2NMSA

The crystal structure of the extracellular domain of the inhibitor receptor expressed on myeloid cells irem-1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
112
structure length
112
Chain Sequence
GIPQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CMRF35-like-molecule 1
publication title The Crystal Structure of the Extracellular Domain of the Inhibitor Receptor Expressed on Myeloid Cells IREM-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nmsA00
4LOUD 3LOWA 2XWTA 1SJHB 4TSAH 2DKUA 1G6RA 1A6AB 4KJPC 2VDOH 2QJDA 4LEXH 4UI2A 1XF2A 3PWLB 2CKNA 5EORH 2VWEC 5JMOC 4K8RH 1IGJB 4PG2C 3CJJA 1UH4A 2B1AH 4OZGB 3VE0B 1BQLH 2L0DA 4JFZL 2ARJB 4PRBA 1CLCA 5SX4H 1WJ3A 1UZ6F 4HGMA 5JR1L 2EIZB 1SMAA 1QBLH 1NMAL 2CLVA 5BZDB 3IF1A 1BJ1J 1ND0A 5FYLE 3O2WH 2PTTA 4CNIB 2E27L 3OGCA 4K9EL 1DQTA 3K46A 1ZOXA 3QQ3B 1YNKH 2X10A 2HKFH 1RZGA 1GGCH 1MHCA 1YQVH 3NZ8B 3U46B 3RQ3A 4H1LA 1CICD 3C5JA 1I85C 3LY6A 4HPYH 25C8L 4Y19E 3RUGA 5IFJA 1S78C 1EO7A 1V3JA 5HPMB 2R56H 4QXTA 4TNVK 5D70H 3OKMA 3ZT6A 4M43H 4LHUG 4PJHE 4OGYL 3ZKXB 2AJSH 4J3VA 3ZE2E 4LCCB 1BAFL 5AUMA 4ZO9A 4F9PC 1ES0B 3FQRB 4JPKH 4XNMB 3JV4A 2MHAA 4ZNEA 3CX2A 1HQRA 4KRMB 4M7ZC 1ITBB 2DQTL 4PUBH 5IROC 3IDUA 4ZAKD 5C0CE 4ALAH 3L1OH 1K85A 3CFEB 4NRYB 3DNKA 4LAQL 3OG6B 1HSAB 1NC2D 2VERN 4K3HA 2HT3C 3QUYA 4N9GA 3IGAA 4KJYB 1U3YA 3GJEB 2IH3B 3MRHA 4NN6C 5HHNA 3EOTL 2VDNH 3QWOA 1NBQA 4OD1L 2MOVA 1CICB 3EFFB 3GIZL 3QDGE 4ODBD 4PJXF 1CFSB 2BMKB 4LPWA 5T5NG 3RWHA 1QFWI 3DX9B 3RGHA 1KV3A 4J23A 3REVA 2E6PA 2OR8A 5ICXA 3HKFA 5IBUG 5JW4N 1OAQL 2JKXA 4U2ZA 1BZQK 3S36L 4F9LC 3GUTA 1S5IL 2VR4A 3D5OF 1GGYA 3M17B 1GC1C 5C9JA 2HN7B 4MA8H 2MQ0A 1GVIA 1Y6NR 5CSBA 4KVCH 3RVVC 1I7RA 1YEEH 4ZAKB 1GJIA 5KN5B 3QHZH 3HE7D 5CP7B 1QO3A 3C8DA 1FYHB 4O5LL 1NC2B 2QQQA 4PJIE 4NO0D 5HHME 4OZIB 3WO3B 5HBBA 3HNTL 5DD5H 1LD9B 2NXZC 1ZHLB 4WY7L 3HC4L 4OZGF 4YE4L 3N0PB 5KSBB 4CMHC 3CU1A 4GAJL 3VXNA 1WTGT 1RU9H 2GITB 1T04A 2CDGA 5JA8B 3QDJE 4UIKL 5DRWA 2R2CA 2EC9T 5L2KA 1MH5A 4O02H 4P9MH 5DVKA 1TCRB 1U8PA 4TUJA 5EUOE 2VC2H 2VKXA 3ARFC 4PFEA 1T4KB 4NBXB 4AIZA 3H6JA 1F6AA 4HBCL 3ARGD 4ZUTA 1WWBX 2DRUA 3UTTA 3O6KH 1V8HA 4M1DH 2ICWB 1TZHB 3SE8H 3HE7B 4ODSH 3NCJH 1IGFH 4I8DA 4M8VA 5BJTA 4NO0B 4RGOH 5IOPB 3PXHA 1NGZA 4HK3N 4XH2B 1CGSH 4FFVD 5DA0B 2E7MA 2DICA 3V0WH 4S0TD 5DUMH 1MCKA 3O3UN 4K71C 3QHFL 4XVTL 2EC8A 3RGVD 4WI4A 4OAWB 3TBWB 4F2MA 4LQ1A 2E9JA 5JOFA 2C3VA 1EMTH 1NCAH 2JE8A 4I5BA 1DDHB 1R5WA 2BCKB 2I9TA 1MJJB 1RIVL 2PYFA 3O8XD 1JYXA 5J89A 5HGHB 3O11B 2AJVL 4JRYD 1A9BA 3ARGB 1MFEH 3T2OA 5DVNA 2WP3O 4G9DA 5KOVC 4GJTB 1IM9D 4WI6A 2W0KA 4N90D 4OB5L 1CD0A 2W0FA 3M8OH 4LF3A 4YXHL 4HH8A 5BRZD 1I8KA 1OCWH 4F7CB 1SEBB 4EUPB 4OGXH 5JO5A 2VDRL 5HDBE 2R29L 4ODWA 4P46A 1FYTA 3RGVB 4YHLL 1BQUA 2VDMH 3SKNB 4P3CL 4PJ5A 5DGQA 3LRGA 3NIDE 2H8PA 3K0WA 1QFWH 5GGQL 5ACMA 2X4OA 5L0QC 1DVFC 3VFTB 2DM7A 1AKJD 4HWEH 5HDOA 2DQFA 3EYOB 5KSBF 4LGRB 2VQTA 4W4NA 3O8XB 2YD3A 5JHDA 4L5FL 2VDPH 2V2WA 3OKYA 4JRYB 4J1UB 1U9KA 5C0BD 3LB6C 2GK0B 4RAHA 1LDPL 4IDLA 4QEGA 5I19H 1YYLH 4OCWL 3H3PH 4TN9A 1BLNA 1KC5H 1YN7B 3RHWF 4XZUB 2Y25A 4IJ3C 4KMLB 4YAQA 1AXTH 3HG1E 1WBYA 5GIRA 2Q87A 3FQNA 2XKNA 5BRZB 1HHHB 2FZ3A 2W9EH 1O7SA 3FL7A 4BJLA 5INDB 3B5HA 1Q9OA 1YECH 4IHOB 4Z78A 1FO0A 5E6ID 2DQUH 5CBEB 3KPNB 1A6VL 3G5YB 3MJ9H 1XF3B 3ARBD 1BFVL 2UVFA 1R0AH 3HC3L 1IEAA 1KTKE 5FO9B 3U0PB 4F58L 1U3HD 5A40E 2ZCKL 3DX6B 5CEXB 3BEWA 1AKJB 1OF2B 3FFCD 3NCCB 4YBLB 2Q1EA 2IBZY 3ARWA 3SPVA 4F3FA 1I3UA 2R8SL 5I74C 1RK0B 4QRSA 4KMTL 4TRPH 4U6XB 5C0BB 5I15H 1E6JH 3EGSA 1FFRA 2Y5TB 4RAUA 2W9DL 1FH5L 3QFDA 4LVHB 1ZLSH 3FO0L 3ZE1F 5ACZA 4JN2A 5EH1A 4AIXA 3SE4A 1UXWA 3A67H 1J0HA 4Z7WF 1I1AC 3KYOB 5AWNH 4U49A 1PSKL 3IRZA 4JKMA 4FQPA 5ID0A 2OP4H 4R96A 3R06B 2SEBB 3GMNB 1Z9SA 2NXYD 4MQ7B 3CFBB 3MV9D 4S10A 5E6IB 2VLMD 3D0LB 4XMLH 4NJAL 3H7LA 2ATKA 4JJ5B 3ARBB 2OCFD 1DLFL 5E4IA 5D7LA 4MX7A 3CXHK 1PKOA 1U3HB 4GRLC 3G08B 4AEEA 3PNWB 5EOTA 3FFCB 4E42A 3C6LC 2FEDC 1PW3A 1GSMA 1P1ZB 5IW1A 2P5WA 1U42A 3MNWB 3W9EB 1BGXL 4B0MM 4UT6H 1EH9A 2AJYL 3B5TA 5EZOL 3EOAA 1T2QL 1HINL 4OV5A 4LCYB 3CCHB 3RWGB 2CUMA 1I3RB 5F6HI 4TVPL 3GI9L 3DV6A 3BXNA 1KIPB 1E6OH 4GQ9L 43C9A 2AV7B 1HYSD 4HIEB 1JFQH 3NFNB 5LVEA 2R4SH 3FO2A 3HZYA 2OLDA 2NXYB 4JFYB 3MV9B 1D5ZB 4H0GA 4UILH 4CW1B 3EO1A 1A6UH 1KEML 5EA0H 4N8PA 4KK9D 4WUKL 2A1WL 3TN0C 1TPXC 4MQSB 3T2QA 5C2UB 1M7IA 3KR3H 3MLWL 4LFHG 1UXSB 4QXUH 2EXWD 1UEYA 1ED3B 4KI5D 1RI8A 2VXQL 4UNVA 2RFXB 1I9RH 3MBXH 3GMRA 5DQDH 5BV7C 4GW1A 2E7BA 4YK4B 1WFUA 2FIKB 4OZHF 1LP9E 4DOHB 5HHVL 1U6AL 3KLAB 5JTWA 4M9PA 5C0RH 1KN2H 4P48A 4FXLA 5JHLL 2FEEI 3WD5L 3UXFA 3V6OE 3CX5J 3OXRB 1SVZA 5KSUA 2XN9E 1RZIB 1ZT1B 5E8PA 2HFFA 4UT9H 1A7RL 3TNMA 1RIUL 3JV6A 2LVCA 3MLXL 2VYRE 4HS6A 1U8KA 3FB8A 5GJSH 3ULUF 3BO8B 1AGFB 1HHJB 3ARTA 1T89C 5JW5B 4LCCC 5ETUB 2AABH 3UX9B 2MTPA 1U8HA 2I07B 1A1MA 3BHBA 1Y18A 4JQIL 1PLGL 4RA0C 2Y5EA 2NY7L 3OPZL 4KZDH 1R3KA 4GG8A 1NGXB 2R2HB 1PYWB 1AR2A 2AK1L 3BUYA 3W81A 4KKCC 3IDJB 5FA3A 3TCLA 3TH2T 2D7QA 1ONQB 4MQXC 1TJGH 1BMGA 3IXAB 3L3JA 5F93C 2IFFH 