4TVPE

Crystal structure of the hiv-1 bg505 sosip.664 env trimer ectodomain, comprising atomic-level definition of pre-fusion gp120 and gp41, in complex with human antibodies pgt122 and 35o22
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
213
structure length
213
Chain Sequence
SVLTQSASVSGSLGQSVTISCTGPNSVCCSHKSISWYQWPPGRAPTLIIYEDNERAPGISPRFSGYKSYWSAYLTISDLRPEDETTYYCCSYTHNSGCVFGTGTKVSVLGQSKANPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
publication title Structure and immune recognition of trimeric pre-fusion HIV-1 Env.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 38
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2014-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpE02
1YN7A 3HI6H 4K2UL 3T2QA 3DO3A 1SBSL 2D7QA 2EDKA 4OGXL 4OZIB 4Y2DB 4Y4FD 3TA3D 4FMKA 3ZDYF 2DQCH 4KRPB 4F2MB 4EI6B 2EH7H 1MHEB 2ICWI 3QJFB 4OZFH 4M6NL 3SCMD 4MJIA 4NQEA 3SE3C 4PJIF 4RGND 2P7TA 4JM2B 4FQCL 3W81A 4J23A 3IDGA 4KMTH 4TTGA 5DVLA 1ND0B 4RBPH 5ICYB 3QWOA 3FT3A 4NQUA 1WWCA 1KPRA 5LBSH 3U79A 5IB5A 3MLXL 5F72S 5IGXH 5D9SB 3QFJE 1AD0B 4LSPL 1MCJA 1MLBA 4QT5B 1JZ5A 1PQZB 1RHFA 2EIEA 4X8JB 3F12A 1DVFA 3DV6B 2BVTA 4X4XA 2A6KA 3TO2B 1QR1A 3QDMD 2P48B 2ADGB 1U8LB 3ULVE 2VXUL 2Y07L 4I3SH 4I13B 3FQTA 4M02A 3TFKD 5IF0A 4HJ0C 3QO1A 4PY7B 1MHHA 1X4YA 1QBMH 3H9HB 4HIIB 1LO0L 1SJVA 2BERA 4QWWC 4PGEA 3HAEA 1AR1C 3HNTH 5B3NA 3RQ3A 3LS4H 1QLFB 2VN4A 3ARGA 4TSBH 2CSPA 4ETQA 4XVTH 3VGDA 2DQTL 3KPMA 2A74A 1PG7W 3MNVB 1YEDB 1WBZA 1X6NA 1UKTA 4G8FB 4KMLB 5GGUA 2DQIH 4H5SA 1ZK9A 4L29B 1GPOL 2VMFA 1CFBA 1KJ2B 3WJLC 5LXGL 1KN2H 3MRHB 4G9FE 1GGUA 5IHZA 2F5AH 3K74B 1FFPA 2Y4SA 4OCYH 3MRJA 2N7BA 3HZYB 3B4NA 1MPAL 4GLRH 3OXRB 3HLAB 4YHIA 2QKIB 5INDB 1PKQA 1RK0B 3FQXA 4O02H 4DGIH 4BYHA 3PDOA 2FGWH 1ZLSH 5ADOL 1TITA 3MQIA 3QIUB 4URTB 1OSZB 2FBOJ 4GG6A 4Z7WE 3C5SB 1JGLL 5KSVB 4M48L 1SVCP 2VZVA 4Q6IB 4QRSA 2WZPD 1ZVSB 5KSBE 3L5HA 4CVXB 2VXTH 3ZYJA 1N4XH 1I1YA 2MCG1 3I9GH 1I3RB 4AM0A 3N1QC 3TNNB 2KUTA 1TVBB 2NY3D 4NM4H 5MERA 3BXNA 3G6DH 3S34L 2VDQH 2W59A 1NGYB 3S3JA 4WNQA 1W72A 2CRYA 4U6YB 4HEME 3G5XB 2FX7H 5EZIL 1J8HE 1PYWB 3L3HB 5F1OB 4IS6B 2HN7A 3MV7A 4LLYB 4BELD 3RP1A 2H9GA 3WLBA 1JPFA 4PJGE 5HDQH 3SQBA 5JHDB 1HQRB 5FO7B 2I9LB 1FGNL 1Q9KB 1G6VK 3NCJH 1LP9F 3PGDA 4X5WB 4ZUUA 3MO1A 3FB7B 3OJDB 4C56D 1R5WB 4LLUB 4OF6A 4Y19A 2OSLA 1UEMA 2DDQL 4NNYB 4F7MB 4E0RB 4NJAL 2VXQL 2GTWB 4QRTA 3WFBH 3VXUD 3SBWC 5IROC 4PB9H 1NAKH 2D3VA 5C2UB 1MREH 1N5AA 4P5KB 1BWWA 1FCGA 5C0GB 5CSZB 1VGEH 3BP6B 2E27L 4PLKD 1U6AL 2H3NB 4YH6A 4V1DB 4C59B 1C08A 1XEDA 3RVXD 2FJFB 1HHKA 1KTLA 5C0CE 2GTZB 3DX8A 5IW1A 1J7VR 4NZDA 3IGAB 3RY6A 4PREA 2X4UA 3V4PH 1HEZB 2X4PA 3O9WA 5T1KA 2IMMA 4FHBD 4WGWB 2IADA 3S5LB 2Z35B 3VXMB 1A7NL 1IGML 5MEPB 1Y6NR 3I75A 4L3EE 3EAKA 2XKNA 5K9QI 1T22B 2A73A 4UU9A 3TC9A 3K46A 4L3CB 4YDVA 5EU7C 4KK5C 1QBAA 4X6EA 4FXGB 3H3PL 4LEOB 3UTZA 3QCVL 3LSOB 4UNTA 4X9GA 3TNMA 4YBHA 1E6OL 4WW1B 3O4LE 4YNYA 5C0IA 3FQRB 1L6XA 5AAMA 3MRKA 2WP3T 3BDXA 1H9VA 1MFAL 1RHHA 1L0YA 4MJ2A 4P2QD 5FYKU 4KRLB 4EI5A 1A1NB 4LHJB 2R4SL 1S8DB 4IRJB 3X12B 4WFGE 1IGYB 4D9LL 3OQ3B 3B2VL 3KHOA 4I9WE 3UTTA 3I2CL 1J18A 1DR9A 3HZMA 3VA2C 1CDCA 4OCLC 4OZGE 2RR3A 3QHTC 4Y4FC 4NKQB 1FV1A 1XZ0B 2DQCL 4F9PA 3RX8A 3D69A 1CXIA 4JDVB 5HHPB 4NNXA 3SCMC 4RGNC 3HI1B 2XA3A 1S7SB 1D9KB 4NZJA 3STBA 3GMLA 5L88H 3RHWK 4JJ5A 4LLDB 4GAJH 2AKRB 3QDGD 5IGXL 3W0WA 1CICB 1HN1A 1DBML 1X5AA 5I1DA 4PLJC 4PJAA 3GSNH 3FN3A 1BZ9A 3TPKA 2FO4A 1IZJA 5EOCJ 1E27B 4X6CE 3Q1SH 1JYWA 3MRQB 3OTTA 1R3KA 1XF5B 3RWDB 4LK4A 3RWHB 5I66A 3NFNB 3BZEB 3IDYC 2X05A 3TFKC 1MELA 1JN6A 2A9MH 4R90H 3VI4E 1QBML 4M6ML 5SWQA 4OZHF 1FBIH 2Y5TB 3SDXF 3B2UD 4EN3B 1XF3A 1YC8A 2IWGA 3QHFL 4LPTA 2PXYD 4M03A 4OD3L 4X4YB 4KKLC 2OI9B 5CZKA 1QUNA 3OKKB 1C7TA 2CLVA 3MYJB 4JFEB 1XH3A 3GKWH 5CZVL 3VXNB 4H8WH 4YFLF 4TUJA 1ZS8A 4HH8A 4LASL 1JWUB 4PGJA 2VYRE 4EOWH 3I3BA 2HFGL 3V8OA 1H0DB 3DUSA 2EDOA 3BO8A 4O02L 4YR6A 3OMZA 4R26L 4PTUB 3CFKB 3LZFL 3ZHKA 2FGWL 4CJ1A 4NO5A 4KZEL 4U2ZA 3DIFB 4OKVA 1KT2B 3G5YA 1M05A 4UILL 1XIWB 3FO1B 2EKSA 2FR4B 3DYMA 1T0MB 5E6IB 4LLQB 1F11B 4GW4B 4PRID 2V5TA 4PJBA 2AERT 3SE3A 1QNZL 2NY3C 4UDUB 1DN0A 2BHYA 4D0CA 3RI5F 4KROD 1WBYB 4PJ5A 3TO4C 2VDQL 5GGSB 4OCSH 1I9IL 4XXDB 4CVUA 3F65A 4NDMB 5ACZA 4WIQA 1MCCA 4HBCL 5KZCD 3BZ4B 3WLWC 2IPKB 1N8ZB 3FMGH 3PWVA 4QO1A 1QA9A 1B0WA 3BIAX 1NFDE 2VZSA 3CNKA 4XCNA 4WU5B 2CLRB 4DTGH 1ZEAH 2F15A 1EUTA 4LCYA 4DAGL 4F80A 5FDWA 3SO3C 5LGKA 1CLCA 2Z8SA 3CU1A 4K7FA 4HX1B 4LDEB 2FB4L 1E4XH 5E2JA 3BPNC 4JFYA 4UTBH 4G3YL 4WUUD 1OARH 4LBEB 4L8BA 2R39A 3MRIB 1DEDA 3QEGL 4ZFGL 4PJIE 4ORGB 2IANA 4LGRB 5C7XH 2Q8AL 3PQYA 5CCKL 1EAJA 4PB9L 4GG8A 1NAKL 3LKQA 3GSQB 4U6HA 3TF7C 5ADPH 5GGVY 1OOAA 2C4FU 1YZZA 2W60A 4S2SB 3WJLA 3H9SA 5L0QB 4PLKC 4TVPE 1KV3A 3STZA 3N1GC 3WNKA 4X7SL 3FFCB 2X1PA 4P46B 3RVXC 1OCWH 3AU1B 1N7ML 5LJYH 4X9FA 4IJ3B 5CSGA 4JRYA 4PG2C 1A64A 4MXQD 1HSBB 2FBJH 1RIVH 3MRDB 2D7PA 1HIML 2ZCKL 3SDCC 3CH1B 1FVDA 3JV4B 4JPVL 2XACC 3QEQB 4LGSB 1P6AB 4H26B 4Y5XB 1KGCE 4U3HA 3SDAB 3SE9L 3NBNA 1RZ7L 3QUYD 4R2GC 2XYCA 4Z9KB 3VFSA 