2DLEA

Solution structure of the fourth fn3 domain of human receptor-type tyrosine-protein phosphatase eta
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
104
structure length
104
Chain Sequence
b'GSSGSSGAIQVFDVTAVNISATSLTLIWKVSDNESSSNYTYKIHVAGETDSSNLNVSEPRAVIPGLRSSTFYNITVCPVLGDIEGTPGFLQVHTPPVPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor-type tyrosine-protein phosphatase eta
publication title Solution structure of the fourth fn3 domain of human receptor-type tyrosine-protein phosphatase eta
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 7
structure length 104
sequence length 104
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dleA01
5CLTA 4LK4A 2APTA 4HWBA 1VADA 3FFDB 4NQSA 4PLJC 3QWOB 1EEZB 3BSZL 3KYNB 4G9DA 1ADQH 1XF4A 4LLQB 3RNKA 1W0WA 1ZVHA 2HP4A 35C8L 2YS4A 5SV4A 4F57L 5I1CH 3HG1A 3T0EC 1JPFA 1EDQA 4JCLA 4O02H 2D03L 5ADOL 4KKLD 3P0YL 1F6AA 2DF3A 2XWBA 1LE5B 1E4JA 2C3HA 4PJ5E 1T20B 4WHYG 4YWGH 2ARJQ 1KXVC 2XTJD 3ZDYF 2QR0A 2RGSA 3RNKB 1W0WB 2X7LB 3VFOA 2A6DA 1GH7A 4CVZA 2BNUB 5E2TH 4YK4C 4KMTH 3HG1B 3HMXH 1JPFB 5D2NB 6FABH 1PFCA 1NMAL 1AO7D 1WAAF 1F6AB 3PWNB 2APFA 2BFVL 5ISZB 3O4LD 4QCIA 3EYVA 3MLVL 3VFOB 2A6DB 4CVZB 4TVSa 5CIPB 4AEIH 5F7EH 3DXAB 4LRIC 3ECBA 2APXA 5CZXC 5C07A 4XP1H 2BJMH 4YE4L 4J3TA 2FRGP 2CIIB 4EEEA 4JGUA 4LL9A 5TDNA 5LGHH 4U1NA 1QLEH 2K7QA 4QCIB 2BVQA 3EYVB 1IAIM 4LPXA 3O4OB 1DLHB 3AS3A 1GHFH 4P2QE 4G6ML 4HHAA 5L2JA 4G8GD 4OLZL 2GCYA 3QH3A 4N8CH 5C07B 1G9EA 4Q0XL 1Q38A 4PJAF 5EU6A 4TVPE 4ORGA 4JRYB 3IU4H 3PWUA 4K3DH 4HKZA 4WCYH 5HHVH 4R90H 2ITDB 4LVEA 4QRPA 5TQ2H 1JNJA 4HHAB 1FORH 3DI2B 5L2JB 1D3CA 2AABH 3TO4D 1RIVH 2GCYB 3GSNH 3QAZC 2NY2C 3KLAA 4NN7B 5GJSH 3H42L 3QR2A 5A2LH 4ELMF 5EU6B 3FO0L 2QL1A 2I26N 3BOVA 2M8XA 3EJZD 4HKZB 3BZFA 1MAML 4FQCH 5B3JF 5I9QC 4LLWB 5M95B 2D03H 5CD5C 5ADOH 3L7FA 3P0YH 3BGFB 4FFZH 2C9AA 2OMNA 3LDBC 4HJGB 1Q9KA 3IDMA 4HUVA 3SKNA 2ZUWA 1AXIB 4IHOA 4B50A 5KBNC 2P4AB 4OUUB 2YXFA 3L7FB 4HMDA 4MNHA 3QHFL 5J12C 4Y1AE 3JWNC 4DKFL 3MRRB 2G75B 4JO3H 2VDKL 3QWRA 1SYVA 4MWFA 3RTQC 3IDMB 3PHOA 3MLVH 3SJVE 1J1OL 3SOBL 1MNUL 4L1HA 4YQXL 4IHOB 3GRWA 4NT6B 5E2UH 1K5NB 1ZTXH 3NA9H 4U3XA 1W72H 3RPKA 4WUUD 2NNAA 3IJSA 15C8L 3QUZA 4IMKA 1LO4L 1QFWI 1K8IB 2WLZA 3PHOB 3MNZB 5DRZA 4MAYC 4G6MH 4DVBA 2N4IA 4OLZH 2VN7A 3ARGB 2ICES 4G6FD 2V2XA 2NNAB 1DN2A 1FO0L 3QUZB 4R2GD 3UTOA 5CP7A 4QHKJ 2FGWL 1DUYA 3IF1A 5IK3A 5DRZB 5FYJD 1MEXH 4OGXL 5B39G 5EO9B 5CD3A 1JNNH 3FO1B 5TGBA 2P5ED 1JGVL 4BQ9A 5FEBA 3HZYA 2W38A 1MCLA 4V1DE 2WBWB 5GZOD 2WZPD 3FO0H 1DUYB 3IF1B 5IK3B 3VRJB 5KVEH 3W5MA 2WIMA 3BMWA 3S96A 5CD3B 4G7YH 1U9KA 5H94A 4OLUH 5TGBB 3QJFA 1N6QL 3VWJC 4QOKE 5HYEA 1AR1D 3TJHC 4P5MB 2R2HA 4EXPX 3V5DA 5C0JA 1GGIL 3FHAA 3QEQE 4HG4K 5GGSB 3ZKXC 2NY5L 4NQDA 1ADQA 4FQXA 1JZ5A 3S96B 5B39A 2P24A 3QHFH 2ZCLH 2OCFD 4DKFH 5LKNA 3BUTA 2R2HB 3TFKC 3RL1A 5KSBA 1J1OH 4QXGL 3OR6A 3SOBH 1P9MA 1MPAL 2F54A 4FQXB 3VA6A 5B39B 2LQRA 2P24B 1S7WB 3F58L 4P57A 5D9SB 2F8XC 2JJVA 4ZS7L 3HMXA 3UC0L 1DBJL 3ULUL 2A73A 3BIAX 3BDXA 1BFVH 4PTUA 5DMGC 4ACPA 2PCPA 5E2JA 5KSBB 5JA9A 4U1JA 3OR6B 2R0WL 2F54B 4W70A 3QCUL 3DYPA 4JDVA 1I8LA 4XH2A 4GG6A 4P57B 2CUMA 2NR6C 1FL5A 1QPXA 5D7LE 2A73B 1PG7W 1CDCA 4PTUB 3RZWA 2PCPB 3MLRL 1QG3A 3D69B 2YA0A 4U1JB 5IWLC 2OM5A 4PPTA 1X4XA 4PGZA 2EDNA 4QGTA 3QDGD 4JDVB 4GOSA 4NUGH 1Q0XL 2EIZA 4GG6B 4ONGH 4KKBD 1DVFC 3EZ8A 1FL5B 3C5ZC 3HI5L 4AIXA 2R1YA 5I1JH 1ZHBA 2J4WL 2VSCA 4OFPA 3KAAA 3QPXL 4X7SH 4NQCA 3VXQA 1VDGA 3U9PL 3SDAC 3FMGH 3U1SL 1A5FL 4BZYA 4LIQE 2AXGA 3GSVB 1GGIH 2R1YB 3GSNA 1ZHBB 5HPMA 5ISZD 1MRDH 1WEJH 5GRYA 4KJYA 3PV6B 1IGTB 3OF6D 4NQCB 3VXQB 1BP3B 4HWEH 5TPWL 4NFDA 4QRRE 3EYSL 3L3HA 3TH4T 1GGBH 3DXAD 1ZGLB 2R56H 3BPNB 2CKBA 3RVXD 2AXGB 4XNQB 4P2RE 3ARUA 4AIZA 5DD3H 2HVKA 1QSFA 3I02A 3P9LB 3MRCA 3IVKA 1NJ9B 1XZ0B 5FIEA 5FUZH 1MJJA 4BQBA 5A43C 4TOYH 4KAQL 4MB3A 3FB6A 5HDQL 3TVMB 1F4HA 3L3HB 4GJTB 3W0WA 1BQLH 2WBJD 2G2RA 2CKBB 4LHJB 1HXMA 3AREC 4UILL 3UC0H 2XQYG 3ULVL 5I8OH 2DKUA 3LPGA 4N1HB 1QD0A 4OZHE 2HVKB 1QSFB 3I02B 4GBXC 3IVKB 1S9KC 4JRYD 4GAYA 3TESA 4I77L 3QIBC 1RUKH 1MHPH 3FB6B 3MLWL 2IC2A 2Y07H 3K46A 4OQTL 4EUPG 4RMQA 5DGQA 3W0WB 1AC6A 1CICA 3SY0B 4B5EA 3MGOA 5EOTA 4CADB 1HXMB 3LKNA 2GKIA 2DLTA 4OZFH 1W72A 4S1QL 4DEPB 2C3XA 5CS7A 3LN5B 3VCLA 1QSVA 4HFWA 3RVWC 4RDQG 1JZ6A 1I1YA 3MPCA 4OBRA 4OM0L 3W39A 3K0WA 5E8OA 3VFTA 2XFXA 2DQHL 1KB9K 5HI5C 5EOTB 1N5AA 5DJ0A 3CH1A 4WO4D 4WW2C 3HI5H 5IOPA 4LGPB 2J4WH 2H26A 3ZTJH 2Z91A 3S35H 3Q6GL 3MRKA 3FQNA 4PGCA 4JPKH 5FDWA 5D2LB 3W39B 3U9PH 5E8OB 1GSMA 4KJPD 3U1SH 2HFEA 4M43H 2XFXB 4EUPA 5DTFA 5DJ0B 4YHIA 1T1ZA 3IFLL 1J9CT 2C4XA 3LRSA 2X41A 5INDB 3ZE1E 4PGCB 2ZOKA 2EDTA 5FDWB 3PJSA 1IJ9A 2RFXA 2IMMA 4NM4H 4HXAH 3EYSH 4O2CA 2NY4D 2HFEB 4XAWL 4EUPB 4PJAA 2YZ1A 4LSPH 1UKTA 4PJCA 3T2PA 4Z7NF 1P69B 4HUUA 5J13B 1L0QA 4CJ0A 3PJSB 5FGCE 4K94L 1ZT1B 4Z95L 3HMWH 3QEGL 4BFGA 1QBLL 1PQZA 1XF3A 1P6AB 3B9AA 3ARGD 2JJUA 1A8JH 4BZ2L 1OAQL 4PJCB 3RIAK 4R8WL 1GVIA 2GJ6A 4RAVA 3LV3A 5AD0A 3VFWA 4J3OC 1VA9A 1PQZB 4NO2A 3OG4B 4XPFL 1XF3B 1LHZA 4Y7MA 1G7QA 1RY7B 