3L3OA 3M1BB 2F15A 5E99L 3X3GH 4QRQB 1CT8B 2WBJA 2XRAH 3HNVH 2R9HD 3GGWA 5IJVB 4AT6A 4YNYB 3FN3A 1D6EA 3MXWH 1H8NA 1UZ8A 4YX2H 5TQ2H 5D1QD 1GGTA 2P42B 4QLRA 5JQHC 4A6YB 5DO2C 2H26B 2WAHA 3RUGE 3TIEA 4NYLA 5IMLA 1UH3A 3QULA 5IFAH 2ZUXA 4BFBD 3BT2L 1WIUA 5D7JA 2APFA 1CFQB 3NFPA 4BQBA 3ISWA 5B4MD 3ILPB 4ZAKC 3BN9C 1WZLA 1LK3L 4WV1C 3QXTA 3I6GB 2A74A 4R26L 2EDFA 5DUBB 2WANA 2QHRL 4ZNEE 1D5IH 1JTTA 2XZZA 5I18H 5IMMB 2AAVA 2JJSC 2W0PA 1WGOA 3H2WA 3QIWD 3WKML 2YKLH 2Y9RT 5I1KL 3DGGB 3G5XB 1NQBA 4ZFOL 4P5TC 2JB6B 3V6FB 3U1SH 1D9KA 1X5GA 3VXOA 3EYQD 4AENB 5D1QB 1TQBC 5BW7C 4PRAB 3ZYIA 3O3BB 2VXTL 3TBTA 3FQWB 4CKVX 5C70A 3ALPA 3ZDXF 4MNGB 3ZKNC 2BJMH 1FDLL 1MCDA 4HGKC 1NAMH 3HRPA 3QI9D 3SDCC 1FVDA 1DE4B 5FK9A 4PJGF 4XC1H 1A2YA 1AHWC 1RZJH 5EU5A 3H3KA 1JPGB 4WEMB 1A8JH 1S7QB 1FGNL 1A3LL 1JWUA 3ULUH 3MRDA 4M61A 5EULV 5LQBH 2GI7A 3QCTH 4GUPB 5KW9L 1WCQA 1JYVA 5HHQB 1UJ3A 5I1GH 2UUDH 3IETB 3OJMB 3QIWB 5CLTA 3HE6D 3DETC 2Z31D 1Y0LA 4RFOH 1JGUH 1KXQE 2PKDA 2NY4D 3TV3H 3T3PE 1CS6A 5JORB 3QO0B 1YPZB 2XWJA 2X2YA 2HWZL 4X5XA 1KIQB 5D7IB 4PP2B 3CVHB 1RZFH 5B39G 3AXLB 4UAOC 5D1XA 3ARGC 5L2KE 2ZUQC 3WEXB 3QI9B 1JV5A 4N9OB 1MRFL 2VE6A 2MWCA 3SDDD 3VFWA 2W92A 3W9DB 3T0ED 4CMMA 4PGJA 1N0XH 5FOJA 3LKSB 2C4FT 3GHEH 3OAYH 1LO0L 4PV8A 2H9GB 3F7RA 3VRJA 1ZHBB 3VA6A 4WI2A 3UTTE 5DK2B 3CD4A 3AU1B 4NT6A 5IESH 3HE6B 3ZSTA 3P4NA 2Z31B 1ZLWK 1KG0B 3LN9A 3VMPA 3GMPB 3CZFB 1RZ7H 4PR5A 4PRPD 1IAIH 3LS4H 5ALBH 3TIDB 3VWKC 1JZ4A 5TFSL 5C0JA 3O3EB 2EDOA 1ADQA 2NY4B 4WW2F 5DJDA 4G3YL 4XBPA 1SY6L 3KS0J 2AJZA 4H0HB 2FX9H 4N8CL 2DKSA 4Z0XA 5IB5B 4JPIA 4J7RA 3O3DA 5T1KA 1KT2A 4L8CB 1S7UA 4M6ML 4EQ2A 1FNEA 4RFNB 2BVPB 3RA7H 2V9QA 5D2NC 3SDDB 4O51B 2IBZX 4Y4HA 2IQAB 3T0EB 5A3ID 2AXFA 3L3HA 5E94B 2X4QA 1DUZB 3VGEA 4IRSA 4KRPC 4X99B 5IF0B 3QH3B 1ZHKB 1D7FA 4NM8L 1AI1H 1YEHL 1YNLH 1MUJB 1FP5A 2NX5A 3GSQB 4BZ2L 2R0WH 1I7TA 4DK6A 3F8UB 3IDXL 4EDWH 4LHUD 1P9MC 4FTVD 5E00B 1HILA 1UGNA 2FO4B 3B9EA 1F6FB 4LARL 4JFOB 4RDQG 1YMMA 4WI3A 1LNUB 1FYTE 1U3JA 1RVFL 4NC1E 1RJYA 3OX8B 4PJ5E 3A6CH 5I1IH 3MJ8B 5I8CB 1UYWL 5FXCH 1BJ1H 1PKQB 2GAZB 3X17A 2P44B 6FABH 2LFGA 5D6CB 5DR5L 1J11A 1WCBA 2IAMA 4LVHC 4ZOEA 4FRWA 3JVGC 4IBLT 4OLXL 4X6CA 2NNAB 4MZ2A 1BX2B 2ZP0T 4UDUB 1B0RB 1CXLA 5JHDE 1R5VB 3GSUB 2V2XA 3QP3A 4NKQB 1VFMA 5D7IF 1OP9A 4UUJB 1XEDA 1XZ0B 1KELL 1BVLB 3K7UA 1OPGL 3C5ZA 3QXAB 4MD4B 4Z0BH 4GQPH 4LHUB 4EDXA 4Y5XB 2EXYD 3EO9H 4QF1B 3IFLH 3NABL 1RJCA 4J3XA 3TA3D 5GRYA 2H2SC 1F3DJ 1YEDB 3MLYH 1YJDC 2F5BH 3QFJA 4XP4L 3BKJH 2XPGB 3PWNA 3QIBD 2BXZA 3MR9A 2O5YL 1DZBA 1IAOA 3ALWA 4LLUA 1U8NA 1MCWW 5EOQL 1YYMH 3ZYZA 4OCRH 1FZMB 3KVQA 3CDFA 2MQ3A 3NACH 2ARJQ 4EN3C 4AMKH 3W39B 4KUCD 5JIPA 1P6FA 4JAMB 4KVNH 5EIQA 3UYOD 2YA0A 2XKSA 1G84A 1H5BB 1JNNH 3QEUB 1ZLVK 4Z77A 4R97B 5A2IH 4G6FD 1Z3GL 1IKNA 4QCIB 3D25A 5H37G 5IBUB 4U1KA 5FYKU 3IKCA 1MI5A 3M07A 3IFNH 3LIZL 5IVOA 3PL6D 2RGSA 4BELD 3TA3B 4IOFD 5GGVL 3VGHA 2X05A 2GCYB 3QIBB 4U1LB 1MQKH 4F33B 3PGDA 1U8JA 2FSEB 3U4EB 5SV4A 1JPFB 5A2KH 2VO5A 5D7LE 5DSCA 2Y4SA 4UMGA 4S2SB 2QQLL 1G7QA 1T1WA 2AK4A 1UB6A 2P5WE 5CHNB 1PX4A 4U3XA 5GHWH 1HDMA 1OAZL 2VQ1A 4Y4FA 4I9WD 5AZ2L 4J3UA 5GXBB 4PRHD 3DUUB 4DQOH 2BDNH 5J12C 4UQ3A 4XCEA 3BP4A 1K9TA 5C0EB 1KCVL 2F9BT 2HLFC 4LQFH 1VGEH 8FABB 4WO4D 3WSQH 4G6FB 5SWZA 2ZKHH 4O2CA 4K8RD 3T3MF 1CVRA 3QB7C 3IFPB 4M3JA 1BBDH 1MQ8A 4X4YA 3F12A 4KK9C 1LEGB 1A6PA 1TZGL 3PL6B 3BZFA 2UZXB 1R24A 4F37F 5E2WL 5J8OA 4ZQKA 2VLJA 4EOWL 3BPOB 4X6DA 4ONHB 4AK1A 5GS0H 2CR3A 4L8DB 1MHHA 5JIIA 2DIBA 5I16B 4LDEB 2FD6L 1SJEA 4NUJB 4YPJA 3SKUD 4L4TD 4M7KH 2R0KH 4FOMA 4POYA 3L7EA 2FGZA 1DBML 5IB3A 4HZLB 3MGAA 4QRRD 1DCLA 3ZDYE 4PRHB 1G9EA 3BH8B 1MCPL 3IDIA 1L6ZA 3WFDL 2CKBA 2VL5B 3FRUA 1QOKA 4WO4B 3AM8A 3PHOB 1QACA 5B38A 3UAJD 1FNGB 3R0MA 5J6HB 5ADOH 3LQAC 3VFPA 2X4SA 4F57L 3FO9A 1NUGA 3HCVA 4Z7OE 1S7VA 2DLFH 3OKEA 3KAAA 2CRZA 3RU8L 1M6OB 1VFOA 5T5NF 1FPTH 3MA9L 4PG2A 4H1LG 1LGVA 1NPUA 1KCUH 5GGUB 4KGLA 4NQCD 3V6ZB 2WM0A 1ETZA 4L4TB 5IB4A 3IFOB 2XG4A 4DGIH 5IVNA 3RDTC 1ORSA 4KKBD 4TUOA 1WC7B 1MEXH 1T5XB 3TESA 4QRRB 4NZDA 1T0NA 3O2VL 2J6EH 3E2HC 4ERSH 3I9GH 2G5RA 4R7DB 2B0SL 1I85A 5F88B 4HMCA 1T0PB 3WE6B 5T3XD 3FT2A 5F9OH 2Q20A 3Q5TA 3U30B 1NCWL 2A6JA 3ZLQC 2KKQA 1NFIA 1UWEH 3TP4A 2JCCA 4F9PA 3Q1SL 5I73B 2BSSA 2N56A 3VG0H 4LASL 4BZ1L 2Q6WA 4NQCB 5IROA 4QY8B 3BQUC 4BQCA 2CUIA 1DQLH 3FT3B 4M6AA 1SYVA 2H2PC 1PY4A 2X9XA 3JBG7 5B4MC 1YEGH 5ADPH 4LRNL 2AV1B 3JTSB 4HK0B 2OTWB 4PJBF 3R1GH 4AL8H 1GZQA 3DROA 3WHE1 5DEGA 5KTEL 5IVZA 2FEEL 2VXUH 3ES6A 2KUTA 4HUUA 5B3JE 3V52L 5D96B 1ZSDA 4LLDB 3HLAB 1YJDL 3QIWC 4M4PA 4YLQT 1FBIH 2MMXA 5EPMA 1JHLH 1IC1A 2P8MA 2GW5A 1CFNB 2X1WL 3MLRH 1UB5B 4JFED 3BP6A 3SGJC 4JREC 2XQYK 1J10A 2BNRD 4L8SB 3P77A 4MA3B 4K7PY 2ADJA 4MXQC 3RNKA 4GMTL 5IB2A 4I4WA 2ZG3A 1FZJB 3P0GB 4GRMA 5ANMB 3HUJA 3B43A 1QG3A 4PV9A 1FN4B 4NQSA 5EWIL 1S7RB 2CIIA 4DFHA 2BY2A 1AFVH 2FBJH 4OLVL 4AH2B 1YA5A 3QI9C 2B4CL 4NQXA 2IALA 2FX8H 1EJ6A 2F54D 4JLRB 1NGQL 1MLCA 1JI1A 3WO4B 3GSXB 2VISB 3EYVA 5FB8A 1INDL 4QTHA 3TH4T 3CSYA 4G5ZH 4F7TB 5J11C 2QQKH 