3T77A 1TETL 2QTEA 2Z4QB 4OFIA 3QWRA 1ZHKB 5ESVA 1UA6H 1WITA 2GK0B 2FIRT 3WL9B 3FKUS 3BPCB 3IRPX 5FGBC 2PYEA 1ZA6B 4XNMA 3MJ9L 1BVKB 4J1UB 4JG1L 3RZCA 1WV7T 5D93C 5EU6D 3TH3T 3AM8A 3WNLA 1I7UA 1BAFH 2HG5A 3HC0A 2R2EA 4YHZH 4CVZA 4HUNB 1ZHBA 2P8LA 4G6MH 4PFEA 5GJTL 1S5HB 3C6SA 4O00A 3BYTA 4HGKC 2O5XH 3LKOA 4OFDA 1CTNA 1T1ZB 4MAYD 5GPRA 3QUMH 3B5HA 4ZTPH 3FZUC 4KY1L 4GRLD 1AGCB 2VXVL 5L88L 1XF2A 4JFFE 1FC1A 1FZMB 2YD2A 3KPNB 1K85A 3RVUD 3SBWA 4P9HH 2O5ZH 4WTXA 5FKAB 1IKNC 1JNLH 4ZS6D 3GSNL 3IJYA 3E6FB 1FNLA 3VXSB 5LQBL 2DQFB 5JO5B 4XPTL 5JPNB 1GZPB 2D7OA 4HG4J 4JG0H 1LO2H 3D0LA 1LEGA 5KVEL 1O0VA 1YN7B 4W81A 1QFWI 4BK5A 2ADJA 4P57A 5EO9A 1FBIL 2AEWA 4AENA 1UJTA 3B2UC 4MHHI 4Y2OA 4MJIB 3LIZL 2P7TB 1MCPH 4Q9QL 1B4RA 3IDGB 4W4OC 4XVJH 4CNIA 5C08D 5CJQH 1U3ZA 3MOBH 5KS9F 4U0RB 3QWOB 3FT3B 4JFPA 1KPRB 4LHUG 1CIUA 5JW4Q 5IB5B 2M1KA 3DMMD 3GMOA 2BNQD 1MLBB 4FRWA 1NUDA 1RURH 3SDDC 3F12B 1DVFB 3VFMA 5E7FA 1VEOA 4X4XB 2A6KB 2G9HA 2NY7H 1QR1B 3UJIH 4R4NC 3V6FA 1K8DA 4OGAC 3ILPA 3FQTB 5IF0B 4FP8L 3QO1B 3GKZA 1MHHB 2GI7A 1DE4A 2CXGA 5KW9L 3CMOL 3MUZ1 2EIDA 4PGEB 4QOKB 1C5CL 4XMLH 2BNRD 2QSCL 3HAEB 4KQ4H 4X6DE 3RX7A 1KCSH 2FX8L 3ARGB 1HHIA 1D5MA 1IVLA 4ETQB 3SCMA 5DD5H 3KPMB 3QZWG 2A74B 3KPSD 1WBZB 1SEBA 3S96A 1MOEA 4KROC 5GGUB 4L4TE 4GS7B 3ZHLA 3DSFL 4OUUA 1BQSA 1PX4A 3ESVF 4I0KA 3WBDA 3UJTL 3FMGL 5IHZB 4Q7DA 3D1MC 3MRJB 1OTSD 4DTGL 4YHIB 2DLTA 4JRXE 1PKQB 2HT4D 3FQXB 3PDOB 5HD8C 5HHNA 3QDMA 1YN6A 2YRPA 1RIHH 3U0TA 3LCYA 4GG6B 2UVEA 2BSSA 4QRSB 1TDQA 4TUOA 1E4XL 3QIBA 1I1YB 2DN7A 2ESVD 4AM0B 1I9RL 4TSCL 5BMFL 3EDJA 5MERB 3BXNB 4MA7L 4A6YH 1QLEL 2HVJA 4TVSa 1EFXA 1GHFH 4XPAL 3MRGA 4LAQL 2YUZA 4WNQB 3R8BB 1W72B 2VZOA 3ARWA 3UO1H 2HN7B 5F7EH 2BDNL 1MCFA 2H9GB 1FL5A 2ZJSH 3WLBB 1JPFB 3CX2A 3QSKB 4U1NA 1WGOA 4PS4L 4L8CB 1CXKA 5H37G 1KG0A 1QRND 3GJFK 3UMTA 3RWFA 5L2JA 3PGDB 4IOIA 5HHXH 4ZUUB 4NP4L 3MO1B 1CGSL 2FBJL 3SDXE 2B5IC 3GB7A 1KCUH 4Y19B 5BO1H 5C0RH 2OSLB 4HT1L 3LPFA 3T0EE 5J9PA 2YSSA 4M1DH 4QRTB 4I77H 1CDJA 5CILL 4UTAL 3QUYC 1SJEA 2LVEA 1N5AB 3TO4A 1AE6L 1BPVA 1A4KA 1O5DT 4KKBC 4I1NB 2VQUA 3MLUH 1C08B 4HWZA 4NCC1 1KTLB 1OAZH 3DX8B 5IW1B 1OAUL 2X89D 4PREB 4M8VA 4N8CH 4XP6L 4LLAA 2X4UB 2HWZH 1HHGA 2X4PB 3EGSA 3O9WB 1U91A 4AEIL 3H9YA 4RFEA 5T1KB 4YHZL 1FH5H 4G6ML 1CLYH 2IADB 3VXRD 4U05A 4HKBB 1NC4A 1GL4B 1NUGA 1XGYL 4QHNA 3I75B 4PJ7A 4X99A 1QVOA 2XKNB 4LPYA 4UU9B 3QCUH 1ZVYA 4X7TA 2DTMH 4YDVB 5BRZE 4X6EB 4QRPE 2KL6A 3UTZB 1G7QA 4EBQH 1TQCB 3UTSA 3TNMB 2HTKD 3NIGE 3DVIA 4YNYB 5C0IB 3QHZH 3MRKB 1FYTE 5C0AD 4WTZG 1RHHB 5FGRA 4EI5B 2XQBH 1CE1H 4PJFF 4JG0L 4P2RE 4H1LH 1LO2L 3UTTB 2BVEA 1WUNT 2C4XA 3SKMA 3HZMB 1UXWA 5T1LD 1MIML 1DTUA 2EXYC 2P5WE 1SMAA 2VLJD 4NQDA 4P59L 3RPIA 9CGTA 1FV1B 4PG2A 3D69B 3CC5A 4NNXB 4NQVA 3T0DA 1KCRH 4OTXL 3S7GA 3SDCA 2ITCA 4XVJL 2DICA 1FQ9C 1GOGA 3GMLB 2Q8BH 4JJ5B 4Q9RL 5F7KC 3KNBA 4KVNL 4LCWD 4TYUA 5DUPL 1LO3L 3ZTJH 2LQRA 3W0WB 3MLPA 5I1DB 1AD9A 1NEZA 3DMMC 4PJAB 3GK8L 1IAII 1BZ9B 5DMKA 2FO4B 1CFSA 2YN3A 2ENYA 2CO7B 3RUGF 5J56B 1R3KB 1BM3H 2IFGA 4JZOA 4P2QA 2LABA 1RUMH 3IAPA 4PRHD 5FGBA 5I66B 3MGAA 1L4IA 1JN6B 1I7RA 2XN9D 3U1SH 5IJKA 2NY2B 5SWQB 4L5FL 1J1XH 1J88A 5I1EH 4YHYB 3L7EA 4AIZA 1XF3B 2V7NB 3CLEL 4E42A 4PYHA 2DLEA 4HUXA 5DD5L 1MSPA 3RL1A 3ABZA 3VRLE 1HH9A 1CD1A 3KGRA 1A6WL 3IDXL 4LEXH 1YEKL 4FOMA 5EWIL 3D3VE 4O5LH 4OGYH 1XH3B 3DO7A 1A6VL 3BQUD 3GDBA 2IAMC 3QXAA 4HBQA 2GK2A 4QHLA 1MRCH 4TUJB 3DI2B 4XWGL 4CADA 3KPQA 1IKNA 1HINH 2CIKA 4LP4A 5CIPA 3LN5A 1OTSC 3VG9B 2XTJD 2NY5L 3DUSB 3BO8B 4CGTA 2C4FT 4YR6B 5B21A 1UWGH 4NO5B 5D7KD 4ELMA 1U8JB 4OKVB 1JTOA 1YMMA 3G5YB 1M05B 4TPRH 4MNGE 2EKSB 2AJSL 2R23A 4H88L 5IB2A 2DKUA 4G8GA 2B1AL 1E4JA 3BKMH 4QHMA 4PJBB 1OAQH 1DN0B 4D0CB 5TFSH 5IESH 4XMKL 3MJ9A 4ZSOA 3VD5A 4QRRE 1SY6L 4HUKB 5BV7L 3EYSL 5ACZB 4K3EH 4G6KH 4OZFG 3VWKD 1RZ8A 2VIRA 1P84J 3PWVB 4PPTA 5K59E 1QA9B 2UVFA 1KBGL 3B3IA 1A7RL 4XCNB 1FDLL 4O2CA 3SDDA 4GOSA 3GSXA 1G7JA 2GW5A 2EDYA 1UKQA 4XAWH 3ULVH 4S11A 1MCOH 1KXVC 2EYTA 2M2DA 1JBJA 3IFPA 2R2HA 5GS0H 4K7FB 4RWHA 1H8SA 4JFYB 4JQIH 4EDXA 4L8BB 1LO4H 1KCUL 5I8CA 4M9PA 1Z9OA 4FG6C 4WHTA 1B2WH 2YD6A 4E41D 1W8NA 2NY5C 4I77L 1V3JA 3PQYB 2FWOA 1JRHI 4GG8B 4MAUL 1WAAA 1T2QL 3LKQB 2VLME 4U6HB 2E9IA 2XXMB 4M7KH 2J5LC 2W60B 3H9SB 1VERA 3PHSA 3AS3A 3STZB 1CU4H 3MLUL 1S9XB 3MPCA 1OAZL 2JB6B 2XQYK 3X14A 4Z78B 4XI5D 4LRNL 3ZTNL 1Y6MR 4HFUH 3VD7A 2LFGA 3HMWH 5GRXG 3H6JA 4JRYB 5BV7C 1P69B 3VD4A 1CLYL 4AY0A 5CFHA 3P0VH 3VXQA 3QFJD 4RCAA 2EDFA 2DQUH 1N5YL 2HAZA 2EC8A 1FVDB 2AW2A 2H8PA 4N9GA 1UENA 1IM3A 3O8XA 3QCUL 3QFDA 3ARPA 4XPFH 5D2NE 2EXWC 3ULVD 4KK6D 3BKJL 3SJVE 5IMOA 4EBQL 5DD3L 3QUXC 4LARH 4XNXH 3VFSB 3A67H 3T77B 5GS0D 3QNYA 4L8SC 2YPKA 4Y5VC 2HTKC 3DNKA 1YEEH 1BECA 5ESVB 1N2RA 3KPRE 5DRZA 2PYEB 4CRPA 4XNMB 3RZCB 4LAJH 3VFUA 3TIEA 1I7UB 1PLGL 2HG5B 1WJ3A 3OB8A 3HC0B 5DO2C 5A43C 2R2EB 1L0QA 4CVZB 2YC1A 2P8LB 2WAHA 4MNQA 1RU9H 3C6SB 4F57H 1GJIA 2R4RH 1DBKH 3LKOB 1AO7D 4IM8A 3HI5L 4G9FD 2BK8A 3FO9A 3KHQA 1KCRL 4M00A 3TEUA 2YZ1A 4GKNA 1XF2B 4NQTA 4BK4A 1Z2KA 1MUJA 1CGWA 3GSUA 4YE4H 5DFVD 1P7QD 4PP2A 