4YQXH

Mouse il-2 bound to jes6-1 scfv fragment
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
EIQLQQSGPELRRPGSSVKLSCKASGYNITDYLIHWVRHRPEHGLEWIGWIDPEDGETRYAQKFQSKATLTADTSSNAAYMQLSSLTPEDTATYFCARSLDSTYIYPFAYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JES6-1 VH domain
publication title Antibodies to Interleukin-2 Elicit Selective T Cell Subset Potentiation through Distinct Conformational Mechanisms.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cytokine/immune system
total genus 26
structure length 121
sequence length 121
chains with identical sequence N
ec nomenclature
pdb deposition date 2015-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yqxH00
3EOTH 2LE9A 1Q0YL 2NZIA 3DECA 4HULB 3A6BH 3EW3B 4UTAL 3O3BB 1IC5H 3RAJL 1A6AA 1BX2A 1S7XB 2R56H 5IJVB 2BOBA 5C0GB 2N1KA 1AD9A 4WW1B 1YY9C 5CD3A 2ZKHH 4NZRL 5KZCD 1UVQB 1IFHH 2F53D 3SOBL 5IJKA 5JXEA 2AJZA 5BV7L 1TVBA 1Y6MR 4U6XA 5B38B 5EORL 4DGYH 3S5LA 1W0VA 1F8TH 1T83A 4CVXA 4RAVA 1KPUB 3TVMA 4FQXB 5CUSL 3F6LA 3PP4H 2OMBA 5KSAB 5IVNA 1AQKL 4HT1H 4Y1AB 4PFEA 4JFXA 5KSBF 1U0QA 4D9QE 4M7KH 1U91B 2PO6A 3RX5A 2YSSB 5H94A 2DLGA 4QTHB 1R5VA 1YYML 1AXSA 1OTSC 4K7PY 4XMKL 2K9UA 1BQLH 2AJUL 1QSED 3CNKA 3GSRA 2IFFH 5I9QC 4GW5A 1A6ZB 3TYFB 1ADQH 4NHUB 1F2XK 3MGOA 4G9FD 4M1GH 4YHYC 4P0DA 1FORH 3TFKD 1KYOK 4G5ZH 3VFOB 2EDWA 1K2DA 4NKDA 1FHGA 1YNLL 1BM3H 2R4SL 4F7EB 5F7MC 2NW3B 3WN5C 4GW4A 1EEQA 5IF0B 4IRSB 4E0RA 1M7DB 2O61A 4DEPB 3WIHA 4QXTB 1FBIH 5BRZB 1N6QH 2BFVL 4JRXA 1LEIB 2EDKA 5IJKC 1T0MB 1QHPA 5JXEC 3LRSA 5J1TC 1RUQL 4PJEE 2NY2D 2YWZA 3FRPG 1D7FA 3EO1A 3N50A 3T65B 1FZMB 3V0VA 1EA9C 1NCCH 1YMME 4KKAD 3E0GA 4S1SH 4Y2DA 4QOKB 1VHPA 2YRPA 3LKOB 3RGVB 4LF3A 4IEFB 2B39A 1QOKA 3V5HA 3QUZD 1EHAA 1S5HB 1RVFH 3MGTB 1ZLUK 3QDMA 3NN8A 1MPAL 4WO4A 1FFNB 2CR6A 5EO9A 1VFAA 4M8QB 2PYED 3PWPD 3ABZA 3V0WH 3CSYA 5DQ9B 4XHQA 3UTPE 2BHZA 3LKRA 3V6OE 3CH8A 3TFKC 4QYOA 2BNQA 4YGAB 5CEYB 1CGUA 3QXUA 1GIGH 4HIEA 5EU4B 4L4TB 4NWUL 1BREA 3SJVE 5EC1B 2Z92B 1T20B 2ED7A 5C9JB 4NYLA 4LARH 3GZKA 3UO1H 3UC0H 4NGHH 4NC1E 1FNHA 2ZNWA 1LEKA 1WFUA 4PY8I 4QRRD 1T1XA 2KKQA 2AQ3A 1ODAA 4TPRH 5TE4L 3DUUA 2N7BA 3GJEB 4M3JA 3O45B 1P7HL 3U4AA 5JPNB 1ZEAH 1RHFA 2VKWA 3P9LB 4BYHA 5AAMA 2XWBB 3QCVL 1CLYL 2AGJH 4QT5B 1JPFA 2VDRL 2YD6A 3FT4B 5HY9A 3V5DA 3QP3A 3IF1A 4N1CA 4P46B 1J0JA 5EZLA 1HSAB 4IRJD 5LCVL 5K9KB 3W0WB 4F7PA 4P23B 2OJZH 4YO0B 2DJ4A 3QUZC 5ESAB 4I0CC 2MKWA 2ADIB 3GHBH 1H8SA 3VFUB 1YJDL 2VLRA 4G80B 2FSEB 4JQIH 4WDIB 3FKUS 3SCMB 4HHAB 3GMMB 1RUMH 1L7TL 1P7QB 2B0SH 3BAEH 1JIBA 3SDAB 5C07B 1NCNA 3VWKA 3Q0HA 1FNEB 3D85A 4MZ2A 4HH9B 4MJ2A 4WO4C 4IHOB 3X14A 2DRUA 5TJWK 2OX5A 3OPZL 3HC4L 4FQHB 4UNTA 1MCWW 4N0YH 1R3HB 2F8VA 2IC2A 4OV6F 2YD3A 3HS0A 5ETUA 4DK6A 3HTLX 1D5ZA 4LSQL 3OF6A 4PJGA 1IAKB 4KV5F 2H3NA 3RPIA 5MENE 1T1ZB 2QSCL 1A1NA 3VRIA 2F5AH 5MHSD 1NDMB 3O8XD 4AQ1B 1F6AA 1S7VA 3O41A 2JB5L 5D1XB 4RMVA 1XGQA 4YEFA 2BXYA 1IKNC 3RZWA 2VZ1A 4PRHB 3S36X 1G6RH 4C55A 1JZ6A 2R8SH 4Y16A 1UENA 3TIDB 1IILE 5EIIB 1CE6B 5A2LH 3RL2B 3PXJA 4MLSA 3OJDA 1H0DB 4XNQB 3VE0A 3ARGD 4LGSB 4CUCA 4HIJB 1WIUA 1IBGH 1DSFL 2FGWL 2IAMA 5D7JD 2FX9L 4MS8D 1EO8L 2VSCA 3MRLB 4OIIL 3X11B 2EDJA 2XWJA 1N7ML 3I85A 5I16B 1KXTB 3LN4A 5L2KA 4ZTPH 2MQ3A 5DJDB 5F7FA 3MNZA 2OS7A 43C9B 1W72H 4Z9KB 5DUML 4CNIA 2ILLA 1T1WB 3GUTA 1LE5B 2GFBB 2HJKB 2PXYD 3S7GA 5L2JA 3BXNB 4KJYB 4F7MA 4X5XA 1TTUA 1MWAL 3W9DB 5BZDA 1CDIA 1NGPH 2VXVH 3BMVA 1OQXA 1NGZB 3VXME 1QBAA 3MXVH 4WTZA 4MNHB 3NCBB 4Y4FB 4DVBA 4L3CB 5GS0H 4ELKB 1UQSA 2F5BL 2VQUA 4H26B 2A0LC 1KYOJ 2YA0A 5GS1C 2YBRB 3MLVH 2WIIB 3VG0H 1I8MA 2EH7L 4K3JL 1Y0LA 5J89A 5EWIH 4NQDD 3DSNA 4EUPH 3MRIB 1BFVL 4J3SA 2LU4A 3VRJB 4DAGH 1PY4A 1G9NC 1ZHBB 2C1PB 5E00A 3R4DA 4UDUB 1BQHA 1AC0A 3U7YH 4MCZA 1QZ1A 4PGBA 3UTOA 1WBZA 4KK5C 3VFRB 3CFDA 2NR6D 4NFDA 4WFFD 1RK0A 3NABH 3HZVA 2VIRB 3Q2CA 3TJEL 4J3TA 3PWUA 2B7DT 4JKMA 4M4RA 4JZJC 4DJMA 3GEWB 2OR9L 3K0WA 4L1HA 4UZGA 3VU2A 5C0NC 3ARRA 3QIBA 4ZUTA 3VXUE 1JRHI 1KNOA 2CJUH 5FYLL 4R7DA 2ZUQC 3BHBB 4KVNH 4WGVB 5J06A 5C0RH 3VXSE 4X5WB 1YN7B 4UOW0 1XGYH 1R3JB 4MAYD 4K2UL 1X4ZA 3VH8B 1RIHL 3BRFA 2BVOA 5C3TA 4ZMAT 2VUYA 2GTZA 3O3BA 4JHWH 3JV4A 1W0WB 5L6YH 1V3LA 4X4YA 2X4OB 1Z9MA 5C0GA 4WW1A 1LE9A 2R39A 4ZAKD 1UH2A 2LQRA 5D9SB 1UVQA 1OAUH 3FQNA 4LSVL 4ODVL 5KVEL 2R2BB 2EIBA 4KXZI 1JHKH 3WJLC 5B38A 3TWCH 3UJJL 1JZ8A 1S7RA 1F42A 4LSSL 1WZKA 3BZ4A 3PF2A 3H7BB 2EICA 3LCYA 3MRJB 4K9EC 1AQDA 5CEZL 1P6AB 4UILL 4KKLC 3CLEL 1CN4A 1CD0A 1JZ7A 1CDCA 3MJ9H 4OM1H 5HHVL 4LEOB 2VLME 3JVGC 4KPHL 4GOSA 3WS6A 2G60L 2APWA 1NGYB 5HSFA 2QADB 4EXKA 5EU5B 5EZIL 4S0SD 1EX0A 1RD6A 4JFYB 4MAYC 3PL6B 3SO3B 2VDQL 1FJ1A 1P53A 3K1KC 1DE4A 5MEPB 1FYTD 3SKMB 4KZDH 5KAQG 2NXYB 1A6ZA 3WV0A 4G43B 2X4PB 5L9DL 5FF6A 5K9OB 5F6IB 3B83A 2H8PB 1U95B 2FH8A 3VXRE 2FRGP 1DBML 2CMRL 1S9WB 4JB9L 4TOYL 1LGVA 2CRIA 5FHBH 3ZDZE 2G75A 5C7XH 4ZDHB 3QXAB 5B8CB 2A73B 1AQKH 2NW3A 3BISA 1M7DA 2DYPD 3AMLA 3FZUD 4DCQB 2XZCL 3GJFH 3KPSA 4XXDA 2J8UA 3STBA 1LEIA 3RWIB 5HBBA 3LHPL 1EEUA 3I6GB 4HEME 5T5FH 2NMSA 3DI3B 4XMKH 1EPFA 3INUH 3T65A 1F6LL 1UM6L 