5IVXB 4KQ3L 1KGCE 1XMWA 2CUHA 2VLLA 3LV3A 3MOQA 4JG0H 4JFXB 3LKPB 2VTFA 1KLUB 2LE9A 4XCCH 5LBSH 3EBAA 4K3EL 4LFHD 4HC1A 2NW2A 2G2RB 3EZJB 2CDFB 4JFEB 1OSZA 5DJAB 2VQUA 1T1XA 2NY4C 5F3BA 3ARFA 3IXTB 4PJEB 3MLUL 1FAIL 1AQKL 2BVQB 3BPNC 1U92B 1OAKL 3S88L 3CXHJ 1RZKC 4NKMB 2YOCA 1NCDH 1S7TA 5F8QC 2IADB 1CE1H 4M6NL 4M9OA 4RFNC 5AYUH 1CE6A 2OSLA 2I60L 5GS2D 1LO2H 2F54B 2AKRA 5BZWB 5ICZA 2LVEA 3LS5L 2PW1B 3FTGA 3T0EC 3VXPB 1I3VA 2V2TA 2Y1VA 1UWGH 2KL6A 5H94A 2EYTB 3EOBB 1H3PH 4E41A 2HH0L 4LSTL 2NW3B 1YEIH 4YQXH 4PJFF 3DV4A 5T5FL 1X7QB 4Y19D 4LHJB 4LNVA 3BH9A 4UTBL 3PXJA 2FR4B 1NDGA 1YY8B 1LEKA 4MLSA 3CVIL 4P4RB 3GKZA 3EO0B 1DQDL 1XGQB 4MJ4A 4LSSH 4JY4A 5I1LA 5DI8A 1PD6A 1M4KA 3DYPA 4X7TB 3L5IA 4OGAD 1KBGL 5CBAB 5CIPB 1HQ4B 1VPOL 1KEGL 4R0LB 1KPVB 5C0CD 5I6XC 3AC0A 4R4BA 4ZD3H 1CLYH 4DGVH 4R6UA 3MBED 1I1YA 4HWUA 5HI4D 5A3IC 5DC9B 3U7WH 1OD7A 3LQAL 2GTZA 3GSNH 3O3AB 4RFEB 2OMBA 3L7FB 3E6HB 1W0VB 4P9HH 3KG5A 3Q5YA 4KRNA 5SWQB 4P99A 4NDMA 3NIFE 4Y19B 5DZOA 5CJ8A 4A6YL 4XCFH 2QBWA 4YC2C 1DVFA 1QRNA 3MRQB 3SO3C 4IS6A 4ZUWA 1NBZA 4XXDB 4PJ9C 4DKDC 4OF5A 2NX5E 4F7PB 1JK8A 2R0ZL 2HVJA 3L5XH 4WW1A 3HMXH 3V5HA 4YEFA 2Q7YA 3KLHD 1QHOA 2NY3D 3DURA 4BH8B 1QEWA 3QUMH 5C0CB 2YXFA 4JJHA 3ARDD 1YMME 4XTRD 3N06B 1PEWA 4KQ4L 5T1LD 1ZGLB 3MBEB 3VFOA 3S6CA 1GPOH 5IHUH 5J13C 4C83A 4X9GA 4X6BA 3CSPA 2HT4D 3F58L 4X6CE 3BKYL 3QT2A 2AI0H 1ZA6A 4OM0H 4Q2ZA 2ZUTA 4RRPA 5F1NA 1A0QL 4F8TA 3RL2B 4OQTA 5DYOB 2IMNA 3VI4F 2HJFA 4PIRF 3ZO0A 3H42L 4LSPL 3S4SA 1U95A 3QIBC 5C1MB 3CC5B 3VGAC 1YUHA 4OFDA 3DVGA 5C0FA 1GGUA 3ZTNL 1J88A 2X1PA 3VJ6B 2NY3B 5BMFH 1JN6A 4JDVA 1IGML 1XH3B 3ARDB 3T0VA 4CVXB 5T1LB 1Y6KR 1SEQL 3LQZA 1C16A 4G8GE 1JWSB 1L0XA 3Q3GB 3PV6B 4PJIB 1A6ZB 3CDGB 3ESVF 1I1AA 5DC4B 1F58H 5C0IA 5KVDH 1RUPH 2H32A 5EG6C 3E1F1 2WNGA 1W0WB 4I3SH 3WLWC 4O58H 4W6XB 4JGMA 5ID1A 4NM4H 3FRPA 2NMSA 4YR6A 5JOPE 4LSRH 3WFZA 3UZQA 5CEZH 4ZFZA 4YHPB 3WFHB 4QO1A 3L95A 3S8WA 3CVHL 3PL6C 3V8CA 5EUOB 5KANG 3O6FC 4IOFC 4LBEB 2XA3A 3C6LA 3TM6A 2BRQA 4I18B 5JPMA 5I1EH 5CGTA 4KDTC 5C0AA 2DDQL 5C0GA 4CADA 4DW2L 2R2EA 1RFDH 4S1QH 1YEJL 1U8QA 4AG4H 1VFBB 3GMOA 3WS6C 3MLZL 4PJHF 1AC6A 43CAA 5ESAB 4F7MB 4Z7QF 3BJ91 4NHCL 3EYSH 4XBGA 5JUEH 4C54A 4XBEH 5TDOA 3QZWB 4QHMB 3DX7A 3I2CL 5FCUL 5FO7A 1JMZA 2EDYA 2HKHL 4RGNC 1VADA 1AH1A 2O5ZL 3MRCA 2AK4E 4NPYA 2R0LH 1MCOL 5ESQB 1V3MA 1NDMB 4K8RC 3GJFH 5CWSB 5L9DL 4GG6A 4XB7A 1JGEA 2CJUH 3TN0A 1JL8A 3NFSH 3E3QE 1KLGA 2VZTA 2YN5A 1QFWM 1UM5H 5E56A 5CGYD 2CK0L 5HVWA 5SWZE 2LU7A 3L3KA 4TSBH 5B39B 3TYGH 4FS0A 4WWKC 3BRDA 3P4LA 3GB7A 1WWAX 2ARJA 2OK0H 1SY6A 4EZMA 4N0YH 3LEXA 5DDHB 4L4VA 4HUWB 1YMHB 2VLJE 4JPVL 3EUUA 1D5MB 1BIIB 4TNVF 4X6DE 3VDAA 3HG1D 2IQ9H 4HKZA 4YDJA 3SGKC 3TJHD 4MNQA 2XZQL 3GRWH 5D8JL 5L88H 3ZL4L 5E08L 3T08A 1U91B 3SGDH 3U46A 4P3WA 2VDLH 3FKUS 4ZG1A 2DL2A 1QA9B 1NLBL 4PGCA 5IHZB 3MLSL 2J1KA 3S35X 5EO9B 1CF8H 4FQLH 3KS0H 4XNYL 4KV5E 4P49A 4X8XA 1EEYB 5LWYH 4AEIL 3SDXB 1T89A 2ZCLL 3FQUA 4MWFA 35C8L 1IKFH 1CG9B 2GHWB 3NIGE 3U7AA 2AJUL 1K4DA 4AIOA 3EHBD 3ROLA 4PG9B 4U1JA 4K7PX 1KB9J 2EDEA 2W38A 2VWEE 2W60A 2GSGA 5EUOF 4Q6IC 2J5LC 3HG1B 4NBYB 3SY0B 2XICA 5EBMB 3GJEA 2IH3A 1KTRL 5GZND 1TQCB 1J8HA 2FHFA 4QHNA 2DWDB 3FB6A 1A1OA 4XMPL 1N3NA 3DX9A 3T04D 5GGRA 5DVMA 2H3NB 3HAEG 2CLRA 3CMGA 1B4JH 2G9HB 5BO1L 2DBLH 3NVQA 2R69L 4JR9H 4FP8H 1NEZG 4TUKH 3RVUC 2CPCA 4QTIH 1X5HA 4MJ5A 4JG1H 3GSRA 2HN7A 4EI6A 5DHXB 1TETH 4ZTOH 2HAZA 5KOMC 4NHUA 2A0LD 4ZAKA 1I9IL 3B3IA 3BESR 5CP7A 1DUYA 3UJIL 4WV1A 2JCCE 5FDYA 4YJZL 3WL9A 4DAGH 3QG6B 3WO4C 3W2DH 4KJWD 4PLKD 3MREA 4KXZH 4FA8A 32C2A 1RPQA 3GK8L 3PGFL 2JJSA 1FORL 4ZYKB 3WHE0 5DD1L 2H1PL 5MENE 3BYTA 3KYNA 1AQDA 4NZRH 3K3QA 1F3DH 4P5TA 5DD6B 1IGTA 4HIHA 1BF8A 4TYUA 4MGXA 5BW7A 4G42A 5HDBF 4FG6D 3IDNA 1GGIH 2I27N 4M1GL 1XGYH 2ID5A 4L3AA 2P4AB 4OLWL 3IDYB 4QXGH 4H25B 2HVKA 3GKWL 1OL0A 5GGSA 3SDCA 3WHXB 2XQYG 3NIDF 1A9EB 3DVNA 2BVOA 1AHWA 3HC0B 2EC9U 3DRQA 5TDPB 3PIQB 4RMSA 3DOSA 1BVKA 2HJLB 3MGTA 5AD0B 2FLRT 3HUJE 2A9MH 3T0DA 3WN5C 3O4OB 3SCMD 2XZCL 5C6TH 3IU3B 3L3GA 1VHPA 1MCJA 1U8IA 3FONB 3U6RB 4M1CD 4JHWH 3BDYL 1Q1JL 3VCLB 2A6KA 3EJYC 2ADFH 4FXGA 2XN9D 1LK2B 3F5WB 5MHSE 3V9FA 1J1OH 4Q74A 3NGBB 4OAWA 3UJTL 1ZANH 5H8DA 4W4OC 4M5ZL 5HYIA 1DBJL 4PGEA 4CVZB 4TVPE 1GOFA 4J3TA 3IJSA 2NCMA 4QRPD 3I50H 4YEEA 1M7DB 4LIQH 2WW8A 2LTQB 3WIIL 3HN3A 1CDGA 1NCBL 2YRZA 4FQJL 1Z5LB 5DRZA 4ZDHA 1YEKH 2HJKB 1MOEA 4ONFL 3CZJA 4RDQF 4HIJA 1DEDA 3STZA 1LP9B 4NFDA 2AW2A 5EORL 3ECBB 3D3VA 4FNLH 1FJ1A 4ISVB 4K8RL 1EXUB 3S97C 5CP3H 2B1AL 5FHAL 3DX8A 5I1HL 4DKAA 5DRNA 3VRIB 1QSZA 5HVHB 2XN9B 1OVZA 3FB7B 4PGBA 4M03A 1ULVA 4JM2F 5HGBB 1S3KL 2ENSA 4URTB 3U2SB 3TNNA 5BXFA 4KKLD 1ROWA 1MSPA 1U8MB 4GSDL 3VWKA 4J4PC 1KJ2H 2XXCB 2DM2A 4MS8D 4U0RC 4E41E 1YNKL 5TQ0H 3O4LA 1AJ7L 3RY4A 1EGJA 2A9NL 4GRWE 1CZ8H 1GGCL 1YQVL 1G0YR 1I4FB 2EDKA 3QUKB 3HR5A 3RZWA 3V6BR 3JTTA 2DQCL 3O6MH 2PR4H 1G6RB 1KJVA 1V7NL 2EDHA 4XVUC 2QKIA 5EDXA 1XF2B 1IM9A 5D2NA 2B7DT 5F7HA 3WIFA 1YN7A 4ODXA 4OIIL 5JLZA 1MCWM 4RCAA 5HI4C 5DD0H 1CL7I 4PRBB 4NQDE 4JHAH 3HR6A 