4RX4D 4V2CB 2HT2D 3QUYA 4LPCA 3Q5OA 1GOHA 1F3DJ 2VXSH 2VZ3A 3PJSA 3GHEL 3IJYB 1WTLA 4O2EA 4XVUC 5CINL 4YHMH 5C09A 3PWPE 1HHHA 1BQHG 5CSBA 2HFEA 5I1IH 4M1CD 5E2VH 4AEHH 1QFWH 4DK3A 1EO7A 3NFPA 1E6JL 3OAZK 3D0LB 1G9EA 3QG7L 2FZ3A 3AMKA 1LEGB 5JIHA 4TSAL 2D2OA 4NPYA 4GRWE 2ADJB 1S7XA 4P57B 1FGVL 1GYAA 5EO9B 1F3JA 1J5OH 4KK9D 1GRWA 1J1XL 4AENB 4J6RH 4KDWA 3REVA 4G7YH 3W9DA 1J8HD 3RZWA 3CX5K 1GC1H 3VWJD 3WSQH 1G1CA 3CVHH 4CNIB 4UT7L 5DEZA 3FN9A 3RY5A 4JQXC 1EMTH 4KH2A 4ALAH 4JFPB 1CWVA 3KJ6L 3BQUC 1EO8H 1ZWIA 2FJHA 2NZIA 3FB8A 3GMOB 3CZFA 4PJXE 4Y8AA 3VMOA 2B1HH 3VFMB 1X5XA 1YYMH 4EUPA 5ANME 4QNPF 2G9HB 3V6FB 1K8DB 4Q2ZA 1KCLA 5DQDL 2WINA 2XTJC 3ILPB 2X42A 1OP3K 4KTEL 4QGTA 5IWLC 5C0EA 1IE5A 5MENA 1DE4B 4WFEE 2DMKA 4BSVA 2BXZA 2YRZA 1IC4H 4TPRL 3EZJB 2JF1A 3H42H 3RBGA 3UDWC 3LH2L 4XNQA 1HHIB 2NY6C 2K9UA 2V5RA 4PJCA 1D5MB 4GW1A 3SCMB 3BKML 3OF6A 5AUMA 1OAQL 1NCWH 5C0CD 1SEBB 4KTDH 3S96B 4WEBH 1MJUH 4DK6A 2ZOLA 3FFDA 3HC4H 2Y9RT 4OUUB 4K7PY 5SWZE 4G6KL 1DQMH 4HKJA 1F8TH 3NFSL 2A6DA 1JF1A 1WZKA 4WW2C 4JFZH 4MA1B 4JLRA 4L3ED 4QLRA 3EJZD 2YD1A 5AZEH 5HHNB 1E4KC 3NTCH 3QDMB 1YN6B 4JCLA 5J12C 3U0TB 3P4OA 4X4ZA 3IDYB 5GS0L 3V4VH 1KJ3L 2BSSB 1T20A 5EO0A 3T2OA 4TUOB 3FB5A 3QIBB 3O4LD 3EOAA 5EORH 1MH5A 5HXMA 1LO4L 1UB5A 4CMMA 3S88L 4WI2A 1B2WL 1I7ZA 1CVRA 2H45A 5D6DA 2R56H 2W9EH 4WFGD 2HVJB 5TDPA 1BHGA 4N0UE 4I9WD 1EFXB 4BH8A 3X17A 4J3WA 3MRGB 3BH9A 4Z76A 3QAZC 4XMPH 1INDH 5DR5L 4RISL 1Z9LA 2VN7A 4M7KL 2IAMA 4ZS7H 4HWEH 2PNDA 4JO3H 3D85D 5A2KH 1FL5B 4X4MA 1LK2A 2DQHH 4XI5C 3S37L 1EBAA 1KG0B 1YEJH 5JA8B 3P9MA 1G0XA 3QH3A 2AJUH 5EOQL 4UV7L 3RWFB 4JCMA 4WWID 5IBLD 1V7NL 5L2JB 1CDGA 3UPAA 4IOIB 5DHYA 4LSSH 1ZOXA 4WO4D 3AROA 3GB7B 3PWLA 1NGWA 5C07A 3U4BH 4OM1L 4S1QH 3MUY1 3GBNH 4KJWD 4RGMB 4Z7OE 5CEYA 5C0FB 5J9PB 2YSSB 4NM8L 3MUHL 4Z7VE 1NCTA 4XPFL 4RMWA 5CZXD 2NY3B 1GSMA 3ULSA 4Z95L 1SJEB 3HNVL 5HPMA 3TO4B 1TNMA 2DM2A 4LARL 1I8IA 1G7PA 5GS0C 4K8RH 4NBYB 4YQXH 2DLIA 4PJEF 3ULUE 4RA3A 1DQDH 4M3JA 4MA3A 4O2FA 4HWZB 3QUKA 3DXAA 3DETC 1T5XA 1NGQL 2OS7A 1KLFA 4RIRA 3EGSB 1U91B 3SO3B 2EE6A 4RFEB 4U1HA 1A47A 4UOW1 1MQKH 2XKSA 2P5EE 1NC4B 4YBLC 4UBDC 1D5IL 4QHNB 3BPNB 1I8MA 3THMH 4PJ7B 4X99B 1QVOB 1XGQB 1NBZB 1I3GH 1WEJL 4X7TB 2KPNA 5HI4C 3PWNA 1Q72H 2IBZY 3KPPA 4FQXA 5E9DE 1G7QB 3S3SA 3RWJA 3UTSB 4APQD 1BFVH 1MFDH 5DFVC 2XOTA 3NA9L 4NQXA 3PL6D 2VDPH 1BZ7A 2VXSL 5FCUH 2OCFD 3NZ8A 5DC0A 4HV8A 4TVPH 1SVZA 1Q0XL 3RGVD 2QADD 1QFWL 1IGFH 1Z3GH 4PBWD 3SKMB 2YMXL 3MGTA 1ZVHA 1RFDL 4NQDB 3RPIB 1SY6A 3RA7L 3MJ8A 4K8RD 2QSTA 1J5OL 3CC5B 1M1SA 4NQVB 5KANG 4S0TD 3BAEL 1VA9A 5A2JH 5FO9A 1GC1L 3SQOH 5EO1A 1K6QL 4NC2B 3SDCB 3ZE1F 2ITCB 3WFEL 1TJHH 4DGYH 1MRDL 5I1AA 4ALAL 1BMGA 1WC7A 2YK1H 5GGSY 4Y1AE 1IAIH 3CFCH 4OSUL 4R2GB 3QUXA 1AD9B 1NEZB 3JWDH 2A1WH 2BY2A 2FYYA 3H3BC 4J4PD 4L8SA 5DMKB 2PR4H 2R8SH 1AGFA 3ECBA 1CFSB 3I50L 4DKEH 2QHLA 3RTQC 1N0LA 4DW2L 2J6EL 4JZOB 4P2QB 4PGCA 3VMPA 2CJUH 1U3HD 2OTUA 2UY7A 3ET9F 3QWQB 4XP5H 4AT6A 3BSZH 4DQOL 1BD2E 3G6JE 3LKNA 4WU7A 2EH8H 3MLZL 5F6IC 3LHPH 3L7EB 3PHOA 4AIZB 3H42L 4HXBH 4E42B 4TVPD 3Q2CA 2B4CH 4HUXB 2FEEI 2CKBH 4KDTA 3RL1B 5ITBH 1F4WL 1HH9B 1CD1B 1OSPL 4KTDL 1CLZH 1MJUL 12E8H 3MJGX 2IFFH 4MS8D 3DO7B 5D1ZC 3WFDH 3QXAB 5DFTA 4D0BA 4LCWA 5KTEL 4QHLB 2ZUQC 3GO1H 5BS0E 1F8TL 2IPTH 2PTTA 5D7LE 3KPQB 4CADB 2CIKB 3V5KA 4D9RE 5A16B 1YEFH 3OGOE 5CIPB 3GUTA 1GC1C 3LN5B 2FEDC 2HKFH 3TVMD 4P4KD 3EJZC 5F7UA 4ELMB 3JVGC 4L1DA 2UZIH 3HUJB 1KGCD 4D9QE 4CVWA 3T4YA 2O93L 1YMMB 2X4RB 3JV6A 3HMXH 1KCVL 1WIUA 3WD5L 4F15C 2R23B 3NVQA 5JDSA 4U2YA 5IB2B 4G8GB 1BX2B 3UROR 4QHMB 5ICZA 4GQ9L 5E0QA 1P53A 2ORBH 4ZSOB 3B9DA 3UPCA 4OCXL 1PZ5A 4FQHA 1EHLL 4ZFZA 2JCCE 2WIIA 3V52H 1RZ8B 2VIRB 5BZDA 4PRDA 2D4DA 2AEIT 3WJJC 5D96C 4OT1H 4HWEL 3B3IB 1VGKA 3ZKQD 1AH1A 3T0BA 3FT2A 1QQDB 3DUHA 4O2CB 3SDDB 3Q3GA 3GSXB 3L5JA 4HK3N 1KFAL 3DWTA 1KEGH 4W70A 3HN3A 3MV11 3T1WA 1G9ML 2EYTB 3BI9X 4PJHE 2AJUL 3IFPB 2R2HB 4LKXA 2VB5A 4JFFD 2OL3A 4LSRH 1J0JA 4LSSL 1RZJL 2YOCA 4XB7A 1ORSA 2HKHH 4OF3A 4EDXB 5I8CB 3U4BL 5D1XC 4S1QL 4WHTB 3UDWA 1JRHH 1QP1A 1YNKH 5HHOE 4AG4H 3ME0A 1JNJA 3KYMA 4LMQI 2FWOB 2R9HC 4YXHH 1T7WA 3ARXA 4KROB 1F4YH 5LGHL 5ETUA 1YPZE 5ESAA 1YMHA 4GSDH 5SWSE 1DQDL 4YDIH 4JFDE 5IEHA 1JJUA 4KGLA 3X14B 1DFBL 4WW2A 4TTDD 4N8PA 1SM3H 3KS0H 2M8XA 4NSKA 2DMBA 1T0PB 5DHVA 5DK0A 3BGAA 3R1GH 5D5MA 1D5ZA 3I84A 3SGKA 3VXQB 1K4DA 5C6PB 3KXFA 5T1DL 2H2PD 2B20A 2H8PB 3THML 4N9GB 3OKYA 2CR6A 1IM3B 2ZWLT 3QFDB 1A6ZA 3ZDZF 3DUUA 2UZYB 1Q72L 5J1TC 1NMAH 1A22B 2NY1D 1G9MC 3BOVA 5IMOB 1KPUA 5E2TH 1BFVL 3QNYB 2YPKB 4GAFB 4ZPTA 4D94A 1TTUA 3PL6C 3BT2H 1BWMA 1RZJC 4EJ1C 5FCUL 3IKKA 3WHE0 3I85A 4NRXA 5D2LB 1N2RB 2D4FA 5JZ7D 1BJ1H 4XC3H 1HILA 3NIFF 3RGVC 1CK0L 1NCDH 1Z3GL 3RJDA 3V79C 1S7RA 3GIZH 5E2WL 1SJHB 3TIEB 1CFVL 4LLVA 5TQ2H 3MV9A 2F9BT 3LN9A 3F6IA 1EGJL 2NXZD 4L4TD 2YC1B 4U7MA 4ZG1A 4AIXA 3QPQD 5T3XE 5J3HD 4J2XA 1EBPA 3P9LA 4HAFA 3QUZC 2DYPD 4LVEA 3PP4H 2B5IB 3FO9B 1UM4H 2W0FA 2Y7QA 4K3JH 1VDGA 1WFUA 3QXVA 1ZE3C 4OF5A 4JRXD 5HDOA 4GKNB 4XCFL 1UZ6E 3S4SA 4DGYL 3GJFH 4PRAA 4X6FA 5HI5D 5HYJE 1MUJB 