3QORD

Crystal structure of human nuclear migration protein nudc
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
117
structure length
116
Chain Sequence
b'SKLKPNLGNGADLPNYRWTQTLSELDLAVPFVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
molecule keywords Nuclear migration protein nudC
source organism Homo sapiens
molecule tags Protein binding, cell cycle
total genus 30
structure length 116
sequence length 117
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorD00
3VQLA 2K8QA 2BOLA 1WGVA 2Y22A 1X5MA 1SHSA 4YE0A 4FEIA 4YLBA 3L1EA 2N0KA 1GMEA 2XCMC 3L1FA 3Q9QA 3J07A 3QORC 3GLAA 2JKIS 4PCKA 2WJ5A 3AABA 1EJFA 4YDZA 2O30A 3AACA 3Q9PA 1WFIA 4M5TA 2Y1ZA 3L1GA 4I88A 3GT6A 5DS1A 3N3EA 2CR0A 4YL9A 4ZJ9A 2MNWA 2N3JA 1RL1A 4PBDA 4RZKA 4M5SA 3W1ZA 4JUSA 3GUFA 3IGFA 1WH0A 5DS2A 4YLCA 2KLRA 4ELDA 3EUDA 3QORA 2WJ7A 3VQMA 3QORD 5LUMA 2RH0A 3QORB 4JUTA 2CG9X 2KMWA 4MJHA 2Y1YA
chains in the Genus database with same CATH superfamily
1T03H 4FNPA 1NGPH 2G3MA 2EXWD 4FQIH 4DTGH 1G5AA 2XA8L 4NXSA 4BZ1A 3UIZA 2OFQA 3FTWA 5F7YC 4U1LA 2WIIA 3C08H 3GWJA 1SXBA 3OR7B 4LLWB 3WIHL 3O11A 4YHML 3BN3B 2PO6C 1S7VB 1ZT7A 3NJLA 3A22A 4RA3A 3KL0A 1G0YR 3ZRCC 5AVRB 1A7OH 5HJ3B 4ZFGH 3V0EA 2WJ7A 4DEPC 5BMFL 1F11A 4XVSL 2HKHL 2F9BT 3OX8A 4W4OA 2UXGA 3LIZL 5L2KB 4RVBA 1JDCA 4N86A 1T21A 3RY6A 2ZCLL 3A0OA 4M00A 2YAFA 1U8HB 2NNAB 1L7IH 5TK2A 5B38B 2XWTB 4LCUA 3ESUF 4FHBD 5IB5B 4TTDD 4PS4H 3QEGL 1GC1H 5EDSA 1PEWA 1E6OL 3MLYL 4PLKD 2FR4B 4IJTA 4HAGA 1H5BC 5F3FA 3IFOB 4J3OF 3N41F 3OG6B 5SV4A 3ILEA 4FXKB 2W07A 1XR8B 1KNOB 3T3PF 2YD6A 1BQRA 2X4TA 1XF3B 3HW7A 4LCYB 3GLDA 2E86A 4FQJL 4PRPA 4HWBL 3T0ED 4A7GF 3II2A 4F3FB 2ZWSA 3TYGH 5AB0A 4HZLA 3WEBA 1M56B 1OGAA 5IW6A 1DQQA 3UGXA 5ANMB 1E28A 1SJEA 2CCVA 4TF4A 1I9RL 4NZRH 5GGUB 1U8CA 1O6TA 1BQHA 3O9WA 2WXPA 3LQAH 2HPOA 1A6ZA 1M6UA 5AW8B 2VLKB 1F02I 3IPFA 1AZBA 3IXAA 3ZR5A 5IQOA 4TULH 2Y7QB 4WY7L 5MENE 1BV8A 4UI2A 2KZ1B 5C92A 3OJDB 5K59F 2C9QA 1WBZB 3QHZL 5C8JA 3ZZLA 1S9KC 3HI6L 1IBFA 1YN7A 1ZTXL 4R5XA 3V52H 4LPYA 3QQDB 2OSWA 3GZOA 1AQDA 4Z7WA 1U8LB 3MJ9H 3TJHD 3TN0D 3W2DL 4S2SA 5D7LB 4BGLA 2MCAA 4LRIC 1KENH 4C4KT 1Y07A 2CKBA 4KAQH 4IIZA 2NY4B 2WSPA 1UWYA 4G1MA 3CTTA 3MLUL 2NNFA 2E9BA 1UD5A 1F41A 3BP6A 4IIQA 3GSOB 4J1UA 3KW7A 2O5ZH 3OKEA 2BRRL 1NIBA 3F00A 3QNXA 4FNUA 4HUMB 2NCMA 3HVNA 1KCVH 3S48A 1IB5A 3H9YA 4XHJD 2Q76A 4L5FL 4C83B 3BFQG 3AG1B 4J8RA 2G0LA 5JPNC 3F7KA 4MJ2A 3HB3D 3QG6B 2C26A 2BC4A 1E4XL 1MI5E 1KCUH 3QG7H 3WLBB 3TT3H 1YPZA 1D5IL 3VFUA 1NBQA 4Y1AE 2FB4L 2HT4D 4X8JA 5BVPH 5GGQH 4YXLL 5EF1A 5K1NA 3KPOB 1F1AA 5CN3A 1ITCA 1WF5A 4MD5A 1U8PB 1ECZA 3IJSA 2ERJB 1WAAE 4HT1H 1ZE3C 3T0WA 4FZ8L 3N42F 3HLKA 4PB9L 2Y23A 1I1RA 3CBJB 5A6MA 2XPYA 4OCYL 2ZUTA 4EQ3A 1HI6A 1YJDH 4HU2A 1X5JA 3B7SA 1VEMA 4KROD 3SQOL 2C7FA 1X9RA 3VO0A 1QFWM 3EYQC 3RTLA 4F9PC 3MRNA 1A2YB 5ABDE 3H2WA 3QUKB 3MV7B 1NFDE 1O75A 4PJ9B 2UXTA 1ACYH 2VDMB 4MJ6A 4CMHB 4Y5VC 5BUGA 4FQLL 4L9LB 3VGAB 4JE4B 5IMKB 2MHAB 4NUGH 3L7FA 2Y7OA 1YEFL 3A23A 1MW2A 5BPPA 1E5UI 4MA1B 3V5KB 3ZSTA 2XYCA 1KJ2B 3MNZA 1QUNA 4AVIA 2APTA 2K3HA 2YD2A 5IKCB 5ILTL 2H26B 4XBPA 2OTWA 4AL8H 4S1DD 1HH6A 3AABA 4ABWA 1HOEA 3HS0C 3VRJB 2HVKA 3UYOD 5J9PA 4J2QA 3O4LB 3AY4A 1JGUH 4HIIA 5A2LH 3QDMA 2EIBA 1UZ6E 5I5MA 3JZYA 1KPUB 3HN5A 4NCDA 4J23A 4MXWL 2VDPL 3Q2VA 1KLUB 3FU9A 3BP4B 4WGVB 3KPQB 1E2WA 3U7WH 5T5NG 4UT6A 3UTZA 5GS0D 3DDFA 2IDCA 3GMLA 5D93C 5FYKH 1E6JL 4FG4A 3ISWA 3WD5H 3DO4A 1KXVA 3QZLA 5BRZB 2BDNL 3FCSA 4D8PB 1B9ZA 2E8YA 5FO8A 3I85A 3PFQA 4UWQB 4JKPH 5ISZD 2QADB 2R1WB 7FABL 2VABA 3KLDA 1XIWD 3MROB 1THCA 4YC2C 1JFQL 5C2BH 4Y19A 3MBXH 2JV6A 2XY1A 3CLEL 4D0DB 3P40A 4NB7A 1FPTL 5D7IA 4PS7A 4ZNEE 2HFGH 4RGNE 2VDOB 3FQYA 4G8GD 4P9HH 4KVPA 1CDUA 2CO7A 4NOFA 1IJNA 5DVKA 2ZYHA 4S1RL 5I66A 2AQSA 3LHPL 4U1LB 3S6CA 4MB3A 2WIIB 1H3XA 4UOZA 3FFCE 1TO4A 1BOGA 1VGEL 4AYDC 1HHGA 3O11B 5FGCB 1ZT7B 1NH6A 1JG9A 1GGUA 3EDJA 3RFRA 5I6XB 1MG3C 1NTDA 4MGXA 4KRPD 4IRJB 4KXZH 3PIQB 5DURB 1F11B 5CBEA 1JE6A 4OZHF 3OX8B 4YDLC 2GBTA 5I6PA 1PZSA 3WKQA 1T21B 4R84A 1NAMH 2HA1A 2OP4H 3KBFA 5ITBH 3ARGA 3U6XS 4OJDH 3WS6A 4Y2DA 4I4WA 5IGXH 4LCUB 1AZVA 3BP5A 3DHJA 3TO2A 4MJ5A 1VJSA 2ZX8A 2ESVD 1EK3A 2WYIA 4WNSA 1T4KA 1N2RA 3TURA 3QFJD 2FHFA 2Q7YA 4V1DE 2EH7H 4NCC1 4U6VH 4FHKA 4A68A 3MLZH 2ZG1A 4WWKC 5KYNA 2W07B 5TH2A 2AMGA 1RY7B 4P9MH 4RGMC 1VADA 3LKQA 4F2MB 3KPNA 3WIHA 2V2XB 2X4TB 4EXKA 5EPMA 1UH3A 4KKBC 2X1QA 4PRPB 4JPKH 4UIKH 3P0YL 5ALBH 4HZLB 5HDLA 2RTTA 4OB5L 3QJOA 3L9EA 3G5XA 3E2HC 4H8PA 1OGAB 4L3FA 3LEVL 5IW6B 4V33A 1G9MC 4XCNA 2I9LA 1E28B 1SJEB 2YSSA 3DGCR 5DZPA 3LIZA 1PZ5A 2NXYB 1ORQB 1A4BA 3BT2H 3NDYE 3BKML 3GMMA 5AVUB 3ABMB 1BQHB 3O9WB 3D09A 2NY5L 3MBEB 5HHMB 1A6ZB 5TPWH 4NZDA 5IFAL 2TRYA 1LE9A 3QJHB 4FP8H 5FF6B 3IXAB 4X7SL 2CXGA 4QR7A 1BJ8A 1HIMH 4XWGL 1RZKC 5C8JB 1PJ9A 3ENEA 1YN7B 2X1PA 5KVDL 4XCFH 2CH8A 3EO1A 2R0KL 3WMSA 3IU3A 1E5YA 1AQDB 2R23A 2XFGB 4Z0BH 4Z7WB 4G6KL 2GTZA 1FFTB 4S2SB 3MHZA 3PWPB 1CU4L 3DX7B 2CKBB 2E5EA 4RFNB 2ZT9C 4HSAC 4BFEA 1FBIL 3IMRA 3H9ZA 3HE7D 4G1MB 4N90D 1PZUB 3OWRA 1I7RA 1C1EL 3BP6B 