2YD4A 4RAVB 1BM3H 1ETZB 3BHBB 1JRHL 5I1EH 4OUOA 4V2CB 3TYFA 4NO2B 4WI5A 5KVGL 1NCBH 3BESR 4UTAL 3GI9H 2FHBA 3OB8A 1T1YA 4HAGA 1UEMA 5E70A 3T2NH 5DS8A 1G7QB 5D96C 1WT5C 3Q6GH 3TBWB 3VWKC 1JYVA 1DSFL 4M8QA 3BKCL 4ZAKB 1ZSDA 1K85A 4HQQH 3RUGB 3DURA 1J18A 4GLRI 5B3NA 3K74B 5CKGA 1T1YB 1T2QH 4YDJB 1MCBA 4TN9A 1N26A 5DS8B 3GSRB 4LASL 5DJ2B 1T0MB 4M8QB 3DNKA 1YEDA 3BN9C 3REWB 4CMHB 3TV3L 1ZSDB 3ESUF 2FIKB 1OF2A 3DURB 4WWID 1QSEB 5JOPE 5FK9B 3WFDH 5HHNA 4UNUA 4JHAL 1MQKH 1INDL 4G80A 5C0DA 2NCMA 2ATPA 1D5MB 3U4EA 2H1PL 1XF5A 3LIZH 3TNNA 1GPOL 4JM2D 3HUJE 5CP3H 5EOCJ 5KSAC 1OF2B 1FVEB 5AWNL 1IFHL 4ZTOH 1IC4L 5HHNB 4XP9L 1RZKH 2F8VA 2C3WA 2ICEA 1IL1A 4BZ2H 4G80B 1VKXA 3G6JE 2ATPB 1BPVA 4R8WH 3TF7C 4NKDA 1A6TA 3U4EB 1XF5B 5D93B 3TNNB 4WUKL 5DEFA 3MRDB 2VR9A 3QQ3A 2DI9A 3EO1B 1OP3H 2IAMD 3RVTD 1X5XA 5FKPA 2YK1L 3SDCA 4NP4H 3S37L 5GZND 2YD3A 3QNZB 4HLZH 2ICEB 1EFQA 3IDIA 1IL1B 2UYLA 1VKXB 5ACLA 1EJOH 2BNRB 2HKFH 4N0RA 3S34L 3RZCD 5GRXG 1UKQA 3MX0A 4NKDB 1ZHLB 2IJ0C 1RI8A 5CMAB 5E6ZA 4X9GA 3VG9C 2FLBT 2VJXA 1LWRA 2ERJC 3NZ8A 1INEL 4OGZA 1X9QA 5C0AB 2UYLB 3IKCA 3KPLB 4OZIE 2FECI 4Y4KA 3BKCH 1A7OL 3WNPA 2DQJL 3EUUA 3IAQA 2VITA 3EOAA 2QADC 4QHNB 5HDOA 5DT1L 1XCTA 1L9NA 3U2SA 3IKCB 4LASH 3R06B 4LHUG 5T5FH 1LO5A 1XGTA 4Y4KB 5KAQG 5IB4A 4OCWH 4K23H 3RVUD 2DN7A 5D5MA 3TV3H 2VERN 3EOAB 4XHQA 5BRZA 3RNQA 1KN4L 3N1PC 4QXTA 3TVMD 1XCTB 2E8ZA 4KK5D 1JFQH 4JHWL 1NC4A 3VXOB 1LO5B 1XGTB 4RBPH 5IB4B 3TIDA 1QBBA 1CS6A 1U8KA 3EO9L 5D5MB 2NYYC 3B5GA 2QHRH 2R0ZH 3LHPH 4EIZC 5FHAH 4LEOA 1QHOA 1IC4H 3RNQB 5BVPH 4XP9H 2XWTA 5L0QC 3CH8A 5D7IA 5HGAB 1NEZG 4WV1C 1NC4B 2APVA 4WHCA 2YPKA 3BMVA 4LHUA 3TIDB 1U8KB 1UWXK 4OZGA 2XIDA 1S7SA 3WDIA 1D6EA 3B9KA 3KS0J 5MEPA 2YK1H 1ZLSL 5J11B 3Q48A 2CD0A 4L29B 2XWTB 3BPCA 3S37H 4X7CC 3M17A 2MCPL 5SV3A 5D7IB 5DJCA 1I75A 3LKSB 3RQ3A 1D5ZA 1JGLH 2XZAL 5C0NC 1IBGL 1CF8L 3DVGA 4LHUB 4YFLF 2SEBA 4OZGB 1S7SB 3B9KB 5GGUA 5MEPB 4HK3J 1AH1A 1INEH 4NYLA 5D7JD 4R4FL 2NY1C 2VXSH 1DBKL 1NUDA 3BJLA 3DTXA 3WFEL 2V2TA 1UXWA 5BS0B 3X17A 5JO5A 1NEZA 1LEGB 5ITBH 1DQJA 4GS7C 5F70A 3DVGB 1A7OH 3GMNA 1O0VA 1WCQA 2SEBB 4IOFC 5GGQH 5EOCH 5HHOD 5HYQA 4W68A 3T77A 4NYLB 1A9BB 2CKNA 3WFZA 1RQ5A 4YIQB 1YMMD 3KPQA 1SVZA 1NANI 5JO5B 1NEZB 1DQJB 2OS7A 3GMNB 3NPSC 1MJ7H 4Q74A 5DUPL 1WIOA 1JHLL 4F15B 3CJJA 3KPQB 2NMSA 1R0AL 2YMXL 4JQXC 1JI1A 2XN9A 3STZA 3HPJB 3V8OA 1GOGA 5HGHB 2VZ1A 2PN5A 3V6ZB 3OMZA 3VD7A 1H3PL 4XI5C 5CINH 3U30C 2CLRA 4PRHD 2EYTA 1IC7L 2DLFL 2X09A 3HR6A 2XN9B 2ZNXA 3KXFA 3STZB 2FX9L 1BAFH 2F15A 1M7DB 4X8JA 4HULB 1J0KA 1ZHKB 3FO9A 3H3KA 5CP3A 5D8JH 5E99H 3WLBB 3VXRA 2CLRB 5DO2C 1RVFH 3RWIB 4IDJL 4YC2B 5I73B 4GRMB 4K7PY 1EGJA 2ADFH 2XZAH 1KGCE 3KXFB 3D9AH 3NAAL 2BC4A 1G7LB 4X8JB 2BVUA 2PTVA 1W2KT 2AK4E 3ULUE 4KTEL 4KDTA 1TPXC 2ZG2A 2EC9U 4ZAKD 2JCCB 4KH2A 1UFUA 4FTVA 1WC7B 4K7PH 4YR6B 4L8SA 4FNLL 3RKDD 3NCCB 4KK8C 2XQBH 4AM0B 2XPGA 1DN0A 1FL3B 1T04B 2ARJA 4YDLC 4RMWA 1F4XH 1G6RH 4IJ3C 1QSED 1IM3A 3O6LL 4HAFA 1NUFA 4MA3A 1FGNL 4G6JH 1FYTB 3TP4A 4L8SB 4FQ1H 2ICWJ 1CI5A 5FB8A 3C60A 5H37H 1DN0B 3BKYL 5DUPH 4S0SD 3KS0H 3CFJB 3V0WL 2D0FA 3IKKA 1IM3B 2XNAB 4MNQA 4RZCA 4KHXL 4X99A 1R0AH 1DUZA 1OM3L 3O6FA 4APQA 3ARDC 3W11D 4U6YA 1DBMH 5F1KC 3HNVH 5FB8B 4LLMB 4XAKE 3SHSA 3C60B 5IQ9A 1DEEA 1EMTL 3V4UL 2JTDA 1CLZH 2CDGA 3LKQA 4ODUA 1KYOJ 3PL6C 2B39A 3UPRA 3PWPA 4N0CD 2BOBB 1KJ2H 4LDLB 4YXHH 3W81A 4APQB 5HSFA 3I3EA 3P77B 4QHMA 1WWWX 4U6YB 2FX9H 2BCKB 2EICA 4MCYA 2BNRD 4N90D 2AK1H 1UA6L 4HGKC 1TNMA 4ODUB 4XCYA 3WO4B 1MFAL 1OW0A 2ZUTA 3MV7D 2GFBB 4PUBH 1ZT4A 5B38G 3T3MF 3UPRB 1U91A 3FB5A 3LRHA 4JB9L 2DB8A 1OAXH 3ILQC 2FYYA 4ZSOB 3SGEI 4OGAD 3T65A 4QHMB 5C0AD 3NAAH 4JREB 3QCVL 3NA4A 3VD5A 4WI6A 5CGMA 3ULVE 2CJUL 4XCYB 1Q9WA 2I25N 3IXTA 1ZT4B 4BSWA 4Z78A 2LU7A 1U91B 1WLHA 5HVWA 2FYYB 2GHWB 2JLLA 4PJ5A 1EX0A 4RRPG 3T65B 1VERA 4HS6A 3T0XA 3MODL 3EZJB 3ME0A 5GS2H 1AJ7H 4Y4KD 4GMSH 1MWAH 3A67L 5IFJA 1A14H 1Q9WB 4JANB 4R97C 5CCKH 5JW3L 4JQVC 4Y4FC 4Z78B 1ZANL 4GRLC 5EZIL 5B38A 6CGTA 2Z8RA 3FRPG 2Y6SD 3UCRA 2Y5TA 4PJ5B 2RCSH 5JPNA 1CG9B 3MOBH 3SDDB 1OY3B 4WW2F 3BKYH 4FHBD 2BMKA 3FQUA 4WEUD 5I71C 1T22A 1YJDC 1NFIA 2ORBH 2VDMH 1FIGL 1BBDH 4YK4B 1RULL 5F7FA 3FTGA 5B38B 5MHSE 2Y5TB 4LGRB 3SPVA 5JPNB 2Z31D 2AEPL 2BHZA 3EHBC 4RRPA 1KJ3L 3MGAA 3QRGL 5HGDA 1ODAA 3N06B 2BMKB 5BO1H 3FQUB 4GQ9L 1JPGA 4M6AA 4CBPA 1SJEB 5HGBA 1RJYB 1U8IB 2IQAA 2VXTH 4BFBD 1R3IL 3AC0A 3FTGB 2BDNL 3VRLF 4PP1C 1IAII 4I18A 4X7EC 2VQ1A 1UA6H 1YYMH 5C0CD 5IHZA 1JPGB 4P2QB 2IQAB 3S88L 1CD1A 3MRNB 4JB9H 1L9MA 1IMHC 4I18B 2ED7A 1S5HA 3FT4A 2O5YL 1B4RA 4RGNE 5BS0D 1F5WA 1TJGL 2C5DC 4I1NB 2G5RA 2DL2A 1SJVA 3FT2B 3HC0B 4TNWK 3GBNH 2EKJA 5IHBA 5F21B 1CD1B 1J0JA 1KFAL 1MFDL 1RZ7H 4IRJC 4M62H 3GI8H 1S5HB 2VISA 3FT4B 4IRSA 4JVPA 4OCSL 2IALA 3IRPX 1GJIA 3CX5K 2A1WH 3W9DA 1HCVA 2NY0D 1CK0L 3FJTA 4HCRA 4Y2DA 3QDJB 4G6KL 3BRFA 3ZT7A 4DN3H 5IG7A 1FFQA 1M4KA 1LO0L 3N1GC 2I60H 2Q8BL 2VZSA 3FQRA 3D39D 3BWAA 2E27H 3VFSA 2YD2A 5EUOE 2DQGH 4OCLC 5IKCA 1YN6A 2VISB 4IRSB 1A4KA 3DPBA 1KEGL 1M71B 3AMLA 4Y2DB 2NY3B 3CFKB 2C4FU 4LCIL 3RTQA 4H20L 3NFSH 