84J 4TULH 5KSAA 3KR3H 1A6UH 5JR1L 5J12C 1KBGH 3CAFA 3MV7D 5C0JB 5DD5H 4Y4KD 1N5YL 5IHZB 3SE4A 4Y8DC 5B8CB 2BXYA 3W5NA 3EZ8A 5DJDB 1EPFA 1U8MB 2DQCL 1HH6A 3G04A 5D2LB 5MP6H 3KNBB 1VFOA 5IESH 5J3HD 2FO4A 1FVEB 2V7HA 4IRJA 4KQ3L 3CSBA 1QSFA 2GY7B 3F7QA 3SJVD 3MLPA 3FTGB 4PG2C 5F89A 1KCSH 2P49B 3BSZL 4MB3A 3SDXF 3RUGE 3Q0HA 2VZTA 4K9EC 3ZKMD 4X7TA 5J6HA 4XCNA 4YDVA 1F00I 2H2SD 4FNLH 3TT1H 5IROA 4BA8A 5BRZB 3QI9D 2YD5A 4YDLC 5HHPA 5GGRB 3T0WA 2F54D 5CEXA 2ICWJ 4L8BB 3DLQR 3C8HA 4GW4A 1U36A 5C0CD 2ICEA 5F6IC 4X4MA 2YK1H 1OVZA 3S8WA 4ACPA 4P23C 1MI5D 3BZFB 1WJ3A 4Y4FC 5I6XC 2E6JA 1XT5A 3IGAB 4UNUA 3CDFA 1TJHL 2DQIL 3OR6B 4WCYL 1IAIM 3FB6A 1I9JL 3PWUA 3FMGH 2W0KA 2D7TL 1BBDL 4JFDA 3U82B 2LE9A 1JWSA 1PQZB 3HZKA 4G6MH 1OP5K 3KYMA 5D71L 2GTZB 2Z31D 5B38B 4AY0A 2VDPL 4HS8L 4L3EA 3F7YA 3TT3H 1FL5B 1BBJB 1EO7A 1O7VA 2FBJL 1K6QH 3CFEA 3S36H 1BJMA 4NO3B 3MRJA 4LLWA 5SX5K 1EEYA 1VGEL 5JW4R 1BZ7A 5FF6A 5DR5H 1DBML 2DI8A 2ZPKH 5C6WH 5IHLB 1P4BL 1JWMB 3KHQA 4PYHA 1ZLVK 5F1SA 1FE8L 2VC2L 4M5ZH 4S1QL 1INEH 4O51B 3BPOB 1FRGL 3N06B 2X10A 4HV8B 5I1EL 3MO1B 5EDXA 2EDFA 1HILA 4ZOBA 4EKXA 1FAIH 1CU4L 5HHQA 3LPFA 4WW1A 3SO5A 1CK0L 4LPYA 3VD4A 4U0RC 3CSGA 1AQKH 1XZ0B 4JRYA 4OCNC 3U0PA 5HGBB 2WUCL 4M5YH 4M1CC 5MI0C 1B9ZA 2CDEB 1QSVA 5IB2A 3GSUB 3VXMD 2F5AH 3OZ9H 4JO2H 2OP4H 3WLWC 4XGZB 3FB5B 5CKAA 1EFXA 1H3WM 3ZZ1A 1JZ7A 1CWVA 5D6CA 3Q5OA 1D9KB 4FQIL 1KB5B 4N0YL 3RI5K 2VR4A 3UAJD 4LLUB 5T3XE 2B7DT 2E6PA 3ZDXF 2XZZA 5D93B 4KFZC 2HFEA 2P8PA 4BH7A 1HXYB 3D85B 5F9JA 5FA3B 1NUGA 4FFWD 5IMMA 3G5ZB 3ULVH 3D39A 1KJ2L 5AD0B 2CK0H 1EEZA 5TE7L 4Z7WB 1MAKA 3NN8A 5JIKA 2FSEB 5DEZA 5L2KD 4G7VL 4JG0L 4Z7NE 1DVFD 1N64L 4LKXA 4LHUA 4OFPA 4XCEB 3VRLF 1U8IB 4GO6B 3VXUD 4GH7B 5GZNC 3CJJA 3U30B 5BV7B 5FV1L 2W65A 5LAXB 5T1LD 4YBLC 2VDOL 4JEGB 3SDXE 3I3EA 3QXUA 5ICXB 4D9RD 2FEEI 1CBVH 3UC0L 4W6YB 1FN4B 4OUUB 1KELH 3T0EC 1DSFL 1U3HD 5DMYA 3DMMD 1AI1L 3JTSB 3NZ8A 2Y36H 1PSKL 4OZHA 3P4OA 3S37H 1YEEH 1YUHA 5DGQA 3NAAL 4ONOA 5CP7B 4TNWK 4ONHA 1XR8B 3BT2H 3VXSD 1QTYT 3SQOH 2CDGB 3QDGE 4NP4H 4NQSA 4D8PA 4MMZC 4V1DD 4YGVB 5F6HI 4MJ2A 2UUDH 4KZDL 4JN2A 5DJ6A 4G7YH 2VZUA 1S5HB 5DF0A 1G7QB 1P7QB 1U92A 3CMGA 1WEJL 2IMNA 1S9YA 3EDJA 3VFPA 1KYOK 3P77B 4YBQD 3KLSA 2IALA 4G80B 4AMKH 2VDNH 2ADJB 2BHUA 5KVDH 4BFGA 4X7SL 3ULUC 5L8JB 5EOTB 2GT9A 1D3CA 2AEIT 2J8UA 2O93L 1F58H 4EN3A 3VFRA 2NNAB 2E9IA 4LARL 4N1EA 3BYTA 5CHNB 2IAND 1R3HA 1S8DB 3GMNA 3HNVH 3WIHA 2PR4H 1T2QL 1PZ5B 3EW3B 3IAPA 4I0KA 1RZ8A 1SJVA 5FKAA 3JV0A 2OR9L 4CL7A 4X5WA 1DBKH 5IEKA 3QUXA 1UACH 1DFBL 1J5OH 4KVNH 1N6QH 4X7CC 4GSDL 1S7TB 4JKMA 3QYCA 5L6YL 1AGBA 3S35H 4DEPB 5CIPB 5TH2A 3K8KA 1HE7A 2WK2A 1IGTA 2O5ZL 3TWCL 4GAFB 1MHHA 3SDCA 3QO0A 3QPQC 4OF5A 4AEEA 3BKYL 5HHMB 2YRPA 5D1XA 5TF0A 1MJ8L 2YC1B 3ARED 3GKWL 3QEQE 2H9GB 3MLXH 3BKCL 3DHMA 5DS8A 2CQVA 4UI2A 2ZUWA 1A47A 2CD0A 4WNQB 4LSTL 5DHYA 3UTSA 3U0TA 2AV1A 2EICA 4LSVH 2VZOA 5GHWH 1T89C 1RY7B 1UH3A 4NCC1 1XF2A 5K9KA 4HH9B 3BN3B 5GS1B 2HN7A 1TFHA 4Q9QL 2HVKB 3EYFA 1N5AA 3W39A 1GC1L 4XMLH 4JQXC 1S7RA 5JDJA 4XP1L 1WIOA 2VL5B 3HI5L 1ERNA 1Q9OB 3ZDXE 4R4FH 1I9RL 3TPUB 1DLFL 3T3MF 3OPZL 1FPTH 4O00A 1M71A 3MTRA 4UINH 3LMJL 4G43B 1IC4L 5E9DE 1BD2E 2CDFA 4PTTA 3OXRA 2AXGA 3S3JA 1ZANH 3A67L 3CLEL 4DCQA 5F7MC 3L7EA 4RMUA 1OWWA 1CDGA 5DUMH 1BJ1J 4ODHL 1FGNH 4LCIH 2E7BA 4CMHB 2XKSA 3DNKA 3ULVC 2RR3A 2DYPD 1DN0A 4GMTH 4JHZA 4HMDA 1B2WH 1WZMA 5HHOB 1ZA6B 3VRLE 3A6BL 3MV01 3QXVA 4PG9A 1R5VB 4GT7A 3UPCA 4PJBB 4FFVD 3L6FB 3CD4A 3V4PL 1TIUA 1WC7B 4QHMB 1JPGA 3IDMB 2HT3D 4K7FA 2HT4C 2VLRA 4QXGL 3VFUA 5IHUH 3TV3L 3DO3A 5D96C 1J8HE 2EDOA 2J6EH 3LEVH 5D2NC 2I24N 5ID0A 3AM8A 4FQXA 3DXAE 1RUAH 3U6RB 3P0YH 2GCYA 3U2SB 1Q0YH 4YNYA 3WFHB 3TNNB 1XIWC 3PWNB 1IKFL 4GKSB 3ILPA 4L8SB 3ARZA 4MA3B 3H6JA 1P6FA 3CFCH 3D2UA 1TVHB 3LPWA 4XP4L 3SDAA 1W72A 4P3CH 4Y2DD 1Q8MA 2BSTB 5F9WC 1Q0XH 3OJDA 3FB7B 5FUZL 5DJ2B 3MR9B 5BVPH 1CFQA 2NTFA 1RZGB 2NR6C 4CW1A 2QSTA 4N68A 2H6PA 4Z95L 1EFQA 4NDMA 4R90H 1JNLH 3VW3L 4BH8B 3TBWA 3B8YA 2JCCA 1PYWA 3NCYS 4NFDA 5T5NG 5INCB 4MNGA 1GGBH 3Q48A 1Q94B 3IAQA 2QHLA 4J3OC 3V7AE 1IEHA 3O3BB 1RUKH 4URTB 5CZVH 5B39B 4DKAA 4HAGA 3V6FB 5EBLB 1K85A 3BIKA 2E9BA 2A6JA 3SGDI 4OAWA 2FCBA 3WV0A 3WMSA 1XCTA 1L0QA 4BFBD 3UBXI 5EU6A 1N4XH 2APTA 5FIEA 3LDBC 1A4KB 3DTXB 3Q5TA 4NO5B 1JRHH 4KKCD 1FAKT 5KANI 3L5WB 5T1KD 1ROWA 4R4ND 1K5NB 3NIDF 3EOYG 1YEHL 1NSNH 2N56A 3BXNB 4WTXA 1FLRL 1I8KB 2NY6D 4TSBL 2O61A 1IL1B 1FDLL 4JVUA 4N9OB 3P0GB 2V7NA 3RTQC 1CR9H 5L2JA 1WZ1H 1INDH 3UCRA 2Q3AA 4LOUC 3QEGL 1RMFH 1EHLL 1RIUL 3IAGC 3NCMA 1ULVA 4KJPC 5BJTB 