2DLEA

Solution structure of the fourth fn3 domain of human receptor-type tyrosine-protein phosphatase eta
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
104
structure length
104
Chain Sequence
GSSGSSGAIQVFDVTAVNISATSLTLIWKVSDNESSSNYTYKIHVAGETDSSNLNVSEPRAVIPGLRSSTFYNITVCPVLGDIEGTPGFLQVHTPPVPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the fourth fn3 domain of human receptor-type tyrosine-protein phosphatase eta
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Receptor-type tyrosine-protein phosphatase eta
total genus 7
structure length 104
sequence length 104
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dleA01
4CU7A 2MSPA 4MAUL 1H0DA 3DECA 4JGJA 1H8SA 3HE6D 1MRFL 2NY4D 1I7ZB 3LPWA 4YQXH 4XWGL 4B7LA 1U8JA 1KJ2A 1I3GL 1TMCB 4ZXBB 1J5OH 4JRXA 3BZDA 2VDML 3THML 1D6VH 2QHRL 3D39D 2UWEA 3EJZD 3NCEB 4JJ5A 1M7XA 2VXUH 4CVZB 2B2XH 4DAGH 2IC2A 3TYFA 2EE3A 1S3KH 3W39B 1IAOA 1S7RA 2K7QA 1JJUA 2BVUA 4I0PD 3OG4B 2EO9A 4G7YL 2IQAB 4NQCD 2GFBB 1RJCA 3B5GA 3TA3B 3EYSL 4LSRH 3IDMA 3BEVA 4ZFGL 4BK4A 1DQLL 2X4SB 3PNWA 2VXUL 4NOBA 4XP1L 2NLJB 3AMKA 1BWMA 5C0AD 2ZUUA 4YPGB 4BJLA 1JRHI 3U9UB 4I2XE 2LE9A 5IJVA 1IQDA 3WDHA 5HHXL 1H9VA 1HHJB 3RWFA 2ED8A 2HWZH 4TULH 5SWZA 1YYML 3H3PH 4Z78B 3LQAC 4ONOA 3BRGC 3KPSB 5D1QB 3S7GA 3WBDA 2WMPA 5J9PA 4KI1A 4NO0D 5I76B 1F8TL 4WV1B 1E4WL 2YUXA 3IU3A 2YMXL 5B38B 1TTFA 1PG7W 2VE6A 4OB5H 4XT1C 3VGHA 4Z7OF 1MHEB 4DGVL 3VFSB 4TTDC 2HFEB 3FOMB 1GGUA 2NY3C 4J4PC 3QXUA 2JB6B 3RP1A 2EDJA 5FYJL 4JFDB 1OTTC 5IW6A 4XXCC 5F3BB 1AGBB 1YEKH 2XIDA 2I27N 4U05A 2OR9L 1Q0YL 2J8UA 1LNUB 2BOCA 4NZRH 4FQXB 5F93C 2H32B 4O2EA 4A2MA 4DKDC 1P6AB 2ICEA 3FRPG 5CP3A 4UTAH 5T1LB 1D5XB 1BVLA 2OL3H 3H9SA 1JVKA 4EI5C 1EAPB 5EU3B 5B38G 3HUJB 1AGFB 5D2LF 3CXHJ 1F3RB 4U6HA 3UTTD 1QR4A 4X7SH 5C0AB 3GMNA 4FG6D 4I48B 2PXYA 4KKCC 4XBEL 2CRIA 1NUFA 1YMME 4ELKA 1A6UL 3QSKB 2F53B 2BVYA 1MFAL 1LD9B 1HXMA 1YY8B 3AC0A 2FGWL 4NO3A 1K5NB 4XGZB 4L3ED 1A6TA 2QSVA 1T89A 4JFDE 1J10A 1FZOA 5I1GL 2XQYK 1P2CB 2B7DT 3I6LD 5F9JB 1RIUH 2VXTH 3FFCE 3ABZA 3TBWB 4WDIB 2HT3D 5D5ME 3CVHH 3HMXH 4OT1H 5HDLA 3UTOA 3KWWB 1EO5A 3PGDB 1FYTA 3X3FH 3B9KC 4P23D 2BVQA 2HJFB 4KTEL 3HA0A 4O02L 1X44A 4WHDA 3O0RL 5F7MC 4NZTL 1IGCL 3H9SB 4Q6IB 4U6VL 1LILA 3WO4B 1X5ZA 2MMXA 3N1QC 3RWIB 2ITCA 4MCZB 1F3DJ 5IIEB 2XKNB 5HHOB 4O9HH 3WUWG 4XWOC 1JPTH 1JTPA 4C55A 3ARPA 2PYFA 4X4XA 5FV1L 3RUGA 4N68A 4H1LB 4BSWA 3QUMA 3BXNB 2BXZA 3R4DA 5BVPL 3G04B 3QFJE 1MF2H 4U6YA 1NEZG 1KJVA 1PG7L 4U1JB 2VL5A 3EDJA 1J0ZA 4NZTH 3GK8H 4L4VB 2LTQB 2BHZA 3LIZL 4Q9QL 3B9VA 1MREL 5KSVB 1WCQA 1JYNA 1MWAA 3GRWH 3MODH 5IQ7H 3BWAA 4GFTB 5EG6C 3RWDA 3BE1H 3BISA 2QQLL 2XZCH 5K9QI 3TBSA 2AJYH 2EDTA 3IJYB 1OCWH 2NY1D 1AXSA 4PTUA 3SE3C 4HKZA 4M7ZB 3NFNB 4LLQA 2ENSA 2R2BB 4HCRL 5T3ZL 4RGNC 4PTTA 5CIPB 5D72L 2WWMD 4OCNC 4PGDA 5A2KH 5IFJB 1I1AC 2YC1B 3CC5B 4JZJA 5GRJL 1YNKL 5JHDE 2IAMD 4ISVB 3DVNB 5FYKL 4PRHA 3O45A 1HILB 5EBWA 3RJQB 2JF1A 4Y2DB 5HHOA 1WZMA 4ELME 3VXUB 1YEGH 3QQ4B 3VXTA 4ODBD 4BFIA 2FIRT 1Q9OB 5IM7A 3RX8A 4KFZC 3GKZA 1MCWW 5JA8B 1J8HE 2IH1A 3GSOB 5SWSB 1KBGH 2VR5A 4L8BA 4PJAE 1D5XA 5T1KB 4ZD3L 3LB6C 4P48A 3CVHB 4FMKA 3O3BA 5FO8B 3HRZB 4P5KA 5EU5A 3E8UL 4U1LB 5C8JB 2X44D 2OM5A 3NBNA 3VGDA 1P7KA 5EZLA 3LD8C 2IPTH 3M07A 5EULV 1RI8A 1MOEA 1RD6A 1Z9OA 4Z7WF 1MSPA 2I9LB 4D9LH 1UXSB 4UB0L 4LHQB 4G43B 4K7PL 4LPVA 1RJZA 4JANB 2RJMA 4JLRA 5IB4A 4M9PA 3WD5H 1MCNA 3SO3B 1KT2A 1FG2B 2BVTA 3L3IB 4PLKD 3LEVL 2D31A 4ISVA 3OJVC 3IDYC 1J1XH 2LU3A 3ULUD 1MNUL 2VSDA 3ZDYF 5D8JH 5DJDA 3FB5B 1YJDC 4DVRL 4HD9A 3MUJA 2CLZB 4H0GA 8FABA 4G8EA 4DW2L 2VDQH 1WISA 5JHLH 3MCG1 4CU8A 2DQJH 1MHCA 4OQTA 3PV7A 3SDXA 2MNUA 5F1IA 4P2RB 4U1GB 5DEFA 4R7DB 5E8NA 4J3OC 2Z9TA 2A1WH 2VC2L 1HYSC 4GG6E 1IGTA 5JQ6L 2YPVH 1VSCA 2AGJL 2VAJA 4HPYH 1I9RL 4EI6B 1QSFB 1T1YB 1GZPA 4IRJA 1FO0A 3H9HB 2BK8A 1G6VK 2VITA 3P73B 3QEHA 5F88A 1MAJA 5ESAB 1GGCH 4PRIA 4WHTB 2EDWA 3B3IA 4QRQA 3VRIA 3QCUL 4XVJL 1PYWA 4NQVB 2B2XL 3S36X 4NBXB 2X6MA 4NQCE 1NUGA 3BIAX 2MJWA 2ZG1A 1IGML 2C7UA 4HWZA 5A16A 3QCVL 2XZAH 5FGSA 2XFXB 5IB3B 1AHWB 4Y88A 4MVBD 1A6ZB 5K33A 5GRVL 4MDJA 4WY7L 1MH5B 1UM6H 2X89A 1TETH 3AU1B 1RJYA 5JUEL 3BEVB 4U7MA 3WJJA 1O0VA 4ZO9A 5DQDL 5HYQB 5FYLE 3QIWC 5I75C 2XWJA 1NCTA 1JHKL 4TVSa 2IGFL 4MSWA 4AIZA 3HZVA 4P4KC 5DRWA 3QXTA 1AD0B 1BFVH 5HI3D 5C08B 4ZOAA 4ZTOH 3QI9C 3QFDA 4EI5B 1O7VA 2DBLH 4WO4A 3C5ZA 3KPSE 5BV7H 4WGVB 2FD6H 1KJMB 1VA9A 1QRNA 2WINA 1IKNA 4ZNEA 3T09A 3DXAD 4OZ4A 5T33H 3ARTA 1II4E 4X6CB 1IEAA 5F9OL 4P2YA 4R4NC 1XGQA 5B39G 5JOEA 3KS0J 4JGMA 3P4OA 1D5IL 2BNQB 1J87A 2X4NA 4HBCH 3DXAA 3VFGH 4QWWC 4N8CL 3TO4A 3V0AC 4K3HA 1IGYB 2PF6A 3BGFB 3EOTL 4P4KD 3VI3F 5IT2H 2ZOLB 5GZNC 2PCPB 2PETA 1Y6NR 1ZHBA 3CDGA 3AU1A 4FQ1H 1RIHH 1AR1C 1PQZA 3OQ3B 3CMGA 4PFEA 4LSVH 5EOCJ 5LKNA 5F96L 3GMOB 5DDHB 4S1RL 1KFAH 1QLFA 5IV2B 1R5VB 3UTSB 4LPUA 2R2CA 3QFJA 3UEZA 4NBYB 4JKWA 4IOFD 5DZNA 4GAJH 5L6YH 2EDEA 3EO0A 3BMWA 3TVMD 4OV6F 4PGJA 2R1YB 2VB5A 1ACZA 3HZYA 4NNPH 2XWBA 2X1WL 5HTSA 5C0EB 1MY5A 2EDRA 5H8DA 1DLHA 4HAGA 3QUYD 4K8RC 5CEXA 2V2TA 2AP2A 4KTDL 1CTOA 1EJ6A 