4JZNB 4KY1H 2J1KA 5CJBA 5ADOL 3RGVA 5DD3L 1IGCH 2E27H 2EDFA 5JIIA 2E8YA 3H9SB 2DF3A 3SGDH 1E0OB 1NMAH 3MCLL 3RWJB 1LQSR 3WDIA 4R2GD 1FFNA 3AM8A 1MQ8A 4M8QA 4OJFL 1EFXB 4WHTA 3WS6C 5HPMA 2NY4B 5DQ9A 2Z8RA 3TO4D 2I07B 1D5MB 5CEYA 1JUFB 5EU4A 4RISH 4AEHL 4FQLL 5EC1A 2Z92A 3D39B 3DV6A 1T20A 5C9JA 2Q7YB 5JQ6L 1F58H 4C4KT 2EDNA 2D7NA 2VLKB 5EUKB 4HC1L 1Z2KA 3NIDE 1GZQA 3QQ9D 2F19L 1PX3A 2UZYB 3BIKB 2FATL 2JE8A 3DGCR 1ITCA 4UBDD 4Q6IB 3UTPD 1E6JH 2VAAB 2XWBA 3RQ3A 3V4UH 4G6JL 4QT5A 3MROB 1TCRB 3RY4A 3NA9L 3S3SA 2B5IC 3SJVD 3RWEB 5EFIB 4LHUB 4RBPK 4P46A 2DDQH 5C0AB 3U6RB 1N64H 1HSAA 1VPOL 2QTEA 2IQ9H 5ILTH 5ESAA 1U8HB 2LU3A 4PG9B 3EBAA 2AK1H 3D9AL 1F45A 3CFEB 1KC5H 4G80A 4R2GC 1QFUL 1A7QL 4WDIA 5JMRA 4HHAA 3T0XA 3UROR 1DVFA 3CVIH 3GMMA 4DFHA 3LS5L 1VDGA 5JXAL 2YUWA 3V6FB 1HYRC 4X80L 3ZKXC 2QQLH 4APQB 1P7QA 3EYQC 3RUGA 5HYFA 4PJIB 3SDAA 3SE9L 5C07A 1T6VN 1FNEA 4TQEH 4NQUA 5TE4H 2VC2H 1JGUH 3L95A 2WWKT 4XVTH 4FQHA 1GGUA 2DI8A 1R3HA 3OL2A 2VDRH 3QQ9C 1PG7H 5E4EB 1D5BB 1TETL 3MV9B 1BP3B 1NDMA 1YJDH 1OGAA 3ZYOA 4FXLA 4PRHA 1EBPA 1INDL 3QXDB 3V6BR 4LDEB 3TIDA 5K33A 1CE6A 3RL2A 4G6AD 4HCRH 5FKPB 1OTUC 1OSPL 4XNQA 1NPUA 1F90L 5B39G 2IANE 5FCUL 4HKJB 4FMFA 4HIJA 3WCYA 1HDMB 4ZTOL 4PRNA 3OMZA 3MRLA 3HC4H 5I16A 3ZLQC 3LH2H 2KZ1B 4OCWH 4YE4L 2D7QA 2YXFA 5GJSH 4LSQH 2CLVB 3MYZA 5H35B 3U30B 43C9A 5CHNA 1EJOH 4Y5VB 3FJTA 5CEXA 5C0FB 2VDNL 3V8OA 3BPNB 1T1WA 1LE5A 4OFKA 3F7RA 4TSBL 2GFBA 2HJKA 4Y88A 4K23L 3BXNA 3BRDA 3MRCA 5EH1A 1DVFC 4KJYA 2JB5H 3HPLB 5DO2D 3W9DA 3LEVL 1TLKA 1E27B 4JFQB 1UWXH 3OXSA 1T2JA 3W5MA 3BZDA 1KGCE 4HJ0D 2CKBB 4Y4FA 2F58H 5T3ZL 4L3CA 2VNCA 3DETD 2YK1H 4HXAL 3VCLA 1WICA 4CMHB 4OZIF 4HGMA 4QXUH 1TIUA 2YBRA 2WIIA 1AP2A 4IS6B 1FO0B 4HJJH 4X7SL 2FGWH 2UYLA 2C1PA 4UAOB 1EO8H 1A7OH 5MEOB 5EU7E 1N7MH 4Y5XC 4G6AC 5C0CE 3VFRA 4F15B 5DHYB 3VXMD 4KK9D 1ZGLB 5ANMA 3KPQA 4NN5C 4UUJB 1HXMB 4PS4L 5IFJB 3EYFB 1S5IH 3MLZL 4POZD 4XBEL 2X4TB 1RFDL 1I9EA 4XI5C 4KK8D 1MVUB 2AJ3A 2WP3O 3VRLF 3QFJB 3DOSA 2Y06L 3MQIA 4XHJD 3BHBA 3KPLB 2F5BH 2BCKB 1M71B 4A2LA 4ELMB 1YN7A 3WJJA 2XTJC 3QZWG 2X89A 1D5IL 4K3JH 3LPGA 4MNQB 1BFVH 3BUTA 4ENEC 4I9WE 4AL8H 5CMAA 1U3ZA 2VRAA 1H8OA 1PKQB 3L3OB 4NQCE 4N8CH 4MAUL 3IGAA 5DA4A 3QWQB 3TESA 1CG9B 4M03A 3OR7B 3FL7A 5I18L 2X4OA 3TJEH 4NQSB 3AGVA 3D18B 1QLEH 1J18A 2FNBA 3K1DA 2OR9H 1G9EA 1OM3L 1FYHB 4CL7A 2R2BA 1PLGL 3GSVB 1JK8A 5I1GL 4LBEA 4TUKL 2DWEB 2NTFB 3H0TB 2OMNA 2P8LB 2WBKA 1QFWH 2BHUA 2VXTL 5EU6A 4GBXB 5E6ID 1WAAA 4POZC 3GIVB 5I71C 1I1RA 3L9RB 2JIXA 4KK8C 4QKXB 5IVZA 1T5WB 4YHLL 3U7AA 2QJDA 5IW1A 3KLHD 1KULA 1X5ZA 4JO1L 4JREC 4LEOA 1RIHH 3VI3E 4DUWA 1D6EB 3HNSL 3CFKB 4GKNB 1NGYA 2RAMA 3TV3L 1MIEH 4CN1A 4HV8A 3BT2H 2XOTA 3UTTB 2WK2A 4P59H 4PJHE 4PR5B 1MFAH 4AYFA 4PYGA 5I19H 3B5GA 5IVXF 4G7YH 1AHWB 4Y4HB 4ZG1A 2Y9RT 3SKMA 4ODVH 2GIYA 3JWOH 3R0NA 4G43A 5K9OA 3CD4A 2HFEB 2A9ML 3K4ZA 4UT6L 4Z95L 5IBLD 4QCIA 4DZ8B 5EBMB 2FHBA 1ZLWH 4JRXE 2BSTB 1U36A 5CEZH 3HE6B 5GZNC 4ZDHA 5CGYC 1ES0A 1A6TB 5BS0A 2A73A 3MMEB 4KH2A 4FG6C 1R24A 4EUPG 3B5TA 4P4KD 2GTWB 3PQYA 4L8BB 4OLYL 5E6IC 5D2LA 3A6CL 4UU9B 2WANA 4KPHH 2HTKD 1E4JA 3SE8H 3DRTA 4XB7A 4MXVE 1PDKA 4FZEL 3RWIA 1QSVA 1QR4A 3I6GA 2F74A 4PPTA 3VXRD 3QDME 1QO3A 2VISB 4NNXB 1MLCB 1A7NL 4JFZH 1D9KA 3MZTA 4N90D 4JZNA 4M4PA 4XPFH 2YHGA 5AG8A 3EYUH 5IT2H 1C12A 5E2JA 2BVPB 4BKLA 1R3IL 4Q9RL 1AGFB 2BNQE 4KRPC 1I3GL 2R0WL 3H9SA 4L4VA 1UH4A 1KEGH 5I30L 5IFAL 3RWJA 1HH9B 3C9NB 4NZUH 5FDYA 1IL1B 3UYOD 1IAIH 4I0PD 5F7EL 3QUXB 3PDGA 4WI5A 3L3KB 4JGUA 3AREA 4GFTB 3DVGA 5HGDA 3V79C 4JFFB 5DJCA 4OZGF 2Z9TA 3WFEH 4FQIL 5IBLC 2X4NB 1I9JL 4RFNB 1JUFA 1L4IA 1X5GA 2XZCH 3GSNA 4GRWB 2Q7YA 5CWSA 3I2CH 2C4FU 4X7EC 1YEFH 4NQEB 1NMBL 1QLRB 5EUKA 1Y6NR 2HTKC 3QEGL 1KFAH 2NY6D 4ZPVB 5DRWB 3ET9F 3MREB 1ED3B 1GGTA 2VAAA 1Z9OA 1ZVYA 4XH2A 2VLRE 3X13B 5JOEA 4MMZC 3MROA 5F44A 1TCRA 3MCLH 3O2DA 4FFZL 4IRZH 1MHCA 3S35X 5EFIA 2IPUK 5I1HH 5C0AA 1MAML 1F00I 3U4BH 5DJXA 3U6RA 1CGXA 5DUBA 2LV4A 5IQ7L 3ISWA 3L1OL 3ARDB 1LILA 5HI3D 1U8HA 4PG9A 3CFEA 3OKKB 4I0PC 1J7VR 3RNKB 5LWYL 4WEBH 1F4YL 4HX1B 4APQA 1TDQA 1BWWA 1CICA 3FB6A 5AYUL 2R1XB 4PJGE 3LV3B 4MB3A 1JZ5A 4MNGB 3S5LG 2F19H 2AXFA 4JVWA 5ICZB 2UVEA 3MUZ1 2EH8H 2FATH 2G2RB 3DUHA 4I18B 4NRYB 4RIRA 2DOCA 3ELAT 4N9GA 4C83A 2ERJC 3AREC 3QBTB 4YUEL 4QGYA 1QA9B 2NY6C 2FHFA 3MODL 4PTTB 5AG9A 2VDMH 3NFNB 3WXWL 3MO1A 2N7AA 1VPOH 2BX5A 1NBZB 3WFDH 1C7TA 5DGQA 4DN4L 5FYJH 1YYLH 4DOHB 1K8DA 4GW1A 4FXKA 1MY7A 3P30L 1QFUH 3F5WB 1RZKL 3RHWF 2YPKB 4QWWD 1EHNA 5E8PB 3HMWH 4U1HB 1U8PB 3QXDA 5I1IL 3W39B 1VFUA 5L2KE 1QSZA 3CDGB 4OQTL 3KS0H 5FKPA 4HK3N 1DFBL 2M8XA 4U0RC 3BDYL 3SDDD 4HS8L 3HLAB 5ISZB 3IDNB 1QBMH 1HDMA 3MLPA 1S9VA 2OL3L 5GPRA 4M6AA 2ICWJ 1NLBL 4LPWA 5FO9B 1HNGA 1FZOB 2JB6B 5GS0D 2CGRH 1XZ0B 1X5HA 2YC1A 2ZZUT 5SWQB 3CMOL 5H35A 3EO9L 3T77B 1BJ1H 2BVEA 4Y5VA 4OZFA 5ESQA 3MZGB 4EDWH 3ZDYE 5HHQB 3HI6H 3HPLA 2W60B 4HUMB 5IK3A 1E27A 2WWKO 3H6JA 4JFQA 5CJXC 5F1IA 3DMMD 3O81A 4JFDB 5D7SL 5JLZB 1NEZB 4RQQB 2A38A 3KPNB 4E41B 4PGJA 5SWZD 2CKBA 2VH5L 1SEQL 2I5YL 4H8WC 3T3MF 4LIQH 1OSPH 4ZXBB 2QL1A 5GS2H 