1DQJB 1G9ML 4CVZB 3NZHL 3R06B 3SDYL 1I1AA 2QSCL 3Q6GL 1MNUH 5JORB 5MHSD 4K3HA 5E2UL 3VE0A 3CZFB 3SO3B 4WRLA 4GJTB 1Y6NR 2Q20A 4U3XA 3S9DB 4KZEH 4LCWD 3ZYZA 1P69B 4KMTH 3ARFC 4O4YH 4WFGD 2HMIC 3T3ME 1SBSH 2PO6A 4OQ1A 2IPUG 3QDMA 1IEBB 3QUZA 4NFBA 2XQYK 3WEXB 5D1ZC 3WUZA 2DN7A 1TQCC 1LE5A 4WUUA 3CVHA 4G6KH 2BCKB 3JWDL 1ONQA 4XNUL 4CMMB 2JJSA 3LN5B 4NBZB 5C71A 4RISL 3WXWH 2ZUSA 3TF7C 2B0SL 4RX4A 3RU8L 2XTJE 1HCFX 4NQUA 1QRND 4JPWL 4X4ME 1FYTB 3LV3A 3SCMA 2UUDK 2AJZB 1FO0B 2FHBA 2QHRH 4YFEA 1DUYA 1ZKAA 1AXSB 3T1FB 1U93A 2H3NB 3SKJH 5D1QA 5EC2B 4JDVB 4PJDA 5KVGL 1CE6A 1YNTB 3DV6A 3K1DA 3HZMA 3MGOB 3AAZA 3X12A 4JFDE 3INUL 4PRIA 2J8UF 2KH2B 3H7LA 5L0QB 3V4UH 5BXFA 3QO1B 4NUJA 1LEKA 4OFVA 4YHPA 2QQKL 1QVOA 2A6IB 3HAEG 4IIQC 1EBAA 3RVTC 1XGRB 5FV2A 4KXZI 4QRUB 3OG6B 3HR6A 5F3HB 5CD3B 3NFPB 4RDQF 5CUSL 1RK0B 5E6ID 4UDUB 3UPRB 4M6MH 3HPLA 1XF4A 3GJFB 3CXDH 1ZT4A 5DK2B 1U8OA 5J12B 2F74B 4EVNB 4ISVA 2N7AA 3U7AA 1CN4A 3BZ4B 4G8GD 3WE6A 5MEND 4MJIA 4U0QB 3B5GA 1UZ8A 4RFEB 3HE7C 3DETC 3MRRA 4WFHE 2GJ6A 1KG0A 2YD3A 3SGJA 1N2RA 4PRHB 4W4OA 4JRYE 1X6NA 3W9DA 3ZKQD 1E4WH 1YNKL 1NGWB 4XWOC 4XNQA 1P7KB 4YFDB 2ATKB 2CKBH 1SY6H 2VDRH 1NAKL 4PP2B 2APXA 4HEME 5FYJD 3K0WA 2Q7YB 4LSRL 2F5BL 4PJ9A 3T4YA 4YDLB 1JZ5A 3WIFB 4MSWA 4ZSOE 1P7HL 3V5DA 4OFIA 3P11H 3WYRA 4BZ2H 4C56D 2V2XB 4I9WE 3HCVA 4KU1A 3IS1X 5E08L 1G1CA 3QFJA 3V79C 3HZYB 5F6IB 3QUYA 1NGXA 4GRMA 4PJCA 1N0XL 2XFXB 2R23B 3NIDE 4P23B 4O2EB 5DRXA 4Y4FB 4KV5F 5I6XB 2VZ3A 2DWDB 4J4PA 5F7DB 3X13B 4QO1A 3NBNA 4L8CA 4GBXB 4UT6H 3VG0H 1HQRA 3X14B 1Y0LB 4HIIB 1JGDA 3N1QC 1HZHL 4C83B 1L7TL 4MYWB 1DQDL 2HRPL 1DUZB 1FV1A 2ZCLL 12E8H 4EOWH 4I2XB 2ARWA 4X99A 5IBTL 1T03L 5TE4H 1G7PA 3SEPA 3FO9B 3BJLA 2M2DA 1Q9WA 1MFCH 4MWFB 3VXOA 2A9ML 4RAHA 4QF1A 5I1DA 1YEDB 4JFXB 1NGPL 3QUMA 3RA7H 4NKDB 1NCBH 4EQ3A 3QRGH 1F6LL 3LOWA 5DSCA 5HTSA 2E3VA 2VWEC 4XCYB 4OZIE 2FDBP 1QOKA 1TCRA 3T65B 4X83A 4R9HA 4AIXA 2OK0H 3PIQA 5JOPE 2CR3A 2OXGA 1QD0A 2Z8RA 3QCVH 3QDJA 4LMQE 1I1CA 1SVCP 1MCFA 3D18B 5AWNH 1JZ8A 1IC7L 1FZOA 7FABL 4DGYL 1NEZG 4UBDC 1CFVH 4KI5F 3PGCB 1HHIA 3S37X 1KT2A 2OTWA 4PD4K 3T8XB 2R69L 5MI0B 1J0IA 1U58A 2EYSA 1K8DB 3CUPA 4HIHB 4LRIC 2V17H 4MXVF 4IJ3C 1CVRA 4BQ8A 4MHHI 2E9JA 4X9FA 4TUOB 4PJIB 2J8UE 4M62L 1T2JA 3RDTB 4AEHH 1IGIH 1FJ1B 2FATL 4WDIA 1UVQA 1G6VK 3B5TA 3CFKA 5F1IA 2ADIA 4YXLH 3V4VL 5JPMB 3H7BB 3KXFD 4XP6L 2ESVA 4QRPE 3BUTA 4Q74A 1NCDH 4LF3A 3REWB 5I1KH 4XI5C 2E7LC 1A6TA 2JB5H 2YPVL 1HOCA 3VFWB 1OHQA 1I3VA 3RGVA 5FUCC 4R4BA 4ZXBC 4K71C 4BSVB 4F7TB 4EDWL 4PP1D 3CDYA 3FFCB 1B88A 1P1ZB 1UT9A 1MF2L 2EC9T 3DO7B 2WWMC 5EBMB 4M43L 2NX5A 4OF8A 5IFJB 5KBNC 4GW1A 5HGHB 4F2MA 2WIIA 2XQBL 4XWGH 4XPHH 4ZDHA 3UTSE 2PW2A 1C5CH 5DA0B 1MVUA 4UT9H 4XVSL 3T0EB 3QPXL 4J12A 3BD4A 1EAPA 3FO1A 2EO9A 3KPPA 4JB9H 4U6TA 2VIRA 5E5RB 3RWJB 3VU2A 4HKZA 4F7MA 3BD5A 3BEWB 3BPLC 5KG9A 3D9AH 3CX5K 3C6SA 4M8QA 5FO8B 4WWKA 3VA2C 1W72L 3ESVF 5TDPA 1IBGH 3HKFA 2ICWI 1V7NL 4X4XB 4PRAB 2KUTA 1QHOA 3W11C 3U4EA 5E8OB 3GBNL 4ETQA 4MJ5B 4Y5XA 3N1FC 4L9LA 4PLJD 3LN9A 4KV5E 1SYSA 4OQTA 2BX5A 3CC5A 1F3DJ 3OX8A 3UTTB 4UMGA 3RNQA 4QCIA 3H3PL 3OR7A 5T3ZL 3UTQA 1E28A 3ES6A 5DI8A 5JQHC 4JHAH 1CFBA 3MLTA 3QG7L 4AJ0A 4UU9A 4H26A 2VITA 1LO4L 4NYLA 4KVCH 2OL3H 3MA9L 2DQTH 2WNGA 3P4MB 5JLZA 2HJLA 4N8CH 3DUSB 4PJDF 3B9KC 3IDXL 2Z91B 3DVGA 1K4DA 2YPLB 3O4OC 2G2RB 1IVLA 2JLLA 3ARPA 5DFVD 5TE6L 2VLRE 3RIFK 2B4CH 3DUHA 4WEUD 2OJEB 1L9NA 4KHXH 4CADB 4NIKB 3L3DB 5F9OH 1G7JA 1OAYL 3WBDA 3NVQA 4K7PX 4TVPL 1OT2A 2WQRA 4KI5E 5C1MB 3ARBA 4JREC 1RUMH 5EZOL 2IAMA 2JELH 2HFFA 1LK3H 1QSEA 1JGLL 1NFIB 5HGDB 2IQ9L 1UEMA 4KTYA 3TJHC 1KFAH 4M7JH 1WBXA 4KKLD 2QQQA 1JCKA 2FIRT 4KROD 1GGCH 1JL8A 2M8XA 1I9IL 3E2HB 1OQOA 3IU4H 4MXVE 4LMQI 4UAOC 1T0MA 1U2CA 4HS6A 1KEGL 5JDSA 2OR7A 1PGRB 3L7FB 4E41E 2FGZA 2J4WH 3DURB 4QLRA 1KB5L 2H26B 4JDTL 4NC1E 4MGXA 4NKOB 2IG2L 2YPKB 5I75C 5GS0L 1F6FB 5C0IB 1LO2H 2ADGA 4F7PB 3QBTB 2W60B 1OB1B 1CDUA 4LLMB 4JFED 3W0WA 4HQQH 3K3QA 1KNOB 1AO7B 3GSOB 3RWDA 1DBAL 2VXVH 1MIEH 2VLMD 2G60H 1G7MB 5KSBA 4FOMA 3TCLA 3EYSL 3DGCR 5GZND 3SOBL 1AD9A 4OD2A 5IVXB 4ZQKA 3FONB 2D4FA 1XGTA 3OMZA 1WBZA 5CD5C 4AIOA 5E2VL 1RZJL 1BVKB 1ADQA 3STZA 4WW2C 4E42B 4GG6A 5BV7L 4HT1H 4KDTA 1M7DA 4NRXB 3M8OL 1IFHH 5IB1A 1QBLL 2ZOKA 5ISZD 3KPRD 1NBVH 1OAQL 1Z3GL 3C5SB 1D5MA 3HE6C 2DL2A 1I4FA 1CD1B 2EEAA 4XB7A 3E3QE 3MZTA 5LGHH 1A7QL 1I7ZB 1MQKL 2OZ4H 5D96B 2JJUA 3I9GH 5D2NB 5KJRH 1YN6B 3T09A 3BHBB 2GUOB 5DD6A 5I8CA 4IMLA 3QDME 1XIWB 2M26A 1MFEH 4I3SH 2PETA 1BFVH 1D5ZB 3QULB 2FGWL 3RL1B 1A2YB 4FTVE 1VFUA 4WUUE 3B8SA 3MA7A 