4HWBA 4IIQB 4J1UB 5E6ID 3GZKA 3KNBA 2CG9X 3DTUB 4FQXC 4PGJA 4N0YL 3PL6D 3DC0A 3OKEB 3UBHA 3QNXB 1UXMA 4ZYKA 1ZS8A 4AGOA 1AXTH 3GSWA 5D72L 2QPDB 3OLEA 2Q76B 4MVBC 3NA4A 1JCKA 2WGNB 3AUWB 4J8RB 4OVVA 2JI3A 2BMKA 4NHUA 3FT4A 3ARZA 4POZC 2P80D 2X53A 3HNTH 1TTRA 2H45A 2KC0A 2XZCL 2BC4B 1BQLL 1FNHA 2CA4A 3EYFA 1W6LA 4WFGE 5F0PB 1MHCA 4EZJA 2YD7A 2WWOA 1GGIL 2P3YA 3VFUB 1AXSA 5T5FL 3JWDC 3QEQD 3TH3T 4X8JB 4FLOA 4DPRA 3WJMA 1YQVH 3B2VL 4MWFA 3WNMA 5GGRY 5KJ7E 2IFFL 4MD5B 4LCCC 5AYUL 3V6OE 4ZD3H 3VXOA 1IBYA 3QJVB 1VZHA 3IGUA 5FM5M 1Q9KB 5JDSA 3CN2A 1KJMA 4YFLF 1BXUA 1Y7VA 4WW1B 1HI6B 1AACA 3UEQA 2DQIL 2O1AA 5AKVA 3A4DA 5CLXA 3MRNB 3SDCA 3FTGA 4R0LA 1KN4L 5I71B 3P11H 5KSUA 4QCIB 3BSZL 4MJ6B 3B9VA 3GC3A 2Z8VC 3K5SA 3L7FB 1OK8A 4D94A 2R0ZL 1TQBC 5F9OH 3MNZB 5DJXA 5IQNA 1QUNB 4FL4C 2X2JA 4GB9A 2WZAA 2BXYA 4XBPB 2OTWB 1P84J 4IOIB 3FF8A 1HH6B 4LPCA 3ULVH 5F96H 3EJJX 4A67A 3ZLQC 1KACB 3AQZA 5D2NB 1YEKH 2VR5A 2HVKB 1YYCA 2WM0A 5J9PB 4HJEA 2WZPA 3B8SA 2VLJB 1Y1DA 4HIIB 4OY9A 3QDMB 1URZA 5KSAA 1NKOA 4ALAH 1LO3L 3N1FC 2QVFB 3B3BA 3VQMA 3VXTA 3QCVL 2EP6A 5DJ8A 4OLWL 1FDLL 2X4NA 1E3FA 4DVRL 3T6QC 5T3ZD 2J4WL 5GHWL 2OW6A 3FT0A 4QRPD 1C7TA 4WO4A 2VW4A 1E4WH 3GMLB 3C5ZC 2VR9A 3L9RA 2WLNA 4JO8A 1MFCH 1KLGA 3IFNH 1LHZA 2FUQA 4WK0B 3SBWC 1KBBA 3FCSB 2DYPB 4FQCH 5DJAA 2F74A 5FO8B 3V7MA 1J87A 5LBSL 1U8OA 4XR8C 2VABB 4K7PH 1F45A 4Y19B 1P4LA 2MQGA 4BHUI 5E2JA 3GUTA 2XZQL 2PPAA 3VFGL 4XN5A 3UJTL 4M5YL 5GZNC 3V6FA 2I60H 3LIUA 3AAZA 1GOFA 2IQAA 1YC8A 3HUJA 1FAIH 1GGTA 5IROA 1IGFL 5D7IB 3GRWH 5GJSH 2QSVA 5I8OH 4ZOEA 4NQCE 1KBGH 1M1SA 3UYRH 5J5EA 4NPYA 4WRLA 5IEKA 2GKIA 4NQEE 5LGYA 2CO7B 4FJZA 3N1QC 1F1GA 2HYMA 4KKAD 5GGVY 5I66B 3FOLA 3QO1B 1FCCA 1QVOA 1BOGB 2C8NA 2GY7B 1HHGB 2C3VA 1P53A 1KTJA 3BESR 1KGXA 2E76C 3WN6A 3NGBB 4K7PX 4WGWB 3V9CA 2YD4A 2X6MA 1ZRUA 3GSNH 3CVIL 1WHPA 2H2SD 2IH9A 3DHPA 3FQRA 3QNYB 4Y9FA 5I82A 5CBEB 1FLRL 1X5YA 2JKIS 4XRCA 1HZLA 1I1AC 3DMMD 1CYXA 5T1KA 5FGRA 3ARGB 5AZUA 2IBGA 2PYFA 2LAAA 5IG7B 5IVXF 4Y2DB 3WFBH 5E8OA 5IM7A 2DH2A 3BP5B 1MG2C 4KK6D 3TO2B 1N5YH 3GYRA 3L5IA 4DKTA 3K6FA 2GI0A 3D33A 1F4HA 4MJ5B 1U3YA 1M2OA 2EDWA 3GSRA 4R90H 3D52A 2VQ1A 1T4KB 4IDLA 3PQYD 2AEWA 2ENJA 4KKLD 3MRKA 3QS2A 2XWBB 3TIDA 4WUKH 4G80A 5I8EA 4LQ1A 4AYGA 3DDGA 2BFVL 3QB7C 3VI3E 2X40A 5TH2B 3MFGB 3ARDC 5CSZA 1VADB 3DSFL 3LKQB 5IP4A 2JQZA 43CAA 5K9OA 2XN9D 4XOCA 4JO2H 1ZHBA 5SWSD 3CFQA 1FYTA 1YEEH 4KFMA 2NUPA 5IVZA 3RPIA 4AXWA 3G5XB 3TIEA 2AV1A 4JR9H 4U7KA 4XCNB 1BZQK 2W91A 2YSSB 3AWGA 1OAUH 1PZ5B 3ATEA 4HIXL 2XKNA 1K8IA 3EUUA 1GL4B 4YQXL 4N25A 4ONFH 1LE9B 1IM3A 4U7MA 1VESA 5E2TH 4G6AD 3OVUB 1F58H 4B0MM 1JPTL 4HJSA 4UMGA 4AQ8A 4AYID 1AG0A 2JVUA 3S37L 1QBML 1G4MA 3EO1B 2GIXA 4F9LA 2NLJA 5SX5H 3IU3B 5KTEL 4GIAA 2R23B 4IRSB 1A0QL 3Q6FA 4XZUB 2IV8A 5E99L 1MQKH 3FN0H 4JDTH 3SB3A 1UACH 4TTGA 4LSPL 3ZDYE 2MTAA 4P06A 3FQ2A 3KWUA 4F80A 2X3BA 5F72S 1CFQA 1D7FA 4I88A 2ROXA 1I7RB 4JFDA 1MF2H 1NGQH 1VENA 1YYMH 2ZX7A 5CP7A 4AMKL 3ARFC 1JXKA 3QORC 1U3HA 2WJ5A 3LPGA 1ZS8B 2G3ZA 1NUDA 3AB0B 3HI5H 2ZKHH 3GSWB 4TSBH 4ZYKB 4L0YA 5KJRL 3I6LE 3L7EA 5H8DA 2BMKB 4NHUB 3FT4B 4HP5A 5C0AB 2MCMA 4PGEA 2XV6B 3SJVE 4MMYA 4JPVL 2W88A 4NT6A 2BVPA 4H5SB 2J25A 1MHCB 1A64A 2VJXA 5D1ZB 1UWXH 4QRSA 1AXSB 2R51A 4WVRA 2QFPA 2ZCKL 3JWNH 3KWVA 1T7VA 3WJMB 1X9QA 2CRIA 4MWFB 3DTXA 3Q8EA 4KQ0A 2RMNA 4M4RA 1B88A 2ZYIA 4HJ0C 5CNHA 4M29A 3LVEA 2QQQA 5HI3D 1KJVB 2CLRA 3VXOB 2R2HA 4BCXA 2DL9A 2UUDK 4P0DA 4Z9KB 3AS1A 2AJVL 5E95B 5JDSB 4PJXF 1EZVY 1KJMB 1KIQA 1Q72L 4IBTA 2WMPA 4P59L 3REVA 1V5JA 4I2XE 2GHZA 2IAMB 1MDAA 2O5XL 3T8MA 3UMTA 1NOFA 3FTGB 4LGRB 4R0LB 3CZJA 1IC7L 3FZUD 3WLWD 5JHAA 5KSUB 1L3NA 5DD0H 1KDJA 4IRZH 1OP5H 4A7GA 4XPAH 4WEBH 3W9DA 2PXYC 6TAAA 4M1CC 4FHJA 2OAAA 1KTRL 4NJ9L 1SDDB 5EOCJ 2A6IA 4WUUE 1RJCA 5DK3A 2IC2A 5T5FA 2YLHA 4ODVL 3ZUNC 2XBZA 4CJ1A 4MA8H 3RWEA 4WEMB 4PJHF 4G9FD 2KS0A 2MQ0A 5F8QC 3N04A 1ZT1A 2D3NA 4Z7QF 4L18A 1RJZA 4G7VL 4OLVL 1N10A 2F54D 3BHBA 5KSAB 1DYZA 2WTOA 1T1XA 3QIBC 3ULUE 3UO1H 3VXTB 4WCYH 3E7JA 1TJIL 3MRDA 2IBZX 2B2XL 2X4NB 4LIQL 3BPLB 1IQDA 4RH4A 4WO4B 3BQUC 2NXZB 3PP4L 3ZHFA 3SGJC 4JM0A 3L9RB 1V10A 1KLGB 4KKQA 3RWGA 5FWQA 2OJZH 3N0AA 5DJAB 2EE9A 3HAEH 2F74B 4Q89A 3UP1A 3ZW3A 3RZCD 4XWOC 5I74C 4I13B 1JPFB 4M1DH 3ZHLA 1P7QD 4HH8A 2OLDA 1D5RA 1L9TA 1CGXA 4TMPA 4YHPB 5TQ2H 4D0CA 4OCWH 1IARB 1IAOA 1ZLEA 5I1EH 1P7BA 5LN8A 3GUTB 1MCPL 3RIFK 2XN0A 4JHAL 3V6FB 2YA1A 2VSKB 1SDYA 3HUJB 4KV5F 5BZWA 2W0PA 4MA3A 3RDTA 4NPYB 4MNHA 1YHPA 3SDAA 4HBCL 5IEKB 3SYQA 3UTQA 4AQEA 1CQYA 5FA4A 5EO0A 2VDPB 1EEYA 3TVMC 3OB0H 3STLA 3F7YB 4KVNH 3P4LA 4YHIA 5GJTH 3FOLB 3OPZH 4YFEA 3Q06A 1QVOB 4JGNA 3AZUA 1UURA 1C7SA 4AVHA 4EI6A 1WFNA 2DM3A 3IGAB 3Q2NA 5H94A 3UBXI 2K6WA 3H3BC 3BYTA 3OBAA 4BA0A 4N2DA 5CZKA 5LBSA 4BFBD 2X4OA 3FQRB 4OGYL 3WNJA 3WAKA 4ZS6D 4XRCB 5T1KB 1BZEA 2CHDA 3T0VA 2PYFB 4P2OA 2BHFA 3P69A 4OJEH 3SO3B 3SYOA 3ZY7A 3WMPA 1H3PL 2F8IA 5AYQA 3OAUL 2V8LA 1NDTA 1R4XA 3MUGA 1V7MH 3GSRB 3L4CA 1E5CA 2VQ1B 2LU5A 2J44A 3MRKB 1KIUA 3RVWC 3CK0H 4GBXD 2BLFA 3TIDB 4G80B 1BFTA 3ARQA 5I8EB 4D9QE 2VQUA 