1FO0A 4H1LB 2VL5A 1KN4L 2D0GA 4H0IA 4KWUA 43CAB 3G5VB 1FRGH 3WBDA 3BP4B 4HIIA 2BY3A 5MEOA 4ZS6D 1J1XH 3TH3T 2YEZA 5DHYA 1AR1C 1Q0XL 1ZGLA 3K74B 1BIHA 4EVNB 5DRXB 3RWGB 1HXMA 5IFJA 1T89C 4TSBH 1N2RB 4XVJL 2X4TA 4WGWB 5GS0C 1EUUA 4EIGB 3PWJB 5FB8B 1MVUA 4JM2D 1XMWA 5LJYH 2Z4QB 3QFJA 1AGDA 1OL0A 3JUYA 4U1MB 1DLFH 3WNPA 3BKCL 3KPLA 3ARZA 2GY5A 5H2BA 2BCKA 4HXAH 1M71A 1ZS8B 1F02I 4L8DB 3WO4B 4ELMA 4IIQA 5D7KD 4GKSB 3M45A 4XC1H 1DP0A 5CFHA 2AABL 2GSGA 1RZIA 2XQBL 1OB1B 4PJCA 4Z77B 4LCWB 1T03L 1JPGA 3MRMA 2R69L 1SMAA 1J1PH 3EJZD 3L3OA 2HH0L 1DUZB 3F8UB 1CG9A 4XNZC 1OLZA 5B21A 3WNLA 3OR7A 1ZLWK 2UWEF 1FVEB 4NQSA 2A74A 4K3DH 5F9JB 3T2NL 1GAFH 4PS4H 3THML 1N4XH 5DHVB 3D18A 3MLZH 1A7BA 4MWFA 4K55A 3EDKA 3GSVA 4WJ5B 1U8MB 3VA2C 4LDOB 3H0TA 4XPHH 4I9WD 2Y06H 5EU3B 1DN2A 1IQDB 1UC6A 5TDPB 3RX7A 4NQCD 2DLIA 1J10A 1RUAH 4Z7VF 4JM2C 1GRWA 4FFYH 4DGVL 5C6TL 4ZNCD 1JYWA 4AG4L 2A6IA 3EOBA 4PY7B 4P57B 4X8JA 3ZSTA 2NY0D 1CR9H 1D6EA 5M7QA 3IT8D 1B4JH 4ZS7H 3ULUH 4OBSA 4QHKI 2FYYB 5I18H 4DWHA 3PWVB 4P5TA 2OTPA 3QA3B 1AHWA 4Y2OA 4PREA 1H9VA 4Y4HA 2ICWA 3EJZC 5EBWB 4PJBF 1OM3H 3NACH 3QEQD 4QRUB 5I1KL 3KPRA 4TUKH 5T1KA 3U9PL 4HFWA 2HFEA 5F1NA 1NLDL 5TQ0L 4IIQC 1JRHL 1B88A 3QWRA 1KIQB 5EBMA 4WV1C 4GKZB 4OGYL 2BSTA 3KPSE 2J8UE 3V4PL 1Q9OB 3ZTNH 2GI7A 4G9DA 4WI9A 1A6TA 2NTSP 4XBPA 2VDKL 4QEGA 4PGCA 5KS9B 2ZOLB 4L8BA 2E3VA 2YZ1A 3HRZB 1GOFA 3QEUB 5EO0B 3KYNB 1FAIH 2RBLA 2X4SB 4WW2B 1QP1A 4YDIH 3OQ3B 3WE6B 2E7LA 4JGJA 4M6NL 3GM0A 1ZT1A 4WFHE 4JPVL 4EN3B 1IT9L 4MGXA 3STLB 1BVKB 2GITB 3U0PA 5INDB 2VABA 4TNVF 3TLRA 1MLCA 2NY0C 4JRXD 4WTZG 3N85L 2OQJB 1F3DJ 2BNRB 1S9KC 1YECH 3BQUC 1I8LA 2BVPA 5AAWA 2XPGA 1AGFA 1TQCC 4MA8L 4Z95H 5DWUL 4JKPH 1LO2L 3QUXA 4OLUL 2J3SA 1U2CA 1BQHG 4F9LA 4JFFA 4N5UA 3RDTB 3PDOB 2D4DA 3HUJB 2HN7A 1IGJA 3AB0B 3HE7C 3RWDB 3GSQB 5GGUB 1U9KA 4I3SH 2VN7A 4FZEH 3MBXL 4IDJH 1C5CL 1UCBH 5D5MF 4HS6B 2J7LA 5GXBB 4NQEA 5BVJA 1Z3GH 2VQ1B 4XNUL 3D48R 1QLRA 1A7NH 4YFLI 3PGDB 1K8IB 5FGRA 5GHWH 1U8KB 1IKFL 1S7SA 4ZPVA 5E8NB 3T8XB 1IEAA 1AGEB 1MRCL 3I6KB 2PR4H 3EYOA 3X13A 2QSQA 2X42A 1MVFA 1CFTA 3P4OB 2PKDA 1IGFH 2ENYA 1MUJB 4WCYH 5FYJE 4RMUA 4OCNC 2IALB 2DJUA 1QG3A 2XKSA 4X4ME 3ZKMC 2HJLB 3RUGE 1DQMH 5C07E 2W9EH 1EGJA 3OAUH 4GS7C 1TNNA 3HC3H 4ZO7A 4LVNC 1NGQL 3D3VB 3O9WB 4MJ5A 1C5BL 1RULH 3MACL 3BN9D 3OKKA 3BWUC 1A6VL 4PJ9B 1G0XA 3VI4E 1XH3A 4HIXL 1G7HA 4HX1A 2EDHA 2R23A 2XWTB 4JDVB 1CF8L 4NOFA 2PTTA 2VLRD 1FLTX 3MBED 5J11C 3E2HB 1MIML 1SJEB 4X4XB 4YBQD 3LV3A 4M61B 3BRGC 1LK2B 5J7CC 3DO7B 4ONFH 1V7MH 3DBXA 1MFEL 4X9BA 5CBEB 4NRYA 2P5EB 5I1CH 4P2OA 3IDIB 1OGAE 1FFRA 3D85D 1MCRA 2DIJA 3FO0L 4PRHE 1AJ7L 4KC3B 1RZ8B 2R2EB 5IOPA 1QA9A 1T6WA 1REIA 1AH1A 3VXTB 4N8VB 1U8OA 4Z7NF 2V9TA 5IQ7H 1KJ3H 5DGRA 3IDJA 1KELL 2YPKA 3GMOB 4LIQE 4U1HA 1U8PA 3W39A 3QR2A 4JZOB 2W0PA 4M02A 3C09B 1RV6X 3CDGA 3P11L 5EUOB 1S3KL 1MJ8L 1XF1A 2F54A 5SWSB 1QQDB 2HFTA 4YHIA 5ISZA 3BN9C 1Z6JT 5E8DH 3PABB 2GK0B 3RA7H 1KCRH 2H2PC 5FO9A 2DN7A 4OTXL 3MBEC 2APXA 5GRWA 1XZ0A 5SWQA 2Q76A 4KJPC 5F9WB 2VDLL 3O6FD 4J1UB 1YJDC 3MODH 4X6DF 3LQZB 1YDPB 2H32A 3PJSB 3WXWH 1WUNT 25C8H 5HHQA 2ZCKL 1OWRM 1MWAA 5TPWL 3U0TB 2ATKA 2W60A 5DJ0B 1R0AL 3P30H 1V3JA 1U3HA 3MLUL 4JFDA 5JLZA 3KPNA 5T3XE 4BZYA 4F8TA 2DBLH 1WWBX 5E8EA 2B2XH 1NC4A 3BDYH 5ANME 4P2OC 4XMPL 5CIPB 3EOAB 3VFSB 4L9LC 43CAA 1X44A 2VE6A 3ARFB 3G5VA 3IVKB 3BP4A 4OKDA 4OM0L 1NLBH 4NOBA 3UPAA 3TJHD 4HS3A 1KXQE 3DX6A 4KROB 3EO9H 2P8MB 1EFQA 5L0QC 3V2AR 1HSBB 3IFNL 2AW2A 4LVHC 5DRXA 4YWGL 1U41A 2ZCHL 3A67L 1N2RA 1JE6A 2IBZX 4RFEB 2NY7H 4FMKA 4XPGH 3U1SH 1T0NA 5FB8A 4PJXB 5ERWA 3O6FC 1GGYA 5DD0H 3EYSH 4L3EB 2Z4QA 5D7SH 2WUBL 2MKLC 5TDOB 3E1F1 2DQJL 5HYEA 3IKKA 1Y18A 3EGSB 4U1MA 4X99B 1NFKA 3SBWC 4FFVD 4DGIL 1ZS8A 3GRWH 4ZUUA 1KCLA 4KHTL 3SDCD 2JCCF 4OGAD 4GKSA 1YC7A 2BVQB 3UPRB 3D2UD 1OB1A 4CDGC 2HT3C 4RGMC 1AO7B 4LLQB 4N8PA 4LCWA 1LDPH 5BQ7B 1BBJB 4JJ5A 3WS3B 1CDHA 1I1AD 1Q0XH 5DLML 1G7LB 2GJ6B 5EU6E 2E6QA 4ZOAA 1WAAE 5A1AA 4POUB 1U3HC 4KUZL 3WHE1 5BZWA 5JIHA 3B6SB 2IWGA 3TJHC 4AEIL 3I50L 2PN5A 4UIKH 4PV9B 1U8MA 4GQ9L 4MDIB 1Q72H 3Q5YA 3RTQB 5DUPL 5HGHB 4Z0BL 5EU3A 3DURA 4Z7OE 1TJGH 1HKFA 4CAGA 3BPCB 1IQDA 3TPKA 3BKCH 3ZE1E 3FT3A 5TDPA 4AK1A 4KI1A 1OW0A 4OCXH 3DUSB 32C2A 5KG9B 3O2VL 4MA7L 3VXOB 2QHLA 3KS0J 2XQBH 5FK9B 5F6HJ 4HIHA 3ALWA 4KI5C 4NC0B 3VXQB 2DKSA 4YQXL 4W6YB 4FQXD 1I1YA 4FFVC 1NCDL 4JFPA 4XP4L 2HH0H 3SDCC 2BXZA 5KSAD 1KTLA 1MFNA 3I6LE 4Y1AD 3AAZA 2FYYA 4HFUL 3BGMB 1YEHL 1N0XH 4YHKL 3LQAL 4OLWH 1ZLSH 4ODSH 3CPLA 4YH6A 4QRUA 5BS0E 1I1AC 4ODHL 4JDZA 3E6FB 1DCLA 3PQYE 4LSPH 1IGML 1MNUL 3ZT7A 5D2LE 1MY5A 4MHHG 2A2QT 3G6JA 1I75A 4V1DB 4Y4KD 1KG0B 4U3XA 1RJYB 3T1FB 3UBXI 1F4HA 1RPQA 3RPKA 5ICXB 5D7LD 2VWEC 4NM8L 4PJEF 4AG4H 4HKBA 2ZOLA 4J3UA 4NNYA 3HRZA 4OLXL 1WVZA 3QEUA 4K7FA 5EO0A 1P4IL 3KXFA 1H3WM 4WW2A 1F5WA 2DAVA 1EV2E 5E0QA 3UXFA 4UNVA 3VFGL 4EN3A 3H9SE 4L4VE 4FN0A 4IRSD 1KJVB 2GITA 3P0YH 5INDA 5BRZD 4FQXC 2HRLA 1HI6B 4TRPL 2OQJA 5KSAC 5JZ7D 3ZSSA 4O51B 3PNWB 2J12B 4M1DH 1NLDH 5TQ0H 1L6XA 2NX5D 1JRHH 3CXDL 1X5FA 1UH3A 4M6ML 4YXKL 2YMXL 1TPXB 4QOKD 