1DVFC 2VIRB 1JGUH 5GQBA 3WSQH 4PBVC 4NYLA 3I2CL 3AAZB 5CCKL 3ZKQD 1MQ8A 3S97C 2Q8BL 1HINH 1W72B 4CN6A 5DGRA 1JV5A 2E7LC 1F45A 3D2UD 3VWKB 1I8KB 1H8OA 3AB0B 3KWWA 1I7RA 3OAUL 4L8DB 4QRRE 5IHZB 5IESL 2C7UB 3QHFL 3UO1L 5JLZA 5I8KL 2C3WA 4OIIL 4R4FL 5FUZL 4WW2F 3ZE1E 3QFJB 4WY7H 5TQ2H 3C60B 3WJLA 3BQUC 2P49B 3OR7A 3BKJL 5DRNB 4Z77B 3O3UN 1V3MA 3VFTB 5C09E 1IGMH 4KHTH 3ZE2E 5EU4A 2EDYA 3SDCC 3V8OA 4IOIA 5I1KL 4G8GA 5FECB 4N0CC 4PR5A 3RNQA 4WI3A 1ROWA 1A7OL 2ATKA 3V0WL 4OM1H 2AI0H 3NACH 5GGRB 3CX5J 3NN8A 1I3RB 1ZHLB 1AQKL 1T2JA 4Z8FL 3UTSE 4JRXB 4I3RL 2DLGA 3Q6GH 5ACMA 3O4LA 2CDEA 3BW9B 1KB9J 4NDMA 5DRZA 2AW2A 1A6WH 5TF1H 4IS6A 1JTOA 1NANI 3FO2B 3GEWB 3B43A 3DSFL 1AGDB 1F11A 2QQKH 1SEBB 1BGXH 2EDHA 3VFPA 4E41A 3AVEA 3NFNA 3HFMH 3GMRA 2W0PA 1S7WA 1QSEE 3DO7A 4LDEB 2JJVA 5E99L 3GIVB 2HRPH 4DVBB 4PB0L 3F6LA 2OZ4A 4OZHA 2F54E 1JF1B 4YBLC 5I71C 4Y2DA 3HAEA 3SDXE 1RZKH 4DN4L 2ESVA 3MRBA 4FTVE 2XWTB 3IF1B 5DFVD 4X5XB 5E6ID 2OJEB 4XPFH 4XC3L 5EZIL 3RTQD 4X9BA 5JDSA 4JG1H 2QSQA 1W72H 1ZLUK 5CUSH 4TUOA 1QBLL 2BVOB 4EDWL 3HC0A 5C6WH 2BY0A 1NCCH 3MRCA 4ZG1A 1M7IB 1LEIA 1XGTA 4IMKA 2DQFA 3U9PL 5LGHL 1KB5A 1T3FB 5ESVB 4NM4H 2W1NA 1PJ9A 2EH8H 4ZTPL 3IKCB 3BDBA 1ORSB 1P69B 3I50L 3IAGC 1DBJL 3D48R 1JBJA 2Q3ZA 3OKYA 1IC4H 4XMKH 2YPLA 5DO2D 4M8QB 1YEJH 3ULUE 2BSRB 1S7TA 1G7HB 3FJTA 3RGVA 3RZCC 4JHBA 5JZ7C 3QB7C 3PWPB 4HF5L 4GAGH 4TN9A 2QV2A 3KPOA 1FAIL 1S5HA 3EZJB 5D7JD 4KXZI 4YIQB 1B2WH 3HZMA 3VG9C 3KPRD 4K9EL 3ULVL 5F9AC 4F8QA 1AH1A 1FZOB 5JR1H 3PHOA 1EA9C 3QHZL 1AE6H 2DQGH 5D1XA 3TBVB 1VCAA 5DURD 4BQBA 1MLCA 3U7YH 5JLZB 1H3WM 4D8PB 5JO5A 1TQBC 2V7NA 5LWYH 3HMWL 4D9QD 2ZNWA 5MEOA 3SDCA 1AFVH 3QG7L 1A9BA 4Y5YB 3P77B 3W2DH 3N85L 4LEOA 3KPMA 3KXFD 3IETA 4OCSL 4ZAKA 2CK0H 5GISL 5HHVL 3UROR 4HUUA 2G2RA 1TZGL 1V7NH 1NLBL 2R2EA 1U3HA 2DQGL 3T1FB 3PWUA 1RURL 2MKLC 3QZWA 1YYLL 1K3ZA 5EC1B 1X5AA 3SKOB 1SYVB 4K55A 4XCEA 1NBVL 4JZNA 4HUWA 3LKRA 1BF2A 4X9HA 4NO5B 4R0LA 2H6PB 5F21B 4M1CD 3SDAC 1BJ8A 1JNHA 4Y4FA 5KS9E 3BRFA 3O3DA 3ZKMC 4RFOH 5CZXC 4I4WA 3WLBB 1BEYH 1BHGA 4JO2L 1HEZA 4PJEB 1G7PB 4XTRC 5ANMA 3TWCL 3V52L 2NY3D 2DKMA 4HC1A 4Y1AB 5FIEA 1KIPA 5IB3A 5IB1A 4G80A 5KAQF 3HG1E 3QXAB 1A3RH 2AEPL 5GRUL 1UZ6E 1XZ0A 1TVBA 4DVBA 1WITA 3D0LB 2NX5B 4JPVL 3S6CA 4AEIH 1FL5B 5H35B 5A3ID 2AK4A 3ZDZF 1EXUB 3JUZA 5T3XH 3QCTH 5B8CC 3OXRB 3F12A 5C08E 1XR8B 1GGIH 1DVFA 3LZFL 3Q6FB 3TCXA 4TSAL 4PJEE 3ZO0A 1TZIA 1IQDB 1EHLH 2ZCHH 3UX9B 1NCNA 3U0PA 3KXFA 2YWYA 2W9EH 4OCLC 4YXHH 3O3BB 2DM2A 3GSNH 2HFGL 5AG9A 1EO8L 2OTWA 3I6KA 3IJHB 4J1UB 5TH2B 2A73A 2OQJB 4XPBH 3P11L 4I77L 4OTXL 3WXVL 1P84K 4KH2A 4JKPH 4W6YB 4X4ZA 4ETQB 2XG4A 1L0YA 5EC2A 1T7WA 5E56A 5DO2C 5TF1L 2VO5A 3B9KB 1TPXC 4QRRA 2G9HB 1T1ZB 1RY7B 3LKNA 1K8DA 2A6KB 4PGDB 2Q87A 3P30L 1DQQB 2ZOLA 3FFDA 4PJFA 4EIGB 4EKXA 3VXUE 3PP3H 2E6PA 2XTLA 1G9ML 5GGQH 4O00A 1UXWA 4J3WA 1JF6A 1DP0A 3VXNA 3GKWH 1QSFE 1U6AL 3SDAB 1CFBA 1GIGL 4GAYB 1XIWA 4BQ9A 3P2TA 2AJ3A 1TNNA 4L4TA 3PQYD 2DB8A 5TDPB 4EUPB 3O41B 3MXVH 1NC4D 5SV4A 3QNZA 4MAYD 4MNHB 5DJAA 4M7LL 4JFEB 3LKPB 1YUHB 2VR9A 1FP5A 3WNNA 4LQFL 1X5GA 2X4PA 3S88H 4EEEA 4MB3A 3C8KB 3FONA 3QZWB 5IGXL 5DHVB 2X1XR 1ZANL 1INEL 3I84A 5J11B 4X7EC 1ADQA 3KPTA 4BQCA 1Z9MA 2DBJA 1VFUA 4PJGF 4NQSB 4XRCA 1HXMB 2ZUYA 5ESQB 1I1RA 5E5RB 4GKNB 5J6GA 2BCKA 4HIHA 2EE2A 1FFNA 4QXUL 4GQ9H 3ARGA 3DMMA 4DKAA 3DV6B 4HWBA 3Q1SL 2HT2C 4PUBL 4WDIA 4OFPA 2AV7B 2WBWB 4R3SA 4EXKA 1HEZB 4PJEA 5DI8A 2DM7A 5C0RL 4LMQE 1W0WB 2YUVA 5IMMB 8FABB 1RU9L 4PJ8D 5F6IB 3UTTE 1BJ1H 3N1FC 5DMJB 4HS6B 3CUPB 4BA8A 4S1QL 1QFWI 3N50A 5LJYH 1LO5A 5J3HC 3STZB 3VFTA 1SYSA 4HKJA 3ARZA 2W65A 1NH6A 3RVVD 4FQLH 4MCZA 4ZUWB 2JELL 1FZMA 1HQ4A 3MRMB 5CJOH 2M2DA 4ONHB 4KMQA 1RMFH 3GMQB 4P4RB 4PJDB 3FB7B 4H8WL 5GGRA 3S37L 2C3GA 5HI5C 1REIA 5HYSG 2WAHA 4HKXB 1PDKA 4HUKB 4KMTL 4U6YB 2NYYC 1CBVL 3LKOB 1EK3A 2HFGH 4LVNB 3BAEH 4RZCA 1UADC 2Z31C 3U83A 3LRSA 4HS3B 1ZT7A 1MRFH 5HYIA 4X0KA 1IEHA 3GBMH 1NSNH 1OTSC 5HGAB 3DETC 3ARFA 5LCVH 4JFQB 5I16B 3C5ZC 3VFPB 4Y8AA 4FP8L 4PP2B 3IRZA 5KN5B 5KJRH 4PJ9D 5EU6A 3LPFA 3V6ZB 3BP7A 4Q74A 3S35H 2GK2A 4MDJB 2QADB 1U2CA 3RWGB 1LO3L 4FFZL 1C16A 2FZ3B 1JPST 1MEXL 2VE6B 4LCWE 4UU9B 2JJSA 5IR1B 2Y06H 4X6BB 5D6CB 3ULSA 4IDJL 3C5JA 1FNFA 3CSYB 4YDIL 2ZOKB 5ETUB 1WBZA 1HQRB 2DLTA 4JO2H 3S5LG 5INCB 2QADD 1F90L 4G9FB 1N64L 1ZLSH 4DZ8A 1UKSA 5IW1A 2YUZA 3RWFB 3SQOL 3FO9A 5JXAL 4DUXA 1KB5B 1T3FA 2OMNA 2QR0B 3PWVA 2D9CA 5GZND 2BNRB 4S1SL 5E6ZA 1NGQL 1UVQA 3ULVD 1PSKL 3JVGA 1MFBL 3OHXA 2AKRA 1B0RA 2UZIL 5B4MC 2VDRH 5GS2D 1NLBH 3TPUB 2YPLB 3LOWA 3MRLA 2GJZA 4KI5E 3NAAH 4U7SA 5FYLH 3WFHA 3QO1A 4FQQA 5ANME 4AT6A 5JW4M 1Q0XL 4WI4A 1JPGB 1I1YB 1FNSH 3MOAH 4LSTH 4LSSL 5CP7A 1T0NB 1ZHBB 4LDLB 1KOAA 4M3KB 5GS3A 4OLWH 3SEPA 1K5NA 4P4KB 5ACLA 4PUBH 3VMNA 5IMMA 3KYOA 4LASL 5BVJB 5GZOC 1F97A 5GGVL 4NRYA 4AQOA 1MFCH 3U2SA 4PRHE 5E94A 3IB4A 2QQNL 1LO0L 4ZPVB 3MREB 2EKJA 1BOYA 4K3EH 1BD2B 3ULUC 3CFCL 4KRPB 3GSXA 2CK2A 4PRAB 3WNKA 1BAFH 4H5SA 4IOIB 1J05A 3VWJA 4M61A 1ZVSB 3C6SB 3MFGB 4DN3H 3LKSA 3FFCD 2F19L 4JDTL 2VRAA 2YRPA 4HXAH 4IRJB 1NDGB 3MRNB 4RZCB 