4YQXH

Mouse il-2 bound to jes6-1 scfv fragment
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
EIQLQQSGPELRRPGSSVKLSCKASGYNITDYLIHWVRHRPEHGLEWIGWIDPEDGETRYAQKFQSKATLTADTSSNAAYMQLSSLTPEDTATYFCARSLDSTYIYPFAYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/immune system
molecule keywords JES6-1 VH domain
publication title Antibodies to Interleukin-2 Elicit Selective T Cell Subset Potentiation through Distinct Conformational Mechanisms.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 26
structure length 121
sequence length 121
chains with identical sequence N
ec nomenclature
pdb deposition date 2015-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yqxH00
5DHYA 1U8HB 2CIIB 2QKIA 4TVSa 4XX1G 1NSNL 1KPVA 3SY0A 4APQB 4R26L 3MJ9A 3QUXD 1A4KA 4DTGL 4NKMA 5ICXB 5HHOE 1IKFL 4PJDE 1JF6A 2YRPA 4OCLC 4TSAH 3IJSA 5DRXB 3KPMA 1BVLA 4S1SL 4WEBH 4OZIF 3U7YH 2EYTB 4X4YB 3L3DB 4JFHE 1ZLWH 5ANME 4LLYB 1R3KA 4GUPB 5J1SC 1AD9A 1E4WH 3G6JE 4ZUVA 5D1XD 3D6GA 3S36X 4PJGE 3QDGD 4TPRL 3L5XL 5CJQL 1A7RL 4WFFE 1LO0L 4QRUB 1CGVA 5L6YH 4OZGB 1JGEA 1CN4A 2XWTB 2D0HA 4BZ1L 3OV6A 1N7MH 3BD4A 4AJ0A 2Q87A 1KLUB 2ITCA 3ROOA 5I1DB 1CR9H 2EE9A 4LAJH 1JNHB 3PUCA 1S7XA 4PGDB 4XCYB 3CVHH 3KXFD 4J1UA 4JHWL 4BFEA 2V17H 3M17B 35C8L 3GKZA 4LCCB 5SWSB 3SDYL 4PJHF 4U6XB 3MNZA 3VGFA 1P4BH 4HUUA 4EKXA 3IF1B 1RHHB 5IQ7L 7FABH 4WI9A 4YQXL 8CGTA 3LKNA 3KLHC 3HAEG 3VWKC 4BELD 4ELKB 1CG9A 4OLUH 4HUVA 5F44A 5HVHC 3EYVA 3V8OA 4EBQL 2NTFB 1HDMA 4X9IA 4NZJA 2DDQH 3KPRE 4XAWH 3KPOA 5DUPH 3MLXL 4XWGH 4JQIH 1D6EB 4M93B 4XPTL 5F1KC 1WFNA 1W8OA 4XCCH 2X7LB 3BPCB 1NCBL 5DYOB 3RL2A 1T6WA 4D9QD 2BY2A 3O0RL 2CDEB 1MIEL 2FJFA 3F7RA 2J8UA 3VRLE 5F3BB 4PP2B 5DS8B 4CMMB 5EWIH 4QCIA 5L7XL 4P23A 4P46A 4XZUA 4PLNC 3EJYD 2CUMA 4ALAH 1DP0A 1U6AH 3UBXA 4R96B 5EZOL 5EOQL 3PWNA 4YHIB 3BRDA 5CGYD 4AEFA 4P5MB 4YUEH 3R06B 3T0BA 1K85A 4FS0A 1UCTA 3RDTC 1T04A 2RCSL 5FM4A 1CL7H 3ALXA 1FC2D 1BZQK 3C9NB 4PJBB 1KC5L 2P48B 5FB8B 3W39A 1I4FA 1YNKH 1J9CT 1RK1B 4OIIH 2IANB 3BP7B 2XN9B 2AJUH 1D5XB 3STZB 2WLZA 2EC8A 1BBDL 3DWTA 2BMKB 1T1WB 1FGVH 4Z77A 4YHOL 3P9MB 4U1KA 1NBYA 1FBIL 4G8GE 4E0RB 1OAYH 3RGHA 3BKMH 3CFJB 6FABH 4Q6IB 3ZYZA 3AC0A 4KHTL 5ETUA 5L2KA 3MRGA 3N85H 2OX5A 2F8VA 3ULVE 4PBVC 1F58L 4EDXA 2WIIB 2AKRB 4HXBH 3QXDA 1RURL 4PJ5D 5TGBB 5J9PB 4YAQA 4RAVB 3NA9L 3I6GA 1A3LH 3CDYA 4N90E 1NL0H 5T33L 4XB7A 3K2UL 3SKNB 1H3GA 1NCUA 4KJPC 5DD3H 5JXEC 3MRIB 5CD5D 1NMAL 1CGWA 4F8TA 5EBMA 1X6NA 5HDBE 3MV11 3OPZL 4R4BA 5J13B 4KI5C 5C0DB 3MJ8B 3SDXA 4U1JA 3FT3A 5I8KL 4HD9A 1MCOH 4HXAH 1AXTH 3V5HB 2CQVA 1RK0B 1T21A 4OT1H 3IDJB 3TZVC 3MV7E 3MOBL 4M6MH 1T5XB 32C2B 4PJ7A 5T1LB 2FDBP 4R0LC 3TBVB 2ZCKH 5K9KB 5KTEH 5IVXB 4D3CL 4JCLA 2J6EL 2CJUL 2NPLX 3T8XA 2VH5L 1AGCB 4ODUB 2CLZA 3BHBB 1K6QH 3UX9B 1BQHA 2VZ3A 1QYGL 4LU5L 5DMIH 4XT1C 4APQC 3RZCA 3LOWA 4F15C 3KJ4C 3O8XA 2Z8VC 1GAFH 4ZQKA 2BSTB 1JF1B 2F58H 3UBXG 4Y4FC 3C60C 5I1GL 3HRPA 3TF7C 1TZGH 2ZCHL 5E08H 5FV1L 3CU7A 5FYJE 1GC1H 1N8ZB 4UBDC 3O2WH 3DTXA 1DSFL 4MS8D 2HKFH 4X8JA 4TUKL 1PAMA 3GM0A 5C8JA 3W9EB 4NKIH 4YDJB 5C0IA 3X13A 3W9DB 3ZKMC 1H3WM 3LMJL 1HQ4B 3WXWL 1CDGA 1GOGA 3G04B 3LQAH 4PB9L 2CKBL 3U9UB 5EUOA 3NCJL 2ICWI 4OZHE 3ROLB 5D7LE 4PJ9A 4I13B 5IVZB 2B1HL 3B5HA 3GSQB 4ZMAT 2YPVL 3VXTB 4F80A 2Y36L 2FCBA 3V5KB 4XNMB 1A6VL 2YS4A 5HGDB 1I8LC 2JIXB 1U8OB 2EDBA 3A0OA 1J05A 1KLGA 4NNYB 1RULL 3RNQA 3TT3H 2VIRB 3FO1A 5D5MB 4LLVB 4HX1B 3QO1B 2B2XH 2R0WH 2E7LC 4PY8I 4NC0B 4LCCC 2V5RA 2YMXL 1HIMH 4PS4L 3T3PF 4TNVK 1KTDA 1UM6H 3U6RB 3EO0A 2BNRE 1VKXA 4CADA 2NY5C 5BJTA 1FZMB 2K9UA 4IJ3B 3TO2B 2BDNL 3FFCA 1OAUL 4G42B 5EBLA 3S96B 4UTBL 3QEQB 1J1PH 1KB5A 3RA7H 1N2RA 3MLRL 5DQ9A 5BS0E 3HS0B 2F53B 5EU3A 3T2NL 3PL6D 2VLKE 4IRZL 4HH9B 1PBYA 4XP9H 5SX5K 1WICA 1MH5A 4BJLA 2AJSH 4FRWA 2FD6L 2W0PA 1WEJH 5DMYA 4LLWA 1PEWA 4XI5C 3ELAT 2F74B 4RISH 4YHNB 1I8MB 1NEZA 2AV1B 4LSTH 5CS7A 5I1IH 4LPVA 1BQHG 1ED3B 4MD5B 5GRXG 1NGXB 1FJ1A 1FYTD 2XICA 1FNAA 4QRRB 1P84K 5C08E 4LSPH 3UTOA 2BFVL 5DJXA 2EH8H 2A2QT 1HCFX 4PRHB 4KKCC 1M7XA 2AK4B 1I1AD 4HKJB 3TN0A 5JOFB 4XNQA 2C3GA 3BN3B 5FDWB 3WS3A 1LP9F 4IMLB 5FHAL 5FEBA 3I84A 5HHOA 2YK1H 4PJDA 1EJOL 1SM3H 1UQSB 4TQEL 1BREA 2ITDB 4LEOA 3VXQA 4GQ9H 4WO4A 1EFXD 3VGGA 3MLWH 1FZOA 3MMEA 1BJ1J 1D5IL 1K2DA 4UUJA 5ANMA 2R0KL 2FB4H 3KLAB 3UJJL 4C56B 5B39A 3G6JA 3Q48A 1KJ2B 4Q6IC 3GMQA 4URTB 5DFTA 4GMSH 1U8NA 4OD3H 1VFOA 5D1ZB 5FK9A 1FV1B 5E94B 2FX8L 2DB8A 1ZHKA 4FMFA 2XT1B 1DFBL 5IHZB 4Y5VA 4E41D 3X3GL 3QXAB 2OQJA 5FCUH 1OAQH 4MB5A 4P4RB 3BAEH 1T89A 3LD8C 3F7PC 3D2UB 4IOFC 1IGIL 3HZKB 3WEXB 3MBXH 1IQWL 4XPFL 1MWAH 1UB6A 4ISVB 4EVNA 5EO1B 5J13C 1T80A 4OGXL 3U7WL 3WE6B 4Y4KB 3TPKA 1HHHB 4JFED 3TYFA 3QFJE 4MJ6B 1HZHL 1HE7A 4L29B 4JFZH 4UT6L 4XMKL 4NQDE 5F9AC 4PJIB 3NCEB 1LNUB 4LCUB 4G5ZL 3DX9B 2Z91A 3QEHB 4IOIA 3OKLA 4FQCL 4XPGH 4RBPK 3CLFH 1M71A 5AZEH 2ADFL 4JDVA 3NPSB 2R0ZL 2XI9A 4PP1D 4XMLL 1CVRA 1NEZG 3KPRA 3NABH 2XRAH 3MXVL 4J3VA 3VA2C 2DD8L 4A6YH 3KDMA 4I5BA 5FF6B 1L7IH 2VXUH 1ORSA 3G5VA 4PRBA 4EUPB 1GXEA 3PIQB 1ZHLA 5LAXA 3GHEH 5E2WH 4IRSC 4QTIL 3AGVA 3D48R 2FSEA 