3D39E 5JOPE 1A9EB 5I73B 3RGVD 3LEYH 2AEQH 4M1CD 4WEMB 1BQSA 5GGSB 3S35H 3RDTA 2LAAA 2EC8A 3JV6B 1G7PB 3PDOA 3FB5B 4D9LL 4YDKH 2WUCH 3SY0A 4PGDA 2EYSA 1OAYL 2CDGA 2OI9B 4MJIB 4G6MH 4JO4L 4Y4KC 4YZFF 5GGUA 4PJ5B 4C56B 4HS6A 2Y5EA 3HG1A 5GZOC 2D2OA 4HC1A 5GGTA 4L4TD 5HHME 2HG5A 3DWTA 3PGDA 3C6LC 5C0AE 5CGMA 3R1GL 3MJ8A 4AM0B 1TENA 4KXZH 5E8NA 1UWEL 3PWLB 1ZVHA 4UT9H 4ZODA 4P2RB 1PYWB 4YHMH 1QBLH 3WD5H 4AZ8A 3P4OA 1EDQA 3SGEI 4TSAL 1H5BA 1MUJA 1LO2H 1QRND 3R06B 5DEZA 3X17A 2WSKA 3QUYB 3VH8G 2HJLA 2XKUA 3IU4L 3RVVD 4GRWH 1NFDB 1HHJA 4XB8A 3IFPA 4P46D 1FPTL 1NL0H 4S1DD 3O9WA 4E42B 1NFIB 3EDDA 3W0WD 4DQOL 4P23D 4M1CC 3MBXH 4ZFOB 1I7TA 4TUJB 3Q3GB 2XWTA 3FFCA 4JDVA 3MA9L 1QFWM 2IEPA 2XG4A 1SJEA 3SCMD 3QFDA 4LLAA 5FYJD 1A5FH 4M61A 1IKFH 3QAZB 1CLZL 3MUHL 1SM3L 3KYOA 4XT1C 1QPPA 1P7QD 5F7NC 3VW3L 4UIMB 1J0HA 1MRCH 4X5LA 1J8HB 4NCC1 4P3CH 3IDIA 4IM8A 5C0IB 3H7LA 5EN2B 2FB4L 4F7CA 1RZ8A 2R2EA 3R8QA 2V2WA 3B2UC 5DJYA 3OKLB 3VXTA 5ACZB 4N8VA 4IDLA 5T1MB 3M8OL 3O3DA 4NZTL 2GEEA 1NGQH 1P9MA 5T5NG 2LVCA 3B2VH 1C5BH 4PGEB 1A6VH 4LLDB 3O4LA 4LQFL 5E95B 3TIEB 3QUMB 5D1XD 4KDWA 2FHCA 1CF8H 1MREH 3RVVC 3FT2B 5SWSA 1FIGH 1QQDA 4C57C 3AROA 3DX8B 4PRHD 2Z31A 4W4OC 3MOAL 1HYSC 4P23C 2VDOH 1RJZA 4RRPA 2EKJA 5KSBA 1U8NB 4J12A 1OT2A 2AS5M 1SY6L 3FONA 4WWKA 1MRFL 3QJFA 2VERN 2QKIB 3FO0H 1C8PA 3HCVA 4NO0B 5GS2D 3DVIA 1YDPA 3OKOB 1UGNA 1FNGB 2ADGB 1J5OL 3U0TA 5DJ0A 4CMMB 1M05A 4R3SA 4F57L 4LOUD 1AGBA 5EOCH 5DVOA 5D2NA 1G7IB 2XQYK 2ZUTA 5J6GB 2BY2A 3M1BA 5HVWA 1RUKH 4XCEA 4K7PL 1MJ8H 5DMIH 4DUXA 4GAJL 2QEJA 1B0RB 1M1SA 3OXRB 1IAIM 2V2XB 3ARFA 2BNUA 4FTVA 3IVKA 5IMKB 3E3QE 5D1XC 3BW9A 5M94B 4OUUB 1A6WL 1BEYH 4P4RB 3MJ7B 4ZOBA 4JQVC 5GGQL 3QFJE 2DMBA 3U2SA 1M6OA 2P8MA 2XY2A 3TZVB 4WU5B 4FOMA 3MFFA 3ZL4L 2UVFA 1GGCL 1P9MC 5FA4B 3BEWA 2AQ2A 1KSRA 5ECJE 1L7IH 1RZFH 4FQJL 4ELME 4PB9L 5JW4M 3L5IA 4FS0A 4U6HB 5FM5M 4RFEA 4X83A 3X12B 3ECBB 3G9VA 3GSWA 4PJCE 2OSLA 5TDOA 1H3GA 2RQ8A 3EGSA 4BZ1L 1V8HA 2WNGA 2OTWB 4H1LH 5L7XH 2O26U 3P2TA 1OAKH 1YEKL 2OXGA 1JI2A 4ONHB 1MEXL 4N5EC 1DQQA 1KLGB 2BVQA 3S34L 4XMPH 1RIUH 4QRQB 1E28B 4Q0XL 1WCQA 3IRZA 4NKQB 4C59B 1AO7A 4TSCH 1E6OH 2PTVA 4OM0H 1DBJH 1B6DA 4LHUG 1BBJA 5IB3B 3WS3A 3GSOB 2FECL 3RZCA 1UB5A 3LKNA 1X5AA 1G7LA 2W0FA 3RU8H 1HWGB 4YWGH 5DS8B 4TN9A 1TXKA 5A3IC 5TH2A 3B6SA 1KT2B 5D2NC 1JHTA 5MEQB 4CKVX 1BFOA 5HGHA 3ULUD 2NY3B 2IPKA 1EEYB 2DQJH 3F58H 4IOFC 3BPCA 1L0QA 4FABH 3CGTA 1OWWA 3FCTA 3K46A 3HAEB 3LPFA 4OD1H 4KHTH 4OD3H 1OPGH 4NKMB 5KG9A 2R2CA 3C60A 4HPOL 4UQ3A 3VXOA 5K9JL 4RGNE 1MSPA 1UZ6E 3LKSA 3HI1A 1TJIL 5FK9A 1BPVA 3GBNL 5FUOL 5I2IA 4NNPL 5EOTA 2YRZA 3VXQA 1CXEA 1BZ9A 4BUGA 2UY6A 1CCZA 6FABL 3KPRE 3H42H 3JTTA 5I1AB 5DHVH 3CVHL 4LASL 4EBQL 3FN0L 4J4PA 1QACA 3MRKB 2VO5A 4TYUA 4Y0GA 1UM4H 4P9HH 5F89B 5CD5D 2QADD 5HDOA 1MCBA 4YDLB 4OCSH 1JV5B 4GQ9H 5AUMB 5JTWA 2EZ0C 3PL6D 5DUPH 5F70A 4Z0BH 4LEXL 1EH9A 5HVHB 1SHMA 3MNVB 1HQ4B 4R0LB 4V2BA 4LDLB 2KH2B 3BO8A 3I6LD 4MA7H 1KG0A 5MENB 5E2UH 4NC2B 1NC2A 1H3PL 4O5LL 3ULUC 3MRBB 4KKBC 1VCAA 4L8SC 3D25B 4ODWA 3CFJA 4YQXH 5EBLA 1V3MA 1NCDH 4PRBA 2CUMA 4LGPB 2QHRL 1AIFB 1X9QA 1LO0H 1NSNH 2WM0A 4JPIA 4CU7A 4EOWL 2RCSH 1GSMA 3FHQA 4B50A 4RDQF 2P48B 1FGVL 1HI6A 5D1ZA 3ZHLA 4AMKL 2H41A 4OCYL 1T3FB 2RHEA 3GIZH 4JFFE 3UDWC 3V4VH 4NDMB 3FO2B 4PJFF 2K3TA 4M48L 4GXUN 5CD5C 4BFBD 1XF3B 4MA1B 2FL5B 4GRWE 4YBLB 3WSQH 1A9EA 5J13B 4JY5H 4XVSH 3X3FH 4NUGL 4UDTA 1HHGB 1G0YR 3PL6C 1KPVB 4NQEE 1F4WL 3C2SA 4NN7B 1VEPA 1J86A 3VD5A 1G7PA 3FB5A 3FO9A 3NIDF 4OLXH 4KDTA 4MJIA 1EFXD 3CK0L 3NMEA 3MLTB 2XRAL 2NY4D 3BMWA 2XIDA 4HSQA 3I02B 3F7YA 4C56A 2VXQL 1CT8B 2VLJB 3MLSH 1P7KB 3JBG7 2A9NL 4FP8H 4UMGA 3D39D 5JOPD 1PGRB 4P2QB 3BZEB 2ADJB 4TRPH 4AM0A 2C4XA 4M9OA 1LO5A 2VLKD 3VFTA 2CH8A 5ESVB 4X6FA 3STZB 4P2RA 4N9OB 4NPYA 1CTOA 1YQ2A 2FJGB 4GRLB 3CXDH 4GAGL 3ULVH 4YXKH 3T4AA 4KKCC 5E94B 3R06A 4JCMA 4MSWB 3QUYA 3ZE2F 2A6JB 2JTDA 4ZUVB 4YXHH 3RVUC 1XGUA 5LAXB 3LD8B 2EYTB 2QBWA 2VTFA 2WLZA 3T2QA 4AEFA 4LHUD 2AV1B 3L7FB 4MNGE 3UBXB 5C0AD 3VXUB 4LAJH 5I1DA 1NFIA 3FFDB 5JW4R 1HH6B 1MAJA 3LRHA 5EPMA 3RVWD 4PLJD 4PP1D 4LP5A 1BIIB 1ORQA 1RSFA 3Q3GA 3QB7C 4HWZB 2PETA 1EAPA 4LU5H 3CSPA 3LDBC 2PTUA 1CE1L 4JR9L 3OX8B 1NCWH 4MB5A 4KMQA 5ITBL 5IB4B 4UIMA 5BVPL 4NJAL 4WI4A 4IMLB 5JHLL 1J8HA 3QCTH 1M4KA 3B43A 1DBBL 5C0IA 5EN2A 5TE6L 3C2AL 4PUBL 3CSBA 5ACZA 5T1MA 4LSUH 1CXFA 4G8GB 5LGHH 1JNNL 5ISZE 4KAQL 1FPTH 2JJSA 4PGEA 1UKSA 1KJ2L 3MV9D 3VFPA 5JW4N 2GKIA 4ZOEA 4GSDH 2OJEB 4JJHA 3GMLB 1JGDB 1NAKL 4MXWL 5GRXG 3VFVB 5KTEL 5J8OA 5FUZH 1FVDB 4M7LL 2NXZC 3MV8B 3VWJB 1PQZA 1MCQA 2QQKH 3KNBB 3MRHA 3S4SG 2DQFA 3KGRA 5HHOB 1X5KA 1OARH 2OL3A 4ETQB 4BSWB 1J11A 3VW3H 2HT4D 1NMCC 4LRIA 3SE4C 4U1IA 1DQJB 2ITCB 4LAQL 4I3GA 3BZFB 4N0FA 1VGKB 4RCAA 4EI5B 2J5LC 2FB4H 4JFDE 1MH5B 2QKIA 4RWYL 4E41E 2XTLA 3GKZA 1JPTL 1G7MB 2FBJL 4Q9CA 4ZQKB 1RZJL 1FH5L 4QF1B 2YKLH 1DQDH 4Q2ZB 5IFHH 4U1JA 4BK4A 4CMMA 5DZLA 4JM2F 2FJFB 1Z9SA 1F2QA 3K2UH 4S1QH 4X9GA 4QRTA 1RK1B 3DVNA 3DYMA 3SKNB 5I76A 2IADB 4PRIA 3U7WL 1F3RB 2NY1D 1OD9A 1CFSB 3OXRA 2X9YA 2V2XA 1BD2A 4ODTH 3KDMB 3B8SA 