4YQXH

Mouse il-2 bound to jes6-1 scfv fragment
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
b'EIQLQQSGPELRRPGSSVKLSCKASGYNITDYLIHWVRHRPEHGLEWIGWIDPEDGETRYAQKFQSKATLTADTSSNAAYMQLSSLTPEDTATYFCARSLDSTYIYPFAYWGQGTLVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JES6-1 VH domain
publication title Antibodies to Interleukin-2 Elicit Selective T Cell Subset Potentiation through Distinct Conformational Mechanisms.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cytokine/immune system
total genus 26
structure length 121
sequence length 121
chains with identical sequence N
ec nomenclature
pdb deposition date 2015-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yqxH00
3EDJA 1I9JH 3GRWL 3M07A 1MCQA 5DT1H 4M7LL 3WJJC 1JNNH 1F3DJ 3ARBC 3CC5B 3LDBB 2GY7B 4K7PX 4X4XB 3CVHH 4CAGA 4F80A 1QBMH 3MLRL 1NH6A 3DECA 5JW3H 1FVCB 4ONFH 4HC1A 4M3JA 1M7IB 4U0RC 1MCKA 3L3DB 4XAKE 2H32A 1JPSL 5AUMA 5FO9B 5C6PB 2WNGA 1U3HA 1DLHB 2BSRB 1CL7I 2NNAA 2X4QB 5DRWB 1NDMB 4I2XE 3N1QC 1CLCA 3KPNB 4UT7H 3R0NA 4BYHA 1KPRB 3O3UN 2Y5EA 2AXGA 5HBBA 1UCBH 1XF5A 4HKXA 3DRQB 3RWJB 3O8XB 3VXUA 3MRCA 4OZ4B 2FSEA 5FDYA 5C0BA 3MLVL 1WCQA 3DXAA 4Y2DD 4GT7A 3T65B 1MI5D 4K7FB 1CL7L 4W4NA 2EDQA 4LRIC 2O26U 4GAJH 1XF2A 4ZPVA 4HUMB 4PGEB 3BDYH 3CFEB 5DJ8A 5JQ6L 4LLUA 2XWBA 3MJ7B 1QFUH 2VWEE 4Y2DC 1F58H 2HA1A 5J6GB 1DEEA 2V7NA 4GW1A 2JJSA 5CEZH 2AAVA 8FABA 3OX8A 2HJKB 3O3EB 5D2LF 4NCC1 2G75B 4LNVA 2ZCLH 1HILA 4IMLB 2VDRL 2CRZA 3OZ9H 4X8JA 3MOBL 3VFPA 3H9SB 4EIGB 5I1IL 1LO3L 4HK3J 3T08A 4P23D 1LP9B 4RBPK 4YFLI 1A22B 2N4IA 2Q1EA 1CLZL 3LKOB 4R4FH 1PBYA 1MAML 3C2AL 1DP0A 3LKSB 1XF3A 1ZSDB 4U1MA 3JWDL 4LBEA 4JY4B 2HG5B 2D0GA 1JTPA 3L5JA 5CSZA 3AAZA 4F7PB 2R1YA 4LFHD 1D7FA 4X8XA 4RFOL 2GSGB 5C0IB 1PKQE 3CXDL 4A6YB 2V5MA 1CDHA 4MD0B 4P2QE 5FYKD 4DZ8A 1IC4H 3JXAA 3QUZC 1RURH 3CSPA 5KS9E 2DD8H 4P9HL 5HHQB 4TUOB 2ZJSL 2FB4L 3VXQA 1PYWB 2VZTA 3QIBB 4ZUVA 4F37K 3Q5YA 2DL2A 3I50H 4P49A 4KV5E 1B3JA 4XVTH 4YX2L 3QHTC 1BZ7B 1IEAB 2VH5L 2WUCL 4HJ0D 5B3JF 2LTQC 2Z92A 3QDAA 5EC2A 2CR6A 5JUEL 3WNMA 3MBED 1V3JA 4ODVL 4NYLA 3NCJH 4JDVB 4MAUH 1UB5B 3TT3L 1QYGH 3T1FA 3ARFA 1MCBA 4HKZA 3TVMD 4TVPD 4HJ0C 2R1WB 5C7XL 1AO7E 2RR3A 4C57C 4UT6H 3PXJA 3MBEC 5D1XA 2YPLB 3MQIA 1A9EB 1Q9LA 4WUKL 5E0QA 3QHFL 3GMPA 2XA3A 3BO8B 5GRVL 3ULUD 1DN0B 1I8KA 3TVMC 3MLZL 2B4CL 2N7AA 4GXUM 5F1OB 5HGAA 1UENA 2E27H 2B1HL 1S7VA 3LHPL 1NC4B 4PB0L 1JN6A 4IJ3C 2DM7A 4M4PA 2AJYL 4GRMB 1VFBA 1LO5A 1XCQB 1A3QA 1KEML 4OLXH 1TNNA 5EFIA 2NXZD 5DO2D 4HPYH 4NDMB 1KT2B 4LEOA 3L5HA 4NP4H 3RUGA 1OAXH 3SE8H 4E5XB 4WFGD 1J86A 1DQDL 4N0UB 1GZQA 3U1SL 5GGRA 1XGRB 1VGKB 5D1QA 2ATPA 2B0SL 1MLBA 4ORGA 5C0CA 2NXZC 5JW4R 1QR1A 4S2SB 4NQDA 4ZPTA 4PD4K 1LK3H 3NVQA 3QPXH 4DK6A 5IHBA 1ORQA 3H7LA 1R5IA 5GGTA 5T1MA 5GZND 1F11B 5I1KL 4DFIA 3EYFB 4P4KC 5B38B 2IGFL 4JPWH 2R9HD 2XY1A 4JZOA 4HMDA 1M4KA 1KC5L 5AG8A 1YEDA 2A9NL 1NUDA 3ZDXF 4ZYKA 4PY7B 4MA3A 5C0FA 3MYJB 2OP4H 4J6RL 4YDKL 2DWDB 4V1DB 2D03L 5FA3B 5GZNC 1CQKA 4S11A 3RNKB 4KJPD 1WWAX 1M6OA 1WWCA 2R9HC 4Z5RB 4WU7A 3PWNB 4JHAH 5H2BA 4D9RD 4PV9B 5SWSD 3IDXL 1S8DB 5DJAB 4RIRA 2R23A 2O5ZL 3BPLB 1J0KA 5DJCB 1FHGA 3S97C 3UBXI 4BFIA 4XPAL 5IWLA 1QSFB 2EDJA 4FZEH 4KJPC 2VN4A 3RWDB 3IDNB 3VFTA 2KL6A 2AV7B 1BPVA 1HEZB 4U1IA 3SE4C 4F7TA 4XWGL 4OZIA 3HRZA 3SDXF 2CD0A 5K9QG 3OB0H 1H0DB 3CSGA 1U3HD 1KB5A 1EHXA 3B9EA 1DUZB 4NOBA 4LSQL 3WXWL 4RRPA 2Z35B 3IGAA 1UXSA 4JO3L 4E41B 3OJDB 1BOGA 1KEGL 4JG0H 4Z7UB 1AFVH 4YHNA 5C0BD 5CZVL 3HG1B 1U3HC 3DXAD 1ZVHA 3SO5A 1R24A 3Q48A 3VFUA 3GJFK 4OGYL 4P3CH 5FYLL 1TVBB 4PJ9A 1ZT4B 5JMRA 3B2VH 3TGXA 1GZPA 4RMTA 