2H2SC 1GZQB 1A2YB 3O3BB 1RFDL 4FFZL 1F4XH 5JHDE 3ZDZE 5ITBH 4NN7B 3K4ZA 5GSVA 2Q7YA 3UZQA 1YQVL 1JI1A 2AK1L 2OR8A 4L4TD 4JY5H 2QSQA 1IL1A 4XGZA 4ERSL 5EPMA 1VSCA 3QPXL 2JCCA 5BO1H 5D72H 4M6NH 3G5ZA 5AWNL 4OF3A 3DMMB 3G6AB 2C7UA 4GW5A 5IMKA 1D5ZB 1UM5L 3EOAB 3HCVA 1NFKA 1Q94A 2DMKA 5B39G 4R90L 1HI6B 4K7PY 2H32H 3MFFA 4TOYH 4W6YB 4U3XA 4ENEC 4G7VL 2WSKA 2N7BA 5ICYB 3HZYB 4HS6B 4NQEE 3ZKQD 3WUZA 4G8GA 2K1MA 1FVEA 4YPGA 3N1GC 4OLEA 3VFPB 1BD2B 1TMCB 2BOBA 3K80A 4KK5D 4NN5C 4WENB 3RPIA 1CLOH 2VDQL 5C6TH 1J0HA 5I15L 2AJYH 5SWZE 43CAA 2DMBA 1Q72L 4RIRB 1QLRB 3JTSA 2CD0A 1XGQB 1P6FA 4Y16D 1TVDA 4OZFA 5DUML 2J88L 1WBYA 2A1WH 5F1OB 4OIAA 4X7EC 2GCYA 4R7DB 2IBBA 4C4KO 43C9B 1NCAL 3B9KC 3ARBB 3TBSB 3R0MA 1TETH 1KENL 2FEEL 4ESKA 1F90H 4P2OA 2J3SA 1S9YA 1C5CL 2G75A 4MNQD 1G0DA 5E6ID 1IARB 4NOFA 5DJAA 3W11D 2NR6D 2ARJB 4EDWH 3MV7A 5KS9F 3QFDB 4AH2B 4DGIL 5K9JH 3O2DA 3UPRB 1YN7A 1SHMA 1Q9OA 3DRTA 3QUXC 4UV7L 3H3KA 3S97C 5I1HH 1C1EL 5IK3A 4JDTL 3EYSL 3EOBA 4F3FB 3OKNB 1MF2L 1NBZA 4KRPD 3EO1B 2ESVD 2FGWL 3A6CH 3MRMB 1INQA 1ES0A 1YA5A 3GO1L 4BSJA 5IEKA 5EZIH 4LEXH 3ULUH 2Q8AH 3ZE2E 1P4LB 1MJ7L 1QSZA 3EYFA 3MYJA 1DVFB 5DMGC 5FUOL 4N0UB 1YEHH 3RAJL 5HI5D 3IVKB 1CD9B 4H20H 1W0WA 2VXQH 5J06A 4HPYH 3JWDL 4X6BA 5TJWK 1ZT4A 2IF7A 2R2EA 1KCLA 5MI0B 3TCLB 3GDBA 3GGWB 4I0PA 3FB5A 3QRGL 3IRPX 2OK0L 2P49B 2EXYD 1XGRA 2GKIA 3CX2A 5HYIA 1I85A 2AJVH 2ZOKB 1F45A 4AMKH 1V7MH 4OZHA 4YDVB 3KWWB 4LSUH 4KI1A 5IOPB 2GSGB 5MERB 3DI3B 3HA0A 4K7PL 1RZKL 1YZZA 3G08A 3WIFB 5KZCB 1JCKA 5GGVH 4MJ4A 4JPVL 3QIUB 2HH0L 1ZHBA 5E99L 1GJIA 1FL3A 1X4YA 2I07B 3K81A 4Y5YB 3FB7A 3TJHC 4LPYA 4PJAE 8FABA 1LO0H 5JDJA 3TBWB 4OZFG 3DGCR 2VISA 2M8XA 4MYWB 3O4LE 2OZ4A 3VRJB 2A9ML 4F7CA 3C5SB 4BZ1H 2BNRA 4JFQA 1FORL 5E8EA 3NA4A 1MHPL 3WO4C 1OQOA 3A67L 3TV3H 1NFIB 1QQDA 3KPSD 5BS0A 1UH4A 2YBRA 4GKNA 2AXFB 2OXGA 1KB5L 3HE7A 4ZAKB 2PYED 4LF3A 1BLNB 1H0DB 1NANH 2PNDA 2VLKA 1LE9A 3EJYC 4UOW0 4EI6A 1EAJA 4K8RL 5IQ7H 3GRWL 5CLTA 4G6JL 5CWSB 1LK3L 3S4SA 2AABL 2C1OA 5LBSL 1R3IH 4XXCA 4JY6A 1UFUA 3HTLX 2Y6SD 3LN5B 4O4YH 4D9RE 5KN5B 4UT7L 1CE1H 3ULUD 4NN7C 5C08A 3SGDH 4ZSOB 3LEVL 4R7NA 1EHLH 4WHTB 3FO2B 3DX7A 1TJIL 3LHPH 3V4VL 4PRNA 1AFVL 3SJVD 3SDDA 1W0VA 1KIUA 1NCBH 2CH8A 2DI9A 2PO6D 4IDLA 1CICC 4X6DE 1VA9A 4NGHH 5J0BA 2GTZB 3T04D 5I76A 1DTUA 2WWKT 3THML 4BSWB 5EU7C 2YD4A 3L3HB 2W0FB 2R4SH 5FECB 1WCBA 2YC1B 1XGPB 2D03L 5EZOH 3VW3L 4PJ8B 3U83A 4GS7C 1QA9B 4N0CD 3MACL 5D7JA 2BSRB 4OM1L 4CDGC 1Y18B 4JZOB 4L4JA 3IDXL 3BDXA 4GKSB 1J1OL 4KMTL 3L3GA 1CGTA 2B0SH 3MGAA 1JFQL 4AG4L 4P48A 5CD5C 1W72B 3OAZH 3C2SA 2DL9A 4NUJA 5IUSA 2ICWB 4MA3B 5TDOB 2LU4A 4JKPL 1PG7X 4MQ7B 4FG6D 1BBDH 1K4DB 1YYLL 3PGFH 2Q3AA 3RUGB 3S88L 4KY1L 3GBML 4J3WA 2CO6B 2ZJSL 2W60A 3F12B 4YHOH 1PD6A 3MRLB 1FBIH 1YMMA 4WTWA 5DJZB 2CLVA 4UAOB 4HWZA 4K2UH 3PDOA 3RHWF 5TF0A 3R8QA 5EBWA 5GRVK 3I75B 1BVZA 2HN7A 2WV3A 3VXRB 4LASH 2IBGA 5ENWB 4AENA 3ARBC 1MRDH 3MRPB 4MWFB 2EYRB 3EDEA 1F58H 4KVNL 4AEHH 3QFJA 1R3JA 3GMLA 1J7VR 3MLVL 4NQVA 4NQDA 3QULB 5JA8B 4M6OL 4ZOAA 3GMOB 3QHZH 3ILQC 3O9WA 3NA9H 1U92A 2CK0H 3K4AA 4CVWA 5EU6E 3SKOB 4QXTB 2NY7H 2FX7L 3B4NA 1NMAH 1NGYB 4QWWC 1XGUB 3OPZH 3U0PA 5DDHA 1QFOA 1NEUA 4S0TD 3FN0L 4GBXC 5I8KH 3ZTJG 4ZTPL 5HYFA 5IVOA 1S7QB 4S1QL 5JR1L 4MS8C 2E7MA 3AXLB 4LLUA 3MV9E 4GKZA 5J3HC 4L8DB 5HY9A 4ACPA 4F57H 4OCSL 3TIEA 4GRLD 2E7BA 5D2LE 4D3CH 1A9EA 4NQXA 3GI9L 3DX8B 5JHDA 4M3JA 3GKWL 1VACB 3WFCL 2VH5H 1HHKB 3FB8B 5FKAB 2WUBL 4NRYA 4H1LB 4ZO7A 5BZDA 5FA4B 1N6UA 3MBEB 4RNRA 5JQ6H 5MEOA 1QSVA 3O2VL 4M02A 1CLYH 2EDEA 2Q6WA 3HPJA 1AE6H 4JE4B 3U0WL 4HWNA 5I1GH 1S7SA 4KJWC 2ZCHH 5IP4A 2BOCB 1OTTD 4EI5A 2BCKA 5CJ8A 2EDXA 4V1DE 1ZWIB 1RZ7L 4U49A 1OY3B 4HG4K 3WYRA 2Z31B 1DSFH 3DETC 1CDIA 3MO1B 4IIQB 3EIFA 4TUKH 4IBLT 2FHCA 5EN2A 1OGTA 1ZVSA 4NQEA 1G7IB 4LDLB 3BGFC 5GGTA 2DQUH 3LMJH 2OXHA 1Z9MA 5I18L 1OTSD 3QXVA 4I3SH 4WI3A 3WXWH 5F89A 2G2RB 4PB9H 2ADGA 3V52H 2E6JA 3MOQA 1SEQL 1I1FA 3MNVA 1XF3A 2Y7QA 2IJ0C 3WHXA 1NGWB 1YEJL 3F5WA 4JO2L 4KKBC 3ULVL 3PL6C 2YPLB 4RMRA 1JZ3A 2VDPL 3Q2CA 5SWZA 2XTJB 5DUBA 2Y36H 4QKXB 4NO3A 1WT5C 4G6AC 4NQCE 4CVZA 2EDNA 1F5WA 4EN3B 2B39A 2UWEB 4EXPX 1NAMA 3ARED 1UZ6F 1TPXB 4U0RC 4Z18A 3GHBL 1UKTA 3NBNA 4CKVX 3U48A 1FFNA 4OZ4A 2KPNA 5HVGB 1KTRL 4Z7NF 3DVGA 5J89A 1YEDB 4PPTA 5AUMA 1I1AC 2BDNH 1XIWA 3MRJA 1G7JA 1OLZA 3O11B 4Y2OA 3VXSE 5INCA 2GAZB 3GSNB 4ZOBA 1YPZE 3MA7A 1ZGLA 5AAMA 4P9HH 3BJLA 2MPAL 1ZAGA 4IRZH 1J8HB 1XZ0A 4P9ML 2X4PB 2P8MB 5CZXC 4PTUB 1F3DJ 1T83A 1FAIL 3WNNA 2GJZA 4NQTA 5E7FA 4RGNC 1J1XL 2EE6A 4JM2F 4I0CC 1FAKT 4H88L 5T1MB 2BXYA 4BUGA 1HEZA 5JIPA 4JGMA 4G6KH 3UCRA 2W65A 5DVLA 1WBXA 1PX4A 1ZVHA 3LIZH 3JV6B 3WSQL 3I50L 1CVSC 2X2YA 2X4OA 1AR1C 2ZSVB 4UI2A 4LCWE 1B0RA 4ZFOA 3CIQA 1MCJA 4C59B 1VFBB 3TLRA 5FHAH 3F7YA 4ZUTB 4BFIA 2Q1EA 5IMOA 1EJOH 4TQEH 4I4WA 4MNGE 3MRCB 5CEXB 3V0VA 1EZVY 3QDMB 1I9RL 3C2AL 4JZJB 3T4AB 2ERJB 3WJJA 1FP5A 3UJJH 1EBPA 1QSFD 1IT9L 1MCSA 2GFBA 2ICEA 1HWGB 2AQ2A 4NRZB 3B3IB 3BISA 4O9HH 4OFYA 1ZLUK 3IU3B 5GS1B 1N6QH 4CW1B 3VI3E 3L6FA 4ONFL 3IDMA 2FO1A 5KG9A 3DBXA 4Y4HB 2VLLA 1IFHH 2YEZA 