3QORD

Crystal structure of human nuclear migration protein nudc
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
117
structure length
116
Chain Sequence
SKLKPNLGNGADLPNYRWTQTLSELDLAVPFVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, cell cycle
molecule keywords Nuclear migration protein nudC
total genus 30
structure length 116
sequence length 117
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorD00
2RH0A 3IGFA 4JUTA 4PBDA 2KLRA 2Y1YA 3EUDA 4JUSA 1SHSA 3AACA 4MJHA 4YDZA 4RZKA 1X5MA 3L1GA 4YE0A 1RL1A 1EJFA 2WJ5A 3QORB 4M5TA 3N3EA 5DS1A 3GUFA 1WH0A 3W1ZA 4M5SA 3L1FA 3QORC 4YL9A 2XCMC 2N0KA 3L1EA 5LUMA 2MNWA 3J07A 3AABA 3QORA 2WJ7A 2BOLA 3VQLA 2CG9X 3GLAA 4PCKA 3Q9QA 2N3JA 2CR0A 3VQMA 4YLBA 4ZJ9A 1GMEA 3GT6A 4ELDA 3QORD 4FEIA 2Y22A 5DS2A 2O30A 4I88A 4YLCA 2KMWA 3Q9PA 1WGVA 2JKIS 2K8QA 2Y1ZA 1WFIA
chains in the Genus database with same CATH superfamily
1T2JA 1UYWL 3KHQA 3VI4F 4DH2A 2FECI 1FNSL 2HKAA 2YGQA 3ELAT 5E7FA 5KVFL 2BSDA 1S3RA 3JWNH 5DFTA 4AQ1B 3ELQA 3L3HB 4B95C 3B6SB 3L17A 1OE1A 4Y88A 3ULUH 4IOSA 4ERSH 2CBOA 4AI7A 3SE3A 2JIXA 4H44C 1YN7A 3NAAL 5DHMC 5DFAA 5L6YH 1FA4A 5I0YA 4X4YA 1MLBB 1NCOA 4HOMA 4KK9D 4TVUA 5HYSG 4XVUC 1CICB 1KEMH 3WDHA 2CIIA 2QQNL 5DFVC 3UPCA 4AH2A 3WI9A 4NO3B 3NH7H 1OGAA 3CIQA 4HEME 4G83A 3BP6A 3U79A 2IADB 5D1ZC 3MRLA 1GOGA 5T1KD 2W9EH 5EUKB 3RIAK 1HZKA 1A2YA 1IEAA 4ZK8A 5HI4D 3QK0A 3LS4H 1QPPA 2YARA 5E1QA 3FC8A 3Q48A 3SDAB 8FABA 4HC1H 5EU6E 4WGKA 1S7QA 2BM3A 2XN9E 4HMDA 1QSFE 4L5FH 3BPCA 1A47A 3QQ3B 3QZWA 4L8BB 1IQDB 3MBEC 1CE1H 2DQTL 2ARWA 3V4PB 2W0KA 3AG3B 5DVNA 5C0AE 1K6QL 3K6FA 4EXKA 2I9TB 3OR6B 4XOCA 3MBEA 3O4LD 3P2TA 1M9SA 4OQTH 3ES6A 1KZQA 1FV1A 1MVUB 4M9OA 1OP9A 3EGDA 4UCFA 4HU8A 3C9NA 3UTPD 1YYLH 3CD4A 1XZWA 4WTXA 5D93B 5LGKA 3S37L 3OKDA 3PABB 4RZCA 3OF6D 1CFMA 1B0RB 3LZFH 4Y4HC 4Z7UF 1ACCA 3RX8A 3GSXB 2IPKB 1CLOL 3A6CL 3IJEB 4BZYA 5EIQA 3X3FH 1H9DA 1AKJB 5JW4Q 1U3NA 4M4RA 5J6GA 1SOKA 2P7TB 4KVCL 3S34L 1WBZA 1WTLA 2D2CC 4PREA 4QOKB 2ED6A 1JZDC 3UEQA 5ISZB 1S9XA 3VFOA 1K8IA 3NJVA 5C1MB 1URIA 2LU5A 2JELL 1JXJA 4XX1G 4Q14A 1EBAA 1UM5H 5H2BA 5L2JB 2XZZA 5TH2A 2FATL 4JX0A 5K59E 1QEWA 2BVOA 4BZ1A 1VAHA 3WUWB 3ULUD 1MH5B 3TBSB 3AWGA 4LSRL 1RP9A 2F53E 1P4BH 5DZJA 4NJ9L 3HE7C 3KYMB 2YSSB 1DCEA 5L2KB 2EXYD 2GY7B 3QQDA 4KX8A 1KGIA 1YEKL 2NUPA 3MNDA 4G82A 3AJ7A 5C2BL 3HE7A 4XPGH 1KCWA 3H2WA 2ICES 2YXMA 2Z4QA 1HL5A 4RQQA 4L23A 5CINL 4B9CA 5DUMH 5IK3B 4APQA 3DX8B 3FQ1A 4WW1B 1W80A 4FLHA 2C7FA 1GW0A 3PNWA 4UOW1 4UM9A 5CN3A 2A6DA 3ARFA 3QUMA 4RFOH 4QLWA 1G7LA 3AT0A 3ZE1B 1NINA 1CFSA 2OKMA 1M71B 3N85L 1CN4A 4W9ZA 1QPXA 4K9EH 4UQCA 3QRGL 2WXKA 3MJ8B 4G72B 4AH2B 1YY9C 1ZMYA 4NPKA 3GMQA 1QWHA 1GPOH 1GZQB 4FEIA 3E2HC 3NCFB 4S2SB 3BP6B 2DWDB 3O8XD 2MH4A 3MRLB 3QCUH 3K5SA 4JG9A 5CP3H 1P6FA 4HWBH 1Y0LA 4OD2A 4DWHA 5JR1H 3S35X 2F68X 5C0JB 1JZ8A 5ELIA 4ABVA 5CWSA 3S8WA 3OLEA 1S7QB 2R69A 1N0XH 4DKFH 5MI0C 2FX8L 3BPCB 3QQ3A 1FSKB 3QZWB 2Z35B 1HHHB 5DHYB 4GRMB 4IJTA 2ZP8A 3NFSL 1ZLVH 3GEWB 3VQLA 4HUMB 4XAKE 3WUZA 4ZSOA 4Y19D 5CHNB 5FGBA 1LDPL 3ES6B 2FYYB 3B7YA 2OAAA 1LTXA 1THCA 4M8QA 3QIUD 5AW4B 3KPQA 3L3OB 3DYPA 2GBVA 3OKMA 5FS5A 4HGWB 1A6PA 2AJUH 1NAKL 2FLMA 2B9BA 4HC1L 2NY0D 3SOTA 1DP0A 2DYPA 2H2SD 2AK1L 3MR9A 2RACA 3NACH 4Z7IA 3T0VA 4BFEA 5ILTL 1WWWX 5EORH 3UTQB 1NAMB 3LNGA 1TCRA 4KTEL 2EYSB 1UZGA 5I1GL 3KBHE 1FPTH 2BVYA 5TH2B 2FYVA 3Q1SL 4JFPB 2YKLH 5D1QD 4DTGL 4LSSH 2BVOB 1MH5A 1ZTXH 3CHQA 4S1QH 2VR8A 1A64A 1TEYA 1BZ7B 3MUHL 1OANA 2HG5B 1WAAA 4ZTOL 4U6YA 3HG1B 2MPAL 4X4MA 4UQ2B 2IQ9H 4U4BA 3MX0B 4M5SA 4LEXH 3M8OH 1YEFH 3HW7A 4ERSL 4KO5A 4OGYH 3BUPA 3L4YA 1R3LA 1AD9B 5DVLA 5T1LD 3GBEA 1X9RA 4N2FA 3QR0A 4XCNB 1JZJA 2MHAA 2BSEA 4BDVA 1N9PA 4W9LC 4PRPD 2FHBA 3VWKD 5EU6A 1CDGA 4PVBA 1JPTH 3QUMB 4ZD3H 2VABA 5EOQL 3NIFB 4BHUI 5E6SB 5AKTA 5C0AA 3JSSA 1NLBL 1CVSC 1CXEA 4N25A 4J3TA 3MV7B 1CD0A 3KG5A 2DWDA 3HB3D 5KVFE 5E99L 2JCCB 1G5GA 2EEDA 5EBLA 3BPLC 4HYTB 4X6EA 5CWSB 2ESVD 1VPOL 4XP4H 1HOCB 2Y36L 2CIKB 2NY7H 3B9VA 3KPPB 3S36H 1ZLDA 3U46B 3F6IA 3QEGL 3D9AH 2DV6A 5SWSA 4J6RL 2KPWA 3T6XA 4NPYB 5JXEA 1LP9F 5D8JL 4C57C 3NPSC 4WFFE 4WTZG 1LE5B 5FYLD 3NRFA 5B3SB 2XBZA 3P73A 5JQIB 4KO9A 3D0VA 2NYZA 4JRWA 1RIHL 2C1PB 3FS9A 4LCUB 3BQUA 4FL4B 2F2HA 4H88L 4N8UA 4AL8H 5KG9A 4KDTC 3CXDH 4P06A 2NNRA 4EDWL 5D2NC 4QTFA 3BAEL 2Q3AA 3UTQA 2CHZA 2VISA 2EYSA 4QY8A 1HILA 2XQYK 4IHBA 2XQYG 4W93A 1QFUL 3S34H 3S3DB 2Y1AA 1ROCA 4L1TA 3CU1A 3CLEL 4J6IA 2E7BA 3GI8L 2ORBL 4R96A 4XWOC 1R24A 4XMWA 1A1NB 4H20L 3SKMB 4G8GE 2D7TH 3A6BL 1YPZE 1FZOA 5E4EB 2XT1B 1PLGL 4B97A 1MPAH 1I85C 2J2ZA 2B4CL 4GEIA 4PJGF 3ZTJH 5DEFA 5EO0B 1N67A 3GXPA 3MACL 3MLWH 5FPIA 3VXSE 4PG2C 3N5AA 2F53D 2ZUQC 3VFTB 5ESVA 5FKPB 1MFAL 4Y5VB 4DFIA 4QD2E 4M6NL 2FJSA 5AD0B 3QIBC 1EH9A 1KT2A 3OKEB 3ARBC 1CS6A 4MASA 5L88H 1UZ8B 4U1GB 3MFGB 4MDIB 1PZSA 4J8QA 1KEGL 2P8MB 5HDQH 2WXIA 1DBJL 2P3YA 3CC1A 3CGTA 2YAHA 4B6ZA 5LNDA 3CFEA 3N2JA 3GBMH 3I6LD 3OZKA 1F42A 1HQ4B 4Y5XC 2R51A 3SYPA 2YEVB 1Z3RA 5KVGL 1FRGH 1EFXB 2B1AH 2VXTL 1P7HL 2CLVB 4Z7VB 1S8DB 1CGVA 2BCMA 4Z7WE 2Z7ZA 