5IMKA 4OUUA 4W70A 1ORSB 3MJ7A 2HT2D 2W59A 1JFQL 4O02L 1MCPL 2OK0L 2ARWA 5LQBL 4NSKA 1RMFL 1WIPA 3TZVA 1IAMA 1LVEA 2P8PA 1RZKC 4XPTH 5FA4A 1UZ8B 4AQOA 2JJSC 3KJ6H 2E7CA 5BW7A 4R4BA 1P2CB 4U6HA 1J5OH 4CU6A 4G8EA 3X12A 3AU1B 3WKML 3QIWA 4MJ6A 4XCNB 4JG0H 3QJHB 3T4YB 4POYA 4LCWE 1U92B 1RUPL 2P1YA 2OTWA 2Y72A 4YK4C 5I8KH 5J9PB 5CIPH 1JYVA 4I5BB 3UTSA 4ONHA 3QFJD 1FDLL 1KLGA 2MQ0A 4QRQA 3ILQD 1BBDL 3BPNC 3RP1A 2HFGH 1OAZL 5HHXH 5IV2B 3FQUB 3QHTC 3VDBA 3B9EA 2FX8L 4JDTL 4MNQD 1LNUA 1K3IA 2NY1C 3IJSA 1F13A 5GGQH 5FM4A 1EZVX 3BGFB 1MCKA 2O93L 4Z7UB 4BH8B 4HW6A 4NQVA 1KENH 2VN4A 3NFSL 4CMHC 4FQJH 1CZ8H 2Q3AA 3WUWB 5JNYA 2HT2C 5MEQA 2WBJA 3U48A 4NBXB 4WU7A 1C1EL 3BP5B 1EEYA 1IC1A 1MCOL 2Y36H 8FABB 1N5YL 3AY4C 4BZ1H 1KB5L 1XGPA 3WLBB 5DYOB 1BLNB 1FIEA 4U1SA 1E4XL 1UJ3B 5TQ2L 4HGWA 4UV7L 3WHXB 3L6FA 4RX4A 4XX1E 1UT9A 3S34H 3WFBL 4L8CB 4GBXD 4CN6A 4PJHF 3MJGX 1U58B 5MI0B 4FQCH 3BKMH 1AD0B 2VDPH 4U1LA 3BPLB 4P5KB 2CDEB 3FRUB 2IBBA 2DIAA 2NNAA 1WLHA 4P9ML 1I7ZB 3ILQC 5BMFL 4YLQT 1PZ5A 2IH1B 5DDHB 3KAAA 4O2FB 5CJQL 2CRZA 3JWDH 5F89A 4DKEH 3QQ4B 4XWGL 1U8IB 2XNAA 4A6YL 1JGLL 5F7YC 3UTTD 5I15L 2SEBB 5AUMA 1SYVA 4L1DA 3IU3A 1JNJA 1IGTB 2WZPD 2KBGA 5J12C 4QTIL 5D6CB 4I8DA 3QRGL 1DUYB 1HQ4A 4R0LA 2PUQT 5E1AA 1DN0A 3L3JB 4U7SA 3C5ZB 5IR1A 5K9JH 4JANB 3CX5K 5GSVB 4OZHF 3TBVB 3MRBA 3QWRD 3GMNB 3LS4L 1SYSA 1U8LB 1GHFL 3D25A 3GHEL 5GJTL 5DT1L 5HDBE 5I1EL 3VGFA 3HE6D 4XPBH 6FABH 5DJAA 3GI9L 3EIFA 4MJ4A 1AIFA 3T3PF 3TBTB 2CK0L 3K4AA 4EBQH 4D9RE 1DTUA 1JNLL 4GBXC 2BY0A 5DJ2A 3G6DL 2IANB 5IGXL 2AK4A 2RFXB 1NEZG 4GG8B 5KVMC 3ULVE 3MLXL 3ORJA 1KUMA 4WWID 3SO5A 1KXVC 1UADC 1CDBA 1ROWA 3Q6GH 1S8DB 3B5HA 3ARBA 3ZYIA 1J88A 4OSUL 5EZJB 4H1LG 3RVXD 2J6EL 1C08B 4HWBA 3ARTA 1XF3A 4KGLA 2FL5A 3FHAA 3HG1E 5AWNL 2WBWB 1CVRA 5F9AC 1LHZA 15C8L 1AE6H 3QUXD 3LMJL 3MV7B 1T2QL 3MRFB 1LO3H 3MLTA 3EOTL 1S7UA 1T5XA 1I4FB 4JFFD 3A6BL 3I02A 1L0YA 2VLJA 4EOWH 5E24E 1P7KA 5J6HB 3OAYK 4OD2B 2DQHL 2BSED 4OCLC 4OZIA 2YPLB 1LO4H 4P2QA 3BZEA 2ADJA 2ZKHL 5HI4C 1BF8A 3C08L 5DJ6B 1IFHL 2Y5TB 5C0CB 4OF6A 5IBUG 2FJGA 3HKFA 4XTRD 3D3VE 3O11A 3ROOA 5TGBA 3L3GB 4DGYL 1ZGLM 4X98B 5HPOA 5I1LA 1F8TL 5I9QB 2D9CA 3AFLA 2DLFH 4GG6B 5CZXD 4MSWA 5IWLA 4NUGH 2A6JA 4ZUVA 3C87A 4QHMB 3FFCE 4YHYB 1L9MA 5LAXA 3PP4L 4K94H 1XR9A 3FMGH 3TCLA 4HT1L 3MFGB 2F53B 3RVXC 3BJ91 3LZFH 3FFDA 1HH6A 1LP9F 4L29A 2P5EE 2Z8WC 3ARDD 3CH1B 2R29L 4JKLA 3WN5B 3EUUA 2VZVA 4HWZA 2ZUYA 1BX2B 2BOBB 1AD9B 4QXWA 4OF0A 1WTGT 1BQLL 3ARBC 5GGRA 1J0ZA 3OX8A 2V5YA 5BO1H 4OF7A 2IFFL 5IB4A 4BH7A 2AERT 2VZOA 4IMLA 5D7IF 3U82B 1ADQL 4U6XB 5T1DH 3QHZH 3RY6C 1EK3A 2FX7H 3O4LE 4G5ZL 4CVXB 4M5YH 5A16A 4JY6A 3PHOB 2EIEA 2W38A 4G8GA 1BM3L 5SWSE 4HBQA 4XTRC 5H37H 3H9ZA 2YN3A 1FCGA 1H3VA 5KSUA 3P40A 4WRLA 5KSBE 2PO6B 2KUTA 1FBIL 1N6QL 1CFQA 4ODXB 1FVDA 3WO3B 3MV8A 3VWJA 5F3BB 2W0KA 3TT3H 2VZUA 3GMPA 5IW6B 5HHOA 4Z7VB 4ETQA 2W65A 1NCCL 3ARDC 4BSWA 1A3LH 3ILPB 4GRMB 3KJ4C 5BVPH 4S1SL 4NJAH 3ZDYF 2V7NA 1DQJA 4GW5B 5JHLH 4PG2C 1ZLVK 3MGOB 3BZFA 3DX9A 1DBBH 5ISZD 4CJ1A 4X9HA 4Y5YC 1MH5A 3UJIL 5TE6H 3C2AH 1G7MA 1GGBL 1T2XA 5C71A 4NKDB 5F1SA 1R3KA 2HTLD 5DSCA 5HHPA 4Q2ZA 5IVXA 3V0WL 1EVTC 1JNNH 4C54A 5JO5A 3EDEA 3QUMH 1MF2L 4PJBB 3HMXH 1NANI 2XKNB 4I18C 3UYPA 4E0RB 2I9LB 3QDJA 4FTVE 3TEUA 1GIGL 5IESL 4PRAB 5KTEH 4KQ4H 3SKNA 1INQA 3VJ6B 3P4MA 3LRSB 3UC0L 4NGHL 5FUCE 4JFDD 4NCC2 2Y1VA 3HPJA 4E41D 3QT2A 4PRPA 2PYEB 3EO1B 3PWPB 3V0VB 3CX5J 3KDMA 4EJ1C 4TPRL 4Y2DB 1UXWA 4LAQH 4HKXA 2COQA 3L5HA 3PXHA 4ZXBD 1ORSA 3KLAB 1MHPH 3DHJA 3QXWA 5D96C 1MCNA 4M8VA 4PJ7F 4RWYH 4ALAH 2FBJH 2AGJL 7FABH 3QDMB 4YIQB 4WO4B 1RZJH 1UZ8A 5EO9B 3RI5K 1P2CA 4RAUA 4XAWL 2Q8AH 4K3EH 2OJZL 4X4ZA 3LKRB 4IJ3B 1I85A 2BNQB 3GHBL 1AO7E 3EKCA 4HIEB 4JQIL 3VD3A 5IG7A 2HTLC 1U92A 5J9PA 1HHHA 4LFHG 5GRJH 3T0EC 4GH7B 5C2BL 4E5XA 2B0SL 4PGZA 3BAEL 2CK2A 4EI6A 1DEEA 1T1XB 3FQUA 3L3HB 1XF4B 2LFGA 4OZGA 1WSST 5D1QC 4JQXC 1JFQH 1MCPH 5LQBH 3RIAK 4N0YL 3WKNA 4BH8A 1JPFB 4ZYKB 5HY9B 4I13B 3QI9C 4LCWD 5D5MB 4OBRA 1YMHA 2Y07H 3WUWA 5EZLB 3SQOL 4KK6D 3V7AE 4F7PB 4WI2A 2F5AL 1MFBL 1TCMA 2DL9A 3WKMH 1QHOA 3B9KA 3BP5A 2FCBA 3ZKQD 2AXGA 8FABA 2XN9B 2EEDA 4KQ3H 3WFHA 3WLBA 3F6IA 5DYOA 1BLNA 3KPPA 2R8SL 5B4MC 3UAJC 3WHXA 1NUNB 2OR7A 1BBDH 5IM7B 1NCUA 2XACC 5CSZA 3TYGH 1U58A 3TN0A 1GGIH 1IBGL 1QKZH 3VXPA 1IGIH 3H3PL 5GS1B 4P5KA 3FRUA 4N8VG 1KIPB 1S9XA 3WFZA 1MCDA 5CP3H 1I7ZA 2OZ4H 5ETUB 3HS0B 1D5ZB 2IH1A 1A4JA 3FN3A 1W72L 2HMID 2H3NB 4OIAA 5DEFB 4V1DE 2DWDB 1H15A 3QQ4A 1S9YB 1A1NB 5T1LD 12E8H 5IHUH 2SEBA 1F6AB 1F11B 3BSZL 3HAEH 1CL7I 1MCOH 1NGPL 1RY7B 2EDXA 3MLWH 4QHLA 1IGTA 1N5YH 4OI7A 1KB5H 2EDDA 4NN6C 4JZJB 3BPOC 1DUYA 2VLLA 2XA3A 3L3JA 3T08A 4KDVA 4WFEE 1BJMA 1NJ9B 4UV7H 3C5ZA 4JANA 5GSVA 1MHHA 2GY7B 2Y23A 3TBVA 2ZUQB 1VGEH 2ZUVA 3GMNA 1U8LA 5DI8B 4LLWA 4ZO9A 2AJSH 4OI8A 4P9HC 3U7YL 2XWJB 3M17B 1Q38A 3TBTA 1TNMA 2HLFC 1PEZA 4GJTB 3UZEA 4MD4A 3NABL 4CVZA 3B9KC 4KJWC 3GMQB 2GSIB 4CNIB 5J1SC 5I1JL 1HIMH 1JYNA 5T33H 3U36B 4A6YH 1A9BA 5ID0B 1JGLH 4EN3D 5C92A 5L2JB 1IM9B 4GO6B 1ZVSB 1YNKL 4X5XB 4JKWA 5JDJA 1FGNL 3GDBA 3NCYS 1V7NH 