5IG7B 3ZT5A 2V17H 3ZHKA 1RULH 2QSCH 3LSOB 2AEIT 3TA3C 4X6DE 4Y1AB 3N50A 3QG7L 3ZDXE 1QTYT 5IKCB 1G6RA 1J8HE 1YN6B 1A4KB 3QRGH 3SJVB 2UWEE 3BGMB 5I1GL 3H3BC 4GQ9H 1X5GA 4X0KA 1E27B 1UT9A 4JFFE 1F6FB 1A7QH 3ZKMC 5J56B 3OB0H 1MCOH 2V5YA 4PS4L 1WZ1L 2J5LC 5ALBL 3MJ8A 5ABDE 1B0GA 2VIRA 3KXFD 2HLFD 2MQCA 1ZLWH 4LDOB 5AZEH 1H5BB 3C8DA 3V0AC 1S9VA 1OT1A 4H88L 1F58L 5HJ3A 1CYGA 43C9A 3DI3B 3HE6B 1KJ2A 3NCJL 4TUJA 1TJGH 2IGFH 1AGBA 2DJ4A 3U0TB 5JNYA 3STLB 4P59L 5MERA 5C0FB 2YOCA 3C5SA 3MRLB 1FZMA 1LILA 4DTGL 4PJDE 1OAKL 3PWVA 1R3LB 2V5MA 2DQIL 4QOKA 3VW3H 1BQHG 3HA0A 3VWJA 4LQFL 4V1DB 4OCSH 5ESVA 43C9B 5GJTL 1EHXA 2BVPB 4KJQD 4S1SL 1PJ9A 1FYTD 4TUJB 3PDGA 3QEQA 2WP3T 1YPZF 1MI5E 4I13B 4ISVB 5MERB 3H9SE 1D5IH 4OSUH 4XZUA 1TDQA 5I2IB 1G9ML 5EIIA 1SY6H 4BKLA 1FAIH 1SHMA 1FZJA 4D9LH 1KEGH 3QEQB 2KL6A 3MJ7B 4CDHA 4HDIB 4P9HC 3ZKXB 4P3CH 1N7MH 1XF1A 1U92B 4OQ1A 1MWAA 4OLYH 2ZOLA 4OIIL 2FX7L 1LK2A 4UTBL 1FSKB 4XCFH 5EIIB 2IEPA 4HIHA 4BKLB 4JFHD 1BQHA 1YUHB 1FZJB 1UENA 5D72L 3CIQA 3FAXA 1IC1A 3WUWB 1ORQA 2DM3A 4BELD 3KPRE 4KKCD 1EBPA 4LAQH 2EE6A 1CU4L 4J3VA 1JYWA 3O81A 2ZOLB 2BY3A 1S3KL 5EU7C 4FQHA 4PS4H 4DCQA 4HIHB 4CU7A 1BQHB 1HWGB 1ZA6A 2APBA 5EU7E 3JZ7A 1JK8A 3NGBB 4KQ4H 4WDIA 1WVZA 5E4IA 2YWYA 1ORQB 2Z8VC 1OTSC 4MB5A 4DGIH 1WSST 1KIQB 5TQ0L 2PO6C 4ZNCD 4LKXA 1P4IL 5C08A 2VQUA 4OB5L 1F58H 3FQWA 2OZ4H 1CL7I 5D7LB 4FQHB 4DCQB 1ZA6B 4QNPE 3C5ZA 1JK8B 2DQFA 4WDIB 4KU1A 1NAML 4P59H 4TYUA 4LNRA 5ERWB 3R1GH 4GUPA 4NGHL 4WIQA 4HBQA 2A9MH 3CVHL 4UQ3A 4Y19A 5CGTA 1P2CB 4F7CB 4NC0B 4AQ1B 4GG8A 3SDAA 3FQWB 4LQFH 3O6KL 4DGYL 3MV9A 4S1SH 4NOBA 4ZO7A 1KCSH 3C2AH 2DQFB 3NFNB 2XT1B 3SDDD 4JFQB 4QRRA 4M1CC 4JZNA 2ICWA 1U41A 2DOCA 4RAUB 3O3BA 4GG8B 2HJLA 1G9MH 4DUVA 4P2RA 3PQYE 4U6XA 5D1ZC 2QQKH 4YJZL 3V4PL 1SM3L 1QBMH 5K59F 2HRLA 1YEIH 4QRRB 2WIIA 4F8TA 3WHXB 2HLAA 3SE9H 4XC1L 4LEXL 4LRNH 2HJLB 4XB8A 1EAJA 4XWOD 1HSAA 4X80L 1M05A 4U6XB 2DQDL 1JP5A 4OZHA 2R1XA 3MLYH 3FFCE 1CQYA 2RAMA 2HFFA 4NJ9H 2Z92B 1KUMA 5EUKA 1LEIB 4GBXA 3QIBA 3OXRB 4P2QD 4NHUA 4HXBL 1S3KH 2IPUG 1WZLA 2VZTA 1LVEA 2R1XB 1Y6MR 2MOVA 3E8UL 3MJ9H 4JM4L 3VFVA 2HFFB 2E7HA 4L4TE 3VD3A 3O2DH 5F9OL 4GBXB 2OMBA 5TQ0H 4M4RA 4OAWA 2X4UA 1P4IH 3QIBB 5EZJA 2ADIB 4OB5H 2A83A 4NHUB 4PJHB 1PX3A 5KANG 2VDNH 1EBAA 3DJ9A 1EEQA 2BNQD 1UJ3C 4KKAD 4X9HA 5IVOA 4A6YL 4NQXA 2R15A 1WK0A 4U7KA 2Q6WA 3WE6B 3QDJD 3RVVC 2X4UB 2A0LD 2FJHA 4U33A 1F00I 3VFUA 2F58L 4NO0A 1AY1L 2A83B 1JGDA 1WV7T 5CGYD 1DBAH 3B3IA 4NQXB 1G7HA 3IDXL 5GRUL 1R24A 4MVBD 2YKLH 2Q6WB 1JNLL 4OM1L 3NIDE 3QXAA 4UOJA 2FJHB 3SO3C 5GSVA 43CAA 3VFUB 4HJ0C 1ZLUK 4NO0B 4E42B 5I76A 2X4SB 1T03L 1JGDB 3RDTC 1FC2D 5DSCA 4Y1AD 1BVKB 1I7UA 4KK6C 3V4PH 2Q76B 2VDOH 4OF6A 4RGMC 3CSYB 5FUOH 3B3IB 5I18H 2VDQL 5EA0L 3BO8A 1G7HB 3SJVD 1J7VR 4UBDD 3CDCA 3S4SG 3WJJC 2C26A 1E4KA 43CAB 1QLFB 5JW4R 3ZDZE 1JZ2A 5I76B 4PJ8C 1WUNT 5TE4L 1QRNE 2C3VA 4Y5XC 2D7TL 3ROLA 5DSCB 5EDXA 4L9DA 3S35X 4OLXL 4P4KC 4Z0XA 3VG0H 2NW3A 2OR8A 1RMFH 5E5UB 3BO8B 5FGCB 2A74A 3A0OA 2R9HC 5I66B 3GMQA 2HT4D 5DVOA 1KXTB 2WWMD 1OSPL 4NQEB 1F4YL 2EO1A 4LVHB 2C3VB 1EHNA 3V7MA 3G5YB 5JPMA 1VENA 3ABZA 4OCYL 4XP6L 2NW3B 4JM4H 1O7VA 3HE6D 4I48A 5EN2A 3WXWL 2A74B 4KRMB 3GMQB 4LSUH 1XGYH 4H1LG 3S4SA 1RSFA 1T3FA 1P53A 1JWMA 5CJOL 5A40E 5I1DA 3MLZH 5JPMB 2VXUL 3QJHA 3MLXL 4V1DD 4XT1C 4I48B 1JMZA 1LDPL 5EN2B 3VWKA 1EVTC 5FXCH 3X3GH 5B4MD 4BUGA 1IZJA 3ARVA 3QIWC 3QUXB 3S4SB 4YLQT 1YEEL 4Z7VE 4D0BA 1U95A 4WWKB 1MVFA 3REVB 4DZ8B 5E1AA 2ENYA 2OP4L 4L5FL 3QDHA 3QJHB 3UZEA 2VLRE 1D9KC 3VWKB 1BF2A 1S7TA 1YY9D 3QEQD 4MXWL 4OM1H 1KJMB 4PBWD 4ENEC 4K71B 3OKOB 4ZS6C 2R8SH 5DRXA 1U95B 1Q94B 2FD6H 5E1AB 4OFDA 2CO7B 5J1AA 5C9KA 4ZUTA 2VDQH 4R26L 3OSKA 3PHQA 3FO2A 2NZ9C 5TF1L 3NIFE 1AI1H 3MRPA 2DD8L 3BPLC 3MUY1 4AT6A 3TZVC 3JWOC 1KCUH 5CBAA 5JIIA 4H1LB 3IJHA 5C6TH 5IBUB 5A2FA 4P5TD 1T7YA 3C6SA 3G6JA 3NVQA 4U2ZA 1TVBA 5J6GA 3V8CA 2AJUH 3QXDA 2LVEA 4NM8L 5J1AB 4NZTL 3WFDL 4YO0A 1DCLA 1NCDH 4FFWD 3PHQB 3FO2B 3HUJB 5EU5A 4RFOL 3DSNA 1H8NA 5GGVH 5ENWB 5E03A 5DEGA 5CBAB 1KPVA 3IJHB 5DQJA 4Z8FH 1KXQE 1I7RB 4HH9A 5AAMA 3C6SB 3G6JB 1CTOA 4F3FA 3GK8L 5J6GB 5D7LD 4U7SA 3QXDB 4HUMB 1HK6A 1C7SA 1S7VA 4RMRA 2F74B 5FDYA 3ZLQC 3RP1A 5HHME 4MS8C 1K9TA 4NIKB 5IM7A 4G8FA 3PWJB 5FYLL 3EW3B 1JPST 2ESVE 5DQJB 4DK6A 4JJHA 1SEBA 1T21A 3HI6L 2J6EL 1CGSH 4ZOAA 4TNVF 4F3FB 4OZIA 2VXUH 3GHBL 4G7VL 2JF1A 3W2DH 3ARBA 4Q6YA 1NUGA 4RQQA 1B4JL 3I50H 3H7LA 3EDEA 5KW9L 4NSKB 3C8HA 2PNDA 1HZHL 5FUCC 3HB3D 3PDOA 4RNRA 1SEBB 3UJJL 1EH9A 3OAZK 5CJQH 5C0EA 2OP4H 1BWMA 4AZ8A 1NGXA 3ARBB 1BVLA 3RX5A 2Q8AL 5C6PB 3FQTA 4KQ3H 1J0YA 1HHKA 2HRPL 3QULA 5FGSA 1OPGL 5J6HA 3JWDL 2X42A 5DWUH 1JPSL 2QADB 4RNRB 1JPTH 1YDPA 5C0EB 2WBKA 2PXYD 3E3QC 4XVTL 1GAFL 2VZVA 1NGXB 2VXVL 2LTQC 1KB5A 3E3QE 5CJXA 3O3UN 1L7TH 3VXME 2QHLA 3P2TA 4LGSB 5KOMC 1HHKB 4F7EA 5L7XL 4O2FA 4MJ5B 3KLHD 5J6HB 2DD8H 3WS6C 3UDWC 1AGFB 1RJLA 2MQ3A 4L3EE 4PJFE 1LO2L 1TVHA 4NZRL 5HHPB 5IGXL 4RWYL 2H45A 5C0GA 4NZTH 1KB5B 4OT1L 5IHUL 2D7PA 1KPUA 1AE6L 3GGWA 1E6JH 5JQHC 4MB4A 1NBVL 5E9DB 3PXJA 2EDJA 3OR7B 1RJLB 4DVRH 2UZIL 3U79A 