4JY5L 5MERA 5F96L 2CLVB 4HIIA 3IF1B 1GAFL 4PUBL 5IKCA 4D2NA 3UO1L 1ND0B 3L1OL 3VFGL 3LCYA 2PTTB 2Y36H 3FHAA 3QUYD 3OGCB 4Z8FH 4CBPA 3DYOA 1P9MA 5CZXC 1QTYT 4P2RD 4OLEA 5FO9A 1WIPA 1RZGB 1MHCB 4U6TA 4H1LB 1BOGA 3C09C 4LMQE 5DZLA 4WFGD 5GS3A 3C5JB 3P9LB 1GGBL 3RUGB 5IFJB 1AY1H 5TF1L 4QXTB 5DVOA 2YD8A 1NL0H 4ZPTA 2DI7A 3OKMB 2NY3C 1CLOL 3HRZA 4M7LH 2XTJC 3ARDC 3JVGA 4Y2OA 1T7XA 3NH7H 4YHKH 5JW3L 1BD2E 4LLWA 5AUMB 5GGTA 1UFUA 3JV4B 2MHAB 1HQRB 1BFOA 5T3XL 4GXUM 2B1HH 1YEEL 3QUYB 4N9GB 5EZLA 4P2RB 3MRHB 5HHNB 1C08A 5DD5L 3QWOB 1KSRA 4KTDH 3FFCA 3RWHB 2UVEA 4HK3J 1WFOA 1BM3H 3REVB 3W9EA 1QYGL 1W72H 5ICXB 2I5YH 5L2KD 3VGGA 3CCHA 2AXGA 3RWGA 3GUTB 1IFHH 3VXSA 4PRNA 5EZIL 3DPBA 4JO1H 3WDHA 4EN3A 4P9ML 4R2GD 3HFMH 3SDAD 2ED9A 5D6DC 1G0DA 4RBPK 4U4BA 1QSED 4JO4H 3W0WA 3A6BL 3PWUB 1I7RB 3UTTD 2PCPA 5CGMA 2E5EA 1QO3B 3ZT7A 4JPWH 4PJDA 3NCJL 2MCPH 4L9DA 1U2HA 5GISH 1IAIM 3VXNB 1HE7A 3STBA 1CGSL 5AEAA 1T04B 2CDGB 4ZS7L 5ICYA 1S9YA 2IFGA 3VFSA 5FYKH 5J56B 5L2KB 1MH5B 2JB5L 2ZPKL 4G9FA 1U8PB 3AFLA 2XA8H 4TUJB 3W82A 4HCRA 5ILTL 1NCAL 5J4MA 1N26A 2WWKO 4JQXC 5IB1A 1CGXA 4R2GB 5C0AE 4AIZB 1T66C 1EEZA 1F6AB 4ZUTB 5H37H 4DZ8A 1QSEB 3RUGF 4YFEA 3UTTB 3JWOH 1EAJA 2BP3A 2N4IA 1CL7H 2F19H 4P0DA 5F71A 5BJTB 2FGWH 1ACYH 5KAQG 4OCMC 5GRZA 1PEZA 3OJDA 3V5KA 5IMKA 5FYJH 5SX5K 1QBML 2NY5L 1MCNA 4P46D 5CGYC 1FYTD 4DN4L 3U7YL 5A1AA 4OGXL 4F2MB 5MP6H 5JOFB 3KLSA 2C3VB 5B38G 4GG6E 3U0TA 1CLZH 4I5BB 2VSDA 1R5WB 4TTGA 2I9TB 1JRHI 1JWMB 1E28A 3KYMB 4FMKA 3RWEA 2PYFB 1TTUA 4HWEL 2RBLA 1A9BB 3TJHC 4UTAH 2Y6SD 3KJ4B 4ODHH 2ATPA 1OM3L 4G9DB 2EKJA 4HXAL 1DTUA 2DQIH 1QQDA 4NZUH 1TQCC 4L4VE 1Q9KA 4M7JL 5BOPA 3LRSB 4OQ1A 3U9PL 1EV2E 1FV1A 1YYLL 2W0FB 4LSUL 3WDIA 3HI5H 4Z7VA 4LF3B 4JO3H 5DEFA 4MNQE 4Q6YA 5IJVA 4YNYA 1I8KB 4Y4KD 5JO5B 4IMLA 4KPHH 4ODWB 5MI0B 1T6WA 4P46B 5F1OB 1FYTB 5C0ND 1K6QH 2W9EL 3X13A 2H26A 4PJ5B 3O2DH 1YECL 2H8PB 4ZUVA 2X4OB 5F7WC 2K9UA 3MJ9L 2IPTH 3VWJD 2P5EA 2DQFB 3RDTA 1RUAL 2EIEA 1JUFA 1G7PA 2V2WB 4Z7UA 4DVBA 1HH9A 1RUML 1IT9H 1WICA 1OP5K 2EDRA 4D3CH 1QLFB 1J0IA 2YMXH 1A4KB 2DLGA 1QR1B 3GBLA 1E6JL 4PB0H 4MJ2A 1BLNB 5J06A 4YBQC 4YAQB 4CJ1A 5GIRB 1WBYB 4JB9L 3FQNB 4LSQH 1KB5H 2XKNB 1A1NA 4Y4KB 4HFWB 3ORJA 2FZ3B 1OQXA 4DTGH 5AWNL 4PYHA 1J8HE 3D85A 3B8SA 4NKIH 1Q9OB 1B9ZA 1RIHH 1RZJC 4Z78B 1FO0B 5BS0A 2RB8A 2ORBH 5LAXA 3ULUC 1RJZB 5CJXC 1F4YH 3P3YA 4K23H 1QNZH 5D7LD 5H2BA 3BQUA 1R5IA 1IEAB 4H26A 5T3ZH 4WCYL 3QUXC 1DN0A 3BEWB 5CD5D 4B41A 3U4BH 4NIKB 4RMQA 4EIZC 1SM3H 4WNQA 2DQHH 4F3FB 3SPVB 2P5WD 3CDCA 4QRSB 1MREL 5DZNA 3EGSB 4PLKC 1I9JH 4HLZH 3C08H 4RAUB 3QFDB 5M94B 1EHXA 5ACZB 4JN2B 3IETA 1JPTL 4I0KA 3QIWA 2WUBL 4IDJH 1UXWB 1VERA 3S35L 5KJRH 2FJGA 5ID0B 3SGJA 4R96B 1E4JA 3QAZC 4AJ0A 4U05A 1M05A 1LO3L 1JFQL 3QEGL 4HUXA 1GXEA 3ZYOA 2A83A 4JRXA 3QO0A 3WIHL 4HWBH 2ATKB 1XT5A 4UILL 2LTQC 1CBVL 5EA0L 1A6UL 5D7LB 1HXYA 3CFCH 2BHYA 4MX7B 4OLYL 3FJTA 3WEXA 4YPGA 3QI9A 4X80H 5EOTB 1LO4H 4E42B 1BBJA 5IW1B 2EDLA 2FECI 2P5WB 4XHJC 1JRHH 4NQED 3TT1H 1X6NA 3LKSA 3CMOH 3SCMC 3RPKA 3EOAB 4OV5B 1GHFH 2RIKA 3HTLX 5E70A 1L4IA 3AU1A 3Q6GL 3MBXL 1OTTC 1OTSC 3C87A 2XFXA 3DV6B 3BXNB 1T7VA 3D48R 4WI5A 1EBAA 4Q9QH 3CFJA 3FO2B 2C4FU 3HB3D 3HZYB 4WI8A 5C71A 5KVEH 3O3EA 3D9AH 4G7VH 3BZEA 3GZKA 4HLJA 5DMIL 3EO1B 1IEHA 3SN6N 4YHMH 5K9KA 1XCTA 4UDTB 1KFAL 5BOZG 2ZUUA 3F6IA 2CXGA 1RUKH 3U0WL 3FOMA 4LSDA 4O51A 3DI3B 3P0VL 4NQEB 4NRXA 3T0EA 3D69A 4S1RL 3GMRB 4X99A 4NWUH 3QH3A 1G6VK 1KN4L 4GW1B 2HT2C 3H9YA 5J1SC 2P8PA 3MACH 5C8JA 3GSQA 2J8UA 2MQCA 4KZDL 1S7XA 4KKLC 4PRPA 5D7SH 4DK3A 3ULVF 2NZ9D 4N0UA 1IC4L 3K74B 1E4WL 4GH7B 1P4LA 4ODUA 3P4MA 4MS8C 5KSUB 2JELH 5E8PB 2HFFB 1MNUH 1TJGL 2WBJD 3TNMB 1REIA 3KLDA 4OFVA 3AAZB 3JV6B 3X3GL 3GSNB 3MJ8A 3O9WD 4ORGA 4HS6B 1PG7H 1U8KB 2GAZA 4UQ2A 4TULL 1BREA 1X6LA 3O4LE 2NY1D 5DGRA 4YX2L 1BX2A 4UDUA 3RZCA 4XNQB 1EEQA 1ZEAL 4CU6A 1U8HB 5I8KH 1A1MB 3VI3E 3BHBB 1NUDA 1Y18B 1JF1A 4PLOB 1KIUA 5D7JD 3JUZA 5I2IB 2APTA 5KANI 4ZOAA 1R3KB 4GG8B 5D2NE 3NMEA 1PZUB 1RULH 3H3BC 1WFTA 5JA9A 3BUYB 5FA3B 4QF1A 4FTVA 1G9MH 2B20A 4WUUD 2Z8WC 3TCLB 1J5OH 4PJ9A 1YEDA 2NLJA 4WJ5A 4XMKL 3L3JB 3L3OB 5E2VL 2XPGA 3T2NH 5I18L 2WBJB 3C2AH 4U1MA 1K8DB 4WW2C 1RMFH 5L7XH 3GGWB 4HKBB 1NANH 4AT6B 1KCSL 5HDQH 3UTZA 2YKLL 2X4PA 5F89A 3O9WB 1D6EB 3TGXA 1UZ8B 1D9KD 4KDWA 4RRPG 3N50A 4K2UH 4QGYA 2NY1B 1F4HA 5IMOB 2OI9C 3LZFH 4JDTH 3X11A 4NYLB 5IMLB 3S4SG 3QULB 1TXKA 4S11A 3HI1A 5D7JB 3T4YA 5DQJA 3OKNA 3NFPB 1KGCD 2BJML 1FRGH 3MGOA 1LMKA 2UYLA 2A74B 4JZNA 4QYOA 4KROD 1BIHA 1B0WA 4XX1E 5IT2L 4YDKH 1OGAA 1AE6H 2OBGA 4MAUL 4X7SL 4WUUB 1F2QA 4XPTL 5I8EA 2UY6A 2WLZA 2VXVH 3D39A 4X7DC 3QNXA 2A2QT 4Q0XL 2QEJA 4U1LA 4BSVA 3SE9H 3RVTC 1BOYA 2W65A 3FRPG 3SKJH 1D9KB 3RY5A 3VXOB 3FFCE 4YDIL 2D7TL 1CDHA 3TBTB 3TV3L 1INQA 3ULVH 3T1FA 3SDAC 1QVOA 4JZJC 4NNPH 4QOKD 5D1XD 1JHKH 5TDNA 1FVDB 3S34H 3BIAX 1A2YB 1KPUA 2OJEA 1RZFL 5EU5B 4NUGH 4WDIA 3VXSE 4C56A 4BZYA 3UC0H 3MNZA 2ARWA 1JWUB 3MRDB 3WLBA 4M61B 4IEFB 4KROB 2VXSH 4P2CG 3QXVA 5GS0C 3W0WE 4D0BA 4EIGB 1UJ3B 3GHEL 3PL6A 3QHTC 4CN4A 3O6FA 5ACLA 