3QYMA 4FG2A 5CSZB 4MNGE 4GT7A 1JDDA 4ZUUA 5K9OB 2PNDA 4X5RA 4F58L 3BGMA 2NOYA 1YEGL 1FORL 1ZHBB 2FLBT 2PWEA 1FYTB 1BBDL 5E6SB 2DBLL 2YBGA 3D85A 3FAXA 4XOBA 5D1QA 5IVZB 2V3DA 4M6OH 4XNMA 3RPIB 4AXWB 3TIEB 4CMMA 3H3PL 3JUYA 1D5MB 4XX1G 4A6YA 3ZGIA 2X6VA 1K8IB 2ARJQ 1WT5A 4EZMA 2PWGA 2Z9TA 3LB6C 5AVSB 1KGJA 2B16A 2BSRA 1IE5A 2XXGA 1DVFC 2D0GA 1IM3B 1QWUA 2ADIA 2AQRA 1CR9L 2GJ6D 4NKIL 1DQMH 1U21A 1FC2D 4Q52A 3UBXG 3A47A 3QDAA 2O30A 1F4XL 4IJ3C 4L4TA 4NQXB 2RQ8A 4Z7UE 3UTTE 3OAYK 3VNYA 5KVEH 1UUNA 4HISA 4P23C 2NLJB 3R06A 5J7CC 2R83A 2YN3A 5I0DA 4K8RL 3J2PA 3Q6FB 1UWEH 3HG1A 3ZKMC 1Z66A 4YAQA 4KH2A 4PMFA 3VD7A 4UAOC 1TFHA 1TF4A 2JK5A 1CFQB 3BLBA 2E59A 1OGPA 2X4SA 2WXNA 4B9GA 2VDKH 4NYLA 4NQVB 5DRZA 4ZNCD 5E08L 1T66C 2H0PA 5IW1A 5CP7B 1FNAA 3F01A 5EIVA 4JY5L 4HS6B 4H4NA 3SO5A 4PTUA 3CDYA 3L3JA 3SN6N 5TE4H 1XR9B 2ZP8A 2OCCB 3L7EB 3O0RH 4R97B 4ZZFA 4OF3A 2X2HA 3NMEA 5FUZL 4AIEA 4PGEB 1S2EA 4MMYB 4NT6B 4OZHA 3QBTB 4BWUA 2BVPB 1FN4A 5D71L 4QRSB 3HNSL 4YSTA 1PMYA 1JYNA 5KSBE 3LN4A 1JPEA 3N55A 4HSQA 4XP6H 3DTXB 3KL3A 1KB3A 1KGIA 4M4RB 3S36L 2UX6A 3W11D 1JAEA 4OT1L 3MA7A 3MLVL 3WE1A 2IANE 2CLRB 2R2HB 1X5IA 3CGTA 3MPCA 4KJPC 5E0QA 3KLHD 1KIQB 2J6EL 1DJHA 2WMPB 4OZGB 3REVB 4KKZA 4HALA 4QXGH 5GRJL 3N41B 1GHFH 3TH4T 3GB7A 5FV1L 5GISH 5C71A 2AK4E 3T3PB 2CPCA 1OAXL 1J9QA 5C07E 5C9JB 4I85A 4X4MA 4DETA 4H44C 4RFEA 4UUJB 3CXDH 3ZGHA 3Q43A 1JV5A 4Q9QL 4M6NL 5G4OA 4OLYH 4LHUA 1XCWA 4NKDB 2CIIA 1J9RA 4ILDA 3O8XD 4XMPL 5CJ5A 1JL8A 4MCMA 4P2YA 4JN1H 1GSMA 3B2PA 2VITB 4DGIH 3US1A 1MQ8A 4XN1A 3RWEB 2HTLD 3BDXA 5DHVH 1NMCB 2OR9L 2VN3A 2Z8SA 4U3SA 4ODUA 4UNUA 1ZT1B 3FK3A 1RJZB 3LNEA 4JRXA 2B4CL 3BHBB 5EU6B 1T1XB 4JQVC 3LNIA 3L95A 3IAGC 3MN8A 3MRDB 3WFZA 1BMZA 4A38A 2XACC 1DSFL 4P49A 3MLXH 3KG5A 4XP1L 5HJBA 3JXAA 1IQDB 1OSPL 1LEGA 3VXSB 1X4ZA 1U92A 3X14A 1EJ8A 2WBJC 4KNTA 3GXPA 3QIUD 3RWGB 5DLMH 1BAFL 4C47A 4PJ6A 4BGDA 4LU5L 3EH3B 4UM9A 1E4HA 2V3EA 3U0WH 1A5FL 1SFDA 3ZQ9A 1JGLH 1MLCA 2CE6A 1TEGA 5C2UB 4PRIB 4CC1A 4D0CB 3CH8A 1IAOB 3KPSA 4LPWA 2XU9A 4RX4D 4AUYA 1AZZC 4HXBH 1QFWH 2OZ4H 1G1CA 2XQYA 5BZWB 4LVHB 3SD2A 2ZWKA 4R7VA 3MV9A 1S9XA 3CFBA 3F7QA 3PABA 4IU3A 4MA3B 3E3QE 4MAYC 4M56A 4MNHB 2OXHA 3ESOA 2EH8L 3SDAB 3UMNA 4JG1L 5IBUG 3UTQB 4AQEB 1YEWA 5FA4B 5EO0B 3LZLA 4ZK8A 3STLB 3PV7A 4YHIB 1AKJD 3N42B 4RMTA 3NIDE 4EI6B 4KVCH 4N0RA 2A6JA 2JNZA 1UT2A 2E7CA 2P5ED 3BRFA 1MHPL 2ZPKH 2ZAIA 2X0UA 5I8KL 4NC1E 2BPBA 4PJ5D 2X4OB 3MOBL 2W65A 1HXMA 3HEIB 4K9EC 1JNHA 3DIVA 5I6LA 5MEOA 2APVA 5SWZA 4FQ1L 4JQIH 4I7ZC 2P48B 4M7KL 2I25N 1NFIA 2BHZA 2EO1A 4P2OB 2LU7A 4LLDA 4WTXA 2I07A 3H9SA 1QASA 3UJIH 1I1FA 1GIGH 3W82A 4GMTL 5HI4D 3X1GA 2BVYA 3CDCA 1AC0A 3JTBA 1VFBA 2CHNA 2UWEE 4L3AA 5EBGA 1CQKA 3Q0HA 5FIEA 3NK3A 5D6DC 3B9AA 3MUGB 5F7HA 3MACL 4N2OA 5CFHA 2Y4SA 3VG0H 1KIUB 4XTRD 3VTTA 2UYLA 1JMXA 2PTUA 3LRKA 1YN6A 2ZJSH 3MSPA 5JW4Q 2YXVA 2B0SH 1BG9A 4AGPA 4ONHA 4ZUUB 3IVKA 1MWAH 4O51A 1YEDB 3BGMB 4ETYA 1AO7D 1MEXH 3D85B 3GBLA 1BFSA 5D1QB 3SY0A 1E2ZA 4OQTH 4XNMB 4DT2A 2BH0A 4CMMB 5K1JA 4LSRH 2ICEA 4MBRA 1TVDA 3VXRD 2XVKA 1G94A 1AP2A 1AR1B 5D9SA 3EJUA 1WD8A 1RUKH 1ZGLA 2BSRB 1SF3A 2WGXA 2WQSA 3NPSB 4KTEH 4FC3E 2ADIB 2KQNA 2XXFA 4I8DA 4L4TB 1TZIB 2XWZA 3IPEA 2QLYA 1FO0L 3K1DA 3MUUA 4QLRA 1RL1A 3D3VE 2LHAA 1N0XL 4XPGH 2R4RL 3R06B 4UTAH 4LSDA 4H1LA 3G5VA 3RVTC 5JHLH 2R4SL 3BFOA 5T3XE 3HG1B 4YAQB 3HE6A 2ZUWA 2FJGA 2M1KA 2FD6L 3T4AA 3PDDA 2JK5B 4DKDC 1D5ZA 4HV8A 2JKTM 1SVBA 3S5ZA 1FL3A 5L4IA 2YPLE 4NYLB 2EDOA 5DRZB 5HGDB 3N0PB 5IW1B 1JPSL 1NC2D 5DS1A 2PYEA 2YAEA 4P4KC 5TF1L 3UOAB 2Z4TA 3L3JB 2NDGA 4FADA 1GGCH 2O61A 4X5PA 4CN4A 2X9WA 4W68A 3TA4D 3DLQR 4JQXA 1MH5A 3QPQC 4QHUA 1UOVA 3WELA 1XAKA 2C9RA 2F58H 4OZHB 1ASQA 4UT7L 2X4PB 3SIKA 2HWZL 2L7QA 2NZIA 3BGFC 1FN4B 3FKUS 5ESQA 4PJCF 2WC7A 1LDSA 1OANA 2EE3A 1TT6A 3LN4B 2NY3B 5IVXA 5KSVA 2QHRL 3A67H 2DWSA 1XF2A 4BFNA 1WRFA 2VZTA 1SXAA 5I5IA 5IFHL 1T7ZA 5T1DH 3LZPA 1X4YA 2OMZB 2FWLB 1K85A 2E8ZA 1T0MB 1JV2B 3DBSA 1GYWA 3ZE0E 3WTUA 2FO4A 3HFMH 4HMEA 1KELL 1XCQA 2VRKA 4JEGB 3IF1A 4LXFA 4U0RB 3ZN6A 3PAZA 2A7BA 3GB7B 2A2QT 2V17L 4LE8A 2GHWB 4LLVA 2VLRA 3FB6A 4PYGA 4XBEL 2WSKA 3D5OF 3QDGE 2VUOA 3WEMA 3LEYL 3NEXA 3FB5A 1QZ1A 3QUXA 2B3IA 2B1HL 3D34A 3KPRE 2X88A 1A4AA 4RFEB 2Y7MA 4K55A 4AQ1C 4BDVA 1JV5B 5M95B 2VZ3A 1HZHH 3CLFL 1JF5A 3QSKB 4Q0XH 1MWOA 1IX2A 1R33A 3OXSA 1C5CL 4LHUB 1KCBA 3K8MA 2CIIB 4ZFFA 3D7PA 3WJLA 3RIKA 1R3IH 5DWUL 4ZFOL 2Q6WA 2W9DL 2BK8A 3QIWA 1IGCH 4HX1A 2J1KA 2KMWA 4URKA 4W81A 1BCIA 4ODUB 3F7VA 3HPLA 3VM5A 4I1RA 3F62A 4JRXB 1CO1A 4Y5XC 1MCJA 2DV6A 4KOCA 3L95B 3MLTA 1HL9A 5G4MA 1QR1A 3EG9A 3NACH 3RGBA 2AV7A 4ZW8A 3AM8C 3GFUA 1NANI 1T83A 4H1LH 1DDHA 4U6HA 1LEGB 2XWCA 2EXYC 1FFPA 1W0WB 3O0LA 3QR1A 1UZGA 2DIBA 1U92B 3SE4C 3O6FB 5KJ4A 3X14B 1MCOH 3JZ7A 1AJ7H 2Z31C 3BOVA 3OKKA 4NDMA 3F65A 4UM9B 1VRSA 3B8YA 4GS7B 1MLCB 3MXWH 2NR6C 2AITA 5LAPA 5JUEH 2OMUA 2H6PA 1NBVL 3KPSB 4KXZI 3SKNA 2QVKA 4JZOA 3K0YA 3W39A 3TPUA 4M7ZB 5EEWA 4K3JL 1S78C 3TNMA 3MV9B 1ZVHA 1S9XB 3CFBB 3PABB 2X6AA 1EMTL 4WENB 1WS8A 4P2RD 1Z0NA 1CGSH 2JKSA 5BS0B 1GPOL 3BWZA 3V8CA 