1EGJH 3S88L 4NIKB 3MRGB 3F7VA 5HDBE 3O4LB 2IANB 3LQAH 5IEHB 1YY9D 3BGFC 3O41B 5DUBB 3WDJA 3FONB 3FOLB 5D7LD 1YDPB 4D3CH 1EEUA 1VESA 2D0HA 4C56A 3CU1A 3TCLA 3MLTA 4EDXA 4M5YH 5I9QC 4G8EA 4S1SL 1AD0B 3LH2H 2NY0D 1RU9L 1PKOA 2EE2A 4QRQB 1RULL 1G9NC 4BELD 3IDGB 2FYYA 2JJSC 1KCUL 1YY9C 4RAHA 2D9CA 5IBUG 3IU4H 2Q8AL 2YKLH 1YUHB 2NR6D 1A6UL 1RHHA 5DF0A 2L4OA 1FDLL 4JAMB 4ZDHB 5L8KB 2A6KA 2ADGB 4P5KB 2C7UB 2NY0C 2D4FA 4HWBL 2C9AA 1N0LA 1J87A 4PYHA 4GXVH 2NR6C 2V17L 1JK8B 3NCEB 3WBDA 1XR9A 1HYSC 1WBYA 3OR6B 1H3WM 1HE7A 4NM4H 4D8PA 3FN3A 1NCAL 3GBNH 1AP2A 2X4SB 4FFZL 2EDDA 3DMMA 4S1QL 1ZEAL 5K9OB 5DZLA 1A6TB 4KZEH 4MXVF 5J06A 3HZKA 1YEJH 2VB5A 3RBGA 3U0PA 2Z4QA 2EXWD 4Y8AA 2BC4B 2YSSA 4TUJA 2XQYK 5SWZA 4H88L 2R4SL 4ZQKB 2XTJC 4G42A 4JFHD 4N1EA 2CKBH 2ZSWA 1RZ7H 3WLBA 4PY8I 1E4WH 2EXWC 3OKMB 4OIIH 5HYEA 2IAMB 5D1XD 4PJCB 3U6RA 4TVPE 4YO0B 4NHUB 4Y19B 1UKTA 4YPGB 1MWAA 3DWTA 4HZLA 5KG9A 3FT4A 3LZFL 2W9LA 3MACL 5I74B 43CAA 4LPYA 2G9HB 3ULUE 3B4NA 5D1XC 2J6EH 5GS0D 4PJEA 4TTGA 4F9PC 1E4KC 2LE9A 3KS0H 3S3PA 3O11A 1T1YA 4ZUWA 4RX4A 4L4VA 4NQUA 4WY7H 3MUY1 2YN5A 4KRLB 2P8MB 4LOUC 5GS0C 3GSVA 1J1XH 3FO0H 5E8OA 1YC8A 2ID5A 4M8VA 4OCYL 2ADJB 5I8KH 5EWIL 1D5BB 5D7IA 5CZKA 2RAMA 4L3AA 3AY4A 5IMOB 5D1QD 3H7BA 3IETA 3U82B 4HBCL 5C0CD 1BQHG 2NY5C 4AK1A 4NQDD 3RPIB 1JGUL 2HVJA 1U3ZA 4UDUA 3PGFL 3UCRA 4P59L 5IF0B 5FDWA 1MHEA 4NKOA 5F3HA 4N5UA 1XGQB 3U9UA 2XY2A 1BMGA 2NY2D 3HZMB 3UTSB 4XCFL 5D70L 4XPGL 4KDWA 2DLEA 4P5TA 4YBQD 4MCYA 4NQEE 4U6XA 1A6WL 4LARH 2EEBA 4OD1L 2EECA 4JKLA 1LNUB 2VLRA 1ZLVK 2NY2C 4JRYA 4PR5A 3MRKA 3D9AL 4GQPH 2DM4A 2BY0A 3RWCB 2DLTA 3OHXB 4MJ5A 4YBQC 3PP4L 3S37H 4H26A 1A9BA 4JFPA 4D9RE 1XGPA 2VXSL 2XNAB 4K23H 3L1OH 3MROB 2PYEA 1IC5L 4LFHG 3WO4B 5FA4B 3MRDA 3QDMB 1Z9MA 4H8WH 5IFJA 3RWGB 5E2VH 5IWLC 3CDFA 4FZ8L 4RNRB 1B4JH 3DVIA 5ACMA 2NPLX 5HYSA 1ZHNB 4QXUL 4X6DB 4BH7B 2XA8H 5EZLB 3C6LA 4ZODA 3CZFA 3DBXB 5DHVA 3CDGA 1KELL 4GG8B 4IDJL 3UTPD 5L0QC 4H1LG 5D9SA 1CFQB 3BP6B 5T1KA 3VXUE 2ZUVA 5EB9A 5C0BE 3DXAE 5EOCL 3VW3L 2EDRA 3S36H 3P77B 4I3RL 3BX7C 1F6AB 2WLYA 1HHJB 3HC4L 5C3TA 4Z6AT 5KVGH 4HK0B 3ET9F 4GG6A 4N0RA 2OK0H 1GGCL 1MFBL 5EU3A 5IUSA 1PSKL 2Y36L 3GIZH 4ODWA 1FZOB 5I1AA 43C9A 3KJ6L 8CGTA 1R3HB 3CX5K 4BZ1H 3G6AA 4HWUA 2I25N 2DQTH 2XPGA 3I6KB 2Y5TB 5BVPL 4L4TE 3BXNB 1PJ9A 4XAWL 4PG9A 5CBEA 3H9HA 4L4JA 4BSVB 3GSXB 4MJIA 1U3YA 2R69H 3O9WA 1M71A 3SDCB 3CPLB 4X98B 3JV4B 4ZUUA 3U48A 1A1OB 2DQDH 3HMXA 3VWJB 5CEXA 5L88H 3TPKA 1BQLH 3WD5L 1IC7L 3D18B 4KDTC 4HMCA 3A6CL 1CK0L 3U4BL 2I9TA 3AXLB 1ITCA 4HIXL 1K4CB 3OL2A 5ICXB 4ERSH 5I1JL 2MSPA 2IQAA 5ILTL 4UZGA 5B8CB 4KTEH 3P0YL 4A6YH 4BFGA 1H5BA 2BMKA 3DMMD 5F7EL 1WJ3A 2ZG2A 1CE6A 1T4KB 4HKJB 2FR4B 1VPOL 2VDLH 3TJHD 1JF1A 5EIIB 1Q72H 1EX0A 2RJMA 1CICA 4M1DL 3OGCA 3IDMA 1V05A 2R0ZL 3HC0B 1F3RB 3V0AC 4JM2A 5J6HA 5HJ3A 1E4XH 3WFDL 3GSUA 1W72B 1P4BH 4JN1H 3WXVL 2CR3A 1K8DB 3DMMC 4XP4L 2FLBT 1FYTB 3T0XA 1NEZG 4U1JB 3TJHC 1X5JA 5JORB 5HVHB 5GS2H 2ZCKH 3FQUA 5DQDL 4PJ5B 5I73B 3T77A 3U36B 3Q1SL 1ZA6B 1XIWB 2L0DA 1BECA 3VXTA 4X6CF 1BIIB 4S10A 4LEXL 4HGWA 3UJJH 4PJFE 1P7KB 4D0DB 4TNWF 1MCJA 1VEOA 4QGTA 3WS6A 3BT2L 4UOW1 4S1DC 4Z8FH 4JPIA 1D9KA 3DNKA 4G9FA 1YA5A 2MJWA 4KKCD 4JZJA 4L4VD 4WFEE 1ZWIB 2YRPA 1OPGL 4U1LB 3MLXL 1N26A 1BHGA 4FNLH 3X14B 3FTGB 4R26L 1E6JH 1RUQH 2HRPH 3HUJA 3EIFA 1S78D 3EOBB 3RZCC 3TO2A 4F3FB 3HCVA 4G80B 5INCA 1BBDH 4KKCC 4PLOB 4JJ5A 2BNUA 5DC0A 3RUGE 5GISH 1KCSH 1AR1C 1I4FA 3J8F7 4LF3B 1S78C 3VFVA 3E0GA 4EN3B 2XV6B 3RVXC 2R4RH 4PBVC 4IRZH 3SJVB 5C0CE 3BIBX 5IESL 5DLML 5IBLD 5EBWB 1G6RB 3AY4C 4LCCC 5EN2A 2J8UF 3VRIB 1WZ1L 3WJLA 3D39D 