3MRPA 1OGTA 5J06A 3OSKA 5CZVL 3W11D 1Z5LA 1U93A 5J11C 3RI5K 2BNUA 4DZBB 3UYRH 4UB0H 3VFMA 4Y4FC 5IMOB 1U3HC 5DFTA 4FA8A 3F7VA 1SVCP 35C8H 3MCLL 1KXVC 4OZFG 4BKLA 1CDGA 3DO7B 1DEEA 3FB6B 5DVNA 5L2JA 4WW2C 4CRPA 2ICWI 3H9SD 2W0FB 2HTKD 5H35A 5TFSH 4HKZB 3ARDC 4K7FB 5I2IA 4J6RL 5D2NC 2SEBA 1CCZA 2QQKL 4X4MA 3ZTNH 2PYED 2VISA 2YZ8A 1ZLWK 4P46B 3EYOA 3V5DB 2VYRE 4D0DB 2IG2H 2AXGA 3CD4A 4NFBA 1JWSA 5KSBF 4YXHL 4MA1B 1NGZA 3BYTA 5TH2A 1CIUA 3MRQB 4N8VG 4PJHB 3GBLA 4FQ2L 1QBML 2XTJC 3HPLA 1GGIL 2H9GA 3IKKA 3S4SA 5EN2A 1SEQL 2P44B 1KTKE 3O8XD 3QNYA 2HKHH 4PJIB 2YK1H 1G6RB 1VGKA 2VZVA 5IKCA 4LLMB 4G9FE 4X9GA 4OLUH 1NMCC 4M7LT 5HPMB 2WBJB 1JZ3A 1KGCE 4MQXD 3MRBB 1XGRB 3HS0A 4GRLD 3SJVE 3Q3GA 3HRPA 4XB8A 4NJAL 3FKUS 4G6ML 1CZ8L 1A1OB 4DJMA 3UPCA 4RAVB 1KF9B 3BP4B 4Y19E 1JPTL 5C0IB 3UTQA 3ZL4L 4LLUB 3OAZH 1X5HA 5HY9B 4J8RA 1Q94A 2QQNH 5SWQA 3X3GL 5J7CC 3KPQB 3S37X 3D9AL 5IB5A 2ED7A 4GS7B 1KYOK 5IHUL 3D3VE 4Y0GA 1KN2L 3HR5A 3L3KA 4RFEA 1QFHA 2FIKA 2GYSA 2VQTA 3P0YL 5HI4C 4XP4H 2C5DC 3RWEA 1UCTA 3D39A 4U1JA 1PW3A 2YRZA 2ADJA 4OZGB 1UZ8A 3JUYA 4OUUA 5D7IB 1FFOB 2XY2A 3MLRH 4LSSH 5E8PA 1OGTB 5EFIA 1S7UA 1XEDA 4OFDA 3VXPB 5I71B 2YZ1A 3T0EB 2BY3A 5D1QD 2X7LB 2J6EH 3LN4B 2DMCA 4P2RE 3FOLB 3QDGD 5LAXB 4XPHL 2BNUB 4HAFA 1OD7A 2VLJD 2FBJL 1K6QH 2LABA 1OLZA 3DURB 1CXKA 5BS0D 1MLCB 1DQMH 3C6LC 4WJ5B 1MCQA 4MD4A 2CLZA 1OAXH 5EUOF 4OFYD 3T0ED 3T3ME 1RIVH 2HLAB 4ODTL 4YBQC 5INDA 3CSBA 1YEIH 1W0VB 2L4OA 1INDL 2R2HA 5JXAH 4OI9A 5K9KB 4GRLB 1FN4B 4QXWA 5AEAA 1DBAL 3WFDH 1ZA3A 5DD5H 2Z4QB 3EFFB 2NLJA 2VDNL 3F5WB 5SX5H 3MOBL 4EDXB 4WW2A 3S98A 3BPLB 4OF8A 2VXVH 4X5WA 5MERB 1N64H 4P99A 5FA3A 1GZQA 1JPFB 3ARDA 4LLYB 5MHSE 4HUWB 4KKBD 4MXWH 3GSVA 1LO3H 3G5XA 4FFZH 4JO1H 4NO5A 4R0LB 3CPLA 3UTZA 1DTUA 5ESAA 1Y18A 4S11A 4X0KB 4FQHA 1C5BL 1U8MB 3KR3H 2XQBL 1F2XK 1YC7A 3MV01 5I0DA 3CVIL 4NNYA 3PABB 4OCMC 2E9JA 3MRKA 4M43H 4ALAL 2HAZA 4QY8B 4ZQKB 3BZ4B 4ZYKB 3NIDE 1U8IA 4MJIA 3O2DA 1MCLA 5T3XD 3ESVF 2IBZX 3ARRA 1HHIB 2APFA 1ED3B 2VLJB 4M00A 3C5SA 5GGSB 4KI5D 3OXRA 5GIRA 1HH6A 1JHTA 3BH9B 5F7HA 2YN3A 2ZCLL 4M1DL 3JWNC 4OLEA 3LDBC 4JFXA 2AJZB 4P23B 1QBBA 4LLUA 1KCVH 4ZXBD 4B5EA 2AABH 3PL6B 1R0AL 5B3NA 1L6XA 3D5OF 1M7IA 4Y2DD 1LEIB 4XNMB 1X7QA 2NTSP 3PHSA 4PJEF 4PG9A 3QJFA 3TZVB 2NW3A 4O5LH 4KK6C 2WUBH 4S0TD 5DLML 1B0RB 2APTA 2ZUVA 4PJ9A 4MZ2A 2R0LL 3TPUA 4MX7B 1FC2D 3TEUA 4CGTA 1C8PA 4XHQA 2J7LA 5DHVA 2PKDA 2J5LC 3BN9C 5F1NB 3KGRA 2P5WA 1LK2B 4XVTH 5C0RH 5J1AB 3T0EA 3RDTD 3G08B 1F4HA 5D7LE 4WO4C 2HLFC 2P5EB 4WCYL 4MYWB 3BZFB 3QHFH 3VFOA 5ICYA 5FK9A 3KAAA 4PJIF 5J89A 1BOGB 1KCSH 3M17B 3S88L 2DD8L 4UOJA 5CEYB 4YWGH 4P5TC 2WNGA 1ORQA 1K85A 4L3AA 1NCUA 2ATPB 1IAIH 4TUKL 3QUZC 4JFFD 4NO0B 2NW3B 3MR9A 4LMQI 1RZ7L 4N9GA 2HT2D 2VXVL 1U6AH 4JM2A 3B8YA 4QRPA 1K4CA 4K94L 5C07A 2IALB 2E7LA 4RNRA 2YOCA 3LHPH 4GRWB 4JZOA 5IG7A 3PXHA 4YFEA 2ZCKL 4GG6F 5JIIA 1QR1B 4FQCL 4U31A 3L6FA 3EO9L 1KJMA 3NN8B 4OSUL 2CXKA 5C2UB 5DVMA 3MBED 4MA8H 1K6QL 2HLFD 3MNVB 1B4JL 5GGUA 1XF2A 1MCOH 2XXMB 1N0XH 3O6ML 1QFOA 1IAOB 4JQVC 2GSGA 4P3CL 4ZXBC 3U0WL 2ADFH 4HDIA 1M1SA 1OP5K 1EUTA 4F80A 1WWAX 5BO1H 1K8IA 4PJ8B 2E7BA 3U6RA 2O26U 1Q38A 3IVKB 4NN7C 3FOMA 5D6CA 5DVLA 2N56A 4O2CA 5HVHB 3DBXA 3WN5C 4KK6D 2Y25A 4K8RH 2DOCA 5EOCH 2XZCL 2PW1A 3ARVA 4JRXE 5HJ3A 1MRDH 1JF1A 1KN2H 3RJDA 1P4IH 3DRTA 3OAYH 4CAGA 5FM4A 3U30B 1RZJL 2NY2B 4WNQB 3B5HA 3LQAH 5DMYA 2BNQD 4K23H 1I9IL 5EORH 2P5WD 2XQBH 3UYPA 5GRUH 3V2AR 1HNFA 4OKDA 2ZUSA 2B4CL 3TWCH 4RMVA 4U1MB 1CICA 3QUXA 3LKQB 3QUZB 5E8EA 2AEPH 4ETQA 1D5MA 3MNVA 2DI8A 1VPOH 4ZFOB 2D0HA 3L3JA 1L7TL 3EGSB 2VN4A 4E41D 5DYOB 2APBA 4U6VH 1BD2E 4OIBA 3OB0K 5KW9H 1H8NA 1AO7E 4GBXC 4NQEB 5MEQB 1MH5A 3C5ZD 4JE4B 1KPRB 1I3VA 3O4LD 2P8LA 4G8IA 3O81A 4KU1A 3HAEB 3UTPD 3WFBL 4JFEE 3VWKC 5DR5L 5DD1H 1AGEB 1OAXL 5KG9A 2LU4A 1E6OL 3DTXA 3VI3E 2CDFA 1UH2A 4RA0C 2E6JA 1Q1JL 2FO4A 3HI5H 3DARA 1RVFH 5D1XB 3QHTC 3DGGA 4L29B 3G5VB 4K7PX 5GISH 4XPHH 5HGGS 3M1BA 5HHVH 1MCIA 4LKXA 4RWYL 3KPRE 3KPQA 4IRSD 5FHBH 2EYTA 1LQSR 5LGJB 1CXFA 3QG7H 4F2MB 3MA7B 1AKJB 2DQTL 1BZ9A 2OTUA 3PP4L 1CVRA 4TSCL 2D7QA 4HKBB 1VGEH 5HHME 4X98B 3WIHH 3D39B 3HE7C 3ZE0F 3LSOB 4JQIL 2ERJC 4KZEL 4LCWA 3T3PF 4Z7VB 2EKSA 5HDBE 1PX3A 1IQWL 2CLRA 2XN9D 1YN7A 1U8NB 5JHLL 1SYVA 2CO7B 4KAQL 2G75A 4OZFB 2DQDL 4YO0B 1BQHB 3IFOB 3K7UA 2AEQL 2X4OB 4PJGA 2HMIC 4JFPB 4E41B 1MNUH 4HHAA 4PJ7E 5DRXA 5KSBA 1I7TA 3GI8H 4EBQH 1BQUA 5TPWL 3PXJA 1IAIL 4TUKH 2GW5A 4WUKL 1QLRB 4UT7H 3RNKA 5K9KA 3MRRB 1MCKA 4XVSL 4ZTPH 3P9MA 4G80B 2HN7A 1SYSB 4UILH 3FQRA 1ITBB 4K7PH 4KDTA 4NT6B 4X4YA 5J0BA 4Z7WA 3RGVC 3G5YA 2AEQH 2VH5H 4CNIA 4JFDA 5ISZB 4AH2A 2B1HH 1MRDL 2HH0L 1IM9A 2ORBL 3HG1B 1U8PA 5FFLA 1FRGH 3PHQA 1S9YA 4QF1A 4D3CH 3LKRB 3RA7L 1BFSA 4EOWH 1ZT7B 2WUCH 3QULB 5C9KA 1JV5B 5L7XH 3NCMA 4NRXB 4YFDB 5ID0A 2B0SH 1E28B 5FDYA 1TITA 3NMEA 2P4AB 4E5XB 3PP4H 3TBYB 4LHJB 2KZWA 4GO6B 4PRPD 5IB1B 4XCNB 3CNKA 3ZYZA 4UIKH 3FT2B 5D72H 5I18H 1M7DB 2YC1A 1WJ3A 4RMUA 3SKUD 3DVNA 5I1DA 4HK0B 3IFLH 4L4TE 1E27A 2XTJD 2UVFA 1KLUA 1MVFA 5F97E 2BMKB 4AY0A 1J8HD 1RU9H 3BP4A 3HLAA 3IFNH 