3QORD

Crystal structure of human nuclear migration protein nudc
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
117
structure length
116
Chain Sequence
SKLKPNLGNGADLPNYRWTQTLSELDLAVPFVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding, cell cycle
molecule keywords Nuclear migration protein nudC
publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 116
sequence length 117
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorD00
4YLCA 3QORA 3GLAA 3QORC 1SHSA 2XCMC 2JKIS 2KMWA 4PCKA 3VQMA 3VQLA 4JUTA 1WGVA 3QORB 3L1FA 3EUDA 4ZJ9A 3Q9PA 2N3JA 2MNWA 2CG9X 4JUSA 4YLBA 3N3EA 1GMEA 5LUMA 3AABA 3L1EA 3L1GA 4I88A 3W1ZA 4M5SA 2N0KA 3Q9QA 4YL9A 2RH0A 1RL1A 2BOLA 3IGFA 2WJ5A 2Y22A 2WJ7A 4M5TA 2K8QA 1WH0A 2Y1YA 2KLRA 2Y1ZA 3AACA 5DS2A 4MJHA 1EJFA 4FEIA 1WFIA 3J07A 5DS1A 2CR0A 4PBDA 4ELDA 4RZKA 4YDZA 3QORD 4YE0A 3GUFA 3GT6A 1X5MA 2O30A
chains in the Genus database with same CATH superfamily
4QRAA 1B0IA 4PJ8D 5E94B 4D3CH 2FQDA 1VHPA 4DEPB 2HCZX 4XX1E 3LEVH 1YEWA 4GKZB 3EUDA 4KKRA 4OLWH 4OCSL 4LKCB 3G7TA 2G2RA 2GFBA 2QTVA 4JFDE 3V7MA 2A74A 1K4DB 1ZS8B 3LKNB 4Z0XB 2VJXA 5CR8A 3KHQA 5KANI 1HDMA 4GXVL 3EFFA 3UTZB 3OBAA 3L9RB 2KQNA 4KDWA 3B2VL 4K55A 4N5EC 4ETYA 1WITA 3KR3L 5C2BL 4H44C 1FC2D 4L4VE 1M05A 4OI9A 2ICEB 3FUJA 4DGVH 5ICYA 2C3VA 3CZFA 3JXAA 2H9GA 3JYBA 4Y4KD 4ZW6A 4WI3A 2X4NB 1MF2L 5BS0B 1HSAB 4K5OA 3QAZB 1QI4A 4XN5A 1IGCL 4LOVA 4Y8DC 3FC8A 3U7YH 1OAXH 3KCWA 4LHUB 2DQCH 4WVRA 1P9MA 1HCFX 4K3EL 1KSRA 5CIPA 4KMTH 2BSEA 4M6NH 5DQDH 4EVNA 1WZKA 3BT2H 3PWVB 3HW7A 4MNQB 4OH2A 4ADGA 4BSWA 2ARWA 4IHBA 5IEHB 4YBLC 5B1CA 4LNVA 2LOEA 5ES4B 4RQQB 1HXYA 3H9SD 1VGKB 3T77B 3TBVB 2YOAA 2XRAL 3BFQG 3TF4A 2YGQA 5EFIB 4YR6A 3IGUA 4WI6A 2AVFA 4GP8B 5IB3B 5EO0A 1ZLWK 2KL6A 1P4BH 1UZ6F 1JGUL 5FDWB 2ZOTA 3IDNA 1MHPL 3FTWA 3MLUL 2AEIT 5D1XC 5HGBA 3I9GL 3F7YA 3ZIMA 3CN2A 2MEJB 3PRZA 4FYSA 3OGCA 2Z3FA 3QB7C 3QBTB 3ZY7A 4APQC 1TXKA 2DF3A 4K07A 4KHXH 1GVIA 2E8ZA 3LS5L 1Z5YD 3C5SA 3MOBL 3VX0A 4HKBA 1OZUA 4BA8A 3KPMA 3UBXG 1I1CA 2FJSA 4XODA 1I7TB 5FHAL 2D3NA 2W60A 5DR5L 1YN7A 2LU3A 1VLXA 4J8RB 4EI5C 3FTXA 3MLPA 3TIEB 1KELL 3UTTD 2AERT 3GMLB 3T3ME 2PWEA 1N2RA 2VLJA 3TP4A 4MMXB 5SWQA 3O8XA 3WEXA 4MQTB 4JM4H 2XKSA 1F41A 4JFOA 2VN3A 3FT0A 4OSUL 4B7IA 3N50A 3Q6GL 4JY6B 4Y19E 2FT7A 2F2HA 2F53D 2R4RH 1QNIA 4HP5A 5HDBB 4GG6E 1ODUA 1H3PH 3AWFA 4XN7A 3D4ZA 2FQGA 4N2HA 4Y1AB 3SE8L 3FQTA 2IH3A 4N8VG 4HU2A 5IHWA 2LTQC 4KI1A 1T7YA 3QEQA 4HS8L 1PTZA 3G6JF 5I0YA 2Z64C 4PP1C 5HGDA 4DP7X 4EIBA 1RJCA 3B5HA 5EUKA 2WVVB 4HIPA 1DQDL 4ZMYA 2BRRL 2CCWA 4J5VA 4L0PB 3AABA 1N67A 4YE4L 4P5TD 1BJ8A 1SUJA 3CHSA 3V52H 3NJFA 3DO7B 1G9MC 1O7DC 1QBLH 2Y7LA 3BPOC 1UM4H 2F74B 2OYPA 1IT9H 3HC3H 2G0LA 4ONGH 3SGJC 3VFVA 4LESA 1E50A 4OCWL 1MLBA 4UUJA 5DD1H 3BLPX 5GS0L 1ES0A 4QHPA 3GTTA 5ELIA 2MQGA 1WA2X 4LARL 4RRPM 2DJMA 3SD2A 2QMJA 4Y1TA 3EFDH 3ILEA 3NCBB 1IEBA 1S7SA 4L4VA 4G7VL 4M00A 4PJAF 4TM9A 1PCXA 4P2CG 4FABH 4QRSA 4XNZB 3ZL4L 3H9SE 4YDMA 2M8XA 2HMID 1I7ZB 2P45B 3QVAA 3I2CH 3LXAA 4HBCL 3RWFB 5I30L 2YRBA 3SZ6A 1JXKA 2DYPD 4WKZA 4DGIH 5K9OA 4KZEH 4LPVA 4PRBB 1SXNA 4AW4A 3QNYA 4RZKA 1XD1A 1RMFH 3IXTB 3U4BL 5JIDA 3FL7A 1WZLA 3JT2A 3IKCB 1JDAA 3K5RA 5L88H 4FKKA 2YEZA 3U6XS 4QCIB 2KPWA 1VSCA 4AUUA 3F12A 5HI5C 1WGVA 1UADC 5M7QA 3T6ZA 4XVJH 1E4XH 2XXCB 3KBEA 3Q2VA 2ZWKA 4JDEB 4KVCL 5IQ9A 3ARGC 4U6YB 3DOSA 2BVQB 5AVQB 4X98B 4LOFA 4XO5A 2BW4A 1A4KB 4A6YB 5AG8A 5FW8A 3FDWA 4BRVA 3AWGA 3G9VA 2MQ0A 3SDXA 3BE1L 3P54A 4M1GL 1IM9A 4IW4C 3UTTE 1DR9A 1R6VA 2F1AA 3ZE0F 2BH0A 1G7JB 3CLEL 2NR6C 4UT9H 4Z7WB 1MQ8A 2ITFA 4AIEA 5JPMA 2K4AA 1GW6A 2Y9RT 5IFJA 4WIQA 4NRZA 2F53E 1QACA 3KM2A 4GAGH 4S11A 3SDCC 2B0SH 2VH5L 3H7LA 1BFTA 1RU9H 4BSVB 1AQKL 4LVNB 3OX8A 1LD9B 3C5ZB 4YL9A 4BINA 3PLYA 4YSAA 4AJVA 1MAKA 2ZP0T 3LQAH 5F3HA 5KSUB 1G5GA 4TRPL 2F7PA 1IGFL 2HRPH 4AXWB 4KO6A 4MHHG 5IWLC 1B4LA 4JM2A 3QZWB 4QHKJ 4U1JB 3T6WA 1JOIA 3ZKMD 4D8PA 3NVQA 5FKAB 2HT3D 1BVKA 4IS6A 4P2OA 3W0WE 2WUCH 3ESVF 1CN4A 2R83A 4YXKH 3VG0L 4C4KT 4PJ8A 1Q38A 2AGJL 2WXMA 4P06A 4AQEB 2E9WA 1MCCA 2F19L 4G6KL 5DD3L 3QFDA 3MGTA 4KH9A 1SMOA 4YEFA 3DJ9A 5FB8B 5I8OH 1FFRA 3BUQA 3PQYE 5L8JB 4OLWL 5CHNB 5A2BA 4E9YA 1KCSH 2ZAHA 4N0YH 3CN1A 3HRZA 5DEFB 3TJHD 1LHZA 2AQ3A 4GRMA 3HKFA 4ORGA 5I1DB 1KEMH 1PBYA 2Z1KA 3A6CH 1VAHA 1YECH 1CICD 3FT9A 4TUOA 3S36H 1KJVB 3PWNA 2YFOA 4Y4KA 2C1OB 5EN2B 1BZ7B 1S7QA 4Q52A 3TFKD 1JF5A 4H1LB 1J48A 3VFPA 3WFCH 4DGVL 4M8UA 1E2ZA 1K4CA 3AY4C 3IJEB 3IMBA 1DQVA 1WAAF 3G5XB 3RHWF 1P7HL 5JR1H 5AOJA 1EO7A 4KUCF 3QIWC 3U7YL 1OAXL 3I50H 4YXLH 1DJSA 4PGZA 1WG3A 5AW1B 1F4WH 3WLWC 3C87A 4KMTL 4XVTH 3H9SA 12E8H 5DQDL 2R2CA 1EDHA 1IC4H 5ITFA 5I1LA 3OKEB 1XF3B 5SWZB 3V0VA 1NGYA 2BNQB 1ZA3B 2WSPA 4IEFB 4BFIA 5ACMA 5KYUA 1S9XA 1SVZA 2DQJL 5JPNC 2J8UE 3FFDB 4GRWB 1P4BL 1LNUA 1RUPH 2ROYA 3PP4L 4NRXB 4X6BA 1J1XL 2UZIH 1JRHH 3KPSB 5AD0B 2F18A 5E23A 1OD9A 1AHWA 2JK5A 2C7UB 2FSEB 1XF2A 2H2PC 2ERJC 1URZA 1XH2A 2EDYA 1R5WA 1UD5A 1CB4A 2VLLA 2CNZA 2CALA 1BIHA 2NW2A 3M86A 4R26H 5D7JD 2XZZA 1OP4A 4KRPB 3UTTA 3EOAB 5E5LA 4KKZA 4TTGA 5HYQB 3MLYH 