3QORD

Crystal structure of human nuclear migration protein nudc
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
117
structure length
116
Chain Sequence
SKLKPNLGNGADLPNYRWTQTLSELDLAVPFVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, cell cycle
molecule keywords Nuclear migration protein nudC
total genus 30
structure length 116
sequence length 117
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorD00
2KLRA 1RL1A 1WH0A 2K8QA 2Y1YA 3Q9PA 3QORC 4PBDA 4YE0A 1SHSA 2Y22A 5LUMA 3QORA 2CG9X 3L1EA 5DS2A 4I88A 2BOLA 3GT6A 3Q9QA 1X5MA 4PCKA 1EJFA 3IGFA 3GLAA 2KMWA 1GMEA 2N0KA 2N3JA 4YDZA 2RH0A 3VQLA 3VQMA 2CR0A 2WJ7A 2Y1ZA 4JUTA 3W1ZA 4M5TA 3GUFA 3N3EA 2JKIS 3AACA 4ZJ9A 3L1FA 1WFIA 4FEIA 4RZKA 3QORB 4YLCA 3J07A 2WJ5A 3QORD 5DS1A 3L1GA 3AABA 4M5SA 2MNWA 1WGVA 4YL9A 4YLBA 2XCMC 4ELDA 3EUDA 2O30A 4MJHA 4JUSA
chains in the Genus database with same CATH superfamily
4DOHE 4XN2A 5BVPH 4TSCH 5AKVA 4D7BA 2DMCA 5L88H 4N24A 1U21A 1KBWA 3VVVA 3LXUX 3HN8A 2DEYX 1JNHB 4Z7OB 1T1XB 5CEXB 1WUZA 5TQ2L 1YYCA 5GSVA 1A3ZA 1SBBA 2ZD0A 4X42A 1NDMB 3O8XB 3A3YB 5GS2D 4JHWL 3CLFH 3Q1SL 4ZPVB 4XT1C 1ZT1B 2R29A 4IBWA 3P30L 1A6UL 1MQKH 2VSKB 1GYVA 3QH3B 4MRCA 1FE8H 1OGPA 3B6SA 3SQOL 1MCPH 3S4SB 4XCYA 1OF2A 3TEUA 5KEZA 3D33A 3WYRA 3PL6D 4MX7B 4GQPH 3F7LA 1TSRA 3GSXA 1KB9K 4JE4B 4KPHL 4QRSB 1I8LA 3FQRB 4CRPA 4TNWF 4AIZB 8FABB 3DIFB 4OLXL 1AGBB 5FWRA 2M26A 2HZHA 1NKRA 4WK4B 4MAYA 4JO3L 2F53A 5HPMA 3EGDB 4U2YA 1DQJB 2FECI 1ZXQA 3CFIC 2AQPA 2H0PA 3TFBA 2CIKA 4X6BA 5G4MA 1UJ3A 1WIPA 5E2TH 3IDXL 3IFLL 1MJJB 5F93C 1LDPH 4FN0A 3N85H 4ZTPH 1AO7A 4MNGE 4C56E 1LQSR 5I1DB 1BZ7B 2IFFL 2YD3A 4F8PA 4PJIB 4CBZA 2OR8A 1GZPA 5FFGA 5KTEL 5E56A 4N8CL 3K81A 1KFAH 1FN4A 1GZQB 4UQ9A 5DS8B 2OZ4A 4JM2B 5DXWA 5D1QE 5HJGA 4PJXB 4H4NA 5TTRA 2FB4L 4D9QE 1RZKC 1M7XA 4LVOB 2AI0H 2F54B 1QX1A 4LCWA 3OKLB 2OSLB 1SOQA 2YK1H 3QT2A 2CJUH 3SO3B 5T1KA 2A9CA 3QORA 1G5GA 2VM9A 4YVNA 2DN7A 2V2WB 1ML0A 3OGCA 3DGCR 3GXNA 4U05A 1KY7A 3T0EE 4FMKA 1AI1H 1TZHA 3D30A 5D4HA 3EYFA 3BH8A 3O4OC 5ALBL 1CG9A 1S9KC 2EIJB 1ED3B 3M45A 1VGKB 2W07B 5FCSH 2LU4A 3TVMB 3GHBH 4J2XA 2GY7B 1V3LA 3DJTA 4YGVA 4JK0D 1A7PL 2NY0B 3KS0H 4M62H 4Q9QH 3V0AC 2B0SH 4QRUA 3AW5A 4AGOA 4PGCB 4U2ZA 4G8IA 2BP8B 2XQBH 5EC2B 4OV6F 1PZ5A 2IEPA 3W0WA 1QR1A 4MJ5B 5D7IF 1T5KA 4PWJA 4BZ2H 1Y1UA 5IB5A 1XB3A 2IOOA 4AL8C 4L0PB 3LMJL 2ZYHA 3U6RB 1RQ5A 5F3HA 2BIQA 1BIHA 3IDIB 2BS8A 3DX7A 3QIWD 4U0RB 4KZ0A 2VL4A 3LZFH 5FA4A 3WS6A 1RZQA 2J20A 2UZYA 4ODXA 1TQBB 1E42A 4UTAH 5IVOA 3HJEA 1FZJA 1P7HL 4XCNA 1F3JA 4KJQD 1D9KC 2GJPA 1FGNL 3Q43A 1SVBA 5E5RB 1SBSL 3P3YA 3JTSB 1U58B 3CVIH 3RVUD 3HE7B 5DDHA 3LV3B 1B0RB 1TQUA 4LESA 4PGZA 4EUPG 3DDGA 3OQRA 3T4AC 3K6NA 3V4UL 2NY4D 2VDRB 4OVVA 2Y07L 3GRGA 4F15C 5EZJB 3SIKA 1XH3B 4E36A 1CXHA 3MMEA 4B0MM 2Y7LA 4UIMA 1NL0L 5BQ7B 5FX3A 4D0CB 2P24B 5D6CA 2Q8BL 4Z5RB 4EN2A 2PO6A 3OZ9H 1UYWL 1P7QB 3TO4B 5CWSB 3MLTB 2N7AA 2A38A 4WRLA 1P7KB 3MJ8A 3CFBB 1AR1D 3LZRA 1MFAL 2CLZB 1R24A 2K6WA 4HAKA 2VZSA 2BFVH 2X38A 3VXRB 4BK5C 4H20L 4BSVA 3OKKB 4LPXA 1F4YH 3WE6B 4JCWA 1YEJL 4MD4A 4ICXA 1JNNH 1JK9A 1NANH 3CLEL 3ALPA 4XX5A 1HOCA 2R0ZL 8PAZA 3FFDB 4DGVL 1KJ3L 3O2DH 3FTZA 4HDIB 3RWIA 1OEZW 4Z0XA 2XRAL 4HHGA 4XBEL 3IDNB 3QDJA 4PJHF 5FCUL 3SYPA 3MRHB 2QGCA 3FDWA 3DJZA 3FB8A 3LVEA 5JR1H 1QLRB 1S7UB 1CXEA 4LGPB 4N2OA 1N0XH 5DO8A 2BNRA 1BMZA 2AJYL 2ZXAA 3HN3A 1HKLL 3VGFA 3SPVB 3SZKC 1A1NB 1KTJA 1OGTB 3QDJE 4N6RB 2H3XC 2Y7SA 4NM8L 3GUTB 5DC9B 4I9WD 3PHOB 5C0EA 3T1FB 2GSGA 2VGLM 2X5PA 3BP5A 4NFBA 1T2JA 4R4ND 4B7LA 3ULUE 1EO8L 4GEIA 1QSFA 4ABQA 4I9WE 1L6PA 2YPLB 3SQRA 4ZBJA 5I66A 1U33A 3BSGA 4PBXA 1JZDC 1ETZB 1R0AL 1UB5A 1KBBA 4R7LA 4WW2C 5E8PA 1PL3A 3FQ2A 3SE9H 3HC0B 5IHZA 3GKWH 2CDEB 5C92A 2ODIA 1ND0B 2A1WH 3K2UH 3LB6C 4NP9A 5EA0L 2OMXB 4QWWC 2JELL 1ZVYA 5C08A 4YHNB 1WFNA 4F58H 3IPEA 2ZE0A 1AQHA 2CO6A 3ARDD 5CCGE 5ITBL 4W70A 1M71B 3DARA 4R5VA 2ZCKL 1MAJA 4KDVA 4G8GB 4OZ4B 5EOQH 5D1QC 4RAHA 3U1PA 3KPRE 3T0BA 4IJ3C 4GQ9L 4HIHB 5IW1A 4QRFA 2CCLA 1CF8L 2Q76A 2ZXBA 1RJLB 1KZQA 5E4EB 5HHOE 5F6IB 3AADB 2G3MA 5H35B 1K3ZA 4K4KA 3U2SB 2XXMB 4RFNB 4Z8FL 3R06A 1X9RA 3GSQB 5IESH 1HESA 4L5FL 2VYRE 4NHUA 2ODHA 2FE0A 2WVUA 1JHTB 3CVHL 4GKLA 4WI0B 3E6FA 4ZAKC 3C8DA 5EZIH 4EPSA 4YSTA 3EGXB 5D1XB 4WWKA 5EZLB 1XCTA 1OQOA 4GAYA 4MNQE 1DVXA 4LP5A 3RPIA 3GB7B 4HOXA 4ZW8A 4MMXA 1ADWA 1B2YA 4OCRL 3HI1A 3MJ6A 1N7MH 3GBML 1CTOA 1PBYA 2VXQL 3GDBA 4OZFB 4DGYL 5IWLC 3M07A 1A6VH 4YUEL 2PTVA 3O6ML 4UMGA 2A4ZA 3SJVB 1N68A 4FQCL 5JOPE 2DKUA 2A3TA 4ICWA 2ITEA 4Y4KB 4XPGL 4KFMA 4PJ9D 3UAJD 4FP8L 1F11A 4LL1A 1A9BA 4QRPA 4A2LA 1WCBB 2GIYA 1DVFB 4OFYA 2FIRT 1DQQA 1BAGA 5BO0D 4PVLA 5E1AA 5SV4A 3RU8H 1T0NB 2XICA 3BAWA 1AH1A 4M5ZH 4WAFA 5ILTL 1NAKL 2WC7A 3ZHFA 1OCCB 5E9AA 2IPKB 2KS0A 4QHPA 2F0CA 3UZVB 3VXUE 2B15A 1WG3A 4AEFA 2DKMA 3NEEA 1CVSC 4UTBA 5JW3L 1GC1L 4LDLB 4XB8A 1RZKH 3CLFL 3I74A 2O26U 4XC3L 4YBHA 3WCYA 1QHOA 5E9DD 1BXVA 3FQNA 4NZRH 4P2OC 4Z7WA 3V6OC 1FE8L 2Q8AH 1XGPA 3SQOH 1EMTL 3H9ZA 3GZQA 2E7CA 1V3MA 2E6QA 1BMGA 4ZTOL 2IOIA 3OHXB 4GW5A 2IO5A 1OY3B 3MROB 4N0RA 