3S34L 4MMXC 5KBPA 3SGEH 4AV0A 3T0EA 4PJXA 5F0MB 5C97A 1K3IA 3VFNA 2CCLA 5F0LB 4MXQC 3AREA 4HKZA 1X3DA 3UZVA 5ESVB 2A0LC 4Z23A 4JM4H 3BZ5A 4YSRA 2I26N 1RMFH 1FNGA 1JNHB 2R7EA 4FG6C 3BWUC 1CXKA 5IB3B 5SWZB 4N6QA 4I18C 1LDPH 3CUPA 2IH8A 3CBKB 1NFIB 1KN2H 2O5YL 3QDJD 4LLDB 2I07B 3H9SB 2AJYL 5I30L 1QTYT 4DN4H 3ASWA 2QQLH 2D0HA 2K6YA 5JW3L 4OM0H 4O2FB 1FNFA 5I75C 4BFGA 1Z3GH 1AGEA 3QYNA 4YHLH 3SE6A 4YWGL 1M71B 3UG3A 2DQMA 4PJHA 1CLZH 1ZV9A 2UYLB 4FTVD 4Y16C 2EYSA 1G6RL 1IBDA 3O3BA 4F7CB 3PLYA 1TFPA 2F1BA 4WTWA 1FAKT 3IVKB 4O51B 4KTDL 4YSSA 2VL4A 3EKCA 2WQAA 1IL1A 3PRZA 3H2PA 5D7LE 5HDRA 2DY2A 4JY6B 3SY0B 2CLVA 5J6SA 2HT3C 1H8NA 1FVEA 1S7SA 1T4WA 1VZGA 2ICEB 4FFYH 3I84A 4U0QB 1FWXA 1AP2B 4KK8C 5D9SB 3T2QA 5FCUL 2CO4A 4H0IA 1PCSA 1I9JL 1PQZA 2BSEA 4IKIA 4K3DL 5IJVA 1ZGLB 1OAYL 3D6GA 5AWNL 3I50L 3I2CL 5A2AA 2PCFA 3BISA 4TN9A 5EOTA 4OUOA 1ZKAA 4WWKD 1JVLA 2BSSA 4Y4HA 1GKEA 3MCLH 2JCCF 3HRZA 2WUBL 2AXWA 3D9AL 4JAMA 3P4NA 4FJ6A 4KKBD 2BOCA 3G5VB 2D2CC 4K5NA 2BINA 3BCFA 1KEML 4I0PA 3GF8A 2HAZA 4NAQA 2JFCA 2FJGB 3RUGE 1DQDH 1JRHL 4UB0H 1D5ZB 3ARRA 2EABA 4U4BA 4HV8B 5T3ZL 2ZXWB 2P5WA 3Q3GA 1FL3B 1KFGA 2LLGA 2WD0A 4YLQT 2A9DA 1BX2A 2WVVA 3AMLA 5FKAA 4XNAA 4QNPE 5LB1A 2O61B 5KAQF 2XXMB 4M8RA 4E2OA 1RIVL 1MH5B 1MAJA 4QHUB 8PAZA 1CGVA 3EJCA 1DN2A 3MV7E 3SDDA 4UZUA 5ESQB 5B39A 5KZCD 4ZTPL 3GMRA 5DRWA 1FO0A 3GLAA 4HQQH 5HHPA 4EIBA 4DESA 5KSVB 2DJSA 2IV9A 2X28A 1JTPA 3QHFH 3VU1A 1DJIA 1OGTA 3OAZK 5D93B 3GXNA 1Q0XH 4LP4A 3TBYA 1HJBC 2FO4B 2VDOH 4ZAKA 5JQIB 1IAIM 4KPHH 2BSCA 1GOGA 1XCQB 1Z6JT 4H8WC 4MVBD 5DMIH 5DTFA 2YC1A 4AYBA 2FT6A 3IF1B 4PP1C 3RRQA 4POZD 4CRPA 5ADPL 3R19A 4LLVB 2VLRB 3FB6B 3MAWA 2E27H 4WJG3 4DQOL 3FO1A 5TQ0L 1UZ6F 4OBRA 3QUXB 4GP5B 4Y89A 2D9QB 3CFUA 4IOFC 4NENA 3X3FH 3L1GA 5AOJA 4XZ4A 3X3GL 1CL7I 1MRDH 4QHMA 3ZJAA 3A4AA 1N6QH 1QQDA 2J72A 4N8CL 1XIWA 5DYOA 4TV3A 1XBDA 3OXSB 4TPRL 4EDWH 4JKKA 4ZFFB 1MFDL 2ORBH 1ZHKA 5ACLA 3MOAH 4M62H 3NFNA 4UM8A 4YSPA 4DW2L 1BLNA 2QKIC 2VXTL 2Q6WB 1FRGH 4M5ZL 2RR3A 1VIWA 1NAKH 5FFGA 4NFBA 3TA3C 1A7PH 1LO4H 1UASA 3F7VB 3HPLB 3NCJH 2X7LA 4DKEH 2XV0A 1UCTA 1A7NL 3MLTB 1SEQH 2FEEI 1IC4L 3MGOA 5I6OA 1QR1B 2F61A 2AV7B 4U6HB 2X4RA 1EA9C 1DDHB 1NM4A 1KOAA 2PW2B 4JFFD 3RIAK 3DGGA 1BFOA 3RDJA 1B0RA 1TJHH 4OAWA 5GRZA 2ZUXA 4PGBA 4D9LL 3ROOA 3ALWA 3OKKB 4NDMB 4RRPA 5LWYL 3CU7A 3MI6A 5AVTB 1LQSR 2VC2H 5C7ZA 3TO4A 5JHDB 3KJ6L 5HVWA 4QIRA 5JMOC 3C60A 1KB5L 4FXLA 2OMUB 3SGKC 2H6PB 1AHKA 5M7QA 5IFJA 3SKNB 4ZFOA 4JZOB 5IBLC 1A3ZA 5C0NC 3H7BA 3TPUB 4TLSA 4UAHA 4HXAL 5I23A 4JUSA 4WI6A 3TNMB 3PE9A 1IBGH 4ZX6A 1EQWA 2IG2L 5BV7H 1K6QL 2DS4A 4IOSA 3QJZA 1JPGA 2HFEA 1ROWA 1XWVA 4L23A 5ES4B 1DQLL 4GXVL 3RVXC 1KWKA 5AZEL 4M1GL 3ECVA 5F3HA 4OD3H 2DQHH 4PJXB 3MYZA 3VGBA 3VFNB 1BD2A 4IMKC 5I1IL 3AREB 2H5UA 5CZVH 1PY4A 4HKZB 1DZ0A 3UZVB 5FO2A 4WV1A 3ZU8A 2Y7NA 1JF1A 3RVVC 5GZND 1HINH 5GS0H 4DVBB 3D8MA 4QRFA 1FNGB 4PJDF 4APQC 4YR6A 2R7EB 4HS3A 4MLIA 3DI2B 5ICZA 2BERA 4QRUA 5FHAH 1A1OA 2FEDC 3CUPB 1OGAE 2NY1B 1DFBH 3OHMB 3QI9A 5CZRA 1ZV5A 4KUZL 4F2FA 1NGYA 2BIQA 2H6UA 3NP4A 4NERA 5HHME 3QQNA 1TCMA 2BVQA 2VN6A 4KJYA 2Q7NA 4AK2A 1RURH 4GLRI 4PJHB 4TL5A 5H4YA 3FU7B 4NQDE 2EYSB 4C56A 4Z7QB 1HKFA 3BT0A 3O3BB 2JB5H 1IZJA 2ZOLA 3QK0A 3SQBA 4C57C 1PL3A 1W15A 1WEJL 5E6IA 2DF3A 3WTWA 1IL1B 2WNWA 1ETB1 4WFFE 4X9IA 5FYKE 5KBKA 4X6CB 4RQQA 1IEHA 1UA6L 1NCWL 2BVTA 3ILPA 2Y1VA 2C7UB 2CLVB 3HG4A 4P5TA 5I5JA 1FVEB 1S7SB 1MXGA 2VIRA 1TZGL 4ZDHB 3LMJL 5F6HI 3WS3A 2P80A 4PLOB 4WHYG 5IJVB 1M53A 3HZKB 1PZ3A 1QI5A 2F5BL 2YO3A 1KCKA 5F7EH 3IDNA 4DN3L 2BNRE 2PCFB 4LESA 5EOTB 3PU7A 2YUWA 2NQ3A 3ULUC 4Y4HB 3HRZB 2Z35A 4JAMB 1JZ2A 2IALA 1LO0L 5I15L 2BOCB 3H3KA 2E7LA 1YPZE 2VERN 4I0PB 1G6RA 3EOBA 2DKSA 4RGOL 2P8MA 4XCCH 3N1GC 3D2UD 5JMRA 1YNLH 1F18A 1OZUA 5CHNB 3WO4B 1WFOA 3G6DH 2P5WB 3B3IA 3OKDB 2AKRA 1SMAA 5I1JH 4WW2F 2OS7A 4HJJL 1BX2B 4JNXA 4NWUH 4OI8A 4DJMA 4LCWE 4W70A 2WVVB 5FKAB 4POYA 3R18A 3VRLE 4ZQTA 4H25A 1GCFA 4BK4A 4JJ5A 3TV3L 2DLTA 1P9MA 3FQ4A 3SDDB 5AB2A 2A9AA 2KYIA 5B39B 3GMRB 2DJMA 3U30C 4A2LA 4PWIA 4X4KA 1FO0B 5HHPB 4PUBL 4RFOL 2WVTA 3ZQXA 2ZF9A 2ARWA 5INCB 2N3JA 2EILB 2G60H 5IT2L 1GZPA 4X83A 5DD3L 3THMH 3F6LA 3POHA 1OGTB 4KHXH 3ARFD 2E9JA 3QORD 3C5ZB 3TBYB 4KDTA 3DWTA 3MFFA 4ZAKB 3FBQA 4NP4L 5DTFB 2YC1B 4QRPA 2ZF8A 5D96B 3H8NA 3FO1B 4C4UA 1CD9B 1VZIA 3L3GA 3V0VA 4YK4B 5J4MA 4NENB 1PU0A 1VHPA 1B4JL 3EOTH 4FI6A 4HJIA 3LH2L 4AITA 4TVPE 4QHMB 5ESAA 3O2VH 4XB7A 1QQDB 1DLFL 2NY2B 3GS7A 5DYOB 4HJ0D 1QYGH 1Z32X 2VJ0A 5I0WA 1JDAA 4LSQH 2ENSA 1ZHKB 3I02A 5DR5L 4UM8B 3NFNB 1P5VA 4LRNL 3HFFA 2Y22A 3GRGA 3JUZA 2Q86A 4J3BA 4EN3C 4JG0H 1A14H 3UERA 2EYTB 3KWTA 2NSQA 5FB8A 2YD9A 4PJ8C 4Y19E 4NZTL 3W38A 1S5IH 2X7LB 1FZMB 3C5XA 3H9HA 3HA0A 4ZXBB 2DMGA 2Y06L 3RIAF 4D7BA 1I3UA 1KY7A 2PPFA 5F1SA 3MGOB 1L9SA 4S1SL 4M1CD 4NZUL 2AANA 1U41A 3P0VH 2EADA 4H8HA 3TZVA 3DYPA 3DGGB 1BFOB 1B0RB 1I1AB 5FW7A 2DJUA 3CFEA 4OAWB 1MNNA 5AENA 2HN7A 4PGBB 4OTXH 1TQUA 1NCAL 2DIEA 4PPTA 2YD1A 3ROOB 1RUQH 5A40E 2LU3A 1DE4A 1A22B 4ERSH 5BMFH 1AANA 4Z76A 1H3VA 3TO4B 1RK7A 1GS8A 4EIUA 1CDCA 