4MJIE 3IAGC 3BKYH 2BNRD 1C08A 4DVBB 4PJ5E 4KVNL 5LXGH 1UQSB 2HYMA 4KHXH 4C56E 4X6DB 1WQVT 5C0RL 5JPMB 4D9RD 1I8MB 3T0BA 2CXKA 3CX2A 2CRYA 4BFIA 1Y0LB 5DC9B 2H9GB 3MV7A 3MRFA 3ULVD 3GI9H 4DVRH 4MCZB 4MD5B 3W2DL 1I4FA 4P2RE 3RDTD 3CFDB 3KPOB 5IMLA 4JHWL 5L6YL 4LCUA 5HDQL 5IGXH 1CI5A 2BRRH 2YPLA 4O2CB 1WFOA 3MLXH 4HBCH 1OAUL 5I8OL 1A1OA 2Y5TA 4HWBH 4UTBH 5L88H 1JHKL 4D0BB 1BF2A 1NFDE 3TWCL 5CAYB 4OSUH 4HH8A 4LFHD 1KNOB 1HILB 3P0GB 5DRZB 1MQKH 4QHMA 3VDAA 2ICES 5AWNH 3G6AA 3KVQA 5DJZA 3D0VB 3W9EB 2F53A 1T2QH 3HHRB 3MJ9L 2ZJSL 3CZFB 4OM1L 4WHCA 5E5UB 5ALCL 1IC4H 1Z5LB 4X7FC 1IC7H 2BVOB 3CH1A 1J8HE 2W07A 2GTZB 2IBZY 5KOMC 3WN5A 3JV4B 3D3VD 3KWWA 3O9WD 2DQHH 4OLVH 4X4YB 5C09B 4EQ2A 2DB8A 4PJ9D 1LE9B 2JCCB 4JCLA 3C08H 2IGFH 5FDWA 5HXMA 3FQNB 4KZDL 1Q1JH 4XVUC 3VG9B 3KR3H 4DN3H 4HUWB 2D03H 2M2DA 2R1WB 1S7RB 4JO2H 5FHBL 4RSVA 3BZ4B 2P5ED 2UWEA 5C7XL 1AQDB 3PHOA 3B4NA 4FQQA 2AKRA 4J8RA 5IHBA 5IMMA 3O3UN 4OGXH 4BJLA 4YAQA 2R29H 2DI9A 2FEEI 4ODXA 3RKPA 3PHSA 5F3BA 2ZUWA 5T5FL 1UWGH 4MYWB 5IW6A 3INUL 1FJ1B 4Z7VA 3GSXB 2ZUUA 1DE4B 4UI2A 3ILPA 4GRMA 2PNDA 4KY1L 1TVHB 1SY6A 5SWSD 5FF6B 4OF5A 4ERSH 1IGCL 2E27L 3BD3A 4J3WA 1U3JA 2QV2A 1NMAL 1OCWL 4PV8A 5EO1B 2G75B 3SKOB 3PWNA 2CPCA 5F96L 2IH3B 2VXSL 1FE8H 4M62H 4YDVA 2B5IB 4NZDA 4PJBA 5DJ8A 2XKNA 1BD2E 5JDSB 5FYKH 2I9LA 1QRKA 3UYRH 1K6QL 4RISL 4LMQE 4PRAA 3QUZA 3KPSB 4XXDB 2J8UB 4OGZA 3WIIH 3VJ6A 1F58L 5FV2A 3PDDA 3RNQB 1PAMA 4DFIA 2PYEA 3PWPA 1CYGA 1ZAGA 4F3FB 1RAMA 4ZFFB 4RGOL 1OTTD 3ZKXB 2DQDH 4U2YA 3KLAA 4Q7DA 1E6JL 1A0QH 3IB4A 2OLDA 3UJIH 1A4KB 3V4UL 2Q86A 3ARFD 4XXCC 3SGEH 1GGBH 5D6DC 4Q58C 4YIQA 1GYAA 4TVPH 4MQTB 3A0OA 3O3EA 1ZGLP 5HGGS 2DDQL 3MC0A 3O6MH 4KROD 1N64L 1GPOH 2A6DB 2Y25A 4WHTB 5HPMB 1FP5A 4PBWD 5ILTL 2E9WA 2IQ9L 1MF2H 5A2JH 4WIQA 5SX4I 1WCBB 4TULH 3S88H 2AK1L 3ULUF 1B3JA 1KC5L 5IESH 3QG7H 1FC1A 5E9DB 3L5XH 3DV6B 3CVIL 5F9WC 4L3ED 2DIBA 2QQLL 1IKNA 3HNVH 3Q6FB 1PFCA 1NBYA 4IRJA 1GZQB 4ONGL 4TQEL 5I17A 5FO7A 2HFFB 3L3HA 3HB3D 2BP3A 1XF4A 5GIRB 3MOBH 2VC2L 1JGUL 1P5UA 2KL6A 3ARPA 1FAKT 2OXHA 5E6YA 3BH8A 3EHBD 3ZE0F 3T0AA 4XVTL 5L8KB 3OB8A 2NY2C 1AO7D 4ZYKA 4KKAC 5D5MA 1OTTC 1PG7L 4JVPA 4OB5H 4PBVC 3ZE1F 1GC1H 1MCEA 4XAWH 4TVSa 5T5NF 5H37G 2GJ6D 5SX5H 1P4LB 4LCCA 4S1RL 3OZ9H 3RJDA 2XN9A 4M7ZC 3N9GH 3JSSA 2AXHA 1DVFB 4KROC 1HXYA 5C2BH 4RFOH 3RTQD 5IEKB 1I9IH 3RUGB 2ESVB 4HCRL 5IM7A 4GMSH 1DEDA 2DTML 1PEWA 4PB0L 3L95B 4U49A 5FM8A 5GS1A 4U1GC 3UZVB 2BVYA 3CVHA 1KIPA 1EUTA 2YR3A 2L7UA 3BGAA 3LH2L 4OCWL 4I2XB 5GJSL 1QPXA 3B3IA 1QR1A 1EJOL 1AXTH 4Y5XB 5DEFA 35C8H 1RIVL 2DWDA 3SQOH 3IXAB 1S9YA 3ARGA 1MFBH 2ZOKA 3O4OC 4J4PD 3TNMB 1E4WL 1F11A 2VZTA 4K71C 1OGAB 4NN5B 2E8ZA 1HOCA 1S7TA 4JZJA 2F58L 4IRJC 3BD5A 5GSRA 1FSKC 1LK3L 1NJ9A 2YK1L 5GGSY 3S37L 4EIZC 5I8EA 3SQBA 4QXUL 5IKCA 1NCBH 5K59F 2VKXA 3OJ2C 3CFCL 1HKLH 4HJJL 5DI8A 4OFPA 2EDLA 4V1DD 3H3PH 1MHEB 1YEJH 4PRNB 4WUKL 1A7OL 2XTJB 3JWDC 2WP3T 3M17A 5GISH 4N1HB 2Y6SD 3RVTD 5CHNB 3GMQA 4LCCC 3FRPA 2GSIA 5JUEH 5CEXB 1HK6A 4N0UA 1PY9A 3MCG1 3U36A 1S5IL 5ID0A 1IM9A 1NAMB 1ZVSA 3MRCB 4NQDA 4ZD3L 3BSZH 4KTYA 2W9LA 4AIXA 3OXSB 1KTKE 1XR8A 5CLTA 3LB6D 3NCEB 3WJLA 3O8XC 3VCLB 2VLJE 4X6DA 1DBKH 3H3KA 5JPMA 5CJOL 4JFHE 1QFOA 1YEEH 4CADB 1AP2B 1FVCB 1KB9K 3QYCA 1E4KC 4P2QE 2H9GA 3MYJB 4AL8L 1TZIB 2UYLB 4KJQD 3WXVH 3HNTL 2CLZA 4HK3J 4MD5A 4GUPB 4N8CL 1DZBA 3KPOA 3ARGC 1AY1H 4LL9A 1ZMYA 2ICWI 3GBLA 4JREB 4MJID 5ANMB 3JVGA 1QBBA 5D7JC 3KPQB 1CFNA 1MLBA 1TZGL 4O2CA 4N0RA 4MS8C 4MD0B 4PJ5D 5I1JH 1QLEL 1YNKH 2A1WH 5CP7B 4PJIF 5DQJB 1FGNH 2AJ3B 4MAYA 4D0BA 2HVKB 3MRDA 1QFWL 1RJLA 3VRLE 1HILA 5DRZA 4MVBD 4J2XA 2PXYC 3JTSB 4P2RD 3DV4B 4Y89A 5A2FA 2ORBL 4WHYH 1YNTA 5F8QC 3SGKC 4Y7MA 2Z93B 3QHFH 3BVNA 3L5WB 3D0VA 3UP1A 3W9EA 3LB6C 5CMAB 4OF8A 3SEPA 3CZFA 5C8JB 4JFEB 1Z5LA 3AS1A 4R4FH 3W2DH 3WFCH 2DM2A 5IHLB 4FA8A 1JWMB 3IGAB 4R26H 4X7CC 2PCPA 1Z0NA 1VEOA 1MIEL 4Y19D 2E6PA 3BT2L 5E6IB 1TPXC 5HDQH 4DTGH 5I73C 1FNSH 5C09A 3NFPA 4P59L 2YUXA 1MFAL 4F9PC 2JCCA 5I19L 1MRDL 3MRPA 4G7YL 4XMLL 4M9PA 1MI5D 4YFDB 4G8GE 5DMKA 5I8OH 2NR6C 1CDUA 1JK8B 3HAEG 5A2KH 4LBEB 3JWOL 1NCAH 2R2HB 4HUWA 3MPCA 2R1WA 1A6PA 4K94C 3UEZA 3P9MA 5EU6B 4WUUB 1J8HD 5FYKE 2AQ1A 2JIXB 2O5XL 3MV8E 4KRPB 5TF0A 5IVZB 2VITB 4WI8A 4GMTL 1FYTA 5HHOE 5IW1B 1KJ2A 2ZJSH 3U83A 1JHLL 5ALCH 2YD9A 3F7VA 3SE8L 2DKMA 4B5EA 2W9DH 4HV8B 1Q9LB 3H9HA 3S3PA 2LABA 4JFZL 3GSXA 2QR0B 5DA0B 1R6VA 4XPFL 5ABDE 1TVHA 3EYUL 1EJ6A 4NKOB 1JWUB 5IT2L 4GKOA 4TVPE 4Z7QF 1CLOH 2OP4H 5DK0A 4D9QD 3IDXH 4LPTA 4ZAKC 1KEGL 4XP5H 3EO0A 3WDHA 4JPWL 4QCIB 4NZUL 5EO1A 1IAIL 2FWOA 3FQWB 3SKOA 5E2VH 1ES0B 2IH3A 5BS0B 5AZ2H 3ALXA 4PRPE 1R24B 3PQYB 4NO0D 2EYRB 3M07A 3BIAX 5JDSA 3WFEL 5D2LB 3DRTB 3G5XA 3TBWA 3KPMA 3FAXA 2IF7A 2P43B 2FGZA 1GOHA 1TZHA 3I2CL 5C0DA 2F74B 4LPVA 1YEFL 3RNQA 1QO3B 2ITDA 1D9KB 3WNMA 4F3FA 5E03A 4LK4A 4ZFFA 1BAFH 4UOJA 5TDNB 1KFAL 5KVFH 1MCIA 4PJEA 2HLAB 1C12B 2HKHL 3UZQA 4BKLB 3OBAA 3PGFH 4O4YH 1A4KA 4L4VB 2WINA 2P42B 1OCWH 3SKUD 4IRZL 3CU7A 5I1HL 1IRAY 1ONQB 5F96H 2ERJB 4FFWD 4XCCH 4YBHA 3U4BL 3WIHH 1MFDL 2VXSH 2A6DA 3AREB 5MERA 1SQ2N 