4YSOA 4U1NB 4E5XG 1BBDL 1E3XA 1S5IL 3INUL 4OF7A 1JK8B 3WNLA 1MW2A 3BXNB 4JDVB 1LGVA 3SPCA 1LO2L 3BQUA 1REIA 3R8BB 3GO1L 1U8JB 3PNWA 3A6CL 3B7SA 1NAML 4PREA 2GTZA 5FOJA 3ZTJG 1B4RA 2NY5H 1KJ2B 2QVTA 5GISL 2HWZH 4JO3H 1TZIA 4HH9B 1WTLA 4GSXA 1LWHA 2NYZA 3EO1A 2ROXA 4JG5A 3G5ZA 4LRNH 3UTZA 2XZZA 4Z3EA 5E2TL 3QULA 4JGMA 3R0NA 2AJVL 4AG4H 3CFUA 3MOQA 1MHHA 2BY2A 3VMPA 1ZEAL 4EZLA 2D4FA 3P3SA 2V9RA 4KKCD 1PJ9A 3L4YA 5C9KA 3UC0H 3T4AA 1FNAA 3FU7A 4O2FA 5GQBA 1EHLL 2ZUWA 5KTEH 2ARJA 1WITA 3L13A 3LIZA 3MJ9H 4NC1E 4WU5B 1ZHBB 5DRZA 1T22A 3MOAL 4I18C 4NM4L 1A7QL 1I1FA 1L9MA 2QEJA 5DZAA 4NO0A 3APMA 4FNQA 4UM8A 1G7HB 3O45A 5HHXH 1RSYA 2VJ8A 2YK1L 4AT6B 2X88A 4AC4A 1UURA 4WKZB 4HUVA 1N64H 3SO3C 1S7WA 4JFTA 5KSBA 1EO7A 2C3VB 3ZR6A 2YZ8A 1R3LB 5T1MA 3ELQA 1S5HA 2PLTA 2JJVA 2FJGA 2L04A 5IOKA 1R1CA 2MCPL 3DSNB 2DLFH 1NCHA 2W60B 3T6ZA 1HEZB 3EYSH 4NRZA 3EYOB 1N5AB 1BQ5A 4RWYL 1UT2A 4NLAA 3EZJB 4LSRL 3GHBL 1J8RA 3T6WA 1D6VL 1QKZH 4QHKJ 1VZHA 2J1YA 2HKHH 3DOSA 4LCCC 2EE2A 4M1GH 1AGCA 1QBBA 3QC6X 2F9BT 2IIJA 1RUAH 3P73B 3WUWA 2WXGA 3MV7E 3A6BL 4Z0BL 4EZJA 2GBAA 2H1XA 4ELMF 1P84J 1JXKA 3TU6A 5IJCC 1BG1A 1A4JB 1A4BA 3H0TA 3WO4B 4KFZC 3X1BA 3C5ZA 3VM5A 4XMXA 1KFGA 3O0RL 1P5UC 1Q1JH 1E28B 1FC1A 2HG5A 3B2XA 3QA3B 1QFWL 4DF9A 1CE1L 4ALAL 4YEEA 1O0VA 1ET5A 2HRLA 3U9WA 4HX1A 4CMMB 1OP3K 2OQJA 2ICES 5KUKA 4FCAA 4J3OC 3ZE1E 1JGEB 1G0XA 3CVHA 1L9NA 3SDYH 1G6RL 1CI3M 4WCYL 1WWCA 5SWZB 4ZZKA 1TPXC 1OPOA 4AM0Q 3TONA 4MSWA 1E3ZA 5IVZA 4NQCE 2Y9RT 1A6ZA 1Y7VA 2LGNA 1T21A 4HWEL 3SYQA 4IJTA 1EZSA 1T7XA 3BYTA 1PKOA 3H9SD 3OAZH 1U92A 3JVGA 4H5SA 4QF1A 5IKCA 1DSFL 1LD9A 4PG9B 2VXTL 3QNZA 1NA8A 3PLYA 3CAFA 3RGHA 3VW3H 3HAEB 3IJ7A 5HVHC 3DX2A 3BZ5A 3BN3B 5E9DA 1TIUA 4O02B 3KYNA 1MJ8L 3ARRA 5ESVA 1OZTG 5I17A 4HKBA 3ZKMC 5JO5B 2E9WA 5I8OH 5IK3B 1FGVH 1JZ3A 1X4YA 1ZHKA 4P5MB 5KVDL 1P1VA 4F7CB 1UB5B 2VDML 3KWXA 3QG7H 3VSTA 1HZKA 4Y8AA 1L9PA 3QUXD 2LQRA 1FLRL 4HS8H 1E3FA 1KG0A 4PRPA 3RDTD 4G1MB 3NABL 4Q9RH 4Y4FD 4TKWA 1OOWA 4KK9C 2YJQA 3AAZB 1HHKB 4FXKA 1BZDA 3OKDB 1NCUA 1H15A 3ROOB 3V55A 4CADB 3ULSB 4PB0H 3PPSA 1R75A 3B2MA 4L4TB 4KITB 4H20H 4RMTA 3UG4A 2D7OA 3SDCD 3GRWA 1YAIA 3CLEH 4PRHA 1M3JA 4NT6B 5A2AA 3BVWA 3G5YB 1YEFL 3C8KB 3Q2LA 4FYTA 3DHPA 3H6JA 3ILQD 4AK2A 4U1SB 4AI7A 1PZDA 2AERT 2DWXA 3DRQB 3L48A 3ELAT 2EDRA 1YSOA 3L54A 4FXGA 4NHCL 5HVHB 5TD4A 1IGFL 2EDKA 4XH2A 3KPPB 4AVIA 5JHDA 1UXLA 1GTFA 3LEVH 2AV1A 1T1WA 1EHKB 3NJNA 4V33A 4ZUUA 5HD8C 1X5AA 3FQXA 3G6DL 1KY6A 1WD9A 4FKHA 3IB4A 1TTAA 3M8OL 2FT7A 2HTKD 3DV6A 2CDGB 1P0SE 4UDTA 1YHPA 2O1AA 5T5FA 3TN0B 4G9FB 3RA7H 3J8F7 5GRJH 3L1FA 4W9FC 4QXUH 5CJXA 3UJJH 2F53E 4IIQB 4Y4HB 2Q5BA 3KGUA 2K9UA 2GBVA 4DIXA 1KTKE 2LOEA 2J8UF 2NXZC 3MLRL 3UDWC 4NNYB 3KYKH 5KZCD 1HAUA 5ANME 1P7QA 1P5UB 5F6IC 3RWJB 5E4EC 4JG0H 5D4QA 1JGVL 4FTDA 3APCA 3D06A 3G04A 4UIMB 1K8DA 2C7FA 5AW7B 1MH5B 4JRXB 1GHFL 1L3WA 5I18H 1ZVSB 3G04B 3GFUA 3WIAA 3WV0A 2CPUA 5D7JB 3AY4A 4BXVA 3FT2B 1AO7D 2DQDH 3F7VA 3MJ7A 3BVUA 4GBXA 2WUBL 3D2TA 3D8MA 4PJ7E 4TVPD 4U7SA 5CGYC 4F33B 3N42F 5ISZA 1PSKH 2A9DA 1IBDA 3ARFA 2HT2D 5DK2A 2IBZY 4TVPE 4X6FA 3GMPA 2YAEA 1DUZA 5DUBA 4AZ8B 1IEAA 5MERB 4JRXE 1JERA 5CLWA 2R1XA 3MU3A 3UCRA 3APNA 5EMYA 2NQCA 2V2XB 3MNZA 1ZT7A 2WXMA 4P57A 2CDGA 4P5TD 2DLTA 3FB6B 3NIFE 5G55A 4X6CF 2UZYB 2B08A 2ZTBA 3LQAH 3QQXA 3GEFA 1E5CA 3UZEA 1WF5A 2BP5M 5C08D 4H8WC 4HK3J 4HCRL 1CIDA 2EDJA 1DVUA 1I9RL 4FNUA 3WSQL 2NUPB 2FQEA 3REVB 1YEKH 4PTUA 4EMZA 3BZ4B 2OYLA 2EIZA 1IV8A 4LP4A 2HRHA 1WA0X 1JHLL 1NCAL 3QJVB 5DEFA 2AANA 3V0DA 4EJ1C 1KB5L 1EJOH 4HJJH 5GJTL 1N10A 1QSEB 3SGKA 5GRVL 4PRHB 1FNGA 1G7MB 1DVTA 1TYRA 3I6GB 4JG1H 4JPVH 3CXHK 2VXQH 5FHAL 2CRYA 1C7TA 4D9QD 4KXDA 4V1DE 1IGYA 1OIOA 3HE6B 2YLHA 2QHRH 3MRPB 1DBMH 3WD5L 1XF2B 5CSZB 5D93C 4FQCH 3CZEA 2K7PA 4U1JA 1SJEB 3O6FC 4N4YB 3EOTH 4YN3A 2X1WL 1TYEB 2QGEA 5CBEA 4IDJH 2OJEB 4Z3TA 1SXZA 2WXRA 3OXSA 3EKCA 2Y5TB 3TBWB 1G0DA 1QPXA 2D7QA 3JWOC 3FTXA 1BXAA 1DEEB 4P5SA 5E6YA 3UBXG 1KEGH 4MKMA 3GHEL 2WKOF 1O7DC 4DTGH 1Q94A 1G7JB 3HCVA 1RERA 5DD1L 3U4BL 4ZOBA 3QHZL 2XNAB 1WP6A 2F7RA 1LD9B 4W1TA 5JHLA 1GC1H 1U92B 4XXDA 5IKCB 5D2NB 1BM3L 5I1KH 5HPOA 5JPMA 2ZXCA 5E08L 3MXWL 3D25A 3DX8A 3SDAA 3MRBA 5IW6B 4PJ5E 3ARGC 2YQ2A 5IVZB 3MRIB 4KRMB 1FBIH 1W8NA 3BWUF 3NRFA 1QLEH 3NDZE 3BKYL 1WWBX 4J3WA 2VLJE 4QTFA 5ES4B 3V6ZA 3V0EA 1F90H 1DQIA 1M9WA 3QZOA 3Q6GL 3CFKB 4R6UA 2WQXA 3L9BA 3DK0A 4I13B 4JZNB 1NAMH 2MQ3A 1S7RA 1SLUA 4Y4KC 5TF1H 2NY5L 1JBJA 4WUUB 1D3CA 1MCLA 2C1PB 3I50L 1AD0B 3JV6B 4L1TA 1MNUL 3D3VA 3CX2A 4EQ3A 3COOA 4X5PA 4DKDC 2CR3A 1BOGA 2AW2A 3WLWC 3PQYB 5EEXA 4KNQA 4QXWA 3WDJA 3UTQA 4POZC 3S4SA 1QWUA 2AJVH 2OXGB 3QXDB 4M4RA 1S6NA 2CWRA 2P52A 2VISB 3SD5A 1EVTC 3PFUA 4Q7DA 4J6RL 5F6HI 1ZT1A 2JJTA 1EHLH 1IGIH 1HZHH 4JCMA 3KPPA 1FVEB 1NOFA 2UXFA 3B8SA 1ZY9A 1WUNT 1NIAA 1S5HB 3TLRA 5HYQA 1L3NA 1OD7A 4ODUB 3UTOA 1J0HA 1KTRL 5J8OA 4Q56A 4C4KO 4ZD3L 2GHWB 5LXVA 4DJMA 2K78A 3BJ91 4GBXD 3GSWB 1LE5B 1NUNB 2CBOA 1F86A 5FHBL 4AYBA 4XX1E 2QMKA 4K73A 3CN0A 1N64L 4D3CL 4NXSA 3KEDA 3AU1A 3AXLA 4FERA 2H8PB 3PGCA 1WBXB 4FGMA 