4V1DB 4LF3B 2VLKB 4QCIA 3MRFA 4HC1L 3DETD 4X99A 5C09B 3SDAA 5JZ7D 4H26A 3LN5B 3MLZH 1P5UA 2IAMA 4Q6YA 5FGBC 2XNAB 4E9LA 4HZLA 4XCCH 1EPFA 5EA0H 4QXUH 5D1QA 5I9QC 1U58B 4YHNB 1QSVA 5I1CL 2VOTA 1ZTXH 5GGTH 5KSBE 2AQ2A 4GMTL 1F11B 5CLTA 5FA4A 4XPAH 2C3VA 4QHMB 4J4PD 1ZANH 1YMHA 2DD8H 4FTVD 5IEKA 5JHDA 3VG9B 4ELKB 2EDFA 3E2HC 3P4MA 1RQ5A 4OLZL 1J9CT 4HPOH 2F8VA 4NKDA 4P9HC 5IVXE 4UQ3B 3UTPE 1F13A 3PWJB 1XF4B 2R1WA 4YBLB 3WIFA 2LV4A 1FPTL 2YBRB 4OKVB 5D1ZA 1CFNB 4GT7A 4JHWH 1UYWH 4ZSOB 4RX4D 1F2QA 3CZFA 4DTGH 3PWPD 1TDQA 2IBBA 5C07E 1A1OA 1LDSA 3TJEL 5GRVK 4X5XA 5IHZA 4U1HA 3BPNB 5EOCL 3VXQA 4H0IA 3TN0A 3MJ7A 4PG2C 4LASH 5T5NG 5JA9A 4YHPB 3LRGA 2RB8A 1F00I 3HNSH 4PY7A 1ZLUH 5INDB 3B8SA 1KTDA 2DKUA 1QOKA 1CBVH 4DGIH 2VLLA 4F37F 3MUGA 3UJJH 1ORSA 2APVA 4ZOBA 3UDWC 5IFAL 4X4YB 4XPTH 3E1F1 4X4XB 1NC2D 2FBJH 4LSVL 1GAFL 3JSSA 3AY4C 4J3TA 3I3DA 4O51A 5IEKB 3DV4A 1VADA 1PKQA 4UINH 3OKNB 1QSFA 2EDXA 2K9UA 1JPFA 2UZIH 3EO9H 4J3XA 2GSIB 1NANH 2R8SL 1A6VL 3V6BR 1OW0C 4L4TD 3IJHA 3QEQE 3E3QE 4R8WH 3QJHA 4I8DA 1PYWB 4NQVA 4ELMB 3EOTH 5IT2L 5I66A 4PRBA 3BHBB 2R4SL 4F8TA 2BVPA 5EOTB 3ARWA 3BP5A 2PO6D 5GSVB 3VI4E 5BOPA 1NJ9B 2F74B 2HT4D 5F9OH 2WP3T 3KLHD 4P2OA 3WO3B 3IGAB 3BQUD 4WTZA 4KVNH 4OAWA 2VQ1B 1S7WB 4KKAC 1TCRA 1E4KA 2R0WH 3QRGL 1SY6L 1KCLA 1UH4A 1IKFH 5DTFB 4MHHG 5DJ2B 2XY1A 4U6TA 4JFZL 3MJGX 4PLJD 2HG5A 2G5RA 1JTTA 3FRPA 1OAUL 3QI9B 5HBBA 4RA3A 1KTLA 3IDUA 4XZUA 3EW3B 1CFQB 1NCDL 3ESUF 1UA6H 5I1JH 4I18B 4LVOC 2O5YL 4HUMB 2PW1B 3KNBB 4IMLB 5HJ3B 4AENB 1U36A 3GJFH 5C0CE 1MUJA 3DX6A 1KPUA 4Z7UE 5D70H 3V7AE 2GSIA 4PJAB 4G42B 5ILTL 3WUZA 1AIFB 3FB5A 3BZEB 1DBAH 1RHHA 2E9BA 3MYJB 3BDXA 5DK2A 5JUEH 1JNHB 4G9DA 5E6IC 1EMTL 4D9QE 3ARED 3W9EB 3BSZH 1PVHA 4RGND 3QXVA 3ILQD 5HXMA 1XGQB 3H9SE 3HZYB 3DIFB 3QCVH 3S37H 1ZS8A 5HHNA 3PWPA 4IEFB 2A6JB 5C86A 2KH2B 3OHXB 5ACZA 3NPSB 1CGYA 3QQ3A 1IGTB 3WHE0 1VEOA 1SY6A 2HFEA 2FATL 4ETYA 1A6AA 3D1MC 4UIMA 5E7FA 5KVFH 4RGNB 4OZHF 3TV3L 1HILA 1KT2B 3L3IA 2CLVB 1I1CA 5CILH 1KC5L 4HPYL 4FFWD 2VABA 1E4XH 3MJ9H 1ETZA 2IFGA 4JKPL 5GS0D 5L7XL 4XCYB 3QG6A 4XMPL 2GAZB 1FC1A 4GMSL 5E2WL 4D3CL 1FLRH 4TOYL 4U0RC 4UDUA 3FRUB 1MJ7L 1GGBL 1EZVX 4GQ9L 5HVFB 2XWBB 5F72S 3X3GH 1QKZH 5EO9A 4TSBH 3GMNB 4MX7A 4PRNA 4UQ2A 3ZTJH 3UYRL 4PLOB 3RTQA 1DFBL 3VXSD 2Q7NA 1L9MA 2RCSH 1JYVA 3DJ9A 1LE9A 2Y5TB 4DUWA 4GRMB 3BXNA 4QNPF 4L4JA 5C0GA 3GSRA 4D2NA 1WFUA 3LN4A 1QACA 4NM4L 2DM3A 4WWID 4IIQA 4C83A 3TN0D 5DMGD 2EE6A 4DN3L 5DJZA 2P7TA 2WLZA 4PJGE 4Z7UA 4D9LL 3GSNB 3JVGC 1R24A 5DD5L 4GOSA 5DJ0B 4JG1L 2DL9A 2BOBB 1T0MA 4GW4B 3O6KH 1GOGA 3PE9A 1BMGA 1NMBL 2A38A 4M6AA 1QLRA 4I2XA 1AD9A 5DWUL 1G9MH 4JRYE 2QADC 1NBVH 1O5DT 4L9LB 5FDWB 5C2BL 1CE1L 3QI9A 5FM5O 1QO3A 4QOKB 1F4AA 5CIPA 1FGNH 4ZS6C 5D7SH 1CXIA 3E6HB 4KQ4H 4TSCH 1EO7A 1J11A 5T5FL 4LFHG 4EVNB 3D3VA 5C08A 3W0WB 2MPAL 3SDYH 1E4XL 3MJ9L 1C5CL 3K8KA 4MQTB 5DQ9B 1ZAGA 4OCRL 3ZHKA 3MLRL 3AS3A 4NHUB 3NVQA 3DMMB 3RX7A 3T2PA 4L8BB 3IDNA 3QUML 4WEBH 4OLXH 3V7MA 3IXAA 1Q9LB 5E9DD 5E8OB 5F6IC 3HI5L 3MV9D 1AE6L 5DJYB 1OCWL 2JJSC 1ZSDA 2YD8A 4ZODA 15C8L 2CQVA 2GSGB 3MCKB 4BZ2L 1FJ1A 3D2UA 4GRWE 1DSFH 3MZTA 1G7MA 4ZOCA 1WCBA 4GJTB 1NPUA 4PJ9C 3BKMH 3RL1A 3GK8L 1U9KA 2Q8AH 2B8OT 2IFFH 1MFDH 3Q5YA 5KS9A 1LO4L 3U0TB 4APQD 4Q9QH 1DQTA 1IAMA 3FHQA 2PCPA 5CD5D 1SVZA 1DBKL 1HCVA 2W91A 5GIRB 5JIPA 4LIQL 4QTHB 2D31B 4R2GD 3EYOB 4ZUTB 3Q3GB 2GJ6E 2Y9RT 2BHUA 5I1LB 1X9QA 1BEYL 3VD7A 4X8JA 3WMSA 5FKPB 1FE8H 5L8JB 1TVDA 4PV9B 4O02H 1RK0B 2X70A 1ZK9A 4PRDA 2WINB 1QVOB 1QFWM 1MFDL 2JJTA 3REWA 4L3EE 5HGAA 4F2MA 1UCBH 3FONB 1NAKH 1RZJH 4P9HH 3U1SH 3RDTC 3EOBB 5DC0A 3VXOB 1S7QA 5BV7C 1EVUA 4N0UE 4LCCA 5GGRY 3D2UB 4I48A 3P4LA 2FJGB 1HH9B 3LSOA 3U9UA 2YWZA 1F3DH 2VXTL 1M05A 1U8OB 1C1EH 3VFUA 1CLOH 2EYSB 1H3TA 2ADGA 5CGYD 4H88L 4JRWA 3RWEB 2L7JA 2F8OA 5DHXB 5FYJU 4HSQA 2F54D 4KVCL 1ZVHA 2VLRD 1U92A 4NZUL 3GMOA 3RIAF 3V4VH 5DD6B 3H8NA 2D9QB 1N0XL 4PRIE 2A9ML 4MAYC 5JO5B 1ADQL 4L29A 1BJMA 2DIBA 1JWMA 2XRAH 4XTRD 4OSUH 5DT1H 1FYTB 3OPZH 1W8NA 1XZ0B 1NLDL 4OFYA 2QKIB 3DX9A 3LD8B 3FQRB 5CEXB 3KPSD 4XH2A 5D2NB 3CCHA 1JYWA 3LHPL 3RWIA 2KZ1B 3T2QA 2EDKA 3N9GL 1AO7B 3DWTA 3JZ7A 4X6CE 1ZHLA 1UZ8B 2AXGB 4U0QB 2OJEA 1FFRA 3FQTA 4DTGL 4Y4FB 5ICZB 3BKCH 3U0PB 1YA5A 2BY1A 1YJDH 3K8LA 1BQHA 3IFOA 2A77L 4PJXE 4JZJC 3T3PE 3G5XB 2E8ZA 2OL3B 3UTZB 3PUCA 2VUYA 4YWGL 5DJYA 2GCYA 3GO1H 2A6IB 3VD4A 4POZC 1P5VA 5D7JC 2CPCA 1A21A 1KCSL 4KKAD 3A6CL 1BIIB 3I2CH 3TBSB 2EXYC 2HWZL 1TETL 1J8HB 3GBML 3MREA 5C0BB 2VLRE 3OXSB 3G9AB 4M4PA 1UM6L 1D5BB 3KPOB 3MLZL 2QKIA 4Y16B 4Z5RB 5IFJA 2YD6A 4QTHA 4A6YH 5F9JA 1KXTB 3CDGB 3PIQA 3GI9L 1Y0LA 3FQXB 1N59B 1VEMA 3U4BL 3S4SG 1T1WB 2RQ8A 4YAQB 4YHOH 5CHNA 5DLMH 5DUBB 3T0XA 3EYSH 4QRUA 4KK8C 4Y5YC 2J4WH 4UDTB 4UV7H 32C2A 5IF0B 5C0AE 1R3KA 2CKBL 5DJAB 4OF6A 1AJ7L 2AABL 9CGTA 4JPKH 2A9NH 4GSDH 5CFHA 1G7HA 4OTXH 2IANA 1FSKC 3QQ3B 2F53E 2VLJE 1B6UA 4OGAD 2FJGA 3SDDC 5I8OL 3AREA 1C12A 2VC2H 4RCAA 4XWGH 2NY1C 4KXZH 4OUOA 1MCEA 1D6VL 1XF3A 4QRSA 1LK2A 2FHBA 1T20B 5F7EL 2EYRB 3S3PA 5GS0H 1D5IH 5I8EA 1U92B 3VGAB 1GCFA 1S9XB 1NQBA 1IC7L 