3DVGB 5HGDB 3TZVD 2CKNA 5DJCB 2NY6B 4JO3H 1WCBA 1YMMD 3IDYC 1Q9WA 1K6QH 4JE4B 5EB9A 4PJFB 2NCMA 1NEUA 5E9DA 3GSNB 5CS7A 3GM8A 4NQXB 1XGRB 5CWSB 4WEBL 1EIBA 1G1YA 4Z7UE 3SJVA 3S36L 4LGRB 3Q6FA 1U8JB 3L3DB 2G5BB 2JJTC 2C9AA 4RGOH 3FZUC 2HFFA 5GIRA 3GK8H 3RRQA 1WWCA 1RZJC 2EH8L 4LLYA 1KB9J 2L4OA 4U0RB 3TA3D 4M7JH 1JF1A 4XH2B 2AXJA 4I77H 4O00A 1MHCB 5HHMB 3AMKA 4EQ3A 3UJTL 3TM6A 2ZG1A 3UBXG 1EVUA 5E2WH 5DJXB 1OAQH 2VDML 5DUBB 1EEZB 5EA0L 1R5WA 4IBLT 3BESR 5AZEH 3WFDL 5FYJL 1YYLL 2HRPH 1P4LA 3QO0A 3BUYA 4HKZA 3DVFA 1G6RB 1T1YA 2Q6WA 1JZ4A 3HMWL 3QIUD 4FFWC 4JHZA 1G1CA 3T1WA 3VFWA 1FNLA 3MX0A 2DLTA 1OD7A 5ICYA 1LD9B 5IEKA 2NY3D 4KUCD 3TO4C 1CICB 2ESVA 3FB6B 4OAWA 2ZUXA 1WBXB 1TJHL 1UM5L 5F1KC 4ONGH 4ESKA 3UTQB 4I3RH 2AXFB 4ZPTB 1BECA 1QBML 4RIRB 4N9GB 4M7LT 2XFXA 2C1OA 4C83B 2EEBA 2CGRL 1P69B 2DQCL 3ZZ1A 2ADFH 4I2XA 4D3CH 4FQ1H 3MUGB 3ZKSD 4Y5XA 4HAFA 1JZ2A 5F8RC 3MO1B 1I3UA 4UBDC 4RMSA 4EDWL 3IXAA 3TA3C 2ZUSA 5B3NA 3V6OC 1OP3H 3HI6L 3TNMA 4JN2A 1K8DB 4GW1B 4S1RH 4HD9A 1SVZA 4CW1A 4FXKB 2OBGA 2V5SA 3ZO0A 5IMOB 3MV01 4M93C 2O5ZH 3QPQD 2MHAA 4NC1C 5KANI 4BA8A 1YEGH 4LIQL 1R5IB 3LPWA 2DTMH 4Q9QH 2BSSA 3SHSA 4PB0H 3QDHA 3QIUC 1X5YA 5MEND 1S9VB 1FRGL 1MHEA 3N1PC 4JGMA 5ID1B 2NY3C 3KYKL 1J1XL 3OAZH 1A7PL 4KU1A 1JGVH 1NKRA 2YC1B 4EKXA 5SWZB 2IG2H 4LKCB 4CVUA 2MQCA 2K7QA 3PIQB 2JELH 1HWHB 3SDXF 3ROLA 2EC9T 4I4WA 4WNQA 3C8KB 4OZFB 1RIVH 5ESQB 5F9OH 2DLHA 2ENSA 2GAZB 1HHIA 1NAMA 3ARQA 1E4WH 4V2CB 5IK3B 1G7JB 5F1IB 1M7IA 4YHOH 4HAGA 4BFEA 3MV7E 1KCSL 5FGBA 1DLFL 3LQMA 1K9TA 1LK3H 2VSDA 3S37H 3E8UH 3S9DB 1ZSDB 4NP4H 5BCAA 4CADA 1FVCA 4XC1L 5T3XL 1YEIL 3CFCH 3T3ME 2VL5B 2YPLE 4RA3A 4CVWA 2R4RH 1A6UL 4Z8FL 3MYJA 1CU4L 1TZIA 1SJHB 5CBAA 4LLUA 3MNWA 4WUKH 4HIIB 4JM2B 4UV4H 2GJZA 5ACMA 4GUPA 1J1PL 1XIWD 2YEZB 2FR4A 2CUHA 2EE6A 3CUPB 3IS0X 4ZSOB 4TUOB 1QSFB 4HDIB 4UT7L 1XCTA 5TE7L 4GG6E 4AIZA 4X9FA 4K3DL 2C5DC 1GAFL 1N4XL 4MD0A 1OHQA 3NCFB 4X6BB 5FKAA 4ZD3H 5C0EB 4RWHA 5GQBA 5CP7A 1DJSA 4HWNA 5DQJA 2APVA 2HVKA 5GGVY 2F53E 4U33A 4XPHL 1AGDB 3OKEA 5FEBA 4JG1L 3JTSA 4I1NB 4HWEH 5H2BB 3DV4A 4GRLD 2DM4A 5DO2C 5CJOH 1RUAL 4IIQB 5I66A 2Z93A 3CFIC 1A1MB 4FFYL 2GSGB 1RZIB 2GK2A 4WV1B 3L5WA 4HJ0C 2PW1B 4PJCB 5C8JA 4LNRB 3QXTA 4JFEA 1H3XA 3HNTH 3DETC 1JPGB 3U46B 3AS2A 4O9HH 3MRMB 1CR9L 4HG4K 1IVLA 1CGSH 1JWMA 3T0DA 1B4JL 3WUWG 4ZS7L 3ULUL 1SJVA 4U1NA 5E6IA 3VXUD 2C3GA 1CXLA 5FGSA 2A74B 1TZGH 4H0HB 4MCYA 4MMXC 4LSTL 4AT6B 4PJAF 1J1OH 5BV7B 2B4CH 4NN7C 3VXSD 4MWFB 1XIWC 3NACL 5FGBC 2OR8A 1ADQA 4KK9C 5FHAL 5JHDB 1CGYA 5IROC 2R2HA 5JA9A 2NY0B 5BXFB 4LVOB 3GJFK 1UYWH 1B4RA 3ARWA 3BQUB 2FIKB 3RBSA 5KVGH 4WUUA 4LHJB 2BJMH 2ORBH 4W68A 1TQCB 3ZTNL 1PZUB 3QPXL 2YN5A 2VITA 1EZVY 4P5MA 4Z7VE 4XHJC 2A6IB 3EOBB 3QEQB 4X8JB 2WAHA 2PYFB 1FL5B 4G8GD 1B0WA 1FAIL 1UEYA 4GRLC 4YDIL 2YD7A 3LAFA 3QNXB 1NGWB 1JPST 2MCPH 2N4IA 1KIUA 2GUOB 2FO4B 3U9UB 4RGNB 1KLUB 4P5TB 3HE7B 1Q9LA 3WL9A 2NYYD 5B39A 1MRDH 4XMLH 4PREB 2ICWB 2QR0A 5FYKD 1FFPA 3NIGF 3MV8D 1ACYL 4NKOA 1JWUA 1YECL 3KPRB 5T1KB 4ZUSA 2YD2A 4HFWB 4PJBE 5HHOD 5F1NB 4CN4A 1KCVH 1T66D 1KTDB 2VLMD 5IB5B 2RR3A 1DQLH 4HUNB 4ISVB 4PJDF 4JKPL 1EHLL 3FQWA 2O5XH 4EI5D 3VXRA 4G9DB 2A6KA 4XBPB 1F97A 4GMTH 2PYEE 3PWPE 4PGCB 2EYRA 2YS4A 2UV3A 4F37K 1JHLH 5EZOH 1F3JA 5F6HI 3HZMA 1PJ9A 5KVDL 1ZT1B 3C6SA 4GS7B 4I3SL 4TVPD 4IDJL 1UCBL 4LVNB 4ZNEA 3QH3B 4I0PA 3KLHC 1Z3GL 3OG4B 2VABB 3U0PB 1ZT4B 5ITFA 2D31A 5GHWL 5TDNA 2HLAA 4G6KH 3QCUH 1M7XA 4HQQH 5J11B 1ZT7B 2XPGB 2PR4L 5INCA 2NYYC 4JPWH 1UA6L 4Q74A 1IGFL 4WCYL 4HGKC 3V52H 4NUJB 2X40A 4WHYG 1ONQA 1INEH 2JJUA 4HUKB 3SE3C 1DQML 1W8NA 1N6VA 1U6AL 2W9EL 1T66C 3OAUL 3NCCB 3HC3L 4HZLA 2HN7B 2BOCB 4TTDD 1IGJB 1N59B 1RULL 4PJFA 2DD8H 3KYMA 4NQXA 1XGRA 1CXKA 5EOQH 3BYYA 2NZ9D 4ONOA 4P4KC 5BVJB 2BSRB 4S11A 1DBAL 3QZWA 5D5ME 1U8JA 3WIFA 3L3DA 2G5BA 1T21B 2K7PA 4CRPA 1S7SB 3AVEA 4ONFL 3UTZA 3DXAB 3ZYJA 1V7ML 4KKNA 2HKHH 5JR1H 2KDGA 4WTXA 1IGYA 1GOGA 1IEAB 4H20L 5I1CL 3RIFK 1J9CT 4ORZC 3OKDA 2EO9A 3EYOB 4R6UA 4XWOD 2XN9E 1WT5A 1CFTB 1FG2B 2DJSA 5SV3A 4JFOB 2P5WB 4OUOA 1MFDH 1EEZA 1ETZB 1KJ3L 3P0VH 1MFCH 1BZ7B 1ZWIB 4I0KA 5MHSE 4MJ5B 3FOMA 1G6RA 2WWMD 3OAZK 3QNYA 4NJ9H 1XH3B 1G7HB 2E6JA 2R23B 1LD9A 5CJXA 5JIPA 2PTTB 3S36H 2IQAB 3QSKB 1WBXA 1EXUB 1CBVL 3IYLW 4TTDC 1C16A 3HRPA 3UTQA 4B7LA 4ZPTA 5HJ3B 3DBXB 5E8DL 3RA7L 5LG1A 1UWXK 1GC1C 1KCRL 4O2EB 2NZ9C 4P2OB 1SBSH 1LP9B 5KS9F 2YXMA 4L9LB 2EXYD 4HG4J 1W72A 3IDGA 1N0LA 3UJTH 5IOPB 3QEHB 3MUGA 5E8OB 2JJVA 3DTXB 1NUFA 3CAFA 1U8OB 2J4WH 3SDDA 4Z0XA 5EA0H 4A2MA 1BFTA 25C8L 5F1OB 1WEJH 3RGHA 1OLLA 5DFVD 1NANH 3IDJB 4LVHB 4G42A 1UXSB 3LRGA 1T89A 5D7IB 2F9BT 5IMOA 2Z8SA 3O6FB 2DQGH 4HPYH 5D8JL 5HI3C 2F54B 2DBLL 1TJHH 2VZSA 1R5IA 1UM5H 2B2XL 4XCFH 1EBAA 5CCKH 4YHIB 2WWMC 4EUPA 4Z76B 4K8RH 1WT5C 4N0UE 2AAVA 3C5ZD 5ID1A 3ULVF 5FIEA 4NQDE 1QNZH 3WHE0 4DKFH 1SVCP 5SWZA 2Q76B 2DQCH 1TITA 4LKCA 1QEWA 3HUJF 3PIQA 4ZFGL 4AY0A 1UJ3C 3C8KA 2AEIT 1HEZB 2H32B 3BE1H 3NGBC 4YC2B 4X6DE 4LP4A 2GAZA 3IAQA 1MWAB 1YPZF 5TF1H 2ATKB 2NY7L 4XPGL 1MCHA 2CKBL 2H1PL 3U1SL 5MI0C 2IAND 1G7JA 1U3HB 5DD0L 3EYSL 