2D31B 3V4VL 2XWJA 1E4XL 1TVHB 3GK8H 1DQDL 2ZCKL 5L2KB 1LGVA 1TCMA 5C0GB 4L4VB 1RUQH 4YDIH 3OV6A 3GGWB 2JIXA 4CVWA 3DRTB 4CNIA 1TZIA 5FYLH 4ZMAT 4X7TA 4OBSA 4U31A 4QYOA 3EJJX 3WEXB 2WV3A 3JTTA 3HI6H 2J6EH 4FZEH 2XWJB 3F7VA 2DICA 5MP6L 4I3RL 1ORSA 4MA8L 4UNVA 2CSPA 1CD9B 4FQIL 3L5HA 2JIXB 1SJHB 1EEUA 4XC3L 1TZIB 1YJDH 1IGJB 4NZUL 4ZDHA 1FO0A 3VGAB 3LQZA 4RWHA 4HJJL 2YN5A 1U8NB 3BI9X 2XACC 4QYOB 1ROWA 5T3XH 2XTJC 4JFEE 3JTTB 3WIHH 1X5AA 3UJJH 1G84A 2XTJE 3W82A 3T09A 3C8KA 3LPFA 3SKJH 2EDLA 3OAUH 3U6RB 3BIBX 1U3JA 1MFEL 1PW3A 3JWDH 1AO7E 4ZDHB 1FO0B 4RFEA 1T0NB 2D0HA 4HIXL 4KY1L 3MC0A 1MCSA 2DDQL 2OSLB 3QUKA 3O4LE 4I0CC 4XVTH 3C8KB 2PTTA 4Y5YC 2VXVH 4AYFA 4JQXA 4LLDA 1TQBC 5L7XH 2P42B 1YQ2A 3CLFH 4LHQB 3RL2B 3IDJA 3MA7A 1HYRC 5IW3A 4FQJL 4UT7L 2J3SA 3QUKB 1BF8A 4NQED 2QQNL 4OT1H 4KZEH 4LLDB 3GB7B 2ITCA 2R2EB 5DRWA 4G8GE 3CUPA 2NXZC 1NBVH 5INCB 1QR4A 1RZ8A 3BZDA 4WW1A 1IEAA 2UZIH 3K2MC 3V4VH 1J0HA 1E4XH 3UZQA 1I1CA 2X1XR 1DQDH 5IQ7H 2VYRE 2BY1A 1HHGB 2ITCB 3G5ZB 4JKPL 4XMKL 1FVDA 1RZ8B 3QQ9D 1IRAY 4WW1B 2EH8L 1IEAB 4UQ2B 3P9MA 4QHLB 3QUXD 2DWDA 2IPKA 5L8JB 4UZGA 4WWKD 5DJ6B 3ARYA 4E5XA 4YPGA 1I9RL 4FMFA 5CEZL 2AK4B 1ND0A 2DM4A 1X3DA 4C59B 1BD2B 1FVDB 4HJJH 3DUUA 4QHKI 1P84K 4X4YA 2YPLB 2F5AL 3KPSE 4QRTA 1P7QD 2JELH 1FNLA 3UYOD 3GUTA 4E5XB 4JKLA 1VFMA 4NC1E 3DX6A 4IOIA 1ND0B 5HD8D 2J8UF 5BZWB 1RAMA 3KLSA 3V6BR 1TJHL 4KY1H 3DUUB 4JFOB 3TT1H 3LEYL 2DDQH 3O41A 2L7JA 3VE0A 4C54A 3OKMB 1LO3H 3VRIA 4QRTB 3FB8B 4YXKL 3MMEB 5C09A 2YA1A 2XKNA 2Y1VA 3ARDA 1UCBL 1AC0A 1C1EL 3DX6B 3VFMA 4IOIB 4GXUM 2FHCA 5I1KL 2VE6A 1GGCL 4WUUE 3VE0B 4Q9CA 4JY5L 4K7PX 3VRIB 4KVCH 1EFXD 3T1FA 2B0SH 5I30L 3MUHL 4P5KA 1YY8A 2GK2A 4LLYA 4EN3D 4ZFOL 2VE6B 4R2GC 5DURB 4ZPTA 1QOKA 1CIUA 2OTPA 1CD0A 2AJSH 1P4LA 4PJBE 1CT8B 1MHCB 2I9TA 3Q6FA 2QSVA 3T1FB 3UXFA 4OFYA 3WSQL 4P5KB 3GFUA 1YY8B 4JKPH 4JVWA 4MDJA 4YAQA 5GZOC 4QEGA 3LN4B 2OL3L 2HFGL 4LMQE 3T0DA 2UVEA 5F7UA 2CDEA 4LU5H 5T5NF 1T89C 3RA7L 2NX5A 4Z7UF 2I9TB 1B2WH 4WY7L 2DQEH 4PRIA 1I9RH 4BH7A 4OD1L 4XMPH 4P9HH 2KH2B 5FYKU 1FFPB 4MDJB 4YAQB 1G0DA 2BX5A 2X4RB 1RU9L 2GT9B 1F90L 1A2YB 4FZ8L 1R6VA 2CDEB 4FQ2L 4JQVA 2ID5A 3PHSA 4Y4FA 4GRLA 2GAZA 4MA7H 4QRQA 4UU9A 3TWCL 4PRDA 5HYIA 4BH7B 2EE9A 3HZKB 3SGJA 2ZZUT 4UB0L 3LEYH 3TCLA 4J3WA 1BIHA 4F9LC 4U2YA 1HWHB 1U8MB 2EDDA 5KG9A 1HH9B 1MCCA 3DO7B 4FXGA 1DP0A 2GAZB 4UU9B 4C4KT 1ACZA 4IRZL 3NZHH 2NTSP 3DV6B 2UVFA 4PRDB 3CFCL 1MF2L 2MKLC 1ERNA 2H8PB 4XP4L 3HZVA 4E0RB 4UDUA 4HLJA 4X6CF 2EXYD 1FNHA 4OLVH 3F5WA 1EZVY 5E9DD 2VLJD 5T1DL 3BXNB 2R4SH 4RFNC 1OD9A 1VGKA 4FXGB 1I3RA 1HHIB 1O5DT 2JB6B 5L2KD 2BSED 1LD9A 4L4VD 4WI9A 2Y72A 2DQCL 3HZVB 1FNEA 3V52L 1AQKL 1WQVT 3OX8A 5DVMA 2EE3A 4OIBA 3F5WB 2E9WA 5HGGS 1VGKB 3BD5A 4ETQB 2CXKA 3BP7B 1T1WB 3UTTB 3WSQH 4KRPB 2NLJA 4KKBC 2LU3A 5SWZB 3QDGE 5D1XD 3OX8B 4Y88A 5DHXB 3E6HA 2D4FA 3MBED 4XVUD 5ITFA 3BRGC 3MRBA 3MRFA 4NQUA 1T80A 4HIEA 4IRJA 4RGNB 4I9WD 4WY7H 5ID0A 3O8XD 4ONFH 4MMZC 2NLJB 5D2NC 4QXWA 1A7NH 1U8LB 1H15B 1ONQB 1JF5A 2HFTA 5GRVK 5ITFB 1NPUA 4F37F 5C2UB 1F90H 4NKIL 4FQ2H 4JKMA 4RX4D 4BH8A 5ISZE 3MRBB 5EO0A 2GY7B 1NCWH 2GW5A 1BGXH 4HIEB 4IRJB 3RWCA 3C9NB 3RVXC 3MXWL 4M5YL 4HIIA 4K55A 4X6EA 3IRZA 4GW1A 2VSDA 3AFLA 3BQUB 2Y5EA 4X6DA 5EUOB 2D7MA 5E00A 5F8RC 5IR1A 1HEZA 3EOBA 3TA3A 3N85L 1J8HA 1AKJA 3O4OC 4KUZL 4GKZA 3CFCH 1MF2H 2UWEA 4KDVA 1ZS8A 4PRBB 4Y4HB 5IMKA 3VXSA 2XZQL 1UM4H 3EKCA 3TNMA 2DQUH 3K81A 4JFFA 2HVJA 3M1BA 4AL8L 4X6DB 4JY6A 3BAEL 5E00B 5E94B 5IR1B 4R3SA 2Q87A 1J0ZA 1J8HB 3QUML 4GKZB 2AJYH 4LOUD 3E2HB 5F88A 4BUHA 2UWEB 5CWSA 4D2NA 5LBSL 2DQCH 3QUYB 5B21A 3V52H 1AQKH 5IMKB 4LCYA 1P4BL 3TNMB 4QXUL 1T2XA 4NN7C 3HC4L 1H8OA 2LV4A 3M1BB 4JY6B 5F7NC 5IROC 4DQOH 1A3LL 5MEOB 1EEYA 1QPPA 3IT8D 4R3SB 3LB6D 5E8EB 3KVQA 4EDXA 3O45A 4M03A 5CWSB 4OF8A 2VAAA 1RURL 4X9FA 3L3IB 4WO4C 3BGFC 4PJDA 2WWKO 2AK4D 4M93B 4GAGH 3OAYK 1BD2D 1WBYB 3L6FA 3A6BL 3U7WH 1EEYB 2YPLD 4YXLH 3RWFB 3MACH 1RZJL 4PJGF 5DFWH 4KJPC 4EDXB 3O45B 4K8RL 1MI5A 1MAKA 2B5IB 3H9SA 1SMAA 2VAAB 8FABA 4PJDB 4XWGL 4PRNA 4JPWL 4MQSB 2Q1EA 3B2VL 4NKIH 4PJ7E 5MEQB 3L6FB 5EPMA 1RZFL 4UDTB 3OG6B 2LAGB 2R2BA 1MHHA 1CFNA 4WEBL 1MI5B 2CQVA 1IKFL 3H9SB 1YEJH 2P48B 8FABB 3TYGL 1YYLL 2E7BA 2B4CC 3V6OC 4LSRL 3KDMA 4J12A 3V6OE 4KXZH 2PR4H 3U0WL 4UIKL 2R2BB 2BSTA 1CFNB 3VH8G 3CFDA 5F7HA 1FBIL 5ICZB 1X5KA 2XZQH 3ARGC 3GMOA 3PV7A 3P4NB 3SQOH 4O4YH 3FCTA 4M7JH 3WIFA 3KDMB 1A6WH 5GRVL 2VTFA 4KRNA 4PJ9D 1QFOA 3NABH 5JIKA 2J2ZA 5DJXA 3L9RB 5EORL 5LBSH 1DQTA 2B2XL 3KPRB 4X98A 3GMOB 4DFIA 3D48R 4QXUH 2HG5B 4UINH 1JHTA 3L7EA 5FO8A 5H8DA 5TDOA 2YRLA 1IVLA 1GC1L 3ZKND 1AGEA 4HFUL 4OGYL 5DJXB 4U1MA 4AENA 2J8UA 1NFDF 3VH8A 4X98B 5KS9B 3GSOA 3BH8A 1F45A 3ULVD 4PGDA 3CFBA 1J88A 4X6FA 5BW7A 3FN0H 2A6IA 3L7EB 3A6BH 2OQJB 5FO8B 3GMPA 3FQXB 5FYKH 4IOSD 4XPAH 3S8WA 1XF2B 4KV5F 2HH0L 2V7NA 4U1MB 4HIJA 3VH8B 2EIDA 1GIGL 3PXHA 4ZXBA 5IBTL 4TPRL 3JWOH 3B2VH 3SCMD 1XFPA 1IAOA 4TUKH 3W5NA 2A6IB 3QEUB 1GZPA 1MIML 1KNOB 1RZFH 2BRRL 3PQYA 4N5UA 3ARFB 1L4IA 4YDKH 4WEBH 5A3ID 1IEBA 4FQXC 3H6JA 3QEHA 4G9FB 1YC8A 1I9IL 4CRPA 2P8LB 4NO5B 