4YQXH

Mouse il-2 bound to jes6-1 scfv fragment
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
EIQLQQSGPELRRPGSSVKLSCKASGYNITDYLIHWVRHRPEHGLEWIGWIDPEDGETRYAQKFQSKATLTADTSSNAAYMQLSSLTPEDTATYFCARSLDSTYIYPFAYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JES6-1 VH domain
publication title Antibodies to Interleukin-2 Elicit Selective T Cell Subset Potentiation through Distinct Conformational Mechanisms.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cytokine/immune system
total genus 26
structure length 121
sequence length 121
chains with identical sequence N
ec nomenclature
pdb deposition date 2015-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yqxH00
3RVXD 4HGKC 2PKDA 1P7KB 2L4OA 4P5TC 1YEJL 4LQFH 2CLVB 2FJGA 2UYLB 4L3CA 5DUBB 4MAYC 3O4LB 2LVEA 3P11L 4H25A 2E7MA 4Z77A 4JAMA 1JGUH 2EE9A 2WQRA 4NM8H 3Q6GL 3UTQB 1PFCA 3MRGB 2BK8A 4KMTH 2VO5A 4UDUB 5I1KL 1KT2B 2R2EB 4NQEA 4POUB 4YPJA 4DFIA 3MRJA 5IB5B 2NR6D 3TA3C 5F9WC 4GG6F 3O3AB 2MCG1 1CGSL 4MJ4A 4XPFH 3KPOB 5DA0B 4LSRH 4WHTB 2DBJA 1E6JL 2GAZA 3VXQB 4QEGA 1KIPB 1U92B 5HDOA 2HFFB 4IOIB 4FMKA 5T33H 3CFEA 1WSST 4A2LA 3EYUL 2MQ0A 2BCKB 3MOAL 5IESH 4I18C 4IMLA 1WUNT 4YXHH 4PRAB 1KCUL 1XGPA 1DBBH 2FX8L 3SOBH 3WKML 2DRUA 4H20H 5J1SC 4TOYH 3IDGB 1JRHI 5IB1B 2F8OA 3IXTA 4O2FA 2UUDH 1C16A 5EO0B 4OF7A 3HFML 4KRNA 2EEBA 4F33A 5BVJA 1T83A 1IC4H 4XCEB 2YXFA 1MCQA 3QXDA 1LO4L 4OD3H 4TTDC 2OMNA 2V9TA 1J1XL 3E6HA 3N9GL 4MD5A 4RRPG 2AV1A 3AXLB 3B4NA 1ZLVH 4FHBD 4FQXA 3ORJA 4U3XA 1OM3L 2DM4A 3PP4L 1IEBB 3CFIC 3SGEI 3IDNB 4XH2A 3EYSH 1FYTA 3B5HA 4X7FC 4X6BB 3T2NH 4RDQG 5DJZA 3S5LG 1JZ6A 2XI9A 35C8L 4XNUH 5DZOA 5FYKU 4NNYA 5E7BA 4PTUB 4TUJB 4I13B 4AEIH 3CK0L 1CICC 4Y8DC 3EJYD 3RKDC 2K1MA 3EYQC 5HYQA 5D1XC 3ZYOA 3FQNA 3WJJC 1C08B 3TT1L 3UPRA 3D39E 2EDTA 3QRGH 2BVTA 3ET9F 1CD1B 5BW7C 5J06A 5DMIH 1QSEB 3FN0L 1B0GB 5EBLB 3MRMB 5DTFA 1A2YA 3SGEH 4UTBL 1JHKH 3KPRE 2CXGA 4LCUA 4H26B 4DOHB 3KWWA 1HKLH 5ETUA 1IGIH 2B2XH 1FVDB 5DJ2A 5DYOA 3QFJA 4U7SA 2OTUB 3KG5A 4WWKC 3QB7C 2CO6B 1LDPL 5H37G 3MV7A 4M62H 43CAB 2X41A 3I6LD 3MRNA 4Z95H 2O61B 2ENSA 3B2VL 3D25B 5HHQA 2V7HB 5DRNA 3WXWL 3O8XD 3G5ZB 5GGSY 1BQSA 4BFGA 1MI5E 3VJ6A 4AH2B 5C0CB 4TSAL 4G8GE 4NQTA 4ODBD 4P5MB 1AO7E 2BVOA 4N8VG 4FFZH 5F1KC 2CRYA 3ZT5A 4IDJL 3M17A 1NCAH 1A6WL 1CN4A 4LSUH 5EZIL 3NBNA 4TSBH 1KJMB 1AC0A 3TBWA 3QDHA 5F3BA 2OR8A 2DYPB 1CU4H 1WWAX 1WFTA 1T2JA 4MDIA 3RPKA 3V7MA 2IMMA 4R26L 3O45A 3HPJA 4DKFH 3RVVD 5DJ6A 3K0WA 4XPGH 5K59E 2XZQL 5IEKA 1A1NA 5D70L 5I8OH 3MRCA 4J7RA 1E6OL 1SMOA 4MD4A 4X6DE 3STZA 4BFIA 4UOJA 5C09B 2YEZB 5TDOB 1XH3B 5F7DA 4G8IB 2GCYA 3DX8A 1LD9B 3HI5L 3JXAA 2XTJB 4ZYKB 4Q58C 1C5BH 4LSSH 3ARGC 1UCBH 4Q9CA 2AK1L 3EOBA 4X5WB 3QDME 4ZQKB 2PUQT 4XGZB 5GRUL 3B9KC 1R5IA 1WCBA 3MRBB 1H3PH 4NFDA 3NN8B 4N0YH 5F9OH 1DVFA 2D31A 3T0WA 4KMQA 3OX8A 4XCNA 5ELIA 4EN3B 4P3CH 5E08H 5IHBA 1RPQA 5FUCC 1FJ1A 1UA6H 5D7JD 1RU9H 2BNRA 4FS0A 4L8BA 1LQSR 4PRID 3D0LB 5IFJA 5CD3B 1VFUA 3M07A 4R4NC 4Y1AA 5KVEH 2X4RB 3OAZK 2CKBB 2ICES 3OKMA 2EYRB 1B6UA 4XP9L 2K7PA 4BUGA 5GS0L 4OQTL 1Z9LA 4GRLA 5I1IL 1HN1A 2MQ3A 4C58B 5GS0C 1MFCL 1SJHB 4JVPA 1I1YB 1IGTB 2Y36H 4KDTA 3HE6C 1IGJA 4Y19D 5FIEA 3VWKB 3TESA 5AD0A 1EPFA 5E2TH 2VLKB 3BH9A 4DCQA 2JJUA 2DJSA 3THMH 4ZS6C 4OLVH 4P9ML 5DK0A 1NEZG 3TNNA 1BGXL 1IBGH 4V1DD 2VH5H 1TXKA 2HTLD 4KI5D 1ADQH 4KKLD 4AQ1B 1LEGB 3ULUL 1Y6KR 5BRZB 1HH6B 3V5KA 4M7LT 4TUOB 1S7VB 1ZWIB 3IRPX 2IAMA 4OFVA 2BRQA 5FKPA 3GMMB 3WNNA 4QHLA 4DAGH 3UJIL 2IAND 2FHCA 1BLNB 4FQIH 5AWNL 5E4EC 1MIEL 3SKJL 5D1QC 4ELME 5SWSB 4Q6IA 5HGDB 4Y2DD 2OLDA 3TN0D 4HHAB 1UT9A 2R29H 3FFCB 1FPTL 4YHLL 5I6XB 1H9VA 4JZJA 1IQWL 3B3IB 5IWLC 4QXGL 1QRNB 4NQXA 5AEAA 3QJHA 5HPMA 3GJEB 3MBEC 4OZGF 2QQKL 4HGWB 3MJ8B 1R3HB 4O2EB 5FOBB 3G08B 1DQQA 2ZUVA 3HMXL 4LKXA 4U1KA 2J6EH 2B20A 4R8WH 2NZ9D 1MIML 1HYRC 1A4KA 3MXVL 3IKCB 3HZKB 5F7UA 3QPXH 3RWIB 1UWXK 5E2JA 3V52L 1K3IA 3BGMB 2FSEA 4WFGE 1QR1A 4H5SA 2XN9B 1LK3H 3D18A 1JZ3A 3EKCA 1FVEA 1FSKB 2X1XR 2ZUXA 4WUUA 2Q8AL 3WO4C 4Q6YA 2XWJA 1HXMB 5GS2H 2ZG2A 2C5DC 4XC1H 2GJZB 1U8KB 4Z7NF 1ETZB 1KLUA 5F6HI 3SCMA 4QRRE 3PGCA 1F4WL 2BSRA 4QWWC 3HNVH 4KAQH 2G60L 3SJVE 1N7MH 2J8OA 5IBLC 5AZ2H 4X5XA 5EBWB 1J0KA 3DMMC 4NGHL 2QQLH 5T5FH 1WGOA 3EOTH 4BQCA 3DVNA 3MUJA 5IB3B 4LBEA 3NIGF 5IVXB 2HYMA 5I15H 1VPOL 4XCCH 3SDDA 4YHKL 2FB4H 2HG5B 3EO9L 3O6KH 1S9VA 4ZO8A 3BZEA 1OARL 2J7LA 5T3ZD 1VFBA 4J4PD 5JHDD 5HHNB 1U3HC 2DIBA 1P69B 4A6YB 4NN5C 5JA8B 4WUKH 1KN2L 1RVFL 3JWDH 2X70B 4K2UL 5KS9B 2GJ6E 3TJEH 4UTAL 3DXAA 4OGYH 5ANMB 1H15B 2WP3T 4E5XA 3VG0L 5L6YL 5GGUB 3DX7B 1S7SA 2H8PA 2Z93A 5C07D 3CZFB 1AGDB 1JGVL 1A02N 4JDZA 2C1OB 3FFDA 1KXVC 1ND0B 2VWEC 2DL2A 3P30H 4C4KT 4M5ZL 3RX5A 2VXUL 3V6FA 1Z3GL 1BOGB 1UXWA 1T0MA 5F8QC 2YA2A 4RX4D 4HZLB 4NRYA 3O3BA 1PYWA 1G0YR 1BD2A 3MXWH 4U31A 3HCVA 4JPIB 5C0BE 4H1LA 4PJFF 5ISZB 2CKBH 2DQGH 1S9WB 3H7BA 1T66D 5LWYH 3MMEA 1I9RL 4R0LC 2ENYA 1BFVH 2NX5D 1E4XL 1I1FA 4UU9A 3MR9B 2PTUA 2V2TA 5D93B 4FQ2H 2J8UE 3RBGA 4PIRF 3WIHL 2XOTA 1LMKA 4Z76B 2YMXL 4H8WH 3RNQB 2VLJE 5TDNB 4NN6C 3BQUA 4U05A 4PJCB 3P0VH 5CIPA 