5EOCJ 4WHCA 5HBBA 3NZ8A 3SDAA 2ADJA 4PJAA 2B7DT 4WU7B 3QQ9D 4G8FA 4PP1C 4X83A 1F4YH 3P0YH 3VG9B 5J6HA 5E6YA 3HFML 5KS9B 3O4LA 5TH2B 4Z7VB 3B6SA 4GW4B 1IGIH 2OZ4L 1OGAD 5DF0A 3FQXA 1A21A 3RVXD 2JIXD 2F54E 1U8LB 3AFLA 4H5SB 5C0ND 4XRCA 1IQWH 4PREA 5DO2C 3OG4B 1G9ML 4DKAA 1Y6KR 4I0KA 3IJHB 3ZZ1A 2D9CA 5IM7A 4QNPF 3WDIA 2A6IB 1ZGLP 5DQDH 4POZD 4U4BA 2WANA 1RZJH 3CFCH 3G5XB 4H0GA 4HUXA 4JPIA 4XMKH 4XH2A 1AQDA 3CSBA 3LQZA 5EU5A 4U1SB 4W4OA 1ODAA 2GUOB 3REWA 3SE3A 5EU4B 3EDFA 4U2ZA 1OVZA 5J56B 1QFUH 3UBXI 1RMFH 4KKAD 4HFUL 2W91A 5DJ6B 2ADFH 4IRJB 2XOTA 4MSWA 2I25N 4JR9H 1NGZA 1JGDB 3OB0K 1T2QL 4P5TB 4XMLH 3ETBF 1MCEA 3FT4A 5DK2A 3O3EB 2VLRB 3GSUB 2J8UF 2JJWA 5C07E 3VI4E 1DQQA 4GG6E 4OF0A 5I1AA 5IQ9B 2VKXA 1KN4L 4Y19E 3BVNB 1A1MA 4IHOA 3H42H 4FTVE 4I48B 1K5NA 4X6DA 1ONQA 3VCLA 4QTIH 1KGCD 1EVUA 4LSQH 1G1YA 2NX5B 4JHBA 1ACYL 3VFVB 3SCMD 2Z31C 2R2HA 1JGUL 5A16A 2AK1H 4EIZC 1T1ZA 4EUPH 1IGJB 3CH1A 2BZDA 5ISZE 1A5FL 4PJFB 3QPXH 4OFVA 4D0CB 3ABZA 1ADQA 1NCWL 1C12B 2DYPB 5AWNH 2DBLL 3OXSA 1AC0A 1IAMA 3MLPA 1FZKB 1UZ8B 2QSVA 4WWKB 4ORZC 1YEEL 4DGVL 5J12C 3QSKB 2P46B 4NJ9H 2NNAA 4N9GA 5H37H 1IAII 2HVKB 4FFWD 4Y89A 4U6HA 3RX8A 1G7HB 3SBWC 2LQRA 1DQDH 1P9MC 3QUZB 4DN3L 4HWBA 2VDLL 4XPBH 1QRND 5D1ZD 4HGKC 3V7AE 3NGBB 5HYJD 1X5LA 2EYSA 3RGVA 3FQNB 4XPHL 5F96L 4J8RA 1ZLSL 5ALCL 5I15H 1PYWA 2P7TA 4NDMA 2VN4A 3BESR 5ADPL 3L9RA 2Q86A 3P4OB 4DCQA 1FO0A 3W5MA 3HLAB 4MCZA 3SKUD 2N4IA 5EU6A 5IMLA 1P7QB 3ARGB 4JY4A 3PWVB 3ZTNL 1DANU 2FX9H 5T5FL 1ZLUH 1NCAH 1S7TA 4Y4KD 1U8MB 4DUXA 3BWAA 1D3CA 1OB1A 4PJ7F 5HI5C 3TBYA 3U30B 3IETB 1C5CH 2OLDA 4HWUA 3VFTA 4D0BA 5KSVA 1FFOA 4ONHB 2FECL 1FDLL 4O51B 4XMPL 3MV9A 4DGIH 2DQHL 3VFRA 3OAUL 4K94L 1OP3H 2GT9B 1U95B 1DLFH 3EYOB 5F7LB 4KRNA 4UV7H 4OLXL 5D2LA 2FGZA 2EXYC 1U93A 3V6FA 1P53A 1EEZB 4LP5A 4TN9A 4D9LH 1A6UL 4H26A 4JDTH 4P4KB 2APWA 1FE8H 4MDJB 4AL8L 1MF2H 2YR3A 5MHSE 1CTNA 1E28A 1W8NA 5DFVD 1AD0A 3STLB 1MFAL 4OFPA 4F7PA 3UTQA 3MLZL 5HHQA 4HKBA 5ILTL 4Z0BL 2C3VA 1K4CA 1UWEL 3CFIC 3P0VH 4PJEE 3PHOA 4V1DA 3RNKA 2P1YA 1A3RH 3LKRA 3RAJH 2HFGH 3MGOA 3OF6D 1PKQE 2D9QB 4TSCH 1JPFA 2YD3A 4JZJC 1WZ1L 2ERJC 3TNMA 4PG9B 3OB0H 5ID1B 3D3VB 3I2CL 1A6ZB 5GS1C 4OBRA 1IC5H 2OK0H 5EUOF 1KPUA 3X17A 2O5YL 5DRNA 5GGTL 4HEME 4JPWH 5GRWA 1CBVH 4HZAA 3VXUB 1R24B 2H45A 3MLSH 4HQQL 1UXWA 5C9JB 2DM7A 4LRIA 1TTGA 3PWPE 3RKPA 3TA3A 1D9KA 4G9FE 3VG9C 5DRWB 4HBQA 4NZUL 5E8OA 5F7NC 3BEVA 4RDQF 3DROB 4JN1L 3KPQB 1C5DA 4PRIB 4JANB 4CAGA 5F21B 5MEQA 2EIEA 4NQCA 1DEEA 4M1GH 3CFBB 3FO9A 5E99H 1AXSB 4ELMF 1NFDE 4CJ1A 3DO7B 5L8KB 1F4AA 1RJZA 5DURD 1YUHA 1FSKC 4PV9B 1NAML 5DTFB 1EERB 1RZ8A 4WGVB 1WVZA 3RIFF 3KPTA 4RX4D 1GGTA 4NO2A 4UNVA 4HGMA 5B3JE 4J4PA 3X14A 4X6EA 2AXGA 5B8CA 4KHXL 1ZT1A 1MHHA 1XFPA 1JGLH 2D7TH 5IB1B 1C7SA 1FORH 2VOTA 3UTTB 4LPCA 2V2TB 1L6XA 1MPAL 2PXYD 4K3JL 4U1HB 3GMMB 3BGMB 3VXSA 2OMBA 4FQLL 5D9SA 3EGSB 1I8IB 1YPZA 1GPOH 3I9GL 4P5TC 1LWRA 5I75B 5LXGL 2AGJH 1SMOA 1XR8A 4HIXH 1EH9A 2HKHH 2VZ1A 2OL3L 2GSIB 2HJKA 2VDNL 4PJXB 1BBJB 4NHUA 1VADA 4K8RH 3KYKH 2WBWB 4LK4A 1KJ3H 3GRWH 2XY2A 4G6JH 2IG2L 1J86A 1LK3H 3LKOB 5LBSH 4N0CC 2UZIL 5HVFB 3TWCH 1RIHH 3PJSB 2VE6A 3O8XD 4UDUB 3O3AA 4QXGH 1KYOK 2BC4B 1FIEA 2EDJA 3ESUF 1S5HA 3LEVH 4BH8B 4OF6A 2DQJH 4W4NA 1JUFA 1CT8A 1TJIH 1FFRA 1AFVH 1ZHNA 5CJ5A 4PJDF 4Y4FA 1NGQL 1PG7H 1G0XA 4LCWA 4LHUD 1CZ8L 5GGSA 1VDGA 1EDQA 2EE2A 3IGAA 4F7EB 9CGTA 3FO0L 3BE1L 1DVFD 5IROA 3I02A 4MNGA 1TCRA 1FNEB 2X4UB 2OMNA 3WIIL 3VW3H 1NMCC 4F7MB 3H7BA 5D6CA 2KH2B 1A9BA 1V3JA 1GGBL 1N6VA 1GSMA 1V8HA 1XCQB 3GI8H 4NFDA 5E9DB 4NPYB 2VWEC 5HHPA 4X0KB 1N4XL 2F5BH 1DLHA 5D70L 1U3HA 3ARXA 1VFUA 3IDXH 3QUZC 4L9LA 2V7NA 5HGAA 2H2PC 5DR5H 1Z2KA 3C6SB 3KNBA 3NGBC 4WNQB 4JKPH 1M7IB 2Y25A 1EUTA 3L95B 4ZUUA 3CX5K 1YYLH 3VA6A 4ETQA 2G5BA 5IHBA 4HIIA 2FHBA 3GSVB 2X4RB 2VLME 4RFOL 3BQUB 1T1XB 1I75A 1MEXH 3LRSA 4XCEA 4O2CA 3HAEB 4KU1A 2F54A 5JMOC 5DVKA 1LVEA 1QPXA 4OF5A 1E0OB 4KK6C 1CXFA 1J12A 4Z76A 2GQHA 3OWEA 1MCIA 3TYGH 2QLVB 3U30C 3NOIA 4M6OH 1YMHA 1R5VA 1AHWA 1E27A 4D9QE 4YDLB 4KK9D 3P73B 1A7QL 4YDIL 2X9WA 4K8RD 4JM2B 4O5LL 4XBGA 5BRZB 5EUKA 4Q9CA 1WAAE 1S7VB 2FX7H 4MB4A 2A74A 2QKIB 1ZTXL 1U8QB 3H8NA 4PRDA 1TQBB 4OKVB 2CIKA 3SY0B 4ZAKD 1OP9A 3IDYB 1A4KB 4M7LL 4O02L 3VFNB 4NKMB 4PGJA 3LS5L 1WISA 5C07A 3VRLF 5IG7A 4GG6A 3INUL 4WV1A 4JREB 5JR1H 2PN5A 2O5XH 4Y19A 3GIVB 1Q0XL 4PD4K 2MNUA 4OCSH 4FTVA 5ESQA 3IFOB 5F93C 3FB6A 2AJXH 2P5EB 4L1DA 5EC1A 3TN0D 1R3KB 1N26A 4BUHA 3GI9H 5JORA 1JHLH 4CMHC 5F1SA 4ZUVB 3GKWH 2JCCF 1JJUA 3NH7L 1R3LB 1QUNA 1B88A 2X89A 3UPAA 4XVJH 5CD3B 1AIFB 1JF5A 4Q9QH 3DRQA 2Z8WC 5ISZA 1AKJA 3O2VH 1N5AA 2NY3C 1UVQA 4FZ8H 4NO0D 3VFMA 1A1NA 1ADQL 2R1WA 2DQIH 3L3OB 3IRZA 1JGEB 4M8VA 5D1QB 5HHXL 5B38B 2IMMA 3QEUA 4JFDE 2EXWC 3JV4B 3KPNA 4HS8H 1JV5A 2IH1B 3HRZA 1FLRL 3EZJB 5JO5A 5KVMC 4PJ5E 2ITCB 4CNIA 4HDIA 5IJKA 2IPUG 4QHUA 1Z5LA 1NKRA 2FO4A 1FRGL 3ULVF 5HGGS 3D85A 3SGEI 3MNZB 5KSAA 2J7LA 1WFTA 4PJHE 4TULL 1SEQH 2AI0H 2ZUQB 1DN2A 4FQXB 1DUYA 4HWBL 2Q8BH 3U82B 3RWFA 1U36A 3LPWA 4JO2H 4S2SB 4B53A 25C8L 1CG9B 1S9WA 4HUVB 1MI5E 3EYVB 4HBCH 