2P5ED 2HKFH 2D0HA 3ETTA 1H15B 3FTYA 4FXKB 4HXAL 2C7UB 5LGJB 2VO5A 2IDCA 2MCPH 2RMNA 1FLTX 4KROC 5FKPB 1D5ZB 4HPHA 1OTSD 1K72A 1YN6A 3UZQB 1BQHA 4OLYH 4RBPK 3RVXC 4ZFZA 2HKHL 3K46A 1A8JH 4UDUB 4PU2A 4X7SH 1CLVA 1IQWH 4W9JC 3VGAB 4G6KL 3TH3T 4UT7H 1BAFH 4EI5D 4KO6A 1KJVA 3KL5A 1OGAE 2XIIA 2GTZB 2J1ZA 2WUCH 5INDA 5CSBA 1MLBA 3CN2A 4M43L 5L88L 2WXHA 1K85A 4PWGA 1KYUA 4M7ZC 4UM9A 5I71B 3KL3A 4MSWB 3ROLA 4DSYA 4WCYH 3ARBA 5HY9A 4LNVA 3RLSA 3ZKND 5I5RA 3K72B 4Y0GA 5DD3H 1G4MA 4OV5A 3E8VA 5H4YA 3TURA 1WK0A 4CW1A 4NUJB 5AKTA 4Z7QB 4CMMA 2F7QA 3FQNB 1PZCA 5BUAA 3B9KA 4U6VL 5MENB 3KPQA 2J6WA 5CUSL 1PLAA 5ANHA 1HEJC 4TUJB 2YD9A 4TL5A 5D2NE 4JVUA 5HI3D 3B3IB 2RB8A 1FZKB 1NCTA 2VXTH 3LPOA 5D7JC 5LGHL 4X0KB 1E5UI 2G60H 1SEBA 2FL5A 4BA0A 4CGUB 3D4ZA 1BJ1H 2WVVA 4N86A 1T04B 1VZGA 2ATKB 1CFSB 2YBRB 4EKJA 1DBJL 1ZPUA 4OLXH 1I75A 1WHOA 3IJHB 1MFDL 4UANA 4BWTA 5EEUA 4P2RB 4Y19D 2DIBA 1J9SA 1LWRA 1N5AA 4NRZB 1HEZA 1G1OA 3N91A 3NABH 4LQFL 3SYAA 4ANWA 4Y19E 3SOBH 5BO1H 4ZTPL 5E8OB 4HZ1A 1HSBA 4HS3A 4I48A 2MHAB 2CDFB 3HZVA 2JLLA 4LAJH 3NCEB 2APXA 4KZCA 4EOWH 3TTSA 4MMXB 3EOAB 4PJFF 2YEZB 4F9LA 1HHGA 2XG5A 3QAZB 1SEBB 2FEJA 1A7RL 4DFIA 4R7XA 3QIBD 5AVXB 3D9AH 4MAZA 2E7DA 1IGFH 4TSBH 4Y2DD 1YNTB 4O2FB 3VTMA 5AAWC 3RWEB 4KQ0A 3T4AB 1YEWA 2CZNA 2CD0A 1NCJA 4NUJA 3HE7C 3WFBL 4CW1B 4LASL 4IOSA 1AI1L 2A5UA 3HUJF 1IM3A 3JTBA 2YRBA 1A2YB 3OB0H 2HJFB 5ICYB 1KBGH 3CH8A 1OT2A 1TZGH 3QO0A 3LXBA 4PJ8B 5DK0A 5DT1H 1FWXA 3REWB 2WNXA 4JREC 3MLRH 3ZQ9A 3EOBA 1V5JA 5INDB 1E40A 2X2YA 3DYOA 3L5JA 4M62L 4JNXA 3IAPA 2CO6B 2KC0A 4WWOA 1H19A 2ERJB 2Z7ZA 2JXMA 5FYJE 3ARGB 4E9XA 4ZFFB 3DX0A 5EIIG 1U3HD 3CHPA 5LJYH 5TDNB 2CDEA 4PJ9B 3TJEL 5D2NC 1WAAF 4L37A 2FRGP 4NNXA 1GHFH 1IGJA 3L9YA 3OZLA 3PG2A 4PRIE 4O4YL 2K3TA 2PF6A 4JO4H 4K2UH 4WI4A 3VXQB 4K8RH 1U8KA 1JV2B 2ITCB 4ZO7A 1TKWA 1ZT4A 2LABA 4J3BA 1XAUA 1B4TA 2ZXQA 2C5DC 4OLUH 3B83A 4ZTEA 3SDAC 4Z7OE 1T80A 3L6FA 3QXVA 4JFEA 2W5PA 3NCFB 1SXBA 2ZONA 3H7BA 3X14B 1SBSH 3KYMA 3WN6A 3WIHL 3ZK0A 2CHWA 1GC1C 6CGTA 3O3BA 1U8CA 1RZJL 1UVQB 1ZPLA 4Y4FB 2C8NA 3KMDA 1JSYA 2X4PB 1AGDB 4GMTH 3LQAL 4NUGL 2BWQA 2F7PA 5DQDL 1DVZA 2EP6A 3UIYA 2PABA 4W93A 1FFTB 4TPRH 1A9BB 3PQYD 3MV7B 2X1XR 3G08B 3KWUA 3K74B 1RK1A 2MOGA 4PJIF 3BPCA 4M1CC 3ZQWA 4TULL 2VLRD 1JHLH 1NCAH 4HDIA 3GS7A 3HR5A 1PQZA 3E1ZA 4HUNB 5GJTH 3WO3B 5IWLA 2OXGA 4HP5A 5GS0L 4OZFA 1KOAA 3PV6A 1IVTA 1KYOK 1OE3A 5C6TH 4OJEH 3OX8B 4F7KA 4UT9H 2EIKB 2AKRB 4U1IB 4Z77A 4P2RE 3GB7A 3MJGX 3IJSA 4Q89A 3WD5H 3K6FA 4KDTA 1F4YL 3VXMD 3BUDA 1EDYA 1DZ0A 2QSCH 3O6LL 5I0YA 2F58H 5J1AB 3AITA 3GXDA 4IDJL 1MY5A 5C07D 3NP4A 4JM2C 1ID2A 2XN9D 4KUCD 1ZRUA 2ZSVA 4EDXA 1UXSA 4EBQH 4I3GA 4N2FA 3WELA 1WT5C 1YN7B 4O9HH 5JR1L 4GLRI 4QD2E 4DP6X 3FQUA 2DI7A 2YHGA 1KLGA 2GK0A 2VJ0A 5GGSY 4AYFA 4XP4L 1N0XL 2HRPL 3O3DB 3SDAB 3D25B 3DX8B 5B38B 4M6OL 1KCWA 4FFWD 4G8GA 4OZ4A 5CR8A 5I1KL 5E08H 3LV3A 3QJUB 3QZWG 2QSQA 5I0WA 1FJ1B 5GZOC 5DS1A 3FOLA 5HYJD 4GAJL 3MLPA 1U3HA 4P2OB 4JLRB 1OP5K 3HS0A 4IHBA 3WFCL 3EO9L 4LIQE 2W1NA 1EO8H 3EFDH 1AZUA 5D71L 4S1DC 1MCCA 3D48R 3DX9A 1P4BL 1X5KA 4JREB 4J3XA 4ENED 1KWKA 3HBPA 2NY3C 2FJSA 1E9OB 1QHQA 3DJRA 4TSCL 3IFOA 3MRKA 3BGAA 3RWGB 1E27B 4W81A 1VADB 1ULVA 5I1GH 3AREC 3SCMB 1ZS8A 1IKNA 4FS0A 4TLKA 4ZUWA 3UC2A 5A6LA 5FF6A 3DJSA 1IFHH 2OR7A 4YGVB 1C5BH 2ZXEB 5AW0B 3Q1SH 1TQCB 1ZANH 3B5HA 3W39B 4JHBA 1SDYA 1MQKL 4FFVD 7PCYA 1CG9B 5GGUB 1GW6A 5DU7A 1CI5A 2BVYA 4Y16C 3TX4A 1UKQA 3FZUD 4RFEB 3MRHA 1QLFA 2A83A 3O3AB 1UCBL 3IS1X 1K4CB 3OGCB 1I3RB 4YDNA 4ZW3A 4HU8A 2OYMA 2X6AA 3CDFA 1FP5A 2XKSA 5HDOA 1DVFC 5JYLA 5MEPB 4LSVL 5C0BA 3HA0A 4MNQA 1ORSA 4RLDA 4TNFA 3IK2A 1HOEA 1EAOA 2IGLA 4J4PA 5FUCE 1QSZA 3NA9L 4WEEA 3VFWA 4X6FB 1D7FA 1M2OA 2G2PA 2BH0A 1N7ML 1EBPA 2PXYA 3L4TA 4R8WL 3CFJA 3EH5B 4X4XB 3N2JA 3N85L 2X0VA 1P5VA 3QDMD 3V4PA 3F7VB 1A6AB 2ZCLH 3AS1A 4PY7A 1ZCRA 2P24A 3WLBA 4OCSH 4GP4B 1BA9A 1MJJA 2VLLB 1CDIA 1MH5A 4JRXA 2W59A 4CJ1A 3D2UD 1TLKA 1W6WA 2PTTB 1XH3A 3P69A 2OYPA 4G1EB 5AW1B 3EGDA 1AZZC 1IEHA 4KAQH 2FH6A 1NFKA 2R0LH 1P5UA 3UJIL 4ELMA 1UH2A 3TFKC 3ZN6A 2CJUL 4ZFOA 1NBYB 3AT8A 3QBTB 2YQGA 3HEIB 4M43H 1U4FA 4CSSA 3HE7A 3DPDA 4PRPE 4YBLC 5ID1A 4MX7A 2VRAA 3N1GC 4X4ZA 1S2EA 4YAQA 1JWUA 1NGYB 2UZPA 4KXCA 4QOKE 4X4ME 1FZJB 3RIAF 1Q0XH 2ICWB 4DQAA 3GMQA 1UJTA 3OJMB 5HHOA 4IJ3B 4HIEB 1FG2A 1P69B 1T1WB 2OW6A 2BCKA 3FRPG 3MYZA 4PP2A 4BH8B 4U6VH 4PJGF 5CUSH 2KERA 2EVHA 1S7QA 4PJXE 3GXUB 2AEPL 4XAWH 4L1LA 4B96A 4AVJA 4EVNA 5D72H 1Z3RA 3H55A 4V1DA 4WQOA 3VXMB 1ACZA 3O6KL 1CBVL 2OAAA 3VB8A 2QFPA 2YZ1A 3WI9A 1DBJH 3MLUH 4WW2B 5KSUB 4FQXC 2NY7L 4FQ2L 4WJG3 1NCBH 3QFDA 3ECWA 2HWZL 2H2SC 4YE0A 1I7RB 4X9HA 5C0JB 4FFTA 3IMTA 4FXKC 5B3NA 4L3FA 4X8XA 2WWOA 3W57A 1MI5B 5BO1L 1FGNH 4TLSA 4JKMA 1RV6X 3T8XB 1IC7H 5GGRA 5IUCA 3T0ED 5E6SB 5CBAB 1GPOL 4FLOA 4JN1L 3RG1C 4CU6A 2ZPKH 4B9CA 5DQJB 3OKLA 2DWDB 4JY5L 5DVLA 3UABA 5FGBA 3QIWB 3V4UH 2KL6A 2V3EA 2EDBA 1S7SA 1A7RH 3SDDA 5EULV 1EEZB 2ICCA 1X5LA 4NQDB 1GZQA 4PWHA 3D9AL 5EUOF 1HWHB 2WOBA 4HA1A 4ISVB 5HHPB 1BZ9B 2X44D 3GSOA 1WCQA 4UU9A 1DQKA 1R33A 4PJ7A 