1O5PA 3HAEH 5EBLB 3HR6A 4D9RD 1TVBB 3J27A 5EC2A 4GUPB 4JPIA 2HN7A 4NRXB 4UV7H 3X14B 1J5OL 1ND0B 4PB0H 4ONGH 4GIPD 3KPTA 3U46A 3U4KA 4PR5B 2QVIA 2H8PA 3ASOB 1JJUA 1DQTA 4NPYA 5JW3L 5KS9A 1HI6A 1QR1B 1LE5A 1E5YA 1U30A 3VXTA 3KLAB 1LQBC 3UZQA 2V3EA 1S7SB 4YUEL 4N9OB 2UYLB 4NUMA 3X2QB 4C83B 1D5BB 3P4LA 4FHKA 2R4RH 3EZ8A 2XQYA 5T3ZH 5LG6A 1KEGH 2EIEA 4DNLA 5DRWA 2I60L 3FKUS 5DMGC 4JS7A 3V0FA 4U1JB 3T0BA 3CZUB 3O4OB 3TT3H 4FFYA 4I4WA 3KDPB 3S4SA 1JCKA 5KG9B 5TF0A 1MRDL 3BZFB 2EDHA 4CDHA 2WWKT 1N6QH 1OW0C 1E8YA 5F7LB 2MPVA 4XVTL 4UDUA 4LCWA 4QY8B 2L04A 1KDIA 2APVA 3DA0A 2VAAA 2VSDA 1QYGL 4P5SA 4YHOL 5I26A 1P5UA 1XGPA 1LK3L 5D7LD 5M95B 2O6CA 5FM5M 5I1KH 5I82A 5IFHL 4PSPA 2X1WL 4XHQA 1Y07A 3W0WA 2XETA 2D4DA 4KJWC 4N2HA 4WEUD 4XNUH 2NY2C 1RJZB 1BQHG 1Z5LB 2CNYA 1T3FB 3TO4C 4RWYL 1DN0B 1BZ8A 1PG7X 3BJLA 1ZLUH 1AR1B 2BVUA 2FWUA 2YWYA 5F0MB 4A7GA 1YPZF 2RH0A 3FN0L 3FQXA 3NPSB 4J3BA 4P5MA 3BAEH 3N40F 4XTRD 5E6ZA 5FXCH 4QRBA 2E75C 2GIYA 5SWZD 4R7VA 2AERT 4MQ7A 4FTVA 4Z76A 1NEUA 1DBAH 4HV8A 2PPFA 1WA0X 2H3XC 3BUQA 4PRIE 3ZRFC 4PV9A 2XWTA 4XMLH 2DN7A 4BSWB 3EFFA 3M8OL 5AVVB 5FKAB 1OGSA 3QNYA 4NBXB 1NZRA 4FX5A 4J12A 2OL3A 4Q56A 2DDQL 4HBQA 1OAQL 4M8UA 3BUDA 5HBBA 1GGIL 4BFOA 5F88A 2V2WA 5AW2B 2DJSA 4TL4A 1DQKA 4FN0A 1T04B 2JJTA 1GJWA 4PGEA 3EW3B 5I1DA 3RZCB 3HNTL 3ZTCC 3NZUA 4N85A 1L9SA 3N3EA 1DL7L 5HVHC 1BVKB 3DTDA 5KYYA 1ND0A 5HYJD 3FSAA 2R7EB 3LJ3A 4G7QB 5LUMA 2EUWA 4DAGL 2FBJH 4QXGH 1RK1A 2COQA 3FB5B 4EUPG 1SJXA 5D6CA 5KS9B 1EGJA 2AEQH 4FMVA 3MV7E 3HCVB 3WJJA 3LQAH 3M17B 3FSZA 4LFHD 1VSCA 1NC4D 3SPHA 4RAUB 1EVUA 4W68A 5SWQA 2ZCZA 5A3IC 5HTSA 5KN5A 5GGSA 3WNMA 2J4WL 4ZW3A 2DQCH 1VF5C 3PIQB 4P4RB 2DLIA 2XWBA 4I4WB 1NGZA 1OP5K 1MEXL 3FTZA 3LKNB 4PJBF 4AJ0A 4BQBA 4O4YH 2GITA 2X87A 2CG9X 4QWWD 5DJYB 4CNIB 1JAEA 2PMZA 5DXWA 1PCSA 4JG0L 2IQ9L 5DJDB 5JZ7D 1HYRC 5EU7C 4D8OA 1P4LA 3L2MA 4GFTB 4S1RH 4G9FA 1WT5C 4QGTA 3KXFD 2QHRL 2XC8A 3GI9L 3RRQA 3S3CB 3F2LA 1OGTB 1PAZA 1MCPH 1RJZA 2FECL 1A4CA 3NZ8B 1U8PB 4AM0Q 3VA6A 3WTTA 4PTTB 3HS0B 3S96A 4DAGH 5IHZA 3RIAF 1BLNA 4HSAC 5EF2A 2E0PA 1E42A 3M1BA 5I1JH 1JI1A 3O0LA 1QI3A 1L3WA 3FN3A 4OCNC 1V10A 5BMFL 3NIGE 2XZCH 5HGAA 3FCGA 2MOQA 3O9WB 1OT2A 3KS0H 4V2CB 3FSOA 4OCSL 4UT7H 5JOPE 4QDGA 1KXHA 1OAJA 1N12A 3O11B 1E0OB 2KYIA 1PW3A 3PL6A 3QVAA 1WC7B 2Y6SD 3R4RA 2WAQA 4X5XB 4UOW0 3VRIA 4JFOB 4IS6A 3BKML 3U2JA 2V2WB 4PQXA 3VI3B 3I6GB 3RBSA 1T04A 3QXUA 4L4JA 4PJCB 1MY5A 1GH7A 4PJ8B 3RZCA 4KK8D 4UZGA 3MNVB 4RDQG 5F3HA 3VD0A 1JZIA 2NY2B 4F2EA 1J8HA 4N5ED 2ILLA 3F7KA 2R7EA 3ZHDA 4GW1B 3K8KA 2X1OA 2DL9A 5EWIL 4LPYA 3FB5A 2QSQA 5CCJA 3FTVA 1WCBA 4I2XA 1E8XA 3VX1A 1AS6A 3VVWA 4ODXB 3V5HA 3WIFA 1MW1A 5ADPH 3MV9E 1AD0A 4G80A 1XCQB 2NZIA 3MUGB 4WV1B 5TPWH 3V6FA 5GS0L 1IGML 2ATPB 1TYRA 2F9BT 3IWVA 1WIPA 3JWNG 4GAGL 2EKSA 3CNKA 3KVDD 4JHWL 5KN5B 3QZMA 3O4OC 2BRRH 2PWEA 3L3IB 5CJ5A 1N6QL 3UZEC 5FEBA 2WKOA 4FQ2L 3ECBA 2GITB 1BMWA 2BPBA 4DZBA 3ESUF 3VXPB 3ILPA 1VACB 2BCKB 2YRBA 2MTPA 1C08B 2LGNA 4AE0A 4FTVE 4YL4A 2FQEA 1HJBC 2NW3B 3LS4L 1NMBH 4HKZA 3QARA 1SXBA 4HJIA 4PRDB 1O6VA 4Y5YA 5ACMA 1TZIA 5E0FA 5H35A 1WHOA 5AL8A 4OD3L 2VLRB 2QELA 3P4NA 4TULH 5CU9A 5JHLA 1HCFX 1I8KA 1UWFA 1A6ZA 2I5YL 4TNVK 2UV3A 3O9WD 1NGWA 2GJPA 4BFBD 1E4WH 4KZCA 3NZ8A 2XZQL 1QAWA 2N7BA 1BIIA 4K73A 1Q0YL 4R5VA 1LDSA 5DWUL 4G6AD 1X5KA 4HAKA 4W9JC 3ZGIA 1YUHA 1OCZB 4OZFG 4GSXA 1A9EA 3ZVVA 5KVDE 1RURL 3NAAH 2J72A 5L6YL 4RGMB 1SF3A 3RIKA 1NCAH 2GFBB 3QO0A 1MAMH 2OMTB 1P4UA 4WWNA 4E5XG 3UZVB 4MZ2A 4ZO9A 5AENA 2YUWA 2ZX6A 4JRYA 4N5EC 4E42B 3D34A 3FH5A 4NQQA 4H1LH 2R4SH 3GKWH 5F21B 5T1DH 4KK8C 4AC4A 2IH3B 3L2NA 1DLFL 5AYTA 3TBCA 4GRWE 3RLSA 4RSVA 2YD9A 3N1GC 2IADA 4Y19B 3DO3A 2CLRA 2NNCA 2IGFH 4GAYA 2QGBA 1FZKB 1OO2A 1XMEB 4RMQA 1S5IL 2YBRA 2DBLL 5KVEE 4AMXA 5FUZH 1ESOA 2WZ5A 3F65A 1LD9B 1BFSA 1ZK5A 4JN2A 4LASL 5T3ZD 3VFUA 1HNFA 1RZFH 8FABB 2VTFA 1Z1WA 3AGWA 1LO5A 3EO9H 1K5NA 2PW1A 1CZ8L 2BC4A 2QVTA 4OV5A 3V4PA 3TV8A 3DMMD 4D94A 5GS1B 2MSPA 1ZY9A 3OR6A 4YHNB 1WAPA 4YDKL 2PYFB 1L9OA 3L4UA 3CBKB 1OSZA 5JUEH 4P2QB 1I8MA 2DH3A 1AD0B 4FXGB 3EGDB 2BVPB 4NZDA 3FTXA 3ZYJA 2Y3AA 1QO3B 3TIDA 5JOFA 4YE4L 4WFEE 2IH9A 2PPAA 3LY6A 5DD5L 3AC0A 2CKNA 4PJXB 1AC0A 3OKDB 3PABA 3N55A 3U6RB 4MAYD 4KWUA 1CR9L 1VEOA 2Z91A 3ARVA 2GC4C 2OK0L 3RZWA 5TE4L 3ECBB 1MFCL 4RMRA 2MCG1 4QOKA 5ISZA 4B9YA 1GC1H 1VACA 3CFUA 4AK2A 5A2FA 4WJ5A 4FGMA 5AVTB 2GSGB 3M1CA 1KN2H 3GC3A 4PRDA 4ELMB 2PWDA 2IOOA 5H35B 5KJ7E 2ENJA 1PZUB 3APFA 1YEWA 3PU7A 4JVWA 2OJZL 4EO5A 3TA3A 2D31A 3CUPA 1QI5A 3DGCR 4AQ8A 2H26A 3BXNA 4WGWB 1T0PB 4KJYB 4ORZC 3QQDB 5TQ0H 3DOSB 4YHMH 4F9LA 1BIIB 5A6MA 1IGYB 3GSNH 4WNQA 1IE4A 2OCFD 3TT1H 2PP8A 1U4FA 4PMFA 3V52L 1TZGH 4WSKA 4X8CA 4M5YH 5LXVA 1YUHB 1AQKH 1CGUA 5DQDL 1AE6H 1GS7A 3K71A 3GWJA 4AEIH 1KMGA 5EZOL 1KYOK 4ZOCA 3DECA 2FJFB 1RMFH 4DP6X 2LTQC 1KY6A 2FWOA 4HKBB 4JRYB 5JIMA 4EN3B 3B3IA 8PAZA 3HHSA 2OULB 3NP3A 2UY6A 2IXQA 2OI9B 4OF5A 3ILQD 3LEVH 1SDAB 1A21A 3FTGA 3ZU8A 3MJ8A 1RZQA 5CD3A 4JM2C 3B9EA 2XSKA 3GJEA 5I74C 4FFZA 2BNQE 4QHNB 1MLCA 4P4KA 5ICYA 5GXBB 3V6OE 3FPYA 4GAYB 