4CBPA 1KTKE 2CDGB 3BEVA 3C5JA 4JVUA 3RKDD 5I71C 5EU7C 4PJBB 1OP9A 3CK0H 3I3EA 4P5TD 3SKNA 4DKEL 1IEBA 3LN4A 5J7CC 4TQEH 5IBLC 4M6NH 4LQFH 3G04B 1AY1L 2BRQA 3DGGA 4P46D 4LDEB 2VLRD 4KZDH 1U8NA 4JRYD 3ZYJA 3C2SA 5L7XL 4JFYB 4L9LC 4WHTA 4R96B 1KFAH 4QCIA 4P5TC 1J12A 3WDIA 1JZ6A 2BSED 3P4MA 1YQVL 3NPZB 4DN3H 1Z3GL 3MJ8A 1HHHA 3K8LA 1RVFH 3UZQA 4P46C 4JM4H 2PYED 4YHKL 1UM6H 3S5LA 1QLFB 3RL1A 4E42A 2ZCHL 1ZOXA 5GGUA 3QPQD 3V7AE 4U6TA 3KXFA 2XFXB 5J4MA 1NL0L 3K4AA 3C9NB 5E4EC 1AXSA 2CRMA 4Q0XH 2LQRA 2AEQL 4OZIE 3O3DA 2R15A 3OAUH 4OQ1A 3C6LD 3FJTA 4KROB 1AGBA 3EDFA 3MLUL 3QPQC 1DSFL 5KVDL 3MBXL 3SKMA 4LSPH 1NC2A 1VFAA 4FXLA 5FHBL 3TZVC 2UZYB 3V5KB 4MD5A 1U92B 4LPTA 4YLQT 1J8HB 3VDBA 2MCPH 5LGJA 1F4YL 2NY7H 1FNHA 1U91A 2UZIL 3HE7B 3PDGA 3O3AA 2GK0B 4KY1H 1HN1A 3HN3A 3TA3A 3EYOB 4GRWF 5HGBB 2MKWA 1YN7B 1GGBL 5HI3D 5K93A 3P30H 1AXTH 3GRWH 3M8OL 1RUAL 3GI9L 3HR5B 1S9YA 4PLNC 4F15B 1K4DB 1F42A 6FABH 3X17A 1HHIB 2B5IB 2EIZA 1WIOA 4C56E 5FOBA 3RWEB 3QRGL 1XGYL 1IQWH 4J3XA 5ID0A 1DR9A 2HWZH 2PR4L 4I3GA 1F6LL 2DIAA 3R8BB 3K8MA 5F9WC 5C6TL 3HNVH 1FL6A 2IG2H 4KMQA 4S1RL 5TPWL 3BYYA 1KN2L 4L3ED 3CSYB 3VH8B 4GKNB 4LCWA 4LGSB 3PJSB 1MIML 3RGVB 1NANH 1WV7T 5F9JB 4JFDB 4H5SB 3SKOB 2W0KA 4OFIA 1E27B 1EMTH 4XGZA 3WIHA 1TQCC 4ONHA 1JGDB 2Y1VA 1N64H 1NAKL 3OKLA 2PW1B 1PD6A 4OD2B 1T1XA 4GKZB 5MEQB 3M1BA 3NIDE 3NN8B 1EEYA 4YBLC 1CICD 1FFPA 2R2BB 3U79A 1AHWA 4JM2D 4Y5XC 4EIZC 3HRPA 1SJHB 3GMNA 4XXCC 3INUL 5I1EL 2W38A 1A2YB 1CVRA 3KYOA 1NUFA 4ZO9A 5FUCE 3IVKB 3KG5A 2X2YA 2KQNA 1CICC 4GBXA 3WN5C 1TCRB 2V9TA 4U6YB 2IALA 5SWZE 3G6DL 4JM2C 2XWJA 1RUPL 3U4AA 3NCFB 1OAUH 1ZGLP 1RD6A 1ZHKB 4WJ5A 5J1TC 5ABDE 1ZANL 1T04A 2CQVA 1CLZH 2XQBH 3ECBA 4J3VA 4PGCA 1MY7A 4PJHF 3V7AG 4DKFL 1G0YR 3IJYA 1EK3A 3PWVB 1ETZB 2NX5A 2R2HB 1T21B 4XXDA 3ILPB 1ZLUK 4K94L 1D9KD 4RFOH 4G9FD 3QRFM 4PJEE 4CMMA 5J1AA 3KS0J 1R3JB 5JIHA 3S8WA 4KPHL 4WWID 1YN6A 4RRPG 15C8L 3I3DA 4L4VE 3QO1B 3ELAT 4YC2B 1ZT7B 4OUOA 4P9HH 1UCTA 2ZJSH 3B9AA 5DZOA 3SE9H 1KGCD 1S7TB 4LPVA 5F6IC 4IRJC 1I9RL 5D7IE 4PJAF 1JUFA 3K46A 4OCRL 4XPBL 5JUEH 4RWYL 3MOQA 4OLUL 5GQBA 3D6GA 4JDTH 3HA0A 2YN3A 4N0UE 5DURB 3DO7A 1LEGA 1I9EA 1A0QL 3DVFA 5EU7E 3TT3H 4RMQA 3RWIA 2HJLA 2PCPB 4NM8L 1SYSB 2DM3A 1OT2A 4KK5D 3PNWA 4DJMA 3GSWB 5IGXL 5J8OA 2IADA 4HJJH 4ZFGL 3G5YB 1U8LB 1YPZA 3NFSL 5T3ZL 4KV5F 1SY6H 4LLMA 3WJLC 1HSAA 3E6HB 5GSVB 1G6VK 1MCDA 3G08A 1INQB 4OCLC 2PO6B 3KYNB 5DYOA 4PUBL 2BJML 3HLAB 2J8HA 4KK5C 4JO1L 1UH3A 2B1HH 2VLRE 4V1DE 4JRYE 3LHPH 1LE5B 5T33L 2QSCL 3MR9B 2AJYH 3MUZ1 1TJGL 5DDHB 1FGVL 1OM3L 4LGRB 2FD6L 4HXBH 3H9ZA 3LD8C 4AQOA 2PYEE 4P3DB 4DUXA 3D87B 3NTCL 2WZPD 3NCYS 1MRCL 1MVFA 4L8SA 3QJHA 1TCMA 4FP8H 5KSUA 1DQDH 4P4RB 4BSWB 3MV01 2JB6A 3WUWB 3TIEA 2NW2A 1B2WL 2IH1A 3O6KL 1NC2D 2C1PA 5DD5H 5F96L 3VWKB 4D9LH 5ICYB 3W11D 5KVFL 3KYMB 4NHCH 2WLZA 5I1KH 3DIFA 3GBML 4PJDB 4Q9QH 3BYTA 4GUPB 2IGFH 2QQNH 5I1LB 3M17A 3KLAA 1WT5A 2BSSA 3ZDZE 1KC5H 2A9NH 2DMBA 3TJEH 3SDAA 2ARJA 2BVUA 4MNQA 4NT6A 4YDKH 5KTEL 4KK8D 3W11C 2D03H 3VJ6A 2GITB 3QIWB 2CO6B 3IS1X 1A7NH 1L6ZA 3OGOE 4NKDA 4WENB 4GG6E 3KJ4B 3GSNL 3IDXH 2WV3A 2X89A 2O5ZH 4BH8A 1MFAL 1T0NB 4K71C 4KK8C 1W2KT 3O4LE 4MA7L 1V3KA 4J12A 5HPMB 1ZA3A 3RY6C 4ZOBA 4Y4FA 2J8OA 2VNCA 4J4PC 5CIPA 2FWOB 4KJQC 5IG7A 1QQDA 1CD8A 2NTFB 4KAQL 1BLNA 4MJIE 5FCUL 4I0PB 4NQXA 1CR9L 2H6PA 1VGEL 1ZKAA 1ZT1B 4TN9A 4UQ2A 1KJ3L 5C8JA 4JFEA 4PLKD 2F53A 4H0HB 3I84A 3DX8A 4LCWD 1FYHB 3IDJA 4KTDH 1Y0LA 1QG3A 2QADD 3P4OB 5D8JH 1KEGH 2WMPA 1NSNL 4NFCA 2J1KA 3G5VB 3ZTJG 2O5XL 3OBAA 5EC1B 4P3WA 5GIRB 4NQTA 3MJ6A 4PLKC 4R7DB 5EOTA 3ZDYF 3CMOH 4NQVB 1A7BA 