3BDYL 5C86A 3C60B 4YXKH 3I6GB 5IFJB 4ZFOB 4JJHA 3F6IA 2PETA 1WV7T 3OL2A 1JZ4A 1J9SA 4K0OA 1OP3K 1BXAA 4PJCA 2OMVA 3ARDB 5T5NF 1BVKA 4OGXH 4JO1H 3SDYL 2LE9A 3VXQA 2M2DA 1EFXB 4MNQA 2FTAA 4LNRB 1S3KH 1JPGB 1JWMA 1CVRA 1I9IH 2CK2A 1NCCL 4P5KA 4XWOD 2Q5BA 3LOWA 5F3HB 1X7SA 3MDJA 5I17A 2EXTA 5D7JB 2GJRA 1BD2B 3PPSA 2YUZA 3BPNC 2Q8AL 2OV0A 1MCWW 4WV1B 5KYWB 3P9LB 2I32A 4HF5H 3RX9A 3VD5A 1JF1B 4MQXD 3VI3F 3KDMA 1EX0A 5CEXA 4L37A 4PJ7E 1XTMA 2DMCA 3AXHA 4GQPH 4HS3B 2UZIL 5CJOH 4YR6B 5EU4B 3NRQA 6FABL 5ICZB 3MUY1 2IH3A 4KMTH 4QRUB 4XNBA 1A1OB 2BOLA 1JNLL 5FYKU 1S7QA 4N2NA 1X6NA 2GTQA 1RUML 3CJJA 1NCNA 4MZ2A 1WFTA 3QI9B 3EIFA 4KJQC 4N2GA 1NGYB 1QTPA 2NZ9C 3QHZH 4XO9A 1SM3L 3RWHA 1L0QA 2BVQB 5EBWA 5F3BA 4FOMA 4KJYB 5J56B 2H1PH 2BP0A 1FJ1A 1U3NA 5DVOA 2QSTA 3KBHE 4X50A 3CVCA 4C56B 5CCHE 5DHMC 2P49B 2ZOLB 1OW0A 3SQBB 3GNML 1EO8L 4OZFA 5KN5A 2OZNA 4IKKA 7CGTA 4JN2A 1U95A 4HWZA 3R0MA 3ESMA 4RQQB 3ILPB 1UM5H 5LNEA 2K7PA 3ZDYF 1WBYA 4P5TB 3C2SA 2VIRB 5IJBC 4XI5C 3WS3B 4OM1L 4J6RL 2GQHA 1KCSL 2I5YH 4P57A 3RVWD 4LDCA 2KERA 1A4CA 5I18H 5I1KL 4YSAA 1VEOA 3IDNB 4PR5A 4ANKA 5EEYA 2Z0BA 4AE1A 3I74A 2QGBA 4TNEA 3MLRH 5HI5C 2FB4H 3Q13A 4FXGA 4UILH 3FUKA 1JZFA 2DQFA 1TEYA 4XPBH 1UYWH 1MCEA 1G6RB 2OYLA 3ZL4H 3EOBB 5MEPA 5F70A 5F6HJ 1ZTXE 2DQEH 3EADA 3L54A 2B59A 3EGSA 4G43A 4GRMA 1BLIA 3QS3A 2P8MB 4LASL 4QJ3B 4OFKA 3S3BB 4FFWC 1KSRA 2AGJL 3ZKSD 3ZRSA 3LB6D 4KRNA 5BW7C 2NCEA 4FLHA 1DVFD 3QW9A 1WZMA 1RLWA 3L5XL 1U8IB 4L1SA 1QNZL 1PS3A 2YWZA 5IY5B 2E75C 3T0XA 1LYQA 4KGLA 1AXIB 3AY2A 3I9GH 5J6GA 1E8XA 4GAYA 4FQLH 2F8XC 2OJEA 1NMAH 1J8HD 2B1OA 2JJSC 4JJ5B 4P23D 5DUJA 1EEUA 5E4EC 5I26A 5FECA 2EUVA 3QFGA 4FNSA 4JZJC 3NSFA 4L5FE 3ZKMD 2EDKA 3EDFA 3DX4A 3W0WE 3O6MH 3HC4L 5C9KA 2J57A 5ILTH 2MOQA 1TLKA 2XKSA 4JREB 4LLUA 4ODSL 3FB7A 4G9FA 1KUMA 1XEDA 1CG9A 2OW7A 3K72A 3U4BL 1GZPB 1WAPA 3CVHL 1T66D 1PD6A 2IPKA 3BQUB 3UROR 1KFAL 4A7QA 4B60A 1VA9A 3MFFB 2TSBA 3LKSB 3FT1A 3QZPA 1KLFA 2XUWA 5LNGA 3Q6GH 5J13C 4Y0GA 5MENA 3V0WH 1NPUA 3IU4L 4EUPA 5EZOH 2EINB 3ZR6A 1R3HA 4JO3H 3L3GB 3R1GH 3G6JF 3V0VB 5E2WL 3ZMNA 4P46B 1FFRA 4ODHH 4AV4A 4L3ED 4MQTB 4NKOA 1VEPA 3NCYP 1DO5A 4TNFA 5DQJA 3R4RA 1MCFA 1TQTA 2OSXA 3V4PL 5IJKA 1FIEA 4PRDA 3FH7A 3I02B 4KJPD 2X3CA 1P5VB 3LNGA 3QPKA 4E42A 2J1YA 3KXFD 2Q86B 1E4KA 2FBJL 1ZVYA 4N2AA 3KR3H 3MV8E 1I3RA 3TVMB 2W59A 4R26L 5FB8B 4HFUH 3VWJC 3CPLA 2JCCA 2JKRM 3EO9H 4ISVA 1EHNA 3ZBMA 3BZFA 3H9HB 1KT2A 3HUJE 1BXXA 4AKQA 4JLRA 1RJLA 4PWFA 3DX9B 1XGYH 3GDBA 4WU7B 5DUML 3U83A 3TZVB 5D1XB 1VGEH 3PHOB 1BYNA 4X8CA 1CI3M 1QFUH 3CFEB 4GRWB 1NBYA 2NNXA 3UP6A 1N67A 2HN7B 4QRTA 3T2PA 4A2MA 2XN2A 3P3YA 1QRND 2XWJA 2XSKA 3GEWB 4Z76B 1EJOH 1HVXA 4XP5H 1PLCA 4Z7OF 3CSFA 1AIZA 3QNZA 5FUCE 4ZMNA 3WV0A 2WIMA 2ATAA 4GQRA 3RY5A 4TOYH 3ZKQD 3L4VA 2MEJB 3JWNE 4JM2D 4B96A 4NN6B 1SOSA 1SNRA 2OMVB 3MV11 3VH8G 2DBJA 1RHFA 1ZXQA 2ZG2A 3RWCA 5JPMC 2F1AA 3VXQB 2WBJD 4MNQB 4W9HC 1KB9J 1MHHB 3VYPA 4JL1A 1UFGA 4GRLA 1JWMB 4PBXA 2V5TA 4P5KB 1A3LH 4K5OA 3O6KL 1TTGA 5SV3A 1TZHA 2ISDA 3FUDA 5LCVH 2A77L 4JRYE 1PZCA 3WAJA 5FFOA 3BXNA 1PJWA 5CGYC 4Q9CA 3IRZA 2KQMA 1NLDH 1RZGA 2F7IA 1L9OA 2FATL 4NO0D 2BNQE 4P5SA 1XB8A 4LHJB 4ZMWA 1Q38A 4IJ3B 5CEXB 2VR6A 1MXDA 4XP4L 1FYTE 2BY1A 5AVZB 4AEHL 3BAEH 5JLZA 2BXZA 1KB5B 2YMXL 3B9KC 1S7QB 4MAYD 5IFAH 2QEJA 3BAXA 5D7JD 4KTGA 2DQGH 2EUWA 2Z1KA 3VW3H 3RB7A 1OXYA 4RDQG 5SX4I 1F97A 2Q8BH 1F4WH 4FS0A 3PG2A 4UAOB 4JFWA 5GGVL 3RWHB 3UC0L 3ARBC 5EBWB 5F3BB 1C8QA 3NJXA 3ECWA 2BP0B 4D7PA 3S8GB 1FJ1B 3UAJC 4XPFL 4Z3FA 1XL4A 2D7NA 4Z7UF 3VQLA 1SZNA 1VPOL 2XVGA 3D39E 1A4JA 2E6QA 3EJYC 3ZDXF 4OZFB 5KN5B 1ZVNA 2X09A 4JN2B 5I1HL 1B2YA 3S7GA 4HWZB 4OU3A 4CU6A 1V55B 2FCBA 5F93C 5E9DE 1VERA 2VM4A 1WBYB 4JMNA 5IESH 2XFXA 1NCBL 1DP0A 2Q20A 4I77L 4JFDE 4TSCH 2CMRL 5DVPA 1L9PA 4JJOA 4UOW1 3JT0A 1T89C 3PWJA 3BI9X 3H42L 4LARL 4P57B 1CXFA 3RLSA 3U9WA 5HDQH 1NPNA 3N40P 4NLHA 1WTGT 4PR5B 4W6YB 4K94L 3ZT5A 2VE6A 4IGBC 2VDRL 2HP4A 4MCZA 2OMWA 5GZOD 5C09D 2DQFB 2HPTA 4QY8A 1MVYA 1UADC 4KU1A 5HHOD 3RJQB 5MEPB 2WQUA 1CLYL 5KVDE 4XXWA 2B59B 3L1OL 4GRMB 1VCAA 5KSBF 3K81A 5MP6L 3RTQA 3WIIL 3MRRB 4H88H 2I9TA 2R1XA 5E1HB 4DZ8A 3H54A 4OD1L 4GXUM 4F37K 4UIMA 4F93B 1D9KA 3SE9L 4PG2C 1FH5L 4ZI8A 3DJSA 3VXPA 1CUOA 3HZVB 3LNDA 4OIIH 5ADOH 2WTPA 3FSVA 3DARA 3BSZH 5J6GB 1AD0A 4GAYB 3HC2A 5FYJE 2FJUB 3P3RA 3E6HA 2H2PC 2DWXA 1WCQA 5FECB 4PJDA 3NABH 4HD5A 2IOMA 3TEXA 4AEIH 1QLFA 3DOSA 1KDIA 3C75A 2YZ1A 3JWOL 1MIEL 4LLUB 3FB7B 3NSDA 4G9FB 4R4FH 5BO1L 1KGUA 3K72B 4B3EA 2CPUA 3SOBL 4XVUD 1FV1A 1QWNA 1F4AA 2QV4A 1HS6A 3EH4B 2IPKB 4Z8FL 2F0CA 2IH1A 4P4KD 4OCNC 1M7DA 2VLLA 1JWUB 1PZDA 1QD0A 1T22A 4GPVA 4QRQA 3CFCH 5CCKL 3KLSA 2R59A 2EKJA 3NEEA 4FXKC 1GGBH 4OF6A 2DQDH 4EOWH 2R69H 3N44F 5MENB 1R0AH 4OLWH 5IR1B 3QPQD 1E27A 4EUPB 1EEQA 3NFSH 3MVSA 3UEZA 4K15A 4P99A 2RA1A 1R3HB 3QIUA 4B9YA 4OSUL 1AMXA 3FB8A 4ZX3A 4YDKH 4KDVA 3V0GA 3V4UL 3SOTA 4OUUA 1A3RL 2XRAL 4NKOB 4MA7H 1KCRH 5FKPA 5IK3A 2JKJA 3EOAA 1NUNB 4E9QA 4BH8A 4RX4A 5AOZA 1SOKA 5FA3A 2EO7A 3CWGA 3APMA 4E42B 2LVCA 2YUXA 1XXFC 1I3RB 1OHZA 2BZDA 3CVHA 4BCZA 