3BP5B 2CPCA 5F9WB 2HLFD 5GISH 1JMXA 2DLFL 3G5YA 3ULUD 1FFQA 1Y18A 1W0VB 4XMKH 4HWBH 4LU5H 3T2NL 3VXRA 1BOYA 5CMAA 3QHFL 1EHNA 1L7IL 4YFLF 3C60D 3HAEA 5JXAH 5JHDB 4PBVC 5I1LA 1ZWIB 3BPCA 1LWRA 2P43B 1OGAD 2YPLD 4G6FD 1A6WL 4Z0XA 2O5YL 4PJDE 5I76A 4YHMH 4ZYKA 2BMKB 3LQAH 1HEZB 3CXHJ 3LEYH 4HWEL 3QFDB 5DQDL 4PRIE 1F11A 1RD6A 3D6GA 1QG3A 3SE9L 2I07B 3ORJA 5IB5B 3KPSE 2WSKA 2XPGA 4BZ1H 2IPTL 1R3KB 1JZ3A 1ZSDB 2DQGH 5D7SL 1LD9A 5E2JA 2BNQA 2JJTC 4MQSB 1F4WL 2YXFA 2B4CC 3ULSB 4GLRH 3WXVL 1BAFL 1HSBB 4J8RB 5FKPA 4LSDA 5C09D 4LSSH 1JUFB 3S5LB 3RX7A 3H9SE 3THMH 5J1AB 2CIIB 5FA4B 3RTQB 4JKPH 4MJIE 3IDJA 4ODVH 5MEQB 4LCCC 4CN6A 4QGYA 3MOBL 5C0BE 2GJ6E 4XBGA 4NQXB 3KLAA 1HIML 5DRNB 1MWAH 4P2RA 3FZUD 2P5ED 3KPQA 4M02A 3EDKA 4PRPD 5KAQG 3ZT6A 3UXFA 2BSED 4Q9CA 2GJZA 4F58L 3ARFB 4JY6B 5D5MB 4DUXA 1DQQB 3NABL 1WT5C 1YMMB 4HXBH 2Q76B 5D1ZB 4P5TA 2KZ1B 4G5ZL 1TQCB 5DXWA 3BQUC 2K9UA 1MUJA 3B2UD 3WDHA 4ZUSA 3A6OA 3FN9A 1LDSA 4PYGA 3BISA 1GPOL 5A2FA 1RUQL 3QFJE 4DOHE 4YE4H 1W2KT 5IIEA 2C3HA 4XPTH 1TNMA 4Q9RH 3WNLA 2DWEA 4IOIB 2GW5A 1R5WB 1GGIH 3DVNB 4EI5D 3MRDB 3VGEA 4LIQH 1XGPA 5JNYA 4K23H 3NCFB 4F3FA 1PLGL 1X7QB 2CUHA 3ZL4L 1R6VA 1H9VA 4JZNA 5DUPH 2XN9D 3NFNA 1N59B 4IS6B 3LKSB 4JPKH 4M1GL 1IGYB 4KQ4H 2XWBB 1ORQA 1G9NL 3PV6A 2XKNB 4WUKL 5SWZE 5KS9F 1M7IA 1NEZA 3BGMA 5FFLA 5E8DH 4IIQB 5IV2A 1N7ML 2JK5B 3CX2A 3RBSA 4LQFH 4E0RB 4G3YL 6FABL 3P30L 3LKRA 3O41A 3QIBD 4MD4B 4MX7A 3OWEA 5EFIB 3LD8C 3KVQA 1UH4A 4HKXB 2Y7QB 3PWPD 3GK8H 4G42A 3IRPX 3CK0L 1H3GA 1N3NA 4OI9A 3QDJE 5H94A 2ITCA 2I9TA 1I7RB 3RFZC 1PKQA 2WINB 4HHAB 1FL3A 3D69A 3HE7B 3N0PB 3QWQB 3MGAA 4GAGH 4JQVC 5FGBA 3VDCA 5F88A 2AW2A 3AC0A 5D7LE 4BJLA 1MCJA 4JFFA 4PBWD 3GUTB 3MYJB 3TCXA 3ZDYF 3O6FD 5JO5B 5C8JA 3I02A 3X3FH 4HGWA 4HPOL 3WNNA 1CTNA 4FXGA 2XY2A 3RY6C 2DMKA 4KJQD 1S7VB 4PV8A 4J3VA 1EEQA 1WLHA 3SKMA 3ILQC 3LQAC 5ALCH 3QNYA 3PHQB 1OGTB 2YEZB 4JG1L 3PNWA 5CEZL 3RKDC 5AG9A 5T3XD 3ZTNH 1ZLWH 4OQTL 2GK0B 3E6HB 3VMNA 1G0DA 5FECA 4U1JB 4UOJA 4I3RH 3TZVC 3HZVB 3M1BB 5C0DA 1FFNA 2XT1B 2H2PC 3WFDL 1RJZA 1JZ6A 2Y07L 3ABZA 4TUJB 3RWIB 5K9QG 3EJZD 3L5JA 2A74A 2IBZX 2JIXA 3B9VA 2E8YA 3MRPB 2X4OA 4KJPD 2P4AB 2NY4B 3O11A 5HYJB 1DANT 4NZTH 2FZ3A 5HPMA 4YO0B 3VWKC 3TIEB 1KN4L 4NKQB 1YN7B 2X2YA 3BH8B 1NCAL 1HYRC 4C54A 5I1GL 3L3KA 4DK6A 5KSVB 2DQJL 3L9RB 1IAIL 5T33H 1J1OH 3SDDA 2DQEL 3VFTA 2W9LA 1LMKA 1IILE 4H1LA 3WDJA 1DL7H 25C8H 2WBJA 4O9HL 4P2QD 3LH2H 5I15H 2WP3O 1F4XH 3LZFH 4DVRL 3QDGD 3EO9L 4NQEA 3HMXL 4K2UH 5MEOA 5C0FB 4IEFB 4CJ0A 4ZS6D 2O26U 5KZCD 1FFOA 3BJ91 3T2PA 4QRSB 3ELAT 2X9YA 1TJIL 2W9DL 3D3VA 1U42A 2B1AH 1FFRA 3Q3GB 2UV3A 3WFBH 1CXKA 1HHHB 3GSXB 2R0WL 3MLUL 2F58L 3BD3A 4HUWA 4UOW1 2A6DA 3UJTH 4LLVB 4IJ3B 4OT1L 4J3TA 5F97E 3MLVL 2R9HD 4I0PD 3T0AA 4HS3A 3CDCA 3RVTD 3TBTA 5KS9E 2Z8WC 4JN1L 3CLFL 4Z77A 3OKDA 4Y4KA 4YHZL 4ZPVA 4ZD3L 1AIFB 1DQML 4UDTB 2QSVA 3U1SL 3CH1A 5IFAH 3RWFA 1X5YA 2NY7H 5CZXC 1GAFL 5F8QC 3H8NA 4BK5A 4NKIH 4YHOL 1EXUB 1X5AA 3KS0H 1WSST 5D9SA 4LPXA 1N5YH 3MSPA 2YUZA 4K3JL 1ZTXL 4OKVA 1J10A 2A83B 4R0LA 1F6AB 2EYTA 2WV3A 4B50A 2DLGA 2DQCH 2WUBL 3SJVA 2H41A 2ILLA 4JO4L 3SGKA 4OCSL 4KQ3H 4K71B 4PGBB 1ADQL 3QEUA 4AIZA 1XMWA 3BSZH 4X6DB 1F02I 3JZ7A 3QI9A 2F54A 1UYWH 5JW4Q 4NBXB 4XWOD 4PJ7F 3KDMB 2FR4A 4WJ5B 1R24A 4BQBA 4QXUL 4KRNA 4U3HA 3ZDYE 3TBSB 4RZCB 1KUMA 2BSSB 1CS6A 4N0UB 4ZTOL 3QAZC 1JNNH 4HC1A 3RWGB 4H0GA 3MRCA 3IRZA 3OKNA 1MI5A 4ESKA 3V5HB 2YD1A 3BPLB 2OSLB 4U6VL 3MJ9A 5GS2H 2NY2D 4Y4HC 4RMVA 4YFLI 2Q86A 2LQRA 2IPKA 2CKBB 4EDXB 4G9FD 5GS3A 1IQDB 3OB0H 5EOCH 1TJHH 1UA6H 2BVTA 4UV7L 4WCYH 5DLML 1I9JH 3C8KA 5DD0H 1NL0L 5I66B 3QWOA 1CICC 1NC4B 2WM0A 1BBDH 5LCVL 2Z31A 3J7HA 1J05B 1S5IH 5IMKA 1T20A 1BD2D 1J1PL 1RVFL 4N5UA 4CNIB 2FWOB 5HHNA 4AEIH 3PXHA 4BQ9A 3MODH 2VDPH 1CDJA 2FBJH 1ZAGA 1LHZA 2WW8A 2C1PA 5KOMC 1U8NA 4OLXL 3MRQA 1DBMH 4LPCA 4HCRL 2VUYA 1G7HB 2KL6A 3B83A 4Y19D 5A43C 1FE8H 4S1QH 1BOGA 1XGUB 2XWTB 1A3LH 1P5UA 2BNUB 4L4TB 1AY1L 4BFEA 2LVEA 2X5PA 4DFIA 3OKLA 3VH8G 2IGFL 1HNFA 5F71A 3UTOA 1TJGL 3RBGA 5B3NA 3KYKL 1QPPA 5A1AA 3C5ZC 2EH7H 1QLRB 2AK1H 3DGGB 1J8HD 2FJHB 4UBDD 4R26L 5C0NC 1QBBA 1Z5LA 3FQXA 4U4BA 1SM3L 3VXMA 3DXAD 3G6AB 4BQCA 2C5DC 3DX6A 2XZCL 3O8XB 4HJJL 4ALAL 2QTEA 4Y16C 3LKPB 1ZGLA 2YA1A 1L4IA 4UIKH 4R96B 4WO4D 4E5XA 2ZSWA 3R1GH 3SKUD 4N0YH 5AYUH 2YD7A 5C0JA 5D72L 4UAOB 5LXGL 4I48B 1KCRL 1DEEA 4OGXL 3CFDB 4YPGA 3L95A 3EGSA 5TQ0H 1EMTL 2GAZA 5L2KA 5DEGA 2ZUXA 1YEGH 1KJ2H 3QP3A 3IETA 4JCMA 5TE7H 5I75B 2R2EA 1J0JA 3TNMB 2VTFA 1NBYB 3FO2B 5JHLL 4RMWA 5F8RC 2CGRL 3K8MA 4JFOA 1IQWL 3VXUA 4P9MH 