5I15L 3OG6B 4ONOA 4GW5A 3STBA 2OTWB 3S88H 1L4IA 3RTQB 4QRTB 1WZLA 2XZQL 5I2IB 3EJJX 4Q9BA 1H3PL 4OZGA 3LQZA 5K59E 1JHTA 1W72H 3JV0A 3GMRA 4GBXD 4TPRH 3E2HB 4OJFL 4Q6IB 1AHWC 5GZOD 4PP1C 4NUJA 4FQXA 3VRJB 1KCVL 3KR3L 1M1SA 3NA9H 1RU9H 1DQQA 4XCNA 1YMMA 1QBLH 3HC3H 2GT9A 1A6UH 4GBXC 2HKHL 4RAUA 1DQMH 4LVEA 4R9HA 1OP5H 2AQ1A 5HDBF 3IDIB 2AV1A 4PJCE 4YK4B 2NX5D 4QHUB 1J05B 3T2OA 1VCAA 1O7SA 3JV6A 1L9NA 3OG4B 1DUYB 4X0KB 5ERWA 4XZUB 1JHLH 3QI9A 3C87A 3IJHA 3VXPB 1U8KA 1TTUA 1O7VA 5HYSG 3VGAC 4FABH 1G9ML 2XKUA 4TNWK 1T20A 3I75B 4G9FE 5DK0A 1JCKA 3B5TA 5MENB 4FFZH 1LDPL 4QRRB 1N6UA 4S1QH 1EUTA 5I6XB 4Z7OE 5EBLA 3NFNA 2CXKA 5EUOB 3HUJE 4G9DB 1KB9K 2FATH 3LN5B 2C3XA 2HFFA 4IRSC 5IT2L 1FGNL 1FZMA 2VLKB 3EHBD 3P4LA 1P4LA 2X1OA 1KGCE 3EOTH 3BRDA 4H88H 2OXHA 4PJIA 4CW1B 1T7ZA 1IRAY 5T1DH 4YR6B 1BFTA 3GK8H 1MFDH 1EO7A 3EYUL 2PTTA 1ZS8B 4YH6A 1C8PA 3EHBC 1KLGA 1G6RH 3T4YA 4K3EH 3CVIH 4GMTL 3C60A 5KSBB 2HFEA 4XB7A 1NCCL 3HPLB 1UM4L 1W8NA 3QG6B 5E8DH 1XGUB 4LHUA 3UTSE 3LZFH 1QPXA 1QSEB 1TZIA 4I9WD 3T3MF 2D7NA 3FQTA 5MI0B 3IT8D 4WWKC 4XCEB 4XT1C 2VN7A 1QA9A 1DANU 4Y16A 5DMIL 3RX5A 1U8PB 3BZ4A 3NAAL 4LL9A 1SEBA 5ID1B 3BI9X 2IPKB 4Y4KC 4CVWA 3IFOB 1UG9A 4MB4A 1D3CA 3QQ4A 3TYGL 4IIQC 3KXFE 2CDFA 5EO1A 3OV6A 3ULUF 1DVFB 5DK2A 1X5ZA 5F7DA 1JWSB 1IGYB 5T1LA 5L2JB 2XZCH 4NJAH 2CDEB 2CKNA 1JGUH 5ELIA 1GGYA 3ZSTA 2ERJC 1ES0B 4IHOA 4P57B 3MJ9L 4POYA 4OTXH 5I8CB 4Z0BH 4TSCL 2G60H 3D3VB 3FQNA 4X5LA 5J9PA 1UGNA 2DBLL 2K7PA 3HAEB 1AQDA 1E0OB 3QUMA 3OXRB 4XCFH 1EO5A 4PP2B 5D70H 4X6BA 4FFVD 3OKEA 3SDAD 4RISL 3OAZK 2VLJA 2IMNA 3ZE0E 1S9WB 4M5ZH 4OD1H 4M48H 1J88A 3QDJA 3IDYC 5JW5A 4MDIA 2ZOKA 3MZTA 4WFHD 4PRNA 2FHFA 3D9AH 3OKKB 1NCWL 2BVOB 4FFVC 4WI6A 1I1YA 3PP4H 1F4WL 5IHUH 1HHKA 5AD0B 1UQSA 3FCTA 5EPMA 3D0LA 3GJFA 2ICWA 4XP6H 4QHMA 1I3VA 2EH8H 4F7EA 1MCEA 3CLFL 1QRNA 1XH3B 3EUUA 4GW4A 3C5ZC 4L29A 4N9GA 5JXEA 3VCLB 3O3BA 4P0DA 3UJTL 4FZ8H 5FGBA 35C8L 3T0EB 5E2UL 3U7WH 4CVZB 3OR7B 2GIYA 4GO6B 4JFED 1UWGH 4EUPG 4HX1B 3S4SB 2F53D 4Z78B 1CXLA 2YD7A 5KJRL 1UH2A 2F74A 3UTQA 2VSCA 4WEUD 5JR1L 3V6ZB 4IDJH 3VDCA 1NJ9B 4HWZB 4LCWE 3C8DA 4N90D 3S98A 4YQXL 4KI5C 3ARGC 1UB6B 3MRBB 4RBPH 5D2LB 5ALBL 4AL8H 2HVKB 3Q3GA 1MH5B 4LLVA 2OR9L 5EOCH 3LKPB 1IFHL 4WUUD 4PLJD 3KYAA 2HP4A 2QR0A 4XBPA 2X4OB 5C9JA 3DLQR 4OF3A 3CFIC 3P4NB 4HWNA 4C54A 4PBWD 4MHHI 5IMLA 3P9WB 5CGYD 4EXPX 4QRUA 2Y36H 5KSAC 4MQSB 4QXTA 1NLBL 3JTTB 3LIZL 4PLJC 3KDMB 3FQRA 3EZJB 4FQXD 3Q0HA 2DQCL 3SDYL 3RWFA 5BVPH 1FYTE 4GRLC 5IBTL 4XAWH 2MFNA 1YEGL 1YMMD 4PPTA 3MOAH 3X11B 1VADB 4YHIB 2HFGH 5EIQA 2LU7A 4PG2A 4PJGA 3EYVB 1HH6B 2VL4A 2CPCA 4FQXC 2I5YL 4R2GB 3WD5H 5D93B 5D7SL 5J13B 1IEHA 1IC7H 1T1ZA 2DF3A 1OGTB 3HNSL 2QHRH 1CK0H 1OD7A 1QFPA 3BWAB 1FG9C 1MEXH 2NX5E 1I8LA 5E8EA 1NGZA 4O2CA 2YOCA 2F58L 5CGTA 5ILTH 1OY3B 3B9KB 1A3LH 3D1MC 1T0MA 1MCHA 4U6VL 5C09B 5F7EH 5FYJH 1GXEA 2DYPD 1VPOH 1ND0B 3GMLA 1EA9C 1N3NB 2VL5B 4DAGL 1S7WB 4M1DH 4X5WA 2YZ8A 4D0BA 5IW1A 5CMAA 3D25B 2WP3T 3TBYA 2C4XA 2CJUL 2FHCA 5GJTL 4NNXB 3REVB 3F65A 1VB9A 3FO2B 3EGSB 4P2RD 1IGCL 5HHOD 4ZOCA 1I1FA 3PP3K 2NLJB 5LQBL 3Q1SH 3SOBH 4RGOL 5AYUL 1QPPA 3QEGH 4MXQD 4NFDA 3OKDB 4ZO8A 4XCCL 5LWYL 4OCWH 1EAPA 5ECJE 4WI3A 5IVZB 4JLRA 1EXUA 1JTTA 3LKQA 4LHUD 3U0WL 4HDIB 1YPZE 4WHYH 3IFLL 3WL9A 3AMKA 4MXQC 4OQTL 1TPXB 3H42H 3SGJA 3CZJA 2B39A 3QUKB 4Y16D 2WIIA 4NZRL 1FRGH 4TUKL 3C8KA 5HYQB 4I9WE 4IEFB 4ZFFA 4HIJA 1BAFL 3V0VA 3MV8D 1OPGH 3MMEB 3OSKA 3BD3A 2D4DA 4OGAD 1HHGB 2AJSL 5BMFL 4R26H 1A21A 1MREL 1DBJL 5C0EB 4NO0A 4WO4B 3MODL 5DGRA 4CMHC 4FOMA 4Y16C 3O6ML 2A83A 4HS8H 5IJVB 5JHDB 1F5WA 2UUDK 4ZAKB 3W9DA 3BSZL 