3GSUB 3T3ME 4PP2B 3QUYB 3PJSB 5AYUL 2A1WL 4J4PC 3EOBA 1BQUA 4O2EB 5C09B 1HHHB 3QCTL 2HFEB 2MMXA 3DVNA 1JGUH 3NFPB 1TNNA 3U36A 4KRNA 2FZ3B 1U3HC 3EO9H 1JK8A 4NPYB 1J1PH 1MCRA 5DJCA 5FF6A 2Z0BA 3BHBA 1S7XB 2QSVA 4X8XA 4UT9L 1F3JB 1NFKA 1UGNA 3BGFB 2EH8L 3MX0A 2BRQA 2EO1A 5FM5O 5E2UH 5I15L 3W9DB 2Y1VA 2DM7A 2OXHA 1ZHLB 2B4CL 2CUHA 2W0LA 2PW2A 2CKBL 5IFHH 2GJ6A 1MHPL 1G6RL 3HC3L 1VKXA 3UTPE 2IFFL 2HJLA 2FX9H 3PUCA 3WFDL 1CBVH 1ZWIB 2FJHB 3S35X 2YD9A 3FB8B 3P40A 3CZFB 2EDRA 2VLKA 5DRXA 4Z7WA 4EUPB 4S1RL 5DJZA 5IKCA 1ADQH 4ZMAT 4Q2ZB 5C9JA 1NCUA 2WINB 3MNWA 2MTPA 1JPSL 1QSEE 3T0ED 2R15A 5C0EB 3IU3A 1XGRA 5EUOA 3B8YA 2VDLH 4BSVB 1MCHA 3HMXL 3MOAL 1UACL 2CXKA 4H1LG 1S7TA 2ID5A 4LQFL 4ZNEA 1ACYH 4GW1B 3QQ9C 2EDBA 1I1AD 4DOHE 2FHBA 5ITFA 4JY5L 3FONA 5AUMB 4XNUL 1N64L 3PHQB 1R5VA 4NQSA 2ZOLB 3FFDB 3HNSH 3P4LA 1TPXC 5EBMA 1PZUB 1AC0A 4ZXBD 3V52L 1KN4H 4HKJB 4OIIH 1R3LA 5IVZA 1U58A 2YWYA 2GFBA 1B6DA 1OVZA 2A6DB 3PDDA 3DMMB 1JF1B 2DRUA 4ORZC 4LF3B 3WS3A 5CLWA 2B4CC 2B7DT 3KJ4C 4JLRB 4PGDA 1JI2A 3RTQA 1KEGL 3ZTJG 2CPCA 2UWEA 3L5XH 2V17H 2VDNH 5BRZD 4AYFA 3P4OB 4QRPD 4M3KB 3O6FD 4W6YB 4LSRL 1T20B 5EO0B 2F54A 3EOAB 4HDIA 1MH5B 1HWGB 1UB5B 4CMMB 1FYTD 3NIDE 4WUKH 3HA0A 5JQHC 1I7ZB 2DQEH 3VFNA 1IGTB 5DD0L 4D0DA 4RWYH 4GKSA 5TDPB 2VAJA 5DA4A 4P2RD 4BH8B 2APBA 3BH9B 1CI5A 3CSBA 1MI5E 3AS0A 2P5WD 3HUJF 5F97E 5D1ZA 4DZ8A 2IAMB 1ITCA 5MP6H 4GSDL 4BSJA 5C3LD 3WNNA 2B39A 3N85L 1LK2B 1LDSA 4TTDC 4MXVF 5D7JC 5CKAA 3P9MB 4NKMA 3QH3B 2F8XC 4L3EA 4BJLA 1WBXA 1RUPH 2DF3A 5C86A 5DHYB 3JVGA 4HHAA 4DVRH 4BM7A 1RZKL 2MPAL 3A6CL 5IR1A 5E4IA 5FA4A 5DJYA 1AGEA 1SEQL 1MFNA 3PWLB 4NKOA 4U1GB 5C07B 3KLAA 2JJVA 2NXYD 3NACH 3B9KA 5CEYB 3F7PC 4YBQC 2AQ2A 1W2KT 4LVHC 5HDLA 3QI9A 1AQKH 3GNML 2J6EA 2MCPH 4ZAKD 3ULSB 2NY1C 1CXEA 2NY0D 5HPMB 3MLYH 1I8IB 1G7PB 2AJYH 2V7HA 4R8WL 4WWKD 1RV6X 3V6ZA 5I17A 1GGCH 4MA3B 3MRLA 2FHFA 4O2FB 1NFIA 1J12A 3QUKB 5JZ7C 4I0PA 4XC3L 3QXWA 4YDKH 3DXAB 1C7SA 1T5XB 3D85A 2GAZA 3JTTB 4RIRB 4U1HB 5HGDA 3D3VD 3QPQC 5J3HC 5KVGH 4JGMA 3WV0A 5F9OL 1I8MB 4JFXA 4OZIE 1P6FA 5F7LB 3C5ZD 4UT6H 4K3JL 3C08H 1IFHL 5D1XA 3KPPB 2QSQA 4LSUH 4LU5H 5HYIA 1A7PH 3RWJB 2JJSC 2ENSA 5HI5C 1WLHA 4NQXB 1OP5K 1K3ZA 2I26N 1BZ7B 1RZKC 3OGCA 3NZ8B 4HV8B 2J5LB 1OTTD 1JGUL 1YNLL 4A2MA 4EQ2A 4ZD3H 2ZUUA 4JZNA 4F37F 5TH2A 3MGTB 3V6BR 3WUWA 1OT1A 1F4HA 4QRRD 3MJ8B 1ZANL 5BV7B 1AGBA 3HE7D 1ZXQA 1W0VA 4JPKH 1IGCH 4Y5YA 5FO9B 5E1AB 5B38G 1X4XA 2DLFL 1ES0A 3T2NH 1S9YA 5IFHL 2NX5A 4XPBL 5I1AB 1WC7B 1DBJH 25C8L 4OD1L 3ZKXB 3QUXB 4LLMA 2FYYB 4L8SB 1AGDA 2KDGA 1AGFB 4MSWA 3ECBB 3PL6A 4PJDA 4U33A 3IAGC 4HMDA 4PD4J 4Y4HD 2AXGA 4PGCB 2OTUB 3MV01 3S36L 4AT6B 4JR9L 4P99A 3KG5A 1R24A 5FO8A 3VCLA 2X1QA 3LKNB 3PV6B 4OCNC 1FNSL 4WU7B 2VDLL 3R06A 5F7NC 1FNEA 3TWCH 5F96L 2VLMD 3X13A 3PHOB 4G8EA 3HB3C 2EDNA 3ZKMC 3QRGL 5IOPA 3QUZA 4XBGA 3RL2A 1G7HA 1NMBH 4X0KA 4DCQA 3U0PA 1YEGH 4ERSH 5DI8A 4RGOH 4PJ8C 4AMKH 3CVIH 5JW4N 3ALPA 4LCWB 4ZFOL 5E7BA 3INUH 4OIIL 3L1OL 2PTTB 1KYOK 3LEVL 4X9IA 5ISZA 3TCXA 1I75A 3VRJA 4W4NA 3V5KB 1WF5A 5KSAD 1YEIL 4J4PA 3GUTB 4I18C 3LB6D 4MLIA 5CGTA 3FN0H 4M7LH 1FC2D 3ZMRA 1UWXH 4PJIA 3IYLW 4KMQA 3T4YB 1U93A 3SJVD 4GRWH 3JV6B 1PVHA 1T83C 4LVOB 5JHDE 3V7AE 3UJJH 1VESA 2AVGA 4NJ9H 5JDSB 3FQWA 4FQLH 3TYGL 2DQEL 3KPRD 3OAZH 5ICZB 4YDJA 5JIIA 4MHHG 4LVNC 4P3CL 4I4WA 2EC9U 2GYSA 4BFIA 3ARYA 1PZ5B 2XG5A 3MR9A 4FQHB 4ZFZB 2WIIB 2I60H 5BZDB 5HYSG 4PRDB 1I9JH 3C6LD 1EGJA 2YEZA 2XZZA 3FRPA 5AZ2H 4F3FA 3LS5L 2EE2A 1QKZH 1Y0LA 1VGKB 4RFOH 1FHGA 3EYQC 5MP6L 3FT2B 4RMVA 4NWUL 5F6HJ 4P2YA 3TJEH 3Q3GB 2KQMA 4Q9CA 5IVOA 3L3DA 2F8VA 1SHMA 2YN5A 4LDOB 4NO2A 4V1DE 4DEPC 1DP0A 4LKXB 1MJ8H 2OL3B 3Q5YA 5DJ6A 3IXTA 4RZCA 5D4QA 2X4QA 1ORSB 3QA3A 1UXSA 3P0YL 4K7PL 4K7PX 2F58L 4RRPA 2YPVL 1AFVL 4FQIH 3PWPD 4YZFE 1PSKH 1WZMA 2A9NH 2NY6B 4XHJD 4P2CG 4Y16C 1OP3H 3VXME 4HFWA 4UUJA 4XCEA 1AQKL 4ZAKC 4B7LA 3WUZA 2NY0C 4EIZC 1IC7L 4MCYA 3MLYL 1FORL 4UV4H 5ETUB 2LAAA 2P42B 4H20H 4WWKC 1YMHB 5ESAB 4J3SA 4MQXD 4KZDH 3V6OE 5GGRA 3D48R 4H0HB 4JKMA 3TV3L 5IEHB 4GXUN 1BEYL 3ARDD 3WO3B 3SGDI 3KPTA 4WW2B 3DHJA 4MMXC 5F8RC 3SE4C 2ICWJ 4NSKB 5C3TA 4AL8H 1C1EH 1E28B 5DHVB 1HYSD 1S3KL 5DK0B 5J12B 1G6RA 5D5MB 1D5ZB 1OW0C 2AXJA 1K4DB 1Z9SA 3KXFB 1NLDL 1UC6A 4WCYH 1LILA 3C5ZC 3PGCB 1A6ZB 3C08L 3G04A 3DUUB 4EIGB 2DOCA 1OHQA 1TTGA 3ETBF 1FO0A 2MQ0A 1MCNA 4YFEA 3T0AA 1KPUB 4NO0D 1WZLA 2GSGA 4OQTA 3L3GA 4ZPTB 5EU4A 1NANI 4WFED 1P4IH 4PBVC 5H2BA 4FA8A 3RAJH 1OGAA 2HRPH 4NRXB 3BVNA 4PY8I 2E7LC 2H2SC 2PO6D 3BKYH 3LKRA 2XKUA 1HILB 4LPWA 4N1EA 4P9MH 1LP9A 3TJHC 1CDUA 4MQ7A 1S7RB 5KN5B 4LLVB 3MV9B 4UB0H 5D7JA 1K2DA 2D7TH 1UZ8A 1MAML 1MAJA 1PG7L 3MNZA 4JRWA 4OLXH 3CIQA 3L5WA 1PG7X 5SWZD 3P9LB 3JBG7 3HE7C 4JPKL 5C0BA 4PLNC 4OV5A 1G7MA 2VLLA 2X09A 3QFJB 2W0FB 2Y7QB 4UMGA 1HSAA 1J0KA 4HEPG 1MY7A 3T2NL 3PIQA 3S4SB 4RMSA 4IRSA 4OIAA 4FZEL 3BPOC 4PRAB 4X6FB 2W0PA 1HH6B 5EDXA 3DPBA 4K9EL 4ODTH 5IIEA 4KV5E 3S9DB 3LKSA 3EOBB 4JFEE 5T5FH 2DQGH 3LRGA 3ULUH 3N06B 3DVNB 4NZUH 5KAQF 3U36B 2H32A 3LEYH 4IIQC 4BZ1H 2G2RA 1KB5L 3BYYA 3WXVL 1JK8B 5IW3A 2E5EA 4IRZL 5J1SC 2FO1A 