3MACL 1RMFL 1YNKL 5B39B 5HY9B 4G6FD 5I1HH 3QUYD 3X17A 1X5LA 1OSZA 3H9SE 4D0DA 1BQLL 3QHZH 3CVIL 3W81A 4PJ8C 1MFBH 4OV5A 3DROB 4XP4L 4YAQA 5JLZA 4G42A 4QT5B 4MLIA 4N9GA 3UTTD 4AIZB 4UV4H 4EVNB 3O3UN 4KKAD 1GSMA 4LSVH 1DLFH 1MCSA 2H9GB 1KPVB 1RV6X 5DRZA 3TO4C 5IJKA 2J5LC 3ZE0E 5FHAL 2AW2A 3FQXA 4GKSB 1IQDB 5HYFA 2I24N 4ZUTB 4MCYB 1GAFH 3KS0H 5AAWA 1FV1B 3BP5A 4MNQB 4R2GD 4NUGL 1M7XA 3BEVA 3OKOA 4YXLL 3K2UH 1DQJB 3V6ZA 2YD5A 1J05A 3QFDB 1J1PH 2DQJH 5D2LE 4PTTB 4PBVC 4EZMA 2GITB 1GOGA 1P7QB 4P23B 3CMOL 5IF0B 2OSLB 4GJTB 4EDXA 1CDGA 1D6EB 1KELH 1W0WB 2WUBL 3FJTA 4GG8A 2DICA 4XP1H 2VB5A 2IBZY 1F3JA 5ITFB 3PGFH 2EECA 4CVXA 1IM3A 4PB9L 3DUHA 3L3IB 4DWHA 2C9AA 4Y16A 2V6HA 1IE5A 1OAKH 4M93B 2YPLE 4BQ9A 1ZHNB 4FABH 5GGVL 1D5MA 2FX9L 5CGTA 2QSCL 2AS5M 2ITCB 3S37L 4N8VA 4U6HB 3C60D 3QT2A 1PZUB 3O6FC 4JFXA 3RY5A 4ZOEA 5D7SH 3BP6A 4OI9A 2BSED 5F9AC 4OUUB 4OZHF 2CGRH 2A83A 4HKZA 4JFFD 5TE7L 2BNQE 4HPOH 4CMMA 1MCWM 5KJRL 1KCKA 5J0BA 4R4BA 1JF1A 3IYLW 4J12A 2I9LA 1QKZL 2YOCA 1I7ZA 4RGMC 5CD5C 1KPRA 3JSSA 5ALCL 3UAJC 3NCEB 2M1KA 2F5AH 3LRSB 3T4AA 3WLWC 1DCLA 1I1RA 1ZK9A 5CILH 5B22A 4DUXA 1MHPL 1RZFH 3QXWA 4MXQC 3KYOB 4M5YH 3UTSA 1J1OL 3D87B 5JHLH 3ARWA 3GSVB 3FT2B 2XWTA 1VB9A 3IKKA 2PYEA 4YX2H 4KROD 3T8XB 2XA8H 2JCCB 5JDSA 4R90L 4R7NA 5FUZL 2B39A 4DEPB 5KANI 4UIMB 1T6VN 1QLEL 3FCTB 3DWTA 1UVQA 4M6OL 4XNMB 7CGTA 2VWEE 1D6VL 5D6CA 4IIQB 2DOCA 4MVBD 3V0WL 1U8IB 5TH2B 4KUZL 5CP7A 4XPTL 1R3IL 3FHAA 4MNHA 1T1ZA 4OLZH 4PRPE 3NACL 3KXFE 1AKJA 4KRMB 4CL7A 4A6YH 2VOTA 4OCMC 2FJGB 2V2WA 1MQKH 2FZ3A 2NZIA 4Z0BH 4BH7A 4Y4HD 1T22A 4PBWD 4H25B 4Z77B 4FFYL 4JAMB 3ZE2E 1YQVH 4FQJL 4KY1H 1INEL 4HX1B 5CJ5A 5F9JA 2HTKC 4LVNC 4N0UE 4NQEB 5CZVL 4F80A 2VZVA 1EFXD 3MRJB 2P5ED 3LPFA 5TPWL 1AC6A 3C5ZC 2NY7H 3QDAA 4AYFA 3GMNA 4AG4H 2Y25A 3HG1B 4ZAKA 5F96H 1GYAA 3BD4A 1HH9A 4PJBA 5I1JH 3QA3B 1HXYB 1G9NL 5AUMA 3MFGB 3MV8A 2GAZB 1TQCC 5LGJB 1MCWW 1G9NC 3GMLA 1QBLL 2HT3D 2AJSH 3CFEB 4R7DA 1NEZA 3O4LD 5ILTL 4MSWA 3TT3H 2D7PA 1GPOH 1U36A 1IAIL 2EYSA 4P2QB 1CFQA 1MVFA 1OP9A 4IMLB 3RWJA 1XGPB 3KPTA 4M7LH 4ONFH 2DDQH 1A1OA 1O7SA 5EIIA 4IBLT 4Z7UA 3IXTB 4LRIC 2LE9A 1YEKL 3F6IA 2YD3A 4F33B 5CJQH 1T1YA 2EH8H 1PX3A 2F58H 3QXDB 4V2CB 4M6MH 3E6HB 3WIIH 3MRHA 2AV1B 1L6ZA 3CSBA 1T21A 1LVEA 5F7EL 4JPKL 2CRIA 3I84A 3ARBB 3TZVC 2VDNH 4BSWA 4F7PA 5E5RB 1U42A 4OGXH 1ACYH 1A6ZA 2YA1A 3O0RH 1J88A 2GTWA 4XH2B 3IU4L 1FYTB 2O5ZH 1JPSL 4XHJC 5LKNA 4I48A 4QHNB 1UH2A 3SY0A 1ZLWH 1S7QA 3Q1SH 5HYQB 5B3JF 1RHHA 3D9AH 1CLOH 5JQHC 3FQNB 1L6XA 3NZ8A 3GIVA 4ZXBC 5SWQA 5C0EA 4K9EL 3F7YA 5E8OA 2E7HA 4M7KH 3O3DB 1KTLA 2L7JA 4RAVA 5DTFB 4K9EC 1A2YB 1A6UH 1TPXC 2A9NH 4NJAH 5ITBL 2BSTA 4LLAA 4LDEB 1S7RA 3KWWB 5ETUB 1OTUD 2C3VB 5DYOB 5DEGA 3QFJB 3RDTD 2FWOB 3UCRA 3MV7B 5BOZG 3T77A 5HHQB 2BVQA 2ID5A 4DKDC 1E4KC 2VDOL 5ESVA 1QSED 1F4AA 4IEFB 5ADOH 5IBUB 3BP4A 4EEEA 2BVOB 3A6BL 4UT7H 5GS1A 3M17B 1YMMA 1BBDH 5IBTL 3TBWB 5D7JC 3TYFA 1NAKH 3AM8A 4P2CG 2EEAA 2VMFA 4NQVA 4ZFGL 4MDIB 4FFWD 3CDFA 2ATPB 4I0CC 3QAZB 3HPJB 5GS3A 4JN1H 4MMZC 2R8SL 5DJ6B 2M8XA 4YDLC 1A1NB 4EQ2A 3MRCB 5I17A 4MD4B 4OF6A 3STZB 4JM4H 1W8OA 4BFIB 5C0CD 5GS2D 4LHUG 2B4CH 3DO3A 1ZEAL 4IDLA 1A7QL 5F7DB 4LMQE 2QBWA 1W72A 2GCYB 3DX8B 1RZ8A 5TFSH 2EDNA 3WNPA 5FGCE 1H3GA 2UWEF 4CADA 3ULVH 2CIKA 2DYPD 4GMTL 1R5IB 5FUOL 4MQXD 3C08H 3O4OC 1G7QA 3RL2A 1JK8B 2ZJSL 3HKFA 4J8RA 1DVFB 2D31B 5CJXA 2MKLC 3BPCA 1ZVHA 1X9QA 5JOEA 4GW4A 5EA0H 4MAUH 3WBDA 5IQ7L 1FYHB 2DWDB 5CBEA 4HIXL 1FJ1B 5DD1H 4H88H 4CJ1A 2BNRB 1BECA 3OXSA 5C09D 4L8BB 5GGTL 2AEIT 5CMAB 3SGDI 4JKWA 1SY6A 1I9EA 5IFJB 4PJIF 2XNAA 3BPNC 2R9HD 2XTJD 4WHYH 4Y1AB 1WBYA 3D1MC 3OKMB 5I9QC 4KDWA 4GRLB 4NO3A 4YUEH 3HE7C 4HQQL 4F9PA 4POZD 2D7NA 4GXUM 2G5BA 3BHBA 2HA1A 3BKML 1IGJB 2W59A 2JF1A 4LEXH 3SGDH 4RNRB 4JCMA 3SKOA 5AD0B 3BH9B 4DCQB 1T2XA 3VXPB 5D7IF 4WFHE 4YEFA 1F90H 2CDEA 4PJXE 1DDHB 1TZGH 4OSUH 5IROA 2QADC 2ZWLT 3TNNB 5JA9A 5H35A 1AGFA 2YPKB 5FECA 1X5GA 5LXGH 1NAML 1RULH 4J3UA 4KTDH 4KVCL 2AXFB 5DO2C 5GZND 3V5KB 4F7CA 3D39A 4TVPL 3T09A 1NBQA 4P46C 3DV4A 2UVEA 4QHLB 5D2NE 3PXJA 1T5XB 2DLEA 2NY6B 4HIJA 1OAZL 4BZ2H 3MLWL 3ZT6A 4X7EC 1PY9A 1J0HA 3VWKD 3KPRA 1G1CA 3U4BH 1U91A 2FJFA 4PJAF 4LF3A 3TNMA 2OS7A 4HBCH 2VLKD 2Z4QA 4LGSB 3TO2A 4Q6IB 1EK3A 1I4FB 4KJQC 5E99L 1GC1L 2X1WL 4NNXA 3C9NA 3FQWA 1JMZA 1RFDH 3FKUS 3QHFL 1G9ML 3IAGC 1NC4D 4B50A 3IFNL 1N4XL 1C1EH 4X6CF 2D0GA 4U0RB 4JZJB 4NFCA 5BRZD 4C57C 1RUQL 3LD8B 4NQXB 5HPMB 4FZ8H 5GRVL 4G6JL 3VD4A 1MI5A 3S4SG 1DBJH 3QCUL 4YFEA 4G8GA 4Z7VF 1DQQB 2R4RH 4LKXB 2Z0BA 2G2RA 1INQA 4U1KB 1AO7A 4OCWH 4NCC2 3WFEH 1KBGL 1JYVA 3P9WB 5BMFL 4N5EC 4OZIE 4XPAL 5SWSD 1MWAL 2EDJA 1FIGL 1U8NA 4P5TA 1NUGA 4Z5RA 3BO8A 4QXUL 4MAYA 4EXKA 3Q5OA 1QSZA 3FFCD 1JHLL 2FSEB 1QR1B 2QV2A 4YQXH 1NCCL 5IFHH 5DHXB 3NFPA 4KC3B 3D18B 1JF5A 2ED7A 1FVEB 5HI3D 1BQUA 3RVUD 1QRND 1RUPL 4D3CH 4WUUB 2XWJB 3HAEB 1JP5A 4X6DA 3TA3A 1A8JH 4X7TA 3ARUA 3MNZA 1KLUB 3SCMB 3VI3E 1IT9L 1CF8H 4O51B 1FLRL 2BSRB 3ZYIA 3MLVH 1NLDL 2OTWA 2UY6A 3P9MA 1S7UA 3EYOA 4FFVD 1YMHA 4X5XB 4JKMA 3QDMA 4JO4H 2APBA 2FH8A 4ZO9A 1HILA 4D9QD 5IGXL 4M7ZC 