4ZXBB 2DAVA 3TYGH 2CUHA 4M48H 1MREH 1IAOB 1MHEA 3LEXA 4OLWH 3QHZL 4AY0A 3PQYB 5FO9B 4JM2C 3U0WH 4NNYB 4FFVD 3VFGL 1P9MC 3EDDA 4YHZH 1A22B 1KCRL 1FBIH 1IEBB 3FFCA 5FYJU 1DBBH 1FVCA 4X7DC 3U4BH 1YN7A 1XR8B 2VKXA 4I0PB 5IFAH 3LEXB 3DMMD 1OHQA 32C2B 4Z7UA 4U1KA 3CPLA 5EBLA 3WDHA 1KELL 3H9ZA 3CDGA 3CD4A 4LARL 3RVTC 3ZMRA 1I1FA 2B2XH 4JR9L 4L4TA 2WUBL 3UTTD 3HC3L 4AG4L 1FE8L 5GZNC 1I8LC 4AEHL 3ZE2E 4D0DB 5SWZD 4ODVL 2XKUA 3O3DA 1GL4B 2KZWA 1Z9SA 3OGOE 1QHPA 3H9HA 4P46D 1D6VL 4U1KB 3CPLB 4Q9RL 4NHCL 3H2WA 5EBLB 1A47A 1RPQA 4MX7A 3ZHLA 4DOHE 1VEMA 1UJ3A 3EYQD 2HKHH 1N6VA 4L4TB 1VFAA 3GMRB 5JXEA 4YFLI 1ACYL 3MCLH 3HKFA 3NFPA 3LMJL 4GW4A 1NAKL 1HKLL 1FC1A 3VI3F 3H9HB 1CGVA 1DANU 4ONHA 3IDYB 1WWCA 2F53E 4ODSL 4MX7B 4BFIB 1VFAB 1GIGH 1MCEA 3O9WA 3IETA 3BPNC 1RFDL 5DQ9A 1FQ9C 4HWZA 4GH7B 1MIMH 4DKEH 3RVUC 3BQUD 1OAZH 2B1AH 1JNHA 4S1RL 5C2BH 4ONHB 5J3HD 3RDTA 5I0DA 2ZG1A 4U1LA 2C1PA 2X05A 1OAYH 5AG8A 3TVMC 4F33A 4KK5C 3BW9A 3O9WB 5DQ9B 4Y4HD 5C0IA 1YEGL 3GIZH 2R29H 1R5WB 4HWZB 2A6KB 2YBRB 4LPWA 1IQWH 5CEZE 5EH1A 5IIEA 1NL0H 4PJ8A 2ZCHL 1M1SA 2PYED 4CAGA 4P4KA 3Q1SH 4U49A 2I27N 1A0QL 4TQEH 3D6GA 3BW9B 5C0IB 3QUYD 1XGQB 1RD6A 3BDBA 5CHNA 4B7IA 4OD2A 1MJUH 3NH7H 3NPZB 1QRNB 5E6ID 1MCRA 4Y0GA 4PGEB 1DQLL 4YPJA 4P4KB 1KG0A 4AG4H 4DUWA 3KPNA 3WIIL 5IJVA 2IF7A 4K9EL 4OCXH 1BIIB 1T7WA 5CHNB 4KVNL 5EBWB 1G9NL 5IB1B 1KC5L 5D71L 2IH1A 3QDMD 4NHCH 3PP4H 1QFHA 4M6OL 1C8PA 3OJMB 4WU5A 2XA8L 5D7JC 4BFEA 5D2LE 3KPNB 1IAIL 3DYOA 1AXSA 4K2UH 1ACYH 1PZ5A 3VGHA 3N0PB 1ES0A 4C56D 2B7DT 4K7FA 1GOFA 1M6OA 4Z7VA 1HKLH 1JYXA 5GS0L 4N0YH 1MELA 2VNCA 4WU5B 4LKCA 2VLRA 3VXNA 3T0ED 5HHOE 1I3UA 3TJEL 5JW4M 2J88L 1D9KA 1KTDA 1HINL 2FBJH 3ARXA 1YMME 5D7KE 1QNZH 2MQ0A 4K7FB 1M6OB 4Z7VB 4CJ1A 5GHWH 1PY4A 1DTUA 2UY6A 3WS3A 1OGAB 3UTPE 5J13C 3T4AA 5DQDL 2AGJL 5ALCL 1FGVH 5F7MC 2VLRB 3GSWA 5DI8A 3HCVB 2GY5A 1CVRA 3T3PF 1TTUA 2X9XA 4B41A 1KTDB 2MKWA 3DUHA 2J12B 2Y25A 2WW8A 1MY5A 4N0FA 3E6FB 3TZVA 1RIUL 5GGTL 5E2WH 3WS3B 1N5YH 2I5YL 1D5BA 2CIKA 4P23B 5DI8B 1UWGL 5T33H 1T1XA 1F8TH 2V9TA 5CZXD 3KPRD 3EFDH 4PJIE 5C3LD 4L8CA 3AROA 4PRHE 3ARQA 3ZE0E 1AGCA 2ICWI 3D85A 3UTSA 1B3JA 4YZFF 3MLSL 2GYSA 4ZD3L 3LKPA 4BK5A 3BP6B 1U6AH 1IQDA 5DJAA 1DQLH 2GTWB 1D5BB 2CIKB 5DMIL 1A1NA 2JKXA 5IMOA 3WIIH 1N4XL 3CMOL 2XICA 1T1XB 3OJDA 2AI0H 4KVNH 3R8BB 2M26A 1AP2A 1KC5H 4AEFA 4L8CB 3K8LA 1L7IL 2ESVA 1AGCB 3D85B 4CVXB 3LKPB 2AJVH 1IQDB 4JAMA 3TGXA 2H32H 4YDVA 3DX7A 3SDYH 1ZE3C 1OAUL 5F8QC 3OKEA 1A1NB 1KN2H 4ZAKC 5IMOB 1BBJA 4LBEB 5HHMB 1ZAGA 3OJDB 2X4NB 2FZ3A 3QNXB 4O58H 2NY2D 1EXUA 1HHHA 5F6IC 1AP2B 3WD5H 3BN3B 2ESVB 1WBZA 4P9ML 1K2DB 3RRQA 4WHTA 1BZ7A 1FNGB 5EBGA 4CMHC 3DX7B 2XTLA 3OKEB 3ARFD 1OP5K 3KWWB 1PZUB 5JHLL 4NPYA 1KV3A 4X6BA 5ESAA 5J4MA 4JZJB 4G9FD 1EXUB 1HHHB 5LGKA 2DM7A 1J11A 1G7IA 4M7KH 4M7ZB 5DQDH 1BZ7B 5K9JH 1PBYA 3BPOB 4NQVA 1JGEA 2Q20A 4LSQL 3RWGA 2AEQL 1G6VK 4X6BB 2GIYA 3MRJA 5ESAB 4ZO8A 5M94B 1S5IL 3V5KA 4L3EA 2AXFA 5ICYB 1G7IB 5FYJH 1MCKA 4XPGH 4I0PD 5GISH 3UDWA 4PJFA 4PY7A 4EI6A 5HBBA 4OI7A 5JDJA 3JV0A 5D93C 1NFDA 4NQVB 1JGEB 2IPTL 1C5DA 4JY4B 1KLGA 3VXMB 4HWBL 2LTQB 4N0CC 2LVCA 1IGML 3WNNA 2VO5A 1OGTA 5DJYA 5IB2A 4H26B 5E6YA 2OJZL 4L3EB 2VC2L 4PJFB 4PY7B 4EI6B 4JFZH 2BNRE 4N90E 4MAYD 3MV01 3BFOA 1E6OL 4OCRH 1C5DB 1N4XH 5EZLA 4G8EB 1KLGB 1U58A 2H6PA 2W59A 1B88A 3MA9H 3P4MA 3B6SB 3MV7E 5I8KL 5DZNA 2CMRL 1OGTB 4OGAC 5CEYB 1WZKA 4DAGH 2BHYA 3ZYZA 1ZHNB 1OLZA 3I9GL 1H8SA 1VACA 5AG9A 1CXFA 1OAUH 3NCYP 1HXYB 3L3KA 5IB5B 4MZ3A 1G7PA 1G1YA 1KCLA 5JHDB 1V7ML 1U58B 2PYFA 1FFOA 1B90A 3GBLA 5LGJA 3K1DA 4KHTL 4Y4KC 3GJFH 1AXTL 3BIKA 1S9WB 3S5LB 5JHLH 3RY6C 2PYFB 2IBGA 1FFOB 5AZ2L 5LWYH 2OTWB 4PJEE 2W0FA 4JKWA 2Y6SC 1AO7A 1J1PL 5T1MA 1NGPL 4JFEB 5DHVB 4I0KA 25C8H 3O4LA 1HQ4A 5GRJH 4PGBA 4ODTL 2AEQH 4Y5YA 4EVNA 4M9PA 1N64H 2FJGA 4PRAA 5JXAH 4LPUA 1AO7B 4EI5B 4IIQB 3RHWK 1JF1B 3TFKD 1C5BL 2CPCA 1CLYH 4MD0B 3O4LB 4XXDA 4TSCH 1HQ4B 2NXYB 1QRND 1ZMYA 1HYSD 5GS2D 4XTRD 2EIBA 1RJCA 4Y5YB 4HWBH 3TBVB 1YEKH 4G8GA 4NJAH 5J11C 5DD1L 1TQBB 2YRPA 1GGUA 2W9EL 4RIRA 4J1UA 2VC2H 5DMGD 4OF5A 4XXDB 3JV6A 1S7UA 4KUCD 1KJVB 4JO4H 5C0CE 3B9KC 3DETD 4HZLB 2NY7H 4H25A 3WBDA 4G8GB 1BZ9A 3TO4A 1N2RA 1UM6H 5HXMA 2ZNWA 3MNWB 2VDRH 4HSQA 3JV6B 3P0VH 5JORA 4OLEA 3ZTNH 1P5UA 3BE1L 3X3FL 5A2IH 2X89D 3TN0A 3J7HA 3TO4B 1N2RB 1DVFD 1FNAA 1TETH 5EC1A 3MLUL 3V9FA 5E7BA 1IGYB 4KHTH 5DA0B 1YNTB 4XNZB 3KPSA 2X1WL 3I85A 5AYUL 5JLZA 1TXKA 4HBCL 1OGAD 3S3SA 2HJFA 3GRWL 2R1WA 3EYOA 4G3YH 3IAPA 3D39E 3TN0B 3MYZA 3QT2A 5EC1B 4F15C 3F7YB 1N0XL 4MD4A 4NZDA 1E0OB 3G08A 4WHYH 1QVOA 5C71A 5B22A 1FCGA 1OARL 3KPSB 2VKWA 1NGWB 1C7TA 3RJDA 1I4FA 4P4RA 4P23D 1CN4A 3EYOB 1G1CA 7FABL 3BDYH 2IG2L 2FSEA 3V7AE 3PUCA 4LSTL 4WUUA 1AR2A 4MD4B 3PGFL 1NAMB 1QVOB 2W0KA 4ZUWA 4FQLH 3CVHB 2XV6B 3I6KB 1I4FB 1S7RB 4P4RB 2MHAB 4XBEH 1FRGL 3MBXL 3HFML 3TIEB 2CGRL 5IMMA 3QPQD 4J23A 2FL5B 2FSEB 4LCWE 3ZO0A 5I16B 5EFIA 2A77H 4WUUB 3AMKA 1UH3A 4YC2C 5T1LA 5I73C 4PJBA 2HLFC 3D85D 3MR9B 4XMLH 3K1KC 1JCKA 5E8NA 4KTDL 5ACMA 2WUCL 3X12A 5KSBF 5FECA 2P5EA 5HDBF 4U4BA 4G6FB 3RGVB 5EFIB 1I8IB 