5I8KH 3P0VL 2HA1A 5D2LE 3S34H 1OP3H 1DE4B 3BEWA 3MC0A 4M93B 5I74B 4E0RA 1G7JA 1C5BH 1CK0H 4L8DA 2XG5A 3LN5A 4LSQH 3SKJL 4U2ZA 1A9BB 3KR3L 2FJFA 1S7RB 4NIKB 3DUSA 5EO0A 4PJBE 2XACC 4UT6L 1Z9SA 3MXVL 4QGYA 5AD0A 4FP8H 5CJXA 3FQNA 1JHKH 1FYHB 1SJVA 5E2VL 4BH7A 4JO3L 2DL2A 1G7LB 5BOZG 1UEYA 1RUKH 1XCQA 3VD9A 1J8KA 4NKDB 1T5WB 1V3JA 3VFNB 4I0KA 3QDJE 4ZUUB 4IRSA 1MCWM 2NY5C 4YHYB 3MV7A 5DT1L 4XAWL 5T1KA 4EI6A 5A2LH 3WEXB 4XCFL 1PY4A 5DQJA 4H8WH 1NFDF 5I66B 2J1KA 5KTEH 5FCSH 1BFTA 3LEYH 1UQSA 1QR1A 2NNAA 2OTWB 1J0IA 4PJDE 4PGZA 1QQDA 4JFPA 4UINL 4I0PC 5C0IA 2CJUH 3HCVB 4FQLL 4NQDB 4ONGH 5IJKA 1G0XA 2DQTH 4RISH 3DVGB 3PL6D 3STBA 4YHIA 4ENEC 3L95A 1WAAE 3BP7B 4LARH 2I9TB 3QDJB 4JFFA 4XNYL 1CLOL 5I2IB 1EV2E 2WZPD 1A0QL 5M7QA 2KQNA 2IH1B 2AQ3A 2V7HB 1OAYH 4KQ3H 5CBEB 1G9NH 5DMKB 1MJUH 5I1IL 3I6GB 1CLZH 4NQDE 2V5SA 3HRZA 4NFCA 4P5KB 1PKOA 3L5JA 3RDTA 4WU5B 3IFPA 1RK1B 2CKNA 4X80H 5T1DL 3R1GH 5EWIH 1YC8A 4Q2ZB 2A74B 2I9LA 5EIQA 5BRZD 1NEZB 4NNXA 4IOSD 5HDOA 3RBSA 5L88H 5AWNH 4D9RD 2JIXB 1WSST 2ICWJ 1CICB 3QUXB 3NOIA 2MQCA 2J8HA 1ZXQA 4KZDH 2K1MA 4CL7A 3C60C 3F6IA 2WWKT 3HAEG 2AK4B 3BKYH 4W6XB 1VFAA 1UJ3B 4PJAF 3OKEB 5CUSL 1NMAH 3CK0H 3BKML 2F9BT 1C7SA 3IF1A 3KNBA 4FMFA 3W11C 4XPFL 1X5IA 4ZXBA 2DS4A 1SBSL 2BXYA 2WSKA 4PJCF 4NC2B 3UAJC 3NCYS 1LWRA 5CBEA 5CEYA 3L7EB 4W6WB 1G7JB 3MV7E 3OGCA 4P4KA 1N5AB 3QG6B 4FZ8H 2AJVH 3QEGH 1XGPB 1YPZA 3CMOL 3QZWG 4Z7UF 5BW7C 1KSRA 5A2FA 2FSEA 4L8CA 5I18L 3CFJA 3UZVB 2X4PB 1K4DB 1ZHNA 2CRYA 5DD0L 5EC2B 4H20H 3TZVC 1MCOL 4WFHE 3WFHB 2YEZA 5C0EA 4MJIB 1KIRA 4MVBC 2H8PB 3QHZH 3Q6GL 4KUCF 3WFCH 2FO1A 3MNWB 4GKNA 2R0ZL 2XKUA 3WEXA 5C2BH 1SM3L 4F7EB 4LNRB 5DWUH 1A7BA 1EEZA 5C6TH 2AJYL 5C0CB 2G5BB 4G8GE 4RFNB 2P24A 1FIGH 1WF5A 3CLEH 3HI6L 4FXKA 1GH7A 2AJZA 1X5YA 3SOBH 5CWSB 1A7RL 2JJTC 2NXZC 2E7CA 1KN4L 4M1GL 3U7WH 4WFEE 3UTTB 4MNHA 4R2GB 3N06B 1J1XL 3QUKB 1K2DA 1ZMYA 4ZAKD 4XVSH 1CICC 3QUXC 5E2TL 5L9DL 5IROA 4WUKH 5C1MB 1TVBB 1U8HA 5C0BE 1HXYB 3TVMC 2DQIH 1HKLL 2N1KA 4Z7QE 1UB5B 4CBPA 1TFHA 5KVDH 1NGXB 4N5EC 4Y2OA 1MRCL 2DJSA 5DVKA 2VL5B 1HWHB 5JW5A 1KIRB 5DK3A 1J1PL 3TZVD 2ATKB 2IPTL 2DI9A 3V5DA 1QSED 4K3EL 4JDVB 1U8MA 4X80L 4LCWD 2F5BH 1N26A 1HHJA 2ICEB 4KRPC 5JOPE 1IQWH 4TOYH 3S9DB 1S9YB 4U1MA 4QNPE 2HRPL 3FO9B 3BHBA 1WEJH 4K7PY 1YEFL 2E6QA 3B9AA 2ARJA 4PJHA 1HIMH 2OQJA 1G9NL 3QUYA 4OCSH 4FTVA 3V6ZA 4C59B 1KJ2L 1BIIA 4E5XA 1JGVH 1I7UB 3UTSD 1NFDB 3WXWH 4OCXL 1ORQB 1NL0H 2P5ED 1KTRL 3SGKA 5ID1B 2J8UE 5AYUL 3MRRA 3OX8B 3RHWK 4UU9A 3O8XA 4GBXB 5TE4H 1QBAA 4DEPB 2Z8WC 1D9KA 1QA9B 3HE6A 4JFDD 3REVB 1PQZB 3FN9A 5E6IB 4XI5D 5GRYA 4FFVC 2F53D 4JM2B 4PJFB 3D69A 2YPLE 4F33A 4JFXB 1KCVL 5F3BA 5DFWH 3S96B 4OZFH 4L3EB 5D7KD 2ZSWA 4K9EH 3ULVH 3LH2H 2ED9A 3LEYL 3S5LB 3V79C 3NPSC 4WFFE 3EYQD 4XCFH 1S7SB 2ESVD 1I4FA 2D3VA 1KNOB 5HDQL 3W5NA 5FYLD 1IAKB 4HH8A 2GJ6B 4WI7A 1CWVA 3IXAB 3QA3A 5FYJE 4NRZA 1NMCB 5FUZH 3MO1B 2VTFA 5D70L 4HKBA 1RUKL 2WBJC 1JFQH 1E4JA 1TQCB 1ZOXA 1F90H 2LAAA 2XN9A 1WZ1L 2EICA 4M43L 4PR5B 1LEKB 1F5WA 4H1LA 4BSWB 5E9DB 3PV6B 1IEBA 4M93C 4PJ8C 4LCUA 4MS8C 1UB6A 4P2OC 2NZ9C 2YXFA 4CVXA 1QNZL 5FXCH 5HVHC 1IL1B 1G1YA 1KB9K 5LQBL 5T1MA 2Y6SD 1QA9A 2EIZA 2CDGB 2YMXH 3BVNA 1FFNB 2XA8H 3EYFA 3BO8B 2DM4A 1GJIA 1TTGA 6FABL 3S34L 5H94A 2AXJA 1XIWB 4R3SB 1J18A 3GMLB 1E4KC 5SX4H 4NRYB 5E95B 4P46D 3SKMB 3WO4C 1S7SA 4LVHC 3SE8H 4Z77A 3FRUA 1TLKA 1UWGH 5I19L 4XNUL 2ZUQB 4OD2B 3LKPA 2NY4C 3DROB 1OM3L 5C71A 7FABH 1MIML 5E4EB 2NMSA 2G60H 5IBTH 2CGRH 5I1EH 2BDNH 4M8VA 4ENED 4OFKA 4MWFA 3W82A 3EFFA 1T4KB 4IRSB 3H9HA 2W9DL 1GGCL 3HZVB 1I1AB 4MNGE 1VEPA 2ARJQ 4LPXA 3ZDXF 4PG2A 2F58L 2J6EL 5ICZA 3ZMRA 5EO1A 4P5MB 2CRMA 5FF6B 1A7OH 1FVEB 1SJHA 1KCRL 5F7LB 1UH3A 5I1KH 3U4BH 4WJ5A 4XP4L 3TT1L 3SO3C 4M6MH 3ZYOA 2Z93A 4TNVF 1HIML 3LY6A 4TUJA 1JGLH 5E1HB 5FUOH 2DAVA 1YEHL 3NCBB 2M1KA 5D71L 1W0VA 3KLSA 1CXHA 3G5VA 2PYEB 2V2XA 4YC2C 4ZFZA 3OX8A 3ISWA 5KN5A 3NIGE 2R2BA 3BP6A 2AXFA 5GPRA 1N8ZA 4PS4H 5I30L 2XN9E 4OCYL 1FL5A 4JM2F 3IDGA 4ZTOL 2D2OA 3K81A 3C60D 1MRCH 3OAYK 3MROA 5D1XD 3ULSB 1IARB 5JW3L 4XZUB 1BZQK 3MRFB 3TGXA 1HKLH 2EEDA 1EGJA 5J12B 1KELL 2O5ZL 3H0TB 4HV8B 1FNEB 4HBQA 4XX1E 4D8PA 5T3ZE 1QRNB 4M7KH 4O58L 1Z5LB 1INQB 3O6LL 1BVLB 4NNYB 3CU1A 1MVUA 3F65A 3RIFK 5D2NE 3VH8A 2VDPL 4OD3L 1TVHA 3HI6H 1U3HB 3FQWA 3ECBB 2BVEA 2WUBL 4PJ5A 2XA3A 4YHZL 1VKXA 1U95B 1PZUB 4OCWL 5ACZB 2FL5A 4Z0XA 4G3YL 1DANT 3OJDA 1FH5H 4N90E 1I9JL 4YHKH 3JV6B 3SGJC 4GG8A 1PGRB 1TJHL 4IJ3B 1I9RH 2EXYD 2OMBA 1WIOA 4C58B 2RAMA 3EHBD 1P2CA 2VUOA 3U4EB 1CGSL 2BDNL 1FIEA 3TBWA 4DZ8B 5SX5K 1U8PB 3DGGB 5D7IE 1EO8H 5LVEA 4G42A 4LPTA 1YPZB 4RIRB 1KCUH 2VLLB 5I19H 3MUGB 4ZFOL 1A64A 4P2RD 5JPNA 2HJFA 3DROA 1UFUA 2CKBA 4HEME 3A6BL 3L9RB 5A2JH 2OR8A 3L5HA 1F58L 3QIUC 4F7MB 3L3DB 3BPLC 4P57B 3DUHA 2FB4L 2Q7YB 1QFPA 4CU6A 1UJTA 1A8JH 4DKEH 1UACL 2VLME 3D25A 5B21A 4LLVB 3DUUA 4EDXA 4BFGA 4JPVH 3AAZA 2Z8SA 3N1MC 1M05B 3QP3A 1QNZH 2EYRA 1GC1C 1B4RA 1WVZA 3MRNA 4TYUA 5I8EB 5F88B 2C26A 1NAML 1NJ9A 2F74A 3SDXF 5I8CB 5IVXF 5IEHB 3VGEA 4NFDA 2DWDB 5I73C 1A3QA 4EI5D 4QTIH 1AP2B 2AVGA 5IHBA 3O2WL 