5HYSG 3VXUB 5HGAA 3DVNB 4LBEB 4UV7L 1FH5H 3OF6A 4K55A 2ZUWA 2BY0A 3SDDB 1J86A 2VQ1B 3SE8H 1WK0A 1EV2E 1PX4A 1MCLA 4JKPH 1HHKB 5ADPL 2QHRH 3VRLE 1S9VB 1DBMH 3BZEB 4NBYB 2DQEH 1PEWA 1FAKT 4HUWA 3P0YL 1CDUA 4Q9RH 3QEGL 5I76A 4OF3A 4F9LC 1S5IH 1ZXQA 1T5WA 5I16A 5BO1H 3U0WH 4RMVA 4DW2L 4E5XB 5DK2A 1PZ5A 5C0JB 2NXYD 4OLUH 4ZTOH 1S7SB 2H8PB 2Z93B 4WVRA 3OKEA 5BZDA 2DQCH 4JDZB 3TYGH 2F54E 4XI5C 5D6DC 4UOW1 1MAML 2CPCA 3IETA 1F4XL 4LSPH 3V6FB 5MP6L 4Y4FC 1UXWB 5DR5L 2AJUH 3ARFD 3BMVA 1CICA 4NRYB 4L4JA 1PYWB 1BD2B 3INUH 4XP6L 1TLKA 4H1LB 5D1XA 3WJJA 2ZZUT 1QNZH 3FT3A 4JM2C 5BW7A 5IFAL 2H2SC 1DQDH 1KB5L 1BZ9B 4TVPE 4PGEA 4GRWE 2FEEI 5JOPD 3EOYG 4Q9BA 1I1FB 4PD4J 4UU9B 2VDMH 3AS0A 5EN2B 4XVSH 1OB1A 3NAAL 3D6GA 2E9IA 4ELMA 5DQ9A 4WCYH 4LIQL 4WWKA 1CXHA 3SQBA 5CIPB 4HLZG 3CX5J 1XGRA 4HK3J 1OSZB 4D0DB 2EZ0C 1QFWL 5DHVB 1F00I 1A7BA 4OIIH 4QNPF 4FQLL 5ISZD 2BERA 4OV5B 1G7LA 2EDLA 4YAQB 5JLZB 4G42B 4N9GB 2EDEA 4M3KB 1TCRA 5F1IA 3ZE1E 4J3SA 3AMKA 2CSPA 5DRZB 5DS8B 2HMIC 1DTUA 3FQXB 1U8OA 4YBLC 1Q1JH 4XC3H 2LVCA 5FCSH 5J8OA 5EPMB 1JI2A 4ZOAA 3BP5B 4YIQA 2FRGP 3ZHDA 3BEVB 4LPCA 3OKOB 5DVLA 4QY8A 6FABH 3V6ZB 1J05B 1ZLSH 2KQMA 1ONQA 2YSSB 3ESVF 4UINL 1G7PA 3TBTA 5HTSA 5J7CC 4EDXB 2NY4C 4EI5C 4XPHH 2AJZA 2NXZC 4GG8B 2LQRA 1U8JA 3FB6A 3LHPH 2ESVE 1FDLL 4CVXB 3JWOH 5C8JA 1QBML 1IM3B 2CRMA 4Y89A 4JPWL 4Y16B 1JV5B 2IG2H 3O11B 1UZ8A 3O6LH 4QRRA 1D5MB 2X44D 1QRKA 3ARGA 4MNQD 4N8VB 2FBOJ 1G84A 3SJVA 4JFXB 5F7KC 1Q9WA 3B9KA 5DVMA 1HIML 1A5FL 4NJ9L 5IMMA 4JFPA 3KDMA 1P7QD 4P23D 1ORQA 3GMQA 2A83B 1S9XA 1P4LA 4HKZB 1FAIH 4F3FA 4CMMB 3RJDA 5DVOA 4K07A 3OV6A 4R4BB 2HKFH 1SEQL 2I9LB 1NKRA 1I7ZB 3W5NA 1YEGH 4HLJA 4JHAL 2KBGA 4Q0XL 4WI5A 1LWRA 3T4AB 5KVGL 1FORL 4YHPA 5KW9H 4PJ5E 4LSTH 3PV7A 4EI6A 4H0HB 5H94B 5BJTB 5ESQA 4WW2C 2BY1A 4LDOB 3AGVA 3EDKA 2GJ6A 2PYEB 4OFIA 2PCPA 4K94H 5J57B 4OQTA 4R7NB 3U7WH 3ALXA 1UGNA 3HE6A 3OG6B 3T0EB 4ELKA 3UTTE 4WENB 1UVQB 2Y23A 4JANA 1OTSD 2LABA 1FCGA 5TE6L 2H32A 5CP7B 1S3KH 1NBYB 2MTPA 1I75A 5I0DA 3Q5TA 1M71A 4LLDA 4X9IA 1AKJB 2HH0L 1HQRA 4NO0B 4U0QB 4AM0A 3QYCA 5C2BL 3QUKA 1NGXA 2FZ3B 4APQC 4UUJA 4BH7B 5C0BA 1T22B 4CVZA 1U8HA 3MO1A 3ARPA 4NIKB 5FB8A 1OTTC 5HHME 1PGRB 1JGLL 3GHBL 2EE3A 2ZCHL 1JNNL 1IC7L 3U46A 1AGBA 4OD2A 3WUZA 5F9JB 1KC5H 5GISH 3ZDYF 2R0WL 5D1QA 3H9ZA 3GMNB 1RUKH 4ZAKB 1A6VL 2J8UA 2VITA 3MRQA 4PJBB 4BZ1L 1X5HA 2PR4L 1X3DA 2VLJA 1TCMA 3MV8B 4LIQE 3BD5A 3O9WA 4IOFC 2ARJA 3GMLB 3ULVD 5J11C 3RIFF 4H1LH 4W4OC 1BREA 3H9SA 1LO0H 4R7DB 1P84J 1NEZB 1YA5A 4MSWB 4NC0B 5IWLA 2EYSB 4N68A 2X1QA 1CFQB 1XF5B 3MBEA 5KVFL 3RWJB 2X6MA 1F97A 2X4SB 1OQXA 4L4VB 1A1OB 4NQED 5E03A 1KTKE 5EIIB 4FNLH 5FYKL 4U7MA 4ONOA 4OF8A 5C0AE 4NP4H 2M2DA 3HMXA 4Y7MA 4JY5L 1B4JL 1HCFX 1NCNA 4OM1H 5GSVB 5CIPH 3U1SL 4NQCE 3AC0A 4P4KC 1INDL 5D2LA 3MRHB 5LGHL 1BZ7A 1JPTH 5FA3A 5EU7C 1EUUA 1T21B 4XNYH 1CTNA 2FR4A 15C8H 4BSWB 4F7PB 2BZDA 1GRWA 3LH2H 1OP5K 1A6ZB 3W11C 3QQ9D 3OAZH 2GTWB 1WZ1H 4QOKE 5HDBF 1OAXL 1CTOA 4KKCC 2AEQL 4I48B 3BYTA 2G75A 2WIIA 2YPLA 1JNLH 5D5MF 3S4SA 1X6NA 2DI9A 3SY0B 2AXGA 1KCLA 5E00A 3DI3B 3A0OA 4ZODA 2A6KA 5KVDL 3GHEH 2VYRE 3DMMA 4ZMAT 1NLBH 5F6HJ 1E4JA 5FCUH 3L9RB 4PGJA 3F7YB 5CGYC 5C0EB 5E8OB 5SWQB 3K4ZA 4X83A 4FQXD 5H37H 1KTLB 4RAVB 2BNQA 3ARBD 1W2KT 3UJTL 4ODWA 2ZKHH 2W9DL 3S6CA 2BSTB 5JZ7C 3VWJC 1S7RB 3GSXB 4PRDA 4JHWL 4NO5A 3KPLA 2A9MH 1TNMA 3P3YA 4UI2A 2EDWA 1KJ3H 1U3HA 1FYTD 3C8DA 4NQSB 2DQDH 3P9LA 2DKUA 3MUY1 3U30B 4OLWL 1BAFH 1VEOA 1BWMA 4LU5L 2DQTL 2VZOA 4FQPA 5MI0C 3SQOH 4YGAB 2IGFH 2BVQB 1NBVL 2OXHA 5ESVB 1UM5L 3PJSA 4N0CC 4KPHH 4ETYA 5JW3L 5IB4A 3S7GA 3BP4B 4XCYA 1DSFL 1CQYA 2X4QA 1S7TA 2NYYC 5HD8C 1T80A 2E6JA 5I1CL 5GS1B 1CXIA 1YMMB 3RI5K 4Y4KB 3TYFB 4L1DA 4WO4C 3QFJD 4OFKA 4PRPA 3KXFA 4ZPTA 4RAUA 3MV7D 3U4EA 4NQVB 2F9BT 2OK0H 1J0IA 1DBKH 5E1AA 4H0IA 4XXDA 4QRUA 4R0LA 4W6YB 1RQ5A 4GUPA 5BV7C 5I17B 1MJ8H 4U7KA 3RWGA 1EERB 4K3GA 2QQQA 1DE4A 4UIKH 4PP1D 4GG6E 4ONGL 4N0UA 5JQ6H 2O26U 4FZEH 3NGBC 1UWXH 1W72B 4JKLA 5E5MA 4EN3C 3DECA 3V4PH 4OGAC 3NABL 3WIHA 1PSKL 4MJ5A 4HWEH 5H8DA 1HCVA 2Z8RA 5A2JH 5TE4L 4FXLA 2CIKB 4OB5H 4AL8L 4PJ8A 1G7QB 2APFA 1NH6A 4DZ8A 2NY5L 3RL2B 1R0AH 4ODXA 3X3GH 1MREL 2DLIA 5LVEA 2NY5C 5BOPA 3KS0J 4GW4B 3MNVB 1X4ZA 2I5YH 3PGDA 1I3GL 1MCBA 5CBEB 3TO4A 1EGJL 2EICA 4PRHE 4BH8A 4J23A 3OXSB 2AABH 4HFWA 4LCYA 1MJUL 2XNAB 4I5BB 4MA8H 2MOVA 1WBYB 5L88L 1FGVH 4YHZL 4EUPG 1ZT7A 4HKBA 1RZIA 1V3MA 5EU7E 2Y7QB 4K7PX 2YD7A 4NO3B 4HH9A 5FYJH 5BZWA 3NPSB 1AR2A 3BHBB 4ZD3L 1DVFD 1QO3B 4K3DH 1QFUH 4POYA 3ZKXB 2V7NA 2BVEA 4OM0L 4JG0L 2HLFC 1IAOA 3QWRA 3SKOB 3L1OH 3QJFA 5C71A 1BEYL 1BM3H 4X7SL 2BNRD 3PDOA 5F71A 1WJ3A 2E9JA 2R56L 4R4FL 2CDEB 1NGZB 2WBWB 4JZOA 4OCSH 3SE9L 3MLYL 2XQBH 4MXVE 5H35B 1AGFB 5FECB 4Y1AD 3O6FA 3S36X 5F1SA 4NSKA 4NZTH 3AFLA 4YE4L 2KZWA 5HHXH 4U1MB 5LBSL 4GRLD 3DV4B 3BEWA 1AQKH 2VDLH 1G6RA 3MRDA 4LFHD 4HIJB 1YUHA 1UWGL 1CD8A 2NY1B 3I3BA 4QGTA 1U91B 2X9XA 2FJFB 1DR9A 4LF3B 3TNMB 3TO2B 4GXUN 4JGJA 2ZUSA 4NNXB 3C9NB 3FQWB 4DN3H 1LHZA 2VDRL 1A3RL 1NMCB 5CINH 4UT9L 1IGCL 4PUBL 2Z8VC 4G6AD 4FFVC 1RD6A 1VFAA 5BCAA 3QCVH 