5HDBF 3OJDA 4XC1L 4YHLH 3U1SH 3RP1A 1L6ZA 3KPOB 1AJ7H 2XPGA 1FO0L 3KPPB 4ZYKB 5CZKA 1G1CA 1UH2A 3SEPA 1KF9B 2GY5A 4UTAH 2ZCLH 4P3WA 3GHBH 3X11A 1FVDB 2FJFB 4IOSD 15C8L 1UWGL 3V6OC 2EEDA 3KPRD 2KKQA 4M8QB 4QCIB 4P23B 4P46B 4XZUB 4GW1A 1IGCL 1QBLL 4OD1H 5EO0B 3UBXB 3PWNB 3MJ6A 2L7JA 2UY7A 2YUZA 3U2SA 2MPAH 3JVGA 1CFBA 4OD2A 5IBUB 4P9MH 3W39B 1I4FB 1FAIH 5GRYA 5IW6A 1PQZA 5DLMH 1S3KL 2EEAA 4ZFFB 5GGSY 3WXVL 3WFDL 1J1XH 4LQFH 4WW1A 1VGKA 1MJ8L 3GSNH 1KNOB 2GK0B 1AP2A 4Z77B 4PJEA 1AGEB 3TP4A 2FATH 1PKQA 1S9KC 5ETUB 5L2KB 2NY2D 3WSQH 3MBED 4XTRD 4Z7WB 1A6AA 5LGKA 4EDXB 3ALWA 4OZHF 3QXDB 3BMVA 3VMNA 5AZ2L 4M48L 5D93B 3KAAA 3RVXC 4YAQB 4ZFGL 2DLTA 4ZS7L 5C0NC 4MJIB 5GRZA 4X80L 3I6GB 3TT1L 2FZ3B 1LO5A 1I3RA 4L8SC 4Z95L 3L5HA 3PWPA 4U7KA 1I9RH 4YZFE 3C2AH 4X5LA 4G9FA 2XXMB 1Q38A 4HJ0D 3OXRB 5I8EA 5F6IB 3ULVD 4QTHA 4KXZI 5T1KB 1P2CB 2FR4B 3V7AG 3SDXB 4FOMA 4QYOA 4ONFH 5T5NG 2R4RH 5E4EC 1NFDA 3ARRA 4RZCA 5C2BH 2ORBH 1SYVA 1JWUA 2OJEA 1CD1A 2HLAA 5D2NC 3I3BA 5JIIA 2BP3A 3RWCB 4N0FA 5JXAH 3HFMH 3K74B 3MRDA 5I1KL 1XEDA 5DHVA 1UB5B 1TVBA 4YXKL 2FWOA 4JB9L 4JM2C 3BDBA 3D69B 4EN3D 2IQ9L 3EJJX 3MV7D 1NDMB 2VYRE 2X4QA 1FYTE 4LFHD 1OWWA 2PTUA 2X44D 5F88B 3IJYA 4DKFL 1EEYA 4J6RH 3IDYC 4ZQKB 3HC0A 3TO4B 4NKDA 1HN1A 2X10A 3LKQA 3UTSB 4HC1A 1R5IA 1TNNA 4NYLA 4YBLB 3PV7A 3GIZL 4LLQB 3QAZB 5LG1A 4X8JB 3GSXA 4HFUH 3HI6L 2J12B 5T3XL 3S5LA 1YJDH 3EOTL 1T2QH 3X13B 2EC9U 1YDPA 1MVFA 5JPMA 3VXNA 1BFOB 2A6JB 3MRBB 3K8KA 2NY4B 1BX2B 4NWUL 1CXLA 4WDIA 3FN9A 1R3HB 4HW6A 4PJ9B 5D1XA 4DKEL 2I60H 4FQ1L 4FFWC 2DKMA 5D7SL 2DTML 1K8IA 1P84J 1QRKA 4I0PD 1I3VA 4X4XA 3P11H 3BPOC 2V2WA 1JYWA 3WFBH 4P59L 1ACYH 4HK0A 4KVCH 4E41E 3CC5A 3JUYA 2MWCA 2DWEB 1D5MA 2P8LA 2DQDL 3FO1B 4ZDHA 3D39B 3D18A 3SGJA 1H5BA 4UB0L 5K33A 1IM3B 2H1PH 1KTDB 1ZV5A 5DSCA 3EO0B 1YEEH 2ZUQC 5I1EH 5LCVL 3T3PE 3HB3D 3FFCB 5LGJA 5M94B 4P2YA 4UV4L 5GISH 4DJMA 3MCKA 5IB3A 1FZJA 4FZEH 5EU3B 2I9TB 2KZWA 1T0PB 2EZ0C 5IFHL 1LO3L 2F15A 1ROWA 5IW1A 1AGFA 1OT2A 4LLWB 1NEZB 1ZA3A 4WFGE 5BS0D 4XPHH 5F96H 1ZS8A 1A7BA 1ZLSH 3HE7D 3WFHB 3IDIB 2HLFC 2VDML 3C09C 5GPRA 1FJ1B 1X5ZA 4P23C 4P46C 3PP3K 1G7QA 1IAIM 3IFNL 1NPUA 2A6DA 3HUJE 1WAAA 2N1KA 1UC6A 2Y5EA 5DHXB 4AT6A 4RQQB 3LZFL 4MNHB 4N8CL 1CD0A 4M7ZB 4L4TE 4N9OB 5FHBL 3RWJA 3RWEA 1RJLA 4K55A 1UACH 3ESVF 5H2BA 5M7QA 3W0WE 1WTLA 3LS4L 4TVPL 3S5LG 1FDLH 4XMPH 1B0WA 2H9GA 4WO4B 2DQHH 3QEGL 4NM8L 3OKDA 5KAQF 3ZDZF 1FZOB 3MMEB 3SDDD 3RTQA 1N5YL 1PLGH 5HTSA 3RJDA 1LEGB 1WITA 1UM4L 2PCPA 3ZYJA 4IRJD 2C1PA 1KPRA 1A6UH 5B39B 3G6JB 3FJTA 4N8VA 2FBJL 1KIRB 4GG8A 5CGTA 4E5XB 3GMQB 1PSKH 4L4VE 4YPJA 3VWJD 1U8NB 3QNZA 3T3ME 4FQHB 4PJGB 1E4XL 4WW2A 3P0GB 1OSPH 3L1OH 1KXTB 1ZHKB 4MLSA 2FH6A 1UJ3B 2NXYD 4NSKA 5CFHA 5JTWA 4K23L 2VSCA 1JP5A 4JQXA 2I27N 4JFDA 4ZS6C 2DM4A 5IIEB 3IFPA 1DQML 2NX5D 4DVBA 1FQ9C 4M1CC 3BP5A 5H94A 1A6PA 3CVHA 4Y2DB 1U3JA 3WFEH 1TCMA 2EDDA 4PJ5A 5IB2A 1UB6B 4OF7A 1S7WA 1OT1A 2BVPA 3WKNA 1I7RA 5C3LD 1MCQA 5KVGL 1B90A 5GGUA 1OM3H 3TYFB 4WEMB 5AYUL 5DI8A 5DVMA 3WN5A 1QR1A 4MA8L 1YMMD 1FNGA 4WWKD 3ZLQC 4PJHA 4U1LA 1DQJB 4J7RA 4UQ3A 3CNKA 4NT6B 4FQ2L 4IOIB 3OKLB 2JB6A 3QJHB 4YX2L 5BVPL 1M71B 4NZUH 5ESAA 3WCYA 4FABH 4MNQE 3RL1B 1MI5A 4WUKL 2ZUVA 3KJ6H 3EO9L 4M7JH 4OCXL 5DK3A 3QNXA 3B5GA 3C5JA 2AXHA 3KDMB 4RA3A 1ORSB 2VUYA 4U1MA 1EMTH 3RZCC 4OCYL 3O8XC 1HXYB 4Y5XA 1MCLA 1ZHLB 2XZQH 1MFEL 3DX6A 3MRRA 1E4JA 1TJHH 1RAMA 5ACMA 1P6AB 1BVKA 2ZUXA 2HVJA 3DLQR 2XV6B 3KYNA 2ESVE 1QFHA 3M8OL 5DD6A 1LEKB 4YBLC 3JWDC 4J3OC 4XBEH 3AS3A 2PETA 3QAZC 4M9PA 1IL1B 1JN6B 1P7QD 2APBA 3FTGB 3ARGD 2EDKA 4FQLH 5EPMB 4DW2H 3I9GH 5LXGH 4H8WL 4XVUD 2DJSA 1SYSB 3HG1B 4D0DB 1U2CA 4N1HB 2C7UB 5IMKB 2OL3H 3BIKA 5DMKA 1ULVA 3NIDE 3ARSA 2B1AL 1KJMA 1Q94B 3ZE2F 4Y7MA 4HKXB 4PJ9C 4MXQD 4JG1L 4QRPB 1RZKC 4Z0XA 2N56A 5EIIB 3PP3H 4ZODA 2BRRH 1BJ1H 3EZ8A 3T2QA 4G8GB 3H9SE 3BZFA 5BVJA 1BAFL 1NCTA 4YPGB 4LCYA 2APVA 3V0WH 5D6DA 1V7NL 1IZJA 2MMXA 2BOBB 3A6BL 3U0TA 3P2TA 5AEAA 3LEYL 3RPIB 4KROB 1CZ8H 2F8OA 4OTXH 4QRSA 1T5WA 4XP1L 5HHME 3VJ6B 5EOCL 3FO0H 2VABA 2DF3A 2RR3A 1T7VA 3NIFE 4M7LT 3OGCA 1BOGA 3WIIH 4QO1A 1RIVL 4Y1AD 1DQTA 1GGBH 1QLEH 1QO3A 2XYCA 3D3VD 1Z9SA 2X09A 1D5BB 1OD9A 4KK9C 4PJAF 3RRQA 4MVBD 1EXUA 4P2OB 1S9YB 3HE6A 3KPSE 3VXUD 4POYA 2H26A 1NMBH 1MREL 2PYEE 2B4CL 3N1QC 1WK0A 5DD1L 1JGVH 5CBAB 1B9ZA 1E4KA 1Q9OB 3ZKXC 1F8TL 3S8WA 1CGSL 4QXWA 1OF2A 1HSAA 2JJUA 4X5WA 3UO1L 5FA3B 1RSFA 1DBBL 3N9GL 4JM4L 4BKLB 1NBZB 4KTEH 2BY3A 1FYTA 4BZ2L 1T4KA 3TN0C 3ULUE 4MZ3A 1EEQA 4Q9RH 4M7ZC 3RX5A 4LDEB 4YO0A 5INDB 1TJGL 3OQ3B 3OGOE 3HMWL 1OQXA 4EZMA 1KCRL 1QVOB 5BZWA 3MYJB 4WO4C 1OTUD 1F97A 2Y06H 2VC2H 4HC1L 2ED7A 1W0WB 1UWXK 5TFSH 1ZTXH 3NFPB 1XCTA 1EFXA 3FB5B 5DD5H 3EJZD 5A43C 4X6DF 3AS1A 1XGRB 5I8CB 2VITA 4U1IA 3BUYB 1B4JH 2EDWA 1RUMH 5KW9L 3NN8A 2VAJA 1H3PH 4MZ2A 4Y5VC 3UDWA 3ZO0A 5D7LB 3PWUA 5CBEA 4FQIL 4MXWH 3RWDA 1T89C 3G08B 1G9NH 1LDSA 3D9AH 3OMZA 4E41A 4ETYA 1QKZH 3CZFA 1FL3B 5CP7B 1FNFA 1ORQA 3FB7B 1F6AB 5HSFA 2UY6A 5ESVA 3NTCL 3LKSB 8FABB 2CUIA 1QACA 1JRHL 3TNNA 1OARL 3LRGA 2FL5A 1IAKB 4OFYD 3K46A 1J0KA 4F7CB 2NCMA 2RBLA 