3MV8E 5DJCB 5FF6B 3BHBB 4CL7A 5D1QD 2IBZX 2EO9A 3QT2A 3WDHA 5HDBE 1JPTL 2FEEL 1DBBH 1DQJA 4I8DA 2MNUA 2DYPA 5D7IF 2PW2B 2WW8A 1FNGA 2EYSA 1JF6A 2V5MA 3M07A 2GJ6B 4DVBA 1MCKA 5IVXA 4ODHH 1VKXB 3AREC 5BVPL 4YXKL 5CD5D 1TCRA 2HJLB 4JRXA 2IGFH 3RDTA 1Z6JT 4Q0XL 5B38B 5ECJE 1GGBH 3VGGA 1P7QB 2VLKB 6FABH 1BBDL 5DRXB 4WTWA 1AR2A 4PP1D 4Z7WB 2F53A 2E8ZA 1JZ7A 2WBJC 5DJZB 5IKCB 1QPXA 4PR5A 1AY1L 3A0OA 3LB6C 5C9JB 2VNCA 3MNWB 2AABH 2CRIA 3FN0L 2E9JA 2GKIA 1BF8A 1JP5A 5D2NC 1XGRB 5EUOB 4ODVH 4FABH 4KKCD 4K9EC 4CDGC 1WVZA 4NJ9L 1S7TB 3ULUD 4FQLL 3EOYG 2E7HA 2NTSP 5ITFB 3FONB 4HWBL 1R5VB 4NQSB 3CXHK 1L7TH 4GW5A 1UM5L 3WIHA 5EBMB 3ZDXF 2QQNL 1Q9OA 3ZO0A 1CF8H 2I60L 1JPGA 1RUKH 1R3LB 5IVZB 1U58B 1MRFH 4FNLH 2GFBB 1DSFL 4RFOL 2P5ED 1XCQA 2Z8RA 3WS3B 4OZHA 4PGDB 5C0JA 2JB5H 3T3PF 3SDXA 3RTQB 3JWNC 1N6QH 3OAYK 2UWEB 1UQSB 5E9DD 3FFCE 3MGOA 3O45A 1MJ8L 2F54B 2MKWA 1TZHA 3G08A 4HDIB 5JXAH 2C9AA 3RIAF 1MWAA 3W2DH 3LMJL 4N68A 2VL5A 1IGIL 3VFNB 2CMRH 3VFGL 4P23A 4XHJC 2ZUVA 3VI3F 2ZCLH 4D0DB 2O61A 4GKSB 2WWMD 2GHWB 4YHPA 1JZ2A 5I1JH 2Q6WA 3QEQE 4PJ8A 4UV4L 1IILE 3UBXI 5D1ZB 1M7DA 1A6PA 4DZ8B 4KZDL 2DQJL 5GHWH 1IAKA 1C12A 2OZ4L 1J0IA 4JE4B 5IT2H 1RK1A 5F70A 3ARDC 3MZGB 4EXPX 1VB9A 4CMHC 2V6HA 2X4NA 4NKMB 4L3EB 1JL8A 5CEZL 4F7PA 3MRRA 1WBXB 4ZUVA 1J1OH 3AY4C 1OAKL 4HHAB 1J87A 2IBGA 3CZJA 4Y1AD 2RFXA 5IR1B 1FNAA 5FA4B 5DJYB 5E6ZA 1T83A 4NKOB 4JZJC 4L9LC 3KLAB 3MXWH 4F15B 4FQJH 3B9KB 3V0WL 4NQCA 2AK1H 4WCYL 5JOPE 4MZ2A 3PV7A 1HZHH 2E3VA 2UUDK 3QI9B 5CLTA 1KNOA 2P49B 4ZTOL 1NCBH 4FFYL 3UX9B 2V7HB 1BD2D 4NWTL 4M5YL 4KK8D 3HKFA 3IS1X 3OJ2C 4JN1L 3V6ZB 3RAJL 5I17B 3K0WA 3QJHA 1EO5A 3MRLB 1TZGL 43CAA 3BKYL 1NFIB 4MJ5A 4MB3A 5D96B 2W9DH 3C87A 1DEEA 3KR3H 5GRVK 2FD6L 3D85B 4XPGH 1GGIH 4R97C 1NAMH 3VXSE 2WBKA 1P7KA 5FUCC 1EJOH 5HGDB 3MRMA 2D7TL 4OLXL 2FSEA 1TTFA 1JF5A 2GY7B 5E08L 2ED9A 3BP4A 1QSFA 4K3DL 3RU8H 3HRPA 4JFXB 4ZFOA 2EDTA 4Y4KD 5BS0D 2DQDL 2J8UF 5D7LD 3G5ZA 4D9RD 5D1XB 3QDJA 3UC0H 5ALCH 3NCEB 2DLHA 4OI8A 4MJIE 4NQEE 4Y16A 3ZSSA 2QQQA 1C16A 1RJCA 1MVFA 2ITDA 4ZAKA 3LDBC 3PXJA 1RJLB 4D9QD 1FPTH 5HGHB 5L2KA 2VABA 3OGCB 4JDTL 5JQ6H 4A2LA 2A83A 4HZAA 4L4JA 1NGYA 4UIKH 1D5BA 3E3QC 5JXEA 2VTFA 1NL0H 3EDKA 4EKXA 5CP7A 5TH2B 5M7QA 3WUWB 3OJVC 4ISVA 3NCYS 2A6IA 4KVCH 3K7UA 4O58H 5DMGD 1AGBB 4XB8A 2LTQC 1W0VB 5ACMA 2JIXD 1JFQH 5DEFA 1LDPL 1DBBL 1HQRA 4Y5YB 1FRGL 3O6KH 4TULH 4M93C 3VH8G 2IG2H 1ES0B 2BX5A 1GVIA 1XR9A 2VR5A 1S9YB 2WWKT 4JEGB 4XBEL 2NX5B 3E8UL 3BWAA 2ZG3A 2N7AA 4QF1A 5IBTL 3VGEA 5CD5C 1A3QA 2IGFL 4LLUA 3JSSA 1MF2H 4YDLB 3P3YA 1WTGT 1KIUA 4F7MA 4NNYA 1AGDB 4MSWB 3PL6B 3UTQA 4PJDB 2L7UA 2EDQA 2EC9T 2E7LA 2AXGB 5LWYH 2DJSA 3I3EA 3OKDA 4YWGH 5IQ7L 4Z0BH 2AJVH 5HHOD 5HVHC 4LSTH 3EIFA 1R24B 4ZO7A 5FO8B 3EO1A 3VCLB 3Q48A 5HYEA 4ODVL 2W9LA 1PKQE 4FABL 3R06B 4NC1E 4NRZA 1FNEB 3ULVF 5DLMH 3X13B 5T3XH 4G8EB 1Q1JH 5E00A 4W6XB 1ZMYA 1RUQH 4ENED 3FHAA 5IOPB 4GG6E 3GFUA 4YLQT 5IMKA 3QUZB 4XBGB 5SWSD 3RL2B 4F7CA 3CSGA 1OWWA 4JFDD 1G7HB 3IDNA 1NFDB 1L7IH 1S9VA 3U0PB 4DCQB 1L7TL 5DI8B 4Z7NE 3VMNA 1RJYA 1MQ8A 3NCMA 4MNHA 3CGTA 3MREA 5MEPA 1NLBH 1RUKL 1LNUA 4FZ8H 5ISZB 3VRJB 2HMIC 3MXVH 2C3GA 3EDEA 4U1KA 1EERB 3TPUA 3ALWA 1B4JH 2YBRB 4IIQA 4YHLL 3MV7E 3U9PL 1U3HB 4PJIB 3GRWA 1YEHL 5J06A 1U93B 4BUGA 3K8MA 4IRJA 5IMMA 3DYPA 1J10A 5KS9A 5JXAL 4YUEH 3FQWB 4X5XA 1S78D 3W2DL 3IB4A 3LRSA 5I8OL 1AXSA 4LRIC 1U9KA 4BKLA 2ZCLL 5KSBF 4I4WB 1UCBL 5SV3A 2WWMC 1YNTA 5DSCA 4Y19E 3VXTA 4OIBA 4BFIB 5I1JL 3MR9B 5HHPA 2Z31D 3AREA 3ZKND 2YEZB 3IJHA 5CWSA 3HI1A 4F3FB 1Y0LB 5T3XD 3WFZA 1OAXH 4M7JL 4DN4L 2ICES 4KI5E 3L3DB 5ELIA 2WBJA 3MOQA 2AKRA 2Q1EA 5F71A 1CICA 4NO2B 1QHPA 2DBLL 1CG9A 1J1OL 5DJ6B 3IXTB 5HYJD 4PJGF 4RZCB 2X4QB 3QA3B 3K8LA 1UXSB 4KAQH 1KXTB 4S0SD 1YYLL 5B3JE 4NFBA 4HF5H 2IQ9L 4FQJL 2Y25A 2APVA 5E03A 1TZIA 4HUWB 5D7IE 4YGAB 1MNUH 4HFWB 4UUJB 4XCEB 3KPRA 3VRIA 5CGMA 1OT2A 1KB5A 5JIKA 4IOFD 5IBUB 1TPXB 3SKOA 4NFDA 4ZUTA 2AEQL 4R4BA 3SGDH 2BVPA 5GGRB 1A0QH 2R0ZL 4KQ3H 4GBXD 4OLWH 1FSKC 1RUAH 5DT1H 3PGFL 2J88H 4OBSA 4FTVA 1NAML 5CP3H 5I6XC 1I8KA 4XTRC 1JWUA 5FXCH 5C0DA 1G6RB 4X5LA 2WM0A 5GRUL 3UTPD 4UQ2A 3GI9H 2BFVH 3UTTE 3MTRA 1M71A 3X3GH 2AXFA 1RULH 4ZPVA 3G04B 3HZKA 1A3RL 1FO0B 1NANH 3TBTA 5I8KH 1K4CB 1QSED 3BDYL 2GSGB 3L3GB 3TN0C 5EU4B 1K9TA 1XCTA 3A6BL 1FPTL 3OXSA 5H2BB 1OGAB 3BVNB 3LKRB 4GMTL 4U6XA 1CL7I 5T3ZL 4P2OC 1LP9B 3W0WE 1WWWX 4NDMA 3RIAK 4MQ7B 4PJAE 4OCRH 3ARDA 1NL0L 5FYKE 3O4OB 5TF1H 5D7JB 1K2DB 4HWBA 5I1GL 1UZ8B 2FL5A 4UINL 3BRFA 4PBXA 4HJJH 2XWTA 4BQ6A 3MNZB 3AY4A 4NKIH 3C60A 5DMGC 4ODBD 4ZNCD 4OLVH 5C0BB 4OV5B 2VLLB 1KF9B 2FECI 3ESUF 3GBML 3QEUA 4L9LA 5CJOL 5CD3A 3D2UD 1HSAB 5HHVL 4OZGF 5A2LH 3PIQB 2DWEA 4IRSB 4LVHB 2EDWA 2K1MA 1CGVA 1YY9D 2NY1B 1A14L 3U30B 2ZPKL 5DURD 5JOFA 1JGEA 3FAWA 1OGTA 2CIIA 1AXTL 2H32B 3P11H 2G2RB 3EYUL 4RFNC 3W11D 3VDCA 3F7QA 2RQ8A 3GSQA 5JR1L 4I3RH 2DI8A 4LSTL 3TM6A 2DD8H 5E6YA 4X6CF 3VFVA 3P73A 4P46A 4P5MA 3RHWF 3DBXA 1MI5D 5DLML 3AAZA 1FG9C 1Q1JL 1UCTA 2HYMA 5GGTH 1DQJB 4ENEC 2YRLA 1RUQL 1UEYA 1MIEH 3VI4F 3OR6A 4PRBA 2CKNA 3I6LE 1RZFL 1FNHA 2DYPB 4QTIL 