4M48L 5I19H 4ZX6A 1Y0LB 3N1PC 4OD2B 4LGRB 5KSBE 3QYCA 2RAMA 2JB5L 2JKRM 4IDJH 2Q2LA 3GNML 3OLDA 5IOKA 1E67A 4XNBA 2VW7A 2VMDA 4E9TA 2X2HA 3J2PA 3PPSA 1IAIM 1RZKC 2MWCA 1FYTE 4HCRA 3RWFB 3OD3A 1Y6MR 4JQIL 1EHXA 5AQ0A 3D30A 3FO1A 3GD1C 1L9PA 3L3DA 2FO4A 5BS0A 4P2QA 1G9ML 3VQ2C 1FVEA 1VGEL 3L4CA 2WCSA 3RE0A 2UZXB 1M7UA 2V0AA 3A4AA 4R97C 5GRUL 5C08B 4KVNH 3K1DA 5CF3A 5GZOC 5IF0A 5FUOH 3TNMB 3T5WA 3C5JA 3U6RA 1JDCA 5CP7A 3QXVA 3UABA 1G1OA 1F3RB 3BDBA 2WXLA 1IILE 1QHPA 5E6ID 1AACA 2DYPB 1Q9WA 2P47B 2AK1H 4ADJA 4XVSH 3TS8A 1Y1UA 3VVVA 4OCWL 3RBGA 1PLAA 2WBWB 4BFIB 3BSZH 1MCLA 3UIZA 3HG2A 3V0WH 2A83A 4Q52A 4Y5XA 4ELMA 3U2SA 3S5LG 3MCKB 1WSST 4P48A 5DSCB 1CD1A 5J12C 1ZA3B 5EBGA 4BK8A 3L9RB 2D31B 3QUHA 1KPVB 4GAGH 4DPCX 2CKBH 2Q8AH 2FEDC 2M83A 1CGYA 5HYQA 2N1TE 5F1OB 4MMZC 4U6YB 1AZBA 4UQ2A 5CNHA 3GO1H 4UQEA 3MX0A 1EXGA 4NQUA 4D3CL 1DO6A 1NH6A 2DTML 1JSYA 4WV1C 2IH8A 4W9FC 1GR7A 4WAFA 5CGMA 1DTUA 1F2XK 1LMIA 4I3SL 2MHAB 2OZ4H 4FFYH 1TFPA 3A24A 3BWSA 8CGTA 3SHSA 2EP6A 4GBXD 2DW5A 3KJ6L 1X3DA 5C0EA 3O4LA 4HKBA 4U6XA 3DJRA 2XZAL 1DANU 4ZTPL 5IW3A 1CU4H 1U8KA 5DK2A 3TONA 3BEWB 3GO1L 3VACA 2VZTA 3GSQB 4FXLA 4HK3N 4TF4A 3W11C 1MUJB 4GXUN 1MRCL 1NGPH 4BZ2H 2KUTA 4XCFH 3KPLB 4NZTH 2DQUH 2ZUQB 1FNGA 3QJHA 4YK4C 1T1XA 2EC9T 5D7JC 3MGOB 1FP5A 2APSA 4GB9A 4TOYL 4QNPF 4XVOA 3IE4A 3QI9D 1ODUA 4UAOB 3S35L 1HOCA 1MVYA 5D71L 5KVEH 3KPPA 4K71C 4LLVA 1YMMB 3O6LH 2W9DH 2CJUL 2DQUL 5SWSB 1MCSA 2AGJL 2BLFA 4HJUA 4F5CE 3APMA 3CH8A 4NJ9H 4RA0C 3RGBA 2B2XL 3FO1B 2YPKB 2X42A 1QUNA 4ETQB 4OGQC 2DLGA 4YDMA 4MJ5B 4I5BA 4GW4A 3T4AA 1UM4L 4DERA 4Y0GA 4DPRA 4HX1B 3D0VB 1BZDA 2YAPA 3IFPA 1F4AA 4LCUA 2E7DA 3TNMA 1VGEH 2VW4A 1TYEB 3LRSB 3EJSA 5AW1B 5AB2A 1FIGL 5A2BA 4KJPD 3W9EA 3V6BR 1WZ1H 3V4UL 3ULSA 1BVZA 3GYRA 4UM9D 4GFXA 3QXDA 1EJOL 4KKRA 4IRSD 2I25N 1RZPA 1IB5A 1U3HA 3U2SB 3UBXB 4LOFA 1WFOA 4GRWH 4RAVA 2OYKA 3LPGA 4JFZL 1ZLVK 1F18A 2FX9H 1T5WA 3M07A 3W2DL 2FHFA 3AUWB 1CGWA 3T9WA 4YDZA 4EKJA 5D1XD 2J2ZB 1IFGA 1I7UA 5DEFB 1U91B 4WVRA 4AW7A 3KR3H 1M57B 2WO4A 4AQOA 2ZSWA 3QEUB 3SQBA 2WOBA 3CH1B 4NLAA 3WUWG 4U49A 5J56B 5AD0A 4UU9A 3TBWB 5HJ3B 3OB0H 5IWLC 3MRBB 2VC2L 3WMSA 3F85A 4HU2A 3K81A 5FGCB 3RVWC 3CSGA 3VI4E 2P8LA 2FD6H 5HI5C 3H2PA 2AEWA 4LCWD 1NDTA 3GM8A 1II4E 4AGPA 2X4UB 1F00I 4L3CB 4YHML 5GGUA 5FOJA 2XPGB 3CN4A 1HQ4A 3REWA 5SV3A 1JMZA 3MLXH 1ZLUK 3IAGC 1ILSA 3V7AE 5C7XH 1GKOA 2F8XC 2L7QA 2CPUA 3IJYA 4J3SA 4AT6B 4Q4IA 1OCRB 1GRWA 5E8NB 1MWAL 4ABWA 2MQ0A 4HISA 4KXCA 3SDDD 2HN7B 1RFDL 3X14A 1GC1L 3U4BH 3V0VB 4I89A 4XXDB 3LRGA 1OSYA 2G75B 1A8ZA 3GPSA 2QGCA 1XCXA 4PR5A 4O2CA 3T77A 2WQVA 2IBBA 3EJPA 3ABKB 1HHIA 2XLLA 4B7LA 1FNFA 2UWEA 3TH3T 1T5KA 2K6YA 2YGOA 3D3VE 4D2NA 4PSRA 1S7SA 1T1WA 1R3HB 2CKBB 3B3BA 5C6PB 1TJGH 1CURA 1LNUA 2DEWX 5LBSA 1UA6H 3QDAA 5BQDA 5LXGH 4FNLL 5FW6A 3IXTB 2ICWI 2F1AA 5DRWB 2PYED 1OM9A 2K45A 3W9EB 5CILL 1GW6A 3NGBC 1JPST 3NQIA 4FLRA 4ANKA 2IPUG 2D9QB 4C55A 1MCBA 4MJHA 3V52H 5JTWA 2P8PB 5FOBA 1S9WA 2ZOUA 1PG7W 2JCCF 1EA9C 4X7DC 2EINB 5BV7H 4FNLH 3UBXA 4XNYL 4RAVB 3H4FA 3DPBB 2DKSA 1FLRL 3CHSA 1G4RA 4BXSV 9CGTA 2YOAA 1UD2A 3L13A 4CN4A 3NIFE 4Y16C 5T3ZL 3W0WB 1EWHA 1SLWA 2A6IB 3OQRA 4YIQA 1D7CA 2ENQA 2WLMA 1FE8H 3QUKB 4PWEA 2IGTA 1DLFH 1PLBA 4ZUVA 3WGVB 5HHPA 3QIUC 4P5MB 4JKNA 4PPTA 3ZR5A 3SKUD 3T0DA 4UU9B 1MCWW 1IM3B 4MDRA 5C0BA 4YGVA 2C7UA 2GK0A 1IKNC 1D7FA 2P8LB 3JZ7A 5EO1B 4EMZA 2XWTB 4DKTA 2WB7A 1E2ZA 1U8CA 5DJ2B 1MFEL 1JZEA 3SB3A 2XI9A 4BFKA 2BW4A 1JERA 4Z7VF 2WLIB 4BZ2A 2VQ1B 5I0XA 1KBGL 5C0DB 2FSEB 2X2JA 4K94H 3BZ4B 3HMXA 5CBAB 4P23B 2RCSH 3N42B 1SXZA 1PX4A 2WZ0A 5KANG 3VJ6A 3WY3A 1MCRA 3X3GH 1LO4L 1EZUA 3OHXB 5E8NA 4K2UH 4J39A 2JXMB 1IARB 1Z9SB 2Y7OA 5KYYB 1YJDC 2F7IA 4HPOL 2MNWA 2IFFL 3G9VA 1F4YH 2VJXA 4WHYG 2YMXL 3QI9B 1G7MB 5D1QB 2EQDA 4DEUA 4XXDA 5GGRY 4UOQA 3DVNA 1KV7A 4O2CB 1HHIB 1SM3L 2DS4A 5E2VL 3HFFA 5IVXF 5CZRA 3O3UN 3MRHA 3HI1A 2ZXEB 3MACH 3MLWL 3WDIA 1WJ3A 3LRHA 2WCPA 3MZGB 3CFJB 4NZUH 3GJFB 1AZNA 1WPCA 4K94L 1JG9A 2X12A 5I6XB 1KCKA 1UACL 2SODB 4KKLC 4ZMNA 4WUKH 2X9WA 3LXUX 4D9QD 1QBLH 1DVXA 2VLLB 2VDOB 2J8UF 2GT9B 1ET8A 2I85A 4FFVC 3SY0A 1KF9B 3MRPA 1BM7A 2NXZB 4HXAL 1FNLA 5FOBB 3O3BA 2FEEI 2PN5A 1KGWA 3B9DA 1O7SA 3VRLE 2HUHA 2X3CA 4OB5L 4YDLC 2H5UA 4AMWA 5A2CA 5I6KA 3VXRE 4OKDA 2V4LA 3FT2B 4L1SA 1MCIA 5ETUB 4APXA 3FU7B 2HRPL 3G6JB 2CR3A 3QUZB 5KW9H 2LLLA 1F6FB 4AYEC 4ODHL 4TSAH 5IHZB 2G2RB 4P59H 5HHPB 1R0AL 3II2A 3OWRA 2XA3A 5HYSA 1T5XB 5C3IA 4YXLL 3WFEH 2J43A 2BZCA 2V3FA 2JQMA 1DQML 1JHLH 3RNKB 1OQOA 1HSAA 3O9WA 1WS7A 1I8LA 2W59A 3ZKSD 1UXWB 5DHVA 4O58L 1J9RA 2WLIA 2XXGA 1MFNA 2HJKA 3HZ3A 3D3VA 1WC7A 4HKXA 5G5DA 3PQYE 5TFSH 1GHFH 4OZFH 3MUY1 5JHDE 4HSCX 3VI3A 2HKHH 1M9WA 2CBQA 3RTQC 2AVFA 4PJCA 5EOQH 2ZCKL 1MCWM 1MREH 1XTMA 5LBVA 5I1LB 2BSSB 3OHXA 5HDBB 2JXMA 2VO8A 1BQHA 3DJ9A 4NCDA 5L4JA 5EZJB 5IB3A 3FU3A 5TK2A 4LKCB 1G43A 4MAYB 1T0OA 3K6OA 4LCCC 3RL1A 4AKQA 3EDJA 2GJZB 2J57A 4LDEB 5B4MC 4WDIB 3OM3B 1DQJA 1HXYA 2YN3A 3E80A 2J4WH 1AXIB 4I2XB 2CKBL 1WZAA 2BY2A 4L4VD 4ODXA 1PTZA 5F6HJ 1HHGA 1RD6A 2E8YA 3MRHB 3QZOA 2B14A 