1T7VA 4ELKB 1XR8B 1BBJB 2VAAA 3RNQB 5FB8A 2J3SA 4OGAC 3VFRB 2X44D 4W70A 5T1LD 2NW3A 1ZGLM 4R90H 5I8EB 3R06B 5GS1B 1U6AH 1P7QA 1E6OL 5DLMH 3KPSA 4YHZL 4RGNB 4CU8A 2OYPA 5JDSB 1J1PL 1I8MA 2EYTB 1FE8L 4LIQL 1GOFA 1JWUB 1KPVB 2GQHA 3RUGF 3WMSA 4JKPL 1CXEA 4WEBL 1CFBA 4Y5YB 2CLZA 2ZKHH 3C8HA 2K3TA 4MNQE 1Q8MA 4Z76A 3SDXB 1I7UB 4O2EA 5ITBL 5L7XH 3BQUA 1FZKA 4O9HL 4NZDA 3MRQA 2ZPKL 2I07B 3TPUB 1EV2E 4WFHE 4HULB 2ZWLT 4PGJA 3RDTD 1N2RB 1Q1JL 4YHKH 4MQXD 3ALPA 1OAQL 1QRND 4NQSA 3QZWA 4G8GB 1I7TA 5GHWH 4CRPA 3LRSB 2P5WD 2APBA 3W39A 1AIFA 3RDTC 1NMCC 3EYQD 2AEQH 4CADB 1Q9OA 4BZ2L 5I76B 2M8XA 1R3LA 4MQXC 3ZKQD 2DM2A 4AIZB 4ENED 1XCTA 1JNHB 4JFEE 2D3VA 3I9GL 3P73A 1MCFA 5FK9A 3P11L 3TCXA 4P2OB 5CP7B 1CDUA 3EYQC 1IJ9A 1YZZA 2W91A 4XMKL 3VXOB 3KPTA 1R5WB 3MUHL 5D6DA 4X5XA 4IOIA 4X9FA 2VXQH 4BA8A 4G6KH 2MTPA 4QT5B 1F4YH 1M7DB 4ENEC 3QQ3A 2ZUQC 3BPOC 4QY8A 2UZIH 4OZIF 4J8RA 3JTSA 3VG9B 5IB4B 2M1KA 2ITCA 4LRNL 4B0MM 3BISA 1MCSA 1GGBH 1RZ8B 2FO4A 1RK1B 4OLZL 3W2DL 4UUJA 1I3GH 2ZSVB 4U2ZA 1RUAH 3FQXB 3MTRA 1FAKT 1RIUL 3GGWB 1JP5A 4D0CA 5CINL 3BIAX 3TYFB 4QF1A 1S3KL 1NGWB 1QLRB 4G6FB 1K6QL 5FGCB 3U0TB 3UJIH 4NWUL 1XGYH 1KTDA 1FCCA 1WZKA 3A6BH 2Z8WC 4FQ1L 4K9EC 2MQ0A 5DJZA 4KJWD 1MHCB 1YMME 2AJ3B 3HNTH 5A3ID 3Q6GH 1YEEL 1QR4A 1I3RA 4JPVL 5E5MA 4AJ0A 2BVPA 5D2NB 5TPWH 5F9AC 2PYFA 1KN2H 3O6FB 4LKXA 5I18L 5K9KA 1MFCH 1DQJB 4IOFD 4LVNB 4KRMB 5B39B 2A74A 1A4JB 3BDXA 4KJWC 3L5IA 3IAGC 1DE4A 5A3IC 4D9QD 2AK4B 3OXSB 1BEYL 3EFDL 2LABA 5DJ6B 2KBGA 4ZNCD 4PREB 3H6JA 3HG1A 2Q86A 5DHYB 1IGIL 4CVXB 4WNQA 5MP6L 4YHOH 1G7HA 1OW0A 3F7PC 3U30B 3H3PL 5INDA 3FT3A 3O8XC 3MLSL 3FL7A 1RZFL 1NBVH 3INUH 2A2QT 5E2TL 4HLJA 3WDHA 1Y6NR 3UC0H 1UXWB 5I1GH 5DQJB 3QXTA 5E94B 4W68A 4UU9A 1MNUL 1IM9B 2YK1H 4PJIE 2JF1A 5DJDA 2PXYB 1F4XH 3B83A 3BIKA 3FB7B 4PTUA 1QHPA 3NIDF 1CWVA 3O45B 3F62A 5ESQB 1CF8H 3PGCB 1S7UA 1PY9A 3H9SD 3VI3E 3K1KC 4DKFH 2VDOL 3HMWH 3QCTH 4UQ3A 1OGAA 4NJ9L 4UIMB 3VDAA 5JPMB 3RU8L 5J1SC 1G7LA 1XFPA 3CJJA 1KG0B 2A6IB 3O0RH 5JO5B 4PY8J 3PWLA 4MGXA 4XPHL 1CFSA 1T5WB 4TSBL 2H1PH 2YC1B 2ZUWA 2OXGA 3X3GL 3BEWB 4R8WL 4KPHH 1CXHA 4U1KA 1IGJB 2VIRB 2GYSA 5C0AA 1U8JA 4NO0D 3CMGA 3F58L 3BP5A 2PNDA 5HPOA 5IJKA 4JY6A 4GQ9L 1D5ZA 3MRHA 3O2VL 4YHLH 3N50A 3T2QA 1ZLVH 2AEIT 2VDPH 4FXGB 3BP4A 1PEWA 1FVDA 4MA8L 1MQKH 1GVIA 3F12B 5FFLA 4Y7MA 4XPBH 4AM0A 4PJEF 4YXLH 2CUMA 4M00A 3KPSD 2D2OA 2VITA 4U1NA 3FQWA 2VC2L 3QIBC 3QXVA 3EFFA 4RWHA 3V8CA 3MRLA 3QNZA 3O2WH 4OZHF 3HAEH 4GSDH 3MRNB 1A4KB 4PJDE 3LKRB 1YEFL 4LHQB 3VGGA 2YPLD 1FNEB 3FO9A 3MGTA 4X9BA 4XNQA 5D7IF 3V4UL 2W1NA 2WWKO 3D69A 3PGDB 4PUBH 4XTRD 2VLJE 5EUKB 1I85A 1L0QA 3BQUD 3PDOA 4JO1H 3UZVB 2Q76A 4DGIL 5J3HD 3QDJE 3NA4A 5BRZB 2DQGL 5CJXC 3WHE0 4U1GB 4JPKL 1WF5A 1TJGH 1OM3H 4U1HA 1X4ZA 4HCRL 4XTRC 2FD6H 5D1ZB 5JW4N 5J3HC 5DVMA 1FN4B 2EDEA 2YUZA 4LVHB 4PRDA 4AY0A 3DRTB 3NTCH 4M7KL 4XC3L 1QRNE 2RHEA 3TH4T 4UINH 5CWSA 5HI5D 1FG2B 4PRHB 3MNWA 5DUML 1B2WH 1BX2B 1L7TH 4KJYA 4MZ2A 4YJZL 4OB5H 4DW2L 4FFYL 2EYRA 4LU5H 1WICA 4LQ1A 1OSZA 2ICEB 3DO3A 1BVLB 1FL5A 2VDNL 4LSRL 3PHOA 3ZE2E 2WBJB 3HFML 5IFHL 4JGMA 3WHXB 1NGPH 1J1OL 3GBMH 5HI5C 1NDGB 2H8PA 4XMPL 1DBML 4UIKH 4A2MA 4XP1H 2MKLC 1B88A 4RA3A 1WEJH 5F44A 4UAOC 2FECI 4OT1H 5EOCJ 3HPJB 1C12A 2P7TB 1Y6KR 5HGHA 5KTEH 1Z5LA 2NY1B 5D6DC 1ADQL 4DCQA 1OTUD 3TO4B 2XXCB 4X6FA 2FX8L 1S7QB 2QKIB 1M7XA 3U7AA 1C7SA 2ZUTA 3QCUL 1NGQL 2JCCA 3FFDB 1S7SA 2H41A 4LHUG 3UTZB 2XWTA 4RMSA 1I7ZB 2FECL 1GL4B 3FB6B 4MA7H 2WP3O 3PQYB 3QNXA 3ZDZF 3MRJA 1BFOB 1FNGB 5BV7L 1AE6L 1Y18A 4EQ2A 1NMAH 3BPNC 5FECB 3V6FB 5L8JB 4LLWA 3AS2A 1VFUA 3SPVA 4KAQH 3L9RA 3PL6B 