3V0JA 3JTTA 3ARZA 1E8YA 1AS8A 5D7HA 4F3FB 2VW7A 3ZPDA 3TIEA 4LLAA 3UEZA 4F15B 2JNZA 2TAAA 3KLHC 1AGFB 1R5VA 2E9IA 1VCBC 1L0XA 5GJSL 3RGVD 3ZT6A 3KM1A 5CJXC 3UO1H 2XT1B 2HG0A 1XGQB 3U0PA 1MJ7H 3LSOB 1PFOA 2PCFA 3ECQA 1FV1B 3PDDA 4GKZB 4TNVK 5I74B 3ZDXE 2F53B 5HPMB 1OM9A 4LSRH 1E2ZA 1D6VH 1N2RB 4IKKA 5E1QA 4LLQB 3CDCA 4PJ5B 5I73C 4RVBA 4ZDHB 1WSST 4P04A 1KGUA 2OKMA 8FABA 4Z0BH 1VCAA 3TZVA 3QXWA 3WDIA 2R59A 1GMEA 4JN2B 2AXHA 5PCYA 1ONQB 5BRQA 2Q7AA 3BP7A 3LKRB 2ZSWA 5FCUH 4AW7A 1NWOA 2MPVA 5FM5O 5C1MB 2AJZA 3RZCA 2XVGA 3IJYA 2IH3A 4P9HC 5HHOD 2CKNA 2R1YB 4LRIC 4WFHE 3DETD 4QRRE 3MR9A 1AS7A 3QNXB 5TDPA 3SDYL 5IB2A 1ZD6A 4ZX3A 4GSQA 1NDMA 2VLKB 2BNQB 2MOQA 3S2CA 1U41A 2VDLL 1SF3A 2BJML 3GWJA 3IDMA 3MUHL 1J48A 2AJ3A 2C3VA 5AVQB 5KSBB 4NM8H 2RH0A 4KHXL 1OO2A 5CEYA 1WLHA 2BVQA 1T5WB 4WO4A 3VFTA 4F93B 1XSJA 2UVEA 2Q3AA 3VW3L 5DQDH 1UM5H 4AIOA 1JTOA 4NSKA 5T3XE 4PI2A 1R0AH 1JAEA 2JCCB 3S5YA 4KI5C 3DX4A 4XVTH 3S36H 1IM9D 5D9SA 5D93B 4YPGB 5KSBE 2BZCA 2CE6A 3GKWL 1H3UA 4DZBB 3IJ9A 4BCXA 1OK8A 4TULH 5D8JH 5C0RH 2YS4A 3ZXAC 3QGVA 4F2FA 3P40A 3TYGH 4Q2ZB 4Y1TA 1NGXA 1FLRH 1M6UA 1UFGA 1HINH 3QUZC 1TTBA 4X98B 3WOVA 3S3CB 1QO3A 3PV7A 1ZS2A 3LH2H 2D73A 4BSWA 3ECBA 1KSRA 4FADA 4ZAKB 3RBSA 1F3RB 1JVKA 3DMMA 3HAEH 1DJWA 2AJ3B 3DMMD 4L29B 3ZDYE 1FFNA 2OMUA 4ZUTB 4OAWA 4GRWH 3GMNA 4JM4H 4HMEA 4A66A 3DURB 4QXTA 4PIRF 3O6LH 3V8OA 4F2MA 2EEXA 4TOYL 1KGJA 4PR5A 3FB5A 3ISWA 1J0ZA 1H3TA 3B3BA 1AD9B 3CVHH 1YA5A 4H25A 4IU2A 2IH3B 3TT1H 3S35X 4UV4L 1F3DH 2X1OA 2N56A 4NHCH 5ELIA 2P28B 3F7YB 1RFDH 3MA7B 4KRLB 4EBQL 5ACZA 1HDMB 2APVA 1Q9OA 2A73B 5IP4A 1T1YB 4RETB 1MG2C 4OT1L 3G6JB 3FC8A 3HUJA 4S1QH 2DPKA 1CFMA 1OB1A 2YPLD 1KXTA 3BWAA 2WCSA 4I9XA 2NW3B 3AQYA 4HIJB 3KPRB 2NY0D 5HHQB 2EUZA 4ZDHA 2GEEA 1OT4A 3KG5A 2XWZA 4H8UA 1PNCA 3ZYIA 2A6IA 5DS2A 2CPCA 1AIZA 2XTJE 4QXUL 2F8XC 4GAJH 3BAXA 3O6MH 1L0PA 4WDIB 1W2KT 1I9EA 3NN8B 3GNML 3KYKL 5HGDB 3ZT7A 1I7UB 1IAIL 3GI9L 3EFDL 4R90H 1R5VB 2AQRA 4HK0B 5I1JH 7PAZA 3VA2C 1XVSA 4YFEA 3OAYH 1R5IA 5HYFA 2NXZB 4NPYA 2UYLB 4P5KB 1QMUA 3QJHA 1U30A 5ILTH 2QVFB 2YAHA 4I87A 2Z31B 1RHFA 3ARWA 5AUMA 3SDXA 1X5YA 3FPXA 3NEXA 1JDAA 2WZ0A 3Q2WA 3OXRA 3TN0C 2O93L 5D1XD 5DHEA 1NEZG 2VMJA 2BNUA 2YGNA 3TZVD 3IWVA 4HISA 2A74B 4OF6A 4BFJA 1MAML 5KG9A 5TGBB 5DWUH 1HI6B 2KKQA 2Y4SA 4KKRA 4LEOA 4RMBA 3SHSA 5K1VA 2V5MA 4CMHC 2FAUA 2MCMA 3OJDB 2CRMA 5IBLD 4WIQA 3JWNG 1HYSD 1ZK5A 4NZRL 5EC1B 1SJXA 3KH4A 2DMHA 3FNKA 4GO9A 4HKZB 2HLAB 1DBBH 1II4E 3EUDA 4GRWF 4I3RL 1BYPA 1WH0A 3PAYA 3D2UA 1XGRA 4GUPB 3LRSB 1Q38A 1BVOA 3INUH 1S5IH 2WLIA 5SX5K 5FYKU 1LO2H 4MDIB 4HCRH 4JO2H 3R06B 3CBRA 3GO1H 3DLQR 3QISA 4PV8A 4BUQA 5FYKH 4G5ZL 2DM2A 2GYSA 2EYTA 1T2QL 3BP4B 4NRYA 3FTSA 4G6FB 4FQQB 1ZVHA 2AMGA 4JANA 5IFJB 3VI3F 3NA9H 3QVAA 3AMKA 2ZT9C 2XV3A 4U1LA 4JG1L 4KK8C 4MGXA 1VENA 1TJGH 2CBMA 2R23B 5FHAH 2QFRA 4PJDB 5C0CB 1ZWIB 2XN9A 5C0AB 2B4CC 3DV4B 1YRKA 5CD3A 1CB4A 2BRRH 2J8OA 3W3BA 1FG2B 3DOHA 4J28A 5ANMA 3UC0L 4D0DA 1TTFA 2EJ1A 4WI2A 5CEZD 4R0LA 3J7HA 5FGBC 1M53A 1PD0A 4EE2A 5EF3A 4NB7A 5CIPB 2ZX6A 3MOAH 3WN5A 3G3LA 5IB4A 4N2MA 4BFIA 1BIIA 3NPZB 1MG3C 3P9WB 1NOLA 2M2DA 4WWNA 1HXMA 1N3NA 2Y25A 3IE4A 3IU3A 4IGBC 2YN3A 5F0MB 3DO7A 1J8KA 3MBEC 4L4VA 4HUKB 5I23A 4WGKA 4M6ML 4X4MA 4TN9A 4AQAA 1YPZF 3SPVA 4L3CB 2EYSB 2EYRB 3HMXA 3AFLA 4FYRA 3UJTL 3DVFA 4K7PX 3VFVA 3WNIA 4F8LA 2VDPB 3E2HB 3JUZA 3U79A 2GTWA 1ZHLA 4A6YH 1QKZL 4L8BA 1JOIA 3MCKA 1HL4A 4KVPA 3CSBA 2AEPH 3ZSSA 1UFUA 2GI0A 2VR6A 4NO2A 1FPTL 3RIFF 2XFGB 2WXIA 4QYOB 2XY1A 3DVGB 1DTUA 2NTFA 2HT3D 3FU8A 1KIPB 3OGOE 3W56A 1JZFA 1WEJH 3K2KA 5C0BB 5IHLB 4ODVH 1HNYA 1A4KB 3PY9A 2IG2L 3PWVB 2NY1C 3OKMA 1DN2A 1PX3A 1R34A 32C2A 3KVDD 2YPVH 4MQSB 2W0PA 1R24B 3CMGA 1DDHA 1NBZB 2EUWA 4OFDA 1FVDB 3IGAB 4L8DB 2VQ4A 1ADQA 2DQMA 4JAMA 2WCPA 3WY4A 5DJ2A 3MRCB 3A47A 3MLTA 2WCGA 4JFEE 2B16A 1A0QL 2HTLC 2FIKA 1JZJA 2PCPA 4OB5H 1YZZA 5BZZA 1KXVA 4F5CE 3T71A 4K07A 1VEMA 2WWMC 3I02B 4P9HH 5BQ7A 2HFGL 5C07A 4EUPB 3OLGA 1N26A 2GJ6A 4UOJA 5J89A 2JJUA 3I75B 4YSCA 2VL5B 1KGCD 2VDQL 1AG0A 3QP3A 3LZPA 5EZJA 2A77L 3X13A 4K3GA 1I8MA 5JIDA 4KOCA 1XGTB 2DWYA 3BISA 3H9SA 5EBMA 5EG6C 5DMKB 4HWBA 3CFMA 3IU3B 2N7BA 3NCWA 1IAKB 3RWGA 4XCCH 3WUWG 2FT8A 5J1TC 3HRZA 5I8OL 2XJLA 1F2QA 1FGVL 3HC4L 1DN0A 4A7SA 4D3CH 3DX9B 4KTDL 3JTSA 2CLVB 5DTFB 2FYVA 3LN5B 4NQXA 1JPFA 2VDMH 4PP1C 3VXME 5L0QC 1ZE3H 4X7FC 3VFSB 1B3JA 2CM5A 2YC1B 5FW6A 1G6RB 3QQ4A 1FFPB 3HOGA 2B9BA 4HWZA 4WK2B 4CSZA 4N6QA 3SO5A 1MREL 2JMRA 1YO4A 2WKLA 4XN9A 1CICB 2F8OA 1CFTA 3PNRB 5IB1A 4PB0L 3TEXA 4MAYC 5GIRB 3CTTA 2Z1PA 4XO3A 5EFIB 4M3HA 2C34A 5A2IH 2XVBA 2HN7A 3GSNA 1AQMA 3B2PA 4G6KH 5LBSA 3KPLB 2XQYA 3K4ZA 4MJ5A 3W0WB 3O3DA 1AYOA 2OJZL 1QR1B 2EADA 3SJVD 1P4IH 1CXIA 4O02L 4YHYB 4EO5A 4NQEB 3W11D 5C2BH 4ZMTA 1RUPH 4Q58C 5JW4Q 2CBTA 2WO4A 5TH2B 3UG3A 2QQQA 3I6LE 3ULVL 1GTNA 3KPSD 1RZ8B 3FH7A 4PI0A 4XC1L 3G6DH 4OF8A 3AT9A 4A67A 2FIKB 3D2UB 2HP4A 3MACL 2QQKH 2ZP9A 3RA7L 2GAZB 2VDLH 2IWKA 4XO9A 2C9SA 5CZKA 2CLRB 4KHXH 1NGPH 2HAZA 3NDYE 3MUJA 2A6DA 2XI9A 4OLZH 2CO7B 4QT5B 3PWVA 3PP4L 1CQYA 4GT7A 