4M5ZH 1FNGB 2Y06L 2OZ4A 2EYSB 5DGRA 1YY8B 4DVBB 3DECA 4GRMA 1QG3A 2NW3A 4YGVA 1TCRB 4JRXB 3RDTB 5CBAA 1F90L 4GAYA 4Z0XA 1HXMA 1WCBA 4PJFA 3JV4A 1QR4A 5JMOC 3KYNA 1NLBL 4PJ5E 1IM9A 2FH6A 4FZ8L 4H26A 5CGYD 4YXLL 5SV4A 2F53B 5HPOA 5TGBA 4PR5B 4NN7C 5L7XL 1VPOH 1B4JL 4KUZH 2R1WA 4O9HH 1FZJA 1ZAGA 2F19L 5EULV 3OAUH 1IC5H 3I6KA 4JO1L 5GISL 1S78C 1DN2A 2XA8H 2XZCH 5A3ID 3AFLA 3UZQA 1BZQK 4C58B 4GW5B 3C8HA 1INEH 4TRPL 1ERNA 3TBYA 3VFWA 2J8OA 3RUGA 1Q9OB 2PCPA 1OQXA 1JPGB 2Z31C 5EZOH 1FIGH 4K23H 2K3TA 3ZKNC 1WT5C 2IANE 4G6FD 3PQYE 1PDKA 4WJ5A 2Z93A 3P77A 5JUEH 3ARBC 5FKPA 1XCQB 4GAGL 2R2CA 4OZHB 5C0JB 1KJ2H 4TQEH 5ENWA 3SDXB 5DMYA 5F7FA 4Y2DD 4LSQH 2HLFD 3H9SE 5FHAH 4KRPD 3KLHD 3MGOB 3O45B 4OLZH 1BFTA 1GIGL 3JV5A 4ZFFA 1FE8H 1TZHB 3G08B 5E8DL 1JWSA 4WDIA 1MWAB 5AAWA 1B9ZA 2RIKA 1LQSR 3OBAA 1MJ7H 2VL5B 4JRYE 1T0NA 4HF5L 1Y6KR 4S1DD 1C5BH 4P23B 2O61B 5KG9A 5LGJA 3BKCH 4YHPB 1S5IL 4MDJA 2Q6WB 1BVLA 4IOFC 4PJ8B 4OM0L 4Y8DC 5ALBL 2AV7A 1M7DB 1IKFH 4W68A 4FFWD 1FAIH 4DFIA 1IAKB 2VUOA 1C12B 1RZGB 1A0QL 1WZ1L 4NZRH 2VLRA 1FNFA 1RK1B 3DURA 4GBXC 4POYA 4OLWL 5D7SH 1RUAL 1HQ4A 3GBLA 5DT1L 3ZL4L 4QXUL 2VKWA 2X4NB 4F7PB 3MRRB 2G60H 1NH6A 4ZUVB 3SOBH 2PYEE 2CK0H 1MFBL 2DL9A 2RFXB 2BSRA 5I2IB 1QYGH 2GT9A 4NQCB 1P9MC 4PJ9C 4S10A 1EV2E 1KNOB 2GJJA 5EFIA 5F21B 4LRIA 4QOKA 1Q0YL 1U8PA 1MEXH 4LVNB 4HCRL 4FFZL 3SY0A 5ID1A 4LL9A 3DYOA 4JHAH 4J3VA 4PTTA 3QJHB 5F7WC 43CAB 5TQ0H 4MJ5B 1DEEB 2Q3ZA 3QIUD 3EYVA 1NGPH 5GZOD 1FFOB 5B39G 5TF1L 1P7KB 3OKMA 4XP1L 3H7BA 3MRMB 3AVEA 3TT3L 2HH0L 2BJMH 5DJ8B 1D6VH 4DEPB 1DLFH 1KXQE 1X5JA 2FSEB 1EEYA 3BP4B 5F9JA 1QSFB 4ZFOB 2UV3A 3G5ZB 2WUCL 3QDJB 3BIBX 2BVYA 3L9RA 4G6JL 4Y16B 1ZT7A 1RJZA 2BHZA 1C16B 2ITDB 1IL1A 5EC2A 3QQ4A 4F8TA 5I1CL 4ZAKB 3SE8H 4DKFH 4DUXA 1A3LH 5DEGA 2NY0B 2A77L 5E5MA 5L2KB 8CGTA 2VABB 5EU7E 5FECA 2A83B 2X10A 4LCCC 5EUKA 3RPKA 3F5WA 1D5BB 5DD1H 4KKAD 5F7HA 5CP7B 1YC7A 3GMPA 4I3RL 1GZQB 5GJSH 4ISVB 5I19H 2A6IB 3DLQR 3VFOA 2FCBA 1X5LA 4G42A 4M43H 4JJHA 4DGVH 3MCLH 5DEFB 5GGTL 2QHRL 4L8CA 2XTLA 1WWBX 4QTHA 4KJQC 5FYLE 1XR9B 1S9WA 1KC5L 2VDMH 3BWAB 1Q9WA 4QF1B 3I02A 1IARB 2BY3A 4TNWF 4V1DD 2F5BL 4KHTL 1CXHA 2C3XA 2BRRL 3UXFA 3TN0A 1DZBA 4QGYA 3UTQB 3DROA 4PRPA 1F3RB 3OKDB 3HRZA 1TQBC 4P2OA 3MJ7A 2X40A 1XT5A 3VXMD 4MD0A 3EO1B 2O5YL 2EKJA 4NRZB 4NBZB 4POZD 2DLGA 5BZWA 2A6JA 2EYRA 5E00B 3OSKA 2EDXA 4RNRA 3U7YL 5IMKB 1WFTA 2VH5H 4F7CB 2XA8L 1KLUB 3GHBL 3IDNB 1PBYA 1QSVA 5A3IC 3HFMH 1BIIB 1S9VB 4QY8B 1HKFA 4X6DF 1LO5A 1RJYB 3BH8A 1TFHA 4MNHB 4HKBA 5AWNL 2J2ZA 4S1SL 1QRKA 3MREB 3BEWA 1YDPA 2EZ0D 4NHCH 3BPOB 2AGJH 3V4UH 2OK0L 1FIGL 4K23L 1LNUB 1CD8A 5E99L 2R1YA 4ZO8A 3SEPA 2K7PA 3MZTA 3KS0J 4U1KB 4WHDA 4YHKL 2J4WH 3TPUB 3NGBC 5C8JA 4LSQL 2B8OT 4IIQB 1XGPA 1JGDA 5DWUL 3KLHC 2YPLE 4G8IA 1DDHA 5DVOA 1BFSA 5DRWA 2C7UA 2DM4A 5BJTA 2CDEA 1D9KD 5IMMB 1FE8L 5KS9B 2FATH 4X5XB 3MLSH 4X9BA 1MJ7L 3LRSB 1AXSB 3HI6L 4GH7B 4WI8A 4S1DC 1VFUA 3B43A 4BKLB 3O0RH 3TA3C 2AAVA 1YNTB 5DSCB 3VXTB 3EJYD 2EH7L 2X4OA 1CQYA 4CBPA 3AREB 3QIWA 3IJHB 1VFAA 5CWSB 1BJ1J 4Z5RA 4H0IA 1IKFL 4KMTL 3EFDH 3WFCH 3RX5A 1J86A 1GCFA 4YK4B 2JK5A 2XICA 5JOEA 1KTDA 2WBJB 5LBSL 1T6VN 5DUMH 1CG9B 5MHSE 4EN3D 5FAAA 2ZKHH 3ZZ1A 2MJWA 4QRQB 1DL7H 5LG1A 1VEMA 4JANA 1G0DA 1IT9H 3O2DH 4EEEA 5HGBA 1KJMA 1EEZA 2XNAA 2VSDA 4KHXH 5GZND 4I3SL 5DZOA 3MJ6A 3OKEA 4JFED 1R0AH 4OI7A 2APTA 1TZIB 2AK4E 1OB1A 4F9LA 2A38A 5FYJU 4PJCF 3KPRB 1Y18A 3VRIB 4B0MM 1BVZA 1VFBA 4HIJA 4PJ7E 1KB5B 3HNTL 4R7NA 1QEWA 3MV8D 2V7NA 1JZ8A 3LS4L 1NBVH 3H0TA 4TSBL 3SKOB 3VU2A 2Y6SD 4ZUTB 1F4XH 1HKLH 2JELH 3FTGA 4R4BB 4XVTL 2P24A 2BVPB 2EIZA 2VAAA 3UTSE 1ZGLA 2N56A 3GSRA 1YQVH 2DQIL 3ARBA 3ES6A 5GZOC 3DX9A 4FTVB 1XIWD 2GJZA 5IB4A 3D39A 1I8KB 1KN2L 2AJ3A 2CUIA 3CFIC 2Z8WC 4PB0H 5E6ID 2F5AL 5C0DB 2EICA 2JE8A 4OF8A 2BJML 1E4WH 1D6VL 4UQ2B 4OCYL 4XVSH 3V0VA 1M71B 3H2WA 2R29H 4GUPA 4LHUA 2AXFB 2XWJA 5D8JH 4DGIL 4ZPVB 4NQDE 4TN9A 1G9NH 1ZLSL 3NCCB 1U8JA 3O6MH 5DA0B 2P47B 5HY9A 4P48A 4F33A 1V5JA 5ILTH 3HZKB 3OAYH 3TBTB 1C8PA 2VXTL 1N4XL 3D9AH 5AEAA 4DKFL 2IH1B 1MFCH 1XCTB 1CL7H 4X83A 3I9GL 3LN4A 3OXSB 4MX7A 4JFHE 2BCKA 4NM4L 4U6XB 3G6DL 3SKUD 4OJFH 3NIGF 1AKJA 4BQ8A 4OAWA 4OFPA 5DD1L 3ARDB 5GSRB 3QZWA 4CMHB 4J12A 2FX7L 1VFOA 4LGPB 2FL5B 2XWTB 5FOBA 1H8NA 1W0YT 2VC2H 1N6UA 4M43L 5GGQH 3C60B 2C1PB 4HC1A 3PNWB 4JHBA 1A9EA 4F7EA 4BZYA 2R69H 5HDQL 3VA6A 3QEUB 1EJ6A 4L9LB 1EX0A 5CD3B 3NCJL 3PP3H 4NKDA 2QQKH 3MA9H 4PJ9A 4PJEA 1UG9A 2DWEB 5J6HA 2OJZH 3FFCD 5C6WH 1HNGA 1OAYH 5JOFB 1RQ5A 4M4PA 1JGEB 3WXWH 1OGTB 3WFBL 3QG6A 4NN5B 5E8PA 2CIIB 4FQQA 3NOIA 1KELH 1MREL 2UUDH 4G6AD 5KOMC 4L4VA 3NPSC 5C0ND 1EUUA 1VGEL 4R97B 4MLSA 3VFVB 3P73B 4NGHH 1U8OA 1KJVA 1S9XA 4P5MB 3QEQD 4I2XA 3DBXB 3WMSA 2IALA 5DQJA 2JB6A 3AAZB 4Z78A 4ELME 1U8HA 4BH7A 3BFOA 3OR6B 4PRBB 3V6OC 1YMME 3V4PL 3ZE2E 1DUYA 4U6VH 3HFML 4XP9H 1GAFH 1A9BA 3QO0A 4GRMB 2NW3B 4G8GE 4YGVB 5CBAB 5F3HB 4GAYB 4Z0XB 1HXMB 1WCBB 4PJFB 2EZ0C 1TVHA 3KYNB 2AGJL 2OX5A 3LDBB 3VRLF 4ZSOE 1IM9B 1PY4A 3FQNA 3E0GA 4LSVH 3N50A 5HHQA 5TGBB 1ED3A 5FIEA 3SGEI 3E6HB 4LCCA 5JOPD 3MODH 3KDMA 3U9UA 2R1WB 