2R15A 4ZXBD 4P5KB 4LNVA 5CJXC 2V9TA 4I0CC 5T1LA 4C55A 3JV6A 4TULL 5EWIH 5I16B 1WFNA 3NCBB 2H32A 2BNQE 5F3BA 4F37F 1Z9OA 1U3HA 5DK0A 3DMMA 2VSCA 4GQ9L 5J13C 5GJSL 1GGUA 1S9WA 4ELKA 3PG2A 2PXYC 2ZNXA 2FJGB 1DSFH 4WW2B 2A0LD 1AI1H 4PJ7E 3VXSA 5AG8A 1TZHA 2APWA 3IT8D 4V1DA 5MP6L 4IDLA 1Q9LA 3S96A 3DYOA 3BZFA 5IESL 5DZOA 2D7OA 3HE6B 5K9OB 4FQCH 2VXQL 2MKLC 3EJYC 4QY8B 2B2XL 4M3KB 4AZ8A 3WHE1 4P2RE 2CJUL 4U1LB 4CU8A 4M9PA 3ZHDA 1R0AL 3FN0H 4HFWB 5IB4A 4P2OC 5E99H 5EC1A 4FNLL 3F8UB 2IBGA 3TT1L 1T5WB 3Q6FA 1A02N 3H9YA 1FZKA 1U3ZA 2H8PA 3EFFB 3BO8A 3QZWB 4ZAKD 3F7VA 1CZ8H 2OCFD 5JIIA 4U1MA 2IANA 2AK4B 4ODWA 4PJ5E 5DVLA 5IMLB 4NO3A 3VXTA 4BKLA 1C12A 3MV8D 3P3YA 5HD8C 1T0PB 4WHTA 3RWEB 1G7IA 2YK1L 2OI9C 4D0DA 2VLLB 5LGJB 5J9PB 1T2QH 4L29B 3SY0B 5LKNA 2XTJD 4CVXB 2OR9H 3B9KD 1Q38A 2YOCA 3LSOB 5DVMA 5TDNB 4D0CB 1FNLA 3K4DA 3FMGL 5D8JL 1DFBH 5T5FH 4OGYL 3MUGA 2EDLA 4GKNB 2YS4A 4DN3H 1FFPA 4KXZH 2OL3B 1A4JB 4HIEA 5DMJB 2NXYD 3CSYB 3TWCH 3AREA 1INQA 1XCQA 3MLRH 1Z0NA 3BKYH 1K6QL 3S36L 4MCYA 3BGFC 5H2BA 3O4LE 4HUXB 2F53D 4CRPA 1MJ8H 4LDLB 2ZPKL 1FSKC 3ARTA 4HX1A 1C08B 3OKKB 4Z7UA 4LSTH 4M5ZL 3D0LA 3QXAB 1KCUH 2R1WA 4NSKB 3MCLH 4PJFB 4MD5A 3GMRB 5GGTH 1ZHKA 1FAIL 3VXQB 5EU5A 2XNAB 3ZKXC 1AGEA 1GC1H 1FC2D 5FK9B 3CPLB 5GGQH 4JJ5B 4LCCB 3V2AR 5TFSL 1AQKL 3DI3B 4HG4K 3HI5H 3HRZB 3ZE0F 1I9RH 4R3SA 1T6WA 1I3UA 4A2MA 1UCTA 1QUNA 3Q5YA 4Z78A 3TVMC 4I5BA 3LMJH 3SGEH 5GGVH 4JO2L 4JRXD 1U8KB 4P5MB 2OP4L 5GGUB 2DYPA 3KPLA 2IBZY 1IKNA 4LSPH 3VXPB 1KTDB 4PGJA 3BQUB 5GRJH 3HUJA 2ATPA 4P46B 3K7UA 1IAOB 4R7DA 4HDIB 3QDAA 3A6BH 2Q8AH 4KTEL 4I9WD 5JOFB 1JV5A 3LKNA 3FCTB 2VE6A 2YBRB 5DZLA 1X5GA 5CBAB 2YR3A 5A2KH 2CK0L 2VLKB 3OB0K 1LNUB 1PBYA 5B3JF 4KRLB 2D31B 1EH9A 3GRWA 2NY0C 1P4LB 4HUUB 3AS1A 1A9BB 3TV3H 1X44A 3RVXD 5SWSB 5EO9B 2R0KH 5F72S 1EHXA 2OM5A 1YQ2A 3GMOB 3TN0C 1ES0B 3PJSB 2FB4H 4Y2DA 1G7LA 1JGEA 2GJJA 1IGCH 2EE3A 1J0ZA 1IKFH 4I13B 3NCJL 3G6DH 1YYLL 3REVA 1OM3H 1KELL 5EO1A 3L3OA 2NNAA 1KCLA 2Y36L 4F15B 5E4EC 5BS0B 5CHNA 5I8EB 1KPUB 1KC5L 5L9DH 4P4KC 3LD8B 3FT4B 1JF5A 4OM0H 3S3PA 3SQOL 3MRMB 1XAUA 4NP4L 3KYNA 4QEGA 4CAGA 3EYQD 4FP8L 4M61A 2X4UA 4G7YL 2R2HB 3FT3B 1OTTD 3QWRD 4NQEE 4KRMB 1T1WA 1ZV5A 4TN9A 2NY3B 1CG9B 4MNQB 4WFEE 1XGYL 3TIDA 4M6AA 1VSCA 3S4SG 2HRLA 3QIWD 1NLDL 1NGZA 4AMKL 3D3VE 1HWHB 1B4RA 3KPMA 3C6LC 5DTFA 2VDNL 4YXKH 1V3KA 4G8EA 5K33A 5KVDL 3CCHA 5CP3A 3FQTA 3NCYP 1MPAH 4R2GC 1F58L 4FXKA 1V3MA 5T1KA 1BZQK 5MEPA 1CXFA 2NY1C 3H0TB 4WNQA 1Q9KB 3HNVL 4WU5A 2PR4L 3UTPE 3UDWA 5C0AB 1A1OA 3TH2T 2BOBA 4KMQA 5F70A 1KJMA 2CIKB 4NM4H 1K3ZA 3U9PL 1A1NA 2Q8BH 3OHXB 3BPNC 1A21A 5GSRB 4HJGA 2UVEA 1UACL 1U2HA 1J5OL 4OCRH 4QRPD 5ICYB 2XWJA 4A6YA 5E8PA 1R3IL 3O3DA 4GUPA 3QEGH 1EHLH 3S35L 4YR6A 4WU7B 4B41A 4Z76B 5M7QA 4U6HB 4LCWA 4RAUB 1S78D 2DMBA 3Q6GH 3ESUF 5ID1A 3CFBA 4G43A 4G8FA 1WZKA 5ALBH 4O2FA 2BVOB 3V52H 3OAUL 1S7XB 3ZE0E 1T1ZB 5CSGA 5KAQF 5C08B 2EDQA 1UG9A 4GKZA 1JWUA 2F54E 1VADB 4PJXB 4IRSC 3MACH 1K3IA 3IF1B 1GC1C 2V2TB 4LSVL 2DQUH 1GZQA 1CXEA 4I18A 4WI9A 3JWDH 4XNUH 1A8JH 1QRNA 1CGTA 4HK0B 2X4SB 5AYQA 5IG7A 1MWAB 3LKOA 1RJCA 2B0SH 2I9LA 3QT2A 4XMLL 1M6OB 3RU8H 5IQ9B 1HYSC 1AKJD 4L8DA 3L3IA 2X42A 2IH3A 2J88H 3EO0B 4U3CA 1I7UB 1FPTL 3JTTB 2IMMA 4L4VE 1TVDA 4MAYC 4UINL 2B5IC 3FT2A 5IMOA 4UIMA 5IP4A 1ED3A 1ZANL 2GSIB 5GGSY 5EN2B 4K94L 2APBA 1UJ3C 2BNRB 3NOIA 5DUML 3INUH 3IVKA 1FGNL 3VH8A 4YEFA 5DK3A 4GMTL 1BWWA 2QQKH 1B2WL 4PGEA 1CL7L 3PDOA 5E6IA 4IMKC 4JY4A 4ZUTA 3SPVA 5HI4C 2P42B 4N9GA 5BOZG 1K4CB 4NRZA 5C07E 1VESA 1CLCA 4AH2A 4Q97A 2DJSA 1MCCA 9CGTA 5KSAC 5MENA 5IOPA 4UUJB 5FO7B 4HUVA 3PXJA 5FYLE 3VGGA 1WZLA 3WLBA 1AHWC 1BIIB 2J6EL 3LEVL 5JIHA 5C92A 5LJYH 2BFVH 4H5SB 1H3PH 1RUAL 4NQVA 2A9NH 3ZE2F 5GSVA 2P24A 3P0YL 1A1MA 3RL2B 1AD0B 5DUBA 1HXMA 1E6OH 3VXME 3CH8A 2HT2D 4IRJC 3MRLB 1CFTA 2HFGL 3CFCL 1WITA 4J1UA 5A2IH 4UV4H 2BJMH 4HBCH 1U6AL 4KI5D 5L88H 5BW7A 4NN6B 5H8DA 5BVPL 1ZHNB 4C56A 4ZUWB 5IROC 3L5WA 1BX2B 1K5NA 5CS7A 4R90L 1JNLL 5TGBA 4Z7WF 4QRRD 5KN5A 4YDKL 3ILQD 1A6VL 2XZAH 3UO1L 4NHCH 4XNMA 4L1HA 1GGBL 1N0XH 1PFCA 3OKOB 4Y4HB 5L2KE 4E41D 5CBEB 3I6GB 1JYXA 5CZVL 3DARA 1MHCA 1X3DA 3WJJA 4PS4L 4OCYH 3TZVD 4XX1E 1UQSB 5LVEA 5SWQA 4MB4A 4KKBD 1HZHH 1WQVT 4RFOH 5CGMA 3WIHH 2HRPH 4YHNA 5INDB 2ZCLH 5CJOL 3HR5B 5A3IC 4M6NH 1K9TA 4GW5B 3WEXA 5EO0A 1WUNT 3ROOA 4G6AD 4DW2L 5BRZE 3VWKD 3MRGA 1ITCA 3RX8A 1LP9B 2EKJA 2XACC 5E0QA 2WBWB 1O7SA 2A9MH 5DMIL 1JPFA 2AJSH 3VMOA 1M05B 1G9MC 1XF3B 3B5HA 4LVHC 5FO9A 2XQYG 1CR9L 3O81A 1WZ1L 2IH1B 2NY5L 4V1DE 4D3CL 2QKIB 2R1XA 4U1KB 4PRDA 3TYFA 4X6BB 3T1FA 