1CR9H 3BPLC 1VGEH 1PLGH 1OT1A 1KJ3H 5DVNA 3UYRH 1A7QL 1CT8B 3ULVD 1LE9A 2R0KL 4OAWA 5BQ7A 3ROOA 2W9DL 3WIFA 4ZNEA 5I75B 2Q3ZA 4LSUL 2XKNA 4EBQL 4PRAA 1NSNH 5K9QI 1RZIA 5GGRY 3V5DA 1CLOL 4OD3H 3SCMA 4KKAD 4I4WB 3VI4E 3HG1D 5E9DB 5I15H 1N7MH 1CFTA 4F7CA 4U6HA 1XF4A 1SJEA 5E6IB 4X6CB 5EBMB 4W4OC 1P2CB 1MRDL 3DX7B 3UDWA 4KKAC 2XZQH 1ZGLB 5KBNC 2V2XA 3ZKXB 4JQIH 1X4XA 1H3PH 2EDOA 5GGQL 1MHHA 3ARDB 1DLFL 1XT5A 1J7VR 4GS7B 3LS4H 3VRLE 3E3QE 1FP5A 5DSCA 4Z7VB 1KNOA 5GS3A 5HHPB 5ITFA 3KWWB 4PTTA 2DDQH 3IKCA 1A1MA 2X42A 2CMRH 3GMOB 4HHAA 1Q9KB 4KXZI 2Z93B 4JANB 2HKHH 1OGAD 5ALCL 5F89B 3UBXA 4M03A 1EFXB 5F70A 3VFSA 4JM2F 2VDKL 1JPFA 4O02L 4XVSH 4PD4J 4Y1AB 3THMH 4X99B 3S35X 2EC9U 2D7MA 1MAKA 5CHNA 1S9VB 1GAFL 3O2DL 5HHMD 5C0AD 2APTA 5IB3B 3GUTA 2WANA 5HDQL 4HT1H 4OBRA 2J8UB 4JFXA 4R6UA 4WHDA 1Q94A 2CLVA 4MXWL 1CLYH 2EE6A 4JFZH 4OF0A 2W0FA 2VZUA 5BOPA 4WV1B 3SGEI 2EYSA 2FX7H 4BFBD 1SM3H 4LSSH 4R7NA 3L3IA 5IJKC 3UPRA 3QEHA 1KLUB 4XBGB 1IM3A 4DGVL 3EYUH 4FG6D 2EXYD 5EU6A 1FIGL 3IRZA 4Z7OF 5AG9A 3FB5A 3AB0C 3HUJF 4NNYA 4O00A 3ESUF 4QOKA 4XNZB 5I66B 2W65B 4KRNA 4YDLB 4MJ6B 2ATKA 4CNIB 1NCBL 1DFBH 3BH8A 4FG6C 2EXYC 3GSRA 4E9LA 2BNRB 3BP7B 2D9QB 4MA1B 3ARSA 4RFEA 4K3JL 4X9GA 3GKZA 3QUYB 5JLZA 1NGYA 2IAMC 1FVEA 1CE1L 2R1XB 3L7FB 3OJVC 5DMIH 2GW5A 2Q8BH 5F1NB 4OV5A 5HDOA 3U9PH 1OLLA 3V6OA 4HS6B 1I85C 3ARRA 3DSFH 1CGWA 3JWDC 1NAMA 3QEQA 3MV7A 3NCYP 3RJQB 5I74C 3BZEB 3SGDH 5IHZA 2CGRH 5DVKA 1QBML 1WZMA 3KPOB 3DX9B 5JW3L 4ONFL 5FKAB 2YA1A 2I24N 1RJLA 3OKOA 2HJFB 4GRWB 3CCHA 4P9HC 5JIIA 4HLZG 3L95B 4BK4A 3AVEA 3QH3A 2E6JA 1IVLA 1T5XB 4TSCH 2H9GB 3EJYD 3VMNA 2AJVH 2ESVA 4Q2ZA 1ACYL 4AYFA 1DN2A 2NCMA 4PJXA 1UCBL 4G43A 3FN0L 3REWB 5I1DA 3PXHA 4WU5A 5EBGA 3SDDA 2DQFB 4QRPB 3L3KB 3DSNA 4Q58C 1CD0A 5F1IA 3EJYC 2DQHL 4ELMA 5D71L 4LSDA 5E1AA 4ZXBB 5JPNA 1C5DB 1ZK9A 9CGTA 3V4PH 5LKNA 5GGVL 5B22A 1MELA 3T8XB 5IVOA 3ZKMD 1QFUL 2XN9A 1OL0A 2JKXA 1HWGB 1GSMA 3TNNB 1KOAA 2B4CC 2WINA 3C5SB 4EVNB 3W81A 5CEZL 1J0HA 4POZD 2YD2A 3LPWA 4YNYA 5IKCA 1G0DA 1V5JA 3B6SA 3ZE0F 1AKJB 4HJGB 3ZKMC 3UJTH 2OQJB 1YEHH 3TP4A 3MPCA 3OZ9L 2FL5A 3DV6B 3VD3A 3DVNA 1G7MB 2O93L 4KHXH 1ZE3C 4POZC 4I2XB 1JV5A 5JR1H 4R4FL 1YEKH 1H8OA 2JIXA 2VLME 2CUHA 4HV8B 1BQSA 1MHPH 3WO4C 1T03L 1CTOA 3ULVE 3WEXB 1RJZA 2VTFA 1PVHA 3CXHJ 4JZNA 5IB2B 4YQXH 3SCMD 2VUYA 1LK2A 3VD5A 2J88H 3MJGX 4QXWA 4WI9A 2P5EA 2V2WA 5B3JE 5IMKB 3SQOL 2XG5A 2OR9H 4R4BA 5A2FA 3DETD 2X40A 1HOCB 1IFHH 1A7OH 2BOBA 3JWNC 4NSKB 4LCYB 1TZHB 5MERB 4ETQB 4Y88A 2B8OT 1RURL 4S0TD 1ZLUH 2DD8L 1TVHA 2QTEA 3KNBB 5JOFA 2IWGA 4K07A 4M1CD 2BVQA 3HHRB 3X12A 3QXDB 2GCYB 4XVTL 3WLWD 4BKLA 4LDLB 2Z31A 1MJ8H 3UDWC 3SDYH 1W0VB 3B3IA 5DD6B 4JHZA 4QNPF 5BV7B 3PDDA 4ISVB 5IBTH 5IOPA 5T3XH 3NCJL 1JNLH 4XBEH 5DS8A 1OF2B 4MAUL 5I8OH 1A6AA 3NACL 1QYGL 4HIIA 3AM8C 4FQLL 2IEPA 5KANI 3FB8A 4TVPL 2B1AL 5CEYA 4UT6L 5A16B 5FYJU 3QZWG 3VWJD 4KQ4L 4XH2B 3HNSH 1SYVA 2HMID 1UM5H 3ULUL 3IFNH 5H35B 3QIUA 2JJTA 4HUXB 2XICA 4OIAA 2NXYD 5HGDA 1PKQB 4NGHL 1MJJB 2HLAB 4LNRB 3VWJC 4P2QB 3CDCA 4QHNA 4LLQB 3EW3B 4P2CG 5FYLD 5HHME 2X1QA 3IXAA 2M26A 5C0AE 5KS9B 5ENWB 1HH9A 2GTWA 2HKFL 4AH2A 4O5LL 4XNMB 5DQ9B 1IAMA 1BVKB 2YZ1A 4X7DC 4NP4L 1OAXL 1EIBA 3ZDXE 4WW1A 4BQ9A 5JW4M 3IU3A 1LEIA 4XVJL 4MYWB 1KJVB 4NWTL 4RGOH 3VD9A 1U8MB 3DURB 2G2RB 5EG6C 3IS0X 1LK3L 3N1PC 1P1ZB 3QPXL 1AO7B 3QWOA 1XIWD 4AMKH 4QOKD 2EH7H 3TBTA 2FJGB 3NPSC 1G7QB 3A67H 4NZTH 5CP3H 4OM0H 1B0RB 3U0WH 2HT2D 4JPWL 2DQUH 5HVHC 4I48B 3IFLH 1JYXA 5I73C 3QISA 4OQTH 4KQ3H 5CS7A 4U1SA 4LLDA 1XIWC 1HQ4A 1KJ2B 2OP4L 1GC1H 2VR4A 5C0GA 1OTTD 1B0GA 3G5XA 1BAFH 2HT2C 3NH7H 1ZTXH 