3RUGF 4E41E 2DD8L 3L3GA 5DQJA 2IAMD 1MI5B 4DKEH 2K7QA 1A7RL 4M8QA 4G8GB 4KK9C 3QPQC 2NY6D 3MRFA 1BOYA 2G2RB 4FQQA 2K9UA 2DTSA 1AO7B 1NCBH 4I3SL 1OOAA 1XF2A 1DL7L 4WV1C 5MEOB 2X4PA 32C2A 1A3QA 3T3MF 2PYFA 3DX9A 1CL7H 3VH8G 4WEMB 1N2RA 1Q9OB 1P4BL 1U8NB 4P5TB 2X09A 3VXTB 3MJ6A 4Z5RB 1WBZB 3BO8B 1MY5A 4ZTPH 4HT1L 4NM4L 4MAYB 1NDGA 2CR6A 1YN6A 3KPSB 3QG7L 3W9DA 3A6CH 3K8LA 4K7FA 3NFPB 2HWZL 1SVZA 3LKNB 4ODVH 1A7NH 4ENEC 3W39A 2R0ZL 3SE4C 2Z35A 4X6DB 3TA3B 4X7TB 4JB9L 3C5ZA 3MNZB 1T7XA 1DEEA 2J2ZA 3JV0A 3S34H 4B53A 3EYFA 5DEFA 1BVKB 3PWNA 2OTWB 1CBVH 3P9MB 4ZS7L 1S7UB 3EYOB 3RVWD 3T0VA 2DTMH 2JJSC 1YMHB 3MYJB 3QDMB 1T89C 3LEVH 1HILB 1CCZA 1HHJA 1OD7A 5HGAB 3L3JA 1BJ1J 4I18B 3HMWH 2VXTH 4JR9H 4X6FA 5DFVC 3BPOC 4WUUD 3RWFA 1OW0C 4RGOL 5JIKA 3G5XA 1S7XA 3SKNA 1EEZA 5CWSA 5J56B 4LRIA 3SCMD 4YWGL 5ACZA 3ARRA 3WEXA 4G7VH 4WI3A 2NY3C 4AMKL 3FMGH 1GGBL 4PRNA 3BH8A 4Q97A 1MQ8A 4J3TA 4MJIE 5C6TL 5H2BA 1OF2A 1T5WB 3SKUD 5I16B 3BN9C 2XG5A 1HZHL 1PZ5B 3TZVA 1KTRL 3HNTH 3OKEB 4HWBL 4U6VL 3SDDD 4WWID 3KGRA 1UWEH 3PP3H 3TCXA 1ZHBA 3PNWA 2HKHL 1SY6H 3NTCH 1F6LL 4PJXA 3RP1A 4KHXH 2IH3B 1CICB 4CDGC 4Y2OA 4XVTL 5D1XB 5HYEA 4X4XA 4MA7H 4ALAL 2FIRT 4WU5A 4NC1C 5AAMA 4RWYL 4JG1H 1FE8L 4ZXBA 4NUJB 4PGEB 3DXAD 3TV3H 1RZJL 3MJ9H 4ESKA 3U0TA 5HHVL 5D2NA 2CUIA 1YC7A 1RZJC 1OB1B 4LLVA 5EWIH 4ELMB 5DQ9B 4B41A 4WWKB 4TUKH 4S1QL 3AU1A 4HS8L 3QIUC 4RGNC 2X89A 3BE1L 1TTGA 4MYWB 3NVQA 4WU7A 4WY7H 1BD2D 1NC2A 1E4KA 1JGEA 1M7DA 3S3JA 3WFCL 4HV8A 4OZGE 1V7ML 3BAEH 5GSRA 5F1IB 3K8KA 1H0DA 4WEUD 4JQIL 2XN9E 3LKRA 2YZ1A 1FGNH 3KR3L 1U8OB 4TNVK 1JL8A 1OAUL 5FYLE 1LDSA 4YIQB 4KZDH 5D7JA 5DMKA 1FFNB 1QEWA 3LN4A 5D9SA 4OZIA 1XAUA 4IRSC 3BQUD 5GGQL 3WS6C 1SHMA 4QY8B 5E9DE 3B2UD 1PLGL 4N9OB 3KHQA 1B90A 3MLRL 1JYXA 4IRZH 3TBTB 3QUXC 1QLFB 2AJZB 4PP2A 3FB6B 3VRJB 5EDXA 2W9EH 3N85H 2UUDK 5FV1L 5C8JB 2BFVL 1ITCA 1KENL 1UZ8B 4QRRB 3O2WH 2Z8WC 4J3OC 1IC5H 3ARGB 1EHLL 3FT4B 3SJVB 1QTYT 3G6DL 1Q9WB 3B9KB 4HFUL 5DMGD 5T1LA 1LK2A 3S35H 1OGAB 3KVQA 4U1GC 2B1AL 4JFPB 5IMMB 3KDMB 1ORQB 3GMQB 4K8RD 1S9XB 1P4LB 4F3FB 1GIGL 3P11H 1RUAL 3BZ4A 4XAKD 5LCVH 5JOPE 4DGVL 2B8OT 4Y16D 3QR2A 5I1KH 1PAMA 4LLMB 2RGSA 5EORL 3V5HA 3V79C 2VXQL 5GGTA 4OCYH 4YHPB 4JDTH 1CGSH 2X1PA 2KH2B 4OLYL 4EI6B 3U0PA 3IDYC 1T7ZA 5ESQB 4Y2DA 4OD1H 3HPLA 4MS8D 2F8XC 4HGMA 1E6JH 1EDQA 3ZDZF 2GJ6B 2PCPB 2W60A 3HE7A 4G3YL 2GT9A 4F8TA 1FN4B 4JFHD 3HE6B 3VGBA 2F53B 4ELKB 3PG2A 4XP5H 3EYUH 3MOAH 3UX9B 4JANB 1EEUA 3BN3B 2R1XA 2H32B 2KL6A 3WKMH 2F54A 5E2WH 3MLZH 3NA9L 1FRGL 1KNOA 1M71B 3LZFH 4TVSa 4LLDB 3QNXA 3S88L 1HQRB 1V3KA 4AM0B 1XR8B 4N0FB 5IW3A 3QUKB 1KIRA 4NC1E 1NGXB 3VXRE 4Z7OF 4UUJB 5C0BB 1R3JB 1EO5A 2DBLL 1NAMA 1U8HB 5FO7A 1DQLL 3IS1X 5D71H 3AREC 3IXAA 4HWZB 5FB8B 4KJWD 2R0LH 2Q7YA 4P46A 3U46B 3EFDL 4EUPA 1EO8L 2PYED 1AGBB 4OD2B 5JPNA 4EDWH 3QUZB 2JLLA 4U2ZA 3T0ED 3K81A 3OTTA 5E4EB 5EIQA 5D1QB 1AJ7L 2GIYA 5D8JL 3LCYA 3TF7C 2J8UB 12E8L 3MRQB 1NJ9A 3NCBB 3D0VA 4MMXC 4GRMA 1X5IA 2VLJB 1YZZA 4RGNE 2CUMA 4UDTB 5EBMA 2ARJB 3N1GC 1F45A 1AKJD 2CMRL 4NO0D 4MNQE 4LOUC 3P0GB 4G8FB 4Z7WF 5E94A 5JUEH 1QG3A 3MBEB 2FNBA 4M1DL 2DM7A 2P1YA 4O5LL 3IGAA 1L9NA 3WN5C 2P8MA 1RURH 2Z91A 1C8PA 5JOFA 1G7HA 1AY1L 2GY5A 1YPZF 3ARBC 4MJ6A 1IGFL 4Z8FH 4ZAKD 2YWZA 1TZIA 2F5BL 4J4PA 5I2IA 1GHFL 2VABA 4JLRB 3MV8D 3M45A 5FM4A 1MWAA 5D2LB 3EJZD 3RWCA 1LDPH 2ZCLL 5FA3B 4AEHL 2ZNWA 5IHZA 3IDIA 2JELL 1UB5A 4UILL 4WNQA 3QWOA 4P2OC 2FR4B 2H2PC 2NY0C 4OT1L 3WO4B 3PHQA 3WXWH 2ESVA 3OR6A 4G5ZH 1D3CA 4HPYH 4TSAH 2G75B 2YPLB 4F15C 2YHGA 3QEUA 4MX7A 5JNYA 5E00B 5TF1L 4RFEA 4ZUUA 4V2BA 5EZIH 2GQHA 1HI6A 1T03H 1S78C 5K9JH 2R69L 3DMMB 4JN2A 4RFOL 4RX4A 4GKNA 4K23L 3R4DA 3MLPA 1J11A 2PW2A 3HLAA 2BNQB 1C7SA 3DRTA 4ISVB 4PRDB 4NO5B 3VMOA 1U3HB 4U1LB 3P9LB 1H8NA 1XIWC 4BQ8A 4DTGL 2J88L 2HRPL 2KQNA 4NN5B 4CW1A 4M7JL 1GVIA 3HI5H 3GSQA 3QQ4B 4F9LA 4XVUD 4PJ5A 5CUSH 1BJMA 2EDXA 2J4WH 4EBQL 3PJSB 3STLA 4JRWA 5IB4B 4XCYB 1G7JA 2X4QB 1S7TB 3OXRA 3UTTA 4BFEA 5DC0A 4PREA 2GYSA 5D6DA 2DQUL 5KSAC 4BUHA 1W0VA 4Y4FA 1ITBB 4PRPB 3HG1E 1YEDA 3KXFB 3CX2A 4ZPTB 3PQYE 3U4EB 2P4AB 3TFKD 2DLHA 2EIBA 4JM2A 1GGCL 5E1AB 1DN0A 4QRUB 4R0LB 2X4NA 4OJFH 1UKSA 4R3SA 1JWUB 5GS0H 4OQTH 4N90E 5IG7A 3RWGB 1KB5A 5IB2A 3W9EA 4N0UB 4M48H 4I77H 4P2QE 4ZOBA 4K7PL 4YBQD 5E5MB 1XCTA 2PXYC 4ZFZA 1YMMD 2QQNH 2NNAA 4NN6B 2H32H 1NCWL 4MJ5B 5IUSA 5I1GL 3MA7A 4KQ3L 3TWCL 3OJ2C 1JHTA 2R0KH 3RIAK 1MJ7L 4P9MH 4PJ8B 5DD5H 2XY1A 4DZ8B 2G9HB 3E3QC 4ODXB 4ETQA 1X7QB 5DDHA 2NW3A 5HHOE 3EDJA 2G5RA 4JFQA 1EH9A 3PGDB 4DN4L 3S36L 4BH8B 4KGJA 3U36A 2ZCKL 4B7IA 3K1DA 5ID0A 3UJIH 1A14H 4WI4A 4HFWB 4KJYA 1MOEA 4LCYB 4PJ7F 4BKLA 1QP1A 2ZUUA 3BKCH 5C0AA 1U8QA 2VZ1A 3SKJH 4PV9A 4D9LH 4KZEL 4BFBD 5FV2A 1ZT7B 4HKBB 5C0ND 3DHJA 1RZIB 1Z5LA 2ILLA 4LQFL 4RMQA 4NQCA 2DKSA 3LEYH 3D85A 4EI5A 1KSRA 1XMWA 1I9JL 5BZWB 1G0DA 1CXLA 3B9EA 1JFQL 5J1AA 1FO0A 5DVKA 1IQWH 4KMTL 1OY3B 4QXGH 2AKRA 1IAOB 2W92A 2QL1A 1NFIA 4M3JA 1XGYH 4RSVA 4NKIL 4QOKA 1HNGA 4IS6A 4NZJA 1E27A 4JZOB 1CGYA 4OI7A 4MZ3A 1N5AA 1QUNA 3O6FB 1EHXA 1MIMH 4UT6H 1MEXH 4HUKB 4NSKB 5T33L 3GDBA 1V3JA 3BEWB 