3TYGL 4DZBA 4OZIA 2W9LA 1IC5L 4WFGD 4LNVA 3LMJL 1FORH 4MDIB 1WK0A 1BM3L 1T7ZA 3IYLW 5KBNC 4QRRB 4PD4J 4RFOL 2VZOA 2EH7H 3MLTA 1MI5E 3F58L 2IFFL 5D7JA 4KPHL 5AAMA 3OKOA 1MJJA 2Y07L 4JZJB 1LP9F 4PJ8A 4YH6A 15C8H 4BZ2H 4P5TB 3QIBC 3WNPA 3GSUB 1XCQB 3LDBB 2VZUA 3QCUH 4NUGH 1FVDA 4XVJH 1TZHB 3KXFB 4PJAA 3P4NA 3DUUB 3MRPB 3QDMB 3DLQR 3DMMD 1FHGA 1A5FL 1Y18B 5I6XB 3GSRB 1S78C 4LARL 1WZKA 3KPNB 5ABDE 5DS8B 5GS1A 1XGTB 3J7HA 1RUML 3LKOA 4LSUH 5IVOA 4EUPH 1LDPL 3CLFL 2FJHA 2MHAB 2AGJH 3O3EA 2R1YA 5FYLL 3MGOA 4OF7A 5I74C 1E6OH 3TH3T 3O4OC 1MCFA 1A7NH 4ZFOA 3SE4C 1OT2A 1F4XL 2I9TA 1MREH 5IMLB 4X5LA 4OGXL 1HZHL 4PJCE 5KVEL 1NC4A 1AY1L 4RAUA 3EYVB 5IWLA 3JV6A 1JL8A 1Q0YH 2JB6A 3O2WH 3TYGH 5DJ6B 4WV1C 1YEJL 4NCC1 2VZSA 4D0BB 1Y0LB 3G6AB 5E03A 3ETBF 1OARH 4I18C 4LVOB 5GRXG 2BNQE 3VFRB 5J1SC 3I50H 1X7QB 1I4FB 1N0LA 4JVUA 5ADPH 4LHUG 1VHPA 4WEMB 3MRQA 2OK0L 1I9IH 5EORL 4XC3H 4EDWH 5EU3A 4QY8A 5KSAA 1W72L 4MMXC 4C4KO 1UVQB 4HK3J 3PDOA 1SEQH 3HR5B 5IBUB 4UQ3A 1MI5A 1WCBB 1T22B 5JOFB 1IEBB 4TULL 5EB9A 4FQ2H 1G0DA 4HCRA 1UZ6F 4J23A 3SPVB 4W70A 5F7EH 4MD0A 5HHXH 1GZPB 3CFKB 4L9DA 3MV8E 3SY0A 4XXDA 1OAQH 1JF5A 4S2SA 1XH3A 4TQEH 1H3PH 4KTYA 2NPLX 1R24B 2MQ3A 5KG9B 2H32H 3L5WA 1CGSH 2A9NL 2X9YA 4GSDL 5CEZE 3ARFB 4Y5XB 1B0GB 1IKNC 4WU7A 3KYOB 3STZA 1EHAA 4Z8FH 3MBEC 4RDQG 1FH5L 3NACL 3REWB 3H6JA 3T4YA 3FCTB 4WUUA 5K9JL 3PG2A 1R3IL 3E6HA 5F8QC 4HDIB 4XNXL 5JW4Q 1HOCA 3MCLH 4Y7MA 3RVTC 2LU7A 2A83B 3C5JB 2GTZA 4Y4HD 2BRQA 1JZ7A 4U3HA 4A6YL 4WI9A 3K4AA 1I9EA 5IVXB 1A3LH 5F7UA 1RFDL 4V2BA 4M61B 4IHOA 1JUFB 4P3WA 1JGEB 2HKFH 4KHTL 4PRID 4UIMB 5EFIB 1YDPB 3QUYC 3KLAB 5DJ8B 4WTXA 2GEEA 4P9MH 4ZS7H 5A40E 3WLBA 3SY0B 4APQB 4E42A 4ZNEE 4WO4B 2FJHB 2GITA 3C5ZB 3IDJA 1WTGT 4MQ7B 4FQHB 3HI1B 1I8LA 5IESH 4HWUA 5D93C 2OL3A 1BVKB 1BQLH 1EHNA 1DANU 5JW3H 3HN3A 1T1XA 3L3OA 4PTUB 3ES6A 3MMEB 5JORB 1EXUA 4OV5A 1BD2D 4ZS7L 4KTDH 1CFTA 4WI2A 2Z4QA 4X7TB 2IQAA 3QR2A 2YXMA 4HUNB 2ESVB 2P8LB 4G8IB 1FGVL 4M6ML 4CJ1A 5DMKA 2GKIA 2VXQL 4JHAH 2LAGB 5CEZH 2X10A 3RWCA 4XPGH 4XP5L 2MFNA 2R4SH 3QEQB 4QHLB 3L6FB 2J12B 3QDME 3OPZL 2IWGA 3MJ6A 1MFAH 2Z31A 4Z76B 4IIQB 4C83B 1OVZA 3KJ4C 4U1SA 3F7RA 5F9DC 5ESVA 2XNAA 4K2UH 2F54B 1T03H 4HJGB 3KS0H 4HX1A 2R4RL 5IIEA 2CJUL 3HI1A 3QO1B 4FQQB 4N1HB 3C6LB 2BOBA 3LVEA 4M48L 2G2RB 4KK8D 5I76A 5E5UB 5T3XE 4M8QA 5KOMC 1A6AB 2PUQT 2UVEA 2DICA 3L1OL 3PWPE 1KULA 4OFVA 2CR6A 3NZHL 3G6DH 1JNJA 3ES6B 1KJVB 4M7ZC 4DGIL 2YA2A 5C70A 4Y89A 3VW3H 1HHGB 2ZCHL 4KK9C 3OKKB 2AERT 4YPJA 2E27H 1U8NA 1PEZA 4OF0A 1X5FA 3CJJA 5J57B 4TSAH 1B9ZA 3V95A 4RFNC 1WWWX 2JK5A 3NABL 3SE4A 3TBVA 3EZ8A 3F7PC 4UT6H 4M4RA 1RJLA 2P8MA 3TZVA 2BSED 2MCPH 2DQHH 4YK4B 1OGAE 4JO1L 5HYJA 32C2B 5IF0A 3B4NA 3ZHDA 1Y6MR 4U1GC 4CVUA 2UYLB 3ULVE 3SDXB 4DKFH 3RNKB 2EC9T 5FB8B 5EBWB 2B5IC 4JVPA 3MUY1 2X1QA 5FV2A 1G6RH 1DJSA 2X4SA 3BGMA 2EIBA 2NW2A 4NQSA 3GMQA 2YD9A 4GKZA 3L7FA 3G5ZA 5GGSY 3MX0A 3OKNA 5T1MB 1TZIB 5EH1A 4MJIE 4V2CB 2OXGA 5DHYB 1F4YH 1QG3A 3PQYB 5C8JA 5IMOA 3GMPB 2Z8VC 4HT1L 2Z93B 2DLHA 1WFOA 3H42L 5T1KD 3K2MC 4F9LC 5E24E 3CFDA 1L0XA 2EXWD 3FZUD 4PY7B 3QWOA 4AMKL 1UQSB 3GSQB 2RHEA 4X6DE 5CKAA 1NCBH 5FEBA 1WUNT 4LKCA 5F7FA 1HHKB 3R0MA 2NTFA 5I1HL 3PGDA 3BD4A 4JG0L 1FBIH 2EC8A 4KRLB 2SEBB 4Z7VF 4HIJB 4Y4KA 1JN6B 3PDDA 1N59A 4JM2C 3QIUA 2D0GA 2C1PB 1HQRA 2ZP0T 4RMTA 1VFBA 2YPKA 5JPMA 5D2LA 1YZZA 3QEQA 2AAVA 4PIRF 4HV8A 3L3GB 1MFNA 3QQNA 3WJJC 1YN7B 1CD1A 4I0PA 3WNLA 1EUUA 5DD3L 3WIIL 1T6WA 1WEJL 2P8PA 2WBJD 2HFFA 3NFPB 1ODAA 4KGJA 5HGDB 3JTTB 2ID5A 4RQQA 4LAQH 5IOPA 4YFLF 2FH6A 2B1HL 2EDBA 1X3DA 4HHAB 2AKRB 2NX5E 4MHHI 1VGKB 4X7DC 5BRZE 5IKCB 4U49A 3PABA 1CR9H 2FHFA 3RAJH 3ULUH 1OPGH 3B9KA 2D7NA 5KVDL 1VB9A 3P4MB 3GSWB 4XWOD 1U8LA 4P3DB 5L9DH 1KLUB 2IAMC 3ME0A 3G5YB 4G6JL 5INCA 4QRQB 5MEPA 3D69B 4F33B 1A7RH 4PJBB 4Z0BL 3KJ6H 3X11A 2DQUH 1S7VA 5I1LA 1Q9OA 3JV0A 1DN2A 4J3SA 2FH8A 2FB4H 2VXSL 1D5ZB 4H26B 1SM3H 4KJQC 1AHWA 2V7NB 3RY4A 1A2YB 4J4PA 3VDAA 5JHDD 3QRFM 1FLRL 1JCKA 2J88H 1HSAB 4Q2ZA 3GMMA 3LRHA 4XMPH 4QXTA 1MFEL 5IOPB 43CAA 1DUYB 1MJ8L 4F3FA 1A7PH 4PBXA 5DXWA 4CDHA 1A4KB 3B9KD 4P23C 5GRJH 2V2TB 5I15H 1M7DA 1X4YA 2W38A 4RBPK 1MHHB 5FHBL 4MGXA 1LP9A 1FBIL 4JPWL 3TV3H 2WK2A 5ESQA 3TH2T 4MNQB 4Z6AT 1YEEL 1UWXK 2BCKB 3JXAA 4HIHB 2FATH 1XH3B 5GZOD 1FZKB 3MNWA 1LMKA 1F6AA 5FHAH 3EYFB 4XXCA 1Q1JH 3H42H 5AG8A 1U41A 3C9NB 3TBTA 4MAYA 4WTWA 1HN1A 3ZKNC 5DJCB 3M1BB 2Q86B 2DIJA 5DRXB 4NQXA 5A43C 4KKCD 4M5YH 3T4YB 3ZT7A 5IMKB 4F15C 3VJ6B 4G5ZH 1QFUH 1IT9H 4JREB 2NX5A 1JNNL 4LP5A 2BY2A 3ZHLA 1M4KA 1A3RL 4JDTH 1LE5B 4AG4H 5FCUL 1BWWA 3VXUA 1YNTB 4HUVB 1KTLB 3KHQA 4LVNC 4JN2A 1ZV5A 1CFQA 4ERSH 4O4YL 4OM0H 2V2WA 4PRHD 2R29L 2UWEF 3WHXA 1JWUB 4MLSA 5K93A 4PGEB 3MRJB 3T65B 3QXDB 2MCPL 4M5YL 1HINL 4L1HA 1GL4B 4RRPA 3KJ4B 3QISA 5CCKH 5I30H 3UJIL 2P7TB 5SWZB 4QKXB 1AY1H 3V6FB 3C2AH 2APXA 1CXLA 1JGUL 4ODSL 3H2WA 3GNMH 3NA9H 2UV3A 3W9EA 5IW3A 3HE7D 4QYOB 1U8KA 1MJUL 4BZYA 3OGOE 2DLIA 2RBLA 4LHUD 2W0FA 1FVCA 3QXWA 4S1DD 4R8WL 1KCRH 4LK4A 4Q97A 1OD9A 2IPKB 2CIIA 1MJJB 3DVFA 4MB4A 3G08A 3ARYA 12E8L 5J4MA 4JFOB 5BZDA 2MPAH 