2CBMA 3FYIB 4PP2A 4DAGH 3W5NA 5CCGE 1W6WA 4ISVB 3WNOA 2DN7A 3FQNA 4LOFA 4HDIA 2A3TA 2FDBP 1I8AA 2NY4C 1RJLB 3RWDA 4N0UA 3KYMA 2AAVA 2HJKA 3HC0A 3TLRA 2C9VA 2YZ8A 4EDXA 5FC9A 3DXAA 1NBYB 3EZ8A 2FGZA 4PJ5A 4QRTB 2HLFC 5EULV 4WW2A 5TFSL 5B38G 4PFEA 4BCYA 2XWJB 5E2UL 1ZJAA 3U48A 1Q0YH 2ZOWA 1XGUA 4TUKH 4Y2OA 3QDHA 5C0GA 5DT1H 1IAIH 4K3HA 4JY4A 1DLHB 4FNRA 1YCSA 3P3SA 3QNZB 5DMGC 3TWYA 3CCHA 4L8DA 3ESPA 2OI9B 1MCIA 5FO7A 4R2GB 3MLWL 2EIMB 2WO4A 2ZD0A 2V7NA 5I1AA 3E6FA 5IB4A 4X6EA 2CUIA 3VGGA 1EHLL 5C08E 2ZWLT 2NYYC 4PJEF 3RWCB 4EBQL 2JWYA 2ERJC 5AAMC 2Y1ZA 1UM4H 1W0YT 4GRLB 5EZIL 2K78A 1ACZA 2UWEF 4E36A 3NCEB 4KZDH 4LKXB 4DP7X 4I89A 3QNFA 1A9EA 1IFHL 3DSFH 3GIVA 2FLRT 1S6NA 4HBQA 2NR6D 3BXNB 4L0ZA 3MJWA 5EU5A 1NMBL 2EDTA 2Q3AA 1RZGB 4PJ9C 4AKPA 5CU5A 4CMHC 4DP1X 3VGAC 3W81A 4WI9A 1XX9C 5IV2A 4QLWA 5I6KA 1RD6A 2VLME 5A2FA 4OZ4A 4MA1C 5D1QE 1GZHA 3BE1L 1H5BA 4Q4IA 5FAAA 3L2LA 3N06B 3RWFA 1KWGA 1T5XA 3NZSA 1E2VA 1ZV2A 1WZLA 3GHBH 5KUMA 3AADB 3QXAA 4XNUL 3FJTA 1BDYA 4MXQD 2XQBL 3OQ3B 1LD9A 1BIIA 5INDA 2A0LD 1CXHA 3JTSA 5B1JA 3KPPA 4FG6D 3KMDA 2NTSP 1A4JB 1OD7A 3U7YH 1N68A 1EDYA 2WP3O 1NC2A 2C4FT 3L08A 1IGML 2YPKA 5E7FA 2IDFA 5A6LA 1M42A 4NQCA 5FHBL 2ENYA 4RGNB 3ETBF 2IPTL 2XFXB 3PXHA 4KO5A 4DGWC 5KJRH 4X80L 4HOZA 1F13A 2QADC 4PGDA 3PWJB 4QTIH 1W80A 2N1KA 3HHMA 1KIPB 1Z9NA 3FFCB 4HVBA 4JO4L 1Q9WA 1AQKH 4Y16D 3MODH 3SQRA 2VE6B 1ADQL 5L4FA 2D73A 2QZQA 4ZO6A 5FYJU 4MCZB 5IQ7L 2OMWB 5MI0C 3WY2A 5E51A 4OZHE 4FABL 3P2DA 1ZAGA 4DKFL 3W9EA 2NW3A 2E7MA 2G0KA 3FO0H 1NEZB 3G6AB 3NJVA 2Z93A 2ZOKA 2H0FA 4LQFL 1J5OL 1O5PA 2HT3D 1J48A 1N4XL 2I7SA 3A4EA 3RTQB 4KK8D 2I9TB 5DHEA 5E5RB 2R1XB 4DZ8B 1JNJA 3O3EA 4TVUA 1JXDA 4UIMB 1F6FB 1D9KB 1IQWH 1I4FA 3QUZB 1FL5A 1SVZA 1SHSA 1IIIA 1TETL 1XF5A 1BGXH 5I6XC 1E30A 2AI0H 3QWOB 4UQEA 3ZE0F 2EXSA 2EQDA 1NC4D 4BELD 2IOIA 1AD0B 4XPHL 3SDXF 1JK8B 4W4OC 4K07A 4GKSA 1IGYA 4ZRGA 3VI3A 3RY6C 4FNLL 4BSJA 3WHXA 5EC1A 4PJDB 1G87A 2Y07H 2VZ1A 2DZEA 4LPXA 1ZLWK 1QLFB 4FD0A 1OP9A 4AG4L 2Y1AA 3M8OL 4NNPL 5FYLH 3SYPA 4O58L 1INEH 3A3YB 5DRNA 4KJWC 1BQKA 4I3GA 4Z3TA 5E4AA 3L3IA 1FV1B 1LWRA 2AK1L 3IJ9A 3X1FA 4WNQA 3F12A 2IH1B 2FSDA 3T8XA 2VLLB 5IIEA 4N24A 1TQSA 2CAKA 2NY6D 1QPKA 1TJIH 1OCZB 3A24A 2V33A 1E27B 1QSFA 4ZS7H 1PZAA 4S0TD 2BSBA 4C54A 1NDMA 3HOGA 4MCYA 3E8UL 1WWCA 3FB8B 1ZEAH 1S7TA 3L13A 1U2CA 4OUUB 4PCSA 1CF8H 2KLSA 4XNYH 2NXYC 5FKPB 4XO3A 3TJEL 2BX5A 4A2EA 5IK3B 3DURA 3EOAB 3EDKA 3HR5A 4XP9H 3CDZA 1N64L 1OCCB 3O9WC 2KPWA 4LSTH 4OCSL 5HPMA 2R0WL 2R29L 5FA3B 5IBTL 3CFDA 4JFXB 3TS8A 4BQBA 3ZZ1A 3UG4A 1MY5A 3ZUCA 5JXEA 2V37A 5IHUH 4PP1D 5JQHC 3UZEA 3CVHB 4LK4A 3T9WA 4PP2B 3KPSE 3Q8AA 3BC9A 1UJ3B 2Q0ZX 3H56A 1AFVL 3W5MA 4W9ZA 3SJVA 4HDIB 4RFNC 1BVLA 5DXWA 1CDHA 4QYOB 3RWDB 1FF5A 3KYMB 2VYRE 1UB6A 5EBLB 2BIHA 2HJKB 4IIQC 4NRXA 3HC0B 3O6LH 4I18B 4EDXB 1GZQA 1MFBH 3DXAB 4QGYA 4PJ5B 4WZ9A 2CGZA 5JHMA 1JZJA 1MAML 1MFEH 4WW2B 1HC1A 5IF0A 4OGYH 5J1SC 5DWPA 1DBAL 2R0LH 1MREH 3TA3D 1G7PA 3V4PB 4Y2OB 2EDDA 3ZRFC 3QDJA 4HJGA 1D6VH 5DMKA 5C0GB 4JY4B 4I2XA 5IVNA 2VXSH 4B41A 4DGYL 1WZ1L 1G7IB 4JFPA 3Q8BA 3CCHB 4L8DB 5KYUB 2OYPA 2DEXX 5FO7B 2WLMA 1OL0A 4CDGC 5I1AB 2V7NB 1V8HA 1LEKA 3DSNA 2DLFH 1ZE3H 2Y36L 3H9SE 4QXUL 4FTVA 4TSAH 4YSDA 4PV9B 1NPJA 2FL5A 2CKNA 3C8DA 5BUPA 2VNCA 1OTSD 3FT3A 5A2JH 2R56H 4L8SA 3NFPB 3GIVB 1M4KA 5F1KC 5EU5B 4RMBA 1YEGH 4BFKA 3OGOE 1T5KA 4N8VA 1BQHG 5IBLD 3GSVA 1RZJC 3VFRA 3MCYA 1A7BA 1RVFH 1R3LB 2YN5A 3G6JA 1UUSA 3CZSA 4KOBA 5IV2B 2VT0A 1OGSA 4OZ4B 1GTNA 2XC8A 4ZPTA 2X0VA 1LTXA 3HZYA 3RWFB 4DIXA 1T5XB 2NX5A 1B6DA 5IQMA 3RVXD 4JCLA 4LSSL 3APFA 5ECGA 2MIZA 3I6LD 2ID5A 2QTEA 1ZK5A 3QXAB 5D2NC 4P2QD 2CK0H 2CO2A 2XPGA 4Z3HA 2F7QA 3AY4C 4KKCC 2FBOJ 1JMZA 2C5DC 2MMXA 4K23H 1LD9B 5MEQA 3Q2CA 4L4VE 3UXFA 3VA6A 1LGVA 3RVVD 1J0IA 3JTSB 3KPPB 4APQD 3X11A 2ITEA 2PP9A 3BH8A 1QLEH 4AW4A 1HXYA 2FEDD 2HH0L 3TL5A 1NC2B 1W72H 4AV5A 1T0NA 2YPKB 3OC8A 3E1ZA 4HWUA 2H8PA 4NQCB 4XGZA 5BVJA 2Z7ZA 4ORGA 2AVGA 4NQEB 2JELL 1MCNA 4PGDB 4ELKA 4M7LH 4AIZA 4KZCA 4IBUA 3HBZA 3QRGL 2PYEE 3POCA 4ZFZA 4JM2F 4MYPA 5TE7H 3CMOL 3P4MA 1Q9WB 2DL2A 4G7YL 2P1YA 4JKWA 4QNPF 2RIKA 3HBPA 5C1MB 3AACA 2FIRT 4F57L 1KPVA 1WA1X 3FRPG 2DLIA 3EHBB 1OPOA 1EZUA 3Q01A 2NW3B 5DD5L 3W9EB 2ODHA 4PRHD 4WUUD 2G5RA 4E9YA 2Z93B 2ZOKB 5IVXE 3PGFH 5DK0A 1H15B 3NJJA 1HCFX 3TFBA 1FE8L 1YEHH 4ZUVA 2J6EH 2F8VA 2RBLA 3O3EB 1CJYA 4S1QL 1YYLL 4UT9A 4GUPA 1FFNA 1OM3H 3WKNA 3FTYA 4I1PA 1J5DA 1FL5B 1XF5B 4PBVC 4F8TA 4XX5A 3NGBC 2J12B 4FG0A 1ED3A 4TL4A 3ZTJG 1MPAH 2JMRA 2XDHA 4K2UH 3ULUD 1DN0A 1NCDH 2VAJA 4FQQA 4LEEA 3B5TA 4Z7NF 4HPOL 1G7QA 4GKSB 2EDEA 2VLRE 1IGYB 3BKYH 3U6RA 2L4OA 3VI3B 5C0RL 5JDJA 2BZ7A 4Q9QH 3ARGC 5EC1B 3DVGA 3HBQA 3WS6C 2FX7L 4Y2DC 1ADQA 3WE6A 5BRQA 2VDRB 1JF6A 3RP1A 3RX8A 5DJ6A 3TF7C 1MUJA 2WUCH 5FM5O 4N2CA 5AOKA 3UX9B 1GYAA 3A6CH 5DRNB 3V9EA 3K6IA 2RB8A 4CU8A 2OYMA 2R27A 3L3IB 4AW7A 4YIQA 4ZUSA 5CD5C 2HVBA 2FNBA 3F12B 5JW4M 3T8XB 5IIEB 4XO4A 1XAUA 3LXCA 2H3KA 1J5HA 3BRDA 3B9EA 4Z0XB 3F2LA 3CN4A 2C3WA 3HRPA 1QSFB 2V9RA 4XP1H 4Z7UA 1G9MH 5ACZA 3UTTA 5F7KC 1NDMB 4JRWA 