3WNIA 4Y89A 3NQKA 3UG5A 1ZY9A 4N2LA 5KSBB 4WHTB 3JV6A 5LG6A 2F53A 2EINB 1FL5A 3N1GC 1IL1A 3UEZA 1A2YB 5A7EA 5GS0D 1BD2B 1UZ8B 3O4LD 4DKFH 2ED6A 4PJIF 3OHXB 2R4RL 3IRPX 2GITA 5KJRL 1GHFL 1H3PL 1NEZB 2OJZH 5AOIA 3PY9A 4UDUA 5CCGE 1BW8A 1NFIA 3WELA 4LU5H 1VRSA 1E8ZA 2LABA 1UC6A 2ED8A 1BM3H 3TN0B 1OL0A 2JIXB 1LXMA 2DEYX 2WKLA 3ZZ1A 1E28B 1AC6A 1QSFD 3BPCB 1E27A 1RJYB 4P5TA 5BW7C 3TWCL 3NSXA 1B9ZA 1E9PA 3H2PA 5B39B 4YSPA 1E3ZA 3DX8B 4KNQA 1TQBB 2AK4B 2G0KA 2YARA 4I7ZC 5LBVA 5CJQH 4AK1A 4L8DB 5I17A 2BFVH 3V52L 4YHZH 3MROB 2OCCB 5ALBL 5E99H 1QBLL 5GGRB 3OAYH 1UM4L 3RI5F 3MRJA 3V4UH 5EO9B 1IT9L 2QQKH 3DUUB 3HC3L 5HPOA 5KYWB 2AXGA 1HC1A 2XVKA 3D52A 4R5XA 1K2DB 2V0AA 2Y06H 2L7JA 2VRAA 2MFNA 5DD1L 1FNLA 2WQWA 4K7FA 2VZVA 5BRQA 3VFSB 1PEWA 1RPKA 5C0CD 1BSIA 3EFDL 3S4SG 4RSYA 1RZJH 3HE7D 4PJHA 3RFZA 1L9TA 4W9HC 3UTPD 4LCWD 4FABL 1JV5B 3DYMA 4I18A 4DKEH 2DYPA 2YMTA 2YC1A 3T4YA 4ICWA 1CO1A 1L5GA 5DT1L 4ZUTA 3IJHA 5GSRB 3I2CL 1G94A 3FQXA 4MSWB 1QFUH 4ZS6D 2XA8H 4OD2B 1N5YH 3F7VB 1LO4H 5MEQA 4KZEL 4DGIL 3DPBA 1PS3A 3TZVB 2GJRA 1E6OH 5F71A 2MPAH 1QHPA 2VL5A 4XMUA 3HVDA 2I26N 2C34A 2XPGA 3IF1B 3L4ZA 3EW3B 2A0LD 1E4XL 1NJ9B 5EMYA 3ZKXB 4I3RL 1CFMA 4AYMC 5C0AD 1EDYA 4NIYE 4XPAL 1SQMA 1KXQE 2EACA 4G80B 3KH4A 4PS4H 4KDTC 2P28B 4ZW5A 4YPGA 4G71B 3IU4H 3AQXA 4NN6B 3BISA 5F7NC 3JVFC 1QHOA 2QHRH 1EAPB 4AW7A 2Q20A 2V8LA 4UT9L 2ZIDA 2FJHB 2VJ0A 3O4LE 2H1PH 4KI5F 1JD9A 4C56D 3FZUC 3OD3A 4GAGL 1F56A 2HYMA 3TF7C 4M8QA 2B0SL 1O5DT 2BIQA 5MHSE 1LK3H 3MRLB 2ODHA 1GRWA 1RU9L 4RBPK 1I9RH 4LP4A 3BP4B 5J11C 2XTSA 3B37A 3IJSA 2J2ZB 4QHLB 5A2CA 3P9WB 5EEYA 1BFSA 1QTYT 3LQAL 4CSPA 2SEBA 4XP9H 4Q89A 4M7LL 2HRPL 1AQHA 1QSFE 3GHBH 2QV4A 3UROR 5E51A 4AYFA 4F5CE 1TCRA 4MWFB 4OVVA 2ICCA 3B9EA 5DC0A 5BRZB 2LFEA 2XG4B 4KJPC 4ODSH 5DHYA 1CYWA 4YXKL 2FBRA 4HZAA 1A1MA 1D7DA 1L6ZA 4KQ4H 2WJ7A 4N5UA 2QKSA 4GXUM 1ZE3H 5C6TH 2RCSH 1WCQA 1CFQB 2O5NA 1Q94A 3LYRA 3D18A 4WENB 3FBQA 3H54A 5I8OL 1GYVA 3DVNA 3KPOA 4CC1A 1KCSL 4N0YL 1NBQA 3R06A 4F91B 1CICA 4JUTA 5C0CE 4TNVF 3ZIYA 2EP6A 2R0ZH 4Y2DB 1B6DA 3OZKA 4JQVC 3L5XH 5D1ZB 2FO4B 5TDOB 3FRUA 1YECL 4ILDA 1H3WM 1IGJA 3S36X 1GKOA 1NAMH 3L3OB 3FONA 3S36L 3UTPE 4LCWE 1TT6A 1NCCH 4YFEA 5SWSD 5EZPA 4HHWA 2YLHA 3RVXD 2HVJB 2ZPKH 1QVOA 3WFCL 2BSDA 2B1HL 2HFEB 3J07A 4LFHD 1JF1A 4HUCA 2FL5A 4RISH 4U7KA 5J7CC 1M7DB 2L7UA 5I1GL 1GA2A 3GS0A 3NAAH 3X11A 4JM0A 4HUUB 4YXLL 3LZPA 4JANB 2ATKB 1F4WL 5D6CA 1TVBA 3QO0A 4NENA 1DQLH 2CGRH 4EZLA 2J21A 1KYAA 1SDYA 1IC7H 1UB5A 3PGDA 4UM8A 4B5ZA 2CO7B 1FLTX 4Y5YB 5A3IC 4FTVB 4OF6A 3ZYIA 4Q0XH 2E9JA 3P4LA 2QV2A 5C0DA 1LVEA 4JFPA 4NN5B 2HLEB 2Q9OA 4R0LC 4S10A 1JZHA 5DK0A 2X05A 5FECB 2O5ZH 3E38A 1XT5A 4ADJA 1RUPL 4JHWH 2WQXA 2UZIL 2Z1PA 3L7EA 3NZUA 1IGMH 1JRHL 5HJBA 3GWJA 3FKUS 2J6EH 4R8WH 5AKVA 1Z6JT 3R8BB 4HXAH 4S0SD 5D7JA 2HLAB 4R5VA 1KXQA 3VSQA 1NANH 1S6NA 1NICA 3MV9D 1A1NB 1IAKB 2W9DH 3V4LA 4R26L 4AIXA 2E6PA 5C0EA 2YAFA 3F62A 4LSRH 3UZQA 3MKGA 5JNYB 1IMHC 5AW7B 3ARBB 4FS0A 4ZDHB 5C0BD 4OCYL 3O4LA 3FF7A 5KBNC 2N59A 5D5MA 3VG9C 3DIVA 1CFNA 4A37A 2YSSB 2OTWB 3K7UA 3UIYA 1LJMA 3MHZA 4DKFL 2JCCF 3EO1A 3F6LA 1DQMH 1ET8A 1ONQA 1PDKB 2D2OA 2OJZL 2QADC 1HQRB 1QSFA 1WFOA 4WJ5B 5HGGS 2XPZA 4LU5L 2X2IA 1BM3L 2IO5A 1QNZH 3HB3C 3CCHB 2N01B 4IBSA 4O51B 4S0TD 5DZOA 4HCRH 2ISDA 4A2HA 4Y16C 1E6JH 1DVSA 1R3LB 4FHKA 3IFOA 3HS0A 4X7DC 2E6QA 2WCGA 3LRSA 2WTRA 3TZVC 5SWSE 4DOHE 3VCLA 2BFVL 1XCTB 4GI9A 3V9CA 3HZMA 4YHZL 3UBXI 1LDPH 2RFXA 1W15A 5E99L 4U1IA 3V4UL 1O9WA 2QQKL 4B9IA 5AEAA 1EBPA 1J10A 3S5ZA 2YAEA 5C0CA 2P44B 3VGHA 3ZKXC 1GKEA 2FJGB 2IVFC 5EORH 1ZLEA 1R75A 3FOLB 3MRFA 2Y06L 2X0VA 2IWKA 5FW7A 3RWHA 3HE7A 1A6VH 1PX3A 2RJMA 1CC3A 4LCWA 4UDTB 3LKPB 1OP3H 4UB0H 1JN6A 3FPXA 4CADA 3ILPB 3T8XA 1A65A 2FX9H 2HFFA 2TRYA 1ZLVH 1RZJL 3RTQB 4QGTA 4YZFF 2R2EB 4DKEL 5E0QA 1D5RA 2HX9A 3GRGA 3SPIA 2YZ1A 4PS8A 1PPIA 1OGTB 1XEDA 1RV6X 4PGEA 2AHIA 3GMNA 5F72S 4KKBC 1ZGLA 3IXAA 2XA8L 1N5YL 3N42B 1LO4L 3TVMB 5LO7A 4AGMA 35C8H 3KPRD 3WIFB 3Q1SL 2UY7A 3S3DB 1Z1WA 1S3KH 4OIIH 3QIBB 4QJ5B 2EDQA 1N5AB 1OCCB 1ZSDA 2X53A 3PFUA 2BP0A 4A2EA 4A2DA 3GSOB 1RCYA 5C0AA 1QUNB 2K78A 4HOMA 2CHDA 5BMFH 2LR4A 4HT1H 1NUNB 5I5JA 2G3XA 1XZ0A 3WTSA 3N3EA 3GMRA 1GAFH 4OGAD 1T20A 4WNJA 2Q10A 1KJ2B 4NUJB 4PS4L 4BKTC 5DRWA 1JI2A 1WIUA 2X4SB 4P3CL 3IU4L 1Z9SB 2HB0A 3P3UA 1V10A 4BQ6A 5EU5A 4C56A 1TYRA 1RJLB 2QHRL 4I4WB 4G8GB 4U1MA 1JK9B 1FO0B 1EXGA 4AVKA 3CMOH 2H1PL 2VERA 1QO3A 1N70A 5F9DC 4OCRH 2AABH 4M3HA 2ODIA 1JDDA 4S1QH 1M6UA 1LK3L 3SHSA 4BQBA 4C47A 3LRHA 1KIRA 1I9RL 5AOMA 4WNSA 4DVRH 5HYIA 4QRRA 5F3BB 2XWJA 4P4KC 8PAZA 4TQIA 5L6YH 4XP9L 2W59A 5FYKH 1M2OA 1XGPB 4GAYA 3TBTA 2IH8A 3L4UA 5CJXC 4D7PA 5GRVK 1CDJA 5F7MC 1ORQB 3GHBL 2XZQL 3QO1A 2AEWA 3EG9A 3ZLQC 4FMKA 3T09A 1HHHB 1CUOA 2B7DT 4ODSL 1E0OB 3NESA 4KK8D 1GGYA 1WVZA 5I8EB 1ZHBA 2OYMA 1MLCA 1PX8A 3CPLB 4F57L 1BJ1J 5DRNB 3WTTA 1DVFC 3Q5TA 5B1BB 5C6TL 3H3BC 1K85A 7PCYA 3H9YA 5KN5B 2FYYB 3LZQA 3P0YH 2KLSA 3NCEB 3BESR 2Z8RA 3IDUA 1CD0A 4Z7QE 1UQSB 4MQ7A 4Y5YC 5EUOB 3CFBA 3IRCA 2RAMA 4J3WA 3CVHH 5HDBF 1S78D 1FG2A 2QLYA 2G60H 