4F7TB 1Q9LB 2E9BA 4JRXD 5T1LB 4WFFD 4XB7A 3VJ6A 3ZL4H 3SDXB 4JFPA 1R3KA 4PJBB 1WWAX 2ESVD 4DKDC 5C70A 5I8CA 1GGTA 1K8DB 4MD5B 3X3FH 1OWWA 1T89A 3L95A 3OKLA 1ADQL 2VZUA 2Z8SA 3QCTH 3QQ4A 4JZOA 5IW1B 5F7LB 2Z0BA 2B4CH 2EDWA 4K3EH 3GMMA 3HR5A 4P2CG 3CXDH 3WV0A 5BVJB 4JFPB 4GG6F 5I8CB 1C08A 5EO1B 4YWGL 3L95B 1KEML 5DGRA 2J7LA 5E2TL 5DD0L 3T4YA 1CE6B 4P3DB 3HMXL 3HR5B 6FABL 4HKXA 5BQ7A 5J89A 3I75A 4ZFGL 5FCSH 1TCRA 2GJJA 4JO2L 1X7QA 1C08B 4PLNC 3C60C 1U8QA 1T66C 2ICCA 4AEIL 3VXMD 2H2SD 5K9OA 5F7EL 5GSRA 1IARB 3PGFH 3I75B 4A6YB 4APQC 5KTEL 4ZPVA 4XP1L 2BJML 4Y89A 1TCRB 4KKCC 5IB3A 1MCNA 5I17A 3BZ4A 5LGHL 1QLEL 2Y23A 2AV1A 3D3VE 3OZ9H 1FRGH 4HUWA 2E6JA 3WO3B 5JTWA 2GEEA 1GHFL 5I19H 1Q1JH 4GT7A 5K9OB 5GSRB 3FFDA 4R0LA 2JJSA 4N8CL 3UAJD 3O2VH 5C7XL 3OKKA 2FEEI 1A4JA 3MUGB 1EEZA 5IB3B 5I17B 3BZ4B 4KTDH 5L88L 1KTLA 3VGGA 3G5VB 3IU4L 3NBNA 4K3DL 5JHDD 4WCYL 3KYMB 4X9IA 3QDGA 4R90L 3UBXI 3FB7B 3NACH 5TQ2L 1FORL 1ZEAH 2AABL 4R0LB 1RIVL 3GSNL 4IMLB 4YBQC 1LE5A 3OKKB 1A4JB 5GJSL 1T20A 5TH2B 2W9DH 1JJUA 5SWQB 1ZXQA 1KTLB 3MV11 2X7LA 4Z9KB 1OT2A 1SBSH 1R3HA 2BNUA 2MTPA 2VABA 3QDGB 4FQCL 4KPHH 1MY7A 2G5BA 5D2NA 2E7LA 4MGXA 3PWNA 4FFZL 1UB5A 4OFVA 5DR5L 4JFED 5ISZA 3SDDC 2FR4A 2DJUA 3OF6A 1KEMH 2X10A 3VFPB 2EXWD 3JTSB 3WFBL 3HI1A 3DUSB 1AHWC 1R3HB 2VABB 5CIPA 5DD0H 3DXAA 4POYA 3VFNB 1EZVX 2G5BB 2A38A 4EI5D 2YN3A 4ZFGH 1UB5B 4JO2H 4X5LA 2CIIA 2FR4B 4JO3L 1PSKL 1EHLH 2FDBP 2NXYD 3LZFH 2EO9A 1DLHA 3HI1B 3UJTL 3ZYIA 1WJ3A 3N1QC 4XWOC 4HWUA 5E2UL 5I1HH 2WBJA 4YEEA 2VL4A 1ZTXL 3ETBF 5KTEH 3NA9L 1EAPB 1W72L 1CZ8L 1CFTB 3B9DA 2Y9RT 3LCYA 5E08H 4J2XA 3QFJE 5KSAD 4JRYA 3IYLW 4DW2H 4ZG1A 4Z7WE 4ODWA 4ZUUA 1IKNC 1Z9MA 2EE2A 2ITDA 3CDYA 4XXCC 1S7XA 2WBJB 1PY9A 4PG9A 4RDQF 4I18C 3HE7D 5C7XH 2R23B 3L5JA 1F3JA 3MV8E 3RWDB 1T5XB 4PJCF 5IROA 5L88H 4NRXA 5GPRA 4ODWB 4ZUUB 1MEXL 4WRLA 1J5OH 4LLWA 1S7XB 5C92A 4C4KO 4PG9B 1JNNL 4KKAC 4WO4A 5EU4B 5J9PA 2BNQE 3NCBB 1U93B 4HJGA 1F3JB 2C3GA 2YPVH 4NRXB 2A0LC 4XNUH 5KVEL 3QDJE 4Y5VB 4F58H 4DN4L 2CKBH 2H41A 1UWEH 5IESH 5CGYC 3TN0D 4G7YL 3TPKA 4OUUA 4OLUL 1CDJA 4WO4B 2R0KL 1ZVYA 2R4RH 4BM7A 4IRSC 4PJ7A 4PTTB 5J9PB 2W07A 3MRRA 5B8CC 5DR5H 3WN5A 2G75A 3LQAC 4UNTA 4MVBC 1I1AB 4Y2DC 1IAKA 3KPSD 2NY3C 3CLEH 3WFBH 5CFHA 2YR3A 4ZNEE 5IT2H 4BQCA 3KJ4C 4IS6A 4NT6A 1CFQB 1K5NA 1K4DA 3PWLA 3RUGF 2ZCLL 4PJ7B 5SWSD 3S97C 3WN5B 2P7TA 1PSKH 3V6OA 4UBDC 1K8IA 1IAKB 1J0IA 1NC2D 3MNZA 4S11A 3OKNA 3UJTH 1A02N 3PP3H 2NY4B 3KYKH 5DC9B 3UO1L 5JMRA 4IS6B 4XP5L 3ARGA 1K4DB 3MRMB 3PWLB 5F89B 1CR9H 1CZ8H 3QSKB 5FM5M 2P7TB 2NYYD 1BFVL 2HT4C 2PTUA 2WWMC 2KBGA 2F9BT 3OKNB 1H5BC 3PGDA 5EO9A 3FO1A 4OTXH 4Z0BH 4NNPL 3RGVD 3LKRB 3AY4A 4EQ2A 1QR1A 3HE6C 4TULH 1VFBB 3INUL 5T1LD 3NIGF 1CIDA 5FV1L 2GJZB 3ARPA 1MCHA 3HTLX 4MHHG 3VRJA 5ETUB 5JOFA 2ENSA 12E8H 3RI5F 1A7RH 3PGDB 5DK3A 4EUPH 1A64A 4EJ1C 4QTIL 4NUGL 4H0GA 1IM9D 4ONGL 3G5XA 3SKUD 1QR1B 4P5MA 1EHAA 4Z7OF 5I1JL 2ZUQB 5B4MC 5K9QI 2CK0H 5GGSA 5LCVH 2L7UA 4X7SL 5JOFB 2NY1D 4DN4H 3P11L 5DHYB 2R0KH 1E4WH 3FMGL 1QQDA 2XXCB 2WSKA 3B2UC 3EYFA 3G5XB 2VQTA 4XGZA 4WEMB 2VDLH 4ZOEA 1YY9C 1NKOA 1MRDL 4M1GH 1WEJL 5DMKB 2EDYA 4HWEL 4F9PC 3MRQB 2FNBA 4CKVX 3V6FB 1WCBB 4J3XA 3MFFB 1S7WA 1FSKC 1QQDB 1MCJA 3P4LA 3EYFB 1GGBL 2WAHA 5D9SA 2R56L 2VL5B 4FMKA 2E3VA 5C6WH 4XGZB 1MSPA 3VMNA 1XGPA 5DD3L 4KGJA 2P8MA 4JM2A 2K9UA 2D0GA 5C3TA 1JE6A 2XG4A 3UO1H 5FUZL 4CN1A 4TOYL 4M6NH 4XP5H 2XYCA 1E4XI 1ULVA 2Y4SA 3TT3L 1BQLL 2NY6B 3MYJA 3VGFA 3WXVL 5I8OL 3NGBC 4FFWC 1XGPB 1INQA 1EO8H 2XZCH 4KZDH 3GSQB 2P8MB 3D69A 3ESVF 4JM2B 3KHQA 2IAMA 5D5MF 1RUKL 4BSVA 1MHPL 4NNPH 2Y07L 2COQA 2X4PA 3INUH 3CAFA 3MYJB 4P2OD 3RZCA 2KDGA 4PRPD 1RUPH 1INQB 1CLOH 4KJWD 4D9QE 4L3AA 2DKMA 4HK0B 5BV7L 5L8KB 1BQSA 2IAMB 1T7XA 2HYMA 4BSVB 2PETA 5DO2D 3FOMB 5FHBL 5BZDB 4M6MH 4QTIH 3BJ91 3IFNH 1Q9OA 5M7QA 2X4PB 4QRPE 2XOTA 3GSVA 1F4WL 3RZCB 5D7IF 3O11A 2VLKB 2WK2A 2UUDH 3IFPA 1SQ2N 3S35L 1Z9LA 4DOHB 3PV6A 1IGTA 4JPKL 3HB3C 3P11H 3V79C 5KAQF 4OZGF 2R0LH 3OKYA 4M43L 1HNFA 1Q9OB 1ZGLA 2IADA 2P44B 4XNQA 4D9RD 2XI9A 5IV2B 3NN8A 3O11B 4CMMA 2F53B 3IFPB 2BXZA 3DHMA 5DFVD 3P9LA 1NJ9A 1RUMH 1XZ0A 3OBAA 1OP3K 2H2PD 4LSVL 2UZXB 4NM4L 4HXAL 5FO7B 2PXYC 3TVMA 1Z0MA 4OD3H 2IADB 4JVUA 2QQLL 3NN8B 4LSPL 4CMMB 3KLHC 1YQVH 4G6AD 1MFCH 5JR1H 4HD9A 1OTUD 3HMWL 3WHE0 1RZIA 1CLCA 2VMFA 5H35A 3SY0A 3TT3H 4CADA 5D6DC 5KN5A 4QTHB 1UZ6F 3WXVH 1Q72H 4HS8L 2QQQA 3HRZB 3D2UB 2K3TA 4M7LH 3LN5A 1CDGA 4XHJC 5FGBC 2DQTH 5F3HB 1IAMA 1NDMA 3KPMB 1RZIB 5F7WC 3JBG7 5H35B 5KN5B 2VOTA 1KENH 1U3HD 4PJHE 3QXWA 2EDXA 5MEND 1UGNA 1EJ6A 2E9JA 4GRWE 4WFHD 1OQXA 5BV7H 1BM3L 5D2LA 3EOTH 3EYUH 5I1EL 1NDMB 5D7JA 5FHBH 1IGCL 1NCAH 5DK0A 4H5SA 1EPFA 1NCBL 3GI9L 3QP3A 1TIUA 4P3WA 1F4WH 2KQNA 1BVZA 3T2NL 4RBPK 5BOPA 2BVYA 5INDA 5LVEA 1I1AD 3ALPA 5HHOA 4LLAA 4J4PD 2ZSVA 2ZPKH 5D7JB 1UG9A 5IVXE 4HQQL 5DK0B 4H5SB 1CGWA 1YMMA 2YEZA 1T2QL 2JCCF 1N59A 2X70A 4B7LA 4ZFOB 1F13A 4KI5F 4U6HA 5FYLD 4DGVH 5HHOB 1GZQA 1ZT1A 2ZSVB 4LSVH 2ZUYA 1XAUA 1YMMB 4PJXE 2YEZB 5JIHA 2QQLH 1MQKL 1N59B 2X70B 2EEDA 4G5ZL 4LFHD 4U6HB 2OL3B 4Z18A 1GZQB 1NEUA 