4H26A 2EDLA 2G60L 3UGXA 3D85D 5IY5B 2QGBA 2V9UA 1YYLH 1JGVH 2AZUA 2J3SA 1M6OB 1DHKA 4BYHA 5E4OA 3ORJA 3VD2A 4IOSD 1WFOA 1ZGLA 3FTGB 4QHKI 3NUKA 1C08A 2B20A 4E42B 2DQDL 5EU4B 1MFCL 3VFVB 1AHWB 3NN8A 4KRPC 2I32A 4W4NA 4WEUD 1NGZA 3UG5A 3DX6B 4PRNA 4PJDF 4Z78B 3E9TA 3NBNA 4MLSA 5B8CC 1EBAA 1TCMA 1KC5H 5CHNA 2YAQA 1PLCA 1EFQA 4KK5D 4HAFA 3W9DA 2C1OA 4FEIA 2X4UA 2EH7H 4N2KA 3WS6C 4XCFH 1GIGL 1KBVA 3ABKB 1LEIB 1JL8A 4HIJA 4TL4A 3OF6D 3FQRA 4QRSA 1XF4A 1EUTA 1OSYA 2XACC 1DLHB 5JW4R 1M05B 5F9WC 6PCYA 1WT5A 4AEIL 1RZPA 4UV4H 1G7IA 1MFMA 2OP4L 3VFUA 2X4OB 3GBNL 4Y5VB 2IQ9L 3O3EB 3WSQH 5KYWB 3D0VB 4FQHA 2OYKA 1R5WB 1AD9A 1U8QB 4Z95L 1ODUA 4C8XA 4ZFFA 5KN5A 5CSGA 4JPVL 5GZOA 5GSVB 4NOBA 2FR4B 1XF1A 2YAOA 1A9EA 4XNMA 4BQBA 5IFJA 1TZGL 4WFGD 4GG6B 1A2YA 5B39B 4LL4A 4JFED 5F1NA 4F7TA 1N8ZA 4PV8B 1GL4B 1ESOA 3WAKA 1JJUA 1OSEA 2B7DT 2Z4QB 4MQ7B 3KJ6L 3MRJB 5E6ZA 1UXWB 4MD5A 1ZGLP 2VXVH 3T2NH 2FJHA 3WKQA 3MFFA 2P80D 4ATWA 3VXRD 4FQ1L 4WFEE 3JWNE 3HMWL 3D39D 4G43B 3BLPX 4MCZB 4NO5B 3P54A 3TJEH 3B5TA 3DSFL 5DC4B 1P84K 3C08H 5I2IA 1MJUL 3LD8C 1IKNC 5EHFA 3BZDA 4LIQL 4RAUA 3ZSTA 4CN4A 1UWGL 4M7KH 4XOAA 5ITFB 3CFEA 1X6NA 3TCTA 3ULUD 4XOCA 3RVVD 1DQLH 3GRWH 4WO4B 3GC3A 3B9KD 2EH8H 5KBPA 2AGJH 2I9TA 2QADB 4MNHA 4PCKA 1XIWC 1QSED 2BNUB 4TNEA 5DMJB 2QQLH 3GGWB 4BKLA 4KVCH 1PCSA 2EKSA 2ESVB 3CCHB 3T6QC 3VD4A 3BH9B 1MHPH 1NCCL 2VMCA 3HTLX 3IKKA 4N85A 1M1XA 4K55A 5E8EA 1INDH 3MR9B 3QNXA 5IB2B 4NUGH 1Y6KR 4ELME 1QW8A 4FE9A 1G9NC 2V5TA 3KLSA 4MB1A 2QELA 1RUMH 5CF3A 3Q6GH 4CKVX 1W91A 1XCXA 4JFOB 1I7TB 1HN1A 2VDPH 4KO5A 4M3KB 4MA8H 2X4NB 4POUB 4HV8A 5I1EH 1A6TB 3BUQA 4OM1L 5L9DH 2FL5B 4R2GD 3II2A 1IO4C 1JGLL 3BKCL 4K71B 3HB3B 4MVBD 2A6IB 5ADPL 4XOEA 5EORL 4P0DA 3RFZC 1SLVA 4PWFA 1XB8A 4UT9L 1NBVL 1U8PB 4K5MA 4XVJH 2BRRL 4NC0B 4R2GB 1SRDA 2PCFB 5HI5D 4GSDH 2NW2B 1DSYA 5HGBA 4FZEL 4NGHH 2R2BB 4J8QA 4MZIA 3FQTB 5TE7L 4HU2A 5ACZB 2F74B 3RKPA 5AAMA 3IMUA 4YQXH 3KYOA 5D4JA 5H2BB 3BPLB 3D1MC 4O2CB 1LDSA 2APTA 1CU4H 2I60H 4PJ7B 4YHLL 3GSOB 4LDEB 4MBOA 4UB0L 1YLBB 4TUKL 4I1RA 5IQMA 3BH9A 3DTUB 4HJTA 1V10A 4AUUA 4P3DA 3GMNB 2FBJH 4ALAC 4WTZA 4OLWL 2YQBA 1ERNA 3HW7A 1J1XH 1KJVB 1DJZA 5FUOH 3LPGA 2HKFL 2HRPH 1XGYH 2I9TB 4M6MH 3ECBB 1MZYA 2B77A 4QOKB 2BSDA 4J2QA 3FSAA 1T83A 4MXQD 3KLAA 4TVUA 3DX1A 5I75B 3D69A 4RX4D 2ZX9A 3BFWA 4HKXB 1JPSH 5J11C 4MQXC 2B59B 5E8NA 3VRLF 3KWWA 4OLYL 1AE6L 3SE6A 4XHJC 1CDUA 4P99A 3WFCH 1YEHL 4WHCA 2X4QB 4G11A 2FTAA 1F6FB 1IBBA 1MWAA 1LEKA 1BLIA 1BAFL 3Q13A 5D71H 5C0JA 1RH8A 1WC7A 2ZWNA 4P4KB 4AV0A 1HE7A 3MFFB 4XMTA 2E9JA 4R7DB 1ZIAA 3ZE0E 2WQSA 2NDGA 5IVXF 2P26A 1TLMA 1OVZA 4ODVL 3VRIA 4ZODA 2H1LM 1SQ2N 1Y0LB 3GMLB 2Z8WC 3TVMC 2ITDB 4AQ1C 2FX7H 2XWJB 3D85A 3PPEA 4GI9A 2NX5E 4V1DB 2F2HA 3CXDH 1D5MB 3ZL4H 4LAQH 1A9EB 4Z1PA 1KCVH 2PO6D 3QJZA 4U6TA 2FR4A 3V0HA 2QVIA 3FULA 1D5BB 1SVCP 1AJ7L 2BNQA 2APSA 5JUEH 1S7QB 3S3JA 4M5TA 3T8VA 5K69A 4QGTA 4DHLA 4OB5L 1IAIM 2VM4A 3FT1A 4UNVA 1BPLB 4L8SA 1INQA 3QXDA 4M4RB 4HLZH 4WHDA 4RGNB 1FNLA 2AJZB 2VDQH 3RZCB 2WBJC 3GHPA 3NZ8B 4WK0B 4YZFE 5H4ZA 4D2NA 4YAQB 3DXAA 1UCBH 3STLB 2VDOL 4ONFH 3MO1B 4OW6A 4WFGE 1IBHA 3CNKA 3SDCA 5IR1A 1YNKL 4HF5L 4DKAA 3HG1A 2X4UB 2DQUL 3HC4H 4GT0A 3RKDC 2X3BA 3QUYA 1YY9D 2JSFA 4EN3C 5SV3A 1ETB1 3ARUA 4LQFH 3G6JE 2NCEA 3K3QA 2W0FA 4WNQB 4E42A 5D7EA 3I84A 2V2TB 4LCUB 1EV2E 3V4PB 4YSPA 2NT0A 3MRBB 4L23A 5IW6A 4JDEA 5HHNB 4FG6C 1KCSL 2LFEA 4PB9L 1CURA 2JQAA 4M5YL 4ISVA 4OD1L 3FT3A 5AKRA 2H47C 3J07A 5C6PB 2J4WL 3X3GL 2EVIA 5B21A 4N8VA 5ETUA 1P4IL 5D7IE 1I8IB 4JQXC 5JDJA 2ADFH 4OR1A 1H9DA 1JV5A 2V3DA 4IKIA 3STBA 3UTSB 4KQ4H 3QCTL 4W9IC 5DGRA 1GOHA 2HFEB 1D5XA 1QRKA 4XC1H 4UZGA 4ZOAA 2OJEA 4FMVA 1FL5A 3SPIA 3WFBH 1O7DE 4XNUL 1CYWA 3ULVC 5BJTA 2VLMD 1Z7JA 3DUUA 3T3PE 1S9YA 2IJ0C 4ZX5A 1XF2A 3GSVB 3QRBA 5T1LD 3S37X 3T09A 4I2XA 3UYRH 3GSNL 3VDCA 5IMMA 3ZOAA 2KQMA 4UI2A 4OLZL 1NUFA 5JW4N 2YXFA 3ATAA 3TNMB 1I1RA 3MUUA 5DEGA 3X12B 4IRSB 5T3ZH 4XAWL 5PAZA 2VJXA 2EO1A 3ASNB 5ERWA 1GYUA 3BIAX 5DEFB 5BRPA 3C09C 4FD0A 4MAUH 3LNFA 3RVUC 3QZPA 1E9OA 4LARH 3MLUL 3QS3A 1GCYA 3I3DA 2EILB 3EYVA 2J8UE 4LCIH 4PJ6A 4FQ2H 1KTDA 4O4YH 4LT7A 3RVTD 4G6AC 1Y07A 5DZPA 5IQOA 2ZKYA 5DO2C 3LYRA 1B4LA 5HJBA 3GMQB 2CAKA 3WIFA 3HS0B 2HH0H 4Y9FA 5J3HD 2PW2B 3D39A 2JVUA 5GS0C 1ZE3C 2FEEL 3D52A 4Q6IA 5MHSE 4PH8A 5JDSB 1L0YA 2EH7L 5GSRA 2ZPKL 4JBSA 3CX5J 2XBTA 1T89C 4PD4J 3L2LA 4JY5H 2QLYA 3KAAA 3OB0K 4AYFB 5LDUA 4BH7A 3AVEA 4HIIA 4E0RB 1NC4A 4TPRL 1TSHA 4WW1B 1CR9L 1MRCH 2WLMA 4MLIA 3KDMA 3ZE1F 2R51A 4LL9A 2GJ6B 5AL8A 4ZMVA 5C97A 2MH4A 1CIUA 1T4KA 2JFCA 3WLBB 5DA0B 1OP4A 4JFDB 4E9QA 2J5LB 4OQ1A 2YPKA 4KRNA 5GJSH 4OJAA 5I9QC 4S11A 4TF4A 2IDQA 4CC0A 5LXGH 5GS1A 1RHHA 5C6TL 1J5OH 3MDJA 1OAKH 2DH2A 4LKXB 3ZMNA 3FONB 1ORSB 2Y7NA 4MNQB 2F7OA 2O6DA 1ZSDB 2HVBA 3LX9A 1G84A 4G9FA 1QFUH 3BQUD 1A4KA 4TRPL 5I1HL 5F7DA 2ZYRA 2L7EA 3KJ6H 3QNFA 1PQZB 2YMTA 4HCFA 5KS9E 2R2HB 1M2VA 3M1CA 2UZXB 3SKOB 3WHXB 2WLLA 4QYOA 1FO0B 4WHYH 1M7IA 3L7EA 3C08L 4FXGB 3UROR 3NVQA 1UOWA 5KJRL 3WMPA 5IBTH 5HJ3B 4R4NC 1MLCA 1S7TA 4FA6A 2AJXL 2YMXL 1BWMA 