1T21B 2R0ZL 4FF9A 1NGZB 4U0RC 4X5PA 4AM0Q 3L5XL 4J4PD 4AJWA 2ADFL 4Z7AA 4CC4A 1L9QA 4ODUB 1NAML 4NN5C 5A16B 1DQIA 3DOIA 4U33A 5FR3A 5K9KB 4ERSH 3OMNB 5CGTA 1U8OB 3LN9A 1NCCL 3MBWB 3II3A 1II4E 2IH1B 5D9SA 1UT2A 2ZPKL 1G7LA 3AREC 1VFBA 2FQFA 2MKLC 4JKKA 3MJ8B 4JO4L 3B4NA 4RISL 3VJ6B 5TE6L 1K3ZA 4MHHI 5JOPD 1UD6A 3NAAL 1O6TA 1BVLA 4YHKH 4QRTB 3DIDA 1HVXA 3QG6B 4NPYA 3PAZA 2J72A 2WIMA 4LAQH 1F4XH 3S34H 2NW3B 3FQWA 5A6IA 1DQLL 4CMHC 2CGRL 1AFVH 1LTXA 1BF8A 3CTTA 1CGSH 4XO4A 1IC7L 1NDGB 5JO5B 2DIBA 2JF1A 1P4LA 4PJXE 4PVNA 4H0HB 3BIKB 3SCMD 1KN2H 2BLFA 3HCVA 3WN6A 3ZUCA 4HLZH 4H25A 3UYPA 1CDCA 2C7FA 2QVTA 2O5ZL 2D31A 1L7IH 2WY3B 2EUZA 1CQYA 4JHWL 1IGML 1L0QA 4M7LT 3UG4A 2E74C 2Z6FA 1NBZB 2J6EL 3MV9A 4R8WL 2C3WA 4PMFA 4R7LA 1ZVNA 4OD3H 4HXAL 2FEJA 3UDWC 2NNRA 1T6VN 4XGZA 3V5DB 3P77B 1WT5A 3OMAB 3WTVA 1U92B 4PFEA 4YJZL 3LHAA 4L4JA 2W9DL 5DJCA 5I18H 2DQGH 2H6PB 3GXNA 2QBWA 3JWNC 4JFVA 4LSRL 3BPNC 3O3DA 5DI8A 2G30A 4XCFH 1UATA 4JS7A 4HDIA 3KS0H 1I3RA 3LN5B 2Y07H 1JYXA 2KDGA 1EZLA 2BVOA 1KWGA 4AQ8A 5DTFB 3DYPA 2BSSA 1MUJA 1KGCD 1V3JA 1DQML 3SE6A 3TO2B 4N2MA 3N04A 4ELDA 2X1OA 1X44A 1VF5C 2J3SA 4JMXA 2HKAA 3H7BA 2IBGA 4Z7WF 1UOWA 2MSPA 3K91A 3NIGE 3MV8B 1G43A 1VJSA 1DN0A 2CLRA 1YN6B 3N55A 3D34A 4JKWA 5E6ID 3RWEB 4J8QA 3TBSB 3VXPA 1QNZL 3CDGB 3ZQXA 4FJ6A 2GSGB 2R4SL 1M6OA 1T1WA 2WINB 1E6JL 2CKBB 3AXIA 1F3RB 1P84J 1IAIM 5EOQH 3WE1A 1U8IB 2DQIH 2X7LA 2YJQA 4JZOA 4LASH 5DRXB 2ZJSH 4J12A 2OL3L 1I1RA 5F89B 2C3XA 3WTYA 4I0PC 4AWJC 1LDPL 1AP2B 1MQKH 3QXAB 4K7PH 1BZQK 3H6JA 4HALA 2GBTA 4U6VH 3EJYC 3HG5A 1RSFA 1R4XA 1UXWB 3CSPA 2NY1D 3IGAB 1JERA 5EORL 1LE5A 1W0VB 3T0XA 3EAKA 4NHUB 4UT9A 3MV01 3I85A 4DK5A 3RVVD 4PBWD 1A6VL 1X9UA 3BEWB 2WOBA 3ZU8A 4EQ2A 2PPDA 4UB0L 4ABWA 2IV9A 1G7HB 3M17B 1JXJA 3V6ZB 2YN3A 4WWID 2FX9L 3B9VA 3O3AA 3UZEC 2VE6A 3WFBH 1T1ZB 2I5YH 3U30C 1NL0H 4BH8B 1T0NB 1VKXB 3KPRA 2OX5A 2ITCB 4WZ9A 3RKDD 1TMQA 4KH2A 2PO6D 2Q0ZX 5IJKC 4PJCE 4QRUB 35C8L 5E8EA 4NWTL 1H8NA 3JVGA 3NOIA 4EIGB 3TBYB 2D3VA 1YEJH 1JNLH 1S3KL 2FTAA 1ETZA 2NZ1A 4OIIL 4P49A 5T3XH 4ADIA 1U3HC 1P69B 4JQXC 4P3DA 2CLVA 1JTTA 1R46A 2FJFA 3QNXA 4NYLB 2BP5M 1H8LA 4PJXA 2BHYA 5DEJA 3QT2A 1UJ3A 4KKCD 3C6LD 2O6FA 3TV3H 4HT1L 3PP3H 4X99B 4L1BA 2ZYHA 1A7BA 3WJMB 1MCLA 3MJWA 4GUPB 4L9LA 4OZ4B 2XTLA 3LD8C 1D7BA 1HHKB 5A2AA 4PV9B 4PLJD 1A22B 2WLLB 4M62H 3UTSB 1N12A 1T7XA 2Q87A 1KFGA 1D3CA 2UXVA 5EC1A 3FCSA 3LZNA 1JJUA 3CMOL 3H85A 2X4UB 1A8JH 1KGCE 2AABL 3NH7L 4FLHA 4S1QL 1B4RA 4ZPVB 1TUPA 3HAEG 3T3PE 5IREA 1KG0B 4MA3B 4DVRL 5EIIG 4LCYA 1BYOA 2XFGB 3T1WA 1TZHA 1U6AL 4POZC 4B53A 3OQ3B 3T0AA 5E8PB 5JORB 2AKRA 5L6YL 1CI5A 2O61A 1W9XA 5FYKL 2R9HC 4BCZA 3RKPA 5I6KA 1WD8A 4DEWA 1N3NB 2NLJB 4TVPH 4WUUD 5D7IA 2CCVA 5EPMB 1X5KA 2FQEA 4G1EA 3L1OH 2N4IA 1T5KA 1DVTA 4OTXH 1U58B 4Y4HD 1GZPB 2VGLM 4R97C 5HI3D 3ZZQA 3FT2A 1P2CA 4H4NA 5KSBF 3GJFB 3C9NA 5ECGA 2FX8H 3P0YL 4RRPA 4YBQD 4PJFB 4G1MA 1TTUA 2YPLD 2CR0A 2X1QA 4J4PA 4J3OF 4H1LH 5DWPA 4IKJA 1S5IH 3V55A 4A2LA 1ITCA 6TAAA 5EEVA 3SB3A 3CVHL 1O6VA 1MAMH 3WV0A 4Z7NE 3EFOB 2VR6A 2W65A 4FQJL 2HJKB 4LRNH 4OGXL 5CP7B 4ERSL 3LV3A 2YXMA 4JRWA 2LLNA 4NAJA 4YK4C 2XWBA 4ATTA 1HHJB 3II2A 2WMPB 1KJMB 1OTUC 4QD2E 1SOQA 4XOEA 3DHPA 2ZUSA 3B7RL 3VFGH 3LRGA 3KCPB 3BEVA 3MNDA 4JFED 1IAIH 4O2FB 4OGZA 2B1AH 4W4OC 3KNBA 4YHKL 1NWPA 1NGXA 3RVTD 4XVUC 2MQCA 2UUDH 4LAQL 3S34L 3KLKA 3MXWH 4GRWH 1AFVL 1H5BC 1H3UA 3PHQA 3SCMA 4XT1C 1ORSB 5B7EA 1WAAA 1WIPA 1KCBA 3O41A 3T4AA 1IB5A 1X7TA 3QXDA 1GGTA 4ELME 3Q7JA 5GS1B 3CQPA 2V2TA 5HGAB 4X0KB 2VDLH 3C60D 3PL6B 4N0RA 3UYRH 3VYNA 5J1AB 3BCDA 4O2CB 2OSYA 3VRJB 3R18A 4MNHB 1DL7H 3FMGL 4X6DB 4PJBB 3VDAA 3DX9A 1YY8A 4NO0B 3APDA 4WEMB 3QRGH 4XP5H 4OD3L 1XGQA 5E00B 5AVZB 2E8YA 3KLHC 2WV3A 4JGJA 4UZUA 3TO4D 5FEBA 2DN7A 3G5VB 5CZRA 4JAMA 1SJHA 5I18L 1RIHL 5SX5H 2DQGL 1CTMA 5CINH 3CBKB 2WXOA 2FLBT 4XCFL 4E9QA 3VDBA 4FQXB 4HAFA 1RJZA 4MCYB 2Y07L 4WUUE 1J9RA 5FO9B 4QI3A 1TPXB 4HXBH 5HDRA 4OGYH 3JV0A 3VFOA 3QHZH 4B3VA 4OZHB 2WYTA 3QUMH 4XXCA 1OB1A 7TAAA 2PWHA 4O9HH 3PREA 3ARFB 3JWOC 3T8MA 4PJGB 3RAJH 2OK0L 2ZYIA 3H2WA 3UO8B 3WGUB 1T4KA 3PXHA 2KERA 3QJVB 4HX1B 4TUUA 3M7OA 4HGWB 2NNCA 4U3XA 2YPLE 4R3SA 1DUYA 1MJUH 5JIHA 1PZDA 3HFFA 4LCCA 3NQIA 4FMVA 2CXKA 4PJIA 4LE8A 3MO1A 1FVDA 3UP6A 1O9ZA 3PAYA 5JLZB 2XUWA 1F8TH 4M4RA 4B9PA 5EOQL 4NNYB 1I8IA 2DQIL 5DA4A 1DN2A 4JKMA 4OZFB 2ZJSL 3VFMA 1HYSC 2P26A 3OF6D 3ZMRA 3CVDA 1A6UH 4L3FA 3CIAA 4EF3A 2LU5A 4K7PX 1BZOA 1MQKL 3DJSA 4PQXA 4MMZB 3TJEH 3SPVA 2XI9A 1KNOA 4JFEE 4AGNA 1TJIH 2P4AB 1A6PA 3QJSB 4I89A 4YHLH 4ECNA 4HMDA 4KAQL 4MJJA 3BH4A 3P9MA 5H2BB 4MMYA 3KBFA 2EXWD 5E4OA 5AW0B 4WEBH 3UJTL 1IGTB 1X5FA 4JLRB 1U8HB 1MHHA 4MJ5A 3DETD 4G11A 1FLRH 1CD8A 5DVNA 3DX1A 3W57A 3WFBL 2I5YL 2PO6A 1DQQA 1GOGA 1NL0L 3VB8A 4EN3C 5EZLB 1QBBA 4ZJ9A 4PJDE 4J7RA 5IZ7A 5FLVA 1A1OA 1BQSA 1E2WA 2NYZA 3AU1A 2G3MA 3BP7A 4NQDA 1FV1A 2WUBL 1OSZB 2JV6A 2ZOLA 5DO8A 3WFHA 1GS8A 3EGXA 4Z1PA 4DK3A 3BFWA 5FYKD 1YEJL 1JNLL 3C6LA 5T3XL 2Y7QA 5EEUA 4P2QB 3EADA 3L3DA 1ZLUK 1RHFA 1KGYE 1T7WA 3QNZB 5JDJA 2DWEA 4ENZA 1XGTB 3DGGB 1E5ZA 2ZYSA 