5DK2B 4H88H 4YHNA 4XPAH 3NAAH 2Q1EA 1IZKA 5HD8D 3WNKA 1FO0L 4IMKC 3GRWL 3QG6B 1YY9D 5E8EB 1DANT 1ZSDA 1NC4B 1A14H 2X6MA 2ZWLT 3HR5B 4PJ8D 4QWWC 2VE6B 1CD9B 1SJHA 5I75C 4JM2A 1LDPL 4O58H 1NCTA 3KYKH 3TBYB 1A7PH 4HS3B 5C9KA 5B3JF 3SDDC 3MLYH 1QLFB 3DX6B 3SGJA 3CUPA 4ZSOA 3MV7D 4TUOA 1QSFA 4HDIA 2DKUA 1KGCD 3QO1B 5BOZG 5DRNA 4X6BA 2ICCA 4LKXA 4XNYH 5C0EA 2APTA 1T0NB 4UIKL 4BELD 5ERWB 5ALBH 4QXGH 1VESA 5IUSA 2YPLD 1Q72L 3GGWB 1KCSH 1Q9KA 1TJGL 1Y18B 3QDAA 3FQRB 1FZJA 1I1AB 5C0CD 4FXGA 1OTSD 4OCXL 4ZUUB 1PSKL 4FQ2H 1A22B 1BGXL 5C08B 1A1MA 3DMMC 2NPLX 5C09E 1YEIH 5T3XH 1WWWX 3ZDXF 4WV1A 3MJ9A 1A6UH 4Z8FH 2JCCE 1CU4H 2PW1A 4W6WB 4Q9BA 5HD8C 3GI8L 4LNRA 1I8KB 1BOGA 5I74C 3U46A 2FJHB 4JJ5B 1AKJB 4ZFZA 3FB8A 4PJ8C 1I8IB 4NT6B 4UINH 4UT7H 5TE7H 4NQCA 1HN1A 5LBSH 4HUVB 1N0XL 3TT1L 5CINL 4OLWL 1ZLSL 4AT6A 4ODSL 3VD4A 5BZWB 4ZS6C 4X0KB 2UZIH 2V7HB 3TF7C 4HF5H 4EDXA 5EUOF 1OF2A 1JTOA 2ZPKH 1CL7H 1FYTE 3BYTA 5JHDA 3I9GH 4LSPL 3V6ZB 5BXFA 3DURB 2ED9A 4JG1H 5JXED 4OFDA 3FT3B 3BQUA 5HYJB 2FIKA 2H2SD 2CIKA 1EO5A 2AI0H 3A6OA 5CZVH 32C2B 3RWFB 3G04B 4NO2A 4IOIA 3L3IB 4HIHB 2KZWA 3QEQA 3SGJC 1UEMA 1H8NA 5EU7C 2DQTL 2O5YL 3TVMD 2PYFA 1B90A 1I1YB 1FL5A 4P49A 5FXCH 4JFPB 1NKOA 4DW2L 3GJFA 3QNXA 4QLRA 1NGWA 4I48A 1KTLB 3VMOA 2AJVH 3AAZB 2GUOA 1CDYA 1QYGH 2FO4A 3U9UA 1KLUA 1P4BL 3HE7A 4WI7A 3P0YL 5F7LB 4LSTH 4Y4KB 2PO6D 3CPLB 5KBNC 1DDHA 4PJHA 5D7LB 1JZ3A 5FHAH 4AENA 2QSVA 4JDZB 4YHPB 4M1DL 3V8CA 5DEGA 3C6LB 4NKIH 2H26A 1KTDA 3VGHA 5IB5A 3T2OA 4ISVA 1T0PB 5E5MA 3G6JB 4P99A 2B8OT 3DROA 3LEYL 1I3RA 2AEQL 3QPXH 3RBGA 2CIIA 4X7TA 4GQPH 3S35L 3MTRA 2ID5A 1HQRB 4HKBB 4NNYB 1FLRL 4YDKL 2H2SC 2B1HH 2D7TH 2WUCL 4K7FB 4GAFB 1AI1H 1D6VL 5FV1L 3KXFB 4MB4A 5E08H 4G6ML 2NX5B 5E70A 2GT9A 4PJXF 1A8JH 1T83C 3G5ZA 3QH3A 2OTUA 1ZT4A 1KCKA 3TVMC 4OZHA 3HZKA 1ACYH 5CILH 4XP6H 1CGVA 1ZT7A 3GB7B 4JM4H 4UT9L 4R8WL 1F4AA 1QBLL 3WD5L 4YHML 2D0HA 3GSUA 5IEHB 1G0DA 2PO6C 3Q48A 4Y2DD 1EHLH 4M5ZH 5E9DE 4NUJA 4LSRL 3RI5F 2APBA 4G3YL 4KTEH 1CIDA 3QDMD 4WO4D 5EC2A 3SY0B 2BOCA 1NL0L 1N59A 2EYSB 4PGDB 2CDGB 1DLHA 4F8QA 5KVDH 2BNQD 4YZFE 2JK5A 1QRNB 3HG1B 2BSRA 1IQWL 2HG5B 5HI5D 1D5XA 2J8OA 4HMCA 1T21A 1A5FL 2LTQC 2W92A 3MJ8B 2X9WA 3DXAA 1XGTB 3REWB 5FA3B 3RIAF 1N5AA 3RFZC 4B0MM 1U8QA 2H45A 4P3CL 1X7QB 2ZCLH 1RZ7H 1FG2A 3BKJH 1UA6H 2VYRE 2V9RA 1H5BB 1JTPA 2HA1A 3AS3A 1EGJL 1ZHNA 1ZK9A 4JFOA 2P5WA 5D93C 3MBEA 2AV7B 1ETZA 2ESVE 4ZO6A 1U6AH 5TFSH 3P4NA 2BC4B 3W81A 3GSNH 2MCG1 4NIKB 2EXWD 1BZ7A 1HCFX 1ZWIA 1HHJB 2C3VA 4Y2DC 3IFPB 4XZUB 3B2VL 3O0RH 3MRRB 2A77H 1JNHB 1YZZA 4X6CF 1I7TB 3FFCB 4HCRA 5MP6H 5DVMA 1MREL 1RU9L 4WY7H 2IQAA 1DBAH 2XN9D 4I2XE 1FIGL 2B20A 5E4IA 1EXUA 5B38G 3QFDB 1VADA 4N0CD 4X7DC 4LMQI 4NBYB 1FQ9C 2YWYA 2PW2B 3KYOB 2VDOL 5HJ3A 4OCMC 3LKPA 4IJ3C 2DICA 3O2DH 4H20H 4O2EA 1K4CA 3VWKD 1T80A 4R4ND 4FZ8L 1LP9A 4OLZL 5F88A 5HI5C 4L9LA 3VGEA 2Q7NA 4U6VL 4F7CB 3QEHA 2A0LD 4OQ1A 2V2WB 1ZA6B 5DJYB 1MELA 2Q8BL 5E8OA 3DTXA 4RA0C 2AJYL 1WIOA 3HN3A 3B9VA 5IB1B 3T09A 2Z35B 3O3DB 3OF6D 1UXSA 1AXIB 4KK5D 4RBPH 5D7IA 5EOCL 2E9IA 3O4LB 4Z7WF 2XTJE 5J0BA 5C2UB 4OCRH 1NUGA 1RUKL 1HINH 3O6FA 4H8WH 3MRNB 4QRSB 5DMIL 2EXWC 1A21A 1JVKA 3Q1SH 1CBVH 1W8OA 2MWCA 4NM4H 1MJJB 4KRMB 4Z76A 2XA8L 3OHXA 2Z31B 4B7IA 4Y16D 3SBWA 1RJZB 5C0ND 1J0IA 1BQUA 5KSBB 2JKXA 3BD4A 1BEYL 3FONB 4WWKB 3BIBX 3QJFB 4N0CC 4YBQC 2IAMD 4PIRF 3HCVB 3W5NA 1HEZA 1P1ZB 1L7IL 5L2KD 3L5JA 2YA1A 2XV6B 3VWKC 3MCKB 1RZFL 4HZAA 3HI5H 4NHCH 2ICEB 5DD5H 4R4NC 3VFNB 5SX4H 1CQKA 1OP5H 1M05B 4R3SB 5DK2A 1AGBB 4LCIH 5D2NB 3M1BB 1IM9D 3NBNA 1FL6A 4XCEB 5L7XL 5SV4A 1RZGB 5D8JH 3QG6A 1IAOB 4BSJA 1BOYA 1OAKL 4BQCA 2C3XA 3PV7A 1P84K 3HR5A 1RIUL 2WQ8A 3IFOA 3EZJB 2QQNH 2BNUB 4FTVB 4TSCL 1E6OL 3BW9B 1DBJL 1OGTB 5HGBA 4NZJA 3TBYA 1QLFA 1ZANL 4OZFH 1NFDF 3U2SB 1M6OB 4ZFGH 4Y16C 4QY8A 3MFFB 3RU8L 1EMTH 3QO1A 3BEWB 3SDCA 4KKLD 4F7TA 2UY7A 5BJTA 5J1AB 5D4QA 3D2UA 2CKBH 2H1PH 5IW3A 5FOBB 5JW5B 2IAMC 3GSWB 3GGWA 2OSLB 5JIKA 4JFEE 3CDYA 3F58L 4LCYA 1YY8A 1J12A 3FQRA 4Y8AA 4PJ7A 1FO0H 1I1AA 4FABL 2V5RA 4OD1L 1OAXH 4FQPA 2J88H 3QIBD 5FECB 2X5PA 4OD3L 1OPGL 5C08A 1DQQB 3LY6A 4MDJB 6CGTA 4BZ2H 1X6LA 1O0VA 5F71A 4E9LA 1S7XA 5IJVA 1I8KA 2FD6H 4JN1H 2V17L 2FJHA 3H42L 4L8SB 1AKJA 3RZCB 1QUNA 1UB5B 3LKNB 4W81A 1I8IA 4NT6A 2W0FB 4HUVA 4J6RL 3H3BC 3NTCL 4WUUE 1UM4L 5TH2B 4P9HL 4X0KA 1JHTB 1XFPA 2V7HA 4GT7A 5E2TH 1DQTA 4OCSL 5C09D 1BFOB 1KPUA 2NLJB 3V6ZA 4FQXA 3IAPA 2IPKB 3D0LB 1CK0L 5KSAA 5HYJA 4TNWF 4Y1AA 4YFLF 3FCTB 1CD8A 3GKWL 1PSKH 3RWFA 3G04A 1BGXH 3C60B 1Q0YH 4UQ3B 5E2UL 4UTAH 3LKSB 1U91A 2X10A 3HI1B 2ZSWB 1Q8MA 2YSSA 3L3IA 3N1QC 5I2IB 3RAJH 1NDGB 3DIFB 5EOTB 3GI8H 3I3EA 4QTHA 2X7LB 3QWOB 1BZ9B 2UUDH 3QIBC 4NZRH 3S98A 3ESUF 3JTTB 2VR5A 2B4CC 1BZQK 4OGAC 3SOBH 1LO0L 1NSNL 5BV7H 5J57B 2RCSL 3TYFA 3TT1H 4NHUA 4WHDA 3SPVB 1V5JA 5CINH 1BJ1J 5EORH 4Y4KA 3BEVB 4G6FB 1IARB 2N56A 2MFNA 5D7LA 4GAYB 3VFOA 4N90E 3GIZL 4YHPA 4JKKA 3V4VL 3C6LA 3MJ6A 3EDFA 5CUSH 3PHQB 4F7EA 4MQSB 3N06B 3WSQL 5IF0A 4IRSA 3NA4A 3BO8B 3NIFE 2WIMA 4JY5L 4XVSL 3X3FL 1NC2B 4QXTA 4ZNEE 3K7UA 1CTNA 5BRZA 1HQRA 4ODWB 1X3DA