3ARZA 2WV3A 4N8VG 3VG0H 1FZJB 3H7LA 5M94B 1LGVA 4HCRA 1QZ1A 1PY9A 3I6KB 5J57B 4YHNA 2VQTA 2LTQB 3RBSA 3WIIH 5IW6A 2Q7NA 3D25A 5BVJB 1T04A 1H3TA 2I25N 4M93B 4N5UA 3F7YA 3HAEH 4JO2H 3MRPB 2DTSA 3TBYB 3VFWB 4OQ1A 3RUGB 1EVTC 3VXSD 3W39A 3W9EA 2PCPB 5GS1C 4CAGA 1VSCA 3B5TA 4X6BA 3KPOA 3VFTB 4WJ5B 3BE1H 1CFTA 2Z93B 1F2XK 3P77B 1WAAE 5FKPB 2CGRH 1Q8MA 5ENWB 4GAJL 2JJWA 5DC4B 5IROA 1UKSA 4R0LC 5K59F 1FL3A 1CGXA 5K9JH 1NDMB 3B9AA 3ISWA 2COQA 4MJID 4NQED 4NUGH 3DARA 3HG1E 4LQ1A 1LEIA 4ZFFB 3Q1SL 5ERWA 1KIQB 3ZT7A 2OI9C 4TNWK 2X9XA 1JWSB 3KAAA 4WDIB 4KHXL 3R0NA 1T0NB 2MWCA 2X6MA 3P4NA 4WTZA 4NN6C 4GKZB 1R0AL 2ZCHH 2A9ML 4R90L 5A40E 5KG9B 5LGJB 4YX2H 1I3VA 4MDJB 3SKJH 2N4IA 3OZ9H 1BVLB 3W82A 1DVFD 5FGCB 4M7ZC 2AV7B 3WS6C 5L6YH 2PXYC 2WP3O 3K3QA 5HJ3A 3RVWD 15C8H 4LPVA 1X3DA 1EZVY 2VLRB 3DURB 2BC4A 1W72H 3CPLA 4J8RA 1HQ4B 5I9QC 3GKWL 2YD4A 1OWRM 4HPOH 4XPHH 3FHQA 4H8WL 4MDIA 4PB0L 5E6IC 3ARGD 3TH4T 3C2AH 3N9GH 5GXBB 5FB8A 4KUCD 4EOWL 4R3SA 2BSRB 1A8JH 5I1LA 2GT9B 5D8JL 1J0YA 1G9NL 3O6LH 3QNZA 2DI7A 4MNQE 4BZ2H 1AO7A 5ILTL 4JVWA 1CR9H 5EFIB 5I1HH 1U8PB 1UM6H 3SY0B 4Y4FA 3TA3A 5ID1B 1CL7L 4PTTB 2NTFA 3KWWA 2KH2B 1A6TB 1T6WA 5HGGS 1PD6A 3MC0A 4OCSL 4QYOA 3EYVB 1V3KA 3BJLA 3BMVA 5C09E 3OKMB 3O2VH 3H7BB 2DAVA 3GM8A 1EEYB 5CBEA 3EJJX 5F9JB 1ZEAL 1R3IH 4DUWA 3NZHH 1KEMH 4UOJA 3OB0K 4M62H 4QHKI 2V5SA 3MA9L 3GM0A 3L9RB 2J1KA 3MRFA 1ZT7B 5GS3A 1RJZB 2D03H 1IL1B 4UTBL 3QQ4B 4H8WC 5EC2B 3MV7D 1BFOA 1OARL 4G5ZH 5DEGB 4ODSH 1AC6A 5E5MB 5FM4A 3QR2A 5DVMA 2Y72A 4PIRF 3UP1A 5FECB 5H35A 1A1MA 2NR6D 5C7XL 2F74A 4N0CD 3MSPA 5EUKB 5T5NG 5IFAH 3F5WB 1G9NC 5D72H 3BZFA 1KELL 3G6AA 3WKMH 1FSKB 3GMPB 1BBJA 5ADPL 5C0NC 3VFOB 1H3PH 3QP3A 4Y19D 4MQTB 4G42B 5I6XB 4HXAH 1OCWL 2DKSA 4OZFA 4Y5XC 2ATPA 4XAKE 3SPVA 5MENE 4QTHB 4GRWF 5GRVL 5L8KB 3L5IA 4N9OB 4KI5D 1S9WB 4X80H 3S97C 4MXQC 3DGCR 4XRCA 1Q9WB 4PJCE 4N1CA 3I02B 5JW3H 1RIVL 2E8YA 3MBXH 1ZGLM 3CX5J 3TN0B 5C0FA 3NMEA 3RGHA 3DROB 2P43B 4PRPB 4JO4H 1RIUH 5DMJB 3HRZB 5T1KD 4N5ED 3MJ7B 4P2OB 2J12B 4PJXF 5FYKH 4MD0B 1S9KC 3RIFK 3U7WH 1UA6L 4LOUD 1A7QH 1NSNH 5BZWB 2A6JB 1SYVA 2EYRB 5HTSA 1WQVT 4RNRB 3AS1A 3QXUA 2XZAH 2I07A 4Q58C 4YPGA 3WIIL 1Q9LA 3UZVB 1BAFL 4ZOBA 1UVQA 3X3FH 2OBGA 1LO5B 2OXGA 5ESQA 3BH8B 2O5XL 3QPXH 4EI5D 1NAMB 2NPLX 3BEWB 1YDPB 3ZE0E 2W92A 4AEEA 1LD9A 4MAYC 4C56A 3RNQA 1XGQA 3QUML 4PJHB 1NBZA 2R1YB 3UTTD 5AG8A 4ZTPL 4GRLC 5JPMA 5GGRY 4G9DB 1NGZA 3OX8A 3RVUC 3IAQA 3VXUA 2ZUWA 4P9HL 2O5ZL 5C8JB 1XGPB 1JGDB 1CCZA 1DDHB 4G8IB 4OLYH 5DRWB 4ZS6C 1JNLL 2C7UB 4X4ME 4DKAA 5BJTB 1F58H 2CDEB 4PUBH 1UADC 1YECH 1A1OA 4U0RC 1YJDH 2VDRH 3QRFM 5SWSB 3CDCA 3W0WD 5C07E 1CXFA 2KBGA 2OP4H 2VDKH 5FYKD 2X4OB 1JZ3A 3QIWB 5HHMB 3T1FA 1VFAB 1MCPL 4Z5RB 5GRYA 3VD3A 3RVWC 1QFHA 3LD8C 5CJQL 5KVDH 3MOBL 3N1MC 3LV3A 1BIHA 2JK5B 1KTDB 7FABH 4ONGH 2NY2D 4PYGA 3DRQA 1F02I 4NN7B 4UIMA 4XPHL 5IFJA 1NKOA 1RURL 1VFMA 4KJPD 3ARGC 3DXAE 4JKKA 4JANB 4K3GA 4HS8H 2NY7L 3UJIL 2DL2A 5HGBB 1KJMB 4ONFH 1EEZB 2B0SH 2XNAB 4MVBD 3OKEB 4GS7C 5T33H 4RAVA 4NOFA 2VKXA 1BQHA 1OB1B 1EDQA 1Z5LA 1Y18B 2B2XH 4P9HC 5TE7H 5I1HL 1VFBB 4HIJB 2Y23A 4XMLL 1F6AB 4KQ4L 4R7NB 1QEWB 1KCSL 4WY7H 3H0TB 4Z7OF 5F44A 3ARVA 1M7XA 2BNUA 4Z7VF 5DTFA 5KVFH 3FTGB 5GS1A 2Z31B 2P24B 2EIZB 4NC1C 2VAAB 1ZGLB 5FA3A 3GSRB 1MCSA 4JKPH 3ARBB 4K2UH 3ES6B 3DX9B 3I6LD 3RFZC 2GJZB 1SBSH 3ULUF 4OGXH 5IB4B 3D39B 1ZTXH 2AJ3B 1HK6A 4R0LA 3O2VL 1KUMA 3QDGA 5TE4H 1T1XA 3V0VB 5A16A 4GUPB 4LHUB 5ACLA 4FQCH 1ODAA 2HT4C 4XGZA 2XWJB 4PJ5D 4D2NA 5ID0A 2GY5A 1PGRB 4BFBD 5F88A 5KSUB 1RIHL 3HUJA 5HY9B 1GH7A 4F33B 4JN2A 2X4RA 3MLXH 4OBRA 4X7FC 4LSPH 2I27N 4G5ZL 3LN4B 1BX2A 3CDGA 3MV8A 3N1PC 4MX7B 4M61A 2BCKB 3OHXA 3WS6A 2PXYA 1FAKT 4A6YL 2VXUH 2Y07H 4W4OA 2EDLA 2NR6C 4N0CC 4DUVA 3UBXG 1GHFL 1AKJB 3Q6GH 4OAWB 3WKML 4P0DA 3QZWB 4ACPA 4QWWD 3UO1L 1AR1D 5FOBB 5F7EL 1QQDA 3ZYIA 5DYOA 3K81A 4WENB 4F7EB 1WFOA 2VITA 1A9EB 2ZJSL 6CGTA 1JNHA 5GIRA 2IAND 2DQTH 3LY6A 2XI9A 5FDYA 5CHNA 3PQYD 4HMCA 1FLTX 3DGGB 4NKDB 1GPOH 4PJ9B 4PJEB 1ONQA 5HHXL 3RNKA 5J6HB 4YAQA 3H9SD 5LXGH 3JUZA 4QEGA 3V7AG 4MD4A 1OL0A 5BO1L 5C0RL 3GSNA 1MPAH 5LAXA 2CD0A 3T65B 4PRIA 4M1DL 3C2SA 4LKCA 3QG6B 5E8PB 3F6LA 4FQQB 1IMHC 4JRYD 4ONOA 5ADOH 4N5EC 4L4VB 4XWOD 1JGLH 1S7VB 4M48H 4DOHB 5FYKL 5DK3A 5TF0A 3U7WL 1IQWH 1U8OB 1KJVB 4I2XB 2IALB 5DQJB 1U8HB 4BH7B 1ZSDA 4N8CL 2CQVA 4EQ3A 2ICEA 2XZAL 3G6JF 2XIDA 3S34H 2HWZL 4QXWA 1TQCC 5A2FA 1MCBA 1PW3A 1XGUA 3WNOA 3JUYA 1DUYB 5FUZH 5IMLA 1FH5L 3QWRD 1A9BB 3QO0B 3FOMA 3C8DA 5EZIH 1TVHB 2QLVB 2PYED 4WUUA 3RZCD 2DTML 3FQNB 5CJ8A 5GRJH 3SGEH 5HHQB 5DJXA 1II4E 3S5LG 1NBQA 1ED3B 1TIUA 4LCCB 1U95B 1H3XA 3KDMB 3U9UB 3QHZL 3IDMA 4U1JA 5E4EC 5D2LA 1CGTA 1LEKA 1F58L 1FLRH 2XQBL 3MFGB 3BZDA 1CE1L 2ZG1A 4Z6AT 2DDQH 3TP4A 4YHNB 5DVNA 3WE6A 1SJHA 3L3IA 5IW6B 3D25B 5H8DA 1YJDL 1T04B 3AB0C 5I76A 2LU3A 2QV2A 2YD5A 3LEXA 1FYHB 5FYLH 3F7YB 3BD4A 1UWEH 3W39B 3W9EB 2E27H 2Z9TA 1F5WA 3D87B 4X6BB 1U6AH 3QQ3A 3KPOB 5L8JB 1N3NA 3OPZH 4HUMB 1CFTB 3SN6N 2Q8BL 4NYLA 3BUYA 1D7FA 2JCCF 1UWXK 3FRUA 3O3EA 3TH2T 1FL3B 3S8WA 1JHKH 1LEIB 5SX5H 1A7NH 1IGMH 1CQKA 