2BNRB 3T65A 4DEPB 2LE9A 3ES6B 3HNSH 5E8EB 2IGFL 1FLRH 3TJEL 5BV7L 2WAHA 5IVNA 3WHE1 3O6FA 1QQDB 1U8KA 2KQMA 4GKNB 3V9FA 5JUEH 3M1BA 1MCKA 1DUZA 5GIRA 2VLKB 3O4LD 3KYAA 3C8KB 4G9DA 4PY7A 4EI6B 4GRWB 2R29L 3UXFA 1FL5A 5I1JL 1FIGL 4KAQL 5SWSE 1XH3A 2D31A 3L7EA 1X4XA 5DD0H 2P42B 4XC1H 5C08B 4R7NB 1WZMA 1YEFH 3FKUS 3HUJA 3DX7B 4QXUH 4R8WH 4YGVA 4PRNB 1KEMH 2XWJB 4AQOA 1EIBA 5IR1A 3RKDD 4L4TA 1UWGH 1A6TB 3H6JA 4PRPB 3W0WA 2E7HA 5D2LF 5MP6L 2YWZA 5JIKA 5SV3A 4KJQC 3OHXA 5ITFA 1WCBB 2NY0D 1QLFA 1CDUA 2QBWA 5BRZD 1QBLH 3FQWA 4ZD3H 3QIBB 1NC2D 1KELL 3VXMB 4KZEH 3Q6FA 4P2QD 5K9OA 1HHGA 4HLJA 5FKPB 4W68A 4WFED 4HMCA 3N0PB 4GAYA 1CFQA 1PZ5A 4L4VA 3RVTD 3CUPA 5L6YL 5IMMA 4NUJB 4HJ0C 3ULVC 2BK8A 1BF8A 3WFDH 4I77L 1MJ8H 5EFIB 3IB4A 2P5ED 4K71C 1F42A 1N7ML 1MUJA 1OL0A 1MWAA 2W60B 1BFVL 1ZLVH 2CLVB 2AQ1A 2I26N 4UMGA 4V2BA 2OI9B 4AENB 4HK3J 2AV7A 5ICZA 1VEOA 3RIFK 4Q58C 1P4BL 4Y16A 1H9VA 5D7IF 3JWOH 4P2OC 4C58B 5AZ2H 4NQVB 4NQDB 4ZO9A 4ZS7H 4HG4J 3KHOA 5E2UH 4BYHA 3O9WB 4X80H 1U92B 4OUUB 1PG7W 1VESA 5BCAA 3C6LA 3I6LD 4OLUL 2YSSB 4DOHE 1JWSA 3DJ9A 4A6YA 3DXAB 2DDQL 5E6IA 4TUJA 3RGVD 5DDHB 4XAWL 4XWGL 4JQIL 5D8JH 4M62H 1YY9D 3ARFB 4ZNEE 3IAPA 4XCCL 3JTTB 1M05A 2XACC 2W92A 2NY1D 4HUKB 4DWHA 4P2CG 4GKZB 4JHAL 3JSSA 4UIKH 1FVCA 4C4KT 2W0LA 5FO7A 1AO7D 4DFHA 1MFNA 2YWYA 1IAIH 5I1KH 2ESVA 4YHZH 5F7YC 1YPZF 1JPGB 3MREB 5FM8A 1QFWI 4NRYB 1TQCC 4RAUB 3HZVA 4XWOD 5BZDB 2R2CA 3ZT7A 1MFBH 3E2HC 4L8BB 4JGUA 3U36A 5CEZL 3DYPA 1CL7L 5MEOB 4DKFH 4I0PC 1G7PA 2Q6WB 3HPJB 5CLWA 3PV6B 1TITA 4JRWA 1YNKL 4HLZH 1I85C 4YHML 1S7SB 2H32A 2H6PA 3CPLB 1IGTA 4XNZB 2OYPA 4EI5B 2BCKB 1KCSH 3ISWA 2AJUL 5I17A 3C5ZB 3QPQC 1LK2A 2ICCA 1RJCA 5HHNA 1IQDA 3GIZH 1FGVL 3H9HA 3K3QA 4ODXA 5T3XH 3MJ7A 5EN2B 1OGTB 4X7TA 1ZVSB 3BKML 3CU1A 4TRPH 3LRHA 3H9SA 2CRZA 2D4FA 2HG5A 3N85L 5F89B 1QSFE 2ADGB 2XNAB 1I3GH 4L5FH 3MNVB 3IAQA 3GMNB 2G5RA 5EZJA 3TIDA 4DKEH 1Q0YH 2H8PA 5D7SH 1A3LL 5DFWH 1NL0L 3ZDYE 5SWZB 3ARVA 2VXTH 5DUBB 4DEPC 4NO3B 5DD3L 3MZGB 4P2RD 1G9MC 2HFFA 2HRPL 5E5MA 4GLRI 5I0ZA 3ZMRA 3IKCB 3VI3F 4XPAL 1FG2A 3MV8A 3HE7C 4HXAL 1HH6B 2IBZY 3D87B 1AXTL 5GGRA 2IFGA 1UZ6E 1OGAE 3KS0J 3TVMA 4OT1L 4UB0H 1MQKL 5C1MB 4OZ4B 3KPSA 5IWLA 4M6ML 1BZ9A 1N59A 4MJID 5AAWA 4NHCH 3DVGB 2PYEA 2ZCKL 3DGGB 5I30H 4XXCC 5MEPA 2VB5A 5F3HA 4KDVA 1XIWB 3MRJB 1G7JB 5FOBA 2Y4SA 5INCB 4RCAA 1ZGLB 2YXMA 3ARDD 1K6QL 1WIPA 4FA8A 3HZMA 4RFEB 3NFNA 3PGDA 4F37F 3SDCD 4OLYL 4CN6A 5IFHH 2C5DC 3SDDC 1GAFL 1YEGL 4FQQA 2F53E 2GJZB 3QDJB 3T0XA 3V7MA 1TZGL 1H15B 1CDHA 5C0AD 5E08L 1GC1L 1HEZB 4Z7UF 3MLYL 3FHAA 2PO6A 5IV2B 2W65B 1EHXA 2HKFL 2ZOLA 2I5YH 1LEIB 4A2LA 1WBXB 5E2VL 4NKIL 4HHAA 1KGCE 3VI4F 5D7JC 4GG6F 5T3XD 4PGCB 4DK3A 4QRRE 5J11B 2A38A 2X4OB 4AM0A 4ZFOB 2X4SA 3LQAL 3LSOB 5C0GA 3TO4D 3ZYIA 3MRHA 5CIPB 5FHBH 3F7YB 5E24E 1CE6A 5LQBL 2LVCA 3MTRA 1F3RB 4TVPH 4OQTH 3QEGH 4NM8H 3NACH 1CGUA 4RGOL 4U6YB 3V0VB 4ODHL 5ICXA 5HYSA 1U42A 4LKCA 1CF8L 4PBXA 2GFBB 4QHKI 2ICEB 2EIDA 2QHLA 3TT3L 1BQLH 1MVUA 3OKEA 3L6FB 2EYTA 2NMSA 5JLZA 2B2XL 3L3DA 4K07A 1GYAA 2R0WL 3QB7C 2NY4D 1XT5A 2YEZB 4GUPA 5HPMB 3NZ8B 5CHNA 3SDAB 2ADJB 1HIML 6CGTA 4G8FB 4LOUD 1UM6L 4K23H 1PY4A 3KLSA 4JVUA 4MLIA 1OP5K 3O9WC 3FZUC 5GZOD 1QRNE 1U3HD 3B6SB 5HYJE 2HT3D 2GTWA 2WBJD 2IAMB 3QI9B 1MLBB 2HJLB 4KRLB 4XRCB 1Z6JT 2RHEA 3PP4L 5KVEL 5DZLA 5KVGH 3D39D 4QOKD 2MFNA 1SBSH 2AJSL 5AYUH 1KLUA 1P1ZB 4JPIB 4XH2B 4RISL 4MA8H 5T5NF 3LQZB 4K94C 5EU5B 2DLEA 3QQ3A 3FQTB 4N5ED 4LSTL 4PGDA 5I1IL 1JHTB 5BW7A 4XVUC 4PGBA 4XHQA 1VPOH 4YX2H 2CMRL 5SWSA 5BVPH 2X9YA 4G8EB 4U6XA 5MENB 1RUAL 2QHRL 3T77A 4PJIE 1RHHA 1NGZB 3EO9H 4KDTA 1T66C 4I18A 3FT4B 4GRLA 3I85A 4ZXBD 1RI8A 1N64L 4ELKA 3FAXA 4LSDA 4AIOA 5I1AB 4WFHE 2ATKB 1S7UB 1T7YA 4HUNB 4IHOB 4DN4L 5LVEA 4X6DB 3DOSA 1U91B 2J5LB 1MFEH 1ONQB 2A0LD 1F3DH 2XWBB 1SM3L 2ZUUA 1D6EA 3WNMA 4GQ9L 1OW0A 4JJHA 4EI5C 2X41A 3MLWL 2X7LA 5DYOA 3PDGA 1CLZH 2CDEA 4TVPD 2ZWLT 1KTLA 2R2HB 2ZSWB 1MY5A 5F3BA 5IT2H 3N1FC 3QJFB 3CH1B 3T2PA 1KFAL 4X6FA 1EGJL 3B43A 4GMSL 1JIBA 4OD3L 3OXSB 3ZL4H 5HYSG 2PTTB 3ME0A 2AXJA 4MAYD 3T2OA 4PJEF 4JDZA 3V4PH 1OAQL 3BAEL 3IS1X 4WJ5B 4JN2B 2NNAB 4N9GB 3ZKND 3OL2A 5FB8A 5SX4I 1OSZB 1W2KT 5KOMC 1RK1A 3MBXL 3CSGA 2B20A 5EOTA 1IGML 1SVZA 4U6HB 4MHHI 1D5XA 4AEEA 3BP6B 1V7NH 3BXNB 1PEZA 1R6VA 3DUUB 2BMKA 5DC4B 1RU9H 5GGRY 4HF5L 1SJEA 3P9MA 3V79C 3LEYH 3BH9B 2BXZA 4E0RA 1GRWA 2ZP0T 4JLRA 3VGDA 5EZLA 4MX7B 3AREA 5CINH 3IXAA 4XPGL 5AD0A 3CLFL 3NCMA 5HD8D 3GMPA 1I8KB 3MX0A 5J4MA 1G6RL 5AZEL 1XIWC 4MCZB 2AKRA 5EU6B 3HN3A 2DN7A 4JY4B 5TGBA 4EEEA 2ICWJ 2C4FU 1NFDF 2XRAL 3TH3T 5L8LB 4A6YL 3SKNA 1L7IL 5DT1H 2VXUL 5K93A 2MTPA 4XP6L 4ZNEA 3TBYB 1T83C 5KSBE 3VFTB 1FFOB 3NZHL 5B3JF 4X5XA 1MREH 5E2WL 3VXPB 3MV9B 3VFWB 3VWKB 1RUPH 3M45A 4FXKB 3W82A 5IF0A 2FBOJ 5HVHB 3DIFB 3PWJA 4G7YH 3KYOB 1F4XL 1YC8A 3VRIA 5HHVH 5I1LB 3MNWA 1MNUH 3IDJA 4PFEA 4PY8J 1DE4A 3LDBB 5HJ3A 1DBBH 3N9GH 4JM4H 1JZ7A 2V5TA 4HV8A 4I3GA 4L3EB 4LGRB 3TBVA 3L3IB 4C83B 5K9KA 5D72L 4M6NL 3WL9A 5ACZA 3DHJA 4C54A 4Q0XL 4MDIB 1AD0B 4WCYH 1AGCA 1M7DB 4ODUA 5HHQB 4HKBB 3RI5K 2APTA 3HMWH 4O2EA 