4JHAL 3QEQD 5AZ2H 1U36A 5MEOB 3MFFB 1NAMH 5IBUB 3MV7D 1EEZB 2YMXH 3PIQA 2LVEA 2UZXB 5F88A 1OTTC 1QTYT 5DJ0B 1M05A 3LV3B 1KULA 32C2A 1RJYA 1WITA 2SEBA 1FNLA 5D7JA 3ALWA 3F7YA 2X4RB 1H15B 2AEPH 4ACPA 1U8IB 3CX5J 1K2DB 1Q9WA 5ESAB 1MJUH 3UAJD 4ODTH 5TDOB 4UDTB 4DZBA 3QNYB 1E6OH 1AGDA 4EN3D 4L8CA 3SJVD 3FOMB 2OI9B 3GHBH 5HHNB 1J1PH 5MEPA 1D5XA 1C5BH 3MRMA 3TH2T 2YD5A 1T2JA 5DRNA 2EE9A 1C08A 3LPFA 1I1AA 3UAJC 4JG0L 1AFVL 5C2UB 4QTHA 4N5ED 4EN3C 1SBSH 2ZP0T 1BZ9A 3ZKND 5JDJA 3ULSA 4L5FL 4J23A 2C1OB 3B2VL 3LS5H 1HXMB 2DKSA 3BUYB 3HI6H 2JELL 2ZPKH 3PWJA 1KIRB 3STZA 3K0WA 1FZJB 3L5WA 4N5EC 2JCCE 2W60A 4DVBB 1EJOL 4QHLB 2V7HA 1JI2A 1PQZA 3LQAL 1MCCA 3HTLX 1RZGA 3EKCA 1CIDA 3PWPA 1T3FA 4D3CL 4YGAB 5DRXA 4QRSB 4ZFZA 4FQHA 4M5YL 1D6EB 1FV1B 4LSVH 4H25B 3EO9H 1QO3A 3LH2L 2X4NA 1DBKL 2XKSA 2DJSA 2JK5B 4BZ2H 5HYJA 4X7FC 3IU4L 2YKLL 1KXTB 2YPKB 3WS3A 2JIXD 2PTUA 3LRGA 4KROD 4MXVE 5JNYA 5TDNB 1N6VA 4M62H 4ZNEE 5IW6A 1CS6A 4XMKH 1UA6H 5DJ2A 5E8PB 3I02A 4E0RA 3HR6A 2P5ED 4GXVL 3VD4A 4JE4B 4PYGA 4KROC 3CGTA 4HIEA 4NM4L 5CSBA 1RUMH 4JG1H 1IZJA 3GBNL 3D48R 1F02I 4LRNH 4ALAH 5DD3H 5E5RB 3W2DH 25C8H 4Y5VA 4KZEL 1F90H 4NRXB 4MMXC 4PJHA 3VFNB 2VUOA 4KKNA 2UVFA 5F7WC 1JZ2A 3NFPB 3VD7A 1ZHBB 1Q0YH 2EDLA 1T2QH 3D0VA 3HE7C 1S3KH 3EOAA 5ACZB 3EYSL 5HYFA 2HYMA 1QEWA 2A1WH 4JFQA 4RQQB 3QYCA 2CKBL 3TIDA 5T3XE 1JMXA 3GSQA 2VXVH 1HYRC 3AU1B 4OIIL 1OB1B 1YEEH 3VXMA 4Z9KB 4JPVH 2V5RA 4APQA 4JCMA 4P23B 4L8DA 3TM6A 4OZGF 1A1NB 1FL3A 1RHFA 5IVXA 3I6LD 4YHPB 3QIUD 3GB7A 1V7MH 2CK2A 2FJHB 3BKJH 4PJAA 1BEYH 3TN0B 1YMHA 2J6EL 5JIKA 3ROLB 4JFDD 5I17B 4QEGA 1VHPA 1J18A 4HH9B 2WWMD 1GGIH 3FKUS 2M2DA 3GHEL 1SMOA 3QIUC 4ZO7A 5IQ7L 3MREA 3I2CH 4WY7L 4HXAH 5L6YH 5TH2A 1IGFL 1RPQA 1I8IA 2VABA 1K85A 1J0YA 3P9LB 2HAZA 5TDPA 3FO0L 4X83A 3FO1B 2WWMC 5J57B 1NGXB 3BZFA 1TXKA 5I8KL 4ZFOA 4RFNC 1I1RA 4H1LB 3NABH 2NZ9D 4CUCA 2VQ1B 3HE6B 2X4PB 3LMJH 3T04D 1JGEA 1MNUH 1EBPA 3MBEB 3L3JB 4K8RH 2BNQA 3STLB 1CDBA 5EU6E 3AC0A 4LVOC 1MQ8A 3G6JF 3TVMB 1KIUA 2NZ9C 1N5AB 3MNVB 3KPMA 5ESVA 3VFGH 4JDZA 5FO7A 4JB9L 2A6JB 3KPRE 4PRIA 2YR3A 1CD9B 2RFXB 1FH5H 3CFJB 4U2YA 4LARL 5EZOH 2BXZA 4PJIF 3IAQA 3S35H 4ZS7H 3WV0A 1WISA 3F6IA 1YNTB 4UOJA 3U46A 3V5HA 2OS7A 5TE7H 1MCNA 3V6OE 1K3ZA 2GSIB 4DOHE 3S37L 5E4IA 2UYLA 4X4YA 3ORJA 3QEQE 4K23L 1FPTH 2Y07H 3DV4B 3L1OL 4MWFA 3MV9A 2NXZB 5D7JD 1OQXA 2WM0A 4F7MA 4CU7A 4H8WL 5F3BB 1T6WA 5E2VL 2GFBA 4X7TA 2H3NB 1AGEB 3BH9A 4GRWH 5HY9B 4YC2C 4JFFA 1MIEL 4GAYA 5GGSA 4LAJH 5DEFA 1KPUB 5C0RL 4KRPD 2XA8L 4U33A 5H37G 3BPCB 5D7JC 4F9LA 3R8QA 3CH1B 3AREA 1KV3A 3LB6D 1I1AD 2FRGP 2EDNA 1X6LA 5LAXA 2ESVE 1IGTB 4HIHB 3GI8H 1BWWA 1MFNA 4PJXE 3L3OB 3FRPG 1OCWH 2OTUB 2J7LA 4NQEB 1C16A 4KRPC 1XGTA 3ZE1F 1GRWA 2VMFA 4G7YH 3VGFA 3QDHA 4JKWA 1NEZB 1I1AC 3S36L 3O4OB 5DTFB 1HDMA 4ELME 4WTXA 3I6GB 5CAYB 4PGBA 3QUXB 3WJJA 1J10A 3ARBA 3UMTA 5KVGL 3UBXG 1VKXA 3LEYH 3H0TA 3GIZL 5GRYA 2XN9E 2BSTA 3TLRA 3PWPD 2BVTA 1W0WA 2X4TB 1WQVT 4LK4A 2PO6C 3SBWC 2DQTL 2YEZA 1FFOA 4M7KH 4PS4L 1BFSA 1Z9SA 3MRRA 4QYOA 4YXKH 4PBXA 2F5BH 4K7PL 5HYJD 5JOPD 3K80A 2A38A 1QBAA 1DBAH 2A0LD 2R69L 2H32B 5AUMB 2NY4B 3GMQA 1U3HB 5L88L 2A77H 1JI1A 1BJ1H 1MJ7H 2IH3A 2NNAB 2NY3D 4Y4HA 3KLHC 2AK1H 5I1CH 1U58A 2V9QA 3HFMH 5IFHH 5FM4A 3G5ZA 2AXGB 4UMGA 1XF5B 4HKXB 2A73A 2A0LC 2NY6D 2WK2A 3MRCB 2XTLA 3L5XL 2VAJA 1BIHA 1BREA 2BK8A 3PHQA 3ES6A 4LRIA 2FSEB 4OI9A 5C0BB 4ERSL 2P5EE 2X1WL 3DXAB 2NY3C 2X6MA 1E4XI 4GLRH 2AABL 4KTEL 1L6XA 2FZ3A 4Y2DA 5FEBA 4WW2A 1RIVH 1XF2B 1MI5A 1P5VA 4ZPVB 2NY6C 3GBLA 1CFVL 3VXNA 5DJ8B 2VDLL 4LLUB 1BQHA 2XWBB 1Q72L 3ARQA 1HNGA 3MUGA 4YHMH 3Q6FA 3QO0A 