3MV9E 5JPNB 1OARL 4PJDE 1WLHA 4KDTA 3BOVA 2VLME 1Y0LB 4LPCA 5GQBA 4H8WH 4PJCA 4WHTA 1LE9A 1X5YA 4OJFH 3OR6A 4NUJA 1A7PH 3MFFA 3VXRA 3WS6A 2AGJH 4P4KC 5DJ2A 2OJZL 1IAIL 3LS4L 4L29A 2XWJB 4BH7A 5T1KD 4X5XB 2MPAH 1UM4H 3OKOA 1SBSL 1X5KA 4QOKB 5B22A 5D1XB 5GZOC 2E6JA 2EEDA 1JV5B 2VE6B 4OI7A 4G9FE 1C5CL 4QNPE 4HJJL 1ZLVH 3VFWB 3PHOA 4XPHL 5KBNC 4Y4HD 3RA7L 4CMMB 3VD5A 1CR9H 1UT9A 2MFNA 2K7QA 2R39A 4IRSD 4N0CD 4PV8B 3GNMH 3VRJB 4ZFFA 1EAPA 4OCLC 1MJ8H 3LEVL 4NT6B 5HI3C 1HSBA 5KSAC 3I75A 1Z0NA 1G6RL 5MI0C 1UWXK 1LE5A 2NX5D 3SQOH 4OF7A 3P4NB 1BVZA 1FIGL 4OLUH 4WWKA 5B3JF 1G7MB 4YZFF 3BAEL 2P24A 4NO5B 4PR5B 1EUTA 2WV3A 1JPSH 4OIBA 5K9JL 1DBAH 5C0JB 4L4TA 4WHYG 5DJDB 3UJJL 1YMMD 2OL3H 1JGLL 4XBPB 1CIDA 1YY9C 3BKMH 2AJZB 5GRJL 1FFOB 3R0NA 1ZGLP 2WUCL 4Z0XB 4JPIB 5T1KB 3O3DB 1KT2B 3SGKA 1S7UB 2Y23A 1FNEB 4G8IB 1WV7T 5DFVC 3EYUH 3NCFB 4U7KA 4FQ2H 3TVMC 2DQEH 3P30H 4Y4HB 4C4KT 1QHPA 2AXFB 3L3HB 2X4QB 2FATL 3EFDL 4IRSB 3THMH 4Y4KC 4MAYC 3RKDD 3RX5A 3WFBL 1FHGA 4EXPX 2HMIC 4HPOL 2NX5B 3C5ZD 3MOBL 1F4WH 1I7TB 3LPGA 1LEIA 3NTCH 3RVWC 4Z7VE 3MRIA 1HILB 1CN4A 1N7ML 1S8DA 1YMMB 3EO9L 1B4RA 1DL7H 3QFJD 3VWJC 4LNRA 4IOSD 4DEPB 2D03H 3QCVH 3L5HA 4HSQA 4Q6IA 5CJOL 5E2UH 4X4ZA 3QNYA 2FIRT 3BKJL 5EU7C 5HHXH 2BVUA 3MLTB 3N1FC 4APQC 1BWWA 1CFVH 2J4WH 1B0GA 4M6OL 4LPVA 1WCBB 2P5EE 4PBVC 4PY8J 5HYEA 3E6FA 2ZJSL 4X6CB 4LLDA 5JOPD 5EU4B 4M48L 4Z7UE 5E5UB 3NACL 3D0VA 5B21A 2V2XB 4UINH 3MCLH 5F7NC 1BJMA 4NJ9H 2ERJB 1N64H 3VW3H 1RY7B 4MA3A 2OR9H 3IS0X 3C5ZB 5TPWH 1A5FH 3OR7A 4G6KH 2OZ4L 1MI5D 4EDXB 4TTDD 3Q6FA 5TE4H 3MV8A 3QFJB 3AS1A 3PWNB 5GRUH 4JLRA 4U6VH 3MR9B 5BS0E 1H0DA 4KHXH 3GSXA 1IAOB 1BEYH 4LLUB 1FNHA 5DJ6A 4RSVA 4MB3A 3HAEH 5I1DA 2ITCA 4AZ8A 2AK4D 4WI7A 1N6QL 3I84A 3KPRA 1OHQA 4S1SH 2X42A 5A2FA 4Y4FD 1QR4A 1N2RA 5CD3A 1XGTA 2F58H 3Q2CA 1C12A 5IEHA 4Z77B 1EJOH 1L7IH 2BNRA 4DQOL 2BDNL 4DGYH 5SWZD 2VR9A 3D25B 3ZTJG 2GEEA 4BQ6A 4U1KB 1P4BL 4K3JH 3AS2A 3WSQL 1MI5B 5C08A 3IVKA 2ZCHH 1OT1A 4L3CA 5FEBA 2QQNH 4JKPH 4I0PC 2XOTA 4OT1L 5LXGH 4JRXE 4U1IA 5DD3H 2F54A 2A73A 1CQYA 1NEUA 3WN5A 1U8JB 3ZHLA 4P59H 4B50A 2VITA 4BM7A 5DSCB 1FE8H 3B9DA 3LN5A 5E8DH 1G7QB 1T1WB 2AK4B 2Q76B 2FB4L 1UB6B 2E9BA 4RMUA 3FFDA 3OZ9L 2EH7L 4W4OA 4UZGA 1HDMB 2VB5A 2VQ1B 4Y4FB 3L9RA 5K93A 4UQ3B 4XCEB 3BP4B 5IQ7L 4CU7A 4D9RD 1MLBA 1NCTA 5ITFA 1KTDB 3J7HA 1JNHA 5SWZB 4O2CB 1QKZH 1ZTXH 4X6CF 4NSKA 4GXUN 4X4YB 5D71L 4G6MH 3F12B 5CBAA 3S36X 1MRCH 5EC1A 1C5DA 3DSFL 3BZFB 1R24B 4HF5L 4GW4A 4P9HC 4ZQKB 5LCVH 5K59E 4HT1H 4LCIL 1MHHB 3S37H 3W11C 3MLVH 5DLML 3GSWB 2YXMA 4NQVB 2C3XA 1JMXA 1XCQA 1KCUL 4TOYL 4U1SA 2I25N 2FWOA 3L7EB 2GK2A 4GW5A 3WUWB 2OTPA 2BOCA 3QXUA 4DCQA 4MQTB 3T0EE 5IB3B 1DSFL 1DBBL 4UV4L 3U79A 3WJLA 1T20A 3IDIB 3OAUH 4J4PA 2CKBB 3FRUB 1HEZB 1FFNA 2YC1A 2I26N 3I9GL 4RGMC 4Z6AT 3VFPB 1S78D 2X4SB 2J8UE 1F4XH 3FO9B 3HCVB 1UG9A 3UCRA 1S7VB 4PRPE 1KLFA 4U1NA 3OKEB 3IAQA 4MZ3A 3O9WC 4BH8A 4N0UE 4RMVA 1ZGLM 4OBSA 2DF3A 3UYRH 2NY1C 1UA6H 3FQTA 2JJVA 3MJ9A 3G5VA 1ETZB 5IB4B 2FX7L 4JFZH 2BVYA 3VG0L 2ED8A 3KDMB 1ORSB 4TUOB 3P0YH 2HT3D 5JR1H 4QT5A 5T1DL 4MCYA 3HA0A 1HCVA 1FO0L 1T0NB 4RX4A 4YHIA 4J3OC 4K9EH 4XX1G 4S0SD 3MV7D 3GMLA 3F7PC 3KPPA 4K3GA 4NC2B 2A6IB 4JVWA 4LSVH 3FT2B 4FTVE 3ULSA 1DEEA 2A6JB 3ARDA 1E0OB 3LN4A 1NFIB 2JCCB 3QUZC 1WAAA 3CDGA 2X44D 4JKLA 4OGYH 3MC0A 3RVVD 4M7ZB 2Q6WB 1BAFH 3MRRA 3OSKA 1T80A 5I71C 1SYVB 1XGRA 1GCFA 2Y07H 3UEZA 2DQTH 5FKAA 5MHSD 4X4MA 2DLHA 1AGBA 5D72L 3QBTB 1WWWX 4IMKC 4KROC 1GZQB 1FGVL 4LAQH 4X6DF 2EDWA 3DROB 2F74A 4NN6B 5DEGB 5IVZB 2BSRA 4TVPD 4X7FC 1UM6L 3ES6B 4HUUB 3M45A 3CUPB 1WWCA 4G5ZL 4JE4B 1ZSDB 3MV7B 4MDJA 3TO4A 5BVJB 2QQKL 1MFNA 2DIJA 5EPMB 1MJ7L 3GIZH 1MFDL 2P8MB 5IBTL 3NBNA 5EZJA 3FHQA 1OGAE 3BP6B 2NZIA 1G1CA 2APWA 3RPIA 2PUQT 3P77B 3FAWA 2ADJB 4JFFA 3RNKB 3D39E 1M71A 1OAQH 4RQQA 2ICCA 2HFGH 1HIML 3ARFD 5IB2B 1ITCA 4GRMB 4X6EB 5ESAA 2XKUA 1S5IH 3GSOA 5D6DA 5FOBA 4PV9B 4NQSB 4NNYB 3NIGF 2CIIB 3QZWA 2HTKD 4XT1C 1KENL 2EH8L 4NQXB 3QCUL 5E6YA 2IALB 4U1GB 2ICWJ 5CMAB 4OUOA 1MLCB 5AYUL 5I9QC 5FM5O 3EYVB 5FB8B 4I77L 4QTHB 3QDMD 4O5LH 4PTTA 3VXMD 3S7GA 1I8IA 4LU5H 3NZHL 3HNTH 3G5ZA 5MEQA 4WY7H 4E41D 2VLLB 3LV3B 3HC4H 4JHZA 4C56E 4ELKA 1CDBA 3BPCA 5CJQH 3OB8A 3CK0L 1NAKL 1OSZB 4UIKH 1C7SA 1T1XB 3JUYA 5F3BB 2DD8H 5DDHA 4JQXA 3ARFB 2ADGA 1YMHA 4TVSa 4Z95H 1HN1A 5GJTL 5IR1A 4PJCE 3DMMD 1MCEA 2XNAA 2EE2A 2E8YA 1S7TB 5FUOL 1M1SA 1H3UA 1KYOK 1NFKA 4Z7WA 4HBCH 4D8PA 4ELMF 1CE6B 2OSLB 2VNCA 3MZTA 2DMCA 5ICZB 3PDDA 1S7SA 3FTGB 2YA2A 4ZD3L 3S3SA 4Y89A 2DAVA 2JCCF 4Y16C 2V2TB 5EO9A 2D2OA 5H94B 3QDMB 3VXMB 4PRHE 4FQHB 4RGNE 4K71B 4XP6H 2XZAL 4E41B 5EOCL 3SDXA 3GSNL 1I75A 2DQGL 2VH5H 1HKLL 4GRWB 3T8XA 3DV4B 3DO7A 4XVTH 3QHFH 3BH9B 4E9LA 1G9NL 1XR8A 1NDGB 1AP2A 1DVFD 1QRND 3JZ7A 3O81A 1MVUA 5EU3B 4KK6C 4JY4B 4DFIA 5I1LB 5DI8B 4ZUSB 4HUVA 2YHGA 3P9MA 1ZT7A 4O2FA 1RIVH 5GGRY 2ZOKA 2AJVH 2Z9TA 4L4TE 4R4BB 4O2EA 3RTQC 5CILH 5TE6L 3QUML 1I1YB 3QPXL 4FQIL 2OYPA 2EEBA 2YR3A 3HUJF 4QRRE 2XY2A 2GTZB 1GPOL 3WS3A 2ZUSA 2G60L 2BERA 4POUB 4YXHH 1NGYA 3X3FL 3RWFA 2VDRH 