1BX2A 3K4ZA 4F57L 3U7YL 1LE5A 4PREA 2OCFD 3UPRA 3D3VB 4O2CB 2IMNA 3M17A 3TT3L 5J8OA 1IE5A 3ARBC 3K0WA 5CHNB 1ACYL 2BMKA 3QDMA 1OLLA 1AIFA 1QRKA 3TCLB 5IFAH 3BZEA 4OCWH 3QXDA 1X4XA 5EZJA 1L6ZA 4YHZH 4U1IA 4FQCH 4X8JB 5A2IH 4AYFA 1JPSH 3MRDB 4ODVH 4XP5H 4YXKL 5EN2B 4I3SL 5J12C 1MCPL 2CO6B 2N7AA 5J6HB 4NN7B 4Q0XH 2QJDA 2AV1A 3GDBA 3VGBA 1A22B 5F1NA 1FL6A 3D0VB 1T2QH 4DFIA 3QWQB 5C0AA 4OZ4B 4XAKD 5A3IC 4X6CA 4N1EA 1H3UA 4TNVK 3T8XB 2P42B 3E3QC 4PJ5B 3VXSE 4JHWL 2P5EA 4O58H 4JFFB 1T89C 4AQ1B 4OB5L 4RAUB 1L7IL 5CP7B 3IJSB 1KELH 5E9DA 2G5BA 3QDAA 2ARWA 3OKKA 1UB6B 5B22A 4WENB 1OF2A 1BX2B 4HFUL 1A6PA 3GGWB 4P59L 5HYEA 3OKDB 5DSCA 2HFTA 3NABH 4JJ5B 4PJHE 4J8RB 2R15A 1SEBA 1KLFA 1U3ZA 5EPMA 5GGTL 4MJ5B 5D7LB 1AGEA 3WE6A 1RZKL 3QPQD 2FGZA 1WTLA 2DIAA 2HJLB 2H3NB 1F58H 3H3PL 1KNOA 2DQCH 4ZS6D 3A6BH 5IVNA 4Z9KB 3L3KB 1YEHH 5I8OH 4Y19D 1LO5B 3MOQA 3T1WA 3SCMC 3T4AA 1HOCB 4NN6B 3LEXB 3IFNL 4UAOB 5E7BA 2COQA 1R5WB 43C9A 2R56L 4LPCA 3TJHC 4PJIE 2X4TB 4GUPA 3KPLA 2OZ4H 3T8XA 5FOBB 4U3XA 2JELH 4LSRL 2WM0A 3HAEH 3SKOA 4FQXD 2F58H 2I25N 4XCEB 1TENA 5DMGC 1KJ3L 1CL7I 4HS8H 4HQQH 1EDQA 3V6OA 4HIIB 4LPWA 1D7FA 3CAFA 4ZUVB 2HTLC 1NCAL 1NGZB 3QJHB 1T5XB 1U93B 5DJ0A 3HCVA 3TO4C 4P5MA 2HLAA 2WIMA 4HT1H 4I4WB 4XB7A 5FAAA 2QHRH 2VN7A 4QYOA 1A1MB 2R56H 1I3GH 3BGAA 2B0SL 2GK0B 3QNXB 2A6IA 1AGCB 4X4ME 4UV4L 2I60H 1RUPH 1NBZA 4OI7A 3DX9B 3JTSA 4K94C 4L8CB 3NIFE 3RA7H 4EOWL 3O6LH 1AKJD 1MQKL 2BNRD 3OR7B 3EYQC 5SWZE 4PB9L 5DEGA 4P5TA 4P59H 2QSCL 4KHXH 3P0GB 1QSEA 4Y4KC 2XYCA 4NT6A 1T80A 4F15B 2E9IA 4S1DC 2H8PA 3U36B 3D18A 3HNTL 4JREC 4RAVA 4LVEA 4IRJD 2WWMC 1ZT4B 1OAUH 4M7LH 3BKCL 4DUVA 3TH4T 3HMXA 1FZJB 5CMAB 4KROB 1YJDL 4LKXB 3GHBL 1XGUA 3RHWF 5B8CB 3I6KB 4LEXL 4J2XA 3CH1A 3L3JB 2MTPA 4M6OL 2HKFL 4YZFF 2VQ1A 5D71H 1JZ6A 1I85A 3MOBH 2I07B 4HUXB 1NFKA 2B4CC 1KACB 5TE6L 1OB1B 4MJ4A 4XCNA 4Q0XL 3J8F7 4V1DE 3RGHA 4JO4L 4AL8L 1INDH 1CFSA 2BP3A 5C6TL 3K2UH 1JHTB 1FYTE 3BH9A 4HEPG 2JKXA 1QUNA 3TPKA 3TO2A 4LBEA 1QPXA 1EHXA 5CGMA 2EYSA 3I75B 3LS5H 1U95A 4K3DL 4YUEL 3OJ2C 3UBXI 3OKDA 3EJYD 1DQML 4KDVA 4B53A 2IJ0C 3ZKMD 2YD3A 3TT3H 5FO7B 3U36A 3VFRA 2FRGP 3KDMB 1AO7D 2XT1B 4MJ2A 2CD0A 2FSEB 3ELAT 3MTRA 4LVHB 1DLFL 4KVCH 1I85C 4H1LG 3CXDL 4A2LA 1PLGL 4M3JA 4MXVE 3T4AB 4NUGL 3LEXA 1FGVH 3F7YB 4JM4H 2AK1L 2P5WB 3GJEA 1ZEAL 3JWOC 4LCWB 2GTWB 2BSRA 3RGVB 3GRWL 5FA3B 2IADB 3UBXG 2ADJB 4OZGA 2F5AH 3BZFA 2APWA 4HZAA 4XRCB 1TJGL 5J13B 3CFEB 4XXDB 4ZUVA 5HGBB 3S8WA 4XVUD 4HGMA 5LXGH 1L7TH 3HB3D 5DUPL 2EC9U 5F7KC 1FFPA 5CP3H 3R06B 3W9DA 2JCCF 5BVPH 2ZKHH 4YBQD 4NHCH 5ICXA 4O4YH 4KROC 1FDLH 4Z7NF 2P45B 3I02B 2GK0A 1JIBA 2Y36H 4XNQB 4Q9BA 3B6SB 1ZGLB 4XCCL 1KIQB 1DCLA 4R9HA 1IGCH 3SBWA 5F7YC 1T04B 3GB7B 2NQCA 3VWJD 3FQNB 2H2SC 5GS1C 1GRWA 5KVEH 2Q6WB 4KY1H 2GFBA 1FN4A 2VDOH 4M5ZH 2NR6C 2HKHL 1F4XH 2W65B 2NY6D 2OP4L 1FZMB 3VXNB 4EN3B 1SJEA 3PHQB 4QF1B 1XFPA 4R97B 1GXEA 1KCKA 4ORGB 5HI4D 5KVGL 2WQRA 5CJXC 5FKAB 2YPKB 5JPMB 2O5XH 3HLAB 5CEZD 3CZJA 4JPWH 3IFLL 5FHAL 3N85H 4EI5A 1BBJA 3L5XL 1A0QH 2VR4A 2FGWH 1QEWB 4F9PC 1ZHKA 1WIUA 1J86A 5IEHA 5C07D 4JFHD 3BWAB 4KKNA 4NQDA 5T5FH 2VKXA 4UNTA 1NEZA 4NNXB 4OQTH 4N5UA 1H3PL 4XHJD 5ITFB 1Q9LA 4MS8D 1FGNL 3IS1X 2A1WL 1OQOA 3L3OB 1BVZA 3H3KA 5EU6E 5JORA 1MCDA 1LGVA 3AM8A 3CMOH 1RZGB 4KI5C 2R1WB 4KPHH 5FGCE 4FZ8L 3EOAA 3FT3B 4P2QD 5F3HB 3O45B 2F5BL 4OD3H 3QDGA 3D85D 5F1OB 1AGBA 1FO0H 1NMBH 1A14H 1JI1A 4CN1A 1IC5H 4ZDHB 1WBZB 3PJSA 4RIRA 3ZE0E 1QHPA 2OK0H 3UPAA 4NCDA 1N7ML 3QO0B 4WU5A 2FEDD 4YHPA 1F3JB 1N5AA 1CD0A 5HDBF 1N6QL 2GJ6A 5C3LD 1A02N 3ARBA 3GIZH 4FXGA 2W60B 2QR0A 1E6JL 2GUOA 4HXAL 3PWVB 4HX1B 3QIWD 4ODXB 3RQ3A 5HHPA 2CMRH 5BRZB 4F58L 4UMGA 2QSTA 2Z91B 2E5EA 4PJ7F 1GGTA 4G43A 1GVIA 4OGYH 1A14L 5ITFA 3U7WL 1XF4A 3ARGD 3PWJA 3WIFB 4MQSB 2QBWA 2YBRA 5HGHA 4MCYA 1AXTH 4QRSB 1U8QA 1U91B 4KV5F 3WL9B 5KAQG 2L7UA 2M26A 4Z5RA 2VITB 2EKSB 2NY2D 5IFHH 4J3UA 1S7UB 3T04D 4NWUH 3MLWL 1MJ7H 1JGLL 2V5TA 4F7EA 3HFML 3O3AA 3GJFK 3MV8D 3X11B 2FO4B 1NAMA 4PD4K 4DCQB 3SCMB 4S2SB 2EO1A 2EDLA 4ZFGH 1RUMH 4WW1B 4YXLH 4H20L 3D3VD 3VG0L 2XFXA 1YNKH 2EYTB 4RWYH 1A6ZA 3WS6A 5F9WC 3QQ9C 1K2DB 4RGNE 5D1QC 4OM1L 1R5WA 2P47B 3FO1A 2CGRL 3OMZA 2Z91A 4NC0B 2BSTA 5DR5H 5IB2A 5KSUB 1CQKA 2V2WB 1OAKH 2YS4A 1PZ5B 1OM3H 1S8DA 2ZPKL 4X9FA 1QZ1A 1JWUA 7FABL 3DRTB 5J56B 3T77B 1EMTH 2VSCA 3FN0L 4G6FD 1N5YH 3X12B 2W92A 1FO0B 3WN5B 2PTVA 3QDGE 4GLRI 4I5BA 4QRRD 4UI2A 5GSRA 5TDOA 4L4VA 3V4PL 4QHKJ 5I1AB 4KK9D 1WZLA 4LOUD 2NNAB 4I9WD 3UO1H 1CGVA 3IFPB 3ZSTA 5KSBB 2OJZH 1G7IA 6FABH 3K8MA 1E28A 1Z0NA 1NAMB 3BPCB 1X6NA 4UBDD 1U8KB 2BFVL 5JNYB 4P2QE 4D0CB 3NGBB 3OBAA 1T1ZA 3OZ9H 1IFHL 2BHYA 5IMLA 2EIDA 5LQBH 4QT5A 1RZGA 3OKMB 1K3IA 1L4IA 4HS6A 1WT5C 3AB0C 5K9OB 1TJGH 1BFOA 4MQXC 5JDJA 4WUUD 3WKMH 2DLFH 4PV8A 3DX6B 4QHKI 1Q9KB 1ED3A 2VLJA 4ONFH 3RBGA 2XWTA 1IKFL 2E27L 3FAWA 4WFHD 3MJ8A 4ONHA 4Y1AE 2AK1H 3SKNB 3RIFF 4P46A 4V1DA 3JWOL 4OI8A 3EDFA 3L3GA 3T77A 1CD1B 5F70A 3S5LA 3DPBA 3CXDH 4U1IB 4IRZL 5TDNB 2XI9A 1WLHA 4M48H 3CH1B 3LH2L 3DIFA 3S3JA 4U0RB 2OSLA 4JAMA 1A6UH 1MCJA 5GXBB 4JPKL 3Q5OA 1NDMA 2W9DH 3QA3B 