1T0NA 4W81A 3IT8D 5F8RC 3PHOB 2NZIA 4V1DB 2DQGH 1ZVYA 1OAXH 3LKRB 4TOYL 1DCLA 5GGVY 3MGOB 2BSTA 2Z35B 1HXMA 5FYLH 3WJJC 3TNMB 2JELH 1TZIB 4HIHA 4R97C 4X9BA 5DRNB 3HG1D 5CP3H 1UCBH 4JGJA 3WJLA 3VFUB 2OM5A 2QADB 3SDAC 5I74C 1WWAX 3AMLA 3ZE0E 1X5YA 1LO2L 3MYZA 3W9DA 4AYFA 2F9BT 1FPTH 5J8OA 3TA3B 1D9KB 4YBQD 1KYOJ 1HQ4A 4QRPD 5GXBB 5E8OB 4S11A 1INDL 2DQFB 2YKLL 3P4LA 2DLFH 1HQRB 4TTGA 2A1WL 5MEQB 2W9EL 4NQCB 1DEEB 3Q6GL 3FO9B 2VXVH 1FFPB 5CSBA 1RJZB 4ELME 3VXTA 3GJFH 1D6VH 2FNBA 1F90L 3NTCH 5F70A 4ODTL 3V5KA 1RZ8B 4XNMA 1OGAA 5HGDA 2JIXA 1OARH 4NO2B 4M5YH 2EIBA 2VR5A 4JKKA 4QHNA 5K9JL 2AXGB 2VIRA 5I0DA 4W4OC 3U7AA 4LLVA 1D7FA 3UC0H 3VGAC 1LILA 1DJSA 4HX1A 3SE3C 3QO1A 3CLEH 4GQPH 2IGFH 3TJEH 4J23A 4DKDC 5BV7H 5I1HL 5TQ2H 2P43B 1UEYA 1G7LA 3RVVC 3VXSB 2UZYB 1Y0LB 1NBVH 3CFKB 3T4YB 4P3CL 1XR8B 3TO2A 2IQAB 4KKNA 4OB5H 2MCG1 2AW2A 3GUTB 4G42A 2JJSA 3MRQB 3O6KH 2HJKB 3A6CL 3S96A 3DECA 1VADB 3R4DA 3U4EA 3VG0H 3VH8A 1S9XB 2F53A 3EDDA 5EZIL 3CX5J 4R0LB 2J5LC 5DC9B 4LEXL 5E8NA 4L8CB 3ULUL 2Q8AL 1FIGH 2YXFA 5DGRA 2I9LA 4KAQH 3QIWD 5DJ0A 2VE6B 2H3NA 1UJTA 3EHBD 5C0CB 2VXQL 3O3AB 4KUZH 2JJVA 4HPYL 3HNTH 4YHNA 3RVTC 2JJTA 3QUYD 4GRWH 4F15B 3KJ4B 2KDGA 4MD5A 5C0JB 4RWYH 4QRRA 1MCWW 3SCMA 3DVFA 4Y4FB 3C60B 2AJVL 4LCWB 4RMWA 5HI4D 2GJ6B 4B50A 4H25B 2NYYD 2R1XA 4AMKL 1V7ML 2FH8A 3IGAB 4YFLF 4I2XB 1A7PH 3D5OF 3T0ED 4OAWB 5MP6H 1OCWH 1JWMB 4LSUL 3I02B 4HKJA 5C0RH 1QD0A 1TCRB 3TPUA 5JOFA 5JZ7C 1U2HA 1S7RB 4IMLA 4KUCD 1KELH 3H7BB 1CGYA 5GGVL 4TNWK 3QQ4B 1UQSA 5HHPB 5CJOH 5FFLA 2PYFA 4WW2F 2DOCA 1DLHB 1RUKH 2AEPL 5C7XL 4PD4J 4L9LB 4KPHH 1X5JA 4MCYA 4JFFD 2V7NB 5HGAB 5ACLA 1VFAB 3I6KA 3RGVC 2YA2A 4I77H 4NBZB 4PG2A 2OP4H 2DQCL 4HIIB 1QRNA 1GGIH 5D1ZA 1BFVH 1FV1A 2NY1C 5E94A 4J3SA 4GXUM 5HYJA 3TV3L 3LRSB 4ZUSB 3P30L 4B7LA 2Y23A 3RUGE 4L3AA 2EH7L 4P4RA 1AGBB 5ADOH 4ODVH 4LSVL 4XBPB 4Z76B 3WLBB 2J4WL 3WEXA 5E56A 3L7FA 3WFZA 2VLMD 1AXIB 1IC4L 1YMHB 1RPQA 4ISVA 1AHWB 1R3IL 1E27B 4XXDA 1B6UA 3QXUA 4X99B 1J88A 4Y4KA 1SMAA 2EO1A 4JRXB 3L3KB 1HHHA 3SN6N 4O4YL 4MJ6A 2JK5B 4P5KB 3OSKA 1CE1L 1GZPB 2A74B 2EO9A 3MLTB 1EHLL 4PJIA 3VH8G 3LDBC 2IH3A 4OLVH 1LNUA 3LHPL 2HYMA 3DX9A 3QEHA 1G84A 2E7CA 2NXZD 3SHSA 1P5UA 5C07B 5FOJA 5IG7B 1KIPA 3PQYB 4LLMA 4NGHL 2D7OA 5FAAA 2EKJA 4JHAH 2WWKO 4FTVB 3G9VA 4G43B 3QUKB 2X1OA 4P99A 3FB6B 2R4SL 3DUSB 5EC1B 2AS5M 1P4IL 4EUPA 3ALPA 3PIQA 2IALA 3LKPB 4OJFH 3VFGH 4YR6A 2WQ8A 2JCCE 1H3VA 1KBGH 2SEBA 3AVEA 5CEZH 3DRQB 1GZQA 5DWUH 1A2YA 3O3BA 3B2VL 2LV4A 1AKJB 3QISA 5ISZB 1N5AB 3CH8A 4NO5A 4Q6YA 3RWIA 3RTQD 3HNVL 3OF6A 4KC3B 2B0SL 5HGBA 4NNXB 4YHMH 1KXVC 4MAUH 1WWCA 2QADC 3QEUB 1XGTA 5DEFA 1BEYH 3KPNB 1JV5B 4LRIC 3HRZB 1YY8A 4NQSB 3PGFL 3TA3C 1D9KC 4I9WD 5I71B 3DMMA 3NCBB 4X6CB 1QEWA 1D5ZA 3VXMD 1IM9B 3EOAA 1PJ9A 2J2ZA 4K2UL 1Z5LB 1HI6A 2HT2C 5B4MD 3VDAA 4JFDD 5IJVA 3FRPA 4LASL 3AY4A 3D85B 1UEMA 1MRDL 5D7KD 5KSAB 3SPVB 4GMTH 3NVQA 4LARH 4HS6A 4AEHL 4R2GD 1J18A 2X4NB 1DUYB 5CUSH 4RA0C 3RWFB 1NCCH 3QHZL 1XR9B 3CAFA 3CCHA 5C0EB 4J4PC 3LD8B 3QZWB 5B8CC 4YZFF 2NW3B 4L9DA 5DEZA 3DVNA 2CK0L 2A73A 4E9LA 3OJDB 2NY7L 1ND0A 4JFXB 2HRPH 4RX4A 4BK5A 1RVFH 5IB5A 1FL6A 5ABDE 4KQ3L 1FNSL 4XPAH 3C08L 5L2JA 5GRUH 1QLRA 3QH3B 4KH2A 5IFAH 1MQKH 1MI5D 3SGKA 2PXYA 3OG6B 5KSBA 4F57L 1WCQA 5C0BD 2VTFA 4MA1B 3D0VA 2DWDB 3E6HB 3MRFB 4GW1B 4YWGH 1KCUL 3BZ4B 4JRYD 3U2SB 3QFDA 2NY6B 4XHJD 1BM3H 5JQ6L 4NNPL 4UILL 4OLYH 3OR6B 1BJMA 1CLYL 5FXCH 1YEGH 1AE6L 3H0TB 2X05A 3QG7L 4EUPG 4IRSB 5CEZD 1PQZB 3ARPA 5JIHA 3F58H 4F3FA 3OKNA 4WW1B 3B8SA 2EDTA 3MLYH 1F6LL 1AP2B 2PTVA 5IROC 4PJEB 3QO0B 4UIMA 5EO9B 4LHUA 2DBJA 4EXKA 5E2VH 3ULSA 1IRAY 1JL8A 2DQUL 4LOUC 3NMEA 2VZSA 1O0VA 1DVFA 5H37G 3IDGB 4GAJL 2HMID 4I3SL 1A6AB 1A8JH 5HI3C 1U3HC 3V52L 1WTGT 4L9LC 2EDYA 5LQBH 1YNLL 3MRKB 3TCLA 2YUVA 1LO5B 1I3RB 1EA9C 3EFDH 3QDHA 3GGWA 4HUMB 4XNUH 4OGYH 4X7SH 4RGOH 3MC0A 4ODHH 4R4FH 3FRPG 4G9FB 1CF8H 2ZOKA 1OHQA 4G80A 2MJWA 3JXAA 4S1RH 3CD4A 4OFIA 5CIPH 2JF1A 4NZRH 1QSED 5C0FB 4YDVA 2BHYA 2B5IC 4PRAB 3KWWA 4S1DC 1FNHA 4NN5B 3WIFA 4ELMA 4K3EL 3OX8B 1XGYH 2VAAB 1JWUB 3QIUA 4IM8A 4TTDC 2CDFA 5GS0L 1DDHA 2XQYG 1AHWC 2I07A 4Y5YA 2YPKA 2WUCL 2WWMD 3PE9A 5DHVB 1TVBB 1ZEAL 3BN9D 3MGTA 3HE6D 1BECA 3DUHA 5FV2A 3TBWA 1VEMA 1RD6A 4CVUA 2DS4A 2A0LC 3B9KB 1BF2A 4P9HL 3PP4H 1ZANH 5CJBA 5KVEH 2C9AA 2XXCB 3IJYB 1AQKH 1L0QA 3E8UH 3BKYH 1P5VA 3GRWA 3D25A 4WV1C 1NFIA 3WLWD 3LKQB 1MHEB 3UJTL 2UVEA 1YYML 1R5IB 1QBMH 4ZAKA 4NYLB 3QUXB 5IB4A 2F19H 2WIMA 1CIUA 1Q1JH 4G6KL 2CMRH 3FT2A 3HUJF 1RUAH 2QHRH 3S5LB 4NBXB 2AJZA 3MRNA 4DVRL 1T22B 1H3XA 1IGYA 4JFYA 3LIZL 5JPMB 4OM0L 1N64H 1L7TH 3N1PC 5KN5A 4WDIB 3T0DA 3DV6B 4DN4H 2X9XA 3BH8A 3QDJD 4LHUG 4RWHA 4BQ6A 3SKMA 5D1XB 1G0YR 3FQUB 2MKLC 2QEJA 3QDGB 5IFJB 4HK0B 2AEIT 4NO0A 2R15A 3CC5B 5I71C 1MFCH 2Z0BA 4GSDL 2P8LB 5IJKC 4O9HL 4YLQT 2WM0A 4ZDHB 1KFAH 3L3HA 1N6QL 2W0FA 2NX5E 2J8HA 3D18B 3T3MF 4HIEA 1EGJH 2HTLC 1KJVB 1IGFH 1UH3A 1H5BB 3AUVA 1I7TA 1IFHL 5BQ7B 1J0ZA 5KSAC 4PJ8A 5A3ID 2NW2A 4LRNL 1QA9A 5DSCB 4PJFE 2BSRA 1F4YL 3KXFB 1I9EA 3P0YL 1Y18A 4QF1A 4RDQG 3U4BL 5HDLA 4KQ4L 1EK3A 2A83B 3HPLB 