4G80B 1HINH 4PGZA 4JCWA 3IKCA 1LEGB 2F53B 4H40A 5FYJL 2YRPA 3AUVA 4E9YA 3BI9X 4Q9BA 5HI3D 4WLCA 2X1PA 1JVLA 4ZTEA 3ZRSA 1BJ1H 4Y4FC 4HIJA 3L3IA 4QRPE 3P54A 4NO0D 3C6LC 4KDWA 1K85A 4H8WH 5IGXH 5LDSA 1OSPL 1YYML 2QVKA 1D6VH 2LU3A 2EH8L 4HUUB 4EOWH 1PKQA 3Q2WA 5E2WL 4EPSA 3QEQE 4L3FA 3SPCA 3O3BB 1XGRA 2GJJA 2P44B 3FBQA 3HHRB 3L6FB 4YFDB 5KS9E 1YEJH 2X7LB 2F5BH 4LPUA 4XMPH 1DANT 3B2VL 4QXVA 5IMLB 1NAKH 4FQLL 5IROC 4IHOA 1Y6KR 1JK8B 2X10A 2PXYC 3L1OL 2J21A 4J3OF 4AL8C 4YSQA 1FF5A 3VB9A 4OZHF 1OAQH 1A8JH 3IGAA 1A4JA 3GZOA 1Q72H 2IQAA 3A4EA 4C54A 4FQQA 3BP5A 5GGTH 3QIUA 4Z18A 2XTJB 3RGVA 1EEYA 2EYRB 4P05A 4LLQA 1F1DA 3ILQC 3LEYH 1FC2D 2JJSC 4XMZA 25C8H 1DYZA 3QHZH 3T0EB 4ZPVA 1CF1A 3V5KA 3K2MC 4LCWE 1R3IL 1E7VA 3EUUA 1P4IL 1OEZW 2GFBA 3OAWA 3PWLB 3QO0B 1XGTA 1ETB1 4JN1H 1TTFA 3T6VA 3UC2A 2X6BA 3UZVA 5GGTL 3GXTA 3NSJA 5IB4B 2QV4A 3MO1B 5DHVB 2JKSA 3W0WE 1OAKL 4KO6A 4WRLA 4A39A 2NPLX 5D7IF 4D8PA 3D3VB 1VA9A 4GO8A 1NCUA 1A4KB 4L4VB 4BV1A 2APBA 3IPBA 2VDLB 2I24N 4H0LC 1JWUB 4M29A 1DQIA 1QLEB 4FQCH 4AEIL 2ZKMX 2IWEA 4M4PA 5KSUA 1TZGL 4R4ND 5F7NC 2GTZA 3E3QE 2ICWB 2XIBA 3MRRA 2PW1B 4OV5B 1E4XI 3NJNA 3CCHB 3LIUA 5E6IB 4YHNA 3MRJA 4WHCA 4X0KB 3CZFB 1F3DJ 3DSFL 4G5ZH 3N1QC 2BY0A 3ZTEA 1EZLA 4W4NA 4FXGA 2P5EE 4JRLA 4OQ1A 1QO3A 3TIDB 4DN3H 5JOFB 1UXSA 3IKCB 4W1TA 3GB7A 2N3JA 4GKOA 4PJXA 1LMKA 1KN2L 4YNYA 3BT2L 4MD5B 4K9JA 4EDXA 3IU4H 3ZHFA 12E8L 3L3KA 2BK8A 1XEUA 1RUAH 3EH2A 3QZBA 4N1HB 1UM5L 4F3FA 3PXJA 4P4KC 1PKQB 1XR8A 2CUMA 2UX7A 4P49A 4UV7L 3CQQA 4WJ5B 2O5YL 3TPKA 3C75A 3BGFB 4KPHH 3F00A 5H4YA 1CF8L 3RL2B 3IVKA 1GY2A 2ZOKA 3MLZL 4MXQC 5AVXB 4DFHA 5KSAB 3ABGA 4Z8FH 2ADYA 1D2OA 2Y24A 3KNBB 4ZXBD 3U1SL 3T6WA 4B9ZA 4FAAB 1J5CA 1DVUA 3Q9QA 1MIEL 3TA3B 4YWGH 4JO5A 5ES4B 3CUPB 3EG9B 1T1ZA 3DVGB 1N4XH 4UILH 1CTMA 2K8QA 4HUWA 2WSDA 2I7SA 1YSOA 3BP5B 2WBKA 3RB7A 4B5ZA 1JF1B 5GSRB 1A14L 4P57B 5BQ7A 1ERNA 3P9MA 3KCPA 4XAWL 1J88A 4LLQB 2OSWA 3VI3E 3HE6D 4XO9A 3APCA 3V6ZA 3T0EA 3K71B 1A7QL 4XP5H 3V10A 1R47A 1OZTG 4L5FL 4EQ2A 5H4ZA 5I76B 1MZZA 1JGUL 1S3KL 2Z6FA 2FO8A 3WEXB 2FJFA 4WSJA 5CR8A 1JN6A 4JREB 4LAQL 3RY5A 3CFIC 3HAEA 2K1MA 4F80A 3X3GL 4CMMB 1U92A 3PWVA 5F96H 2UY6B 3O45B 2PWFA 3L4ZA 4OCLC 4ZSOE 4YHLL 1RJYB 3NCMA 4NX0A 5AVZB 3GJEB 1A4KA 4MJ6B 1AVAA 4LSPH 2AV7B 2P9RA 3GSWB 4PW9A 4QHNA 5AW6B 4DW2L 2EYTA 3BH4A 1MI5B 1U8MA 2ESVE 1QQDB 3H9SE 4K7FA 1Q1JH 1CT8B 5C0GB 4CSSA 5F7BA 1G9NH 4GMSL 4MMYA 1L9RA 4HMEA 5L4FA 1JGVH 2AZUA 1PD6A 1G7PB 3EGSA 2E7MA 2GTZB 1MWAA 2NZ9D 1QVOB 1F4XL 5AW5B 4R3SA 2AEIT 4KK6C 4N0FA 1FRGL 2E9WA 2VXTH 4HIHA 4LSPL 1X6LA 4XN2A 1NMCC 2WYTA 3MDJA 3PQYB 3ZE0B 3KBEA 4C4UA 1JYNA 1UD8A 4PP2B 1MCDA 1UC6A 4YEEA 5IF0B 5K93A 5E7BA 1X44A 5GRJH 4ZUWB 5ICXB 1RLWA 4PI0A 2AJZB 4ELKB 1CFTA 1R3JB 4WNSA 1FLRH 4OLUH 3VXSB 1Q9WB 2ZSVA 4F9PA 3Q5OA 4JDEA 1J0YA 2UX6A 3JV6A 4X6DF 4YHPA 3K2KA 4LP8A 3VXMA 4O00A 3RTQB 2D0HA 2PYEE 1HZLA 4P99A 4JY5H 5FLVA 2PCFB 1W0VB 2RJMA 2IOIA 2QTEA 5JOEA 5DSCA 3KNBA 4E9LA 1LO2L 1BDYA 3OWEA 5JW5B 3NSDA 5CBEB 2JKTM 4G3YL 2XVGA 1KPVA 1UCBH 1R6VA 2GUYA 2EXWD 2AXFB 4XNMB 1NQBA 3CLEH 2BNUB 3O8XB 1CF8H 4HJEA 1JF1A 5GSRA 4GLRH 4FD0A 3RKDC 3WEMA 3U7WH 4DGWC 5BQ7B 1JGIA 5FYJU 4LLUA 3S36X 3HBPA 2C5DC 1QP1A 1TPXB 4KJPC 3B6SA 1XGQA 3P0GB 1MI5D 4M8VA 4JY4A 4OSUH 5CMAA 2XYCA 5DWPA 2NY6B 3BIAX 1YN7B 1AGFB 3GXUB 3T08A 2J12B 5F89A 3ZW3A 3O6ML 3HAEB 4TUOB 4XGZA 3GGWA 3O2DA 2YGPA 4DKDC 1U92B 5DC0A 3BD5A 4W81A 5DK2B 2WQSA 4PJGE 1T89C 2IANA 4MJ6A 4ELDA 4U7KA 4AG4L 2EYTB 3HVDA 5HGHA 3IJ8A 5GRVL 3WNLA 3GMRA 1HH9A 4K7FB 5HYJB 2BIIA 1GOHA 4O5LL 1A2YB 5C0GA 2CR6A 4MMYB 2Y36H 1IEAB 4J4PD 3SDXE 4M93C 5JZ7C 2HRGA 5EORL 2VUYA 1KGCD 1OPGH 3C6SB 4MJIE 1OP3H 1QVOA 5JXAL 3P9LA 1KULA 1BECA 1TSHA 2X88A 2AQRA 3G5XA 3UPAA 5IB2A 4KUCF 1PCXA 4KJWD 4FA6A 1ZVSA 4HXBH 2TRYA 1MFBH 3T0XA 2YPKA 2VZUA 5FAAA 3KLSA 4ETQA 1GSKA 4DGYL 4OCYL 4I5BB 1LILA 2Y07H 3SGEI 2BP5M 2V2XA 3C9NB 4PP2A 2FTAA 2MEJB 5F7KC 3GBLA 5IQ9B 5D7LA 3LRSA 1I31A 3GSXA 2AJZA 1KWKA 1Q9KB 4F58H 2RR3A 4DETA 3U4BL 3ULSB 3QZPA 2ZSVB 3S3SA 2C9VA 3CZEA 3MI6A 2HJFA 3QHZL 3INUH 5T1LB 3ULVE 4H25B 1SHWA 4GY4A 3ABMB 1CFNB 1K8IB 4BA8A 5DT1H 2PCFA 4HT1H 4N8PA 4NHCH 4D9LL 1XBRA 3US9A 4OGAD 3WOVA 5PAZA 4F7PB 2VH5H 4QT5A 1GZHC 3WUWA 1QTSA 3TN0B 1KB5A 1T5WB 1XB3A 4FTVD 3C8HA 1HCYA 3DHMA 2AEQL 3EDEA 4XO4A 4QHUA 1FHNA 3Q6GH 1L3NA 2YSSA 3RA7H 2FLBT 2GVYA 3KH3A 2A9NH 1U8HB 2ZF9A 4FQXB 4E36A 1TSRA 1GXEA 2NUPB 3G04A 3FZUD 1X7SA 1ZT7B 3F84A 3O3DA 2B3RA 1XGQB 3PP3H 3QP3A 4GQRA 4D0DA 3FQUB 4APQB 5D4JA 2HX8A 3T04D 5C0IA 1AGFA 4P04A 1YQVL 3PNWB 4XCEB 1B4RA 1D3CA 4QTIL 5FYJD 2ERJC 2AJUL 3FUFA 3STLA 3Q2VA 5MHSE 5FYJH 1J1OH 2CJSA 2VN3A 2DJ4A 3BT0A 3ZE2F 2X4UA 4L3CA 4G7RB 1MW0A 2F5AH 2XG5B 4LL1A 4M56A 3REWB 1WD9A 1GZQA 1RUML 1UH2A 1YAZA 1YC7A 4L8CB 1VKXB 2BIPA 4NI3A 2B4CC 1XF5B 3UTPE 5AW3B 3BKJH 2IBZX 1GGTA 2A1WL 2IAMA 3KBFA 4H0HB 4NWTH 4XR8C 3G5YB 4OD1L 1IGIH 2AMUA 3G5XB 1ANUA 1E2VA 4JM2D 1HHHA 3G9AB 3TM6A 4X6FB 4MHHI 4BKSC 1NC4A 1OCWH 3OMNB 4ZNEA 4ZSOB 1GPOL 5E51A 4AIXA 5EZIH 4EI5C 1ETA1 2FYYA 3KYKL 5HXMA 4R5XA 1FVDB 1R3HA 2CKBA 3BVDB 