3LKQB 4RNRA 5CSZA 4HKBB 4JDVA 1MNUL 2Y06L 5B4MD 3HC0B 5C9JA 5T3ZE 3BEVB 2GYSA 3C5ZB 3TBYA 3QNZB 4XVTH 3E8UL 3JWDC 2CO7B 4I77L 2JTDA 5FYKE 4X7FC 3M17A 1WF5A 1ZVHA 5IQ7L 3G6JA 2VQ1B 1JI2A 5FHBH 1A7NH 1K2DB 1QEWB 1RIVL 1XH3B 2IANE 3WXWL 4FTVD 2YHGA 4WUUD 1RK0A 2CK2A 4M62H 4UDUA 3RZCC 3UPRA 5IW6A 3KXFA 2BVQB 1JF1B 1JK8B 4N8VB 5FAAA 3GMQB 1C5DB 4XPFL 2DF3A 1QBAA 4XP6H 2X7LB 4JDZA 4G8IB 2Z35B 5HI3C 5CZXD 1X5XA 3KPOB 1HQ4B 4TVPE 1X4ZA 3EO1A 4Y5YC 3TYGL 1BMGA 4QYOA 1NDMB 4DK3A 5GPRA 3QJHB 3V6ZB 2RB8A 3V4UL 4ZNEA 4PG2A 4YGAB 1CXLA 1SJEB 4PRID 4QNPF 3S5LG 2A2QT 3ZE2E 1E4XL 3AS2A 3KPSD 1KYOJ 4M43H 3O0RH 4M6ML 2MPAH 1B3JA 3GSRB 2XQBH 4JVPA 5F96L 5J13B 1PDKA 3LRSB 1LK2A 3VFVA 2V2XA 4NZRH 2PXYB 2WIMA 4XVSH 1VFBA 2EEBA 3QPXH 1L0YA 5E5MA 1FIGH 1L6XA 3CU1A 4YIQB 5EIQA 1T5XB 3W9EB 1I1FA 1B90A 3H9SD 2WWKT 3MYZA 3C5JA 4LVOC 3B6SB 4FG6D 1LE9A 3FO0H 3RWCA 5DMGC 4K55A 4Y4FA 4EIGB 4RA3A 4Z7WE 5E03A 1W72H 3GSNA 2J1KA 1FC1A 3CDGB 1V7NH 2ARJQ 2IADB 1Y0LA 4LPWA 2OS7A 3IDGA 5C0BD 1E4WL 1R5IA 2H45A 5ESQA 3CNKA 2OTUA 2CKBL 2W59A 1ZHBA 1KXQE 1T22A 2VDRL 5IW1A 4NN5C 1CICD 2Z4QB 4TTDC 3P11L 4PJBF 4LCYB 2C3XA 5GRXG 1SVZA 4S1DC 3X11A 2W0LA 1JIBA 2JB6A 1C7SA 1LO4H 3VRJA 1F8TH 1A9EB 3VDAA 4MXQD 4PLKC 2OI9B 5F21B 4WHCA 1H8OA 3IDXH 4HMEA 5FGCB 2YA2A 5K93A 1LEIB 4M00A 4UT6L 4APQD 3EYVA 4BFIA 2A1WL 5TE6H 5IKCB 1YPZB 5HJ3A 5ESAB 3T0BA 3QUXC 5JMOC 2R2CA 2HVJA 4PJAA 12E8L 5DJYA 4OD1L 2JJWA 3QXWA 5TE4L 3VFNB 3QHZH 5ACZB 5EA0H 3R8BB 2R0LH 5C0ND 3VJ6A 2UYLB 5SWZD 4X7DC 1SEBA 4X4YB 1J11A 3SDCC 3I75A 2B39A 3LEXB 3RA7L 3PUCA 3BGFB 4A6YL 1NCBL 5ESVA 3QRGL 4ZUUA 5TDOB 1BEYH 2D0GA 4Y16D 1CLOH 2P8LB 3S4SA 1FSKB 4QWWD 2IQ9H 4C4KO 2OK0L 1EVUA 5D4QA 1I9IH 3QQ3A 3GSWA 5AWNL 2GSGB 2LU3A 1CFSB 1MCKA 3V0VB 2FEDD 3ZKXB 3PABA 4JDTH 3L3HA 3MRNA 2J3SA 4LK4A 3QJFA 4JFEA 4RA0C 3CVHH 2KKQA 3OKEA 3A6CL 4TPRL 5D7LD 4IBLT 4PY7A 1XF5B 1UB5B 3PL6B 3VWJD 2EO1A 3TVMB 3DX8A 2V17L 5HHME 2D9CA 4X9GA 4PGZA 5MERB 5EBMA 3ECBB 4JFPA 1ZK9A 5HGHA 4P4RB 1WIPA 4PJ8D 3O9WB 1RZIA 4UQ3B 2DLTA 4YXLL 4QNPE 1KJ2B 3SOBH 1WFUA 1QQDA 1U8QA 2WZPD 2EXWC 1P4IH 4GRWH 5E2VH 5ISZA 1NCDL 3KPRA 4DZ8B 3RWJA 2IC2A 2EZ0D 1TZGH 3L1OL 5I1KL 5F44A 3MOAL 4JM2D 2JB5L 3NA4A 4FFYL 4NRYB 1RURH 4EQ2A 1RK1A 1IGFL 3PHOB 2GK2A 1RHHA 5IBLC 2Y5TB 3DPBA 4X0KA 2NY0B 2MMXA 4U1IA 4QOKB 2PYEB 1MQKH 4LCWE 3PE9A 4WFGE 4RAVB 4H25A 1VKXB 1W8NA 3EJYD 1S9XA 4JRWA 1A6ZB 5KVFH 3IFPB 2YA0A 3AM8C 5IF0A 3TN0B 1ZLSH 4X9BA 1HN1A 1E27B 1MLBB 3B3IB 3F7PC 5C0GA 3G08B 2J12B 4P2OD 4XWGL 1ZLUK 4XPHL 2VLJB 1C5CL 1ETZB 2FGWH 1SMAA 4QRQB 4UT9L 3ARGD 1H3XA 3LQMA 5HHOE 2NW2A 3SDAC 4BSWB 3T4AB 1NCUA 3G5VB 2OX5A 3QEQB 4JB9L 5E4EB 1MCOH 4OZ4B 4XXCC 3VFSA 5FHAH 3G9VA 3C60A 3O3EB 1JPSH 4PJBE 2EDNA 4MZ2A 1OGAA 2YPLA 5HD8D 1WCBA 1WCQA 3QHFH 2G2RA 1IBGL 4H20H 3MGTB 1RZKL 1MHEB 1F13A 1DE4B 2F19H 3G6JF 1NDGB 3U9UA 4NO0B 4YWGL 2HJFA 3DI2B 2F9BT 3NPSC 4Z9KB 5DQDH 3CMOL 3V6BR 3QH3B 5DHVA 5K9QI 4N90E 4M9OA 3AMKA 2PTTA 4PJEB 3C6LB 4Y1AB 3DUUB 2D03L 4JHAL 1RJYA 2FIKB 5JPNA 4R2GB 1CT8A 4QHLB 3BP7B 4NKMB 2OL3L 1GSMA 5C09A 3BI9X 3GKZA 3MROB 4RGMB 2NY1B 1OWRM 3BUYA 4N8CL 2L0DA 4JPIB 3V7AG 3V8OA 3MCKB 1G1YA 3DRQA 3BPOC 3DX9A 4RGNC 5MENE 3P40A 3D0VA 1VACA 3OGCB 2B4CL 4JQXA 1QACA 3AVEA 1KIRB 1NC2B 4KHXL 4JGJA 3QEHB 5DQJB 3HC4H 3EYOB 2YZ1A 3O2DA 2P5EA 4PRPA 1U8JA 4U6XA 1I75A 3MOBH 3RI5F 2ZWLT 3QUMH 4KUCF 4KKAC 5T1MB 5EZJA 3RUGA 1QFWI 1BQHB 1I1AC 3DIFA 1RUML 5FYJE 3DROB 1AR2A 1U91B 2JELL 3T77B 3HHRB 4F58H 2FL5A 1NGQL 1GOGA 1QZ1A 3OAYH 4M7LH 1LK3L 3DSFL 2D9QB 4R8WH 1FLTX 5FDWB 1KFAL 4M7JL 2HTKD 4PRBB 1AQDA 3QUZC 5DQ9B 1D9KC 4OCXL 2XY1A 1GGCL 5ICZA 3IU4L 3ARRA 1X9QA 3MRHA 2NLJB 1GPOH 1ZT7B 3RWHA 4EI5A 4FQQB 2JJSC 4XHQA 5FCUL 4Z7VB 5GRVK 1B0RA 3HNTH 4Z5RA 4W6XB 1X5IA 1MCHA 3HI1A 1MY5A 1QLFB 4IHOA 2XN9A 4BQ6A 3SCMC 2CMRH 1MJJB 4G6JH 2GFBA 4WWID 5DMKB 1UXWB 5DDHA 4MAYB 2W0FB 4XXDB 2NY0D 2VAAB 2CLRB 5DO2D 1S7UB 1R3JB 4KRPB 2C9AA 2BK8A 4LRNH 4M1GH 3TC9A 3WNMA 1D7FA 1WTGT 1KEML 1MIEL 2EDDA 5DJAA 1OAZH 1KB9K 1RZJC 3O2VH 3PQYD 4NQDD 4WUKH 4PGDA 2ZKHH 4TNWF 2YD8A 3IDIA 3MRIB 4LSQL 1ND0A 5ELIA 3QIBA 5J11B 1WWBX 3OXSB 4ZOEA 4Y5VA 3VFOB 3DVFA 4HFUH 3TBVA 3K1KC 2VLJD 3OAZH 2RFXB 4HT1L 3PWPA 3P30H 2X41A 1W0VA 4LLYA 2NQCA 1IFHL 1MFAL 2X9XA 3NGBB 2XV6B 5KSAB 5FYKU 4JFYA 3MLWH 1N6VA 5AZEH 2BDNL 2VDMH 4P4KD 3CK0H 3MUY1 5LGHL 2OZ4L 3H3KA 1AHWB 1F90H 5KJRL 1OQXA 1U8HA 4ONGH 4AENA 5J8OA 4GRLD 3G04B 1HH6B 4K07A 4CKVX 1AGDA 3O6FA 5FOJA 3HS0B 2FO4B 1EO8L 4I3SL 4KDVA 2DKMA 2V7HB 1WK0A 4IRJB 3SGJC 1F45A 4W4OC 1QSFB 3G6JE 3FRUA 3OSKA 5FCSH 5GISL 4X7TB 4XCNB 4YDVB 