3LIZL 1E4KC 1FG2B 5F6HI 2VRAA 3P3YA 4LVHC 3PGCA 4PJIA 4ZTOL 4PRHA 1EGJL 2MWCA 1RZKL 3EHBD 4M5ZH 4NQEE 4FQQA 3GM8A 1R5IB 2FJFB 2Y36H 4HS8H 5F9DC 4TRPH 4MXQD 5ICXA 4UT6H 1ETZA 3BHBA 5A2KH 3VGDA 1UB6A 4MXVE 3T0AA 3PGCB 2DTMH 4PJIB 4NP4L 4PRHB 4FQQB 1MLCA 5HI4D 2JK5B 3TBWA 5ICXB 2FB4L 1EJOL 2HKFL 1FNFA 1G0YR 1XMWA 1UB6B 2N1KA 4GXVL 5KVFH 4ZAKA 3QUXC 2DMCA 1MH5A 1IGCH 3RUGA 5L6YH 3MROB 1Y18B 1I1RA 2W92A 3JVGC 3KG5A 4MDIA 1A6AA 4WWKC 1JHKH 1MLCB 4YDJA 2V7HB 4Y16B 2EIEA 3GSRA 1OTTD 5DJ2A 1T0MA 4PV8B 2X6MA 1U8JA 7CGTA 4OF3A 4XNXH 4K71C 3REWA 2YUWA 1JN6A 2AJZA 4ODHL 1MH5B 2FIKA 4U1GB 5FF6A 1QSEA 2G60H 2Y7QA 5FK9A 1V3JA 4MDIB 1A6AB 2GSIB 1H3GA 4BZ1L 4MA1B 1F42A 4OIAA 5DD5H 5F6IB 1Y6NR 4FG6D 5E0QA 2PW1A 5LQBH 4BK4A 1DFBH 4R7DB 5HD8C 5T5FL 1VPOL 1D5MA 1U8JB 1H3TA 2YUZA 4OCWL 4K23L 1X4ZA 2Q7NA 3U9UB 1JN6B 2AJZB 5FF6B 1LP9E 1FVEA 2Y7QB 1U8OA 1UCTA 2PW1B 5EOQL 1JFQL 4R7NB 2AJ3B 2NY6D 3OKDA 4G5ZH 2F5BH 3Q3GA 3MRDA 2QHRL 2R0ZL 3EO1A 3LHPL 5FHAL 5CJBA 3ZKQD 1U8OB 5BVPL 1EGJH 3QNZA 1BHGA 1U42A 2BNRA 4EN3C 1MVUA 3OKDB 2EDEA 1ZHLA 3CMGA 4XBGA 3GNMH 4MJID 3Q3GB 4S2SB 5CMAA 3MV7A 3ZKMD 3ZZ1A 5TFSH 3MCKA 5I75B 1HIMH 1OWRM 4EIGB 4MJ4A 4ESKA 5C0AA 4N0UB 1OCWH 3KPLA 2FB4H 1MVUB 5DLMH 1JGLL 1LDSA 2VLKD 1KTRL 4XBGB 3LEVH 3ZDYE 3IS0X 4XBPA 4GXVH 2AJXH 3MV7B 5FM5O 3K7UA 3MCKB 4QHNA 3I2CH 4XVSH 2VXSL 3ARBC 1WAAE 3R06A 4EOWH 1QRKA 3R8QA 3S6CA 5ITBL 3MFGB 4HPOH 3VGBA 2F53D 4YHMH 4XBPB 5GGQL 4Q6IB 4M61A 4ODHH 4PJEA 5EOCL 5T3ZH 3WCYA 3RY6A 4D0CA 4KXZI 4BZ1H 3QUMB 1UYWH 5C1MB 2EC8A 3MUZ1 5CUSH 2P5WB 5J0BA 3VD9A 3VXOA 3RU8L 2VZOA 1VPOH 1Z3GL 4K3JH 2CLVB 3W9EB 5ADPH 4YHYB 1QLRA 1MJ7L 4M61B 4PJEB 3WDJA 4D0CB 1PKOA 2XRAH 2NTFA 4TVPL 3RGHA 2PF6A 2Z31A 5HGAA 5EOQH 4NKMA 5CJXC 1I8KB 2BSSB 3U48A 1PLGL 4PJAE 5CEZD 2VH5L 3D2UD 3J8F7 1QLRB 1AD9B 3S3JA 2GSGB 5E9DE 1J8KA 2VLJE 2R69H 1A6VH 4L29A 1VB9A 1QEWB 5CINL 2NTFB 2AERT 3L3GB 2Z31B 3WNKA 3I6GA 4JDZA 2IQ9L 4NKMB 3RPIB 3LKSA 5L2KE 4JG1H 4ELME 4L4VE 2NW2A 5E2VH 5C0CA 1QKZH 1BAFL 2EEBA 1AFVH 3C09B 5B3JE 2HWZL 2R39A 5J57B 5D8JL 1FDLH 5E99L 5GRWA 4Y8AA 1WFOA 4R4NC 3I6GB 1RVFL 4JDZB 4FOMA 4WI7A 5BS0A 1TZHA 1LEGA 2ADFL 2NW2B 3D9AL 5C0CB 3MBEC 2XY1A 2PO6D 4PJGB 3VGAC 3V7AG 4GSDH 1YEFH 4FQPA 1A9BA 5BXFB 4YIQA 4MLSA 1X5LA 4I9WE 1TZHB 1I3GH 3I3BA 1MCWW 4K7PL 3QHTC 3BISA 3AS1A 3BVNA 1ZA3A 2XQBL 3N1FC 4EQ3A 3D39A 4PLKD 5ACZA 4LCCB 4ZFFA 5C9JA 4QF1A 2X1OA 5LAXB 1AD0B 1F4XL 1G6RL 5ECJE 5D7KD 4G6JL 3RU8H 4YHNB 1PX4A 3UPAA 1Z3GH 2NY0B 4FQ1L 3MOQA 5DJ8A 3UTPD 3HPJA 3Q2CA 1NSNH 3BVNB 3HZMB 5HGHA 1ZA3B 4DWHA 1T7VA 1FG9C 3D39B 3V6ZA 5ACZB 2EKSB 1ZLVH 3H8NA 4ZFFB 4AH2A 5C9JB 5I0ZA 4QF1B 5D1ZD 2FEDC 4TVPH 3G6DH 4I3GA 3SGKC 3SBWC 3SGDH 1PLGH 3TH2T 3B5HA 5DJ8B 2VH5H 1DBML 3HNVL 1UH4A 1SYSA 1M7DA 1LE9A 1ZHKA 5DJDB 3P9WB 1CLZL 2D7NA 4LCWA 1RZGA 3A6CL 4AH2B 1NQBA 1FH5H 3WLBA 2NY5C 3C6LD 3VXUD 1KJ2L 1SEQH 4LOUC 4YHOH 4YXHL 2IQ9H 4HS3A 3RWIA 4GRMA 1AQDB 1T6WA 1SYSB 1G7LA 5IUSA 1JTTA 1KYOK 3WKML 4U1IB 1LE9B 2AK1L 5E4EB 4LCWB 2HWZH 1RZGB 3LB6C 2JCCA 4PUBL 5ELIA 5MI0B 5D1QD 2BZDA 3LQAH 4HS3B 5DK2A 1OAXL 1WC7A 4YR6A 4HCRH 4Y16D 3CSGA 3ULUC 3SE3A 4AM0A 4NWUL 4LSDA 1FL3A 1T04A 2ZP0T 1BD2E 3O2WH 3HAEB 2VLLA 4HF5H 2YPLE 5TJWK 5DK2B 3HN3A 1JIBA 1FYTA 3V95A 3P40A 1H3XA 4Q9BA 1AJ7L 2E5EA 4UV7H 4GMSL 1MWAL 3CFJA 4WENB 1B0RB 1A14L 4FFYH 5CCKL 2D2OA 3OB0K 4WU7B 1E28A 2VLLB 2XNAA 1GRWA 3ARRA 1A1OB 2RCSL 2O61B 1ZLWK 3MOBL 2CR6A 4LLMA 2HTKD 2DLIA 5DXWA 1IC5H 2EDQA 1MLBA 4QWWD 2ORBL 2VDML 4CW1A 1BBDL 1E28B 2BOBA 4GMTH 1TNNA 1FV1B 3IGAA 1RIHL 3P77A 3ULSB 2BCKA 4WI3A 3QIUD 5BO1L 3S36X 4GKSA 3P73A 1QFUH 2ZSWA 4OI8A 3D0LB 1MLBB 3A6CH 2VXTL 4CW1B 2GFBA 2IANB 1HDMA 3SE4A 5F9WC 3U36A 4ZSOA 3IGAB 5BJTA 5EULV 1QA9B 5E5MA 3D3VB 3WKMH 5F96L 1MCWM 1YYML 3D5OF 4GKSB 3P73B 4YGVA 4Z7QE 2ZSWB 4LPTA 2FX8L 4LIQL 3ZKNC 2ILLA 1KCKA 1HDMB 5D7SL 4OZ4B 3U36B 5BJTB 1HI6B 3MTRA 3ULVC 4JJ5A 3FL7A 5E5MB 4OZHF 4KROB 2P8PB 4NWUH 1VHPA 1MRFL 4YGVB 4JANA 3GBNL 2GK0A 4RISH 3CVIL 3OJ2C 4F7PA 4MAUH 1RZ7L 4PJHF 4M62L 3GI8L 1CG9A 4JFDD 2P5WD 5JQ6H 3SDDA 4JJ5B 2A1WL 3SCMC 3QIWD 1KCVH 3G6AA 1KBGH 4NUJA 4DN3L 1CL7H 1AHWA 1PKQE 2I60L 2GK0B 5C0BB 3FRUA 2E27L 5A3IC 4F7PB 2XZZA 2DQGL 4HC1H 1RJZA 5EG6C 3BKJL 3SE8H 3SGJC 4S1DD 3PABA 1UVQB 1SJEA 3G6AB 3NFSL 1RJYA 1U8IA 4NUJB 1AHWB 1T7ZA 2V17L 4XVJH 4FFVC 3FRUB 3BWUC 2QSCL 4M1DH 1G7MB 3LD8B 2QEJA 4NCC1 1RIHH 4K8RD 1NGZB 1RJZB 2WWKT 2YD8A 3QFJA 2NZ9D 2EC9T 4PIRF 4Z7WA 4MCZA 3PABB 3ZE1F 4NC2B 4P2QA 1IKNA 3BYTA 1A6PA 1S7QB 4XXCA 3MRNA 5I15L 2HMID 1A7QL 4WTWA 3FRPA 1MCOL 4KGLA 1UQSB 3MCG1 5HYSG 3QFJB 1B9ZA 4KRPC 1WWBX 3UTTE 4D8PB 4Z7WB 4MCZB 1QO3A 4NCDA 5F96H 5SWZE 3FT2A 3FOLA 2IWGA 4J3SA 3HC0A 2YD9A 1XGUA 3QNYA 2FX8H 2EZ0D 4S0TD 5AZEL 4LIQH 1ED3A 5FOJA 4K94C 3VMOA 5D7SH 2BNQA 3P4OA 3EYQC 5DUMH 4RGNC 3CK0H 4MJ6A 5CSBA 1JBJA 3MV8B 4EDWH 3VXRE 5FM8A 1JUFA 2IGFL 4N1CA 1QO3B 1MRFH 3QDJA 4LVOB 3FOLB 3WNMA 2Q7YB 1XGUB 1JMXA 3QNYB 1ED3B 2VUOA 3PIQA 4E41D 3CVIH 3DSFH 3VW3L 1U3ZA 2BNQB 2OR9H 3P4OB 2F19H 4MJ6B 5B8CA 5T1KB 1JUFB 5HYSA 3Q5TA 3RBGA 4Z7NE 1M71A 4ZUSA 4PD4J 1KPRB 1CXEA 3CFKA 1D5IL 1IGIL 