5C07E 3BPNC 4NC0B 2NNAB 3QCTH 4XMKH 2DWSA 3OXSA 1BHGA 3UMNA 5IQMA 2DQFA 3VNYA 4HGWA 3WNPA 4A7VA 1H3GA 4QXUH 3LZQA 4BCXA 3P1VA 4JZOA 32C2B 2EKJA 4NSKA 2NT0A 1S7XA 4GQQA 4TN9A 2YJQA 1QLEH 1S9WB 3VD1A 4U1SA 4R9HA 2VDLH 2WO2B 1G9HA 3LV3B 4A7QA 4ZMLA 1IX2A 4I85A 3CX2A 5E2UL 1KYOJ 3QWOB 2ZOLA 3HMXH 2MRYA 1YPZA 1FYHB 1KTBA 4YIQB 2IH1B 5KJRL 3RWHA 4BSJA 4I0CC 4ZTPH 1E5ZA 2D2OA 1RZ7H 2GCYA 2G0KA 3O3AB 4RNRA 5KYUB 3AU0A 2BW5A 1ASPA 1H19A 2A9CA 3SPIA 1DJXA 2FH8A 1WK0A 1J5OH 1ZT7A 1XXDC 5I1CH 4ELMF 4ZO7A 4I3SH 4IBSA 1R5WA 1IM9B 3H2QA 2GI0A 4N2BA 1KPUB 1IM3A 1T22A 2AEOA 2GJRA 3X11A 4AENB 2DM3A 2KDYA 4XCEA 2J6EA 4GSRA 3QR2A 3EJQA 3OVUB 3L48A 3IGLA 3ZL2A 2N4IA 4EQ3A 2F58L 1NOLA 1XQ4A 4ONOA 3EDKA 3NABH 5DJ2A 3QZNA 4XO3A 3TJEH 5CZVH 5E9AA 3GK8L 5J6SA 5C0AB 5C08D 2XG5A 2FSEA 3RGHA 4FFZH 5AB1A 3VM7A 4LDCA 3MCYA 4TMPA 1U42A 4XOBA 3UTTA 1SJVA 1QW8A 3RI5K 3V0DA 4EUPB 4YXHH 1AZVA 3HN8A 3UAFA 3RYMA 3KW8A 1PZDA 1JRHI 4NXKA 1B9ZA 2DQGH 5L2KD 2CUHA 3H1ZA 5MEPA 1AYOA 2IAMB 4JRFA 3KPMB 3BP7A 3CSFA 4Y9GA 5CIPA 5EZOH 2ADFL 2CIKA 5FGCE 2OSYA 1ACXA 3QH3A 1G0YR 4NT6A 1ZVHA 3CSTA 4JG1L 1U95B 1FNAA 1I9EA 2ARJQ 3HKFA 3GS4A 2QZQA 3LAFA 2EE9A 3VMNA 2CO1A 1X5MA 5JHDD 1AXSA 4KITB 3LZPA 3P73B 3HZYB 3EAKA 3GJFA 5CO1A 3AXIA 2BSBA 3ARDD 3V0JA 5TGBB 1NGQH 3OXSB 5FUCE 5D70H 2YZ8A 3W39B 1PAMA 3BGAA 4OFKA 5AG9A 4EZKA 1UWXH 1A1OA 3L5XL 5HJDA 3FFDA 4PJ9B 2C9AA 3SY0B 2HT4D 3VFGH 2HPOA 3MRQA 1KCLA 1LYQA 2BVTA 5F3BB 3BWUF 1D9KD 3MBWA 4N2MA 4WK4B 5FYKD 2NY1C 4LARL 4DCQA 4N2CA 1EEZA 3WKQA 2WLYA 1ZVYA 3C8KA 3I84A 3LV3A 2A74A 2UVFA 1G7QB 3X13A 3HKZA 2HTKC 2XWXA 4OZFB 3LDBB 3NCEB 2H32B 5CZXC 4APXB 1A1NA 1Z5HA 3SKMA 4ZMPA 5JIIA 2BP0A 3RWHB 4QRAA 1YNKH 5EU3B 1JGDB 4YE4H 3G6JA 2GCYB 4LVOB 1UCBL 4XE0A 3F01A 4JFFA 5EO0A 3H3BC 3JTBA 3L81A 4P3DA 3WO4B 2BNRE 3N40P 4GYBA 3FB8A 4JFXA 3ECWA 3VFTA 3MAWA 1TENA 3IETA 3O0RL 5J1AB 2VDRL 4AENA 1NMCB 1YNLL 1KT2B 2HFGL 3OKEA 3IDMB 4CN6A 2VDNL 4PTUA 1AZUA 5C09E 2VSKB 1HSAB 4OGXL 3DIVA 3T2PA 1PX8A 4QHKJ 2EUZA 2P48B 3DNKA 4ODWB 1TJGL 3GPEA 5CFHA 2CRMA 2YMOA 4PRHB 2DQ6A 1KGUA 2BSTB 2XA8L 1QBBA 2HJLB 3EYOA 5E2TL 5C07A 2A5UA 3UAJA 3DX7A 4F8LA 4R4BB 1SFHA 3MRMB 1S8DA 2PO6A 3P02A 1OP5H 3NGBB 5I1LA 2N7AA 2IGLA 4L8DB 1M4KA 3FMGL 5AALA 1MG3C 1F5WA 1TVBA 2PO6C 5EC2B 4E2OA 3WXVL 3IXAB 1WHPA 2MCPL 2QHLA 4GUPA 4MRCA 4ZMYA 2IFGA 2YQ2A 1YA5A 3CK0L 3TOPA 2GYSA 1HJCA 1OPOA 1MWOA 1K9TA 1N8OE 4MAYA 4N2EA 2AMGA 4RH4A 2EXYC 3NQKA 1COBA 5IW6B 4N2NA 1WWCA 4PJCF 3LNFA 1DQDH 3DHUA 1LEIA 4XVJH 4MYPA 2HXAA 2PO6D 3UZQB 1IT9L 3V9EA 5EUOE 4KI5E 2UYLA 2Z93B 1NDMB 5D72H 3I9AA 5DFWH 3LPOA 3W39A 3EJCA 3RX7A 2OV0A 4TULL 5HGDA 5ILTH 1B2YA 3QJOA 5E2UH 3PF2A 3OAZH 3NACL 5BRPA 5I66A 3A21A 4CVXA 5CIPH 1AGDA 1N19A 3MV8A 4E41D 1PF3A 2IG2L 2AQ1A 5FHAL 5JORB 1A7PH 4LCWB 3SYOA 5DRNB 3C8KB 3VGDA 1IZJA 2TAAA 1OSEA 4RMUA 4BQCA 4OZFA 1U2YA 3GXDA 2AP2A 5EU3A 3WLWD 5EHFA 3IGAB 3C08L 4GH7B 5IFAH 3QIBA 2XBDA 4NYLA 4Z7OE 5GGQL 4LGPB 5HHXL 3CFKA 5B1KA 1YRKA 3CC5B 3RGVB 5DD1L 1CFQA 1MAML 2JI3A 3CVHB 2Y5EA 3F12A 4P2OD 1FC1A 3PAYA 1MCFA 5C8JA 2VW6A 3FUDA 3HAEG 2F8OA 2J6EH 2PTTB 5HI4C 5A3ID 5LJYH 2O5XL 4ZPVB 5DS2A 1NFIA 4PJ7E 3V5KB 5LGHH 3VXUA 1I85A 3FCTB 3GRWL 4AGNA 4AJVA 5EEUA 4OD1H 2HTKD 4Z76B 5F1NB 4CGUB 5B1AB 3S2CA 5F8QC 3FUKA 1BFVH 4PJAA 3B8SA 2NY1D 4OZIF 5HHQA 2HVJA 2VDKL 4NEHB 4HS6B 4JHZA 2HT4C 3DETD 3RWDA 4A2MA 5FYLH 2OL3B 4LSTH 4ZFGH 3EYOB 5I6MA 3BIKB 3BWUC 5AOJA 2F5AL 3L5WA 3L7FB 2PO6B 3EOTL 3UO1L 1BJ8A 1CG9B 4L8DA 1L7IL 2TRHA 2J88L 1FI8C 4JL1A 4YHIB 3HFML 1WGOA 4HOZA 1P53A 1J8HE 1VJSA 4PGCB 3RILA 3G6JF 3QUGA 4HZAA 4UOJA 3U9WA 1LVEA 3D39E 2WAHA 3MRJB 4X0KA 1Q9LB 2OZNA 2VCOA 2DEXX 4XNZB 5K39B 1LEIB 3EFDH 1RJCA 3LOWA 3FFCD 4FQIL 4GRLD 1G7IB 1E90A 1YEDB 5CUSL 1IC5L 3BW9A 2PCXA 4IOIB 4TNFA 5HHMD 3V5DB 5EZIL 1SHMA 2QHRH 3GI9H 5JQHC 3CJJA 2V2TB 5SWQB 4ONFL 3MRKB 4DP4X 3WFZA 3L3KB 2OTPA 1J8HD 2WXPA 3Q2NA 1VFAA 4JPVL 2VH5L 1JYXA 4P3CL 5D7JB 1NGZB 4ZD3L 5AWNH 1ZDQA 3S9DB 4GUQA 1A9BB 3L95B 1TETL 2YD4A 5BW7A 5J13C 4P2RD 1OTUC 5SWZE 3ROLB 4EBQL 3SPJA 1AHWC 4WI0B 2VDOH 2OLDA 3IVKB 5DJDA 4U33A 5ACLA 1NBZB 2EE6A 3EKCA 3VO0A 3WKNA 3UCRA 2ZKHL 4OJDH 4JGMA 4ACPA 3KZ8A 1OTSC 3EG9A 3I3EA 3UPRA 4U2YA 5IZ7A 1DBMH 1KN4L 1LLAA 1J1OL 4HUWB 3DKHA 4PTTA 1N6VA 1NLDL 4OLYL 5GJSH 3LPWA 5AVWB 1E5UI 1BLNB 1KCUL 2X70A 3B2VH 1PQZB 4OLEA 4R7XA 3V6ZB 4LXFA 4FC3E 3KPNB 3IDXH 4JLRB 4ZS7L 3OSVA 3MLVL 3BE1L 1FO0A 3T4YA 4F7EB 2CK0L 3TURA 3IDYC 4PJAB 4A7GF 1G0DA 1MLBA 2DMCA 2EJ1A 3GXFA 3QS2A 4CMMA 1MCPL 3O45A 4HS6A 1VDGA 2W94A 3DGGA 3IDJB 2IBGA 4PRPE 3IDNB 3FT9A 2ZUYA 5F71A 1MHEB 2JLLA 1RSYA 2EDXA 4X5XA 5F9WC 1KB5H 3VRIB 4F7TA 1H15A 3RG1C 4MX7B 5KUKA 1OAXL 5EUKA 3KWTA 2CJ3A 4NUGL 5JW4M 1MCEA 2IOMA 4JKLA 4QJ5B 4NRYB 4M7LL 2M2DA 4YDIL 2GBUA 4BUHA 3MBXL 3M45A 3NJMA 3CDYA 3DJTA 1RV6X 3GBDA 2JNZA 3D06A 3CN0A 4HF5L 5I1AB 2P4AB 5JPMC 2CO2A 1IQDA 1LQSR 4M43H 1X7QA 4M3HA 4Y9EA 3IMTA 4WWOA 2PABA 4N87A 5IJCC 1DJWA 3MBEB 2B0SH 3BHBB 3BOVA 2W0PA 3PQYA 1G7IA 2APWA 3QYMA 2CBTA 3SDAC 4KROC 2K7PA 4M3KB 1ETZA 3QUYC 1MCKA 1GAFH 4NFBA 4FHJA 2OFQA 5EEYA 4HUCA 