1A47A 4IRJD 5CU9A 4ELMA 1XAUA 1JGDA 5AOZA 1UGNA 2WCSA 2YKLH 5ABAA 3SQRA 1I7RB 4ZT1A 3S3JA 4NKIH 4M62L 5AOKA 4F2EA 2UXFA 3I02A 4L48A 5FWQA 4LCVA 1NAMA 1R5VB 2W07A 3SDAB 1SDDB 5CMAA 3GEFA 4IBYA 4X5LA 2UYLB 5BOPA 3QP3A 2AV7B 3IDGA 4WFFD 3NJKA 5GGTH 5C09E 3WE6A 4LEOB 2CE6A 5T3ZH 4A7TA 4NKMB 4AGPA 4XBMA 4MRBA 3RDJA 1DEEA 4WUUA 2QKIB 1YEDA 1XIWB 2R0LH 4GRLC 3B9KB 4MNQD 2A7BA 2XN1A 3ORJA 4YLQT 1DSFH 3IVKA 1XR8B 4Y4HA 4TVPL 3PV6B 1L6PA 3V6FA 1T5XA 2NY6D 3L1OL 4IU3A 1F97A 4AJ0A 3MJ6A 4XC1H 2X4QA 1D7CA 4ZO9A 5B8CC 3W81A 3WKMH 2V9TA 1QA9B 2WVTA 2YPLA 4DFIA 4MA1C 1YJDL 2FX8L 4MDJB 2X88A 4F1SA 4IIQC 3MRQB 3LRMA 3L7FA 3QR2A 4F33A 5DYOA 3QQ3B 1PFCA 3DTUB 3SY0A 3VNZA 1N4XH 3OKKA 1S5IL 4MBRA 2P3YA 1T66C 2HRGA 2J6EA 4GSXA 4ZX6A 1F1GA 1F3JB 1I9JH 1MAML 4XCNA 3VXOA 1D6EB 5HSFA 1S9KC 5GS1C 1KTDB 4HBQA 4LRNL 1KB5B 4UT6H 2EDLA 3PL6C 5ENWB 4Q4IA 2OSWA 5TTRA 5IW1A 4BRJA 2Q7YA 4JDVB 3O45A 1VZHA 4JFEA 2A6IB 1MY7A 3V95A 3FPYA 4IK7A 5JHMA 1MSPA 5BZDA 3VDCA 3ZN6A 4OAWB 1SN2A 1X5ZA 2APFA 4WI0B 4U0QB 4Z7UE 3VFGL 4BKLA 1IAIL 3VRIA 3DECA 2B1AL 3KLSA 1E5YA 3FNKA 4Q4EA 5DXWA 2J5LC 2P5WB 4LRIC 5IROD 3MXWL 2AANA 3QA3B 3QEHA 2G2PA 5LWYH 5AAWA 2XQ0A 2HT4D 4PWJA 2NY5C 3TNNB 1UWEH 2OJEA 2X4OB 4N24A 1X3DA 4PLNC 3OG6B 3B56A 3B2UD 4YNYA 3CFJB 1FCCA 3C60A 2Z93A 5DO2D 1ZLWH 4BHUI 3BRDA 1FC1A 3KMDA 1WC7A 1UT1A 4U05A 2GSIA 3NIFB 2R69L 3WO4B 4HCRA 3EGSB 1CR9H 3EYQD 4IMLB 2VDLL 3MFFB 3UYRL 1PIFA 3B6SA 3R19A 1HOCA 2I69A 5D7LD 2Z7YA 1DL7L 2YA0A 2I07B 3HE6B 5EBLB 2RACA 2I32A 3TO4A 3D39D 3QRGL 2WXHA 3N42F 3TTSA 4WFFE 2OKMA 1AOZA 3MQIA 3POHA 2Y5QA 1GMIA 1QPXA 3H3PH 1U8CB 4XOCA 4OGQC 5CINL 4JO1H 3NCWA 2D03L 5KSVA 2Q7AA 2Q76A 2JXMA 1DJYA 3MJGX 4M7ZC 3FN3A 3T1FB 1HAUA 1WA1X 3S98A 3WN5A 3EH4B 1IX2A 4HOZA 5MERB 4GIOA 4HXBL 2CBTA 3SZKC 3EJUA 4GW1A 3QHZL 1IARB 3QUML 1T1XB 1D7FA 2R29H 4QDGA 4HMEA 2DQUH 4JKPH 4E42B 1TNMA 3KJ6L 5FGCB 3L4TA 2R2HA 5L0QB 3EOBA 5JW3H 1J5HA 1N9PA 4TUKH 2NZ9D 2PYED 2C4XA 2CLZB 1MJUL 3TEUA 1G87A 2JCCA 2LQRA 2BNRB 2PTTA 4XZUB 1F8TL 2W9EL 1YZZA 3BKML 3OF6A 4PJ9C 5FAAA 5HHPB 3N1FC 5GZNC 1HWHB 3IS0X 5T3XD 1CE1H 1KIQA 3BZ5A 3VFRB 2F7RA 3MLZH 3FQ2A 5HHNA 1D5BB 1TKWA 5KYNA 1A6UL 3S88H 1I1YA 1UHVA 3HG4A 4FFWC 3GSQB 4FZEH 5CZKA 3FB7A 4WK4B 4LSQL 2BFGA 3TJEL 2YPKB 1BX2B 5DHDA 4CA4A 2PCPB 1HSBB 2FGWH 1TJIL 2XXFA 4P5KB 4L5FE 1X5MA 2PCYA 3JZYA 3P30H 3BAEH 3QORC 3GO1H 2KPNA 5C0FA 1NLDH 1HH6A 4LP8A 4IDJH 1K8DA 2QSVA 3IGLA 2VO8A 2A6JB 2IH9A 4ISVB 1GXEA 3QFJB 4HIJB 1FLRL 1FYTB 1OAZH 3K2UH 3MSPA 3K1DA 5I8CA 1HN1A 5EUOF 5B1KA 3TGXA 4B5EA 3IDXL 4Z7UA 3WUZA 1UACH 3MV7E 2X4RB 4N68A 5B3JF 2GY5A 4G8FB 4HETA 1M7IB 3HBQA 3CAFA 1KPUA 5E94A 5KYXB 4HUVB 3EHBD 2DV6A 3KWVA 1DQJB 1OQOA 1S7VB 3BO8B 4X6CB 5D7LE 4EDWH 1PLAA 2QKIC 3FF8A 4IRJA 1KIUA 4JFXA 1XIWC 3D39E 1WEJH 4TVPD 3ZHFA 3OAUH 4X9GA 5JMOC 4Z0XA 2OMTB 4M6OH 3B7YA 4JR9H 3UZVB 4BFNA 4W9IC 2GIMA 2X6CA 2EXYD 3UTZA 2ZXCA 3L9RA 3VD4A 4S2SA 3IMVA 2YKLL 1WBXA 4YBHA 2BZDA 2Q7NA 2Z92A 1HX0A 1AJ7H 4A38A 2ICEA 3R7RA 7PAZA 5I2IB 1WFIA 3CVHA 2DTSA 4NKIL 4F2FA 5KSAB 4AKPA 2BNUB 3CLFH 4QHUB 1UCTA 3RNKB 2VDNB 2X4NA 3FS9A 3X12B 5BS0A 1PZ2A 4ZAKD 1HIMH 1HH9B 3T0ED 3T2PA 4HLEA 1NCTA 4GQ9H 3PGCA 5ESVB 2Q2EB 3OL2A 1SLWA 3RIFK 4CVXB 4W93A 2GVYA 1IIKA 3VMPA 5GGTL 4FE9A 1LLAA 3S4SA 2OTPA 4MNQA 5T3ZL 5K9QI 3HMXH 1FNSL 1L9RA 1AH1A 5J56B 4E9VA 2MOQA 1AGFA 2R0LL 2WTOA 2G75A 2CR3A 5FIEA 4RSVA 3TYFB 5EFIA 4L3CA 1DSFL 1M71B 5F96L 1EZVX 4JZNB 1DVXA 1I3GH 3B1UA 5EV7A 4PVLA 2EECA 5CN2A 3T2LA 5IB3A 2BNQD 2XQBH 2DW5A 1GIGH 4HJIA 4ONHA 5T3XE 1WISA 3PYCA 5HYSA 1X5LA 4HMCA 1AANA 1FL6B 2WNWA 3BN9D 4WHDA 5GRUL 1R33A 1T83A 3WKML 1OAUH 1A7RH 3ZTNH 4JY4A 2EVIA 2H8PB 5C07B 1CG9A 4XNUH 1FNFA 2X9YA 5IEKA 3SBRA 4LBAA 4JRFA 4GAJH 1R3HA 1AIFB 1N4XL 4F7TB 1RZKC 1I7TA 4NQEB 3VM5A 4L8SA 4FLSA 2FEDC 1I9JL 2XWCA 5GISL 4KRPD 4PEEA 4N26A 5DZLA 1HYRC 4V2CB 4R90H 5TGBA 4GFXA 4MMXA 4UT6L 2NMSA 1I4FB 1FBIH 1RZ7H 4OFIA 5FYLH 1ZIAA 3Q9PA 1BMWA 3QUHA 4HAKA 3HE6C 4IRZL 3I6KB 1WBYA 1RK0A 3VFWA 1BD2D 2OW7A 3CFIC 4U6TA 5IROA 1RULH 5H94B 1FL3A 3CHRA 4K3DH 1MWOA 4IGBB 2VR3A 5LB1A 2ZOWA 5LWYL 4F3FA 4Y5XA 3AG3B 2CRZA 3F84A 4E9LA 5D93C 2V17H 3D7PA 4A55A 1JWUB 1UWEL 1XR9A 4EUPG 2BXYA 1AD9A 4GSDH 2OMNA 5D7LA 4Z6AT 3RL1A 1CR9L 4OVUA 1Q8MA 1WDAA 5CD5C 3D39A 5L0QC 1FCGA 1H3TA 3K2KA 3T65B 2Z35B 4QNPE 1W8OA 3GB7A 2QQNL 1KZQA 2VXUH 1R47A 3GEWB 5EC2A 3T0EE 4R2GB 1BFVH 5ID0B 3QUXD 1HILB 5DHVB 4HYTB 3SJVD 2VDRB 2VZOA 3L4WA 3IRZA 4GW5B 5HBBA 1ZHKA 2CAKA 3SKMB 4HUMB 4U3SA 1JZIA 4MJ6B 4IBUA 3NN8B 4ZFOL 2X12A 2A1WL 1A5FH 3DX3A 1DZBA 3H3PL 3MRRB 4RNRA 1K72A 2EEXA 3KW8A 3L3KA 1H8SA 2FWOB 2PNDA 2YA2A 5HI4C 4JO1L 3NFNA 1I7ZA 4CVUA 3PJSB 5FX3A 1Q9OA 2QTEA 1NC4D 3GHPA 2Q86B 4JO2H 3RWFA 4QAMB 1Q9WB 2GTZB 1SF3A 4MCZB 5I75B 5A7BA 1R3KB 1L9PA 4E41E 5ISZB 4LNRB 3IKCA 1T6WA 3BVNA 3ZX1A 2DIEA 2Q8AL 2R29L 3G3LA 1QLEB 4YMPA 3TIDA 4CGTA 1ZTXH 3SQBB 3ULVC 5ERWB 1BZ9A 1Q9KA 2PYEA 3OKNB 4Y9GA 4M6MH 3RWJB 1MJJA 5JW3L 4LZKA 4KRNA 4MCMA 4OF0A 2P8MB 4JDEA 4Y5VB 3PXLA 4B9KC 1MFCH 1QFPA 2ZKHH 2EKSB 2BVQA 4LKXB 4X98A 5E9DB 1T22B 2R2BA 5HHOB 2CJTA 4HIXH 