3V52H 4DJMA 1DUZB 1A64A 1ULVA 3STBA 1WCQA 5IESL 3MRDB 2OXGA 1U3YA 1YUHB 1OL0A 4NFBA 1ROWA 3FN3A 5ACLA 1A1MA 4H20L 3QDGE 4RGMB 3HC3L 4TOYL 4HK0A 4QHKI 3JV6B 3C6SA 5DLMH 4J1UA 5I1EL 1JNHA 4WW2A 1KLFA 3LKPA 5GGRY 4OD3L 1CGVA 5I0ZA 4M1CC 3UTPE 1TTUA 1VFAB 2I07B 1T3FA 1P7KA 3D39D 2UV3A 4RDQF 3L3GB 2CLVA 5DQJB 2DIAA 4M8QB 3RGVC 3F5WA 1ZA6A 3MRFB 1Z9SA 1JRHL 1LEIA 4NPYA 5D72L 3MA9L 5DUPH 1XF2B 3BRFA 1OLZA 3EYSL 2X4PB 3JUZA 32C2B 4M02A 1U41A 3EO9H 4XNUL 2PYFB 3DX9B 2A73A 4HIHA 1N2RB 5CGMA 2YS4A 1UM4L 2R15A 1BVZA 4APQA 1NDGB 3VG9C 1YN6B 3NOIA 2X05A 3KPOA 1WIOA 3W9DB 4WHTA 4K7FB 3GKWH 5DMIL 1KIPA 3SO5A 1YY8A 4K2UH 3W39B 4LVNB 2Z35B 1MI5D 3IJYA 4LHJB 1JHKL 3C5ZB 3WHXB 4G8GD 5L6YH 4GG6A 1DEEB 1AO7D 1CR9H 3EYFB 2B2XL 1JGVH 3MCG1 3PWNB 3TJHC 3VXOA 3MGAA 5LQBL 3KPPA 2UWEE 5FGCB 5IB1A 3UDWC 2VXUH 4O9HH 4M62L 4P5TD 1HHJB 2AI0H 4W4OA 3E3QE 4MAYD 4Z95L 4KQ4H 3L3JB 1IEHA 1ZHKA 2D7MA 1I9RH 4U1SA 3RWFB 3G5XB 1IAKA 3TA3D 2IQ9L 4PRHA 4FFZL 1Z2KA 5CWSB 4PJIE 3UC0L 4A2MA 1NCAL 3WEXB 5GRYA 2O5XH 1IEBA 3C8HA 2AJVH 1IRAY 5B39G 4PRNB 3QQ3A 3PF2A 3BH8B 5E0QA 2X9WA 1CU4L 4PGCA 5H2BB 1OF2B 5MEQA 1EX0A 5DJDA 5DZLA 3QDMD 4JHZA 1RMFH 1YNKH 2WZPD 1UKTA 3TZVB 3K80A 3MODH 3OF6D 5ESAA 2EIZB 1OT2A 1FNLA 2BMKA 5KAQG 5D7IE 3IDXL 1ZHBB 5EBLA 1XGQB 3NCCB 2P8PB 3DSFL 5FHAH 3OJDA 2E8YA 3D69A 4LSSL 4HG4K 3NH7H 1YNTB 5JW5A 4X4XB 4LGPB 4NUGH 4WU5B 2VC2L 4TTDD 2E8ZA 1CVRA 1H3PL 5DD6A 5CBAB 4KK6C 4N0YL 2WP3O 3CMOH 5F9OL 4XVJL 2PETA 3U0TB 4FQHA 1TPXB 4YDJB 3D25A 4LP5A 3OPZH 5FXCH 2YD8A 3WV0A 1UJTA 3VWJA 4LLVB 1SBBA 4PJAE 1UA6L 2IFGA 1XGTA 3L3HA 3AU1B 5I73C 6CGTA 4UNTA 4WU7B 5GGVH 3HS0A 1CICD 3RKDD 5KVEL 5GJSL 3EYQD 4KTEL 5F1NA 5D1XD 2FX9H 3BWAB 1ZMYA 1NC2B 4X6CE 4M43H 1JGEB 1XR9A 3H42L 1M7DB 2CO7B 5TQ0H 3JZ7A 5GSRB 1H0DB 4KI1A 4E41A 1YDPA 2Y36L 4Z7VE 1G6RH 3LKRB 4D94A 2OL3L 1CZ8L 5ICZA 5C08E 3THML 4OLVL 5GRJL 5DMKB 1QEWB 1QKZH 3LN4B 5D9SB 2ITDA 4WWKD 4OFDA 1DBAL 2IPTL 2ATKA 4G8IA 4Z7UF 3T08A 2VH5L 5IP4A 1ADQL 5HI4C 4JJ5A 2IALA 5MENE 4PP2B 4PJEF 1J1OH 3QO1A 5FOJA 5INCA 3VXUE 2OJZL 1TJGH 4DAGL 4FQIL 2X4OA 1WFOA 5IVOA 3FO1A 4EN3A 1I3VA 1YEFL 1WVZA 1QLEH 2FLRT 4CGTA 1D9KB 5IMKA 3UJJL 4LMQI 4KUZH 4XPTH 1R3IH 1NGPH 2ICEA 3D0LA 1H8OA 1I3UA 1LK2B 5T1LB 3O4OB 1OP5H 1HHIA 2LTQC 2RBLA 4WI7A 4U3HA 3DOSA 4RISH 3EHBC 1QPXA 3ZKMC 4WTWA 3SDAB 3BZ4B 2EYRA 4WFGD 4FFYH 3C6LB 1TDQA 1KEMH 4FQJH 2D7OA 3DJ9A 2HVJA 3NCJH 4P2RE 5GHWH 1AD0A 1J10A 1LO3L 3RFZC 1I1YA 4R6UA 1IAII 4PB0H 3HUJF 5CZVH 2J6EL 4WHYG 3V5HB 1MRDL 3BPNB 5TPWH 3MLXL 4QRRD 4S1RL 5HGBA 3ARGD 5F7FA 2VQUA 5I9QB 3U0PB 2Y06L 2GK0A 3QPXL 1G9NH 3SJVD 2NTFA 3HPLB 4MJIA 3B9KD 7FABH 1TETH 3PIQA 4ERSL 1OGAD 2FD6L 4ZUVA 2W60B 3HE7B 3TH2T 2DJ4A 3ZMRA 1P7HL 2NW2A 3RNKB 1V7NH 1IAIH 2WNGA 2R1XB 4XC1L 5C6PB 2F54B 1KNOB 3QNXB 2IQAA 1ZGLA 4R4ND 1CGXA 1KIRB 1QSVA 1I7UA 1NAMB 5HGDA 3MFFA 3IXAB 2Q7YB 4NDMA 1A6AA 2P8LA 2GJ6D 5GS0D 1G0XA 4GRWB 5JPNB 1T7YA 4OTXH 5I15L 3HE6D 3SGJC 3A6OA 2NLJA 4DZBA 1MCRA 1EO7A 3B3IA 5I74C 4DK3A 3O6KL 4XRCA 4HF5H 1NJ9B 1BIIA 4C56B 1R5WB 3D0VB 4ZS6D 4GRMB 2I60L 5FOBA 5A16A 4XMLH 4G9FE 3H9HA 1A22B 4PG9B 5EBMB 1VFOA 3B43A 4UQ3A 1FFQA 3I2CL 4WUKL 4U1NB 4QNPE 3CPLB 3QXVA 5C0BD 5E94B 1KULA 3IKCA 3TJEL 2NCMA 2IBGA 4OGYL 5FA4A 4OZGA 2Z91B 1IGML 1K8DA 1CIUA 1VDGA 1YEIL 1G7HB 5JOFB 5EZJA 2XN9A 5ENWA 2AEWA 4WV1A 4X7DC 5D1QD 3TP4A 2AXHA 1SMAA 5E8EA 5DI8B 4XMKH 3P30L 3JBG7 5I2IB 2JE8A 2VLJD 2VABB 1AR1C 1KJ2L 1ETZA 5E9DA 1MWAB 4PLNC 4ODTH 2CKBL 3RWCB 3WD5L 5IHZB 2VAJA 3IDIB 3H9SD 5LWYL 1UB5B 5IM7A 4WNQB 2MCPL 3QWOB 1WIPA 1BFVL 3KYNB 5IBUG 4B0MM 3MBED 3PHQB 2AXJA 2VDOH 3GO1L 3SE4A 2DQIH 2W0LA 3HR6A 3OR6B 2IBZX 1ZKAA 2WLYA 4X9BA 1KN4H 5HVFB 2CKNA 2V5YA 4H8WL 4LK4A 2CDFA 4PLKC 2BJMH 3QEUB 4MX7B 4Y5XC 5JNYB 5IBTH 4KRLB 4ZUUB 1HWHB 2JJSA 3P0VL 5HI5C 1I85C 4C54A 1MAKA 1T89A 1HI6B 2BC4A 4QYOA 1BFOA 3QHZL 1DJSA 4M7ZB 3VFWA 4GKNB 3CSYB 1MFBL 3ELAT 2RAMA 1FNGA 1JZ7A 3TLRA 3LRGA 4ZFGH 3LQAL 5E95B 2PW2B 1CFSA 3HLAB 2B1HL 1HQ4A 4NO2A 1RK0A 1FZMA 3DRTB 3LQAC 4LSVL 3SDCC 1VGKA 1DLFL 3T2QA 4NWTH 1OW0A 5LG1A 3CDCA 1H15A 3T0EE 1QA9A 4CU7A 3EFFB 5I18L 1GAFL 1N64H 5EIVA 1H3XA 2YPLD 4CW1B 4XWGH 2W65B 4QWWD 3GB7A 2H1PH 3QH3A 3C8KA 4JFDB 2X9YA 2ZPKL 3GSQB 4AY0A 5IBLD 4PJ5B 3K2UL 1MFAL 3HTLX 5CAYB 5I75C 1J1PL 2DQJL 4NZRH 1PG7H 4Y4KC 1LP9B 1A6TB 3DMMD 1N5YL 4XAWL 3STLB 2B5IC 4JPIA 4LPXA 2FDBP 5FUOH 1KPUB 3CLFL 4Q7DA 3GK8H 1S9WA 4E42A 2BNQD 2UY7A 1IL1A 4CMHB 3PGFL 1WZMA 4DVRL 1ZANL 1IKFL 4PREB 4HWBA 2CH8A 3E0GA 5IQ7H 3C5SA 5L8KB 1U3HD 2IH1B 4Y4FB 2Q3ZA 3V9FA 2OI9C 1BX2A 2RHEA 1YEDB 1QPPA 4JM2B 3VXRA 5D7SL 2OX5A 2X4NB 1CLZL 2VZTA 4LFHG 4R3SB 2CGRL 3BGFC 5AG8A 2C3WA 5SX5K 5IG7B 1ZSDA 2DN7A 1KB5B 5IB2B 4LASH 3F58H 3DROA 3BD3A 3DGGA 4OCNC 3HZVA 3IDJA 4HQQH 3W9EB 3ZDYE 2Y9RT 4ZNEE 1GGTA 4AIZA 2HP4A 1XCTB 2XZCL 5K59F 1MPAH 2EIDA 3K4AA 4ZFZB 1MHHA 2NNAB 3IVKA 5D1ZB 3OBAA 4L4VE 2KPNA 4MHHG 3QIUA 4C83B 4JQXC 2A77L 1JHTB 4PRPD 1A9EA 3KXFD 2Q3AA 3SO3C 3UEZA 5C0FB 4MNQA 3H7LA 1RZKL 1CQKA 4M5YL 1JZ2A 1LNUB 4KVCH 4ETQB 1DQJA 2CIIB 2VTFA 3O3EA 1WLHA 2V5SA 5DDHB 1ZHLA 4YX2L 1RZKC 4EUPH 3CNKA 2DM2A 