1NDGA 3BQUC 5J06A 1NCUA 2L0DA 2VWEC 3PIQB 3GO1H 4OSUL 2FWOB 3LSOA 5FA4B 4Y1AA 2VWEE 3RJQB 1SY6L 1FFRA 5B8CB 1VFUA 1YNKH 1FAIL 3BKJH 3UX9B 4Y4HC 5HYSB 4D9LL 3SJVA 3BGMA 4LSSL 4ZUSB 3RAJL 1E27A 2ZJSL 4LVNB 1JZ4A 1NDGB 4P3CL 1N7ML 2X2YA 3KJ4B 4MQ7A 4OLYL 1SJXA 1CBVH 3OTTA 4UOW0 2PYEE 4XCFL 2FO1A 4YHKH 3E2HC 3ARZA 3QUYC 1YNLL 1MFBL 1BJ8A 2LE9A 1CDIA 1A1MA 3THMH 1NLBH 4LAQL 3KPOA 2ED9A 1HKFA 3CC5B 1H5BA 2OJEB 4MQ7B 5I15H 4TUOA 2DLGA 4LCWD 1K6QH 1UJTA 5L8LB 5F71A 5LXGL 3LPWA 3HE6A 4JDTL 4U1SA 5F9JA 3U0TA 3VXTA 4BSJA 4KQ4L 4DJMA 3STLA 1T6VN 5C0FA 3MRLA 4M93C 2M2DA 1A1MB 3ARTA 1RHHA 1K3ZA 4LDEB 1NCCH 3KPOB 3HUJF 4DGIL 1R3LA 3QDME 2NQCA 4TUOB 4F2MB 4ERSH 4WGWB 2OZ4L 4V1DA 3QI9D 2BVPA 5CZVL 2B5IC 3WUWG 3G6JF 2OTUA 4U1SB 1MUJA 5F9JB 3VXTB 4I3SH 4ISVA 4XPTL 3R1GL 4C56E 1RHHB 5I1LA 2A9ML 5DRNB 3F7RA 3D1MC 5I2IA 3RIFF 5KSVA 4P0DA 1VADB 4NQSB 3T0EE 1HQRA 3OJVC 2OTUB 1MUJB 1KCSL 1FP5A 3C2AL 4PYHA 3UTZA 3MJ7A 1BLNA 1IGIH 4HDIA 4G9DB 5I1LB 1XF4B 3WKNA 3UYRL 4U6VH 2AQ1A 1U92A 3HNTL 4F9PA 4KTYA 5DC4B 1CDUA 4UUJA 5KSVB 2QLVB 3JXAA 1HQRB 1YUHA 5DFTA 4PGJA 2QQKL 5JUEL 2XWBB 4M9OA 4OZIF 4OFKA 2ED8A 4LSSH 3WUWA 1CGXA 1QBML 3RAJH 3UTZB 3WHE1 9CGTA 2ZJSH 1YEIL 1BLNB 4UT9L 2QR0B 4Z77A 3SE9L 4P5TA 4LRNL 1S78D 4UUJB 4NKQB 2IAND 1S9XA 5CSGA 3GDBA 5I8EA 1YNLH 1MFBH 3MLYL 4NJ9L 4HC1A 4A2MA 5HHXH 3D3VD 1KIQA 4Z77B 1GXEA 4P5TB 1A6UH 3L1OH 1WBXA 5LXGH 5D7LA 1S9XB 5EC2A 3TC9A 2DYPD 3ECBB 1CE1H 4JDTH 5HYJD 1TQCB 2OBGA 5I8EB 2NXZD 2OK0H 2BSRA 3GKWH 4W6XB 3RX7A 3MJ9L 5E1HB 5ERWA 5KS9E 2ZUUA 5TDNB 4KROD 1CQKA 3O2DL 4U1NB 2YA2A 5J7CC 2BVQB 2CUIA 3EDKA 1CFVL 1P2CA 4F7CA 4TTGA 1WBXB 5EC2B 2C4FT 2VDNL 4NO3A 5CZVH 3QH3B 5F1NA 2BSRB 4XPTH 3NFNA 3BSZH 1UXSA 4JFQA 2ZUSA 4ORGB 4H1LH 4NOFA 5BW7C 2LAAA 3PWUB 1I7TA 35C8H 4RMSA 4J6RL 4F57H 4RAUA 1FHGA 4QRPB 3ARFC 5C0BD 1KB5L 4NNXA 3U82B 2ZWLT 4NO3B 1RUAL 5F1NB 1DBAL 3KLAB 4ZXBC 1UXSB 4G9FE 4QO1A 4WGVB 3WHXA 2YKLL 4WFGD 3UYRH 1N6UA 3HNTH 4ZO9A 1I7TB 3MREA 2K7PA 3BZFB 5DYOA 1QYGL 2PXYA 5KZCD 4NNXB 4LF3A 1NMAH 4R96A 5JUEH 2BFVH 2VDOL 3QDAA 5DVKA 4C58B 5FUOL 1I85C 2Z92A 5I18L 3AM8A 1LEIA 4UT9H 1Q9KB 4I0PC 4HUVB 3SKNB 4JG0L 1L6ZA 3MREB 5GS0D 1URLA 3OXRA 5DYOB 2C1OA 4L9LA 2EECA 2PXYB 4JCMA 4KWUA 5D6DA 4LF3B 4MLIA 1ZWIA 4MNHB 4R96B 5SX5H 4N9GA 4YE4H 3VG0L 3QFJD 3HPLA 1RMFL 5KOVC 4YBHA 1SYVB 4MWFB 5FGBA 1YECL 3KGRA 5GS3A 2ADIA 2C1OB 4L9LB 4PJHA 2RR3A 4ZUVA 1ZWIB 4ALAL 4Q0XH 4N9GB 4HX1A 3IJSB 3MV8D 3HPLB 4C83A 3WE6A 1X5YA 3U7AA 1HSBA 1CFVH 4LSUL 1XGYL 2X9WA 3IDYC 4DVBB 1UEYA 1FZOA 4YFEA 3MZGB 4ZUVB 4O5LL 3MLZL 2V2XB 4GRWB 4HX1B 3H42H 2NZIA 5JXEC 3BUYA 2FEEL 5T1KD 5CP7B 4C83B 3ZKSD 3C5JA 3LOWA 1HSBB 3JV5A 3QO1A 5IVXA 3X3GL 4Q9QL 1MAMH 4J6RH 4E42A 2X4SA 1EERB 1KB5H 1FZOB 2BRQA 1RUAH 1BVKA 2KQMA 2BY2A 2Q76A 3HZYB 1EO5A 3CSYA 3BUYB 3X13A 3O9WC 1RHFA 2B1HL 3C5JB 3QO1B 4DKAA 2BP3A 5IVXB 2E6QA 3ULUF 4PJXA 2J1KA 1QLFA 1QYGH 5F7DA 5DZOA 2R8SL 3O3EA 5H94B 3QJFB 2FD6L 5E56A 2D7QA 3X13B 5TE6L 5ID1A 2VDKH 3V5DB 5C0JB 5I66A 1MAJA 4JG0H 1AI1L 2AW2A 1VSCA 4PJXB 1MNUH 4HKBA 4YQXH 1HYSC 4XTRC 1KCUL 4NQEA 4NQDB 5F7DB 5C6TL 3O3EB 5CBEA 3EBAA 3G5YA 2L4OA 2CK2A 2AJUL 15C8H 1HCFX 3AB0C 2DWEA 1LO4H 5ID1B 1NCDL 3RL1B 1FZKA 1YECH 2ZUXA 5GGVL 4HKBB 1QACA 2HT2C 3O3AA 4MHHI 3KYAA 3DETC 4Z8FL 3DX8A 5CBEB 4L8BA 5DDHA 4ALAH 1N8ZA 4UAOB 1FO0H 2DWEB 2FGWH 4TNVK 1FZKB 3MRGA 4OGXH 3QUXA 5IBUG 3O3AB 1F6LL 3OPZL 1RK0A 3JVGA 4WWKA 3DX8B 3REVA 4O5LH 1CGSL 1JGVH 5C08E 4L8BB 5DDHB 4DZ8A 1U0QA 4XH2B 1N8ZB 3W2DL 1NH6A 1U36A 3I50L 1KJMA 4Q9QH 3NMEA 4Z7QF 3OKOA 3MRGB 3DVNA 5E95B 5K33A 2YD7A 2EEAA 3UJIL 4HG4J 1RK0B 3HS0A 1Q94A 1P7QA 4Y19E 1K4CA 1OGAE 2AAVA 5CJQL 3HG1D 1N6QH 3M8OL 2EIZB 4F8QA 1BZQK 3R4DA 2D7OA 5GGRY 2B1HH 1YMHA 3MV9E 4KQ3L 2YD1A 4AK1A 1LP9A 3ULVF 3DVNB 3NCFB 2NY5H 5DWUL 4H1LA 1UZ8A 3LH2L 4FN0A 4XPBL 1JPTL 2VZ3A 3HS0B 1P7QB 1K4CB 4P23C 5SX4H 3RBSA 1FAKT 5TE6H 1PEZA 1YMHB 1L7TL 3GSNB 5HPMB 1QUNA 3HUJA 1LP9B 4KJYB 4QXGH 5ENWA 1MPAH 2N7BA 2YUXA 3IB4A 1UZ8B 3T04D 3T3ME 1I7RA 4I8DA 1EFXA 1FLTX 3F58H 4ZS7H 3ULUH 3QPQC 1DBJH 2F74A 1QSZA 5DA4A 4EN3A 5C07D 4AIZB 1T83C 1E6JL 4PLOB 3JV4A 3LAFA 3PWJA 3MRCB 1PDKA 2R0WH 5IHLB 1A6ZA 1MJJB 4DVRL 3QCUH 3MGTA 1EFXB 4PREA 4X83A 5HI3D 2G2RB 3BP4A 2I24N 4JEGB 3WNOA 1EUUA 1RUQL 4YDIL 4EN3B 4D9QD 2YWZA 3IS1X 3MLRH 3JV4B 5EU6D 4JRXE 3QBTB 4WFFE 4NSKA 1A6ZB 4P99A 4GAYB 3VXPA 2A9NL 3OPZH 3MGTB 4FZEL 4PREB 2DBJA 1WAAA 4QRPD 1Q0XH 1CICB 3MGOB 1A9EA 3BP4B 3O6ML 4M8VA 2W1NA 2DM2A 3LKNB 4XCEA 4JZJC 1FNSL 1W72B 1YJDL 3QPXH 4RGOL 3VCLB 4PFEA 4HFWB 4M7ZC 3U46A 3VXPB 4X4ME 3UJIH 1I1YB 5T3XL 3WIHL 3VFTB 1A5FH 3BPOC 3M8OH 3SKJL 1A9EB 1N5AB 3CH1B 3PDDA 1PD6A 4XCEB 3OAUL 5A16A 5IOPB 1CCZA 2H26B 2YRZA 2Z91B 4EKXA 4CL7A 3MRKB 4MJ5A 3FQNB 1X5ZA 1JZ7A 5TPWH 1M7IA 1AGFA 3U46B 4XPBH 2QBWA 3LH2H 3ZYOA 1U2HA 3GKZA 5HHPA 4WJ5A 1R5VA 3VRLE 4NDMA 1H9VA 2VXQL 4JHZA 5DTFB 2H2SC 4YHIB 5A16B 1T1ZB 1XR9A 3LRSB 4JLRA 2DL9A 1QZ1A 2ZOKB 3CLFL 2VLJA 2RFXB 3QWRD 4NFCA 4N5EC 5E9DA 1M7IB 3OR7A 2ADGA 4KAQH 2WNGA 4O2CB 5HDQH 3BKML 2D31A 4WJ5B 5EUOF 1R5VB 3TBTA 5FAAA 4NDMB 2EDHA 4UILH 5L2KA 4ELMA 3ULVH