2JJTC 4G8AC 4JFFB 4YVNA 2P8PB 4FDWA 2Y2YA 5CZVH 1K8IA 2J43A 1NFDE 3OPUA 2WBJD 1ITBB 1GOHA 4QKTA 4B50A 5CEZH 2ZOKA 4KRLB 2J20A 1CE1L 3WUWB 3MLZL 5E24E 2VWEE 1Z7JA 2QGEA 3LQZA 4FEMA 3S88L 1HS6A 3Q6FA 4NKQB 1B9KA 3V6OE 4FI6A 3MRNB 4FZEL 4BSVA 1RD6A 5IB2A 5BCAA 3U6RA 4NQCB 5FXCH 3VWKC 4N0CC 2X6UA 3P30L 1S5HB 3BAEL 3GO1L 4A7SA 2AJXH 4OFQA 3U9UB 3BWAB 4ODTH 3UAAA 3HNVH 1LO0H 5CO1A 2QGBA 1OAZL 3RNQB 1A6TA 1Z9OA 3K2UL 2E75C 3BGFC 4FP8H 4F8NA 1T04B 1P5UB 5INDB 1AAJA 1UACL 4AE0A 1MIML 2IDUA 3L4XA 4GW4A 2H6OA 1SHSA 2XY1A 5DLML 5TPWH 4AQEA 2DZEA 2YEVB 1PJWA 5T3ZD 4RAHA 1WPCA 2GG1A 3ELQA 3G5ZB 2QDWA 3IMUA 3FT3B 3QI9C 2W81C 2VIRB 4HK0A 5FB8A 2B3RA 3IM1A 2H45A 4EDWL 3LAFA 4G7SB 3MRIA 1GC1C 3SDYH 3AROA 3SJVE 5FLUA 2NYKA 1HL8A 5I1IH 5I1DA 5FKPA 4M6OL 4JR9L 2BY1A 2VITA 2DICA 2W0LA 1E30A 4RDQG 2V8MA 1KJVA 2Z91A 4J23A 4PREB 1MJ8H 1PVHA 2C1OA 2C8NA 1BZ7A 2ADJA 5D1ZD 3UGXA 4I13B 4F7PB 1VADA 1YQ2A 1BV8A 4ZAKA 4H1LA 1AJ7L 4PTTB 3LNIA 3T0EA 2Y3NA 3AS3A 4JJ5B 4BEIA 4ODXA 3ULUC 1HHGA 4ZSOE 5L2JB 1L9OA 2B59B 3CLFL 2Y25A 4OQTH 1HIML 1T5WB 4N0UB 4GQ9L 5EU3B 3CHPA 4RBPH 3MUJA 3OSVA 3HVNA 1BZ8A 3FUIA 5F6HJ 4KXZH 2PR4H 4PJ5B 3HMXL 4P23D 2F54B 3ULAB 4GFTB 5LXVA 3PWLA 1XF3A 4X6DF 4PJBF 2BNQA 2XTJC 5CWSA 2EH7H 1TZGH 1RUAH 3FO9A 3F64A 4AEFA 5C0RH 3KWUA 1I3GL 4WI9A 3RGBA 1CGUA 4F7EA 2XQBL 1GIGL 5AUMA 2UV3A 2DTML 1QSEB 4IMKA 1G6VK 2CGZA 4OLYH 3ET9F 5AVYB 1VB9A 3RLSA 2VDOB 4C4BA 5AD0A 2CDGB 4NBXB 3UL4A 4I9XA 5D1QE 1OAUL 1H9VA 1V7NH 2FWSA 4K5MA 2QVIA 3HG1E 3FHQA 2C7UA 5IMMA 2FSEA 1RUKH 1OPOA 3GSRA 1B0GB 4NO3B 4QYOA 4XNUL 3BD3A 5F7EL 1BGXH 1ZHLA 2ZKWA 1NFDA 4GAJL 4OZHF 4L4TE 4H5SA 3T2QA 4ODWB 2D7NA 2OI9B 4PJGF 2X6AA 2PPFA 3RL2A 4RGNB 4WHTA 5KSBA 1NA8A 3AITA 4PRID 3L1GA 3NPSC 4R90L 4P9HH 3V6OA 1VZGA 2G2RB 2GFBB 1FBIL 3ARBD 2EZ0D 3L4YA 2A74B 1RZ7L 1BD2A 1UZ8A 3POCA 3GK8L 3ML8A 1HDMB 4R2GC 4CNIA 1IC0A 2EIZA 4H7VA 5T3ZE 4EIUA 1NEZA 4CL7A 4BH7A 5KW9H 2AJVH 1RULL 3EKCA 4LLAA 3L2LA 4GIAA 4F8OA 5ICYB 5IMLA 2C3VB 1KCRH 1IILE 5ETUB 3I9IA 3IMWA 1RUQH 4K3DL 1GGBH 5ACZA 2K7PA 1CDGA 1E28A 3QUMA 4YDNA 2L7QA 3N9GH 5E1AA 1M3JA 1OT4A 4JGMA 4A66A 1U3JA 4QGYA 5B39A 5CUSH 1TCMA 2V17L 4AZUA 4HWEH 2ZKXA 5CIPB 3DX8A 4AYGA 3I75A 4WGVB 3FTUA 3A4FA 2K8QA 4JL1A 4F8LA 4GSDL 3FCGA 4LDCA 2OMYA 4BSWB 3MROA 3CFQA 1YNLH 3QUXA 3UTOA 3DUUA 5TD4A 1NCBL 4UOZA 1YHPA 1JXFA 1K2DA 4WQOA 4JN1H 1BFVL 3FSOA 4U49A 1W91A 2O72A 5INCA 2MCG1 5EO0B 1MNNA 4OJFH 3FHAA 3F83A 5EU6D 2CPCA 1NC4A 1P6AB 4R83A 1A5FL 1JV5A 4JO3H 5CD3A 3X1GA 3OGCB 5MEPA 4GQPH 4YSEA 5LDSA 2NY4B 2H41A 1PL3A 5T1DH 5AVWB 5TQ0H 3C5SB 2X6VA 4HKBB 1CL7I 2E7LA 1QZNA 1UOVA 3KPMB 2HT2C 3E1F1 2W60B 3H9HA 4OKVA 3ZGIA 1VCBC 3TVMD 5KVMC 2VAJA 5F9AC 5C0NC 3BYTA 5JUEL 1FQ9C 1MCHA 1N2RB 2VLJB 5J4MA 5SWQB 5J3HD 3O8XB 1J5DA 4NN7C 3V9FA 4M6ML 1YVLA 3WEXB 3W5MA 4PJ7E 4JFOB 2HPOA 1NJ9A 1JWSA 1MFCL 4UTCA 2WBJA 3U0TA 4JPVH 3APFA 4G80A 1P5UC 4HIXL 3HG2A 5KWYC 3FQTB 1LE9B 1WICA 5CZVL 5HYJD 2IH3B 4X7TA 1QLRB 1X9RA 4HKJA 4YLCA 5CEZL 5DVMA 4ZG1A 3EF7A 4PRIE 1M7UA 1EAPA 1F3DJ 3QEQB 2H2SD 1D9KB 5EF2A 5HGDB 3PPSA 3MAWA 1CJYA 2MCAA 3RJQB 1JZ2A 4PPTA 1YEKH 4NPJA 3QSKB 5EUKB 1NMCB 4GO8A 4ZMWA 1O0VA 3I3DA 3FH8A 4FQQA 1UENA 3HR5A 2J2ZA 1WTGT 1DP0A 1X7QB 3K3QA 2PXYC 4FFVC 3GXUB 5C08D 1EIBA 3CJJA 4KTDH 5E1IA 1KOAA 4TSCH 1URLA 2AJXL 1IC5L 3IAQA 1EBAA 4M93C 3VFVB 2EE2A 3ZTCC 2FHBA 4ODTL 5LG1A 2Y1VA 1LO0L 1MLBB 3C09B 3HNVL 4RAUA 4UUJB 5GGTA 5IB4A 3VQMA 1FFPA 1ES0B 1EJOL 5JIMA 4C4UA 1PZ3A 2XG4A 4YGVA 1G9MH 1LO3H 1PD6A 4G6FD 4L4VB 3D48R 5TPWL 5L2KD 2NXZD 5FK9A 4M1CD 4QRSB 3DK0A 4NAQA 1ZMYA 3AMLA 1CFQA 1NM4A 3GKZA 1E3FA 2X9ZA 4EUPH 2WXGA 4TLUA 2C9VA 4JEGB 2Y6SC 3GXDA 3SDYL 1I1AC 2M2DA 1E4WH 4WKZB 2V3DA 3HG0A 3NZHH 1EEYA 1ZT1A 4U2ZA 3WO3B 5I1IL 5D1ZA 1OOAA 4LDOB 1AS6A 3KPTA 2YEZB 3L3GA 3S37L 1TTAA 4ONOA 1HK6A 1THCA 3FTZA 1XCQB 2YGPA 2X28A 2FEEL 1FHNA 1IBGH 3CWGA 4QTHB 5IQ9B 3BUDA 4X9BA 3V7AG 3DOSB 3STZA 3MRHA 1KBWA 3FFCD 4OQTL 2VDPB 4F9LC 4QJ4B 4KXAA 3DJZA 5JXED 2QPUA 4UT6A 4HUUA 4WHYH 4BWTA 2OYLA 3UYOD 4AL8L 4O58L 4P23A 4B9YA 3O9WD 2AJYH 2JLPA 1J9QA 4KROD 3VMNA 5BQ7A 5ID1B 3P3RA 3NIFF 3QWOA 2CO6B 3J2PA 3S96A 2PR4L 5IBUB 3VB9A 5JPMB 5IFJB 2FK9A 4I3GA 2CO7A 4OLVH 5DVKA 1LWJA 2EH7L 2A74C 1TZGL 1OHZA 4X6FB 1UKSA 25C8L 2NCEA 2RMNA 3APNA 3L3IA 3OX8B 5HYJE 2YD8A 5G55A 2GJZB 1LL1A 4UWQB 2B8OT 2FHFA 2NY2D 3WU1A 4TQHA 4I5BA 5F3HB 4UINH 1HL9A 4LGPB 4OLYL 5CLTA 3NRQA 1JPGA 1TQSA 3MRMB 3O81A 1U9KA 2BHZA 2ZUVA 4Y19B 1P6FA 3NBNA 4DP6X 5CEYA 3VXSD 1HZHL 4D8PB 1UFUA 2BSBA 4JPWH 3BIAX 3MRCB 5C1MB 1RUKL 1BVKB 2HLAA 4IS6B 4P2OB 3B5TA 3KH3A 2BS8A 4DP9X 1A1NA 1CFTA 1UXSA 3MBXH 3RILA 1BGXL 2WP3O 1E8WA 3ESNA 5C08E 4UOW0 1P9MC 4X7SH 4PRIA 1CYGA 3QFDB 3MGTB 4JDTH 3A47A 4JHAH 5I9QC 5JNYA 1WZ1H 5BUGA 1J8SA 3INUL 1EEQA 3ARBA 3KGSA 4HGKC 5GJSL 3ES6A 5IVZA 1RPUA 3HRZB 3TEZA 4P9HL 4PG9B 3UTQB 2YSSA 4XNMB 5IIEA 4UT7H 4NZTL 1N10A 2FVNA 3IB4A 3VXRD 4ZFOA 1KLGA 1U95A 2DM3A 1CIDA 1F6LL 5L2KE 5CEXA 5LKNA 1PDKA 1Y6KR 1GYAA 4Y4KB 3VWJC 1SHXA 4PG2A 1SJVA 1YQVL 4E9SA 5EIIA 5G4OA 2M83A 4I48A 1WUNT 3DUSA 1KCRL 1AGCA 3NG5A 1RUQL 