4MASA 4M7JL 1GW6A 3BN9C 1OE2A 4MCYB 3O2DH 1O6VA 4K71B 5CF3A 1BAFH 1UOLA 1CS6A 4Y7OC 3CZUB 5DUPL 4IBWA 4PAZA 3QAZB 3HR5B 3ZDYB 5AFAA 3CDZB 5D7SH 3MNMA 1NL0H 1RZKH 2QTVA 1J8SA 3MGTA 5EA0L 3KEHA 3O2WH 3TT1H 4E41D 5A16A 4OFPA 3KPTA 5D4JA 3CFDB 3FW6A 4GEJA 1QSZA 1OY3B 4DPCX 3T6VA 4AVJA 2ZXDA 3ARUA 3TP4A 5C7XL 2AABL 4LAQL 4ABUA 3K8KA 1AY1H 2BM3A 5L7XH 5TTRA 4Q4EA 4GUCA 2UVFA 4WSKA 3SJVB 2DW5A 3F58L 1AGFA 1N3NA 1QSED 4N1HB 4B9ZA 2WVSA 2JKWA 5DZ9A 2QQNH 1UB6B 2ZXAA 4NRXB 5KSBA 1B6UA 4QD2E 4ZTOH 4ONOA 5FPIA 5PCYA 1GZQB 1IC5H 3F6JA 2UY7A 3AB0C 4O5LH 4YHZL 1JGDA 3DGDA 4NIKB 2J71A 4EN3D 4GINA 4M3HA 4GAJH 5EOCH 2QKSA 4PJXE 5IF0B 1JTOA 3SKUD 3FU0A 3IN0A 3T0EE 1FP5A 2JQMA 4PJ8D 1G7PB 3GINA 3ZQWA 3VE0A 2OX5A 5DMKB 3JWDH 1KYOJ 3S88L 4I2XB 2IOOA 3L8QA 2OKMA 5D1ZC 3GJFB 2VZUA 2J21A 5L8JB 2AK4A 4B27A 1GY2A 4I5BA 4NGHL 1LEKB 1NEUA 2TSAA 1JZ5A 4WDIA 5DC0A 2F19H 3L3OA 2O6PA 3IDJB 3UGEA 3TXAA 4FTVB 1PAZA 4KHTH 3AU0A 2FL5B 3L3KB 1YEJH 2FRGP 1K9TA 2A1WH 5D1ZI 3FT3B 2Y2TA 5LAXA 4G9DB 3VYOA 2GIMA 2HFFA 2IAMC 3ARVA 3QUML 2J8UE 4L8SB 2YGVA 4HPHA 5AAPA 3SDCC 2VERA 1P69B 5BZDA 4R0LC 4W9JC 4M9OA 2DLHA 4N8VB 4FA7B 2AC0A 3UTSD 3BWAA 5E1QA 2GB2A 4RESB 3VFRB 1T5WA 5FUOH 5T8IA 4JDZB 1J1OH 3NIGF 1FGVL 1C16A 2KUTA 1HEHC 1INQA 1YUHB 1RZFL 4ZPTB 4G8FA 3HZYB 3ZKNC 5F7UA 2YAHA 1JD7A 2CO6A 2NX5B 3GMNB 3K2UH 3PWUA 2DYRB 1IJ9A 2VH5L 1I3VA 5CUSH 2A6DA 3PP3K 6CGTA 2XPGB 4O02L 2CJ3A 2AW2A 4ABQA 5EUOE 5MEQB 1E4XI 3BVXA 5KSAC 4N28A 4OJFL 4P05A 1NCOA 3MREA 2ZIDA 4H7VA 1R24A 3WTTA 2CDEA 5EO1A 1DBML 1QATA 5CJQH 3BPLC 3DV4A 3X11B 3BH8B 4IKNA 4IYKA 4WO4C 5C6WH 2NXZC 1HXYB 2WTRA 4KV5E 4BUQA 1T3FB 1WA2X 2EZ0D 2NRDA 6PCYA 4YPJA 1PLAA 2IAND 4XGZB 4XMWA 5C0IA 3ARPA 3T71A 3VSQA 4KJQD 5T1MB 4ORGB 4HLZG 3SGDH 2G75B 2NZ9D 4X7TA 1MNUL 3EBAA 4M43L 3RB5A 4AIZB 5GRUH 2A6KA 3EFOA 2YRLA 4LSVL 4ZFZB 4CKQA 5C3IA 1SOQA 3P4MB 5AW3B 5CEZD 2AQ1A 3VRLF 1NLBL 2W81C 2AJSH 1AYOA 3V10A 1KPVB 5IROC 1NDGA 5E2VL 3WFEH 5EEVA 4B9JA 2DQUH 2CIKB 3ARFA 3KM1A 4BQ8A 3QORA 2HFTA 3LS4H 1YNTF 3FYEB 3MZGB 1L6PA 1T80A 4PJEA 1DBJH 4GW5A 4HIQA 3FBKA 3P30L 4EVNA 4XMKL 3WFDH 4XI5D 1PLBA 2XI9A 4ZUVB 4AJYV 3ALPA 2D2OA 3AWFA 3KAAA 3WIFA 1H6TA 2UWEA 4GUPB 1FFNB 4XBEH 5AOLA 5CFAA 4ZT1A 1J1PH 5FUCC 2WB7A 3D4ZA 1DN0B 1CB4A 4FQQB 4CJ0A 1T03L 2N56A 1X5AA 2C9UA 1G7QB 2PUQT 2XIBA 3LZFL 4OLZL 4YDIH 1NGPL 4FQIL 4DTGL 2BHYA 3U9PL 2VM3A 3DVGB 1D5XA 3LY6A 4H2AA 4MNGB 3SO3C 3E38A 3WE6B 3C08L 1LQBC 4EI5A 5ISZE 5DJ6B 1MUJB 4NBXB 4FFWD 2Q9OA 4U2ZA 1J86A 4NBYB 4XN4A 2VOTA 2RCSH 3O3DA 4Z95H 4UTBH 2WCSA 5DQ9A 2M83A 4YIQB 4ZUSB 4ZFGL 1A7OL 1L3WA 3KHQA 1T7WA 1MFAH 1K4CA 2C1PA 2C9XA 3FN9A 4KI5F 5K9QI 5T1LD 5I8KH 4H8QA 1DVYA 1G7HA 1YG9A 4QHNA 1UWGL 1L7IL 4G8GE 2IGTA 1NKGA 4Q2ZA 5AW9B 1D2OA 3G3LA 4Z7UB 5ACZB 2APWA 3UTTB 4JFED 3D3VA 3DVNA 4PS4L 1GC1L 3IBEA 2VXQH 3DRQA 2WXJA 5SX5K 2XA3A 5KANI 3PXJA 1T6WA 5TF0A 3JYBA 1HL8A 1YDPA 4HUNB 3DHMA 2DM7A 2NY7H 2OMYA 4N6RA 4ENZA 4QHLA 2DLEA 1T1YB 1NIFA 1E3XA 3MRMB 3U0TB 1E9QB 4ZJ9A 1JI1A 4EE2A 2QPUA 1AE6L 5A16B 1S8DA 5AB9A 2X2IA 4KNSA 1MIMH 4AQ8C 1NBVH 4Q6IA 2B9BA 3RGVA 3AROA 1AGBA 1EGJA 1IEAA 5EN3A 3TYGL 3W56A 3GBMH 5CO1A 4F9LC 4XB8A 5E5MA 5I0XA 2VN4A 1NEPA 4JVUA 4AQAA 5L6YH 2G5BB 3GSXA 4NZRL 5AZ2L 2ESVE 4M8QA 4WI5A 1HNGA 4TRPH 4XVTH 1AGFB 1CYWA 1N3NB 2WXKA 3LQAL 4ZSOA 4M5TA 3QFJE 1M2VA 1PX3A 2HG5B 4O4YH 4TULL 3ARTA 3MRCA 5A2KH 25C8H 5KSBB 3U36B 3KPMA 4UQIM 2F53A 1JGEA 3REWB 3TJPA 4N4YB 2VRAA 5K9QG 4JDEA 4RDBA 2OJ1A 4WKXA 3NP3A 4R97C 3CV5A 3MJ9L 4ZMOA 2NY5C 3UTPD 1KENL 3VE0B 2OX5B 4MB5A 4YE0A 1U42A 3SDXA 1N19A 4KAQL 3BLKA 4XC1H 1OT2A 43C9B 3QDGA 3SKJH 2AK4B 4NZJA 3AG4B 4PJ7F 2J20A 3GT6A 5KANG 3EFFA 2O5ZL 5C07B 3T0AA 1CWVA 2E74C 1MRCH 1FZJA 2YMTA 4WDIB 2VDLH 3KPRA 2QMKA 3L3OB 1OP5K 5CMAA 3VXMD 4EEEA 3IDMA 2YQ2A 1KCVL 4MJID 2PPCA 3QWRD 3VMNA 4PVMA 2FO8A 4F1ZA 1G0DA 3Q05A 4UANA 4N9OB 1EAOA 1FZOA 1WHOA 3ULVF 3IMVA 1ITBB 5LAXB 5H4ZA 4J3OC 5EC2A 3P3TA 1KCUL 1N8ZA 1ZJBA 2GG1A 3QG7L 2HFFB 3FMGL 1U0QA 2WN2A 4JZNA 4JCMA 4LHQB 3Q9QA 5FGBC 1DVZA 5BZDB 3N44B 5BVPL 1B2WH 5GGQL 1BZ7A 4PWHA 3BWAB 4N90E 3RG1C 5T3XD 4DEUA 4G11A 3RNQB 2YA0A 1F3RB 2BS9A 5LN4A 5JOFA 4M4PA 2YARA 1C16B 2K70A 4U1MA 5K1VA 1INQB 4G8FB 1F4YH 1G1OA 2YPLD 2ZG3A 2FZ3A 4NFCA 5HYJD 1NSNH 1XGZA 2CO6B 3MO1A 1YJDL 3PWUB 3DBXB 2JXMA 4PI2A 1HCYA 4NJAH 3B6SA 2A6DB 1RP8A 1NMCC 1RIHL 4OD2A 4XO5A 5AL8A 2YHGA 3RI5K 1ACYL 1FI8C 5I5RA 4NN5B 5CGYD 3ZE1F 3EDEA 3I75A 3QEQE 4XOEA 2XWDA 1IAKA 2YKKA 4NUGL 8CGTA 3MREB 2XTSA 5CIPH 2CDEB 5EO1B 1PGRB 2AF2A 3DV4B 2WBXA 2P47B 1F86A 2WTRB 2VXVH 4WSJA 3B9KD 3VSUA 7TAAA 1BBJA 2QLVB 1CXIA 1MJUH 2BRQA 3WI9A 2N4IA 4A66A 2YAPA 5C0IB 3D4CA 4XNDA 3S0PA 3NAAL 5AL0A 1J1XL 4UDTA 3ZTNH 4P23A 2GW5A 1J8HA 4ELMF 1JGUL 3UH8A 4X7TB 3US9A 5EORH 3LDBB 3ARBD 1CIDA 3C6LD 1DVUA 3EFOB 1KBWA 2VDNH 3VXUD 1NCGA 3QHTC 4HETA 3UAJD 1KB9K 3QR0A 4HKXA 4ZTPH 3U7WL 3O41A 1ICTA 5GS1A 4KZ0A 4N87A 4FMFA 5FYKL 5IB1A 4LVHC 2BW4A 3EJYD 3WD5L 5J13B 4O02A 1J0HA 3IN2A 5LG1A 4J3OG 2AFNA 2WWMC 3H53A 2Q1EA 3RWJA 4DQAA 2H32H 1TCRA 3SDAC 2KDYA 4KXBA 5IOKA 3DO7A 3I9PA 4PJEB 4BE6A 4EVNB 