5I16B 1YMME 5DZOA 1KJ2L 1F2XK 1JTTA 4TUOB 1IGMH 5E6ZA 1MELA 4ODSH 3FOMA 4MQ7A 4WY7H 1K4DA 3CXHK 5DQDL 3RUGA 1RZJL 3CFCL 1AGFB 4HF5H 3IXTB 4LIQH 1F4HA 3F12A 2XFXA 3MRLA 3O6FD 4NRXA 5DJZA 1ZA3B 2DQTH 4YXLH 2M2DA 3I75A 1QFUL 4MA1C 5ENWA 3WO4B 1G7QB 2I24N 4MWFA 1RMFL 3DV4A 2EYRA 3JZ7A 1G6RH 5GS3A 3V95A 5AG9A 4JR9L 3UAJD 2J1KA 4H8WC 2NZ9D 3U4AA 1PW3A 1R0AL 2YD7A 4WFGD 4TNVF 3WBDA 1T3FB 2NY6C 2YN5A 3JVGC 3MJGX 4XP6H 4N1EA 3RWJB 1MCPH 3SKOA 4QXTA 4MJ2A 4JO3H 1NGYA 3H42L 5ALBH 1XGUA 3NZHH 1HINH 3EFFB 2F8XC 1NDGA 2EKSA 3OKDB 4LSQL 5CMAB 2BY1A 1VFMA 1GGYA 1S7QA 4M1DL 4OZIB 5E7BA 2E3VA 2IPKA 3W0WD 4GG8B 5DA0B 3AU1B 3G5YB 3JBG7 4KZDL 4OV6F 2Q20A 3QNZB 5I1CL 3V6ZB 1CICB 5SX5H 4FQJH 3NIDF 1MY7A 1CK0H 4LGSB 4Q0XH 3DX8A 4ZO6A 5KOVC 3ZYOA 1KULA 1HHKA 3FB8A 5E95B 4NSKB 5I9QB 4LGPB 4ZFZB 4ZPVB 1MHCB 4OSUH 3IFPB 3MBEA 4NJ9L 4L4VD 2DQEL 3CVHB 4GS7B 1WFUA 4UINH 4PJ5B 1B0GB 2CLRB 3TH4T 5FGCB 1BIHA 2Z93A 4YFDB 1DQDL 2NTSP 2BSED 2IPUK 1JHKL 4KTDH 3HR6A 5DI8B 3BYTA 1Y6MR 4Y1AE 4XPBL 2AP2A 3WN5B 5I66B 4IIQA 5DEGA 2B4CC 1FNGB 3D3VE 4Z5RB 4HMEA 1U58A 1G7IA 4PJHB 3PWLB 2VXSL 1LO2H 4UQ3B 1XF2B 1NC4B 3NIFF 3VXUE 4U7MA 5ESAB 4WU5A 4KKLD 3ILPB 1INDH 2G2RA 2ZPKH 2APFA 2YKLH 3VXOB 4U3CA 4GXVH 4PR5B 2CGRH 2W9EH 4F37K 3C5JB 2FX9L 3Q6GH 1FGNL 3C6LD 3T09A 4PUBH 1L9MA 3MSPA 3QIWC 3EHBC 2R0LL 4ODTH 4Y5XB 5B21A 3DX6B 1HOCB 2QJDA 4EN3A 3T0VA 1KN2L 4NCDA 1DLFL 2HVJB 3KYNB 1KG0A 2OJZH 3V5DB 4F58H 4W6WB 2RGSA 4JKLA 4D9LL 4OF8A 3BOVA 1FE8L 5F1NA 4GBXB 4QRTA 3SE8L 4P3CH 5CEYB 1YEDA 3ULUF 4JVPA 1DBAH 1NJ9A 1TVHB 3O11A 4JKWA 2GAZA 3GSNA 2AJ3A 2WINA 1KJMB 3BGAA 3KLHD 3VWKD 5D1XC 2V6HA 3CSYB 4FNLL 4Z0XB 2UYLB 3P0VL 3L5IA 2X4PA 1A3RL 2P8MA 4PTUA 2HFGL 4RBPH 3QA3B 4TSCL 2X70B 4HCRH 3JWNC 3VFOB 5TE4H 5C70A 3NFSH 3MQIA 4U1GC 4NP4H 5JOPE 4L3ED 4LCYB 5T1MA 2D3VA 1IC5L 2B8OT 2VUOA 1RQ5A 2BVQA 1RZGB 4JPWL 1TFHA 1CBVL 5LGHL 3SGJC 1BFSA 1H5BC 1PVHA 1FN4B 3GBLA 3MLSL 3GB7A 2GY7B 3H9SD 4HT1H 3GBNH 5EB9A 4R4ND 5ID0B 4YJZL 3OGCB 1BOGB 5JW3L 4LVEA 3BGFB 1X7QB 4OFKA 3HHRB 2R9HD 2BNUA 4PGZA 3RDTD 4M1GL 1BGXL 5HHMD 3RZWA 5FUZH 1UADC 2PR4H 2AEPH 1EXUB 4D94A 5C7XH 1FG9C 3T4AA 5J57B 1JPSH 1KEGL 4NRZA 3B2UD 3PL6B 4XC3H 5SWQB 3CK0H 3IU3A 3BX7C 3RBGA 3SGDI 1JGLL 1IEBB 3V0AC 4WIQA 3MV8D 3G6DH 2D7TL 1KB9K 3VFSA 2DQCH 1UENA 2NXZC 4Y4HA 1AC6A 3TVMD 3X12B 2Y1VA 3AS2A 4NZTH 2D7PA 4Q2ZA 5F7DB 1GPOL 3P30H 4U0RB 2AGJL 1N0XH 5D71H 3SKJH 4LFHG 4HIXL 1FYTB 2EH7H 1T4KB 1GH7A 2HKHL 4LSVH 4GW4A 3RWGA 4Y8AA 2J4WH 1K9TA 4YO0B 4LVOC 3KYKL 4H5SA 4RMSA 1KJ3L 5IGXL 5CGYC 5I73B 1Z3GH 1IC4H 5BZWB 4UDTB 1I1AB 3TWCL 3IJHA 1RIHL 3N1MC 4NUGL 2A6IA 4KJPD 5JXED 4WTXA 3AS0A 4J3XA 4QXGL 3RTQC 1MAJA 3QG6B 3PXHA 2L0DA 4U1SA 2DQJL 2GUOA 3FFDA 1XCTB 1EFXB 2QR0B 5BRZE 1T0MA 2NY5H 2VITB 3TZVD 2WZPD 3BFOA 3Q1SH 4WW2C 1PG7L 3R1GL 4IRJA 4P2QE 2RQ8A 5DJ6A 4RGNB 5E00B 1JGDA 3NN8B 4WFEE 2EDQA 5I9QC 2E8ZA 2CDGA 1B2WH 2P5WB 4JQXC 5B4MC 1MFDH 3VWJA 3RWDB 5IQ9A 1A02N 1P4IH 3N50A 4DZBB 5C0CD 3BVNA 3D0LA 4EQ3A 1LD9A 3V4UL 4E41B 2BX5A 3GI8L 3S35L 4DQOH 3CZFB 4L3CB 2P5EE 2D2OA 4APQD 2C3HA 2F5BL 4DZ8B 3B2VH 3MUJA 5ESVB 2NX5A 4YDKH 1PFCA 3VFVA 2ENSA 3HNVH 3C60D 3P9LB 3WN5C 5DR5L 2FJHB 4O58H 1IGJA 2M26A 4PJBF 3A6OA 2BNQB 3RY5A 4PJFA 12E8H 4UBDD 4D0CA 1C12A 5GGQH 4JFEB 5J6GA 4F7TA 4DUVA 2P47B 5JDSB 1UZ8A 1MEXL 1CGXA 4WWKA 3I6LE 4OI8A 5IKCB 3M1BB 1DUZB 4XB8A 1W72L 4JQVA 1EVTC 4G9DB 3S35X 5HXMA 3TYGL 4Y5XC 3O45B 1FL5B 2HVKA 3ECBB 1G7HA 3UROR 3MCLL 4IS6B 3U9PH 1IILE 2D31B 4YHPB 2Y07L 4LMQE 2V9TA 3CXDH 2X4TA 2EDOA 1MIMH 3FQNA 3HUJB 1AO7E 4CDHA 4KQ3H 5CSZB 1FNSH 3S4SG 3C08H 2R56L 1TTUA 3ZSTA 5SWSD 5IR1B 2O5XL 1P7QA 3GSOA 3ARGA 1LP9B 3PWVA 1J0YA 4RGMC 3BEWB 3OHXB 5ITFB 2AJXL 4JRXD 1QLFB 1U8MA 3FQWB 2P44B 1JHLL 3IETA 1S5IH 1KCUH 4ONHA 5K9OB 1CFVL 4XVJL 4O51A 4Q9QL 3LEXA 3LPFA 4DGYH 2GT9A 5DK0B 1HNGA 4NNPH 1CFQB 4UILH 5D6DC 2XKNB 4UU9B 1K8DB 4FZ8L 2YD8A 4NJAL 5JW5B 4XI5D 3PQYD 1EEZA 3QG7H 3CUPB 4CN4A 1WBZB 3NCYP 5IMMB 2DQIL 1BIIB 4LQ1A 4P4KA 5A2IH 2VQ1A 5DJDA 2P4AB 5LWYH 4ZTOH 3HC3L 3BKCH 4HS8L 2D7MA 1MWAB 4JG0H 1EJ6A 4PIRF 4KKCD 3F6LA 2DI7A 2ATPA 4GAJH 4P2RE 5IHLB 5ICZB 4I1NB 2OTUB 4Y16B 1A14H 1KTKE 5B3NA 3HE6C 3P77B 4Y1AA 3NCYS 5D7IE 4F9PA 2AI0L 5E8PA 1YNLH 4PG9A 5J12B 2IAND 2Q8BL 4JHZA 3SOBH 2VR4A 5ID1A 3PXJA 3D3VA 1BHGA 3SQOL 3ZDYF 4JAMA 2XN9D 1A6ZA 4Z7WE 2LTQC 3GJEA 4PV8B 2W59A 4HBCL 1X4ZA 1E4KC 2GW5A 3FONB 1GOHA 3VXUA 4YHLL 1R24A 4MNQB 4MJIE 5FYKH 5E6IB 1IM9D 3U1SL 3WLWC 1AJ7L 1QG3A 1QNZL 4UTAL 2ZCLL 1CFSA 4POUB 1M05B 4Y88A 5DQJB 3HC4H 4Z7QE 4LL9A 4K3EH 2A9NH 2VL5A 3DSNA 1GC1C 5F9JA 5FO7B 5I73C 3CFBA 2ZUTA 5GS0H 3P9WB 4LKXA 3DO7A 4IOFD 2CUHA 4LNRA 2WUCH 2ESVB 2RFXA 1ZEAH 4OD1L 5D96C 5C0AE 1U8IB 2GI7A 5HGHA 4KJYB 4LPXA 5CAYB 5BXFB 1HILA 1NCDL 3LQAC 2OL3A 1G7PB 5IB1A 4RFNC 4GH7B 2H32B 2H6PB 4U1HA 5DLML 5KAQG 3GMMA 5T3XE 3EGSA 4LQFL 1CFNA 1YYMH 2RB8A 3K0WA 3UJTH 3UDWC 5I17B 5T1LD 1KCVH 2GHWB 3GSNL 1SEBB 4HH8A 4OFDA 5HHNB 4XVSL 3H9HB 2E6PA 4ODXB 2FEDD 4B5EA 3OKOB 4WHYH 3UTSE 2FATL 4CVXA 4DVRH 5GRJH 3W5NA 3OB8A 4OM0H 4M7KH 4KMQA 4QGTA 4QY8B 4LLAA 1AH1A 4P0DA 4LPTA 5FYKU 3IU4H 