2G75A 4NDMB 2R29H 3RWCA 4YGAB 4DKFL 4RMTA 5L0QB 1DVFB 1QRNB 4IS6B 4P3CH 4ZUWB 1NBZB 1D3CA 4LVOC 3MFGB 4NO2A 1PZ5A 5GGQH 1Q72L 2E6QA 1JK8B 4XC3L 1IBGH 2HVJB 4PLJD 3CFDA 4HBQA 4WW1B 3V5HB 4OZHA 2Q7YB 4M4RA 3DURB 4L5FH 2QR0A 5ESVA 1QEWB 3MRPA 1L7TL 4OZFH 3VFOB 4HJ0C 1NLDL 2DYPA 4IJ3B 4R9HA 4OCWH 4C83B 4X6BB 5HYFA 2BNQD 1NAMA 2X4RA 5DURD 5GGSY 4AEHH 5GGVY 2JJWA 5KVDL 3K8KA 4HKXA 1KJ3L 5TE7H 1ZA6B 4Q2ZB 3U4AA 5CJXA 5F1NB 3PWVA 3SOBL 2HYMA 4LEOA 4LSRL 3QUXA 1A6VH 1BFVH 2HJFB 3HC3H 3C6LD 2FEDD 2F8VA 3S4SB 2DIAA 4F58H 1U95B 1YUHB 2AEPL 2PF6A 5I74B 1LDSA 1A3QA 3DVGB 5C0FB 4GRWF 5C3LD 2BNUB 3RX7A 4OTXL 2R8SH 1VACA 2CD0A 4JDVB 4KMTH 3MV8E 2HG5A 4NWTH 3LQZB 5DS8A 3JV0A 1C16B 3VG9C 4X4XA 1LK2A 2W9DH 1FH5H 2QADC 3F5WA 4AG4L 3FO0H 1WISA 2XXMB 2AQ3A 3NN8A 2EZ0C 2IWGA 2XG5A 2BNQB 3ZE0E 1XF4A 5JUEL 5DURB 3IYLW 2X41A 3VFRB 1PSKH 2NY6C 2WBKA 5ID1B 4YR6B 1HHGA 1RQ5A 2ESVA 3GBML 2R0LL 3TN0D 4NJAH 1J1PL 4JFEE 1SYSA 4QHLA 1CWVA 4BFIA 2BNRE 3C6LB 3G6JB 4Y8AA 4PJEE 4CADB 5C0AB 5C0GB 2R23A 4QXWA 2R2EB 4DZBA 5C08E 3SCMA 2ZNWA 4ISVA 1YC8A 3K1DA 5EU6A 2M2DA 1U8QB 1S9WA 1JTOA 3T0WA 1CTNA 2AJYH 2VLKA 4L4VD 1T7ZA 4QRUA 1T2QH 1HINH 43CAB 2F54E 4XBGB 2OMNA 3V4UH 3GI9H 5TDOB 5HGBA 4MNQD 3DX7B 5FO7B 1U8MA 5IM7A 4HDIA 1VADB 3MRCB 4XXCC 3ABZA 3GRWL 4QRPA 5FA4A 3PP3K 3C5SA 4NPYB 1ADQL 3QDAA 4GG6B 1JGEB 4NN7C 4OCNC 3TN0B 1TPXB 3C9NA 1KEMH 1KLGB 4RA3A 3MPCA 5CEYB 2P1YA 4WUKH 5L8KB 2A1WH 2Z8SA 2VLRA 3I3BA 5LWYL 3L3KB 3MLWH 1NFDF 4PJGA 3KNBA 4ONGL 1G1YA 3GB7B 3RL1A 2VXQH 5BV7B 3K8LA 3LEXB 4L4VB 1ZVSA 1UACL 4KKCD 4HKZB 4YDJB 2DM3A 4MNQB 5HHVH 1U6AH 1IZJA 4R90L 5FKPA 4MA7L 2PTVA 4RZCB 5CZVL 1TITA 4MQXD 5HHPA 1J8HD 4OFYA 5JHLH 1F3JA 2J12B 3WD5H 3P9LA 4PGCB 4MB4A 1AGEA 2FRGP 5E8EA 5IBLC 4Q7DA 4KAQL 4M8QA 5EIIA 1B4JL 4DWHA 3FQUB 1U93A 2DBLL 3MLXH 4MWFB 5FHBL 5DO2D 3WNKA 4TUKL 4Z76A 3T77A 3U36A 1K4DB 3WFCL 1KPRA 3ROLB 4PRDA 4LLQA 1F02I 3VGDA 4U1JB 3BN9D 4JM4L 2W60B 4ODVL 4TNWF 2GTWB 2GSGB 4JQIH 5IJKC 3LSOB 2NY7H 3OPZH 4XPFL 4P2RA 4WFFE 3VXTA 4DAGL 2AK1H 4HJGB 4AQOA 1OTUC 3IT8D 4GKZA 1J8HB 2CSPA 2O26U 4JM2C 4QHNB 3FB6B 4Y88A 1A1OB 2HFEA 1KIRA 1N3NB 5F7YC 2B5IC 1U58A 3BZDA 4WW2A 5GGRB 4HUMB 4F15C 4P5TD 2CLRB 5E99H 2FCBA 3LKOA 3PHSA 4HXBL 2OZ4A 4MJ5B 3ZKND 1P4IL 5D93B 3GSRB 3DLQR 1FZKA 3BGFC 4EI6B 3SDCD 4GG6F 3PWUA 4NHUB 2XY1A 3U9UB 3B3IB 4ZOBA 2XTJE 4YFDB 1DUYB 3AREC 3LMJL 4WV1B 4U1GC 3RJDA 3WL9B 1WAAE 4XNZB 1LK3H 3MREB 3ZDZE 4R26H 32C2B 3ARZA 1H3WM 4OUUA 3FB5A 3KYNB 1CXEA 1AQDB 1SJVA 1JYWA 3DETD 1URLA 4X4ME 2CIKA 3EAKA 5F6IC 5HY9A 2ADFL 3I3DA 3WKMH 5DMKB 2DL9A 4P5TB 3BE1L 1IGTB 4HIHB 4X98A 5I1KH 1A7OH 1HCFX 3JWOC 1TQBB 5IK3B 1EERB 4G42B 5DHVH 4EI5C 3IDNB 1B88A 3V79C 3SDAA 4JZJA 3RWIA 3I50L 2HVKB 2VXTH 5GGSB 3PJSA 1QSEA 3SDCB 1NC4A 3DVNB 2BVOB 2HTKC 1AHWB 4M00A 3DRQB 5D7KD 3RFZC 3QRGL 5C3TA 4JFFE 1FDLH 1MCRA 1BVKB 3LD8B 3MGTB 4I1NB 1TJIL 3D3VD 2UZIL 1FGNH 3L3GB 1U8IB 5KW9H 2A6KB 4Y5YC 2HLAA 4FXGB 3MNVA 4Z7NF 5INCA 4UT7H 1T1YA 1IEBA 1QBAA 4FZEL 4PGEB 5KVFL 3VWKD 5J6GA 2MNUA 3IJSB 4P4KA 1SQ2N 1JWMA 3KYMA 3LRHA 3O4LD 3BIKA 5DC0A 2BVEA 3UZVB 4RISL 1A14H 1IILE 4BKLA 5TQ0L 5D9SB 4UAOB 3DMMC 4OV6F 1CZ8L 2ZUQB 5DRZB 1FQ9C 2HWZH 2RCSL 4RBPH 4ZDHB 4WHCA 2X4TA 1NCCH 1MF2L 4HIJB 1CFTA 3STZB 5HPOA 5SV3A 2CKBL 1MRFH 3LRSA 3LDBC 3ARUA 1QZ1A 2F53A 3D3VB 1FJ1B 4KRPD 2HRLA 4MXVF 4L9LC 3DX8B 3L6FB 5KSAA 5IG7A 5DRNB 1T21A 1LO0H 2OL3B 3BKCL 4JHAL 1EA9C 4PGBB 2CMRL 1DQML 2YBRA 1T03L 2JJTA 3TNNB 5BXFB 3QA3B 2VIRA 1F8TL 3VWKB 4OZIF 5FO8A 1A6WL 2J6EA 3SDXE 3O4LB 4UU9A 2ICWI 3O41A 3HZKA 1SY6H 3HR5B 3JTTB 5HHOA 2P49B 4ZXBC 1KJVB 1QLFA 3PV7A 5IFHL 1AY1L 1A4KA 2QKIB 1IM9B 4M6MH 1QR1A 3TVMA 5D2NB 2F8OA 3WIFB 3O0RL 1NUFA 2VMFA 4OD3L 4ODXB 1C1EL 4OLZH 5JLZB 4UV7L 4M7LL 4KRPB 3NH7L 4G6AD 4Y4KA 4HFWA 3GMMA 4MAYA 5MERB 4JKKA 3K4ZA 4HZAA 4HIIB 1OAUL 5IKCB 3VA2C 4WHYH 3ILQC 1YEHH 4P23C 4LHQB 1RJZA 2D4DA 3BPLC 4BZ2H 5HYJA 3OJVC 5CUSL 4KJQC 4CL7A 3IDXH 3SBWC 4AEFA 4EKXA 2H2SD 3VWJA 3MA7B 1VFAA 5F7DB 1BOGB 4LARH 1ZAGA 4PLJC 5E5RB 4Y5VC 4APQA 2ICEA 1RVFH 2UUDK 3OB0K 1LO5A 4ZPTB 1BM3L 4KY1H 3X14A 2RR3A 3H0TA 3HRZB 3VXSD 3QO1B 1UYWH 4EN3D 4LLWB 5J3HC 1IFHL 4JO1L 3W0WD 4HHAA 3HFML 1ZV5A 1BFOB 1IC5L 2NYYC 2V6HA 2DQJL 5TGBA 4RNRA 2QHLA 1T0MA 2FDBP 5I0DA 1FLRH 2V5SA 1KELH 3NCYS 4JZOA 1OPGH 3QNZA 5EZLB 1GC1L 4JPWL 1LQSR 2YRPA 3TJEH 1C08B 3ET9F 3KWWA 1P5VA 1BFTA 4QWWD 3GM8A 3D1MC 3NABH 4KUZL 1QFUH 2E8ZA 3ULUE 4XP4H 3QXDA 3S3JA 5M95B 3PUCA 4XWOC 1OP5H 2O5YH 5DQ9B 4G9FD 2AXGB 1X5LA 2UV3A 3VXSB 3VU2A 5EOQH 4PRNB 5DRXA 3MXVL 4EN3B 5JXAL 2C1PA 2BSTA 3QQ4A 3V0AC 1FNSL 3W0WB 5JMRA 2MJWA 2PCPB 2HLFD 4HC1L 2YUZA 3IJHA 3GO1L 3BZ4A 2LQRA 1MVFA 1WZ1L 4PJDB 4PLNC 4A2LA 4LLMA 1MCFA 1A64A 1Z3GH 2OQJA 3LH2L 4FZ8L 2NY2C 4UDTA 1ORQA 3LIZH 1TENA 4I0PA 3B2VL 4YHNA 5ICYB 5K9QG 1S9YB 1U8LA 4KZEL 4KTYA 4NQEA 1G7LA 3VFSB 3N1QC 2ESVE 3DTXA 2UY7A 2WIMA 1NGPL 4G9FB 4PJBA 1JZ2A 1VKXA 3O45B 2QLVB 2R1YA 3FZUC 3ZSSA 5IB1B 2WIIA 2QQLH 2P48B 5DK0A 4X6FB 1EEZB 4DZ8B 3V4VL 5J12B 1Z0MA 3DUHA 5EU6E 2EYRA 1AR1C 4D9LL 2VLKE 2ZOLA 4AYFA 4XRCB 4ODHL 4PRIA 