1Q72H 3HZKB 4NOFA 5JIKA 2E9WA 3DVGA 2EE9A 4MD5A 2IF7A 2Z92B 4DOHE 3DVIA 5ID1A 1FFQA 5F71A 1HI6B 2PO6B 2NY5L 1IJ9A 2G60L 1IGFL 5IBTL 3U48A 5I1EL 2AJXL 2FL5B 4NZUH 4FN0A 3TM6A 3SHSA 4NQEA 4OCXH 2VZ3A 5HVGB 5F7NC 5DC9B 3L3HB 3BD3A 5IBLD 5IR1A 1ES0A 3MV8B 2VDPH 3V5KA 4JM2D 4L1DA 4LQ1A 4XPGL 1ZT1A 5MENB 1J7VR 4WI8A 1MPAH 3H7LA 5EU7E 3WFEL 4JFHE 3HE7A 4LAJH 1A4JB 1ZLVK 1DE4A 3BEWB 5I75B 4M7KL 2FD6L 4JEGB 4WUUB 2ATPA 1BJ1J 4CJ0A 3KYNB 5J1TC 3PQYE 3JV5A 4NC1E 3P9MB 1QO3B 4Y5VC 1LEGB 5DUMH 4R7DA 2X09A 1AC0A 3SGJA 3GO1L 1FCCA 3TN0C 1E4WH 1CK0L 5BQ7A 5HYJB 2I24N 3JBG7 1BQLL 1U8HB 5E8DH 4R7NB 1AI1H 4PJCB 4YPGA 3AREB 3MRLB 1PZ5A 3DHJA 3EOBA 1WBXA 3UC0H 3ZDYE 1JFQL 5DMIH 4LIQH 5CD3A 1IC7H 1VFAB 1VACB 1O7SA 5D1ZB 4GMTH 2N7BA 1V7ML 3CFBB 2FLRT 4HH9A 5DJXA 3VCLB 2CDGA 1T0NA 1GSMA 1OF2B 5IBUG 2YK1L 3G6JF 4LOUC 3IDIB 4FFYH 4FXKB 2BVPB 5EOTA 4GKSA 5GSVA 3VXRE 1AXIB 5K9QG 4XP1H 3GZKA 1IGIH 1KB5H 3PGCB 3MLSL 1A1MA 5ANMB 2PW2A 4NKMB 4Q9RL 1P1ZB 4J7RA 1IAIM 1NGPL 3IT8D 4OV5B 4FTVB 4OD2A 3STLA 1U42A 3S35X 3DSNA 4HQQL 5CJQH 5IMKA 3DX8B 3U2SB 5K9OA 1YEEH 1XAUA 3O4LE 3ZKSD 2UYLA 5E6YA 4GRLA 3DV4B 1C08B 4JY6A 2A9MH 3WXWL 1T4KA 2JB5L 1S78D 1KJ2H 3KPLB 1EIBA 5DC4B 1ZVSA 1G84A 3HKFA 5ISZA 5CJBA 1J12A 4CMHC 5CD3B 2Z31B 1A9EA 1DEDA 5E0QA 4H88H 4KQ4L 4WNQA 2R69H 3NH7L 2WBKA 5FKPA 2OYPA 3I9GH 2VQUA 3I3EA 4QXGH 2MHAA 3RUGF 2IQ9H 4RX4A 3O4LB 5DRZB 4UT9H 1ZSDB 35C8L 3KPRA 4GBXD 5KZCD 1ZLVH 5I17B 1FRGL 2ZG2A 3TBYA 3EJJX 1WWCA 4F58H 2PW2B 4NKMA 2FIKB 4OBRA 4UILL 4AK1A 2NY7H 2VH5L 2ILLA 2Y72A 5FGRA 4YNYA 5CZVH 4NGHL 5ADPL 3ECBA 2DTML 3IDXL 3GIZL 1JMXA 3MLYH 3BIKA 3T0BA 3QIBD 4TRPL 4LCUB 1N6QH 1L0QA 3BIBX 5L88L 3B2VH 1XF5A 2YKLL 3ULUL 3S96A 3C8HA 1GHFH 3M45A 5DK0B 5ISZD 4OZGF 4PJ7B 3N9GH 1FNEA 4JB9L 5MEPB 3PL6C 2FYYB 1JHLH 1JE6A 4KAQH 1DQDH 4H0HB 1HZHH 3KLAA 4U3CA 1LO4H 2YA0A 4ODVL 4FXGB 4TSBL 1YEIL 3KG5A 2JCCA 3WIIH 1M6OA 3CSGA 5J6HA 4ODTH 3T0WA 4OGXH 3RGVD 2WP3O 3GM0A 5D96B 4M6NL 1XF1A 5HYJD 3F7QA 4BQ6A 1RZJC 4OZIF 4CADA 2F15A 3RRQA 1U3YA 3G04A 3EDDA 4JFYA 4JPIA 1IC1A 2CK0L 4YZFE 4C54A 4DGYL 1P7QD 1U0QA 3R0NA 1VFMA 2QL1A 1U2HA 4XHJC 4X6EB 1I7ZA 3ZYJA 4K3JH 4LLDA 1KJ2B 3Q0HA 4GG8B 4Q58C 2XTJE 3I75A 5HGBA 2A0LD 3TFKD 2BRRL 4YE4H 5HPMA 1W72A 4ONGL 3ARXA 4PJBA 1RZKC 5H94B 4XCYA 3CFDB 1MAML 5DSCB 3GSNA 1R3HA 4C56D 5DK0A 3BUYA 2X4OA 3NCFB 3VGFA 4JRYB 4NUJB 3F58H 4Y1AA 3ZKXB 4ODSH 4L8SB 4B7IA 3DGCR 3X14B 1CG9A 5CBAB 3TBTB 1B90A 3CDCA 2X4RA 3BH8A 3O9WD 2A2QT 3S36L 1ZLSL 3GUTB 3MR9B 2XN9B 3PNWB 5CJ5A 5ILTH 43C9B 4JO3H 4Z7WB 1X5LA 1P6FA 2DN7A 4NHCL 2EDQA 4P4RA 4PJDA 1AQDA 1UB5A 3OR6A 4WFFD 2B4CH 2DJ4A 5TJWK 2CUHA 4U1NA 3PGFL 4OGAC 1NFIA 4NZJA 3CVHA 4WFGE 5I1JL 4KGLA 2C1OB 5ISZE 4OUUB 4ZUUA 3O9WA 3VXME 1FZKA 2DQHL 5T1DH 4JY4B 4KTEH 5DK2B 2AJUH 2V17L 1P9MC 1KN4H 1QBLH 4M1GH 1MAKA 1T7YA 3VRIB 3EDKA 3SOBL 5DQJB 3P0VH 5B39B 3LAFA 5CGYC 4GXVH 5L2KD 1RIUL 1XF2B 3VH8B 1AGCA 4OJFH 1NGWB 4TVPL 4L8SA 4I13B 2IQ9L 3HNVH 3INUH 3RWGA 1C12B 2NY0B 2EZ0D 4IRJC 3QUMH 1CFTB 5TE7L 3WFCL 1WV7T 1D6EA 3T0AA 4AM0A 4PV8B 3PWLB 1A6VH 3TVMA 4F7CB 4MA3B 1VERA 2BC4A 4KI5F 1N6VA 3CDFA 4Z7VE 1I1AA 4D94A 1DVFB 4S0SD 1DN0A 3UP1A 1MWAH 3GRWA 4JDVA 4HWBH 4FQXC 4E0RB 2EXWC 2ZSWB 1BBJB 1LVEA 4G3YH 5CJQL 4JO4H 4FRWA 1RK0A 3HC4L 4YDKL 2IMMA 1XGUB 1BZ7B 3VRLE 1NGPH 1QTYT 4Q9RH 4ODXA 3O11B 5CD5C 3VXMB 3HNSL 1T6VN 3F62A 4JHAL 2J3SA 3RVTD 2NY3B 3O6KL 5CEZL 4GW1A 5CS7A 4TNWF 2DQUL 1HK6A 3ALXA 1NMAL 3CK0L 5AYQA 1UWEL 3BZ4A 1CD8A 4K94H 4P46C 2XKSA 1BQSA 2RFXA 4KUZL 4XC1H 1N8ZB 3SO5A 1BP3B 4J3VA 5C0FA 3FFDB 1NEUA 3CFKA 3FO0L 3CSPA 3U4EA 5EUKA 5D6DC 1CR9L 1AI1L 4HPOL 2O5YH 4EQ3A 5I8CA 1VFBB 5EBMB 4LQFH 3TN0B 4JRYA 4XMLH 2IBGA 2VAAA 4MXQD 2OX5A 5L2KA 5DZOA 1UG9A 4CUCA 3O41A 4XC1L 2PYEE 4Y5YA 1A7QL 4KUCD 2AV1B 3RY6C 4U1KA 2YR3A 1B3JA 5E2WH 3L3DA 2UUDH 4ZUWA 3O11A 5H2BB 2X9XA 3WS6C 1M71A 4M9OA 2BSTB 1AQDB 3I85A 4KJPC 2VNCA 2V7HA 2R9HC 3QDHA 4P49A 3RVXD 2VDLL 4XNYH 4Y4HA 4HH9B 4XNXH 5DJXB 3FQTB 1R3IH 2EIZB 1RV6X 1KJ3H 1YMMB 5I1AA 4DOHB 1MLBA 2KKQA 1R6VA 5B3JF 3RWDB 1YY9D 4PRBB 3VFMB 2A74A 3IDJB 3NFSL 1CDBA 1LK3H 5E8OA 3I6LE 3WE6B 1FVCB 2HYMA 4YHML 1P1ZA 3BUTA 3EGSA 4P5TD 4N0CD 2Q76B 3DI2B 1ZGLA 3FCTA 4TQEL 1F4YL 1MIMH 3O6FC 4IRZH 2R9HD 1Y6KR 3HNVL 5D2NA 4XNUH 2D4FA 3WJLC 3ARBD 4CMMA 4NCC2 4FZEH 3QWRA 2XQYG 3C8DA 2J2ZA 1DUYA 2C1PA 4F3FB 3AY4A 1WQVT 3W5MA 4FQJH 3TCLA 2LFGA 1G6RL 3PIQB 5T3XL 1NGXA 1K9TA 3RDTB 3V5HA 1MUJB 2Y06L 3F8UB 5TGBB 5BV7L 1MEXH 3NFPA 2EIEA 4L9LC 4NHUA 2H26A 5M94B 2FECI 5M95B 3TA3D 2V5RA 5KJRL 1T66C 5J9PB 4PJ9B 5ECJE 1UT9A 4XNZB 1I8MA 3MLPA 4KRPD 1GC1H 1ND0A 4PP2A 4NKOA 5DJCA 5EBGA 5C0ND 4PJIA 1NSNL 3BP6B 3LKNB 1G7MB 4LFHD 2PR4L 1MCPH 1NC4B 1XGYH 2I07A 4Y16A 3K1KC 1T22A 5JOFA 3FMGL 2B39A 4R0LC 1DSFL 1KEML 3RWHB 5K59E 1UKTA 1W0YT 2WIIA 4G6KL 1N2RA 4XAKE 4ODUA 4R26H 1JNLH 4M62H 3W0WD 2P48B 3V8CA 1BF8A 2J4WL 2DWEB 3KPNA 5TE4L 5DA0B 1N4XL 1GPOH 3OAZK 3ARBB 1IM3A 4N0UA 1QFWL 4OCRH 5MI0B 1MVUB 5KS9F 2OSLB 4JAMB 2YPLD 1CL7L 3A67H 1JK8B 5EZOL 2V5MA 3O6FB 3GSXB 3DYOA 4BSVB 3NGBC 4UOW0 4LU5H 5CINL 2DYPA 4X7FC 3IDYB 5JIHA 1V8HA 1CTNA