2LU4A 4XMKL 3ULSA 4HWBL 2BSRA 4LU5L 4NZJA 3KXFE 3OTTA 4K8RD 4EUPG 4PJ9C 5HHPB 1T0NA 3EBAA 1PG7W 5JXAL 5CEXB 2VQUA 4JG1H 4FQ2L 5CEZH 3LB6D 1BF8A 3VG9B 4OQTH 4GW4B 1BHGA 1BLNA 2ICEB 4YHML 4XCCL 4JAMA 5DURD 3LQAL 1VFAA 4OGAC 3WFDH 2WAHA 4J4PC 3PV7A 4ZNEE 5KOVC 1CFNA 1MEXH 5CWSB 3FB6B 4BZ1L 2DQGL 2CRMA 4PD4J 4L3AA 2EE6A 2NZ9D 4EBQH 1FGVL 4TNVK 4NM8L 5EG6C 1KN4H 1OAXH 3UTZA 1JWSB 4CN1A 3HZKB 5F9AC 3SDXA 5I1GH 3KYMB 2DQJH 2XG4A 1NANI 4IRSD 2BVEA 4L3EB 3F7YB 2QR0B 1WICA 2GHWB 4W68A 3THML 3CFEB 3BE1H 4LVHB 4P2QA 1PKOA 3MRJB 1JHTA 4LLWB 3PWLA 1L0XA 3Q2CA 3SE3C 2ICCA 1EEYB 1TENA 4BZYA 1BZ7B 5FF6B 4O9HH 1BFSA 4HXAL 1EO5A 4V2CB 3EO9H 3ARDD 1JHLH 4DUWA 5HHQB 4WW1B 1S7WA 2QJDA 3ULUF 1NFKA 3ARVA 4L1DA 4QHKJ 4LLAA 1ZT1A 1NUDA 3WUWB 3UJJH 1I3GH 1V3LA 4JRYB 4RWYL 3U0PB 3CFJB 3HNSL 2R0WH 2ZCKH 4NQCB 4E0RA 1TQBC 4X6EA 5IB2B 3UBXA 3MLVH 2GTWA 1F3DH 2DS4A 1YMHA 4YE4L 2PYFB 5HVHB 4PJ5D 4XPTL 5HI4D 3MLSL 4JN1H 4PRNA 4Q9RL 4YHZH 1EFXB 2NYYD 2HKHH 4ZD3H 1GGIL 4HKXA 4XPBL 1TZIA 3P4NA 5D6CB 3U1SH 1GAFH 1G9NC 4KJWC 4M1DH 5DUPL 1CCZA 4K3JH 5IT2L 5J06A 2HFEB 2P8PB 4BH7B 1HKLH 4Y5YB 2FJFA 4KQ4L 5IMMB 4PREA 2IF7A 3O6LL 4U1SA 4YZFF 3D39B 5FM4A 3ZE1E 2Z0BA 2V2WA 3GZKA 2Y25A 1EEZB 4NNYA 1KCVH 2DM7A 5D7JD 2DTML 3NN8B 3L5IA 1ADQH 4LLQA 5ACMA 1JJUA 1BQSA 3LPGA 1SEQH 4WI2A 1DEDA 3P9WB 4GXVH 4LHUB 4YH6A 4UT7H 3O4LD 1F3RB 1HH9A 3ZMRA 4QXUH 2W65B 3GK8L 2V5RA 3QIUD 3QCTH 5ITFA 5HGAA 1NUNB 5EBWA 3NZ8B 1TVBA 4G9FA 4OZHB 1IM9D 4JFZH 4GAGL 5AZ2H 3P4OB 4U6VH 5DD1H 1HNGA 2XZQH 4RWHA 1YUHB 3SN6N 4P3DA 4ONHB 4WWKC 1CE1H 3GO1L 1HHJA 3MRPA 4NQSB 4UV7H 4D8PB 1DBJL 1BD2A 1TETH 3ULVF 4JN2B 2BRRL 2VLME 3FFCE 1CLZL 3MRFA 4Y5XC 2EXYD 5LCVH 4L9LC 4NN5B 3BP6A 1U92B 2LABA 1BGXH 1J1PH 1YN7A 2PTUA 1S9YB 2X4PA 3HAEH 4J6RL 3VFPB 1V7MH 5E7FA 2IALB 3I84A 4OLUL 5A3ID 1F5WA 5TF1H 3WHXA 4Y19A 3T0EE 2P48B 3BGAA 1CGUA 1DBBH 4NC0B 2GT9B 2J8UB 2VNCA 5ISZE 4EN3B 3VFRB 4I3RL 1SJHA 4KK9D 1R3HB 3TO4D 5F7LB 3GMNB 2FX7H 5HDQH 1MQ8A 3BMVA 1AY1H 4OM1H 1RZ8B 5FKAB 1AC0A 4UNTA 1J8HA 3C2AH 4Y8AA 4X5WB 4X5LA 5IEKB 3DXAA 4LL9A 3SO3C 3QUXB 4OSUL 5DHXB 2R1YA 3CSPA 3ROLA 4NZTL 4AM0A 3IXTA 4Q2ZA 5CGYC 1AGBB 4HZLA 5TH2B 3Q3GA 3EZJB 2WP3T 3VRIA 2GQHA 3OAZK 3GSXA 1IGTB 1AXTL 4WO4A 1YDPA 1MHHB 3SDCB 3QO0B 5DZNA 5T33L 3ULUE 3PGFL 4OFYD 1NJ9A 5D1XB 4IM8A 4HK3N 3V0WH 2IAMC 2EDRA 5ADPL 5GJTH 3N1PC 1LO5A 5DS8B 25C8L 3HG1D 5IUSA 1E4JA 5DHYB 3UTSB 1M1SA 3RZCD 1TITA 5I15L 1EXUA 2AV1B 2YPLE 5C9KA 5IM7A 1F4XL 4JR9L 3LZFL 1U8LA 4NHUA 1KCRH 3U46A 3MUZ1 4DVBA 1XF2B 2HN7B 3EYFB 1N5AB 3W39B 5HI3D 1YNLL 2DQDH 1S7RB 4NQED 4XBEL 4LGRB 2I60H 4KH2A 4ZXBA 1A3QA 5JHLH 3WFBL 2CGRH 3WL9A 2V9QA 1M71B 3IFOA 3ZKND 4YZFE 3IU3A 2UZYB 2CDFB 4PTTB 2AXGB 3W5MA 3L7EB 5C09E 4F9PC 2B1HH 3MBED 4HJ0C 5IFAL 4GQ9H 2NY7L 5FOBA 3GI8L 4NKIL 5GJSH 5HHVH 1DN0B 3ALWA 2AJVH 4PJHA 3UTPD 1OLLA 3EFDH 5FYJU 4Z7NF 3UYRL 4PG9B 3BP4A 4FXLA 4KDTC 1KXVC 2BRQA 3WFEL 3U79A 2P5EE 2DM2A 2VXQH 4PRPE 3MQIA 1JPGB 1QBMH 2B2XH 4K7FB 1IZJA 4MDJA 2VLRB 2CJUH 3VFUB 4WV1A 4WI8A 1R0AH 5ID0B 1UYWL 2PCPA 4LGPB 4FQXB 4JPVH 4ZAKA 1E0OB 2GCYB 2V5SA 4YNYB 2ZG2A 3ULVE 3MV8A 2K3TA 3ILPB 4HSQA 2BXZA 3D2UB 1JNNL 3SDAB 1W72B 3TA3D 4RRPG 5T1DH 3QNXA 2ZOLA 3GIVB 1G7HA 3JBG7 1Q72H 5TJWK 3B9KA 4MVBD 1HHGA 5E8NA 2PF6A 5HYSG 4CBPA 2NTFB 2XN9E 4CW1B 2H6PB 5EOCL 4GBXC 1UA6L 3WDIA 4NDMB 4GXUM 2QADD 3TBWB 3STLA 2JCCB 4CDHA 1PYWB 2CLVA 5D8JH 5DD0L 3HMWL 4L4VD 4OGYH 4MCZA 4MNGB 3UJIL 1S5IL 3TO2A 3NPSB 4L3CA 4AEIL 5LG1A 4Y0GA 2F53A 3BIKB 3MODL 3PDDA 5DD3H 1VPOL 3LKPA 2A6JB 4MJ6A 2MHAA 1VEMA 3BDBA 3ARWA 4OZFG 4OAWB 3V7MA 3HLAB 1XCTB 4OKDA 1KENH 3GSVA 1JNJA 4RQQA 5AAMA 2DM3A 5EU6B 3PWPE 5C07D 3HFMH 5DJCA 4OF7A 4K3DH 2W9EL 4RGNB 1A3LL 3QUKA 3GJFK 3GBML 3R0NA 2R29H 4ZG1A 4LEXL 5LWYH 4HWZA 3ALPA 5FYLD 4O58H 2ZUVA 2APVA 2EH7L 2O61B 5DYOA 2AK1L 3RIAK 4XCFH 2V7NB 4EUPA 5TFSH 5L2JB 4QT5A 3TNMA 2XOTA 2ICWA 4ODUA 4P57A 5HDLA 4JRXA 4JHWH 1IAMA 3S88H 4X8JB 2M1KA 1I1AB 2CRYA 1QNZH 4H1LH 3VE0B 3FQNA 1F4AA 5E2WL 4UIKL 1FVCB 4U1NA 4FRWA 2GI7A 3RDTC 4ZSOA 2PO6B 2VISA 3QDMB 3R1GL 3QUZB 1OL0A 5JIPA 5IR1A 4QHUB 5AYUL 4P5TC 5KVEH 3O45B 1LE5B 4YUEH 3PWVA 3K74B 3CVHB 4OBRA 1ONQB 4KTEH 1ACYL 5TQ0L 1JNHA 1YEGL 4OV6F 2R0ZH 3SCMB 3LV3B 2PN5A 1DUYB 2DLEA 1CLYH 5IBLD 2AJYH 1JN6A 4P9ML 1U93B 2QQNH 4UZGA 3SE8H 5D1QB 4ZPTA 1N8ZA 4PJDB 2DLIA 1CE6B 3WO3B 1KACB 3IJSA 2HLAA 4AQOA 3DV6B 5EWIL 3HZMB 3MCG1 2MSPA 3AAZB 1QFPA 4GRWB 3S34L 3X12B 3HA0A 1YMME 3D25A 1T7ZA 3BVNA 5DRWA 3NCJH 5BXFB 1YYLH 4NUJB 1LEKB 3FOMA 4YHPB 5BRZD 4C57C 3QB7C 1QVOB 4J7RA 1YJDL 3KAAA 4ENEC 1RZ7L 5IW3A 4P2QE 