2XA8L 3P4OA 3V6OC 4GRWH 4RBPK 1EBAA 1VACA 3X14A 1EEYA 4YBLB 3U36B 1RK1A 5ID0B 1X5FA 5DUMH 4KJYB 3MLWH 4BKLB 3MX0A 1U8QB 4DUWA 1Z6JT 4PV9B 1T6WA 4IRSA 3WS6A 4OLZL 2R2HA 3MZTA 3Q48A 4NHUA 4A6YL 1ZHNA 1Z5LB 4PJGF 4O58H 5E99H 4NQCB 1CDJA 2VXSH 3NPZB 1MQKL 3O2VH 4JFYB 4Z0BL 4F58H 4IHOB 3D85B 2NY4B 4PJ8D 4EI5B 3QUXA 3RTQC 2BDNH 2NXZB 3QHFH 3ARDC 4MQ7A 4N5UA 1YQVL 1FO0B 4KY1L 5JPMA 3IFNH 1N4XH 2AGJH 2AKRB 1RUQH 5HDBE 2VN7A 1NFIB 4NCDA 2ICWI 3TO4D 3MTRA 3V0VB 4X99A 3B6SA 4QOKB 4IS6B 3TVMC 4G6JH 3DVIA 1E27B 2NY7L 2VLRE 4J3WA 5D5ME 4L4TE 5C1MB 5IT2L 2RQ8A 1N5AB 3Q6FB 3RZCC 2NY1C 4F7TA 1JN6A 5F3HA 5DJXA 1XF3A 1NMAL 1MWAH 3N0PB 2AJSL 3GSNH 5F44A 4LVEA 3W0WE 4QXUH 4MD0B 5CEXB 2FGZA 3ILQC 3LDBC 3HAEG 1NCCH 3PL6C 1A1MB 3RA7H 4M7LL 4ONFL 3QWRD 3F6LA 4WJ5A 4HK0B 3C6SB 4FQCH 3FCTA 1S7WB 1F3DH 5DFTA 5FDWA 4J1UB 3RBSA 1IT9H 5CJQL 1FLRH 1JNHB 4WW2B 3LKPB 4HJGB 3O6FD 3ZYZA 2V17L 3FO2A 3WIIL 4FQ1L 3H3BC 1T3FB 4JJHA 3GMOA 3WFZA 1NMBL 3RX7A 1F4YH 2MQCA 1MRFH 3B83A 1H8SA 3F5WB 1ZA6B 1FZOA 4OGXL 1ACYL 1LEIB 4NPYB 3O0RL 4HX1A 1GCFA 3GIZH 4PJ9C 4P0DA 5CD5D 1Q9KA 2SEBA 2X7LA 4XTRC 5HJ3B 3UAJD 1UM6H 5DGQA 2A73B 4HIHB 1CE6A 4IRJC 1YEHL 5DJ0B 3WLWD 2OQJA 3Q1SL 3HG1A 3P0YH 4APQB 3DX6B 3PQYA 1MCFA 3QA3A 4MXQD 1HXYA 4BM7A 3AREA 2HT4C 5LGJA 5CSZA 1YY8B 4Y88A 1MFDH 3ALPA 2PO6C 5E6ZA 4Q74A 5T1MB 3LS5L 4L8DA 3IJYB 1A6UL 2A9NL 1ZA3B 4NJAL 4GG6B 2DLFL 4F8QA 4P2QA 5BVPH 5EUOF 4D2NA 1OQOA 3VXOB 4KTYA 3AMLA 3KPPB 1Q38A 3V2AR 4PG2C 1KB9K 4H1LG 2VDKH 3ZKSD 1MAMH 5J11B 1F4XH 4JO2L 5DR5H 3UROR 4WTXA 1OP3H 4XP6H 4ODUA 5E70A 1V5JA 1ZHKB 3OKKA 3V6OE 3HRPA 5DJAA 2YK1H 5HHOA 3WN5A 3F62A 4U1SB 5ADOL 5IFAH 4JCLA 3VGAC 2HTKD 1YYMH 1HHGB 3G04A 1OCWH 1IAKB 3KAAA 4PRHB 4UB0H 3ARBA 2Z92A 5DT1H 3C5ZD 3SDYH 2Z31B 1BBDL 1JVKA 3BISA 2Y07H 1YY9C 2XG4A 4NZUH 4LCWE 3QQ3B 5GPRA 1NAKL 5D96B 5GZOC 3GI8H 4PGCB 5MEQB 4OBSA 4P4KB 4LIQH 4QHNA 2VLME 3PWVB 5DJDB 2VERN 1B4RA 2WWKO 1QFWH 4GBXB 4P2OA 3KLHC 2R2CA 4FQLH 3PWUA 1X5AA 5ESAB 3HI1A 2AQ1A 3RPIA 2BMKB 3HR5A 2B4CL 3O3DA 3FB7A 5HGHA 1QYGL 1U6AH 1VHPA 3EDFA 1FL6A 2O5YH 1ZT1A 3OJDB 3QRFM 1MCPH 3FQTA 3D69B 5TFSL 5JW5B 2C3VA 4ZSOE 1KCVH 3AROA 2PTTB 5CSBA 2FWOA 3C08L 3FOMA 5DD6B 4NOBA 3D5OF 3QDJE 4HKJA 4HWNA 3VGFA 4FQHB 3TZVD 1FO0H 1JZ8A 5EA0L 5C3TA 4I8DA 3VWJB 3WUWA 4W6XB 3VGHA 1PQZB 5DD1L 4H88L 1XGTB 3QDGA 4ORGA 4XHJD 3L3HB 1XIWA 1N0LA 4WFHD 5FGSA 4U1HA 3CX5K 4YXKL 4S11A 3HS0B 2X4UB 5MI0B 5F1NB 1BQHA 1NKOA 1VGEH 1XR9B 5CEZE 1A4JA 1PEZA 3RUGE 4ZXBD 4N1CA 1UZ6F 1GGIH 4E41B 1YDPB 3KPSE 2ATPA 4NJ9H 3VD5A 1KEGL 3MRPA 1WEJH 4YR6A 2BVUA 3HNSH 5FFLA 4OCXL 4LEXL 5ICZB 5I19H 5KSAA 1A6PA 3RX8A 2VL5A 1TFHA 5KZCB 5TQ2H 4WO4B 5K9OA 5JO5A 1Y6MR 2ITDB 1TZGL 4OSUL 2YC1A 3ZE0F 4JHAH 4KUCD 3U83A 4Q0XH 2ATKB 1M7IA 1YN7B 2X89D 2I9TA 4KTDL 1FORH 4JJ5B 3DSNA 2IALB 4P5KA 5EOTA 4YK4C 1NC2D 5C9KA 1TITA 5BV7B 1TENA 3QO1B 4JPVH 3DBXA 4S0TD 5INCB 2FLBT 5F7HA 1JK8A 3Q5YA 4BZ2L 1U95A 1PKOA 2X4OB 3NGBB 1BIHA 3FO1B 3LPWA 2PXYA 3U4BL 5IHUL 4HBCL 5IMKB 2DWDA 2GJJA 3W2DH 3LQZA 5CMAA 2ICEB 2UWEA 3WXVH 3ZTJH 1RFDL 4YHOH 3KLDA 1HHIB 1YJDL 1GOHA 4GLRH 1SBSH 3AY4A 4L3AA 1S9YA 4FZ8L 1YJDC 2XZZA 4MGXA 1T7VA 1JGLH 3GHBH 1DBJL 1JNNH 1KV3A 2HVJB 4OFYA 1AD0B 1S9KC 4DKAA 2R4RL 3E2HC 4OCWL 3WFEL 5FGRA 4PJIA 5EOCJ 1OD9A 4RNRA 1CLYL 5HGBB 5HDQL 1A6VH 3ARTA 3VXPA 4RA3A 3WYRA 2GK0B 2NTFB 4MJIB 1DDHA 1YC8A 3PIQB 5T1LD 4ZUVB 2YPKA 5E56A 3ZL4L 4YQXL 5IFHL 2NW2B 1WQVT 2AXFA 3QUML 3SDAD 4UAOC 1K4CA 4D3CL 3BXNA 3ULUC 3CH1B 5KVFH 2DWEB 4HIIA 5D7IA 3UXFA 1CF8L 1T5XA 2P46B 3VFTA 2DMKA 3QUZC 2IQAB 1ZGLB 1XF1A 3G5YA 4X80L 4KHTL 2D03H 4JY5H 1B4JH 1I7UB 1I8IA 2EYTB 4Z0XA 1I4FA 5E6YA 2DQHH 2EDKA 3MFFB 3U1SH 5B8CC 1XCQA 4NDMB 2XPGB 1A6AB 2A6IA 2P8LB 1INDH 3HE7D 4HD9A 4UBDC 2CD0A 3QEQE 5J1TC 1CXEA 2NLJB 4DZBB 3SE8L 2N56A 5ERWA 4XRCB 4PJAA 1BIIB 3REWA 2BHZA 2DQEL 5FK9A 1CGUA 3OAUH 5A16B 2F54D 1CFTA 3BYYA 3H9HB 2QADD 4S0SD 4UQ3B 1B9ZA 3G5VA 1K9TA 4LNVA 4ZUSA 1S5IL 4P3DA 1P84K 5DO2D 3BIKA 4X6CA 3MRKA 5BO1L 5T1DH 5KVDH 5FA4B 4LGRB 4P46D 4QHKJ 4OZGB 1JF6A 4OLUL 1K8DB 4TVPD 3RGVA 4ZTOL 3MCKA 3QSKB 4Z7VA 5EZJB 2DQCL 4DGYL 4EQ3A 5KSBF 5ENWB 4WV1B 1FFPA 3TYGL 3BRDA 3ZKNC 5E8EB 1J87A 1K4DA 4U6XA 1JYWA 1CD0A 2R23A 3EDEA 3HAEA 5F72S 5C08A 2XT1B 4KJQD 2AJUL 1EAPA 5C2UB 4O51A 5E9DB 3INUL 4KVNH 2MPAH 1QOKA 4MQTB 1OAYH 3WHE1 2HT2C 5IM7B 3DURA 5C7XH 3EYVA 4G43B 1DQDL 2OR7A 5MENA 1OGAE 2ZUTA 1RJLA 4I0PC 4LCIL 3VXUA 2HFTA 1R24A 5AYQA 2FGWH 1DSFH 4XVSL 3T0AA 5FUCE 5E2UH 2EKSA 3EAKA 4XHQA 1JJUA 3T0XA 2VQ1A 2CDFB 2QJDA 2H6PA 1ZLUK 5I30L 1HHKA 4N5ED 3UDWA 2QSTA 3D3VE 2BC4B 4OLXL 1FHGA 4QYOB 1BFOB 3VFWB 4OIIL 1PKQB 3FO0H 3T4YA 1FNGB 3WSQL 2FEEL 3QXUA 1CFSB 2O93L 2BVPA 1A7OH 1HQ4B 4NO2B 1RK0B 1FZMB 5BV7H 3BPOB 1VGKB 1NQBA 1OHQA 2ESVD 4GXVL 4NN7C 2F53E 4P2RA 2VE6B 5C0JA 3UZEA 5F97E 1Q1JL 1QA9B 3KYMA 4NKOA 4ONGH 3D2UA 3S9DB 2NY3B 3GBML 3CJJA 3GB7B 3TM6A 3QH3B 3C8KB 2OTPA 2DLGA 3TC9A 1Q72L 6FABL 3PWPE 1ZLSL 2WM0A 2AK4E 3ZDZE 4CNIA 5K9QG 3VFGH 3E6FB 3CFCH 8FABA 3HN3A 1JBJA 4AL8H 4XPHL 3OAYK 4E42B 1T20B 2NY5H 3X12A 5GRWA 1IARB 3LHPL 1IL1B 3ULUE 4JEGB 2CJUH 1BZ9A 5EB9A 