1HKLH 1F6FB 2H2SD 1F11B 1CFTA 3CDCA 2FHFA 4TYUA 3QWQB 1WIUA 1HCVA 2HFFB 2QQQA 4W6XB 2XZZA 4NN6C 5E5MB 1MJJB 3O6FC 3CVIL 4GSDH 5E70A 1FG2B 5FYKD 1DANT 2R4RL 2W38A 3RPKA 5C2BL 4HAGA 2ORBL 2FJGA 4OBSA 3DURA 3KPSB 4XAKD 3W2DL 3UAJC 1N59B 1XCQA 4LRNH 3D39E 1OPGH 4NPYA 4QOKE 2NZ9C 4AIZA 5GSRB 1JZ2A 5MEPB 5JXAL 5DXWA 3EYQD 4NC1E 5F3HB 4KQ4H 3U4BH 4ENED 2VMFA 3BW9B 1KJ2H 3UYRL 5GS0D 4ORGA 2BJML 2PW1B 4M5ZH 1HKFA 3LV3A 2VLJB 3MLUL 3HZMB 1M7IA 2EDFA 3J8F7 3NFNB 3L95A 1FSKB 1KSRA 3OKYA 4J6RL 5T3ZH 2EDRA 4M61B 3LB6D 3GSVA 2X4RA 1U8JA 3BQUA 3OAYK 1T1XA 3QUMB 1MLCA 1SJHA 2PW2B 2V2XB 3SJVB 5E2TH 2PO6B 2K7PA 1A1OA 3F62A 4Z7UE 4S0SD 3DI2B 4PJIF 3MR9A 2DIAA 2ZOLB 1VB9A 3QEQD 2E8YA 2Q76A 4YHKH 1YJDL 5B22A 2F53D 4MA7H 2OSLA 1FCCA 3B9KD 1F3JB 1R0AH 4HJGB 2CRMA 2OS7A 3P73A 4AM0B 4TVPE 3NPZB 4DAGH 5C0GB 5BRZA 3FCTB 2IMNA 1NC2A 1NCNA 4GRMB 4HZLB 4HS3B 3AM8A 1U8QA 4P2QA 2I60L 3WO3B 4OKVA 1HK6A 1AGDB 1ZT7A 1F4WL 3IS0X 4CJ0A 5EG6C 2ILLA 3P11L 3VFNA 3WFBL 5HYSB 4QRRD 4LKCB 4KVCL 4M1DH 4N1CA 4NKOA 3EUUA 1UKSA 4KK5C 1I9JL 3GIVA 2X42A 1ZXQA 2IADA 3QWRD 3WNKA 4LHJB 2A77H 4PRHD 1MVUB 3IFOA 3O3UN 4FFVD 3OKEB 1UA6L 1II4E 5JLZB 2AK4D 4Q9BA 1LHZA 3S37X 4KZDH 2P5EA 5I1CH 3NCCB 5CHNB 5I2IA 4KKLC 4Y16C 1R3LA 4AY0A 2H1PL 3FRUA 4RMQA 5DMGD 5CD3A 5I1EL 1AIFA 1EUUA 4YEEA 2OBGA 1NLBL 1C08A 1T7ZA 2QV2A 5EA0L 3C6LC 1C16A 4MB3A 4UOW1 2GTWB 1NMCB 5GISL 2DQEH 1KOAA 2FEEI 2K7QA 3L3OA 4C56D 3ZT6A 5D1QA 4FZEL 5E6IC 5B38A 3W11C 2NR6C 1XMWA 4UOJA 3JV4A 1JHKH 2IH1A 2ICES 2RIKA 1HH9B 2EECA 4K3DH 3T1FB 3QQ3B 3KS0H 1RZIB 2VXSH 5T3ZD 1WC7B 3D1MC 4PGBB 3VD4A 4QHMB 4KDWA 2ZKHL 4KRPC 3D2UD 2Z4QB 3QCTH 1ETZA 3T77B 5I19L 1U8PA 5C71A 4FQXA 4I18B 3P4NB 3Q3GB 4GRLB 4CGTA 1JK8B 2HJFB 4S2SA 1AO7A 1FGNH 3TJHD 2IPTH 5FO9B 5KSBF 2V9QA 2OCFD 2R0LH 1UACL 2EDHA 3DYMA 3RY6C 2ZUSA 4G3YL 2NQCA 3MV01 2F5AL 4D8PA 1XF4A 4WUUB 2YUXA 3MA9H 3KPPA 1KV3A 4ZYKA 1HHIB 1KN2H 5FGSA 3RQ3A 3GM8A 1PLGL 4MD0B 4JFOA 1FVDA 1KTLB 1CU4H 5KJRL 4WFHD 4OGAD 5IHUH 3HI1A 3S3SA 3UYPA 1BMGA 5EORL 4M8QA 4X6FB 3SE8H 2LU7A 1PSKL 3CMOH 4R4NC 4XNYL 2FIKB 5EO0A 1OSPL 3L1OL 1JZ5A 3OAYH 3JV5A 3B9DA 5I8OH 3PGCA 2R9HC 4JDZB 2WBKA 1O5DT 3HG1E 5J1AA 4FNLH 3RWHB 4UZGA 4QHLA 5IBLD 4CMHB 3WIHL 1T6VN 5ELIA 3WFEL 5JHLL 3CMGA 5EOTB 4ZFFA 2R2BB 5DRZA 4QRPE 4NZDA 4F9LA 3B2UC 1M4KA 3G9AB 1RUQH 2NY3B 1KNOA 4NFCA 1OM3L 2GK0A 4XP4H 1CICD 1SJEB 3DMMD 4P2RA 5LGHH 3TVMC 3NAAH 1F2QA 1AGEA 3ZE0F 5CKGA 4HJJH 1CXHA 5E4IA 2DI8A 2CO7B 4JLRB 5D7IA 5TDNA 4PTTA 5IWLC 1ZK9A 5EZLB 5B38G 5HYQA 3AREB 1UXSA 3IXAB 4YNYA 3KYMA 5AD0B 4Z7WA 3GMPB 4FABL 5JW4N 4DOHB 3E6FA 5JW3H 3KJ6L 5FO8A 1P69B 4M7JL 3PABB 4MJIA 1DQLL 1AY1L 1KCKA 4K7FB 4KV5E 2FZ3A 2ARJQ 3KPLB 1JNNL 1BGXH 2Y6SC 1BD2D 2DMCA 3TFKD 2ED9A 1EMTL 4HIJA 1V05A 3OXRA 3IFLH 2XZQL 2LFGA 4X5XB 3ULUC 2YA1A 1S8DB 1AI1L 1TJHL 2C4XA 3ARDA 5T1KA 3ZDXE 1KEGH 1P2CA 5E5UB 2FR4A 4YXHH 4BFBD 5IF0B 5F7EH 1CYGA 1NC4D 3PWJB 3SDCA 4HGWB 4RSVA 4KGJA 2R1YB 3VRIB 2DKUA 3MNWB 4XBEL 2PO6C 4N68A 4LHQB 3FMGH 5HJ3B 1DE4B 2JE8A 1IVLA 2MCPL 2D4DA 5C0AA 4HV8B 4DW2L 2XY1A 3RWCA 3H3PH 3WL9B 5ACZB 3ARBD 4LBEB 4X98B 1EV2E 4OKDA 3IDNA 4Z78B 5JOEA 2ENYA 1UB5A 4M6AA 1IBGH 1JTPA 3JV0A 4CU8A 4HFWA 5HYEA 5F6HI 1ZA6A 3D69A 5ERWB 5IGXH 3ILQD 2W9DH 5FYLE 4O2EB 1NDMA 1T0NB 2D0FA 5GQBA 2NLJB 5F88A 1YQ2A 4NUGH 3TO4A 1HXMB 2BRRL 4LDOB 4QWWD 5DJCA 2GITB 3GNML 4P57B 2EE3A 3CFDB 3T0EE 3ZSSA 3UTSA 4GBXD 4HSQA 2CKBB 1X5GA 4HIHB 3V0WL 3MUY1 3CGTA 4FG6C 4FP8H 3BO8B 4LLQA 5IBUG 3MZTA 3R1GH 1MAML 4TSBL 1QSFB 5J3HD 2VNCA 2G9HA 4OTXL 1IAOA 4MQTB 2E5EA 1S9VB 3WKMH 1NGPH 3MUGB 1BFOA 2A6JA 3MRBA 4U2YA 1BX2A 1KIQA 4JFFE 4GXUN 3BIBX 4ODWB 5C09B 2CXGA 1R3HA 4KTYA 3V4UH 1CE6B 3S35H 1QLEL 4JJ5A 1GGCH 1LDPH 1OD7A 4WEUD 2C26A 3OKMB 1H3UA 4XP5H 2E9BA 3OKKA 2WBJA 5F1IB 1OGAB 4KJWD 1HHJA 2DWEA 1NMBL 2P24B 4QHNB 2BSSB 2YRZA 4L8SB 3D39A 4QOKA 1JGVL 1UT9A 5BW7C 3DETD 1T2JA 5KZCD 1IM3A 3HMXH 1J5OH 3MFGB 1G7LB 5DA4A 4WWID 3QIUD 3RUGF 4KDTC 2FYYB 1YEKH 4I18C 2VZVA 1MCWM 5HDOA 2J8OA 4GRLC 1W72H 5E4EB 4KTEL 4QRQA 1OAKL 1UGNA 3V8CA 1TNMA 4YBHA 4Q9RL 3VE0B 1IKNC 3U4EB 3VH8B 1L0YA 1OWRM 5D2NB 3PHQA 2I9TA 1GVIA 4KKBD 5E8NB 4JFPB 1T03H 3MCLH 4ZXBA 2I9LB 4B41A 4M93C 1OW0C 5DJ0B 2Y06L 2VC2L 2H3NB 1JNJA 4HLZG 4GRWE 4G6AD 2Y07H 2X1QA 5TFSL 3K1DA 4Z7UA 5DHYB 1KPVB 1OTTC 1LO4H 5DD5L 3WFHA 1JI2A 1A7NH 3IDIA 5CCKL 4XCNA 2R56H 3SCMB 1I1RA 1UYWL 1B4JL 5CJXA 2R1XB 4OQTA 2E6QA 1RUML 3Q0HA 3IJSB 1H3PL 2JTDA 3KPMB 4BSVA 1X9QA 5EIQA 1MCHA 1BVLB 3LH2L 4RQQA 3BUTA 5IBTL 4MNHA 4FFYH 4MXWL 3TPUB 3BD3A 1OTSC 1AR2A 3MODH 1G9NL 1AD9B 3MJ9L 3D9AL 1J11A 3MXWH 4MAYA 1CTOA 4PRPE 1CFVH 1SJXA 2PYFB 1QKZL 4ZPTA 4I9WE 1I1CA 4AIXA 5CZXD 3F7VA 1NBQA 3VXME 4M43H 4NJAH 1LEGA 4MCYB 3RX7A 2VQUA 5TE7H 4RGND 1I7ZA 2XZAH 3I6KB 5F7MC 1KIRA 5D7KE 3BPOB 3HC3H 2P5WD 4E5XA 1Z0MA 3AREC 4H1LH 3HNSL 2EIZA 4FQHA 4PJGA 1QRNB 3H9YA 2L4OA 4WI4A 5HYJB 3SE4A 4PJ8D 1VGEH 3ROOB 3ET9F 4Q97A 1UJ3A 1A7OH 1S7XB 4M9OA 5TE6H 5JUEL 1C7TA 3U46A 4J1UB 4MD4A 2AVGA 1AR1D 5IIEA 4HUUB 2IWGA 4Y2DA 3L7FB 4OV5A 1BWMA 1M1SA 3LKNB 3SQOH 4UNTA 4XXDB 1VERA 2BNQD 2OR9H 3EW3B 1QR4A 5DD0L 1HDMB