7FABL 4F91B 2ZUXA 2QLYA 2WQXA 5IT2L 3D48R 1DSWA 1UG9A 4RZCB 5AB9A 1X9UA 1T0MB 3B4NA 3N85H 1LO2H 4CILA 1A3RH 3AY2A 1F97A 5IMKA 4FHBD 3TA3C 3CV5A 2C3XA 3KCWA 4CDGC 3C60D 4C56E 5D1XA 3QEHA 1AZRA 4XVTH 2E7HA 4JY5L 3ARED 3U1QA 2EDTA 1CFBA 2BCKA 3NA9H 1YY8B 4X50A 4QI3A 3ROLA 1W0VA 4YSSA 5L2JA 4WI0A 4L9LA 1JZ7A 2E7LA 1VFBB 4NN7C 2O5NA 2EDKA 5F6HI 1OLLA 5JW5A 1KBKA 3P4NB 3QQ9C 1OK0A 3HS9A 4QRRA 1A6ZB 3MLUH 1SOQA 5L7XH 2XNAA 2YD5A 1B4LA 2OQJA 4J3XA 3F58H 4H1LA 1JNHA 4FQ1H 4LSRH 5MEND 2WV3A 3N44F 4AQ1C 4AUJA 1EERB 1OARL 4YX2L 3K91A 4X7SL 1SYVB 3RVVD 4WENB 4PMEA 5C7ZA 5AVQB 4MNQE 2FGWH 1A9EB 1R4XA 5AYQA 7PAZA 2ZWYA 4G7VH 4UM9B 4TTGA 2XV0A 2A6DB 3ARFB 5E9DE 1L6ZA 3DMMA 3CZSA 4TUOA 4XGZB 1O6TA 1TJMA 4EI5B 1G7LB 3ESNA 4P23D 5CLYA 4E42A 1E5CA 2WBJC 4KHTH 2E47A 1C5DA 3LH8A 1HE8A 3N44B 4X7FC 5BVPH 2IH3A 2A0LD 2XWZA 5JUEL 1QACA 2OPCA 3TL5A 5HHXH 5MENE 1N10A 4GMTH 1N8ZB 1LK3H 5JHLH 5FYLE 1H15B 4KGJA 3VFRA 1T7YA 4Y19A 3H7BB 5KSBA 2CLRB 3FCUB 4MJID 3QSKB 1FZKA 4I77H 4KKCD 3U4EB 4QUOA 2ADGB 5EIIG 1LD9A 3O41B 2YOCA 3JV4B 3VFUB 5I1AA 1FIEA 2ZAHA 3P9LB 3HJEA 1K5NB 3P69A 4XPBH 5D5MF 2R0LH 5IY5B 2BC4B 4JFED 1KJMA 4GRMA 3ZSSA 4L2YA 1PBYA 1NOAA 4OT1L 5GS1A 1VIWA 4HFUL 4I88A 1NIEA 3FRUA 4FNQA 4TLSA 1OSZB 1SEQL 1WZLA 2QQKH 3A23A 3UJJL 3FO2B 2RCSL 3GK8H 3SCMA 1RZKH 3ZX1A 2GBAA 3IJ7A 3R1GH 4IJ3B 4Q6KA 1T0MA 2VLMD 4PJFB 3TTYA 2HT3C 4I1RA 4D0CB 5BVPL 3QDGE 1FNEB 4FYTA 2XACC 2PXYB 1E4KA 3QFGA 1BJMA 4RIRA 5T1LA 2WXRA 1JZ2A 2R2CA 4CGTA 4H25A 2QT6A 3QEHB 4KI5C 5E56A 1OF0A 5DJXA 3TFKD 3QORD 2YRLA 2Q86A 2RA1A 5AAWA 4H8PA 1W16A 2GSGA 2VMCA 3LDBC 4G5AA 4L9LB 3BN3B 1VFBA 2OTWA 4ZMVA 3B2MA 4NHUB 1R75A 3K74B 3LZOA 3TN0A 1KB5B 3ARXA 4MVBC 2MQ3A 4Z0XB 1FNSH 5KVFH 4BSVA 1ZT4A 1ZDSA 4DF9A 3BXNB 4ETYA 1AO7D 3BKYH 5F96L 4GQ9L 2OQJB 4DN4H 4XI5C 3DOSA 1JNHB 1BW8A 2BY3A 1JXDA 1U8HA 3GTVA 4FQXA 1DBJH 2ZUVA 3QIWA 4KY1H 4NCC1 5AB0A 2H2SC 3G04B 4F9LC 4WNQB 1DQQA 4LSUL 3Q13A 1O9VA 2DQIH 5IR1B 2ZUSA 4XB7A 1WRFA 1DVSA 5DZPA 4XCNA 4H4NA 1JXFA 3WGUB 3VGAB 5I18L 2FX7H 1KNOA 5CJQL 5EU6B 5C70A 1QA9A 2FWOB 3UTOA 2B4CH 2WPGA 4P0DA 1ZANL 3VSVA 4BCYA 3B3IB 2H3NA 2Z8RA 5AZ2L 3HHSB 4EAEA 5DUPH 2L8AA 4Z95L 4NQDB 3KMDA 1RK7A 4JO8A 4CSZA 2ORBH 1NTDA 2HWZH 1EGJL 5KBPA 2DPKA 2WK2A 4QTHA 3DRTB 5A2KH 4Z8FL 3VFRB 5ICYB 1LO3H 2OMYA 1SPDA 4POYA 3VGEA 5DD0L 1W2KT 3F05A 3FUJA 5D96B 4JFEE 1GS6X 2XV2A 2GIMA 2VXVL 3O8XC 1I7TB 3LZNA 3JV4A 5GS0C 3G5YA 4J3OH 2A1WH 4DQAA 1SBSH 2OR7A 5L0QB 4YX2H 1IM3D 4LL4A 4X6FA 1JTOA 4M7LH 1T1YB 3H56A 5E6UB 1RUMH 2HLFD 1OHZA 3DVIA 4NUGH 3GSNA 2HA1A 5BS0B 3VW3L 1UT9A 3G5WA 3JWNC 1WZMA 4K55A 1FVDA 1AGCA 2DIAA 5FCUH 2UZXA 6PAZA 2X4OB 4HS8L 3K1KC 5C08A 4PG2A 1E6OH 4LB8A 2OMXA 5I1EL 3D9AL 4H8UA 3J7HA 3BQUB 4XXWC 5L2KE 4FXTA 2P5ED 2YD7A 1FNEA 2A38A 4PV1C 3SDXB 4UQDA 1BAFL 4B9KC 4RIRB 1YVLA 1EANA 4UINL 3STZB 1SOXA 5EBWA 2VLJE 4LPVA 3BFOA 3L4XA 2VDQL 3MXVH 4KTEH 4PG9B 4FQCL 4R7NA 4MZIA 3HUJF 5DEJA 5EZPA 2Q86B 2ADFH 4NBZB 3L1EA 4OJCA 4Y5XB 3ULVD 1TCMA 4KXDA 4QF1B 4OIBA 4YBQD 2BWDA 3QWOA 2K8MA 2ZOLB 3APDA 4G8GB 1ZA3A 4JQXA 4ZMAT 3L9RA 3PHOA 1FH2A 2OL3H 4U3HA 5LO7A 3S3BB 5IKCB 3HE6C 5I73C 1I7ZB 2G3NA 3S5ZA 1ULVA 3O3AA 4HZ1A 4MGXA 3QIWB 5E5MA 2XU9A 3OJVC 4HT1L 4QKXB 3H3PL 3SJVD 3ILEA 5E1GA 2J25A 2V7HA 4AVKA 1PLCA 4G6KH 4Y5VA 5SX5H 4H26B 1EV2E 1R5WB 2XIIA 4TSCH 5BO1L 1J1XL 1KPUA 1T22B 2FJGB 1RZJL 4HD9A 3X11B 5HDBE 3LB6D 2ZPKL 4UTBH 4XOEA 4NGHH 4HQQH 3VI4A 4FJYA 3ARFD 3F3HA 1QA9B 3SPVB 5HJBA 2H3NB 4UDTB 1XEDA 4N2IA 4U1HA 5D1ZI 4JREC 2WLLA 4WFGD 5D7HA 3BEWA 3CPUA 3L1OH 4QHPA 1MUJA 2YS4A 1RZ7L 4WI8A 1GYVA 3P0YH 5MEOA 1TMCB 4X0NA 3UTTB 4ZFOL 4G8FB 1FNGB 1ZT1B 2N0KA 1JS4A 1T1XB 5E8DL 3MKGA 4OLVH 5JXAH 3UGEA 4OIIL 3WIIL 3KLKA 1GJUA 1XZ0B 4MS8C 5MEPB 3ZO0A 4J4PA 1B2WL 4F2MB 5A6IA 5MP6L 3KPMA 3LNEA 4WEBH 2Y4SA 1JHLL 5CIPB 1DQLL 1KCRH 3MNZB 1J10A 1QFWI 4M00A 3QH3B 1UADC 4QAMB 4JFYB 1JYWA 4Y2DD 1T1YA 3CU7A 4OLYH 5DA4A 4ZX5A 4YO0B 1C1EH 2OW6A 5EOCL 4I3GA 3GSNB 1RZ8A 1QR1A 1QUNB 5LBSL 1SYSA 3VXTB 3EJZD 4F24A 3EO0B 4C83A 4HX1A 1MRCH 5TGBA 4OCMC 3RWGB 4KFMA 3VQMA 2BERA 4UYPA 2XJKA 3SDXA 2UZYB 1A1OB 4NPJA 4KXZI 43CAB 1A02N 4PJ9A 4GAFB 2IPUK 2WMPA 3MJ9L 2DRUA 1ZSDB 3MRQB 3AM8C 5F3BA 4W9IC 1NSNL 4FP8H 4N26A 5J12B 3QDGD 1RUQH 4N6RB 4HVBA 3LHAA 4HWBL 3BSGA 3EH1A 3GMOB 3ZXAC 3IJHB 3P77B 1OOAA 1U9KA 4QF1A 2MNJB 1P5UB 4ECNA 2F8VA 4PB9H 3HUJE 4A67A 1IC5H 3PHOB 2IMNA 3O6FB 5CSBA 1JGDA 5D7LE 1I7ZA 1SUJA 1SQ2N 3UX9B 1I7UB 4YLCA 4L1DA 3LXAA 3VGGA 2VWEE 1RHFA 1KG0B 3NDYE 4P3DB 1E5AA 3ZDYF 1UOVA 3QEUA 3CH1A 4H26A 2AZAA 3Q3GA 3IETB 2VDQB 5C0BE 2C9PA 4JHAL 2FJGA 3TBWA 3V0WL 4JFEA 4PY7B 4R90L 2ZOOA 5FHAH 4JAMA 1V05A 2IG2H 1KC5H 1NGXA 1BGXL 3T3MB 2OR9L 4ODWA 3N42F 4BSWA 4YFLF 4HK0A 1AI1H 3U48A 2ODIA 3CXHJ 2XPYA 1L0XA 1OGAE 1KLGB 5CEXA 3ALWA 1UJTA 2HJLA 2YR3A 2H6PB 3T0WA 3DX7B 1YJDH 4PJIF 3MJWA 3MRMA 4G8FA 3IE9A 5DMJB 1KEML 5C08E 3DIFA 2ZT9C 2X1XR 5DD6A 2NY3C 4FDWA 4CW1B 4OVVA 1XZ0A 3GRWH 3QHFH 4I13B 3ZZQA 3C5SA 3QE5A 2BP8A 4RFNB 3ZL1A 4ZMZA 4YDVB 2AJYL 4UUJA 4K7PY 3V0VA 4JPQA 1Q1JL 3VWJB 3B1TA 1OHQA 2HT2C 1UACH 1ZWIB 5IW6A 