4G5AA 1GGBL 1K4CB 2WJ5A 2WNGA 1KPRA 3ARDD 4WKXA 2R29A 3N9GL 4ZFQA 3MV8D 3W82A 3WOVA 3ESOA 4PTUB 1EJ6A 1AXTH 4LL4A 2EDOA 1R3LA 2ZUUA 5K93A 2BK8A 2ICWB 5CUSL 3T0DA 1AKJD 2K6YA 4HWEL 2EDRA 4GG8B 5IW6A 3V5HA 4IOFD 2C9PA 3ULVF 2WQUA 3K2MC 3H9SB 5E8NA 3LSOA 4J2XA 2H0FA 3D2TA 5ITFB 4F93B 1YNLL 2AEPH 3O8XC 1NGYB 5C97A 3P4MA 4BFIB 2APTA 3FQUA 1S9XB 2X38A 3O2WH 1TZOA 5KYUB 5EU6A 4M9OA 5H35A 1SYSA 5CEZD 3MJ9H 3LKPA 1LNUB 5DS1A 2PWGA 4X6BB 3BJLA 4YPJA 3EBIA 3ARSA 1XX9C 3E6HA 4AGQA 3UGEA 1AHWB 2JK5B 1NBCA 2R2EA 4XZ4A 1CLVA 1JZ6A 4JO3L 2FH8A 4TOYH 2ZUXA 4FXTA 1OGTA 2HXAA 4M48H 4N28A 5T1DL 5D2NE 3BSHA 5EA0H 1G7MA 3EH1A 1KGIA 1X5IA 2NW2B 3UTTB 3TVMA 1B90A 1ZD6A 3WIFA 1YPZE 2HJLA 4BELD 1HCVA 4WF7A 5DEGA 5H4ZA 3QIBA 3DGCR 1YMME 3GMMA 1N5AA 3JV6B 4RGMC 3WS6C 1W72H 5C3LD 3GSOA 2F53B 1QUNA 1P6WA 1IL1B 2GTQA 1JZDC 5AZEL 1G6RB 1UH2A 3APMA 2YPVH 3KL0A 1WAEA 2Y24A 3HLAA 1OE3A 3C09C 5HYJA 4RWHA 3K0WA 2GITB 4DVBB 2E47A 1IFHH 2LGNA 4JPVL 3MRGB 1WK0A 1U4EA 2FGZA 2X4SA 3GDCA 5FF6A 1G7QA 3CVBA 5DMYA 5GRWA 1NFIB 3A5VA 3OWEA 3DBXB 5CCKH 3WDIA 5I23A 3W0WB 5JW4N 3FO0H 3VXRE 4FXLA 2FB4H 4Z78A 4P5TB 1YC8A 1JVLA 2D8KA 2GW5A 4FZ8H 1CF8L 4L1SA 5C08A 3ALWA 1BQUA 1FORL 2FWLB 3LB6C 3HHSA 1IFRA 4XN8A 3U36A 5I17B 5AB2A 3PQYB 5F3BA 4DETA 5IJCC 5C92A 2OA9A 2VLRD 4KTDL 3MRJB 1NPUA 1XGPA 4TSCL 4QWWC 2AXGB 5EBMA 5C0BE 4ABQA 1XSKA 4CKQA 1ET5A 2DH3A 4UU9A 1KYFA 4K7FB 5L2KA 4X8JA 3VW3L 1M56B 2CRYA 3HMXA 2Q8BL 4FHBD 4ANUA 5JQHC 3G5YA 1G9ML 1S9VA 4XXDA 5I8EA 1JGVH 3GMQB 5DRNA 1QSZA 3L17A 5KN5A 2DYPB 3T4YB 2FYYA 5JW4Q 4ZUTB 1L5GB 3U46B 3LQMA 4S0HA 2G2NA 4ZXBD 1S3RA 1GOFA 1E4WL 5MEQB 2YRLA 3NZHL 5I6XB 3DPBB 4KJYA 4LGRB 1NGZA 4YXHH 2VDNH 1FGNH 1INDL 1RZQA 5BOZG 4ODUA 4LLYB 3BT0A 5B21A 2VL5B 5BV7H 5D55A 3UERA 4FD0A 1U8OA 2XPGB 3LTVA 3MBWA 2X9XA 3FUEA 2IH1A 3FFCA 1HCYA 3RBGA 3QJOA 2P7TA 2E56A 1IBGL 2OM5A 4JM2C 3TNMA 5JXEA 3W37A 2CXGA 2J8UB 2NNFA 2GSMB 3O9WA 2F7QA 2KKQA 4MXWH 4PJ8C 4NC1C 3ECVA 4YPGB 4DP0X 4NAMA 3GXIA 3QG6A 3A67L 2JJSA 2L04A 3M7FB 1BWMA 3CDZA 1INEH 2G5UA 3B1TA 1RZFH 2CHWA 2XV3A 4HJ0C 1KULA 1WYJA 2HVKA 2R15A 3N85L 2WXFA 5JO5A 5MEOA 4OLVL 4M8QB 3D2UB 4WUKH 4XWOC 4B60A 5CGMA 1YPZA 1NWOA 1ZXQA 3VGFA 4QXTA 3SPCA 4F15B 3PAVA 2IDSA 3F8UB 4N9GB 4OQ1A 4UINL 3VXSA 4F8QA 4Y4KC 3GXPA 5H8DA 2GHZA 2ED9A 3JWNG 4AYFB 2GJJA 1BDYA 2VW4A 3LN4A 1U2YA 1VGEH 2VISB 4JPWL 4R4ND 4N6RB 4NQUA 3BVUA 3NSDA 4N5ED 2DLHA 3P3TA 1K5NA 2UVEA 1A1MB 1OCWH 3MBXL 5EZJB 1JZ8A 4GI8A 3LIZH 3A3YB 4JREC 2R8SH 1B0RB 1CK0H 3LRLA 3PPEA 4X7SL 2H6PA 1VPOH 2VLRE 4UOW1 3UPCA 4ANKA 2OXHA 4JDTL 4TXVB 1ADWA 1XF4B 2WBXA 4UCFA 5DD0H 3D18B 3VXRA 4MVBC 1QFHA 3KPOB 4DGWC 2DM2A 3R06B 1A9EB 1CICB 1YYCA 2F68X 3DROB 1HEZA 2KBGA 3AG2B 4UT7L 1BQKA 3VRLF 4IOSD 4FQXD 1E90A 3IFLH 4ZS7H 1PMYA 3FRUB 3I9AA 5EWIH 5J12C 1IGJB 5BJTA 2AVGA 3FONB 3SN6N 3RX7A 5JOEA 5AL0A 3FFOA 3ARDA 3INOA 1NCUA 4M3KB 4QXWA 4B6ZA 3GNMH 3MV8A 1QVOB 3IFNL 5IVOA 3I6LD 4K9EH 3RWEA 3TBSA 2XA3A 5FFLA 4Z23A 1JF1B 3CDGA 2FL5B 4FXKC 1AKJA 5IFAH 15C8H 3B3IB 2WINA 3X11B 2OMUB 2DJUA 2EE9A 5D1XD 1AXTL 1CZ8L 4HZ1A 3FW6A 4F1ZA 4KK9D 5DHVH 2VDRH 3QO0B 4NHCH 4NENB 2CHNA 2Z65C 4FNQA 4APQD 3ZT5A 4N8CH 4CMMA 1UB5B 3WTWA 4UM8B 1A3RH 5TK2A 4PHXA 1ZDSA 3K2IA 3RG1C 2VMCA 3V0DA 1T0PB 1W0VA 5B22A 1Z9MA 3O2WL 4JFPB 2W8CA 1ZT4B 4BGDA 5DK0B 1OVZA 5KOMC 5SX4I 5FM4A 3M17A 1YUHA 3RTLA 3L7EB 1L7TH 3L13A 1O7VA 2CRMA 3IJYA 3DXAD 3QJFB 3T08A 1T0NA 2G9KA 1DJHA 2JQZA 4M48L 4YFDB 4ZMZA 2QZQA 2XV2A 5GGVL 4QRUA 3MYZA 4XXWA 5C0EB 1UCBH 4H13C 3UZQB 4JVWA 4HPOL 4JCLA 4DQOH 4PP1D 3WNKA 3O4LB 1HFUA 5I73C 2B1OA 1MW1A 1W72L 4WFED 4AM0B 4NYLA 5FPIA 5HDQL 1MPAH 4IKLA 4ZBJA 2PETA 4DUXA 3EO1B 2XY2A 4K9JA 4X99A 1KC5L 2YBRA 3IPBA 4NLAA 4I87A 4XPHH 2XWDA 4AK2A 3DDGA 1IFHL 1ONQB 4ONFH 1UA6H 5I0WA 5J9PB 3IETA 3Q2CA 5KBLA 2HMIC 3SE4C 1JNHB 4XCCH 3TT1L 1QSFB 2IBBA 1DSWA 1RAMA 3RFZC 1OARH 2CUHA 3D08A 4I18C 2UWEE 1ML0A 1XTLA 2A4CA 4J1UB 3FO0L 2AK1H 2FB4L 1H6TA 3J8F7 2X4UA 3JV4A 4FZ8L 2A4EA 3IFOB 3FCBA 3HS0B 1BPLB 4CN6A 4FAAB 2YGVA 2B4CC 2VLRA 2WTRB 1A64A 1KG0A 2H32H 5E70A 1OD7A 2JH2A 2OP4H 3VCLB 2Y2WA 3ABKB 3HZMB 2PYFA 5JORA 4OQTA 2Q6WB 4WTWA 3I6LE 5E8PA 1RLWA 1XQ4A 2R23A 5DK3A 5C0CB 3ZVVA 2ZUQC 3MRFB 4PP2B 5D1XE 5EPMA 3RWHB 1OK8A 1DJWA 1EZUA 3GSXA 4LCWB 4XRCA 4ABUA 3T8XB 4LLMB 3OR7A 2Z4QA 4RZCB 1JGVL 3D09A 3ARGD 4ZXBA 4ZMQA 3K71A 4PBVC 2D0FA 2KH2B 4PJFA 5D7EA 1ZLUH 3QUYB 1U0QA 4PGEB 3PAUA 3EIFA 3GMNB 1SXCA 1W2KT 4KRMB 2TRHA 2PF6A 4KKLD 2NR6D 2R56L 4Y4FC 1ILUA 1XSIA 2UY7B 1A6WH 4YXHL 2VDNL 1FGVH 1FGNL 4BQ8A 1ZSHA 4AUJA 1ZSDB 2HJKA 5CP7A 2CWRA 5I16A 4KXDA 3DXAE 3SDCD 3P40A 5BV7L 1AHMA 5E2JA 3BYYA 2HT3C 4AIOA 4AYBA 4DCQB 4OJCA 4GNKB 4CSSA 1J0HA 1XZ0B 3AM8A 2ZXAA 4XO3A 1T20B 1U91A 3KCPA 4MXWL 4UQ2A 5DRWB 2AITA 3IJ7A 2FNBA 1FUNA 3NABH 4Y2LA 4E9TA 3CX5K 4NWUH 1HEJC 4C56B 2GYSA 3CXHK 1PG7L 3TJHC 4LPCA 1INEL 1B4TA 1RZFL 5CSZB 1GGIH 5E03A 4ZPTB 3LZRA 2JKTM 1QO3B 1O7DE 4X0NA 1NUFA 1U8NA 4WUKL 4NXSA 3NA4A 1DHKA 3UAFA 4NM4H 2XQYK 3HMWL 1T03H 5J1AA 3PDOB 3TBTB 2QT6A 1MVUA 5E9NA 5FO8A 4MNHA 1ED3A 3QO1B 3GFUA 3EG9B 4JFZH 3V0GA 2YA1A 2DB8A 