2EDFA 5CU9A 1MOEA 1BQSA 4JFYA 4YHKH 4TVSa 3SE8H 3B1UA 2K7QA 3QQXA 4OI7A 1ZWIA 4WK2B 4GH7B 3WIFB 1OTTC 2UWEB 1RQ5A 4U1GC 3NJMA 1BAGA 1XFPA 3QPXL 2HZHA 5T3ZE 1N26A 4IGBD 4QRPE 4GRWH 1KGCD 2HFGL 4JFVA 4E9WA 3LHAA 4HHAA 4P9HL 1CLOH 4P2OC 1D5XB 5EWIH 4Z3JA 1T2QH 4FEMA 3WY1A 5KBDA 2IWKA 3EO0A 1IKNA 4EI5B 2KT6A 2ARJA 1BYPA 3QQ3A 4DUXA 5KW9L 3KXFA 5KVFH 4L29A 5E00B 1GGYA 4RAUA 1JZ7A 3O3DB 5ENWA 3BUIA 3VAEA 4ZO8A 5HDOA 1YY9C 1PLGH 4HK3N 2C1PB 3FOMA 4HG4J 1EHAA 2IGFH 4Y2LA 5CLWA 1NAML 2OP4L 3K6OA 3PUCA 2D03H 5ITBL 4QHNB 5L2KD 2H2PD 2CXKA 2ZCZA 2NTFA 3QXTA 4Q2ZB 5JZ7C 1WP6A 3EH5B 3EF7A 3NQIA 5IGXL 5I73B 3D3VB 3DVNB 4FMVA 4U6XA 1DVTA 2WK2A 5D1QC 5A2CA 5JORA 1F3DH 1A9BA 2FJFA 3DRQB 4NQSA 3P3UA 1QRNA 1USQA 1AR1C 1YDPB 3TEWA 3E0GA 2R9HD 3IAQA 3WJJA 1WT5C 4N6RB 1BSIA 2EH7L 1G5GA 4QHLB 4U6VL 3MLZL 2CRZA 3NPSC 5TDPA 4P9ML 1S8DB 4N2BA 1KB5H 2SEBA 3OKLA 4Q6IB 1HYRC 3RGVB 4JM2A 5CWSB 1AGBB 1IEAB 4DP5X 5ALBL 4HHGA 2DQCH 4DUVA 2A74A 2N7AA 1QABA 3MU3A 3D0LA 3N2JA 3V79C 2WBJA 4KUCD 4UV7H 5IW3A 2HKFH 4AQAB 1QLRA 4N2LA 1E8YA 1CGUA 2GK0A 1WVZA 2O4EA 3GSXB 3BT2L 2C4FU 4M8QB 4PJCE 1ZMYA 3LPFA 5TPWL 3PQYE 4ZSOB 3GMPA 3SBRA 4LP8A 4FP8L 1M2VB 1A6AB 5DI8A 3PGCA 2VO5A 1HIML 3KPMB 1CK0H 2VLKD 4HCGA 2F53B 4JPIA 4NO0A 2LU4A 1JGEB 4PREA 3SPHA 4XCFL 4EAEA 2XN9E 5AB1A 4JDEB 4RBPK 3V7AG 4Z6AT 3EJZC 5SWSE 4Z0BL 1K72A 3HC3H 3ZE0B 4LLQA 1ONQA 2VO8A 1I53A 1RK1B 2Y2WA 5DVLA 4Q56A 5D7LD 3DIFA 1AHWA 3RKPA 1SGKA 2KKQA 2E7BA 2NY4D 2Q2EB 3DYOA 3QDGB 1ZLSH 4JKLA 5B1BB 5F9JA 1A6TB 3KEDA 4S11A 1FZJB 4NO3A 3KPRB 4N2MA 2A5UA 5J1AA 5CMAB 3IDMB 3FUJA 1AKPA 1UD3A 1FVCA 1E5AA 3CQQA 1XB6A 4OLEA 2HLFD 1W8EA 4M7LT 4HKJA 1FZOB 2ODIA 3HNTL 1F90H 2CGRH 2DPKA 4U0RC 5EC2B 4CVWA 5EZJB 1N8ZB 3VB8A 2ZKXA 9PCYA 3V6BR 5JQ6H 1Q1JH 4JZNB 4WI0A 1JBJA 2ZTBA 1XBRA 5DMGD 1YQVL 2BFGA 5C0DA 4U1KA 1H8SA 3FONA 3MJ9A 5JOFB 4X6FA 2L04A 1WO2A 4U1MB 5J8OA 4ZD3L 4W4NA 1GXEA 2NYYD 1TYJA 1HE8A 3BKCH 5D4IA 5JR1H 2F5BH 2FZ3B 4NSKA 3MO1B 1RUPL 2JXMB 3RI5F 5GZOA 4TUOA 5C70A 4KKRA 5IJDC 4GG8A 5C09A 4YN3A 4OD2B 3P11L 5DJCA 2XWRA 5BUAA 2EE6A 2X89A 3I75B 5K9JH 4XBGA 4PJ9D 2XWEA 4FNTA 4PM1A 1IAKB 4ZG1A 1EEZA 3FFDB 1FIGH 2CU9A 2F1EA 2MNUA 5IHBA 3VB9A 1ZY9A 1B4TA 2IDUA 2VISA 5F9OL 3QUMB 5HP5A 4WFHE 4PWJA 1EDQA 5HYSA 4CVZB 3OJ2C 5I6NA 3D07A 4V11A 3O6FC 4LOEA 3TTSA 3ULVL 5F96L 2BHUA 3T3MF 4AI7A 1RFDH 1YEKL 4BK5A 4UDTB 3BX7C 4OV6F 3MXVH 3MRQA 4GS7C 4F7EB 4ALAL 4C8XA 1I8UA 4LB8A 2LVEA 3O4LD 3LX9A 3NZ8A 4M6MH 3D0AA 1E9OA 1L9QA 5ICXA 3QE5A 4HKXB 5BZZA 3O41B 1E4WL 4M7ZC 2H3NA 1HL4A 3VI4F 2YGPA 3M1CA 5IB1B 4RISH 4X5WA 1MFCL 4O02B 1ZLWH 2WWNA 2MOGA 3T0DA 4XMUA 3RWJB 3KDPB 1OQXA 5BRZD 1TCRB 1L7TH 3HMXH 1X5KA 3INUH 1GAFH 1A6PA 3SCMA 1RIUH 4G9FE 4J7RA 4K7PL 2X42A 1CFVH 3CQPA 4JFYB 2QADD 4YZFE 1QRKA 1ZWIB 2BOBB 2F54E 4KQ4H 4XVOA 4K9EH 4PJGE 1I3GH 2I60L 1Y0LB 1C5BH 3FQTA 2DJ4A 4LHUG 4N20A 3GM8A 5I8OL 1WZAA 1KBGL 2WXOA 2VZOA 3UYRL 4NQDA 5EF0A 1U91A 4HHAB 1J8RA 1NCTA 1JOIA 2G3XA 2F18A 4KY1H 3VFPB 4AT6A 2IXQB 4BK8A 4YFLI 1TQCB 3EO0B 3K4AA 3QQ3B 2ARJB 5E8DH 3KXFB 1CE1H 3STZA 4L1TA 4L29B 4RAUB 1NJ9A 4LRNH 1CICB 1KGWA 3CHXA 3S3PA 5GS3A 1M3JA 2E9GA 4UDUA 3GSNL 3SEPA 5J06A 2WLJA 3FOMB 3KPLA 4YGVA 5AKTA 4IRJD 3WMQA 5DURD 5K9KA 1NGWA 2C4XA 3DJTA 4F5CA 4U31A 2BNRA 1KULA 5A7EA 2NTFB 3WFBL 2XNAA 2JCCE 4MS8C 2HT2C 4LEXH 4N22A 1N5YL 1C08A 1KXHA 4JKMA 2R39A 4U6XB 4P04A 5JORB 2FJFB 1A9BB 1BF2A 4RAVB 2LQRA 4NQSB 1MFUA 4PVLA 4WO0A 1CBVH 2CHZA 1Z9MA 2ICEC 4JGUA 4R90L 2OK0H 4KJWD 4PJFE 4QHKI 5HGHA 1EBAA 1IKFL 4WUKL 4AGMA 2IADA 2XQYG 3RUGB 3G5ZA 4Y5XA 3FCGA 4CNIA 1X5LA 2Y24A 4OR1A 2SEBB 3OKLB 3P73A 4JO2L 4JM2B 2WXGA 1YEEL 1G9EA 4LCWA 1OTUC 2A74B 1WCBB 4PRPD 3D0LB 4JR9L 3NJKA 3LS5H 1GSKA 2A73A 1QLRB 3DROB 1OAUL 3OHXA 2YJQA 1BAWA 1GS7A 1NAMA 3T4AC 2HSIA 4I0KA 2NXYD 1BM7A 1YNTA 2YXMA 3CHQA 3JTTA 4JPWH 4ONFL 4YMPA 3K74B 4F15B 1KXQE 3O9WD 5HHMD 3MBED 3PGCB 4X5QA 5E2TL 3WXWH 1BFVH 1F58L 3NCFB 4V2BA 4HEPA 3NRFA 4Z7IA 4JPIB 4W6WB 3IFLH 1S7UA 4PREB 5DHYA 1PYWA 4JG5A 4Y5YA 3GHPA 1YSOA 1P1VA 3OTTA 1AZCA 4J3WA 4JQXC 2Y7LA 3ABLB 4LLQB 4JMXA 1ONQB 5CCJA 1MQKL 1TG8A 2IO5A 2NY0B 3FN0L 4JDTL 5A7BA 1UACL 4Z7NB 4KK5C 3HHSA 4DCQA 3M6DA 4NO2A 1JXFA 3VGDA 1LMKA 2DD8H 1SJMA 3PWPD 5KEZA 3DIFB 3ZIMA 2J88H 1AHWB 2OMNA 1MF2L 3IDIA 4J5VA 1NGQL 1DBBH 3ZIYA 1YYML 2ED8A 2JH2A 5F9JB 3BZEA 4K8RC 4CVUA 2ICWA 4NO3B 5J1AB 3HI5L 5L2JA 2ZKHL 1FVCB 1SBSH 4OFDA 5KVGH 3BVDB 1CD1A 4HKJB 1WUNT 1EJFA 1INDH 1U3JA 5CM1A 5FR3A 4I9WD 3HZMA 1VLXA 4WI0B 4Y8DC 1R47A 3FAWA 1R5VB 2BVUA 5CGBA 3X1NA 1ORSB 5EZLA 4AYMC 1GRWA 5I1GH 3DECA 3QUXC 5C0DB 4U1KB 1DJYA 4YUEH 2E56A 5AKSA 1G7MA 3FONB 3OKOA 3DYMA 3Q5YA 2CO3A 4UF7C 1PY9A 3T0BA 5MI0B 4JFUA 4J2XA 1NANH 3D4GA 1PEZA 3WJLC 2QPFA 4Y8AA 5GRVL 5I1KH 4NSKB 2WO2B 4XVJH 3QIWC 4TUOB 1XH1A 4W9DC 1IMHC 4YX2L 4GG8B 1AQ8A 5DJCB 4JKNA 2MH4A 1VFMA 4PB0H 5DD0L 3TV8A 4IRZL 4XPAL 4XBGB 4KXDA 4WEBL 4WWPA 1CIUA 3OMZA 1EEZB 1HSBA 4FFTA 2XZAL 4PSPA 1ZSDA 4FCAA 1CI5A 2X1OA 1AG6A 2AQ3A 2VISB 1T83C 4LFHG 4D0BA 5BCAA 1YLBB 4FFVC 2QDVA 1DUZA 1UH4A 4JBSA 1T7YA 2WAQA 5HYSB 4JFZH 1P1ZA 3CBRA 4MA8L 4ICWA