2V17H 2Q8AL 5CCHE 2B1AL 4NOFA 3N41F 4HMCA 5J3HC 3ZKMC 4N8VG 2FWLB 2YD6A 1GYAA 4X5RA 5FDYA 3KXFA 1SMOA 1BG1A 4D7PA 4OAWB 4O9HL 1NDMA 4XC1H 3RZCD 1LNUB 5AVRB 1FZMB 2B59A 4YOKA 3RTQD 3RPIA 3LRLA 3QPKA 3GUFA 4X4ME 3RAJH 3BQUD 1OT1A 1TQWA 2UZYA 4ANVA 2WW8A 3EH5B 43CAA 4RWHA 2IF7A 2I26N 4FS0A 2WMPB 5F9OH 5I0DA 4OCXH 2VDNB 2H2PC 1LJMA 2DI9A 4QO1A 4ABQA 1OD7A 1GTFA 4QRPD 4PW3A 3RDTD 5DJZA 2UY7B 1OF2B 5HYIA 1U4EA 5IREA 4PBDA 5E6RB 2CLZB 3WN5B 3L2LA 4KRMB 1HQRA 3TT1L 4CVZB 1PY0A 2K3TA 3MLTB 1IT9H 1PG7L 1VFMA 3SGJA 3ARFC 3NJIA 2CPCA 3U1SH 1PS3A 3FFCA 2FDBP 3FYEB 3QUKA 3K0WA 1HHJB 1B88A 3QIBB 1U8PA 5HP5A 4DGIL 4X7CC 3RVVC 3BKCL 2NY6D 2WBXA 3HS0A 1REIA 4ZUVB 5IQOA 4BKTC 1F90L 1NL0H 1VENA 2XWCA 2OMWA 1IMHC 3SJVB 5FO9B 4R5TA 3PL6D 5C8JB 4XP6L 3F6JA 2B5IB 1V7NL 3FCTA 3NSFA 4PY7A 2ATKB 3TCXA 1BQSA 3FFOA 4I48A 1OGAD 5DURD 4YPJA 4K8RH 1QTYT 5DC9B 4L1HA 1FE8L 5AYUL 2QL1A 2EDBA 2J20A 1AYRA 2P52A 4M62H 5BW7C 4FFVD 1BWMA 2Q20A 2KC0A 5AVSB 4MXWH 4V33A 2CBMA 3WENA 5DD5H 3RFZC 3ZE0E 1BPLB 5JHMA 4JFOA 1E2WA 4XNYH 1I8AA 2EECA 3FBKA 3HC4L 4LVOC 4N8VB 1UOWA 3GUTA 3R8QA 3LKRA 2Z3FA 4WCYH 3SN6N 1IJ9A 1A6WH 5B7FA 3PY9A 4CW1A 2OMZB 2WXMA 2GW5A 2VR9A 4B9GA 5ERWA 2ZUWA 3WNIA 3C5SB 1LO0L 1Z9SA 1WZKA 4OGAC 5F3HB 5I23A 3IN2A 1RL1A 4DGVL 3MGAA 3BRDA 4OJYA 2VLJB 3HRZA 3FF7A 4P2YA 3VWJA 4GW1A 1HNYA 4L05A 4WJG3 3DVNB 4DK3A 5GGSY 3OXRA 1FFNB 1Q9LA 3CPLA 5ABDE 1T21B 4OLZH 1KUMA 2ZG1A 3TFBA 4MA7L 2IGFL 4DP1X 3ALXA 3LN4A 3EYSH 5GRJL 1MNUH 3D51A 3U82B 1QLFB 3UTZA 4WV1A 3CFJA 3V6FB 1KJ2B 4PHZA 3PDGA 2NXZC 1UQSB 2AANA 3WL9A 4FFWD 5T1DL 5D2LB 4CSPA 2CO6B 3GKWL 3F6LA 4OZIE 3NABL 3BJ91 5G4MA 5AAPA 3QEQA 1YNTF 3D7PA 1A6UH 3ILPB 4JDVB 4LVNC 1VCBC 2UY7A 4DEPB 1BMZA 1K5WA 3JYCA 5F3FA 1L7TL 3IMBA 2CLZA 3UYRL 3IBOA 5L9DH 4Q9QH 4N0UA 2O30A 1UATA 2VLRA 4J4PC 2Q3XA 5ETUA 5F2FA 3FQTA 4RFNC 1WFJA 3QDMD 5T3XL 4LVEA 1NGWB 1NBVH 3FU7A 3RU8H 1OTTC 1U3JA 4L4TD 4CMHB 2NY3B 1E3FA 4HLZG 5CCKL 5EMYA 1CGSH 4N8CL 3VSQA 2NY0B 2FUQA 1CLCA 2HAZA 1Z66A 3ZQWA 1T5XA 2E4TA 4A66A 1BF2A 1PQZA 2H0FA 2YN5A 4EOWL 1RPQA 1TNNA 3IDXL 4YHYB 1NMBL 3KPNA 4JLRA 5I6XC 3P3UA 1RU9L 1NUFA 3BC9A 4XI5D 1FZJB 2OMTA 1F02I 2CXGA 2GPZA 2ZX7A 1K2DB 1DBML 4XO8A 1UXWA 5FC9A 3TASA 3ERXA 3IDJA 4OI8A 1E6JH 1MCQA 3HG1D 5EEZA 4B27A 4HETA 4PM1A 1WIOA 1QTPA 4JM2F 1S9KC 2CWRA 1OAZH 1JF6A 3KL0A 2ICEA 1C5CH 4MX7A 2QDVA 5EFIB 3I50L 4KI5D 3PJSB 4IBTA 3LKRB 3NRQA 4WW2C 1KTJA 1E4HA 1HX0A 4XBEL 2OMZA 3ZE0F 3QQ9D 2E56A 2DIJA 5ERWB 3ZHKA 5JIKA 4EZMA 3K6IA 3WS3A 3WV0A 5EZJA 1N2RA 1I3RA 5TK4A 2ZCKH 3LNDA 2O5YH 1LO5B 1QBAA 3MUUA 3E8VA 2LU7A 3IYLW 4XZUA 1ROWA 1A65A 2OJEB 1X7QB 3C2SA 2HKHL 3FPXA 3KHOA 1FFNA 1HZHH 2GB2A 3UBFA 1OCCB 3MRCB 3CPLB 4TUKL 1HXYB 1JOIA 1RUAL 3QAZB 1QWUA 1SMAA 3QFJD 1HHGB 2CUIA 4Z7UE 3KLHD 1QOKA 1C5CL 1ETZB 1MXGA 2BVPA 5B3JF 3UTZB 4KY2A 1U8QB 4IIQC 1Z9NA 1KJ2A 3OZLA 1CYWA 3H85A 1S9YA 4JO1L 5DQJA 3UG3A 4N0RA 2EDDA 3QBTB 3U30B 2Z91B 2J5LB 1IAMA 4NAJA 3GZKA 4WHDA 4KKCC 1UUNA 2NSXA 2AXGB 2KH2B 1IBZA 3QEQB 4HUUA 1JK9A 2DBJA 3WKMH 4B7IA 4JDVA 2K6ZA 5DLLA 3JYBA 4L0ZA 4OCWH 2QQLL 4ZNCD 3RVWD 1XIWC 2AQTA 5FK9A 1RERA 1ZV2A 2BINA 2X7LA 4OW6A 4DPAX 3U9UB 1MF2L 4X9BA 4HWZA 3QQ4A 5J9PA 5LWYL 1FL3B 4UQAA 1U8LB 4QRRB 4IHOB 3FQTB 1SY6L 1PZCA 3TA4D 3MNWB 5I24A 1FLTX 1TDQA 3U9PH 3W82A 2R8SL 2IQAB 5E03A 1BBJB 2APXA 1UWXK 2FB4L 3HJ0A 3LVEA 2Q76B 3FB6B 3C6EA 3T0EE 5DHEA 2D3JA 2M26A 3VSTA 1J0HA 1L0PA 2RQ8A 4G42A 1B90A 2AJXH 4JJOA 4R0LB 5DT1L 5M94B 2ZX8A 2ENPA 3BLKA 5L8KB 1XGTB 1FZJA 4FNUA 4LVHC 4JGUA 5SX4H 1AMYA 5AG8A 1MEXH 5I6PA 2XG4B 1U6AH 1BOGB 3MO1A 2X2YA 4APQC 2KS0A 1AO7E 2IXQB 1TYJA 3F7LA 5KANI 1C12A 3D6GA 4XAKD 5CD3B 1G9NC 3Q7JA 4D8PB 1FAIH 3KPRE 2ESVA 5J57B 3LQAL 3SE4C 2ZOWA 2OL3L 5EFIA 3L16A 3LTVA 3NUKA 3H7BA 5KSBB 3KPSA 4HHWA 1DDTA 4FQLH 1OTSD 3U7YL 3U4EA 3P9WB 5IJVA 1H3VA 5KYNA 1IO4C 3ZT5A 2ICWA 4U1NA 3QXAB 4NWUH 4PJAE 4PAZA 3S3PA 2D9CA 3CCHA 3MA9H 3MRCA 1F11B 3ZMEA 1AZZC 3IRCA 1JNJA 1TR7A 5GGTA 4MXVF 3CVCA 1NJ9B 1CLVA 3L3DB 1IAKB 1CDUA 1FVEB 3IFLH 1G9MH 5LNGA 5F9AC 3BAYA 1UXSB 4JQIH 3EYQC 4PIRF 4YQXL 1S9YB 4Y4KD 3BVUA 4Y4HA 4YNYB 4BRVA 5GIRB 3C5JB 4ANWA 4MD5A 2LAAA 4EDXB 1MHHA 5CP7B 4FLSA 1A4BA 3UACA 4U31A 2RIKA 2X28A 3IM1A 5FA4A 4Z3TA 2IMMA 1A6UL 5HY9A 3VXME 4A1RA 3D69B 3O6MH 3DI3B 3WXVH 5CSGA 3ULUL 3PUUA 1XR8B 1WF5A 4OFYA 2J8HA 4XT1C 5DZVA 1AOHA 3QIWD 5HI3C 4BFIA 1ZHKA 1BQ5A 1ZOXA 5GGVL 3DK0A 4OSUL 3RL2A 3S48A 3MCKA 1QSFA 5IEHA 4NHUA 3QQ4B 1KTKE 4U1MA 3ATDA 1FL3A 1P2CB 4Z0XA 5TE6H 1G94A 3C5ZC 4QMEA 1ZSHA 2VZVA 3E8UL 3D08A 2FUTA 5GISH 3CLWA 5SV4A 2FRGP 1S78D 3CFQA 5EH1A 2Q7AA 2BZDA 5EEVA 3FB6A 1UCTA 2HLAB 4LGSB 2NY5C 3QPQC 5AEAA 3B7UX 5JO5A 2FEDD 4YPGA 2GJ6E 3NTCL 4TVSa 3NIDB 4M5YL 3SSGA 5I18H 5I76A 3DO7A 1DQMH 3BAJA 2DMHA 2YPVA 1KNOB 2EIKB 4PRIA 4WCYL 5C0EB 1YMHB 3VD2A 2JIXD 1BOGA 5CD5D 1AHWB 2HPTA 2YAEA 3JXAA 1O0VA 4MXWL 5I8EB 4I2XE 2IV8A 4TNVF 4URTB 2C4FT 4IU2A 3BVTA 5IVZA 3GSWA 4JPWH 4FTDA 4X6CB 2BHZA 4XN4A 5J6HA 2JFCA 1UTDA 1MI5A 1U8MB 4G8EA 5KBNC 5F8RC 4XBPA 3QJHB 1CVRA 4PGBB 4M9PA 5JHBA 1ZIBA 2Y06H 2JJWA 4F37F 4YR6A 4ZDHB 2QZ5A 5DGQA 