1U21A 3O6KH 4MCNA 4PWGA 5C86A 3ZR5A 1VGEL 2BWQA 4XPTH 3WEBA 4MASA 1IQWH 1ZHBB 1OCWL 1MLCB 2WZAA 3DA0A 3EGDB 4J39A 3LIZL 4U3CA 2R8SL 3GPEA 3ILQD 4FHJA 1PNDA 1WWBX 4OKDA 2EJ1A 1M3IA 1VPOL 2EUVA 1G9NH 3TBBA 3GXTA 3GBEA 5T5NG 1F42A 2YKKA 4FQXA 4IOSA 4GIPD 4Y9FA 4XOAA 5CN1A 4MQ7B 3B2DC 3CFBB 3D0AA 2BS71 3G5WA 5DZJA 5ICUA 5D96C 4F37K 1C8PA 3NFSH 3AFLA 3IFLL 3Q5OA 4K23H 1YAZA 4OZHA 4TPRH 5SWSB 5CLWA 5TK4A 4DOHB 1HE8A 2CD0A 1IAMA 3ARFA 3H42H 3GUTA 4HX1A 4UILH 5D6DC 5D9SB 3GNML 2J1WA 4TUJA 3SKOB 1YG9A 1VFBB 4K9EL 4XMXA 4K71C 1TMCB 5D7JC 3SE3C 3THMH 3IDMA 5IFAL 15C8L 2OR8A 4LSTH 5JLZA 3WY1A 2FCBA 1BVLB 4APQA 3FJTA 4NNYA 1G1KA 4NPYB 3P2TA 4ZO6A 3AW5A 4NHCL 5HVWA 5KOVC 4N8CL 4U2YA 4X5XA 2FX7H 4AJYV 1Z5HA 1A3RL 1CU4H 1P4LB 1F4YH 4MMZA 1RVFH 1AD0A 3CN0A 1AQDA 3SE9H 4WI2A 4KITB 4H25B 1VFAA 1IJ9A 4HEPA 3SYOA 2FUQA 3OKMB 4AVJA 2D31B 1IGTA 4AKOA 1N6QH 5IUCA 2VQ1B 1L7TL 1JYWA 2ITDA 3Q8FA 4FXGB 4YFLF 3MV9B 3GRBA 4AYSA 1EHXA 3QR0A 4XGZB 4A7GA 2WXPA 3QFJD 4Y9BA 1XGYL 1FYTD 1SLXA 4WNQB 4LSDA 5DJCB 3EYSH 5KAQF 3HS0C 3US9A 5DJAA 4BFKA 3O3DB 5KTEH 5F0LB 3H53A 2PTVA 4DQOL 3VU1A 2NRDA 4HDIB 5ESAB 3FUNA 2NY3D 3FXIC 4YEEA 2WLNA 3CNKA 2BVOB 3VFTB 1MPAL 4LPYA 3VH8B 3R4RA 4Z76A 1I8LA 3DGGA 2BSSB 5K39A 1MUJB 4XPHL 2Y0SA 3CSGA 3HE7C 4K4KA 4Y1SA 5H37G 1QBMH 4EUPA 2YQBA 2HH0H 1UA6L 2AEOA 1EO8H 3H7BB 2OFQA 3L4CA 1I7RA 4XCCL 4AV5A 4QR7A 3AC0A 1G7IA 1DN0B 1OARL 2XFXA 3VXPB 1JZGA 4ZS6C 5AKTA 4O2EA 2XOTA 4K5NA 4AQOA 2C9UA 4AV0A 1M6OB 1T1WB 1TF4A 3QULA 2AK1L 1QFOA 5KSAD 1EAQA 2E7CA 2ZX7A 2X7LB 2EDHA 4JZOB 1E5BA 1ZJBA 2VT0A 2BJMH 2R39A 4LEOA 1CLOH 1MELA 3MZTA 2OP4L 4NKMA 1DBBH 2GQHA 2ROXA 1OGAE 4HUWA 4IDLA 3BD4A 4Z7QB 4HV8B 1MN4A 1I8KA 1RK1A 3ML9A 3DLQR 3SYCA 2CIKA 4JZJB 5KBPA 1BXXA 3VD3A 3MDJA 4AEIL 3QRLA 1TQCC 4HCIA 3K6SB 2H47C 2APSA 2BWDA 3ARGA 4N2EA 4LVOB 3OKOA 2A4ZA 1TIUA 1EVTC 3O3AB 5FGRA 4XO9A 3O6FC 1MEXH 5E08H 1NUDA 2P1YA 5DZPA 5T33H 3KPRB 2NR6A 1M42A 2DQTH 3MRQA 2OX5B 4FA7B 2WWKO 3QQ3A 5DUMH 1Z2KA 1JD7A 4HG4K 4G42A 5L8KB 1JPTH 2O4EA 1EZVY 4PB9H 3S5YA 1KFAH 3U2IA 1PD0A 4FKEA 2F8IA 4KV5E 1FGVL 3E2HB 1D6EA 2ZKMX 1ETZB 4ETQB 3HN8A 4F9PC 1C7SA 3NGBB 1U2CA 2ENJA 2CLVB 3QNXB 5ENWA 2FJFB 4MKTA 5EULV 4PJXB 3K1KC 3DVIA 1MJ7H 1UJ3B 2RHEA 4WJKB 3QHTC 1P0SE 2VJ8A 4YSOA 2ZOUA 2VR9A 2FNWA 4OAWA 4HEME 4L9LB 3RY5A 1AG6A 4UIKH 1MKFA 3NABL 1AIZA 1J9CT 4U7MA 2IAND 1K6QH 2BIPA 2JI2A 1YEIH 4NWUL 5E6UB 5B4MD 5EC1B 1LK2B 3FCSB 2IFFH 4KJPD 3QA3A 1GGIL 5TFSH 3CIQA 2DMKA 4YX2H 5K59F 1KTLB 1WQVT 4HJJH 3TNNA 1KXVA 1TTCA 4C83A 5IHBA 3QJHB 4RESB 3ZSTA 1KDJA 2XN2A 4Q2ZA 1NTDA 2TAAA 3FYEB 2PW2B 4MJID 2YD6A 1CPUA 4MKMA 3RVXC 3BN3B 1TZHB 3D4CA 4NGHH 3EGSA 2MWCA 2DWXA 4IHOA 4IMLA 1T03L 2O61B 3MFFA 2V5SA 4K94C 4N2OA 4O00A 3X13B 4NZUH 1E9QA 4X4XA 1EZSA 1EV2E 4MDRA 4JFZL 5EBLA 1QRKA 5BZXA 3O6KL 1PU0A 3V0WH 4AV4A 4LEEA 4G1EB 2E9BA 4XPTL 5KVEE 1O9VA 3NPZB 2O6PA 1IQWL 1JYVA 5F70A 4AYEC 2PUQT 2ZP9A 3OJ2C 3NIGB 1L0PA 5CXPA 1CE6B 3FT2B 1U8CA 2Y22A 3X3GL 3ZDYE 2J88H 1G9NL 1AZVA 4G1MB 5HHXH 1KCKA 3CFUA 3MJ9A 3DHUA 3P69A 5DRZB 4LLWA 3T1FA 3D50A 2F08A 5DA0B 4G8EA 2O6CA 4KJQD 3V0AC 4BGLA 1CGVA 5MERA 2WIIB 4XE5B 3CHXA 1F13A 32C2B 3NFSL 2N3JA 1C5DB 1Y0LB 1HEHC 2WVSA 1T1XA 3DK2A 2W65B 4TPRL 5DZAA 3REVB 3X17A 3ZO9A 3W38A 1A6AA 3PWJA 4YSQA 3LV3B 3H42L 5A3ID 5A2FA 4I0CC 5JPNA 1ZV2A 3GI9H 5FM8A 3F7KA 4UV4H 3RIKA 2XWBB 5JMRA 4UILL 3BKCH 2CIIA 1PZ5A 1THAA 4P5RA 4GMSL 4UTBH 2Y1ZA 3DSFH 3MUUA 1EUTA 3P2DA 2E9GA 3THML 2LFGA 5F9WC 4Q56A 3BEVB 1UA3A 4LSTL 1W72A 1WT5C 2XZAH 3KNBB 4XNYH 2DIAA 2HVBA 1NGXB 3WEMA 5HHPA 4YL4A 4JFFD 2YPVA 2FIKA 1M9WA 2ARJQ 3CFDB 3FO2B 4D94A 1BJMA 4FI7A 4KZ0A 1TEYA 2MOGA 2QLVB 2FX7L 3PHQB 5JW4R 3SCMB 3UEQA 2JKWA 1BQRA 1CU4L 1V7MH 3FB5A 1F4YL 3T4AB 4AQ8C 3EO9H 3QXDB 1BG1A 2PCPA 2HFGH 4H40A 1JV2A 3SE9L 4F24A 4XBGB 4EN2A 2IANE 2JTYA 2LLGA 5LGJB 5FA3A 2QJDA 2G4GA 2PP8A 4W9LC 1N6QL 3ZQWA 3QFJA 3DRTA 4XMWA 4HIJA 1FYTA 3DX9B 4HU8A 1YY8B 1ASPA 3IJ9A 1MCWM 1PW3A 3LKSA 1XGQB 4NP9A 4D0BB 1JHLH 1GMEA 1KGWA 1QI5A 3KGRA 4HEMA 2FIRT 1XV8A 3WBDA 4MJIE 1G6RH 2Z31C 2BRQA 3BGMA 1M7IA 3EYSL 4G8FA 1Q1PA 1SJHB 4JAMB 5BW7A 5EOCH 2C3GA 2WD0A 4HPHA 5KYXA 3IDIA 4HUVA 3N0AA 4I3SH 1S7VA 2MCPH 3BO8A 4JFSA 4X6CA 1RJZB 4Y16D 1Z3RA 3BKJH 2DWDA 3EH5B 3JTSA 4XBPA 4FQ2H 2J8UF 3UZVA 4UAOB 3VFOB 4WV1C 3TYGH 3F7PC 4OY9A 1FAKT 3T3PB 5KJ7E 3SGKA 4MB4A 3VD5A 1OB1B 1NCAH 1QBML 5E6IB 2HH0L 1MCRA 1EO8L 1T4KB 2IQAB 3OJVC 3SKJH 3SOBH 3QCUH 5KSAA 2EDEA 4R3SB 2BNUA 5FCSH 1IVLA 2DJ4A 3X12A 4LCCB 5FFOA 3FTVA 1FVDB 3ISWA 3MO1B 3LQAC 3QDMD 2V2XA 1R34A 3V7AE 3VACA 3JYCA 4CVXA 1I8IB 3KPQB 2HRHA 1HZLA 3N40P 2BJML 4PD4J 5DJYB 3TEXA 1CLOL 4G72B 1E42A 1DBBL 4CILA 4KKBD 4PJ5D 3QUKA 3T8VA 1KB3A 1UJ3C 1KNOB 5CKAA 2QPSA 5D72H 3BQUC 3C08L 4Z7NB 1E5AA 1ZV9A 1Q4NX 2J7LA 1J1OH 4R7NA 3P9MB 4L9LC 4EPSA 4B9JA 3MNMA 4W9JC 4HFWA 3NRPA 3EYVB 1JZ5A 1JFQH 1MHHB 2CJUH 4MJ5B 3MKKA 5E4AA 3VTTA 1J5IA 1JZJA 3HJEA 4YDVB 4J28A 1AYRA 1MEXL 2PO6B 3LOWA 1DQQB 1R0AL 4FL4C 3P11H 5T33L 3W39B 5FYJH 2DQTL 4EOWH 1O7SA 1N0XH 5I6PA 3RPIA 1BZEA 2WB7A 3FYIB 1I75A 1TVHA 3AU1B 3KYKH 4L29A 2GPZA 