2CR3A 1H5BC 5A2FA 2IG2L 3C5SB 1I3GH 1EBPA 2OZ4L 1MNUH 5EN2A 3DUUA 1BX2B 4NQDE 3PABA 4I3RL 1GOFA 1MJUH 3VXRB 3QIWC 5EFIA 2R4SH 4PJ5D 1EUTA 5B3NA 5E2VH 2J12B 4YHZH 2CK0H 3MLTA 3S3SA 4YDKH 1F2QA 1XT5A 1ZSDB 3CC5B 5DHVA 2WBKA 1UB6A 4NRZA 3DGGB 3UBXB 3HZVB 3IDJB 2LV4A 2F19L 2HKFL 2ZUQC 4WDIA 5IJVB 3CDGA 1MHHB 1BHGA 4OM0H 1YEGL 4XI5D 3IVKB 3DARA 1AH1A 2P44B 5ALBL 5DS8A 1BEYH 2A74A 3QIUB 3VI4F 3N1FC 3GEWB 2FEDC 4Y4FD 4RGNB 4G9FA 2R56H 5EZOH 4ZFOA 2Q8BH 3W5MA 1ZS8A 1A9EB 5EPMA 3SE9H 25C8H 5FEBA 4LSTL 4Z7WE 3LKSA 4OF0A 5F93C 4JM2D 3TIEB 1L0XA 2H2SD 3O3EB 3AB0C 1ZHLB 4K94L 3TPUA 2PW1A 2YSSA 5HHMD 1KXQE 3P4OB 4Y5VC 4YE4H 2XQYG 1WT5C 3HC4L 1VACB 4PV8A 3X14B 1EEYB 1YPZE 1RK1B 3VFSB 4F7EA 2XICA 4MA1B 3S35X 3JV5A 2OL3A 3EOAA 4IRSB 3AUVA 2R2HB 1JV5A 3O11A 4NHUB 3FOLA 2BP3A 1NCDH 2EZ0D 5L8JB 2Z9TA 3QUXB 2VDRH 4MQ7B 1NFKA 1IGCH 5JPMB 4PUBH 2LU4A 3A67H 4QLRA 1KC5L 4X99B 3B6SB 2HMID 1EAJA 4TSCH 1IEAA 1ZVSB 3IFLH 3P4NA 4I3SH 1Y0LA 4OF5A 4L9DA 5FYLH 5C0AD 4GFTB 1XFPA 4F7TB 1JN6B 3BP7A 5F3HB 5DJXB 1RIVL 3EUUA 1JTPA 1XF3B 4U1GB 3L5JA 2WMPA 4PJXF 4NQCD 1UYWH 1LO0L 4OZHB 2AERT 3RY6C 3D85D 4HT1H 2NY4D 3DRQB 4NM4H 5MEPB 3OL2A 4EI5D 3PP3K 4K71C 5H94A 2NXZD 5BJTA 1FNHA 2VXVH 5GRZA 4UOW0 3WJLC 5I1AA 4WJ5B 4FTVE 3T0EA 4QOKD 2BOBA 4NP4L 5FDWB 3OKYA 1EHAA 3KJ4C 3IDYB 3CUPB 2XZAL 3NFSH 1NBYA 3FO2B 2P45B 4CJ0A 4NO0A 3GMOB 2E3VA 4XNYL 3GRWH 4ODHL 15C8L 1P4IH 1QVOA 1FZOB 4QTIH 3H2WA 4BSJA 2RCSL 4QRQA 4X5LA 4QXTA 4Z7QF 2EE6A 1Q9KB 2SEBB 1KGCE 2X7LB 3KNBA 5SX4I 1CE6B 2H41A 3JWNC 5E8DL 2BSSA 1K2DA 2OQJB 3T1FA 1YECL 2Y6SC 3PQYB 1WAAF 3GHEL 1FL3A 2VZUA 4OZIF 3AREB 1NLBL 5C6TH 4KK8C 2XQYK 1TZHA 5CSZB 1NBZA 2A1WL 2OP4H 1HSBA 4LVHC 1HZHH 4L8DB 1KCRH 3SGJA 1CIDA 4WI8A 1FBIL 2ZKHL 4ZNEA 1VERA 1KCSH 2IBBA 1U8LA 1MCOH 1XF5A 5SX4H 4HWBH 2R2BA 2X4SA 5FM5O 3ARXA 4G7YH 2DQDL 4L4VA 4YHML 4QRPE 4KJPC 4G80A 3G6JF 4HUVB 3OJVC 4APQD 4LP4A 4X9GA 2JJWA 4JO3H 2IGFL 5CHNA 4ODUB 4ALAH 5GSVA 1OTTD 3OKKB 3QNZA 4KPHL 4L8SC 4RWYH 1FE8H 1NFDF 1A0QH 2VDQL 4OZFA 5DJAB 3WN5B 5HHOB 4GAJH 3UZVB 4CRPA 4KI5F 3G04B 1B2WH 2EH7H 2Z92B 4Y19B 1R3KA 3DYOA 4PJ7E 4P9HL 3HRZA 1LO5A 2C4XA 3IFPA 1IM9A 4YPGA 1TNNA 4P9HC 5AZEL 2K3TA 3Q0HA 4IOFD 4M6NH 4S1QH 4DQOH 4HS8H 1KJ2A 2OK0L 4FP8L 1DBKL 2AJ3A 4N1HB 4P2OB 3PWUB 4HDIA 2NY0B 3WFCH 3DETC 3HI1B 1MJ8L 4YC2C 3L9RA 3RPIB 4NT6A 2WIMA 3HR5B 5JQ6L 2COQA 3FB7B 4KKBC 3U4AA 3VFNA 4S2SB 5HGHB 4PRHD 4F15B 2VLRA 5D5MA 1FL6B 1RZ7L 1ZT1B 5ID1A 4Y5XA 4L4TA 3FQTB 1CT8A 1K6QH 1RZGA 3V7AE 4HWEL 3GSXA 4M1GL 2EDFA 1I85A 4HCRA 4NQSA 2IPKA 4Q2ZA 4P4KD 2IFFL 4OB5L 5GGQH 4I2XB 3FOMB 1PLGH 4IJ3C 2JTDA 3NA4A 4I9WE 1R0AL 4QKXB 4HKJB 3X3GL 3W0WA 1WWCA 3DVFA 1EXUB 2XXCB 3SDCA 3L95B 3WUWB 3W11D 1I1AC 3QDGB 4ORGB 2EDRA 4KKCD 1XIWB 2P7TA 2AABL 3DIFA 5JR1L 2P48B 4MA8L 4U1HB 3VXME 2EXWC 3MNWB 1MFEL 4LPTA 3QCTH 4LAQH 1P1ZB 1BQHB 1EHLH 4Y4KA 3T65A 3QZWA 3RWHA 5MHSE 1A4JB 3C09C 2WV3A 4HFUH 5CGYD 5FYJL 2B1AH 3BT2H 4K3EL 1QFUL 3MRPB 4YR6B 3I75A 5JZ7D 3VWJD 5KSAB 1U58A 4GS7C 1BM3L 2VL5B 4X8JA 3ZE1F 4KH2A 3MV9E 4JO1H 2ADGA 4NWUH 5K9OB 5JO5B 2ZOLA 4ZDHA 2YC1B 4OCSL 1IVLA 3P77B 2EDHA 1OLLA 5EORH 1M7IB 1WC7B 2C3GA 2I9TB 3PUCA 3JTSA 4HUMB 1OT1A 1D9KC 4P5KB 1JZ4A 5EOTB 1E28A 3O6MH 3V95A 5IVNA 2F8VA 3V5DA 4HJ0C 5HHXL 2QSVA 4N0CD 2AJXL 3DBXB 1EA9C 3I85A 4E41D 1KIQA 1U95B 2NYYD 5HD8D 3DV6B 2PXYB 4ZNCD 3SDAC 3WL9A 4AIOA 3C6LC 3MNVA 2EEDA 1UJ3C 4JQXA 5KZCD 4WO4D 4NCC1 3LKQA 3LQZB 1FRGH 4FG6C 2UWEB 2UZIH 3U79A 3MOBH 4I5BA 1JPFA 2UVFA 1KJVA 4RWHA 3QCVL 1S9YB 1U2CA 1S8DA 2N7AA 2Y7QA 3V6OA 5C86A 4KGLA 1RIHH 2GFBA 3EFDH 4DKEL 3R8BB 3ZTNH 5CS7A 1CFVL 2OCFD 1QO3A 1NCBL 3MGTA 4PJIB 3BDYL 3JTTA 4EN3D 3BESR 4OGAD 4DVBA 5DQDH 5D8JH 3RY4A 4J6RH 1JI1A 12E8H 3VXSE 4LCWA 1AD9A 1NGZA 5L9DH 4ZTPL 4ODSH 4RA0C 3MQIA 1MRCH 5CJOH 5EO1A 1F6AA 3RTQA 3EZJB 1UACL 3ARDA 3A6CL 4HS6A 5LAXA 1X4YA 3LV3A 3SBWC 4OIBA 4N8PA 4TNVF 5DRXA 1K4CB 3BXNB 3GMPA 4U1MA 4M1DH 3ARZA 2MKWA 3TVMA 2EC9U 4LVOB 1UQSA 1WTGT 4K3HA 4HIIB 4PY8I 5D7IB 3LMJL 4CN1A 3VFTB 3S34L 1FC2D 3SE3C 1TVHA 4GSDH 3SGKC 3TH4T 1T04B 1AY1H 1X5KA 3QXAA 3RZCA 1CBVL 1IGFH 3G5YB 4MNGE 1AGCA 5CP3A 4HMDA 2MJWA 1D5BA 1I8IB 4ZSOA 3AS1A 4Z0XB 3VGDA 1XGUA 3G6AA 5GGSA 3LEVL 2ICWJ 4PGBA 4MJID 3AM8C 4F7MA 1XCQB 2A6IB 4W4NA 1GC1C 3QDJA 3HMWL 1L7TL 2DI7A 3KLAA 3FONA 4ZOCA 5T3XL 2JELH 3PL6A 1G9MC 3GZKA 4IOSD 4JR9L 2RR3A 5ERWB 4JRXE 2HLFD 2E27L 4JRYE 4OT1H 4PJAB 5LJYH 3REWB 5E8NA 5FK9B 2X40A 1CFTB 1SYSB 3GBNH 5DURB 4G7VL 2UZYB 1KOAA 1MCDA 3BKJH 4QTHA 4U1JB 3T1WA 5SX5H 5MEOA 3G5VB 3NFNB 4ZUSB 4P3DB 4JREB 4XMPL 5GIRB 1J0YA 3DVGB 5TF1H 3I9GH 3BIKB 4X6CB 3MRKB 1Q9OA 3VXTA 1WBZA 3RUGA 2X2YA 2R69H 4LEOA 3H3KA 5FYJE 1MCCA 3OSKA 3HNTL 4K23H 3RGVB 3KPSA 2WINA 3MCKB 4TQEL 4Z7VB 4GMSL 1U3JA 3WDHA 1FFPB 2YZ8A 4PJ9A 3LKNA 1K4DB 4U6XB 3ESUF 2R23B 5C08B 4NZDA 4IRJA 5JXEC 1EAPB 3CXDH 4KHXL 4TNWK 1BWWA 2JB6A 5SWZE 1YEEL 2J88H 3VG9B 2Q1EA 4MA7L 1SM3H 2WBJC 1BVKA 4RBPH 1QACA 4M7JH 1L7IL 2HFEA 3DURB 4HIEA 3EYVB 3BIAX 5MENB 2ADFH 1JCKA 3MYJA 4PJEE 1RJLB 2PO6A 2HN7A 3MJ9L 4EBQH 4J2XA 1R24B 4LKCA 4KK9D 3L6FA 3QPQD 4I18A 2XN9D 5I8EA 2EKSB 