3WFDL 4OZIB 3EJYC 2GBTA 4K4KA 1I7TA 1UZ6F 1G7PA 1I1CA 4PB0L 1MWAB 5EV7A 4I87A 4LLVB 4HXAH 3ZMRA 2V8MA 1TKWB 4TL5A 5ITBL 3ARDA 2HFEA 3A6OA 3EADA 5FV1L 3MKKA 3IRPX 1S4IA 3C6LD 1FHGA 1M1XA 5BNXD 1TLKA 3GIVB 1AGCB 2XZQH 5B7EA 4ZMWA 4FABL 4U3XA 2X4OA 1J9QA 1RZKL 1SJEB 4K23H 5LGJA 3MA9L 3H7LA 4HK3J 1VEPA 2QPEB 2P46B 1LWRA 1SXCA 1URZA 2R56L 2VZ3A 3US1A 3GIZH 1S7WB 3MLPA 1AQDB 4HFUH 2YBGA 3STZA 4W9CC 5EBWB 1E50A 2CCWA 3CFCH 4K9EC 4LRIA 4PG9A 3FQ2A 2O93L 5TDPA 3QXDB 4OLUL 4Z77B 3TYGH 2X09A 4FLOA 5CP3A 3GS7A 3RIFF 3K6SB 3OMIB 1PKOA 1QSFB 5IEHB 4W9DC 4MB1A 1ZS2A 4U1MB 4U1LB 5I28A 4DQOH 2X6UA 3MRDB 2NQCA 5CBEA 3W2DH 5HSFA 3RB5A 1GJIA 2FH6A 5D5ME 2AXFA 2QMJA 1UWEL 4LP5A 5JOPD 1IBYA 2YAOA 3OPUA 1YNTA 3TBVB 4ATTA 3A6BH 5ID0A 3O8XA 3F62A 2LLGA 5IBTL 3ZRCC 4OTXL 2HLAA 4KHTL 4XN5A 2V7HB 2X44D 1VCAA 4NIYE 4AVJA 3SQBB 2AJXL 5D1XE 1EEQA 1ADWA 2ZG3A 1ZGLM 2ZX9A 5CMAB 4UB0H 4KPHL 1UWGL 5CJOH 1F1GA 1BEXA 2YAFA 5IMMA 3O2VH 4Z5RA 4K94C 3VI4B 3CVBA 5JMOC 5JYMA 2FVNA 1M7DA 2OI9C 6FABL 4UDTA 3CXFA 5DDHB 4H88H 5DA0B 1S7VA 1IV8A 4KX9A 3MCLL 5I8EA 4NKIL 5FW8A 2JKLA 2IANB 2O6DA 1WBYB 5CFAA 4XCCH 3BPLB 5IVZB 5J6HB 3GSUB 5F97E 4BFNA 1AQ8A 4DESA 3OJMB 5HGHB 2WM0A 3LS5H 4CA4A 1X4ZA 1HH9B 1TLMA 1WAAE 4Q9CA 2R15A 1YO4A 1KC5L 5HYJA 3K4ZA 2QFRA 4P5TC 5IFJB 2QPDB 3IJYB 3RPKA 5CZXD 3PDDA 4M3JA 2JKWA 5CEYA 4F2MA 4DP8X 4POZC 3ZE1F 2WGXA 4FG4A 4IMKA 4F2FA 5BMFH 4UANA 1TTAA 3PJLA 2BDNH 3MNZA 3S88H 1IEHA 1D9KC 5DC2A 1E4JA 5CGTA 5B21A 3ULVL 5I1IL 2IDQA 4JO1H 4M5TA 3ZKXC 2EH7H 1UENA 1NEPA 4C8XA 1RZ8B 1GA2A 1PZ5B 1SYSB 4YWGL 1T1WB 4AJYV 3D18A 2V2XB 1JNNL 2VDPB 3QJVB 1ZLSH 5HDBF 4GKLA 5ADOL 3B34A 1IFHH 3VTAA 3IXTA 1I9JL 4QHLA 5D7LB 4KI1A 2X3AA 3FH8A 3NEEA 1OE2A 5IEKA 4JFFE 2NCEA 3D87B 1AQDA 5FCSH 1Z5YD 1JPTL 3BO8B 1E8ZA 3MJ9H 4B3EA 1D5MA 4NRZB 5GGVH 3FT1A 5GZND 1TJXA 2DTMH 4DO5A 1XH1A 2DD8L 3GMOA 5GRXG 1PJ9A 1AP2A 3P77A 3VDAA 4NXSA 4HP5A 3K6SA 3HN5A 5AW8B 3UGUA 3DPBA 1EK3A 3D07A 4QT5B 1NIFA 1BG9A 1NKOA 4GQZA 2K78A 5LLIC 3HBGA 5ENWA 3PNRB 3MQIA 3NYKA 1BJ1J 3TH4T 4QHUB 1DSFH 2APFA 1A0QH 2VR3A 1DUYB 4UNTA 2FAUA 2DKMA 2XRAL 4K5OA 4ZAKB 3RUGA 5GZOA 2AAAA 3L3OC 3EO1B 5A40E 3V4PH 4D0DB 3GMLB 1AFVH 1EVTC 2ODHA 3LIZL 3P11H 4JFEB 5D6DC 3CXHK 4YGVB 2KBGA 5IMMB 2KQMA 2VC2H 1H6FA 2GK0B 3VFSB 4FXGC 3STLB 3SDXF 1D6VL 1KIQB 4JRXE 2OMNA 2E9GA 1U8CB 2LABA 1GGBH 1HCVA 2D03L 2ENYA 2HTLD 4FG6C 4H8WL 5GRVK 3SO3B 4ALAC 1UOKA 4AIZA 5T3XH 3ZYZA 4Z7OF 3LRMA 1KLGA 2XRAH 3FRPG 3N0AA 5CEXB 1NLDH 1AG0A 3MUJA 3GSUA 3PRZA 4PJ9C 3CVDA 4GINA 2WTOA 4PW4A 2WJ5A 1VKXA 1FAIL 4AITA 3DIFB 3BLBA 5HDWA 4W70A 5KOVC 2PPEA 5DO2D 2P43B 4AYDC 4HGKC 4HC1A 4EZJA 2YPVH 2RFXB 1UH3A 4BE5A 2DQDL 1I8IA 3QI9A 1G7MA 3MV8E 3AVEA 1ZGLB 3ARDC 4G9DA 3HE6A 3LNHA 3TZVB 3VG9C 4Z7NF 4FZ8H 2JLPA 1ZWIA 5HVWA 5F9JB 4ORGA 4LLAA 1WA2X 3QQXA 2Z1KA 2JKNA 4CUCA 4UQ9A 4MRBA 1Q72L 3EHBB 3NEOA 3ULAB 1YYCA 1SRDA 2SEBB 3RHWK 1PZ5A 2NR6D 1ZAGA 4PH8A 3HI1B 4Y5VC 3WLBA 3C6LB 3D18B 4X7TB 4F8OA 1KSRA 4OAWA 3O2WH 1W0YT 4X8XA 2D03H 1XH0A 1TIUA 5CUSH 1YEIL 1JF5A 4Z95H 2CRIA 1KCSH 2GSIA 1Z32X 3EFDL 5FV2A 1OV8A 1ZANH 2JTDA 1ZIAA 4YS4A 3KWWA 3WJJC 2GT9A 5ISZE 5J06A 1A1MA 5IVNA 1YYMH 4PJIA 4WY7L 1QNIA 2CSPA 4TQEL 2W38A 2ED8A 4U1SB 4R8WH 1OF2A 3FHQA 1IC4L 4RISL 1AP2B 1OAYL 4M7JH 4I9WD 1B3JA 3STBA 1XH2A 1PL3A 4UNIA 3BN9C 4OR1A 1JD9A 1HINL 2E7LC 4L9DA 2CDEB 5KYWB 2DWYA 2IH1A 4NZTL 2CHNA 5JIPA 3FFCB 4MCZA 3ARUA 4GO9A 1O7DE 3MV01 1DBAL 5FO9A 3SJVA 5BCAA 5HDLA 1A7NH 3RVTD 2VUOA 2X4TB 3S5LA 2W0LA 4HW6A 1Z6JT 4XBGB 4UF7C 3IDGB 1FFTB 1NL0L 4JW3A 4BFJA 3CWGA 2MOVA 1T7WA 3KJ4C 4AMKH 3QISA 3L5IA 1U3HC 4YFLI 3H54A 3SGKC 4QWWC 1ADQA 3MC0A 2NYYC 4A2GA 1EHNA 1I1FA 2FIRT 4LRIC 4N2KA 2HJKB 5EOCJ 1NCHA 3S37H 3FAWA 4F8PA 1KFAH 1FBIL 3BSHA 3FO0H 1IKOP 5B39B 2QJDA 3VD9A 1EBPA 5BV7B 2AC0A 4PYHA 5IV2B 4ZFOB 2BSSA 3WFBL 1K6QH 2VXUH 1HDMB 2GTQA 2LFEA 2R0LL 4LKCA 1ZGLA 1RU9H 1E43A 1F4YL 4JRYD 2XKSA 3VDBA 3RL1B 5G2NA 4NT6B 1QX1A 1U8NA 1GMEA 1BSIA 3THMH 4JO4L 4J2XA 3GIZL 3SO5A 1I9IL 3CMOH 3LN4B 1FFPA 1AXSB 1XR9B 1XFPA 2OXHA 3AS2A 5DVOA 2CGZA 3Q8BA 3BFWA 1NCWH 1XT5A 2NDGA 3FQWA 4JMXA 4K5LA 2HB0A 4P9MH 3WL9B 1N7ML 4F27A 2WZPD 5D2LA 3U6XS 1AY1L 4ODUB 5CSZB 2XN2A 2JJSA 1GY1A 2D7QA 2NQDA 3EJTA 1TVDA 3HC3H 2EC9U 2RTTA 4UM8B 1HU8A 1A1MB 3LKPB 3ESPA 4RESB 1U0QA 2W81C 1XGRB 3CG8A 4XH2B 3B1UA 4ELME 4DCQB 2VAJA 2EO7A 2UZIL 2CGYA 1N7MH 2D73A 2RHEA 1WV7T 3NESA 3R1GL 3WFDH 4FNPA 3FMGH 3SKJH 4AYSA 4BWTA 4NC2B 1JK8A 4H5SA 5KYWA 1SEQH 3UJJH 1RIHH 3OKOB 4RFEA 5H8DA 1A4JB 4JO4H 4FQQB 4Y4FA 4BUGA 3D2UA 4LAQH 5B8CC 5ALCL 3EJJX 4GJTB 4KC3B 4JFXB 4LSVL 3UTSE 5B8CA 4RVBA 1Z0NA 2ITEA 1D6EB 1KXQE 1OL0A 3IDIB 3A22A 5D7KD 1IAII 1MFAH 3FTSA 3NA9L 4NQXA 4ZO8A 5HGBA 3PWLA 3IDGA 3SPGA 1XXFC 2OTUA 4HCGA 1UFGA 3KGTA 4BA0A 4EI0A 3O0RH 2J8UA 1Q9OA 1AQKL 2EDYA 4K23L 4ADIA 3UYOD 1K2DA 3GHEL 5GS0H 5JHLL 2CRZA 2A4CA 3ESOA 5TF1L 1I1FB 3H9HA 5ADPL 4RGNB 3DROA 1G87A 2BSTA 2QVMA 1XWVA 3HC4H 5HHMB 3NCBB 2DL2A 1T83C 3TCTA 2JQAA 3R8BB 4Z23A 2FT7A 4G9FE 1GAFL 5C07B 3MLZH 1MHPH 2DM2A 3CX5K 5B39A 1HYSD 3PJSA 5ITBH 4WFED 1NCCH 5GRZA 3IWUA