4RFEA 3WNOA 3DVGA 3P1VA 1JPTL 2ZOLB 3EJRA 3WFHB 3EGXB 1KFAL 4PRDB 1N64H 1AR2A 1VENA 4N8VB 5AVRB 5I74C 5CF3A 3C6LB 4FEIA 4ZOEA 5IK3B 3L3DB 1E4KC 2WWNA 2YWZA 1I4FA 4JCWA 3BHBB 1E2VA 2DQDH 2YQ3A 3LIZA 1MJ7L 3S8GB 3KYMA 1AZZC 5IKCB 4ELMB 3I6KA 1DBJH 3DHMA 5DJDB 5IQNA 5AB0A 2EYSA 2OV0A 3E9TA 2IANA 3CFCH 4DP8X 3V8OA 4UIKL 5FO7B 2K6WA 1AMYA 2DLIA 1AI1L 1ETJA 2WO2B 1K6QL 3CN4A 3MLVH 1YEIL 4XBEH 4KZDH 3SIKA 2Q1EA 4IBZA 3HC4H 4IGBA 3T6XA 4KNUA 2IFFL 1NAMB 2L4OA 3MCLL 1S78C 4YX2L 1MXGA 1CXHA 4RFOH 5CMAB 4MJIA 4HJJL 1JWUA 4HIEA 4JJHA 4K3EH 5IOKA 4LLVB 2IPKB 5KJ4A 3WE6B 4L8BA 1PZCA 1WBZA 4BK8A 1ZPUA 2WPGA 3UCQA 4CVWA 2EICA 4WUUB 4AGLA 4NGHL 1YEDB 1YYLL 1BP3B 2Z35A 2XRAH 2Z0BA 2G4EA 2KDYA 2DQMA 2EDDA 2MQ3A 4NZUL 4Y4HB 3S35H 2YD4A 2VAAB 3D8MA 5DHVA 1T5XB 5DUBA 2K9UA 3LH2H 4ICXA 4IU3B 4NBZB 8FABA 2VLKD 2HG0A 3MRKB 5MEND 2VDKH 4D9QE 3WYRA 3NN8A 4UF7C 3I9GH 4NUQA 1MHEA 2J57A 3RZWA 3MRRA 2YPLB 1QYGH 4KUZH 3TL5A 4BFBD 3NJLA 2E86A 5CZXC 4J6RH 1I3VA 4L23A 1IEAA 3X2QB 1SHMA 5HHXL 1XL6A 3GRWH 4F33B 2Z7ZA 5DYOB 4HKXA 5LQBL 4MCZA 4P8QA 3QDGD 5J6HA 2K45A 1AZBA 2WN3A 3ELAT 2EH8H 3NCCB 3NSJA 4MAYB 2NY4D 3SY0B 4IRSC 1KB9K 1E65A 1R3KA 2X09A 4ZMPA 1H9DA 1RP8A 4MLSA 3DHJA 3DKHA 4BZ1L 1PG7W 2IXQA 4XCNB 1KELH 3VXOB 2ALWA 3GQFA 3S0PA 1J8HD 2VDQH 4X8CA 2COQA 3TH4T 1OAQH 1MFDH 3QZBA 5IW1B 4R0LA 3GI9L 4XMTA 3MX0A 2I60H 3O45B 4UV4L 2Q7YB 4PWHA 1VFMA 4JFEB 3BKCL 3UABA 4Q6IB 4HSQA 4LKXA 4UTBL 4OI7A 1IVTA 5E9DA 3LXCA 1T22A 5DUJA 5HHOA 4GLRI 1DLHA 4BKLB 4JFFA 1JTOA 4JUSA 2P8PA 3S5LG 3NIDB 3VRIB 3WXWH 2WQAA 1WO2A 2XZAL 4V1DE 3RX9A 4XNYL 4M9PA 4PW4A 3ZSSA 3CN3A 4PJDB 1D9KD 2BRRH 1N6UA 2OJEB 3KVPA 1V7ML 1I1FA 4YNYB 5I6NA 3C60B 3EO9L 2Z93B 4UAOC 2HFGL 4XXCC 1AHKA 2JB5H 1EHLL 2GSIB 3HS8A 1N19A 1S5HA 3HA0A 4U31A 2BSRA 4PR5A 1IIIA 2A6DA 4PRHD 1FP5A 1C9SA 3B6SB 4UQCA 4OFPA 4AC4A 3BWAA 4OCWH 2UZYB 3RNQA 2OL3B 2E7HA 3TO4B 4JFDD 2H32A 3MACL 2Z0UA 1JHLL 5B3NA 3FAWA 4UI2A 2YMOA 2VKWA 3M1CA 4G7VH 1G6RL 4WTZA 3QFGA 4R7XA 4Y16A 5D4HA 1OP9A 3RGHA 4FTVE 5KSVB 2JXMB 4RIRA 2AS5M 5CGBA 4I3SL 3L5JA 2NY1C 2MCPL 3BKJL 1A3QA 3DMMC 1NPNA 5F0PB 3WN5B 4LCUA 5L4JA 4FQ2L 5MI0C 3PV7A 5MENE 3ECQA 4GW1B 2ZCLH 5C09B 3TYGL 1ZT7A 1HQ4B 2NT1A 1TQTA 4I0PD 4EEEA 3WJLA 4PREA 1NOFA 1NCAL 2UZXA 1XBRA 5AVXB 2R2HB 2ZXDA 2W94A 1OV8A 3C75A 4F7PA 3EJYD 3WMSA 4TLTA 2DLGA 2DM4A 3W9DA 2O6EA 4U1LB 4DP5X 3W5NA 3QDMA 4KFMA 3SKJL 3BW9A 2EILB 3SOBL 5AW5B 1QR1A 3KJ4B 5B3SB 3NJNA 4P2YA 3L5WA 3PDGA 2I7OA 4FYRA 1T5WA 4NQTA 4LMQI 3BE1H 3AG4B 3NP3A 1PLBA 2PP9A 4U6XA 3QWQB 4LSVH 4M29A 5JHBA 3JWOL 3LPGA 5B38G 3CLEH 1J8HE 5BO1H 1NMAH 1GS6X 2A9MH 1NZRA 5HHNB 4PJ5A 2APWA 1TKWB 3ZRSA 2VMEA 4KKCC 1AS7A 3FB6A 1I1YB 1KGXA 4UYPA 3L4VA 1QEWB 1MCBA 3FB7B 4NSKA 5FUCC 3PNRB 3E80A 1G0XA 2VUYA 1J18A 1ZE3C 4OJAA 2X3AA 5D72L 4MLIA 3F3HA 4CUCA 5IOPA 1I8AA 3MBEC 4PLJC 3E6FA 3U25A 1J1OL 2ENYA 4QHKI 3MTXA 1QZ1A 5C0FB 4PJEE 3IGKA 4MX7A 1JFQL 2CJUL 2CDGA 1KTCA 4NDMB 5BZWA 3U2JA 2VSMB 3QJTB 3IJ8A 2CH8A 2XWRA 1AO7D 2OLDA 3GMPB 1B0GA 4NO3A 4OIAA 3P11L 1OF2B 4Z7UB 2XDHA 2Y7SA 5FYJL 4EOWL 5LNEA 1WZMA 1CVSC 1EJFA 1YEHH 4G6KH 1KPUB 3KYKL 4E36A 4A2MA 4B97A 1UD3A 4ODWA 4PRHE 3TX4A 3N41B 1N64L 2A9BA 2C5DC 1R5IA 1VERA 2E7DA 4R5TA 4FQIH 2V5YA 3F01A 1KIUB 4IRJB 3HZVA 4JFXB 4KI5C 4ODHH 2DQDL 4BFGA 4PRPD 2FE0A 3FBKA 5EBGA 2L8AA 3QNFA 2NXYC 4JJOA 1DBJL 4POZD 5DFWH 5HI3C 2X4PA 3GYRA 3CFCL 4S2SB 3IN0A 1WBXB 2AMUA 2R9HD 1FNEB 2Z92B 5T1MA 1I7UA 4YBQC 3BDYH 2AJ3A 3CVHB 4OFKA 4XBEL 5ETUA 3MLVL 3RGVD 4KZDL 3HC4L 1WRFA 3ETBF 2X6MA 2P42B 1SBBA 3PGCB 4RFOL 4H26A 3WXVH 3ESPA 5JW5A 3UIZA 3R0NA 2WXNA 3S4SB 2LAAA 5CJBA 4R6UA 4GSUA 2FUTA 5HVHB 1H8OA 1MRCH 4P07A 1AGFB 2G75B 3B3BA 2NY6B 4YHOH 5DJ0A 5MENA 4L3CB 2NCMA 2VLKA 3ARVA 1BFOA 1UD4A 4FQCL 4Q14A 1LEKA 3S35X 2DQJH 2PABA 2R7EA 3S35L 4TQPA 1YUKB 4CAGA 3LH2L 4ONHB 3RVTC 5HYSB 3PP4H 4ZW7A 1J1XH 4GKSB 2VDKL 1DVUA 2AMGA 4OV6F 3MR9B 1RH8A 4JY4B 4KUZL 1QYGL 1A7NH 3QDGA 4L05A 2YXVA 1H15B 1CG9B 1BHGA 1TETH 3GBDA 4J6RL 4WO4B 5IEKB 3LX9A 4FRWA 4XNBA 3GRWL 1WFMA 1X5JA 5DJ8A 2ZWYA 1B2WH 1HE7A 1R3HB 2EH8L 4KKQA 4L8SB 4A39A 4N87A 2XV6B 4IU2B 4E9XA 5DK2B 2C1PA 1T7VA 2X3BA 3DX7A 3VXTA 5C0IA 2VDQL 3LKQA 3IPFA 4JRXE 5TGBB 2RQ8A 3U1SH 2YBGA 1AO7E 4U1HA 1OAQL 1MFDL 2VUOA 4QHNB 1IBZA 2AV1A 2ZX5A 2I60L 5E5UB 2XJKA 5KJRH 5CJOH 2VW7A 3WY2A 2AXHA 3TO4C 1WBYB 2JKJA 3OHMB 1GHFH 1OEZW 1RK0B 4H8QA 3VFWB 1KN4H 3F04A 4K3GA 4KPHH 4Y2NA 4PJEA 1LE9A 3WXWL 1QAWA 5IF0A 4KK5C 1QLRA 5D7SH 3OXSA 1FL3B 1M4KA 2J71A 4U1GB 4LLDA 4Z7QF 1IM3D 1D9KA 1G1CA 4KTEH 4PRPE 3EH3B 5B3JE 4HJGA 3MV7B 4YHNB 3TWCH 2HSIA 4F3FB 4IBLT 4Y5XB 1TYJA 1OO2A 1KIPA 1F6AA 3RIAK 1XR9B 3W0WD 2CMRH 3DV6B 1U8MA 1ACXA 5GGUB 2WKOA 4MZRA 4L1HA 1AD9B 3U6XA 4RA3A 4PRHA 1X7QA 2V3EA 2JB5L 2VB5A 3CZUB 3M88A 3RPBA 1F45A 5JIIA 5ALBH 5D7LB 3L45A 3RL1B 3K46A 4OLXH 3D39B 4JFDA 1OY3B 3DDFA 3GB7B 3PQYD 2F8XC 5EC2B 2YS4A 4OZIE 2CBPA 3L16A 1TFHA 1ZHKB 3BMWA 4U3SB 5DSCA 1PLGH 2WWOA 2QFRA 4RNRB 4CC0A 3IE4A 1GW0A 3L3KB 5DT1H 5L4MA 1JHTB 3NFNB 1PY4A 2SODB 1MRFH 1Q9OB 4PJXF 4UTAH 4JHUA 4JG0H 1QFWI 1Z3GH 2XQYG 3SO5A 3FQRA 2X0WA