4OZIA 1KC5H 1A7RL 1ZE3C 4OD3H 3LVEA 3HPLB 1XF4B 4L29A 4J3XA 1QA9A 3QWRA 4FQCL 1ZT4B 1U8OB 2C7UA 3MZGB 1PG7X 3QXDA 3C08L 4ISVB 4FP8H 3I50H 3SKNA 4JLRA 1KGCE 3WE6B 1YY9C 3QIWA 4MJIB 1FNGA 3FN0L 1MY7A 1UZ8B 5E99L 4S2SA 1XGYH 5T3ZD 4NNXA 3FQUA 3MRRB 5FGBC 1NLDH 2GJ6B 4HC1H 1KG0B 1G6RA 4N0FA 1N2RB 5FYKD 1K8IB 5ANMA 5HDBF 1CZ8L 5E95B 3W9DB 3RIFF 4NOBA 1MOEA 4XNQB 1X5JA 1EIBA 2VN7A 1C08A 3O6ML 2YUVA 1AGFA 4PJ9B 3T4YB 4Z8FL 2H1PL 4MSWB 3V5DB 4QRPA 43CAA 3LIZL 3U9PH 3IJHA 4KK6C 1KTLA 3QFJB 4DOHB 1VENA 5T5FL 4LCCA 1R3IH 3QUYB 1NGXB 2ED8A 4GRMB 4PJCB 4DN3L 4TVPD 4ZFZA 4LNRA 1QFOA 5DRXB 5H35A 4L8CB 1EERB 4MAUL 3MLRL 2ZJSH 1HQRB 3QCUH 3KLHD 4PUBH 1JGDB 1U8KA 3ZO0A 3OAUH 1OAUH 3LQZA 2XXMB 2G75B 5EU4A 4PJHF 3P73A 4P59L 4ODTH 1FORH 1MJUL 2MWCA 2R39A 3AB0C 4X99B 4Q6IA 1ZMYA 3RZWA 2C1OA 4IOFC 1KCUL 3E2HC 1G7PB 2LAAA 3MCLL 1NPUA 1IAOA 5GGTL 1Q9WB 4LBEA 4XHJC 1D9KD 5AUMA 1AKJA 4QF1B 4WI7A 4XMPH 5I1DB 3QUMB 4WFFE 5F93C 4LP5A 3SDDC 5DSCB 2MTPA 5GGQL 5GS0D 4MNHA 4G9FE 1F97A 2O5XH 1I7TA 2HTLC 3D85D 1TCRB 1JVKA 2WBJC 3K4ZA 1T66C 5F1OB 3PIQB 1A9BA 3OKMB 3QDJB 2YKLH 2DQFA 4GAYA 3EKCA 5GGSA 3MREA 1FZOB 5GGVL 1ZS8A 43C9B 5HYJE 1HHIB 4K94H 2UVFA 1KT2B 3LRGA 4LSPL 2OTWB 4RGOH 1TTGA 1J87A 5GRJL 1OP9A 1UGNA 4OLWH 2X4NA 3TFKD 4E9LA 1FG2A 4NQTA 1CL7H 1TQBB 1U58B 2EYSB 3F5WA 3CUPB 3Q1SL 1QR1A 2QEJA 4NO2A 4J3WA 4Y19E 2Q8AL 5I1AA 5I8EA 2MCPH 2X4QA 2VWEE 2G9HA 5EORL 2NXZC 2PKDA 4OJFH 4D94A 4Y4KC 4WDIB 1UVQB 4YEEA 5IGXH 2R4SL 3CFKB 5F1IB 2ADIB 1U8PB 1Q1JL 1MCDA 2EC9U 2ESVB 4NPYA 2VABA 2H32H 4LF3B 4F80A 4CJ1A 2R0KL 1B4JH 5I30H 5ETUA 1A6TB 2P7TA 5CCKH 1VGKA 2FB4L 3HPJA 3PP3H 1HOCB 1G9EA 1IGCL 3SGKC 1P7QD 3RGVB 4RMQA 1I9EA 2EKSA 4R4BB 3ZKMC 3G6DL 2HFGH 2H2SC 1OM3L 1I8MA 1RUPL 3VCLA 3R0MA 1U6AH 3RVWC 3VI4F 4ZMAT 3P0VL 3RY6A 1IGJA 1VEOA 5IJKA 5L9DL 4QRRA 2D7QA 2NX5B 3N9GH 3WO4B 3FN3A 4OM0L 4XC3H 5HDBE 1MHPL 5HY9B 4GW1B 4F2MB 2WIIB 4ZDHB 1JFQH 2PW2B 1YEKH 2RBLA 3OHXA 2A73A 1MVUB 4E41A 4YDKH 5GSRA 1DCLA 5HYQA 1A6VH 1EAPB 3BDYL 3UO1H 1AGCA 3FO1B 1ZGLP 1BZ9A 3KPPB 3TZVA 2VIRB 4F7MB 4HKZB 3V6OC 1T83C 4B0MM 3AY4C 4DTGH 3C6SB 1UFUA 4M8QB 1TPXC 4PS4H 4WWKB 4U6HA 1CGXA 5FUCE 3NIFF 4FZ8H 5TDPB 4B7IA 1KLGA 4YXKL 2NZIA 1BM3H 4QTIL 1MPAL 2DD8L 3U4EB 4ETQB 3RP1A 4Y5XB 1QO3A 1OW0A 4L9LB 3VWKA 1XGQA 5HHMD 5CJOH 2FNBA 2Z31C 4WW2F 1SYSB 4DW2H 3CC5B 2P5WB 3OX8B 5DJZA 3RNQB 4QCIB 3OR7B 3SQBA 3MFFA 3UTQB 1E28B 1OSZA 4P2CG 3ES6B 4MQ7A 1H15A 4NM4L 4N0UE 4NNPH 5DI8B 1MCEA 4OIAA 5DMIH 2A38A 2Q8BL 2X4SA 2VH5H 2X9WA 3MLTB 5I73B 4PJHE 4JCLA 5IQ9A 4UU9B 4H26B 4OCRL 2VITB 4NYLB 5I2IA 1EEUA 3KPTA 4OGZA 4CU7A 5JLZB 3EUUA 3ET9F 2NY5H 4D3CH 2HJLB 3RNKA 1I7UA 3U0WH 4FQJH 3ZTJH 4HBQA 3PWJA 3DVGB 1K4DB 1EGJA 3LS4H 4X6CA 2P46B 2Y06H 5E4IA 4WTZG 4YBHA 5ALBL 3IFLH 3ALXA 5D7KE 2ARJA 3V52L 2D0HA 3DRTA 3E8UH 2X1PA 5HYSA 4JFQA 4I77H 1H0DA 4K3GA 3MACL 1OTUD 5I17A 4C58B 5IQ7H 3JXAA 4FTVA 4OZIF 4JKKA 1G7JB 1MCPH 2DQUL 4NUGH 3TGXA 4F7CA 1I3RB 3IDUA 4JM4L 3FRPG 3DBXA 3MV8E 2XYCA 5BZWA 4KWUA 3C9NA 1RIVH 3ARBB 1D5BA 4XVJH 2IAMB 4JZJA 5HHOD 3BWAA 1BJ8A 1J18A 1MCWW 2HFFB 3UAJC 1QSEB 4QHKI 1MSPA 2J88L 1FP5A 4PJGA 3GJEA 4K94C 4XPFH 4L4TE 3EHBD 1T0MB 5IK3A 4FFWC 4OZFA 1JRHI 32C2A 1J9CT 3MNZA 4HS6B 1FL6A 4UB0H 4KHTH 1GOFA 1UWEH 3TYGH 3GMLA 3NPZB 4FQPA 5GXBB 5I1HH 3BX7C 1DVFC 2UWEA 3MRLA 2ADGB 1UXSA 3KPSA 2F53E 4PR5A 4N90D 3LN4A 2UZIL 2G5BA 3W0WB 4PJFF 3MV11 1E4XH 1KIUA 4KGLA 5DJXA 3RWDB 1HSAA 4HLJA 2YMXL 4CU6A 2CSPA 4YQXL 4WI3A 5JOEA 1KPVA 5F96H 5KSBB 1U3HC 3TCLB 4XH2A 3DMMC 3H9SA 1VB9A 3VI4E 1AD9B 4OD2B 5ENWA 4ZQKB 1HDMA 4WEBL 3S36X 2E8ZA 4YHYC 1XGTB 5I8KH 1BQHG 1WBZB 4ZFFA 3STZB 1LGVA 2FYYA 4GG6B 1VA9A 2BFVL 3FAXA 4V2BA 1H3PL 1M7DB 2A9NL 2AV7A 2YRZA 2X1QA 3HI6L 5C0BA 1E6OL 1D5MB 2PTVA 2EDBA 1I4FB 4JRXE 4TQEL 4UV4L 2BJML 4HBCL 1CICA 2FD6H 4OF6A 5L88L 4YBQC 5DD6B 4RIRA 2PW1B 3NIFE 4IMLB 4X9HA 8FABA 1YA5A 2EDKA 1UJTA 4HKJA 4EXPX 1MVFA 3MBXH 3NFSL 2P5WD 2VN4A 3JUZA 3MA7B 2I25N 2AP2A 2XZAL 2X09A 4NHCL 5CSBA 3IDYC 3KS0J 5F7FA 3G5YB 1Y18B 2XRAH 4APQA 3RHWK 1G6RL 1H5BA 4MA1C 3U4BL 4X6BA 1IRAY 4OCYL 5CP3H 3VXRB 4MXWH 5CMAB 4XVUC 1B0GA 3I3DA 3HAEB 2NW3A 2A1WH 3U83A 5I1LB 2F8VA 5BQ7A 3BPCB 3V5KA 2NY4C 3T2QA 1AFVH 4TSAL 5DRZA 2RCSH 4HG4J 2EECA 4RFOL 3BZEA 1KTRL 4Z0XB 1YEJL 3WIHL 5I76B 4X80H 4ZYKB 4M6NL 4OD1H 5SWZA 1FNSH 1OTSD 4K3EH 4YDJA 5I0ZA 1F11B 5F1KC 1OCWH 2BC4A 4Y16A 1ZGLM 2NY5C 3AREC 3BZDA 1NQBA 2AJSL 4A6YH 2JKXA 3X17A 2XPGB 1SQ2N 1T04A 1LD9B 2BNQB 3N1GC 1JF1A 4UOW0 4NT6A 1C5DA 3OJ2C 4ZS7H 5FKPB 1J1XL 2CLZA 1FZJA 1NAMA 1J0HA 4QRTA 1FYTD 1RJLA 2E6QA 3AU1B 2AQ1A 5EIIA 