2R2BA 3BSZH 3VXUA 1KCVH 3B2UC 4OI8A 3QSKB 3CFKB 1L9MA 1PQZB 1RUQH 1CIUA 2QSVA 3AAZA 3N85L 3TBVA 3EOYG 3GBNL 1QPPA 3OJDB 3V5KB 3ZKMC 3GSNA 5IMKB 4BQ9A 5JW4M 4YUEL 2PYEA 4QRPE 1TZGH 1U8OA 4KHTL 2IGFH 1JZ5A 5E2WH 4XNQA 3U0TB 1BECA 1IGYA 4EOWH 1TMCB 1BJ8A 1G9MC 4G8FA 1CI5A 3O2DL 1J05B 5I2IA 2P5ED 2EDXA 5EBWA 1E28B 3RDTD 2VLRE 3NPSC 3RWEB 2IPTL 3RIAK 4PJGE 2Y06L 1KYOJ 4EUPH 3HMXA 3BD5A 1DBMH 2ATPB 5E1AA 1H3XA 4MNHA 3QUMA 1QQDB 4NZJA 3GHBH 4D3CL 1Q9KB 1MCPH 3WFDH 3BRFA 1CK0L 4WWID 1FV1B 1BQHA 4Z7VB 3NAAH 1K8DA 5DEFB 3EIFA 3CLEL 4HKBA 2D9QB 2E7LC 1S9XA 2AEQH 3O9WA 3WDJA 4F57H 4IMLB 4LSQL 2AP2A 3D85D 3VD9A 4OKDA 3P11H 2L7UA 4OFKA 5EBGA 3X13B 5BS0D 5IMOA 4M7LT 3RU8H 3K8MA 5D93C 4PJDF 4YDVA 4JN1L 4ZUVB 1MWAH 3BQUD 1F4YL 2H2PD 2P5EB 4K23L 3R8BB 3RDTB 2GKIA 3NA9L 3FN0H 5T3ZL 5J0BA 1JUFB 1G7PB 4DVBB 4Z7UB 1HH9B 4XNZC 1D5XA 3E2HB 3KPMA 4WUUA 5K9OA 1UVQA 5F9DC 2P46B 3C08L 4OQTL 5L8LB 2AJXH 4QNPF 1JIBA 2B0SH 4TQEL 3ULVC 2GY7B 1FVEB 3VMNA 1A1NB 4P2RE 1D6VL 1TTGA 3VFMB 4MXQD 3D85B 4JRXD 3QUZA 4J6RH 4WFGE 1NCWH 5BS0B 5F1IA 5LAXB 1XF5A 1K5NA 3MRJA 4WGVB 3DRTA 3RI5K 5H2BB 3BQUB 1R5IB 4HWBL 5AZEL 4H26B 2NY0C 3AY4C 3Q1SH 1DN0B 4BZ1H 1QLEL 4LASH 1RK1A 3CFCL 1KTLA 4WNQB 3CH8A 5EO0B 3P4OA 2NR6C 3RVXD 3LD8C 4D94A 3AVEA 4IMKA 4KI5F 4DJMA 4LRNH 4H8WC 1T6VN 4X8JA 3V7MA 5IUSA 3QZWG 1J87A 5JPNA 1IGIL 4TPRL 3BP5A 1X5FA 3V52H 4UNUA 3OBAA 5ALCH 4BFEA 4DN3L 2FJGB 1EO8L 4Z5RA 2V7HA 5FGBC 2V5RA 4LPYA 5E2TH 4JREB 3TBYA 2J3SA 4Q9QL 3SGEI 1I3GH 1M05B 4HUXB 5EC2A 2A83B 12E8L 4JRXB 4D9QD 5KVEL 1DLHA 3IJYB 4HMDA 4P2QA 3D9AL 3GJFA 4GMTH 5GRVL 1VCAA 1HXYB 4QOKA 1KJMA 3SJVA 4Z7VF 4HG4K 3TYFA 4YPGB 4OFPA 3KHQA 2BFVH 5EWIH 5DJZA 1BBJB 3VDBA 4H5SA 2B4CH 4KI1A 1MFAL 1RUKL 5BVPL 4XHQA 5FV2A 1OW0C 4DVRL 1NGQH 5DUPH 5J11B 1QSEE 2EKSB 1IARB 5EUKA 1INDH 4OF8A 2XFXB 5HD8C 4KQ3H 2QSCL 2YA1A 4JO2L 1G7MA 1AC0A 3MUY1 4G8EA 3UTQA 4NO5A 3CFJB 2X1OA 3GRWA 2HA1A 4K3EH 5H35A 3BZEB 4GMSL 5BV7L 1FFOA 5ISZA 4YXKL 3BPNB 4HFUH 5JOEA 5B8CC 5K9KB 1XCTB 4M02A 3T09A 1FAIH 1AQKH 2DTML 1WFNA 3QG7L 2YD6A 1MNUL 1TNMA 1OAKH 2WMPA 4G8IA 4FMFA 3S88H 3MRMA 1Q0YL 4OCXL 1NBYB 1CGWA 3QISA 3FOMB 2DMBA 4M6NH 1PG7L 4N1CA 4NRXB 4K3DL 1QFHA 4Y16A 3D69B 3RZCD 2I60H 1NCNA 3LS5H 4JFPB 4M62L 1BHGA 2P8PB 5C8JB 4KKAC 4C4KO 5HTSA 2HH0H 2J8UB 4LSTH 2F53E 2P7TA 4E5XA 5D5MA 5F3HA 1C5BL 1S7XB 4GLRI 4PRPB 5T5FH 1PJ9A 2DLEA 1VB9A 3ZMRA 4N0UB 4PJ9D 1NUNB 3MRBA 4LLVB 4ODUB 1P4LB 4UTBH 1G9ML 1Q8MA 3P4MB 1J5OL 3IU4L 2YSSB 3PG2A 3FQXA 4KMQA 2V7NA 2CDEA 3MCKA 3MLTA 3MRLA 5F9WC 4ORGB 1WEJL 1MFCL 5I6XB 1F3RB 1RMFL 4MD0A 4UQ2B 3MODL 3ZZ1A 1KBGH 3RTQA 4XP9L 1VPOH 1KEGH 1Q94A 4O9HH 4OCSL 5E4EC 3RZCB 5EU4A 2Z93B 2XWBA 1QRKA 1YPZF 4G6AC 1A3RL 4HMEA 1JF1B 4MA1C 4KKNA 2VJXA 3MUZ1 1EX0A 1TJHL 5DTFB 1UWXH 4XCNA 4YC2B 4FTVB 1JNLL 3SO3B 1OGAD 4RWHA 4PJ9B 4XVSL 4U33A 1MHPL 3OKLA 1FSKC 2NLJB 3D39D 4WJ5B 4A6YH 3ARVA 3T0AA 1AE6L 1FVCA 2P45B 1AGCB 3UBXA 1ZWIB 2BX5A 4N0FA 3BW9A 3HMWL 4D0CA 4YDLB 2AQ2A 2VXVL 4U1MB 3UTPE 5HYJE 4X9HA 3UTZB 2R0ZH 2X4PB 5F89B 1MHEA 4N8VA 1UQSA 5CSGA 3EDJA 1I1CA 3LEYL 1ZMYA 4WGWB 4X9BA 5TF0A 3EDEA 3X11B 1NSNH 1UCBL 5EU7E 4KQ4H 5J13B 4QRTB 5C07A 4U6YB 3TEUA 5K59F 3HI1B 1I1RA 3DARA 3T4YB 5DQJB 3OKNB 3WLWD 1RD6A 3MGOB 2UYLB 1I7ZA 1JHKL 4C56D 5AAMA 5F72S 4JZNB 4QYOB 1HOCA 2OR7A 2ZUVA 3C60D 9CGTA 3CGTA 1OGAB 4XCYA 5I8EB 2VXSL 3O6FD 4I3GA 3E8UH 2FLBT 4FFWC 2YPLD 3D39B 3QDJA 4QWWC 3QNXB 3K2UL 4XPBL 4GBXC 3VGAB 1F6LL 1MIEH 1G7IA 3WNLA 4BSVB 1WZMA 3H42H 3MUJA 2W65B 5FF6A 2J8UF 4B7IA 4WHDA 4H8WL 3VXRD 2Q76A 1INQB 2AGJL 3T1FB 5HGGS 1QVOB 2VN7A 5HI5C 4DUWA 2DS4A 1UENA 2BHZA 4OZ4A 3INUL 4RGND 5TDNB 2EYSA 2IG2L 1UM4L 1KPUB 2OJEB 4MJ6A 4WDIB 4C56B 1KTDA 4OM1L 3MNZB 5DF0A 3WLBB 4L8BA 3OXSA 3C60B 3J8F7 4D0BB 4U2YA 5CP3A 3O6FB 2YPLB 4YGVA 1W8NA 3DUSA 4GLRH 5DJ0B 3KYKL 3WFEL 3CX5K 4QHKI 4LKCA 1MJ8L 3PQYA 4WWKD 3CVHH 2JIXA 2Q86B 3WNPA 3V4PL 4PJCB 1E4XL 3LPFA 4PJ8C 2I9LA 4NCC1 4WHTB 2DJUA 1LE9B 3SQOL 1WQVT 3OR6B 2DDQH 4DW2H 3VXRB 3MFFB 3GSWA 1KJ2A 4NQVA 5GSVA 5DJ2B 5DJCA 4PYGA 1YEJH 4X7EC 4L29B 3VFUA 3WUWA 1BQSA 1AIFB 1LWRA 3TWCL 4BH7B 2OL3L 3OKOB 4NQEE 1NJ9B 3MLZH 4QGTA 5E8NA 1DJSA 4RGNB 1RHFA 4NHCH 3HPLA 4G6JL 4XXCA 3I2CH 5FCUH 1HEZA 4XAWH 2EDTA 2HKHH 4ZNCD 2O5ZH 1EGJL 3P30L 2R1XA 1MCOH 1ZK9A 4ZFFB 1EAPB 4N68A 5DXWA 5L9DH 1HSBB 3I75B 1A7BA 1L0YA 3THML 4PS4H 1LE5B 4PRIE 4WWKB 3VXUE 2CK0H 2P24B 1FC2D 1FFQA 4N1HB 4R3SA 4UB0L 3NTCL 1LHZA 2OM5A 4HIXH 1YEFL 4K9EC 3KDMA 3OAZH 1EHNA 5I8OH 2BOBA 5CJBA 4JPVH 5F9AC 1U3ZA 4Y0GA 5LG1A 4FQCL 5E08H 4PJAA 2A6IA 5SWSD 4KUCF 1NLBH 3MLSH 4PGDA 3MCLL 4NP4L 5JIKA 4XNYH 3RVUD 1HZHH 1WUNT 5F21B 5CINL 3SKOA 3VW3L 2VL4A 3EDFA 1N5AA 4AEIH 1LEIB 4LVNC 2OR9L 3RRQA 3MRIB 2WK2A 2ZCLH 5TPWL 35C8H 5GGTL 4GS7C 2AJUH 3MV8D 1S8DB 2DLTA 5KZCD 4JRWA 4LNRB 3DBXA 3SKMA 2N7AA 4HV8B 2PXYC 4Q6IB 5IJKA 2ITDA 2J5LB 1NGWA 1T5WA 3QNYB 3N9GL 3UTSA 3GMQB 5GRUL 1B0GB 3DWTA 3VMOA 3G9AB 4ESKA 4JM2A 2E9IA 2P47B 4XNUH 3G04A 1MAJA 3CUPA 1GIGH 3E6FB 3MV7A 5BVJA 5SX4I 3KPRD 4KK8C 1MRDL 1OAYL 1YN6A 2IPKA 3D0VB 4WRLA 4XMPH 3MRNA 4YHYC 5I1CH 