4NJ9L 5T5FL 3TT3H 3TBTB 3P2DA 4NYLA 4XMWA 3LNHA 2EYSA 4FNRA 4MNGA 4M6OH 4BQ9A 4U3SA 4JEGB 4DO6A 4I89A 5TDOB 3BCFA 2GFBB 5F7BA 3U46B 3OB8A 5DSCB 5F7WC 1VKXB 3SCMA 1S7XB 1HXYB 2I25N 1MHCB 4FFYL 3FT4B 5E6IB 2WLHA 1MHPL 3EO9H 4OU3A 4XBPA 3VAEA 1NFIB 4Q0XH 1INDL 1MCBA 3A21A 5I19H 1B9ZA 3AS2A 4IBZA 4ACTA 4YXHL 2LAAA 2OA9A 3BHBB 3NP3A 4XVTL 4Z7QF 3EYQC 5CCJA 1IL1B 4L37B 4NPKA 3JVFC 2WOYA 1DQDH 3O4LB 4XN7A 4D0DB 4KZDH 3L3HB 4P2OA 1N6QL 3MRLA 3T2PA 4OM1H 3BGFC 5DD6B 3TYGL 4ZXBA 1H5BC 1JGLH 4WJ5A 5DVPA 3BAEH 3FN3A 2UX6A 2FJFB 4QYAA 1K4DA 3GMRB 3GMMB 4AQZA 1Q4NX 3VU2A 1LEGB 2D0FA 5CAYB 1BYOA 1KTBA 3LH2L 1GVIA 5DK0B 2G75B 4YS4A 2EXYD 4JANB 4NKQB 3KPOA 3N6YA 2OMYB 4C55A 4WWKD 3JXAA 2CHNA 1I1AD 4JM4L 5TE7H 3LPFA 2W8CA 1HX0A 3ZVVA 5LCVH 2W65A 4YGAB 4YQXL 2VMDA 1JF6A 1BG9A 3BESR 4TOYH 1IGTA 3CVBA 1I7ZA 2Z8SA 5CJQH 4C54A 3VU1A 1JZEA 2DI9A 4YHLH 5CS7A 2UXGA 1E9PA 1N5YL 4HEPA 2HYMA 1VFUA 1BD2A 4N5UA 4K15A 4YC2C 5C2UB 3U48A 3V9EA 5GGTL 4F7EB 3N1PC 4S1QL 5JQIB 3DJ9A 2UUDK 4Q8BA 1SJHA 3VNYA 3TC9A 3VI4F 2CHXA 3MN8A 1MZZA 2GABA 3PYCA 2GY5A 5IGXH 2WVTA 2ZCLL 3MJWA 4NLHA 4PRIB 4X5XB 3QQ3A 1UOLA 1AE6H 3V4LA 2F19H 4OCSL 4D9LH 4JMNA 2IAND 1J86A 5KVEE 4P5TA 4IEFB 3RTQD 2LT9A 3TYFB 1DBAL 2UYLA 2I27N 2VZTA 4IKNA 3BIBX 4LVNC 5I1JL 4J1UB 4KAQL 1RPKA 1QASA 4LVHC 3LVTA 5EZPA 2Y7OA 1RZGB 3FSOA 1QRNA 3CIQA 1AGDA 4RMQA 2FECL 5DFVD 2QL1A 2WO2B 1FYTE 4JHAL 3STZA 4APQD 5D7LA 2Y7MA 3FCSA 2PP9A 2PYED 1TT6A 1KCVL 4LCCA 4WKXA 4X5RA 1ZHBA 1YY8B 4JFFD 1WBZB 1EEYB 4JFEB 1UT9A 1LMIA 4KHTL 2KZKA 1AOHA 4JFFE 3QRFM 3P30H 5IMKB 2RD0A 1CICD 4LB8A 2FHFA 1ZXKA 5E1HB 4X6CA 1MCPL 4U1KB 3TXAA 1UB6A 3BVVA 3QZWA 2BOCB 5DMIH 2VWEC 5JPMC 2AXWA 4JFYA 2XV0A 3KCWA 2P3YA 3LIZL 5IQ7H 1JZHA 3O6KH 1CBVH 4NKMA 3C6LA 2UZIH 3E6HB 3L5HA 4AYEC 1U8JA 3PNWB 2DQUH 2GT9A 3QJXA 2Q1EA 5J6GA 4XXCC 2OMUB 4NKMB 1NAMA 4OD2B 4ZUTA 1T2QH 2I07B 4I1NB 4FQJH 3T0AA 1WFJA 5FO7B 5AYUH 3MBXL 1O6VA 4QRQB 3QZWB 2CH8A 2H2PD 2V8LA 4BDVA 1FZMB 4ZFZB 1LDPL 4Q6IC 1KCBA 1U8OA 5E23A 2DQCH 3S48A 4P9ML 1E0OB 4XNYH 4P07A 2IFFH 5IMKA 3EH4B 4F57L 4P46C 4PJEB 1QWNA 1D5ZA 1R3JA 1GPOH 4JN1H 5FKPA 1KCSH 1RVFH 3ILPB 3PAZA 4HK3N 3CIAA 4KO9A 1TFPA 5D9SB 3QJSB 2QADD 3SGJC 3O6FA 5E6ID 3NIDB 3QWOA 2XC8A 4LHUB 2AI0L 1GOFA 2NX5D 4A1RA 3EOAA 4TSAH 3GSWA 5AAPA 4KQ4L 4DOHB 4KY2A 1T0NA 2VKXA 1UWEH 4LP8A 1GKEA 4TQIA 1G0YR 2MHAA 4M00A 2EIBA 2VABB 3SY0B 5HYQB 3QYNA 1HHHB 4H0IA 3GM0A 4IEFA 1MAKA 3JV4B 2YAMA 5ALBH 3WKMH 4X50A 5IMLB 5BS0E 1KV3A 3AM8A 3UYRL 5BV7H 4H1LA 1NC2D 5F0LB 4XPHL 1BFOA 4K5PA 2N7SA 3UTQB 4AGQA 5CILL 3HLAA 1E4JA 4A38A 2EC8A 4FLRA 2Q7YB 3B4NA 4F80A 4KKLD 2WGXA 1FRGH 3D3VB 1KPVA 1HJBC 3EJCA 1S7VA 1W8EA 2FUTA 2ZAHA 4GAYB 5DYOB 1WEJL 5F97E 2B3RA 1E67A 3IDYB 2PMZA 4N1CA 4P4RA 4BBWA 3IXTB 4YPJA 2IG2H 1YVLA 3K6OA 3CFKA 4KX8A 4MCYA 4R3SB 2OL3H 2OW7A 5F1SA 3VXUA 4C56A 1GH7A 3DHMA 3DVNB 3OAUH 2IQAB 3LZFL 3QDGA 5HYSB 3LQAC 4HOMA 4P23A 2PP8A 3GSQA 4XXWA 4AKQA 3PHAA 2HH0L 3ARBB 4H8WH 5HY9B 2GUYA 2WWKO 5ESAA 3MRIA 4AW4A 2I26N 3TA3C 4MA7H 4XPBH 4EF3A 3KPOB 2BIIA 4F3FA 3CVIL 1QATA 2IGFL 1H8LA 5AB9A 1V8HA 2VAJA 4Z7OF 3VVWA 2YEVB 2AQ2A 5AOZA 1CVRA 1U36A 4YH6A 4EZMA 1UM5L 3IJEB 3NK4A 1Q94B 4DERA 3CMOL 4XP6L 1TG8A 4M3JA 2IPUG 3NIFB 3APFA 3S36L 5DQJA 3HB3D 1AHMA 1CR9H 1Z5HA 3MODL 3BDBA 2CUMA 3LKOA 2XIBA 3MRMB 3V5DB 1NL0H 3FO2A 4NI6A 5D8JL 4S0SD 5C0RL 1QFHA 5CM1A 1G4RA 4WV1A 3ZBMA 4PRAA 2D9CA 2Y2TA 2LLLA 3OZ9L 1UYWH 1DJHA 1FL6B 2VITA 3P4OB 4N9GA 1QSFB 4FLHA 1IEBB 1MCOH 2RBLA 1HINL 1NFIA 4BSJA 4BFKA 2EDDA 4KKNA 5LXGL 2EE9A 3TBSA 3JYCA 1J5OL 2JKSA 5LGJA 2R1WB 3WJMB 2XWRA 3EJTA 1BQSA 5K9JH 5AVZB 2EE3A 4WZ9A 2MRYA 1NSNH 2JK5A 5D2LB 3FU9A 1UWXK 1B6DA 3QXAA 3KVQA 1JWSA 3G5WA 2ZNWA 5T3ZE 5F9JA 1MCKA 2R0ZH 3L3OB 3NCJH 1NINA 2DWSA 5CJOL 1GSKA 1GMIA 3VI3E 3ATBA 5CD5C 5HJ3A 3UBGA 3F2LA 2DEWX 3EJPA 3IETA 3CN3A 5T8IA 2X4TB 1HXKA 3KBEA 3Q48A 4UOQA 4AVHA 2GHZA 1FFQA 1TVBA 2WSPA 3GSUB 3VM7A 3PP3K 4AOFA 1WHPA 3BX7C 1HOCB 2KH2B 1HKLH 3ISYA 4O58H 4YXLH 2DL2A 2WP3O 5F7DB 1ZK9A 2DYPA 2EIMB 3II3A 1FG9C 3PQYA 2ZF8A 3B2UC 3ARBC 2GJ6E 1LHZA 3B34A 4YSUA 1PPIA 5J13B 3UBXB 2EDNA 2YRLA 3LZLA 1E8WA 5DMGC 1EJ8A 1FDLH 2G2RB 4FFYH 1N59B 4XVSH 1UUNA 1P4UA 4N68A 4HUCA 3DBSA 3F85A 4LSPH 2A9MH 4Z76A 1GGYA 1IAIH 3GI9H 4HUWB 3E3QE 4ELMB 4L05A 1NC4D 5D7JA 1D6EB 2NY2C 4G1EA 4RGMB 2H7WA 2CCWA 3QHFL 5AVTB 4AJWA 2QKIB 1KCRL 4KZDL 3B1TA 5MEOA 4WHYG 1TNNA 4JFZL 5JPNB 2EDXA 3ASWA 3U4AA 4Z76B 3QI9B 5CZXC 2Q87A 1CGYA 2OZ4L 5E1IA 3CBKB 2GVYA 1W0VA 5C0FB 1EXHA 4WW2F 5GRYA 4GQ9H 4UYPA 5I16A 1P1ZA 1U58A 3S3SA 3BRGC 1AKJA 4G8GD 1FAIL 4GFTB 1DBBL 4X83A 1GIGH 3LNGA 1MF2L 5KBKA 3BPOB 4U1MB 5GGTA 4JKWA 3FFCE 3C6LC 4XTRC 1RZ7H 2FYYB 1VLXA 1OGAD 4JO2L 2B1OA 3BUBA 4AEIH 4HWUA 4LLVB 4FTVB 1SJEA 2MIZA 2ZCHH 3ZDXB 5I8KH 4HFWB 3DRQA 4G5ZH 2J2ZA 3MLYH 1LO3L 4Z95H 2BMKB 2R9HD 3Q8EA 4TQHA 2WXJA 3O0LA 2X05A 3SKJH 4P23D 4OCRH 1EAPA 1G9MC 1S4IA 1JFHA 1JWSB 1HZLA 3GBMH 1T6WA 4WUUD 5JXED 3NCYP 1KELH 1FNGB 1G7MA 3IJ8A 4NO3B 3VGBA 3JZ7A 3H1ZA 3PHSA 4UAHA 3R4RA 1QG3A 2G0KA 3GSVA 4OFPA 4NUMA 3VSQA 4UTAA 4G1MA 1JPEA 2VW4A 3SGJA 