4XHQA 2P8MA 5ERWB 1BM3L 1M7IA 3CK0H 2BXYA 1RUML 2B0SL 4PJHF 4MVBC 1U2CA 1W8OA 3P4NB 5C1MB 2VERN 4KK5D 5D5ME 1HDMA 4HLZH 3H3PH 5EU6A 2P45B 3U1SL 3QCVH 4M6OH 4J7RA 1LHZA 3KXFE 5I1EL 1FP5A 4CU8A 3ORJA 1MFAH 4HS3A 1T3FA 1ZHLA 2R4SH 5HJ3B 5KVFL 5I18H 4MAYA 3DVFA 4D9LH 4KDVA 3B2VH 3LQZA 4LEXL 1EXUB 1AXIB 2UYLA 2BC4B 3I2CH 3CPLB 4J8RB 4GRLA 4O5LL 1YJDC 4OGYL 1YPZF 5FYLD 4M4RA 4WI5A 1MCDA 3NGBB 1MRCL 5JW4M 2WBWB 1ZTXL 4MDIB 4OI9A 4L9DA 5TE4L 4NHUA 5FB8B 4LSDA 2QQLH 1ZA3A 1HINL 4J3OC 4R3SB 1AP2A 1Z9MA 3MV9E 5I1LB 3QNZB 1UWGL 1AO7B 2EDHA 2X7LA 1U8QA 4EVNB 4ZOEA 1ZLWK 1DBMH 4Y4FB 3TA3B 4PLJD 1HOCA 1X5GA 4LMQE 3H3KA 1OQOA 5EH1A 2NTFB 1ORQA 4NO3A 3KWWB 1G1YA 4RGNB 3EYOA 3PHQA 3AC0A 4NCDA 4OCWH 5TFSL 5IESL 1A5FH 2PYFA 5C08A 1T2JA 2YUVA 4QYOB 4YIQA 1O7SA 3Q6GL 1A7BA 4K3EL 5JLZA 1P4LA 3VWKC 4M6MH 1CFNA 3QIBD 3BW9A 3DMMA 2BNQA 5BXFA 3QHFH 5CBEB 4LF3A 4OD3H 1UYWH 5MI0C 4XAWL 4KKLD 3QUMA 1EFXD 3ULVL 1MCOL 1ZLUK 4FQ2H 1F6FB 4XBPA 1MCWM 3TCLA 3EO0A 4U3CA 3MROB 3EZ8A 3MRFB 2X44D 4PLOB 4JQIL 5CZVH 5DFWH 1BFOB 2YPLD 1NMCC 2IPUK 2BNRA 4LASH 3ILQD 2L7JA 5E8EA 1IGTA 2GJ6E 2HFGH 1OY3B 1UZ6F 5H35B 1A1MB 2F74B 3KPSA 3T3MF 4R26H 3LZFH 3BZFB 2G5RA 4GO6B 4KZEH 2VLKE 3G6AB 4L8DA 4CN6A 2NY4D 1BBJB 4XWOC 4UILH 3ARSA 3B6SA 2ICWA 4NIKB 1NUFA 1FN4A 1CU4L 1IQWL 3UBXB 3WN5C 4OZFB 5CJXC 2ATPB 4HK0A 4GXUM 2IH3A 4MJ6A 3SPVB 1QNZH 3S37X 5EUOE 4HFUL 3HMWL 3TO4D 1PEWA 5B4MD 1I9IH 1KB9K 3HS0A 4HBCH 5FUZL 1T03H 4XRCB 1V8HA 4ZNEE 3WLWD 4X98A 3P0VL 4JB9H 4NOBA 5MHSD 2DQUL 4HUVA 4R7DA 3NH7H 3RZCC 2E7CA 4J3XA 4MWFA 2ESVA 3AM8C 4JPWH 5FV2A 5GRJL 4DAGH 1RAMA 3ULVC 5MEQA 4KK6C 1AHWC 4XNXL 3A67L 2AK4D 5HYQA 1NC4D 3OR7A 4GFTB 1YEEL 2FB4H 2XPGA 2D0FA 2XWBA 4K07A 4G3YH 3WHE1 1FLRL 3C8KA 2UWEE 3BN9D 1SYVB 3QEGH 4ZFGH 1A2YA 4YPGB 2I07B 1CS6A 5GS2H 1Q9LB 3CFEA 3JTTA 3UTSD 2EE3A 2F54E 2Q8AH 5CCKH 1QRNA 3PXHA 1UVQB 5FYLL 5ESQB 1RU9L 4R4FH 4F57L 1UWEL 2R4RL 1BOGA 1DBKL 1LD9B 4C56B 3RNQB 2CRZA 1W0WA 3HCVA 4X7SH 3QULA 3OPZL 5T5NF 5JPMB 1N7MH 1NGZB 2E6QA 4Y89A 3OX8B 1X5YA 4NQDD 1TMCB 3VXUB 4YE4L 2HT2C 1CD9B 1T1WA 3DX6A 2D9QB 1JHKL 1J11A 3NPSB 4YHML 5CIPH 4Q74A 5D7IA 3RY4A 1GGYA 4CN4A 4M1CC 5I1IL 1HIMH 2ZCKH 5E2VL 3SDCD 4JPVH 4AEHL 1P7HL 1MJJB 1A1OB 3CK0L 4JFHD 3TT1H 5D6CA 3MA7A 1T5WA 2X89A 2OTWA 1QFOA 3G5VA 5SX4I 3SE9H 4A6YA 1RZ7H 4M6OL 4PY8J 4R2GD 5E5UB 2DI9A 4KK9C 1TETH 3BRDA 3I6GA 4J6RL 3NIDF 5I75C 2MHAA 5F3BA 4G7YL 3VXRA 3T1FB 2OR7A 5IVXF 5E1AA 3VWJC 3WSQL 3NPZB 1EPFA 3CVHL 5I18L 3MJ9H 5BOPA 4JG1H 1Z0NA 3LV3B 3JTSA 4K3HA 1EMTL 5GS2D 1EIBA 3ARFD 5BQ7A 3DJ9A 4YEEA 5F1IA 5CMAA 4IDJH 3DRQB 3O11B 1EO8L 5GJTH 4UIMB 5IFJB 4Y5VA 5FM8A 2ZSWA 5DJ0A 2B1HL 3MLWH 2QQLL 1YYML 2VWEE 5C0AA 4H25A 1CTOA 4KY1H 1V3MA 3FZUD 3NCFB 3T4AA 5D93B 4RAVB 3QEHA 2VXVH 1BQHB 1CLOH 1Z5LB 3PV6A 5CJ5A 2CRMA 5T1LA 1AJ7H 4Z7UF 1IC4L 2VLJA 3DVGB 4MCZA 2AV1A 5B22A 5TDOA 5CAYB 1TVDA 2BNUB 5DTFB 5LQBH 4MA1C 5GS1B 3IVKA 4XPTH 2HTLD 1NCWL 3R4DA 5FA3B 4WEBL 3HAEG 4OCWL 3GI8H 1A5FL 1J0HA 5KVEH 3HC4L 4BA8A 2OLDA 4OLEA 1YMMD 43C9B 1DQML 3QIBC 4R0LB 3QDGB 1ZT1A 4HGMA 1T1XB 4G8GD 1TJIH 2DS4A 3DX7A 5AYQA 3LIZH 4JFZL 3LAFA 4MZ3A 4Q9QH 4XGZB 1UYWL 2YXFA 3HZVA 5ID0B 5AZEL 1RPQA 3NTCL 4HQQH 5F88B 4PRHA 3T0WA 2WK2A 4FQ2L 3TESA 3NN8A 4JN2B 4NN6B 3V4VL 1EZVX 2XN9A 3VXPA 3EDDA 5K9OA 5EORL 4OZIF 3SDDD 3ILQC 3CDGB 3DRTA 3MV8B 3QDAA 4M61B 2Z8VC 1X4ZA 2NX5E 4M7ZB 2R56L 3OHXB 2W9EL 2PXYB 4R4ND 5C70A 4JM2F 4OGAD 4WHYH 4FP8H 4H1LA 5E24E 1F4AA 4JQXA 2E9WA 2NZ9D 4XMPL 3WO4C 5KW9H 3CMOH 3EDFA 1WIOA 4PJDE 2NY4C 1INDL 5I9QB 5TPWH 5AG9A 1URLA 4UDTA 3BQUA 1C5CH 2C1OA 4ZS7L 2QSCH 5DYOB 4RGMC 5JMRA 2FX8H 4JO3L 2VITB 4XXCC 1JNHB 2CH8A 5GIRB 2DQHL 5CHNB 1M6OA 1YEJL 5DMIH 5IK3A 3NA4A 1LVEA 4GKOA 5B4MC 3DSFH 5IBLC 3IJSA 5IWLA 3HHRB 2OMBA 4L1HA 1ONQB 3RNKB 1VADA 1T03L 4YAQB 3IS0X 4WO4C 3HPLB 3UJTH 4KPHH 4JB9L 3V2AR 4MD4B 4LLWA 5MEOB 3GBNL 3GSNB 4KJWC 3HG1D 4U49A 1M4KA 1MY5A 2V2WA 3NH7L 1IGJA 2ED7A 4BFEA 5LAXB 4PRIB 4LKCB 4JPWL 5CZXC 1MHCB 3V8CA 5HD8D 1Z0MA 4QXTA 1REIA 4R9HA 4U3XA 2W65A 5ISZE 2YKLH 4K8RL 5KZCB 1IAMA 4YQXL 3MRBA 2HVKA 3VWKA 2J8UA 4D8PA 3ZDYE 1DBAH 5DC9B 3D0VA 3O8XD 3BN9C 4YHOH 4HLJA 1I9RH 4TSCH 5BMFH 4KC3B 1ZSDB 3WEXA 1VACA 4XX1E 4MA7H 2ICEB 1LE9A 1QLEH 1KIPA 5KAQG 1E28A 3WHXA 1E4KA 1A6AA 1F6LL 1XGUB 5JDJA 4ZOAA 5INCA 4XPAH 4LAQH 3VDBA 5IMLB 3UAJD 1NCNA 1MQKL 3FL7A 4R4FL 5C9KA 1INQA 3FOMB 2NNAA 4WUUB 2BDNH 4NNPH 5E8OA 1I3GL 3PGCA 3C09C 1GXEA 2W1NA 3ARQA 5DJXB 1OLLA 5EIIA 4PS4H 3OB0H 4MB4A 4E41A 1B90A 3LOWA 4APQC 3MLVH 1MFDL 3CCHA 4MNQD 4ONHA 2P8PB 3IDMB 4NP4H 4U1JB 2VDPL 1SBBA 5JTWA 1HI6A 4EUPH 1CGSH 1KYOJ 4LIQE 1HHJA 1LEKB 4TVPL 2VR9A 1FG2A 3WDJA 2QADC 1N6VA 4RSVA 2MOVA 4HT1H 1IGFL 1T4KA 3WN5A 5KN5A 3WE6B 2GUOA 3TT1L 3L3IB 5CJXA 5EN2B 5CILH 5DZLA 4UTAH 3J7HA 5I76B 3RWEA 4AIOA 3LEXB 1T7VA 1AE6H 1I1RA 4K8RC 1A7OH 4HJGA 5C09D 4KKBD 3IFOA 4WV1C 2VJXA 1IRAY 1CGYA 2ZOKA 1SYSA 3QQ3B 3QFJA 3SQOL 1N3NB 3JXAA 1ZHNA 3P2TA 5E1HB 1OAUH 1TJHL 4NYLB 4XP6H 3BUYB 3BP7A 3ARFC 3FRUB 2LU4A 3O3EB 4MJ4A 3UTOA 5IHLB 5IJKC 1HH6A 2YK1L 4AEIH 1IAIL 3CFCL 1H3UA 1YUHA 4ZDHB 4IDJL 1AHWA 1CDYA 3JWDL