1C8PA 4DGIH 3RVVD 5AAWA 4ORGB 1SJXA 5EOCJ 5J6GB 3F58H 3ZLQC 4NGHH 4XVTL 4M48H 5D7LA 1A64A 3IDJB 3VWJA 1B6UA 1JYVA 1ZHLA 3A6CH 4TPRH 2ZNWA 3KLAB 1F3JA 1KLUA 1N0LA 4P2RB 5FHBL 5GRYA 4NC2B 5ANME 1A7NL 3BRFA 3KPQB 1J0YA 3QQ9C 3FFDA 4PJ8A 3VGAC 2E27L 5JW5A 5CJ8A 2GJZB 2SEBA 2YD2A 4UTAH 3VI3E 2ADFH 4P5TB 3RKPA 1AH1A 1REIA 1MUJB 4JM2A 4PJFE 2B20A 5C0EA 4ZUSB 4HJ0D 5CKGA 1D6EA 4LCUB 4FFVC 3MRKA 3L1OH 5I1IL 3MOAH 5IIEB 4DKEH 4FFYH 3IXAB 4AL8L 4WTWA 2HT3C 1IZKA 2DWEB 1IGFH 4RSVA 5DC9B 4U49A 3RX5A 1LO0H 1NBZA 4PJXF 1XGPB 2BY0A 2JE8A 4ZFOA 5JNYB 1FCCA 4F3FB 2W38A 4XRCA 3GMPA 4LPTA 4JZNB 4PRHD 3NFNB 4P2OA 4U2YA 3NA9H 1ORQB 3O0RL 3S35X 2MPAL 3ARGA 1R3LA 3PV6B 1EA9C 1MAMH 3JV4A 4Y2DC 2Z4QA 3BRDA 4KUCD 4BSJA 3FHAA 4NZRL 4YLQT 2DLHA 1S7SA 1NEZB 3BGMB 1FIGL 1GYAA 5IV2B 1UB6A 3DHJA 1J86A 4OZGA 3LKRB 3O41B 4X6CF 4LEOA 3FO0L 4MX7B 1A6PA 2VLKE 1LEIA 5FYJH 5GRVL 3WUWG 4X6FB 1FZMA 1EHAA 2ZSVA 1RZKH 3L3GA 4G42B 3S6CA 1IEAA 4P23D 5IKCA 1N3NB 1YPZA 2VXTL 4Y4FD 2ITCB 4L5FH 2I9TB 4GBXD 4EZMA 1HHKA 3LY6A 1PKQB 4EI6A 4YWGH 1FL3B 3D69B 3BAEL 2EIZA 1RULH 1CQKA 5F88B 3CMOH 2R8SH 4Y2OA 1S3KL 5K9JL 4JFFB 2D03H 2X89D 3MPCA 5ADOH 4JZOB 3QXTA 5C8JB 3I02B 1MRDH 4PJGF 5EZIH 4HGWB 4KKCC 2ENYA 5KS9A 4JFHD 3EOBA 1D5XA 1F8TL 5FDYA 2X4RA 5IBUG 5BS0E 4FXGB 1NGYA 4PV8B 5BVJA 1LEGA 4KTDH 3SKMB 3VD7A 2E7CA 2AXFA 2MFNA 3QNYB 3ZKSD 1JZ4A 3PNWB 1DANU 3MJGX 1FHGA 2UWEF 5CILL 1RSFA 5FECB 1T21A 2HG5A 5C0DB 1FFNB 1CDCA 4I4WA 4WVRA 1RJZB 3QHZL 4OI8A 5EA0L 1GCFA 3O8XC 2R0LL 2A74B 2JIXB 4ODXA 4LLDA 4R7NA 4B53A 1MIMH 4M1CD 5MERA 3ECBA 4IDJH 3O11B 1NGQH 3BH9A 3CFIC 1BEYL 3WNPA 1CLOL 2KQMA 1YYMH 4FZEH 3DSFH 4OLYH 4HLZG 5HPMB 4EIZC 3AB0B 1EGJL 1TCMA 4QRRE 3WLWD 4OCXH 4QXWA 1KJVA 3RDTD 1ZXQA 1U95A 4TVSa 5C0AE 2J7LA 3L3KB 1GZPB 4QXTA 4I18C 3QDHA 3U48A 5JXEC 2APFA 1KPRA 3SDDB 5CEYA 3IKCA 5FCUH 1HK6A 3VFTB 2OQJA 3OJVC 1MLCA 1Z2KA 1OD9A 2Y5TA 4H1LB 3KPNA 2WBJB 1A0QH 2LAGB 3CVHL 1T4KA 4WI5A 2BOCA 4HIJA 4M93C 4KJYA 2VKXA 1OSPL 3H3BC 3WD5L 4P48A 3PQYA 4NQDA 3MNVA 1LP9F 5MEOB 1UZ6F 3E6FA 3IDNA 1Z0MA 2IQAA 1KEMH 3FFCD 1FFOB 3MMEA 1QFWM 4PJXE 2X05A 5JZ7C 1UM4L 4YK4C 2VLJA 4LSQH 3SHSA 3D3VB 4WTZA 2XA8L 1GOHA 1FBIH 1P4IL 4HUWB 5E6IC 2A6DB 5DVNA 1TZGL 1JBJA 3H9HA 2EDTA 5E1AA 3T0ED 4HS3B 1MFAH 4P4KA 4XT1C 3MV7B 3TBTB 1RURL 2NXZB 4Z77B 3OKDB 4Y4KB 4ZPVB 1XR9A 5I1JH 4W81A 3CH1B 4K9EH 3FRPA 2BDNH 4MD0B 2BVPA 5D9SB 4GRLA 3NTCL 2X44D 4X6CE 4OKVB 5KVFL 4R0LB 2EYTB 4S0TD 1ZLSL 4JGMA 3SJVB 1WVZA 2YD4A 1NCNA 3O3AA 4KMLB 2DIJA 1H8NA 1QRKA 1EO8H 3KYOA 5F9DC 4S11A 4PJEA 3QEUB 5F7EH 3UTTD 5ITBH 3V0AC 3VFMB 1A14H 3WFZA 1KIQA 4LIQE 3QI9B 1RZKC 5FUOL 4WI6A 3ZYOA 1MCOL 1DTUA 2F54B 5FHAL 3H42H 3GHBL 5HGGS 5IEHA 5BW7C 3GSNH 1JPSL 2FR4B 4ODSL 4YHKH 4PFEA 2ZCHH 1UWGH 5C0CB 4H20L 4FQ2H 4PJGE 1N6UA 2HJKA 5HBBA 3MRCB 2F19L 4MDIA 3OKNB 4LHJB 1MI5B 1OARL 1T1XA 1FVDA 4XCCH 1JGVH 4AG4L 3MRBA 2Y4SA 1W0WA 3QG6A 4KY1H 1TPXB 2Q86B 2IPKB 3WJJC 2LTQB 2UWEE 1ORSA 4HWUA 4KK8C 3BESR 4ERSL 3JSSA 5DC4B 4ELMA 1A5FH 3QPQD 3QWOB 4JM2F 4U6YA 2Y5EA 4GG8B 1FGVH 5BZDB 3BW9A 2Z31B 4NM8H 3DX7A 4IRSA 5IMKB 1T20B 2Z93A 4ZUVA 2P47B 4XX1G 5J4MA 3F7RA 3GMMA 4PJ7A 2DI9A 1ZT7A 3DV4A 4FFZH 2ZUUA 2C1PB 3PP4H 4JANA 4XHJD 1D6VH 5JA9A 1U8NB 3I6KA 3MRQB 3HC4L 3ARDA 4HXAH 3WSQH 1BOGB 3QUML 1JHKL 2YN3A 3AUVA 3OKLB 4M4PA 1T66D 1R3JA 4TSCL 1UJ3A 4M7LL 1KCKA 4R8WL 1T6VN 2FH6A 3P9MA 1Z5LB 3FQXB 1NAML 1ZVSB 2XA3A 1JGUL 1AO7D 1ODAA 4RWYH 5IVZA 2OMBA 3DSNA 3HNSH 4OZGF 4N0CC 2AKRA 3DX6B 4P46C 4GMSH 4PJ5A 1LP9E 3OF6D 1UZ6E 3ULVD 3RPIA 1ZGLB 5L7XH 3ARQA 3SKOA 2ITDB 3HNTL 3MLSH 1YPZF 1MCNA 3KJ6L 3PDGA 2ZSWB 4XPBH 4E5XB 4WGWB 4YJZL 3EOAA 1JPTH 2CMRL 5EUOA 4G6JL 4JGUA 2NXZD 3AXLA 5B38G 4PLOB 1AHWA 1RZFH 4GLRI 2R4RL 1DEEB 5IT2H 2HT4D 2BY3A 5D7JA 4YPGB 4LRNL 3L95B 3EGSB 7CGTA 4F33A 2GAZB 5L2KB 3O6LH 5DEGB 3U36A 1CYGA 1S7QA 1OAZL 3IETB 3O2VL 2AJ3A 3HS0A 1HI6A 1DVFB 2ZKHL 4PP1C 2DTMH 2R2EB 3IKKA 4YHLH 3F12A 2P45B 3NCCB 1BF2A 4JFOB 2DDQL 1KV3A 1T3FA 1XIWD 3O4LA 4HFUL 3VXUB 4PV9A 2EYRB 2AI0H 5C7XH 4F15C 5FB8A 5T1LB 1IM3A 3MV9B 3JV6B 4U1HA 4U33A 3RVWD 3QIUA 2H32B 4ZFOL 5F3BB 4HIXH 5DEFA 3ARSA 1U3HB 1AE6H 5DJ8A 3DMMB 5DK0B 3MLWL 5AZEL 2VDML 1IM9A 1S9WB 4ELKB 5I74C 2NR6D 4YHYB 2AQ2A 4ZO7A 4HUNB 2VL4A 1F90L 5JHDD 1I8IA 4PGCA 4QTHA 3VXSB 1DQLH 3MNWA 1FNEA 1TZHB 4ONGL 1RFDL 5LBSL 2NY3C 3O2WH 1YECL 2Y6SC 4V1DB 1Q9LB 3S96B 3ULUH 4ZTPH 4XTRC 1F4HA 2C3VA 3GO1H 4PLJC 1DBJH 5JQ6L 5CWSA 1E4KC 5EU3A 1FNAA 3EAKA 2BRRH 3STBA 1CLZH 1AC6A 5IB4B 5EC1B 4DKDC 4J6RH 3Q6FB 1FZKB 3UZEA 2H8PB 4OLUH 3BO8B 4YHIA 3QA3A 4FQHA 1UKQA 2QR0A 3F7VB 1QLEL