4S1SL 4WUUE 2IJ0C 4XPAH 3OR7B 3MROA 2R69H 2IANA 4X6EA 5C08D 1PBYA 4NNYA 5F7EL 3Q6FB 3MV8B 1AD9B 5KZCB 3VDCA 4MJIA 2ZCHL 3AREA 2HTLC 1TNNA 5CMAA 1CU4L 1I9IH 1H0DB 1A22B 4MCZA 3RVXC 3UJIH 5LXGL 5IGXL 4HUNB 4NZTH 4UBDC 5DJ6B 5CEZE 4ZSOA 1FLTX 2X89A 4NKOA 5I1DB 1ODAA 2ITCB 3EJYD 1JCKA 1WBZA 2EO1A 4R8WL 2NTFB 1LILA 2UWEA 3KPRB 3OHXA 3GK8H 3PGFH 3STLA 1FORH 1OOAA 5DD1H 5GS1B 2H1PH 5E8DL 1TZIA 1N2RB 3DECA 4LLAA 3I6LD 1XGTB 5CD3B 1C12B 1N5YL 1UEMA 5IEHB 5HGAB 4JCLA 2GIYA 4CN6A 2BNRB 1MAML 1FAKT 4EI5A 3IVKB 4HCRL 5C08B 1F00I 2J88L 2R1WA 4L3CB 2E7CA 5D1ZC 4WFHE 1CGYA 1T22A 4OLWH 1JBJA 3NOIA 3GKWH 4P5KA 1E27A 4U1IB 2A73B 4YHOH 4P2QE 5ABDE 3WN5B 3FMGL 1VFUA 5LCVL 2VITB 3BDBA 3QDMA 4QOKE 3SJVE 4K94H 3VXMA 4FQHA 4ODTL 4HT1L 3LN5B 1FCCA 1FL5B 4Y5YA 1RJLA 1OSPH 1EPFA 1EBPA 3C8KA 3BDYH 1Q1JH 3FFDB 3FOLA 3PHQA 1A7NL 4PJXB 3L9RB 4J4PD 3UJTH 1Q38A 4M5ZH 5DWUH 3MCG1 4EBQL 1DBJH 1MLBB 1MPAL 1U41A 5EU3A 5ITFB 4ZMAT 1JNHB 1X3DA 4ZUSA 4GXVL 3P73A 1I7UA 4NSKB 2X9YA 3F7YA 3VI4E 1OY3B 3DMMA 3VGBA 3PABB 2DBJA 5EC1B 1C5DB 4XVUD 4N5UA 3QXWA 3WIIH 1NCBH 4FQJH 4GW4B 5I75C 5ISZE 1K4CA 4OSUL 1WIOA 3TO2B 1FNLA 3RZCC 3O2DA 3UYRL 4WFFD 4L9LA 5E6ZA 1UA6L 4YBHA 1JZ7A 4Y2DC 1XCQB 4U1SB 2FWOB 4GW5B 4HW6A 4HS3A 4ZPVB 5FHAH 4K55A 5I1HH 2BOCB 4DCQB 1FFPA 2W9LA 5C09D 1X4XA 1R3IH 5CZXD 3P40A 3P0YL 2IBGA 4CVWA 2YPVH 1T20B 4RX4D 3WCYA 5F7UA 1S3KH 4U0RB 1H3VA 1KCLA 3ZE0F 4GSDH 5IVXF 1FFNB 2YC1B 4EXKA 1TVHA 5I17A 3F7VA 3IDMA 4YDLC 4UOW1 4MSWA 4CUCA 1AJ7H 5D5ME 2A9NH 4ZXBA 1KB5A 4U1NB 4LSVL 3WNOA 2AEIT 2GFBA 1HNGA 2XTJD 2DQCH 2Q8AL 4YHZL 1V7NH 4OFIA 1CYGA 3JWDH 4P57A 3FQTB 3B6SB 4PJEF 5JZ7C 3G5VB 2V17L 4OIIH 1AGDA 3TPUA 4KU1A 4Z7QE 4IRZL 4U3HA 5E03A 4OI9A 5K9QI 4JY5H 4P23A 5F96H 4QT5B 2X1QA 4MCYB 5C09B 1EFXA 2Y07L 1GAFH 1IQWH 3UO1H 3VXQA 1FZOA 3VFGH 2Z35A 3SBWA 4YHIB 2PETA 3GDBA 3C09B 3TO4D 3GMLB 1YZZA 1MELA 3KPPB 2J8OA 3TT3L 4XVJL 3LPWA 1DN2A 3HNSH 4Y5VA 2BNUA 1GGBH 4WIQA 3ULSB 3HHRB 1DEEB 5TF1H 1Z9LA 2XTJB 2CGRL 5DVLA 3LN4B 1WTLA 4JFFD 3QFJE 1F11A 4IRJC 4X5WB 1CLOH 2K1MA 2XQBL 1JNJA 4HWBA 2HFGL 1C8PA 5JW3H 3QEQA 4JEGB 4UOJA 4U31A 3MRRB 4DUVA 5DMGC 2BNQA 3CLFL 4CN1A 1XGRB 1O5DT 3VFRA 2ZSWB 1ZT4A 2DKMA 5FKAB 1ZLUK 1AGBB 5T3XH 2BY1A 2GSIA 2HRPL 3UPCA 2C9AA 5C07E 3C60C 2F74B 4RIRA 2BSRB 4CDGC 1P7KA 2G5BA 4MDJB 4NCC2 3TO4B 4V2CB 3G6JA 4LU5L 2C3WA 3MUGA 2IMMA 3EYFA 3CXDH 1MI5E 4PP1D 5EZJB 3TZVC 5E2JA 5I66B 5CJQL 1ZHNA 3O6LL 3Q0HA 1QYGH 3RPIB 1FG9C 4CVUA 4JFFB 1M71B 7FABL 4RQQB 1UKTA 2LAAA 4R4FL 3GSOB 3ZT5A 5FOBB 1T66D 2DD8L 5EZIH 4DKEH 3ZE2F 1DBKL 3REWA 4Z95L 5DT1L 3SEPA 4EVNA 4Q9RL 3QIUC 3A6BH 3T0XA 1CTOA 4LL9A 5M7QA 4IIQC 2Q7NA 4LIQE 4PTTB 2VDQH 1YNTA 4W81A 1I8IB 1RZKL 3G6DL 2A77H 2FHCA 3G5ZB 5CEYA 5MEQB 5CAYB 5CKAA 1ERNA 4ELKB 3MJGX 4XI5C 4ZODA 5C92A 3BPCB 4XP6L 1EZVY 2EIBA 2FJFA 2VH5L 4ZS7H 3Q5OA 1J1XL 4KK5C 3KPLA 1F90H 1XIWD 4KC3B 2Q8BL 3SDYL 2ADGB 2JB5H 2D7MA 5DJXA 2DWEA 2ZPKH 3QWQB 3PQYE 4YWGL 4MYWB 4HG4J 5IR1B 4HGWA 5ILTH 2XNAB 1B6DA 4RZCA 1MJUL 1CD1A 2AVGA 4Z7WB 4D8PB 3BN3B 3B9KC 4POZC 4S1DC 1S7SB 4EJ1C 2EICA 4GAGH 5CSZB 3X12A 5CZKA 5CILL 4FFYH 4FQXC 5MEPA 4PJIF 3K4AA 1WAAF 1X5AA 3OKDA 3ZDZF 1CXFA 1PX3A 4D9RE 1RURL 3T8XB 1QBMH 2NY5H 3DO7B 15C8L 5CIPH 1NBVL 3BD4A 4DN4H 3U7YH 1XR8B 1AP2B 4ACPA 1BQHG 4Z9KB 5GS2H 1MVUB 1XIWB 5FYLH 4GKSA 4HUVB 2GTWA 1H8SA 1S7WA 1XFPA 3P9MB 1ZT7B 3LSOA 5I1JL 5FGSA 2FYYA 5C7XL 4O2FB 1GZPB 3C6SA 1IBGL 2V5YA 2ZOKB 5FUCC 1HNFA 3ARSA 4HJGA 3DSNA 1Q9LA 4O2EB 4YBQD 1OM3H 3QQNA 2DYPD 5KSVA 4HXAH 3PP3H 4FABL 2LU4A 4M7JH 3LHPL 3U9PH 1JZ3A 2E7LA 1MWAB 1V7ML 3WS3B 4LSUH 4MDIB 1QP1A 4BSWA 4ENEC 1KCKA 3VD3A 3E0GA 4U6HA 1NGYB 4AM0A 2AERT 3RWFB 2G75B 3RWCB 4AEHL 4V2BA 3ULUD 4PJAE 2GJ6A 1SVCP 1I9EA 1A4JA 5TE7L 5E1HB 2D3VA 3QUXD 5D2LA 3U9UA 4NO2B 1PZ5B 1QLRB 5F7LB 4YFLI 4C58B 4RWYL 4YXLH 3CFDB 1RUAH 4OZHB 2QR0B 5ESVB 1RUMH 3MRPB 3QQ9C 5HSFA 5IEKA 4XP1L 3PP4L 5E9DD 4M5YL 2DYPB 3BMVA 4TSCL 2JK5A 1VESA 1IQDA 4NWTL 2FL5B 1ZXQA 5GS1C 2BRRL 3UTSE 5DMKA 1EEUA 2XT1B 1NAMB 2JF1A 2X4RB 4JB9H 4JVPA 4F7EA 4KWUA 4PB9L 4WU7A 3G9VA 4OCYH 5IK3A 4YFLF 3MV7E 4HKXB 4JGUA 5KVGL 1CXIA 3IDGA 4FN0A 1VDGA 3PWVB 2ESVD 2RJMA 3AB0B 1WSST 4LEOB 3AY4A 3QUXB 4X7CC 4LK4A 4O4YL 3QYCA 4QKXB 1F42A 4LPTA 3PGCA 2A6DA 4WCYH 2X4NA 4XHJD 2IANE 2ADIA 3SDXF 2CO7B 5EU6D 1G7HA 1VACB 1DFBL 4W6YB 3MRKA 3D87B 4ZTPL 1MREH 5JIHA 1OTTD 1OTSD 2VLKD 2HG5B 4ETQA 4MJIE 5E9DB 5DS8B 2YK1L 1R6VA 1GRWA 4X4XB 1TVBA 1INEL 2B2XL 2DQDL 2VZVA 1JPTH 3NN8B 1IM3A 2WUBH 5FYKE 5C2BL 5FGBA 4ZSOE 1XF4B 3V4UL 5EN2A 3QAZB 2WZPD 4KTEH 1JYNA 1XR9B 2X40A 3S35H 2UWEE 1IC7L 2IC2A 1HHGB 4PREA 3KXFA 1MIML 1LO3H 3QEGH 2ESVB 2GT9A 4C59B 5D9SA 3WIHH 1SYSB 2X70A 4QHLB 4BFIB 1CBVH 4TSAL 2VLRD 4OLYH 1RV6X 2R23B 2VDOL 4LEXL 4DZBB 4K7PH 3SCMB 2EDQA 4WEUD 1OW0A 2YS4A 5FECA 5EU6B 1N8ZB 1S9WB 2HT2D 4LCWA 1BQLL 2WWKT 3L6FA 5FYJE 2VLKB 3L3DA 1L0QA 4QRUB 2OL3A 4ZUUA 5JQ6H 5HYSA 4QHUA 3Q6GH 5HVGB 4JFDD 1QBLL 3TFKC 5AYQA 3QA3A 3QDME 3WJLC 3VXME 5IM7B 3O2WL 4HDIB 4MXWH 1J0KA 4OFYD 5FA4B 4QRPB 3C5SB 1CD8A 4GKNB 5L6YH 2HKFL 5BCAA 3L5WA 5B8CA 4RAVA<