1IEBA 2R2CA 2Y06L 4A2EA 3ZTJH 4WTXA 4IRSD 3ILDA 1MVYA 1FL5B 3PRZA 2MMXA 2X7LA 4F7CA 4CDGC 3GDCA 5J12B 3V5DA 3MRMA 3VTAA 4PGDA 3DSFH 3DUHA 3OAZK 3BUPA 1MJUH 1WAEA 2F54A 4JFQB 5HYJE 2GEQA 4JO1H 4Y5VC 3HZMB 1T20B 5EOCJ 5ETUB 4OZIE 1QTYT 2E47A 5LG6A 1FYHB 1IEAB 1U6AH 3TBYA 4DUXA 1P1ZB 4PG9A 3FTWA 2OMBA 2Q3ZA 1RZKL 4UT9A 4QR7A 2EXWC 5ISZB 3PGDB 3TTYA 1YECH 2X6MA 3FUJA 3FCGA 4RCAA 1HAWA 2BSRA 3PWNB 4MJID 2Q8AL 4XHQA 4HIPA 3C60A 3MVSA 4N2NA 2F54E 2ORBL 5E0QA 5SWZA 2WXPA 4ZTOH 3TO4D 1NCCH 3K0WA 4PRDB 4ELKA 4X6BB 2CIKB 5DMIL 4P23B 1BBDH 3QNYB 3R1GL 5C0AD 2IFGA 4NQSB 1PDKA 2PW1A 3CFDA 3LIZH 1D6EA 3OHMB 4XWOC 1IGMH 1CN4A 4NENA 4CAGA 3HPJB 5FS5A 5LBGA 2CXKA 3T4YB 3BGMB 4XMKH 3T0XA 4CVZB 2WD0A 3IJSB 5BRZE 2WIIB 4ETYA 5AYUL 3AG3B 4JFDD 3S37L 2NZ9C 5DRNB 1PZ3A 3IMBA 1K9TA 2EE0A 2GK2A 3F00A 1PX8A 2ZX5A 3PV6B 3QXTA 4UZUA 4NN5C 3POCA 4JFDE 3ZMRA 2WLNA 3SJVE 5BXFA 1BXXA 1ZEAH 3MNDA 1MPAL 3RE0A 4LBEA 1HYRC 3B7RL 1LYQA 3H53A 3IN0A 3K8MA 2LLNA 2X4TA 3VTTA 2X09A 3CV5A 3VI4E 4UOZA 2A77H 1S7WB 1X9UA 2PPDA 3NFNA 1G1KA 2B3IA 4WKZA 4HPYH 5C0GA 4Z6AT 2X4PA 1B2WH 2ITDA 5J12C 2QVKA 3RVXD 1OTTC 5JOEA 4WV1C 1G7HA 3O45B 3OMIB 4NOFA 2JB5L 1UWEL 4LHUA 1MXDA 4FNLH 1SMDA 1F6AA 5FB8A 5AW5B 2DY2A 4KTDH 3V0GA 2NYKA 1XDTT 5FUOL 3ULSA 4X0NA 5DRZB 2E5EA 3WJMA 5FC9A 4YX2H 3N43B 1OP9A 3ILPA 3BPOC 2DLFL 5C8JA 1OF0A 4XO4A 2CKBA 3BVTA 5CLYA 3D50A 4RWYH 2VITB 3HLKA 2MTPA 3NJLA 3FW6A 3NSDA 3EDDA 1SHSA 1J88A 1KGCE 3LKOB 1XEUA 3HAEG 1UGNA 5AQ0A 3G5ZB 1CYXA 4QRQA 1BM7A 5AAWA 3J2PA 3A6BH 3L3IB 4IMKA 2V7NA 1SDAB 2Y6TE 3N1FC 4E2OA 5K1NA 2IH1A 3QQ9C 5HHME 4HG4K 5J6GB 2A99A 2AJSH 5EU5A 2IPTL 2J7LA 4K7PY 4QF1B 2P1YA 4HIQA 3RUGB 3BQUB 1QFWH 1PIGA 1KF9B 1XL4A 4D9RD 3GS4A 4L9LA 4O2CA 4EI6A 2DEXX 4PJ8D 3CXDL 1LILA 3FN0L 3FQ4A 3OKYA 1G87A 1EGJA 1HVXA 3ESOA 3NIDE 4U1NA 3MROA 1AJ7H 4ZS6C 2WBXA 1G94A 5ESAB 4B9GA 3WE1A 2DWEA 1CUOA 3MACH 4ERSH 3NJJA 2R2BA 1JFQL 3BGFB 2ZYSA 3W0WD 5CKAA 2OZNA 3QDGB 2IGFH 4OLEA 2XWDA 1NGPL 3IDGA 4JUTA 4MJJA 1OWRM 1H0DB 4NFDA 1AACA 1FSKC 1ADQL 1DSFH 4YJZL 4YDKH 2E59A 2BDNH 4POYA 3F7PC 1UKTA 1YYLL 4N0UE 1KPVB 2CIIA 3HS9A 4YLQT 3RYMA 3S35L 4GUOA 3QIUD 1UOVA 3WNMA 2XQYG 1XGZA 1YNKH 2X4RB 2HLFD 4Q9BA 2BWIA 1RJZA 4NC2B 4G3YH 2Q2EB 1XF3B 1QNZL 5GHWL 3O9WD 5E1AB 1A3LH 3Q5TA 5DRWA 3MZTA 3ZW3A 4LF3A 2MCAA 1F4XH 1FNHA 3QIUB 2OI9C 2EDHA 4GS7B 2NXYC 4HS8L 4B95C 4CDHA 1WFIA 4RRPM 3QIBC 4OIIH 1AQDA 4G7RB 3B7TA 1L9SA 4UM9D 1KC5L 1U0QA 2YXVA 1KT2A 2OJ1A 5I1AA 4L18A 1ODAA 1Q0EA 4MNHB 1PMYA 3O8XD 2JJSC 1PKQB 3VNZA 3LZNA 4RZCA 5IW3A 5EIIA 4JFFB 1KTLA 5I28A 5J7CC 4JDZB 1EUUA 4ZMZA 4F27A 1X3DA 3FXIC 2VM3A 2G3XA 2WVVB 1U2CA 1YEFH 1GS7A 3DO4A 5KYUA 5CJOH 4PJAA 3BZFA 4DNLA 4IU3A 3DVIA 1KXQA 2H45A 4FMFA 4NERA 1IM3D 5JW4M 3MBEB 1OM3L 2G4EA 4C4UA 5DJAB 4UQBA 1SN0A 2OP4H 3CZJA 2ZG3A 1NWPA 5FV1L 4S10A 4DP7X 1B90A 2BC4B 3EJRA 3MLZL 5JHDD 2NY6C 3GBEA 4IOFD 4O58L 1IC4H 3NEOA 4UAOC 1LO0L 4JR9L 4NN6B 3UJJL 5BVJB 3GSNH 3MRQB 5AFAA 4IRJA 5KUMA 2G75A 1KYAA 4OKVA 1RIUH 5DJ6B 5MENE 5T1DL 3D34A 2BXYA 3L9EA 1ZLWK 5IEHB 4LSPL 2A9ML 1QWHA 3FRPB 4FABL 2RALA 1YNLL 1E65A 4N90E 2PYEE 3T2NL 2BPBA 3F5WB 5J1SC 4IKJA 3KCPB 2Q10A 4FQ1H 2WTOA 1LXMA 5FYLL 3O4LA 1IARB 1PCXA 3P9LA 2YD6A 1KCRH 1QFWM 1MCRA 4LSSH 2N01B 4BFBD 3NCXA 4LIQH 3IGLA 2WQRA 1MFEH 1XV8A 3VD9A 1TTCA 1UWGH 4M7KL 4MZ2A 4ORGA 3UZQA 2HFFA 4DP4X 3K91A 4TUOB 3BP5B 2OZ4H 2X12A 4QHMB 2BINA 3L9RA 5E6IA 1OSZB 1L4IA 4WGVB 5HI4C 4MWFA 3EO0B 2IWFA 4YHOL 5FGCB 3ZJAA 4DFHA 4AQ8A 4NKDB 3DRTA 1UH3A 5DSCA 2ZOOA 3AY2A 5D7IA 3TPUA 3L3JA 4L4TE 1FAIH 4LLMB 3PHQB 2E7HA 2BNRB 3NYKA 1OGAA 3EAKA 2OX5B 2XZAL 4NYLB 1OAYL 1F97A 3GIZL 3UTTB 2UWEA 4OTXL 1DQQB 1RZ7L 4BK8A 2AS5M 4C83A 2VKWA 5EWIH 3BJLA 4NWTL 1YEKL 3LPPA 1ZGLM 4GUCA 4Z0XB 1K5WA 5B1BB 1HEHC 4K7PL 4N9OB 3SKOA 3WHXA 1KB5H 2J21A 2VISA 5AW8B 4AQOA 4EIGB 4UUJB 1K6QH 1RULL 3KR3L 2QVMA 3ZZQA 4G80B 3N0AA 5ADPH 4MD4B 5GRUL 1WISA 2Q6WB 4XMUA 5GRVK 4J8RA 2A6DB 5ALCH 2CLZA 4XVJL 4XNQA 4GMSL 4LKXA 3KZ8A 1NPJA 2WINA 4GSDL 1S7RB 3CGTA 4OZGE 3NIGE 4K23L 4KJWC 4LNRA 4NENB 1URZA 1E9PB 1H8SA 3C5JA 4GAGH 4JFDA 2J88H 4EEEA 5T3XH 5KYXA 3IMVA 4X9GA 2JTDA 1PDKB 3CFDB 4DKTA 4NQSA 4DVRL 2I60L 2FCBA 2YRZA 5FXCH 5BOPA 1UZ6F 1KEGL 3KW7A 4UB0H 3NJGA 1E7VA 4M7LL 4OCYL 3UPCA 2XTJD 4DGUA 2WM0A 3C60B 3LS5H 3F8UB 2ICEB 4OLWH 4DTGL 3ZKMD 1NC4B 9PCYA 1SFDA 1FORH 2Y7QA 3KL0A 4PFEA 1MCNA 5EU3B 5L8LB 3VXTA 1SMAA 1MFUA 3ES6B 4D7PA 5FDWB 3CDYA 4IBLT 3D0LA 1XSKA 4X5WB 1QTPA 2YXWA 3NZHL 2R15A 3E7JA 3C60D 3MXWH 4PCYA 4QRBA 2G9HA 4RDQG 4RDBA 3W9EA 3KPTA 1XEDA 1YECL 4OFKA 3L17A 1JPSL 5DD6A 4NUPA 3MV8B 2NYYC 3D39B 4PJ5D 1IIIA 2XPGA 3JWOL 5CN1A 3D09A 2RQ8A 3S7GA 3IDUA 5GS3A 1QLEL 1EK3A 3ALWA 4AXWB 5IHZB 3BKYH 2VR3A 4Q0XL 4GSUA 1Z5YD 4ODXB 2YA1A 3R1GH 2E86A 3CC5B 2YGVA 2XXFA 1JPFB 4YXHH 2XBDA 1A4CA 5K59F 3L4UA 3C6SB 4G2AA 5F9AC 2C3WA 2KMWA 4U1JB 4L4JA 3KDPB 2NX5B 3BQVA 1UHVA 2C9AA 2YO3A 4KRPB 4P4KC 5AWNL 4NN6C 2WPGA 1PZ5B 2JE8A 2FX7L 2ADJA 1CDYA 3I50H 1N6QH 2BP8A 1S7XA 4ZO8A 5EC2A 4YLCA 5DJYA 5ERWB 3IKCB 3ATFA 3KPNA 3MCG1 3BAEL 3NQKA 4UQAA 1OLLA 1I4FB 1EAJA 1MCWM 4NO3A 