4PJDF 3S3PA 5JW4M 1M6OA 5EWIL 2HJLA 2H6PB 3EO0A 4BK5A 3FRPA 5FYLD 2EC8A 2DQUH 4PG2A 1ZTXH 3MV01 2GSGB 3M1BA 1AHWC 1O0VA 2MHAA 5E9DD 4WY7L 1N0XH 4PLOB 3T4YB 1JIBA 3SDXF 1RUML 2BVPB 1GGCH 3BSZH 2IMNA 3BAEL 3UYRL 4L29A 4G6KL 3IU3A 1VCAA 4ENED 4TULL 4P2RB 1FGNL 3HUJE 3KYMB 1C5CL 4NKOB 4LQ1A 3D2UB 4CMHC 4K7PH 4KZDL 4GAGL 4X0KB 4XPBH 1JTOA 4CNIB 4QO1A 3TWCH 3ZYJA 2VDPH 4IRZL 5C0GA 4WIQA 1X5XA 8FABB 3VFRA 2IH3A 1VEPA 4WW2F 2W1NA 1KG0A 1OPGH 4MHHI 3X12B 5CKAA 4QRSA 4PS4L 2W9EL 3N85L 1Q94A 5DFVD 4NUJA 1CXFA 2NTSP 4WEBL 4WHDA 3S36H 2F74A 1EFXB 1JWSB 3O2WL 2EXYC 1T2QH 3DUUB 1IC5L 4HS3B 2NY3D 4LPWA 3PABB 4C56E 4CVWA 4LNRA 2BHUA 5DD3H 1CG9A 3HB3C 5EFIB 4CAGA 5D1ZC 3S35L 3BN9D 3OKLA 3MLTB 4AENA 1QSFE 3BX7C 2GI7A 1ZOXA 2J3SA 3ARQA 3RHWK 1UB6B 4NRZB 5HYJE 1NGQL 2BNUA 1I9JH 3QEQA 4YBHA 5T3XE 1JFQH 5LCVL 3VRIA 2NY2C 2W0FA 4WDIB 3X11A 1Q0YH 3CDGB 2A0LC 1G6VK 2D9QB 3UO1L 1CS6A 3OB0K 3MRRA 5INDA 5EU6E 5I73B 2A74B 2UZXB 4NKIH 4AEFA 4G9FB 4OCYL 4ZFOB 4JDTL 1ZS8B 4YHIA 3LKSB 3VE0A 1KYOK 2FECI 4OD1L 1FFNA 3VXRD 4XBPB 1EZVY 5IEHB 4N8CH 1QD0A 3TPUB 2PW1B 3GI9H 4O4YL 4XP5L 4PV8B 3SPVA 3RL1A 1QLFA 4F7EB 3V7AG 1F02I 4HJJH 2FL5A 3VRJA 2OL3B 1HYSC 1WTLA 4Y0GA 3EOAB 1I3RA 5E2WL 3MLZL 1UEMA 4B7LA 3LZFL 3HC3H 4XB8A 1WWWX 2HFGH 3QIUD 1CWVA 1FNSH 3FOLB 4RGND 3ZZ1A 3AAZA 1IAIM 1F13A 5I1EH 3FT4A 4FRWA 5D71L 4RCAA 4OCRH 3WO3B 2R0LL 2APXA 2IPUG 5DD0H 4FXKA 1OGAA 1VENA 2BOCA 1G7MA 3LSOB 4EDWL 4PGDA 3U7AA 1FIEA 3ES6A 1MUJA 3M8OH 1CK0H 3VXNA 1IEAB 3MCLL 3NIFE 1BF2A 1JRHH 5A40E 5D72H 3P4NB 1Y0LB 3MA9H 3HAEH 4IRSD 3BP7B 4LLMA 3RWEA 3RDTB 3D3VA 3VA2C 1FL5A 2LTQB 4EOWH 4MLSA 4JFDE 4G9DA 3S8WA 1UM4H 4MXVF 2B0SL 3QUXD 1WWBX 1TJIH 3TBVA 2FIKB 5JUEL 5TF0A 1LP9E 1I7TA 5GJTH 1RURL 5CZXC 3KJ6L 3P73A 4HXBH 1A7PH 3CFBB 5I1AB 1FN4A 1J0JA 1L4IA 1K3ZA 2F53A 4Z8FL 3MGOA 3VDAA 2BOBB 3RIAF 2LAGB 3NZHL 2E6QA 1RAMA 2P24A 3PWPA 5LQBH 4L3EE 2AK4A 3I50H 4JFEE 1WICA 1XR8A 4N0FA 2CXKA 3GSOA 1R3JA 1QVOB 4HWZA 3MLUH 1M4KA 5I8KL 3QUMA 3IJHA 1D5ZB 2E6PA 4QRQB 5J12B 4QXTB 4G5ZL 4F57H 3KNBB 1UC6A 4HPYL 3EO1A 3QUZA 3IF1A 3WNOA 3WFBL 4PJHE 2BSSB 1K2DB 2IQ9H 1IKNC 1TJHH 3UC0H 1LO2H 4IMKC 4NQDA 4WFEE 3LN5A 3T1FB 4YJZL 1VA9A 1T03L 2DKMA 1FL3B 3LAFA 3NIDE 4ZO7A 3BMWA 5HGGS 4JQVC 5K9JL 1BJ8A 4UDTA 5B8CA 2JJTC 1TZHB 3QIBC 1NBZB 1UH3A 1MCEA 1HSBB 4G8FA 3CDYA 3FZUC 4XX1E 1O5DT 5J3HC 3PWJA 3HHRB 2DQFA 5I74B 4LSQH 3U7YL 1U8LB 1RJZA 4KK5C 2R2BB 5CZKA 5A3IC 1U8MA 3IDXH 3N1PC 4G80B 3LB6C 3DSFH 2Z31C 3V4UL 3HG1D 2A2QT 5CUSL 1T1WA 3V4VH 2VNCA 3PQYD 2IPUK 3MLSH 4Z7WA 5CHNB 3J7HA 2J4WL 4JLRA 3ARED 5D96C 3QNZB 2VC2H 5C0IA 4NHCL 2ZSVA 4OZFB 5ACMA 5M94B 1RIUL 1PVHA 5DHVH 1IAMA 2YUWA 2OMBA 4N90D 4RIRB 1RHFA 4XVJH 4GBXC 1R3KB 1YPZA 4YDIH 2OR9L 3X3FH 3HRZB 1WBXA 3F7PC 4P2QD 1LO5B 5BS0E 4MXWH 3IFPB 1IM9B 4YPGB 5DFWH 3V6BR 4HC1L 1DFBH 4PJGE 2APWA 3WDJA 1FZKA 4PLJC 4RFNC 1KJ2B 4XWOC 1B6DA 1NCTA 4LOUD 4NBZB 2XIDA 2AJ3B 5GJSH 1UFUA 4KTEH 1J18A 4OJFL 3TBYA 4HDIB 3H42H 4I0PA 3F8UB 2Y1VA 1MLCA 5HHOD 2HJFB 4K8RH 2NPLX 3RGHA 4L9LC 5B4MC 4NT6B 4M48L 1EJOL 4I77L 3VFNB 1PG7X 3ZKQD 2R1WB 2VLRB 3ZDXF 5D5MB 2OL3H 5ID1B 2QQNL 4L4TB 4Y5XB 2ED8A 1CZ8H 1CT8B 1RZGB 1DEDA 4ISVA 4U1LA 1EMTH 5GRJH 1AFVH 1GXEA 2GSIA 2IPKB 2R0KL 4Q2ZB 1DQML 1DBAH 2IPTH 5DD5L 1D5IH 1NC4B 4PR5A 5HBBA 3QQ4A 3W0WB 5F89A 4DGIL 5BXFA 4P2OD 1R6VA 2AJYH 1K8IB 2QKIA 2WQ8A 2H2PD 3SDCB 2NY0D 4JZNA 1KACB 2FBJL 5AYUH 2YBRA 4GW1A 3GM0A 3E8UL 4OUOA 4MA3A 5JW4R 2OJZH 4FTVA 2P7TB 1A14L 3BIBX 3DIFB 1DANU 5CSGA 4NC2B 3BKCL 4D9LL 1YEFH 5T1KA 4HMEA 4LCCC 3U82B 3FTGA 5I75B 3U9PL 1S78D 3DGCR 3OR7A 3QZWB 5EOCL 3RWHB 3T65B 3QBTB 3UJJH 5HVGB 3LEYL 5IIEA 3O9WC 4K3JH 2B5IB 1PG7W 1AE6L 4YHYC 3CU1A 2EDYA 1IZJA 1GGUA 4OI8A 3CH8A 2J1KA 2EDOA 2KDGA 2V5TA 3PWLB 1P6FA 5EC1A 3I75B 1JWUA 1H5BA 1U58B 1XGYL 2XKNB 4X8JB 3VU2A 3QDGD 2ADGB 4ORZC 1HKFA 1IFHL 1UG9A 4HW6A 2ZOLB 2OI9B 1LO3H 4ZDHB 1ZGLP 1XIWD 2OZ4A 2N7BA 3HZMA 1MRDH 3JTSB 3L5XH 3MLXH 3QIWA 3QULA 4S1RH 3VDBA 4UT6L 4LLUA 1PDKA 4L5FH 1MEXL 1E28B 5E8PA 4HWUA 2Y06H 3V5DB 2E5EA 3BGFB 1I8LC 3UTPD 3P4LA 4ERSH 2FD6H 2G9HA 1KIQB 1BP3B 5GQBA 3WKNA 3UP1A 3WFHA 1X7QA 5EUOE 3WL9B 1NCUA 2VSDA 3HI6H 5IW1B 5KSAD 3LQMA 2YPVL 4KFZC 5IVXF 3LKQB 5DLML 1SYVA 5CCKH 4QRPA 1R3LB 5FYKE 3SO3B 4XNQB 1JPFB 4L8CA 5KN5A 5DC4B 4M4PA 1A47A 1KJVB 2AV7B 3GGWA 4XBGA 5F7LB 2E7BA 2HAZA 5F8RC 3CXHK 5HHPA 2GKIA 1CI5A 1S8DB 3KPMA 4Y5VA 1ZLUH 2GFBB 1WT5A 2NXYB 5DF0A 5CJ8A 1MLBA 2NMSA 3L5WA 5FKAB 3MGTB 5DUPL 1FLTX 3JTTB 2PXYD 1F4HA 5KS9F 4WFFD 1O7VA 4DVBB 4PJ7A 2YD6A 4LCWB 1AD9B 5DZNA 2I60H 2L7UA 3RVTC 3ARFB 3I6GA 5E6IC 5EO1B 1F6AB 3RTQB 3OKDA 3ARDB 1L0QA 3I2CH 4HS6B 3GKWL 5LAXB 3AS3A 3LV3B 1JWMB 5DRXB 3VW3H 2GUOA 2QR0B 4OZFH 4HMCA 3GMPB 2YD9A 4IM8A 4OFYD 1DUZA 3TVMB 3R06A 1F8TH 1UQSB 3N1QC 1SVCP 1IGMH 1YEIH 4O02H 1TVHB 1AI1H 1AXTL 1CR9L 2LFGA 2FX7L 3RZCB 3QXAB 1AGCB 1OGTA 1FNAA 1TTFA 3OAYH 2YWYA 1PY4A 1D5BB 4ZSOB 1K85A 4MB3A 1XGUB 4O9HL 3G6AB 3JV6A 5GGSB 4GQ9L 4PGBB 2AI0L 3MBXL 1KJ2H 4F7MB 3RY6A 2V9RA 3LIZH 4HG4J 4KQ4L 3QDJB 1CL7I 5EOQL 4RMRA 4MWFA 2ADJA 4NKDB 1NL0L 3KLAB 3FONB 3LDBB 3Q3GA 3WD5H 3ISWA 4PJCF