3S37H 1H6EA 2GFBA 3QR2A 4X6EB 5J11B 1J1OL 3IU4H 2HTKC 3FH8A 4GYBA 1T0MB 2FWOB 4Z7UA 3TL5A 2UV3A 3QWRA 5JQ6H 3F3HA 4PJEE 1DJGA 2W80C 1IGIL 2CBPA 1K2DA 1EJ6A 2OCJA 1AFVH 4LLVA 5I5IA 1JS4A 3L7EB 1RK0B 1U8LB 4Y9GA 5EU6E 5BUGA 4YXKH 3ULVE 5CJQL 2VDOH 4URTB 4FYSA 3DPBB 1SF5A 3E1F1 5A16B 3QI9D 1B2WL 1VJSA 4B97A 1A65A 1ZT7B 5FHBH 3LRLA 3LHAA 3DBXA 3ZO0A 3WE6A 2GI7A 1FVCB 2BOBB 2JB5H 3OKKA 4B3EA 4LHUG 1R9FA 1ZSDA 4PYHA 1FNSL 5L2JA 4N0UA 3L2MA 4W6YB 1KNOB 3LHPL 3C5SB 3QR0A 5CGYD 4ZO6A 5I82A 4Z9KB 5HDQL 3WY3A 3GXTA 1Q9WB 3IE9A 4RWHA 4QY8A 4NO0D 4F33A 5KOMC 2PO6B 2HT2C 5DQ9B 1AO7B 4HGMA 5CNHA 2K3HA 1DJYA 4GB9A 4B3VA 4MHHI 1NFDB 4L3CA 4Z18A 4X7SL 5AVVB 2DM3A 2QKIA 3VGGA 3BPNB 3LOWA 2ICWI 3LEYL 4FQPA 4UT7L 1GGTA 3QXUA 1BQKA 2E6PA 3TA3B 3PP3H 2VLKD 3IRCA 1FSKB 1G1CA 1MVFA 2HT4C 2P5EA 3MV8D 3DO3A 2IPTH 4HC1A 4G7QB 4P05A 1N59A 2WYTA 1SEQL 1QA9A 2GW5A 4QAMB 4U1GC 4JHAH 2VZ3A 5JDSA 1CGWA 2WXKA 3FN0H 1XR8B 2AK4B 5CIPA 3RFZB 3GEWB 3MGTB 3ARQA 4XCYB 2WYIA 1F1GA 4HSCX 4M5ZL 4ERSL 4APQA 5FK9B 3ETSA 4KHTH 5ANMB 1CLCA 5E24E 3I85A 3Q8CA 2Y1YA 1CD0A 3TBCA 1U93B 3BI9X 1WQVT 2H9GA 2P8PB 3UACA 5ABDE 1ADQH 4F37F 4YDKL 3IETB 2A6KA 4ZFGH 5LGHH 3CZGA 3TASA 2FNWA 2YAPA 4LOVA 5CEXA 2B8OT 1E90A 2NNAB 2YD0A 4G8IB 4ABUA 3S35H 5HVWA 3HZKA 4MAUL 3UEQA 5LDSA 4I0PD 4NRXB 3GMLA 4ZRGA 3T0EC 1MFDH 5AD0A 2VC2H 5GHWH 1QNZH 1Z9MA 1TFHA 3HHSA 4UIKL 1A3LL 3N42B 4QJ3B 4Y2OB 4Y7MA 5D2LA 5GGQH 1SXSA 3LDBC 1NIFA 3DHJA 4PV9A 4FQJL 3SB3A 3NIDF 4PWIA 1E5YA 2Y6SD 3O2DA 1J10A 1JWMA 4ADGA 4CADA 3MBXH 3AAZA 3Q6FB 1ED3A 4HWBH 1QSFE 4WO4C 4X5LA 5HHMB 1JZGA 3QG6B 3D4CA 3SOBL 4AQ8C 2VQ1B 4GH7B 2GBUA 4JFPA 4HKZA 3SDXE 3UYOD 4PN6A 4P9MH 2CU9A 2V2WA 1UWFA 3ARPA 4F57H 3D6GA 2VSCA 3LD8B 1QQDA 4EIUA 5SX4H 3AUWB 5CCKL 4K5NA 5JO5A 3RX5A 2R8SH 3UOAB 1AQKH 4G5AA 4QKXB 2J43A 3WFZA 3OXRB 5F8QC 4Y1AA 1QPPA 1FO0L 3QPXL 1NCIA 3WY2A 4B6ZA 1URIA 3NA4A 2Q7NA 3FT3B 2M83A 3I6KB 2FEDC 3GT6A 4TSBL 3QJHB 4P5KA 2HMID 5TJWK 1KYDA 2XZQL 4KGJA 1JVOA 3MLZH 4AM0A 4MTMA 5LHDA 1S78D 3KYOB 5EBLB 2NR6D 1J9RA 3V52L 1AAJA 3ATDA 1IT9L 1YPZB 3RL2B 1QP1A 3V10A 3AUVA 1QVOA 4YDVB 5DCCA 4Y1AE 1OAKL 1I8UA 1T3FB 2OQJB 5BV7L 2ATPA 2WZ5A 1AHWC 1H3PH 1UZ8B 5DT1L 4XPHH 5T1DH 3TJHC 2XX1A 1E28A 2HG5B 1QFUL 2XTJB 3D4YA 2CUHA 1AGBA 1XBDA 3WEXA 1YNLH 3PFQA 3OR6B 5IR1B 1I82A 3QUGA 2NZIA 3KXFE 5FYLH 1WICA 1NFDE 3STLA 4AIEA 4FF9A 4ANVA 4F2EA 4HUXA 1OQXA 4LZKA 4D8OA 3QUXA 4GBXC 4FNPA 3AG1B 5E2UH 4F24A 2H26B 2AJXH 3I9IA 1S3RA 4W6XB 3EYOA 3JV4A 4S1RH 1NUGA 4WFHD 5LGYA 1DCLA 4WSJA 1A22B 4YHOH 3BUYB 1TEYA 1SFHA 5T1MB 1FFNB 4MA7L 1Q8MA 2H3NB 1BD2D 1GGCL 4YHPA 3WS3B 4W9KC 3US0A 1BBJA 1KJMB 1QO3B 3QUKA 3DA0A 3UZEC 1MUJA 4X98A 4DN3H 2YKKA 1O5DT 1Y1DA 2LTQB 4GMTL 2OMZB 4OTXH 4ZX6A 2Z64C 3VA6A 1I1FB 1Y6MR 3DGGA 5EOTA 1TTGA 2GJZB 1WC7B 1QR4A 3QUHA 4P4KA 3MODH 4GRWB 4YSSA 1MQ8A 3VWKD 3AG4B 4YPGA 4OFYD 5F21B 3PABB 2H1PH 2CGRH 4GKNA 5BRZA 3ZIMA 4U7MA 1ILSA 1Q1PA 1R3IL 4JRWA 1IKFH 4PJBF 4HKJB 5GS0H 1T03L 1MCOL 1FZMA 2X9WA 4X9BA 3ABMB 4HZLB 3QFJB 4R7VA 2Z31C 1PG7H 4ZXBD 5K9JL 1CXKA 2F08A 4KXBA 2H3NA 2VQTA 4N1EA 2LFGA 4GMSH 2I07A 2L7QA 1NSNL 1A3RL 3OD3A 3BW9A 2BIOA 2ENJA 3BWSA 2QSCL 5FECA 1ASQA 1DQVA 1WYJA 3CSGA 2K9FB 1RD6A 3C6LB 4PJAF 3NCJL 3RX7A 5D4IA 2YAFA 3LRHA 5C07E 4DVRH 1BFSA 1CT8B 4YDLC 5I76B 4OGAC 4B5EA 3LKNB 1KMGA 4NAMA 4E9YA 4M7LH 1D9KD 4NBZB 4OCYH 3CDZB 3BN9C 4WI8A 5FLUA 3BP7B 3LKRA 1SXNA 2V9TA 2WTPA 1RJYB 4FNSA 3SDXF 2OK0H 4JB9L 2FSEA 3EJYD 3TZVB 5F0PB 3ZR5A 3UBFA 3WEXB 3ZU8A 2GSIA 1CWVA 4Q6KA 2YA0A 2VO8A 3FCBA 4L8CB 4DK6A 4U0QB 3B8YA 3G5XB 4YBQD 4QWWD 5M95B 2F8VA 2F19L 1FDLL 4IBYA 2GUOB 4M6NH 4XVSL 2H32B 5D70L 5KSAA 1NGZB 1HL8A 3RVWD 4ODSH 4OGXL 1QRNB 2KQNA 2VLME 2IV8A 3QWRD 2VC2B 4XE5B 2RCSH 4PRPD 2YXMA 4E9LA 3D3VE 1F11B 2VWEE 1F02I 4LSDA 1XH2A 4QRPB 4JFHE 1ETJA 1F1DA 3QHFH 3BAYA 1CYGA 1UWXH 4AIXA 1M6OA 2TRYA 4MCMA 2DYPD 3CWGA 1EIBA 2YD4A 2YUVA 1PY9A 3IDJA 3PWUA 4RESB 5JQHC 4X5XA 3RZWA 2GCYB 4CNIB 2M8XA 4LOUD 1K5NB 2YUWA 5JZ7C 3LRGA 4DCQA 2QQNH 3AROA 4JKPH 1V55B 1J1OH 2VDNB 1C5BL 4LPYA 3LZQA 1EERB 3NG5A 4MNQD 5EO0A 1IAOA 4Q74A 4UF7C 3RDJA 5JQ6L 1GJUA 3V4PH 3Q1EA 2NY1B 4RAUB 3O9WB 4LPVA 3JWNC 3ZYJA 4UZSA 4WWKB 5EZLA 1X7SA 1WD8A 1NFDF 4V2BA 5TK2A 3WEBA 5L7XL 1A1MB 3I6LD 4G43A 4MCZA 3WXWH 1IGCH 4UINH 1RZ8A 2DBJA 1JZIA 5I6PA 4AUYA 4Y2OA 2DM7A 1QYGL 3FQYA 5I8KL 3WTXA 1OP5H 4NQEA 1H8OA 3VFOA 1KLFB 1U9KA 4XAKE 4LSVH 3IF1B 5BW7A 5D7SH 2RIKA 5C0BE 4R96B 1BVNP 5IF0A 1TETL 3GTNA 3VE0A 2W95A 2VXSH 3F84A 3H9HB 2A6KB 1LEGA 3IFPB 3LHPH 1K4DB 3WMSA 4M02A 5GIRA 1SN2A 2ARWA 2DQJL 2DQCL 4PP2B 3HG5A 4BH8A 4XNYL 2BCKB 5F7AA 1EXGA 2JKLA 2CO2A 3MRLB 4X7EC 3DX3A 4FLSA 4YSEA 3E8UH 4XCEB 1JUFA 4XPAL 4KMTH 5T1JA 4F8TA 1RVFL 1UCTA 1VEPA 2VDKL 4KKAD 2ZP0T 2COQA 4KJPC 3RFZA 1FZOB 1MRFL 5AW6B 3JV0A 4Q52A 1R46A 1M05A 1VPOH 2IAAC 1OZUA 5IROD 2A7BA 2R0LL 1J0JA 4P2OD 2YPLA 1HL5A 4GNKB 3TV3L 3DWTA 1KDJA 1LEIA 2ED7A 1IAKA 4H13C 4PJCE 1E9QB 1GSMA 1T6BX 4JO1L 2ESVE 3T04D 4B50A 2BSSB 3PF2A 2XWCA 5EUOE 3P0GB 4M8UA 4MASA 4YFDB 2PTTA 1LE9B 1A1OA 1EQWA 1NUDA 3BC9A 4U3SB 1Q0XL 1BVNT 3P4NB