1DEEB 1E4XL 2V7NB 5F7FA 1P4BL 4GW1B 4JN1L 4OLVH 4FTVA 8FABB 3OX8B 4Y5VC 1A6ZA 4LHJB 5BV7H 4XNXL 1HILB 2ZCKL 1FLRH 1SEQH 2NY0B 4X8JB 2VQTA 4ZO6A 3VXMD 1YC7A 3VFPB 1PEZA 5AEAA 5DJYA 4APQD 4I0PD 1TFHA 2R0KH 1JRHH 4NC1C 1XF3B 4U1MB 3A0OA 3PP3H 4LBEB 5EH1A 1V3MA 5CSZB 3AAZB 2R1YB 1CLOH 3WKMH 3L7EA 3QHZL 3RIFF 4I0PC 3QUZA 4DEPC 1ZXQA 4Z8FL 2H2PD 4DZ8B 1R5VA 3C09C 1HZHH 3QA3A 4HUWA 5IROC 5D5MA 4PJGF 3VFMA 3SY0A 2WW8A 4XPFH 2Y6SD 4FNLL 1LO2H 4PIRF 1MRDH 1RUQL 5GXBB 2HRPL 3VXQB 1C5CL 4ZUVB 5DVLA 5GGQH 2H2PC 3GSOA 1BBDL 3GSNA 4KGJA 3HKFA 3MRIA 3H2WA 2Q87A 1BFVH 2Z92B 5EC2B 5GISL 2Y6SC 2BCKA 1KCSL 3EJZC 3VI4F 4ODSL 4NYLB 3OKNA 3RTQC 2R4RL 1ZLWK 3T1FB 3GKWH 3ARFB 2WBWB 4HKZB 4H0IA 5GRUH 4IM8A 2I9LA 4P99A 5D1XB 4MVBD 1K8IA 2CIIA 2A6DA 1WC7A 4PJFB 1F2QA 4W6WB 2IFFH 1Q9LB 3GMPB 4TYUA 3CK0L 2F19H 3LEXA 4TQEL 1I8KB 3ARZA 4M6NL 1X5LA 5BJTA 1KJ2H 5TE6L 5HGAB 4KXZH 4KZDL 1JPST 2IPTH 3GO1H 1S7VB 3BRFA 2VXUH 1JN6B 3VA6A 3BD4A 1ONQA 3L3GA 1VFBB 2VKWA 1ULVA 1OHQA 2UWEA 4DN3L 2J5LC 1LO5B 1INDH 3RWHA 4ZSOA 5TQ0H 5C0DA 5EU5A 5F6HJ 3MV9D 3OTTA 4XHQA 5EFIB 1GHFL 4HQQH 4MMZC 4LEOB 4C83A 3WFHA 3RUGB 1QD0A 1UKQA 2VLKD 5AZEL 2BOCA 5SWQA 1GZQB 5GGRB 5D1QB 1YNLH 2ATPB 4YWGH 4JFFD 1MLBB 4ORGB 5C0CB 4QWWD 3OAUL 1NBZA 1QR1B 1JJUA 4NQDB 4ZPTB 4P4KA 4K2UL 1ORQB 4AZ8A 3ARED 1R5IB 4MAYA 5T1MB 3EDDA 4LSPL 3MO1A 2FH8A 3BJ91 4QWWC 2NY2B 3JWOH 1GJIA 1F2XK 4JZOB 2IPUG 4F9LC 1YEDB 4ZYKB 4MA3B 5HI4D 1QSVA 5C0FB 2NY7L 1GIGH 4K3JH 5D6CA 1CE1H 1JWMA 1M6OB 2ZG1A 4JRXA 4WU7B 5E2WH 5H2BB 3P30L 4RIRB 2R23B 2H26A 5HI4C 1AXTL 2EKSA 4BFIB 5SWSA 1X5XA 1Z0NA 2VQUA 5C07A 1ITBB 1ZLSL 5HGGS 3SE4A 1DDHA 2X9XA 4DVRH 4K94C 3PWPE 4IS6A 3SN6N 4BQBA 6FABL 3VFTB 3IAPA 3FFCA 1KF9B 1BJMA 4U1IB 1U95A 5IQ9A 4F7TB 1IQWL 4OZIB 5JXAH 2HWZL 2YA0A 3HRZB 3IF1A 1NANI 5SX5K 5HYJE 1KB5B 4Y4HD 5JOPE 1QACA 3HNVL 2IG2L 1D5MB 3VXSA 1HQRA 1N5YH 3IGAB 4PRBA 1UXSB 1OQOA 4IBLT 5DEGA 1BOGB 1ACYH 3D3VD 1FNSL 4YHNB 3CD4A 4G6AD 5C08A 4Y4HC 3FN0H 5F1SA 1R24B 5HXMA 3BW9A 5DA0B 5F7KC 3VFUB 2OJEA 3WFEL 5T3ZD 4PJ9B 1EMTL 3UYOD 1GZPB 2DQHH 4EI6A 5TF0A 4HG4J 1N64L 4HZAA 5D71H 1IAOA 4G6AC 2DLGA 1FORL 3HB3D 5E6ZA 3V4VL 4ODHH 3F7VB 1F3JA 1LD9A 5JZ7D 5GGVH 4PJHE 4ORZC 4WW2C 4FTVD 4RAVA 2V6HA 4C56B 3TCLB 1ZVYA 3MLTB 3UX9B 4EDXB 4G8EB 1IGMH 5D7LA 3HB3C 5A1AA 4V2BA 4MB5A 5JZ7C 1AI1H 3MNZA 2FYYB 1UACH 1OAUL 1RHHB 1EFQA 3VXME 5C0JA 2A6KB 1X5YA 1F97A 2XQBL 3CU7A 4U3HA 4YDVA 5IV2A 4DFHA 1T03H 2ZUSA 1BD2A 2VISA 5IVXE 1PW3A 4L8BA 3MJ9A 4N8PA 4PJ7A 1PG7X 1XR9B 2Z8RA 3QUZD 3T0EC 1WBYB 4PJAE 1RZJL 2HT3D 2P46B 3SQOH 5DXWA 4D8PB 1AP2B 5B3NA 5FYKH 3DMMB 1AC6A 3DJ9A 5FHAH 2W59A 1U8OA 2HT3C 3LEVH 3GMMA 3ULVF 1T22A 3U0PB 2Z4QB 1IQDA 1ZVSA 4NC2B 4R4NC 3SE9L 3T4AA 4H1LH 2YSSB 4CN6A 4TUJB 1ODAA 4U31A 2FO1A 5SWZB 3OB0K 4G42B 4Z7UF 2VR5A 4JDTL 1JF5A 2ZSWB 5IB5A 2OZ4H 2X5PA 3WLBB 1T0PB 2BNQE 3NACH 1IAKA 4FQLH 3H8NA 4LCUA 3U6RB 4TVPH 2B1AH 2GUOA 4YDJA 2F8VA 3O6LL 2DQJH 4HJJL 4KQ4H 4CU6A 1MWAB 2HN7A 4X9HA 5D2NA 4HZLB 4NN6B 4F9PA 2UV3A 1E4KA 5KG9B 1BWMA 1SY6L 3FT4B 4PRIE 43CAB 3ULUH 12E8L 1TQBB 2BVYA 4PJEB 1A7RH 2VE6A 4NGHH 5F21B 4N1HB 2AEWA 3RRQA 1WTGT 5J13C 1AGFA 3O11B 1T1YB 4ZUWB 4HF5H 4L4VB 2OL3A 2KUTA 4MZ3A 4Y89A 2JTDA 4NBXB 3GSVB 2HKFH 4HSQA 4O5LH 4PGDA 5ETUA 4HXBL 1RZKH 5E8OB 1UWEH 4NCDA 3VFWA 3MV9E 4PB9L 1G7JA 5D7IB 3B9KC 5BZDA 3H7BB 3IETB 4FP8L 3JV5A 4WDIA 2P48B 4P4KD 4XVJH 4FXKA 2HVJB 4JFFE 4UDUB 4NWTH 3TWCH 3BE1L 2IFGA 2GY5A 4MAYD 5KZCD 5FDWB 1MHEB 4NKOB 5DD5L 1VEMA 3OJMB 3WFBH 4D9LL 5F3HB 5LVEA 3U9UB 2OCFD 2CK0L 4NHCL 4Q9QL 5JQHC 1WLHA 4L1DA 2YD4A 2QQNL 4P5TB 1XZ0A 2H2SD 4MCYB 4MAYC 4U6XB 1HXYA 3TBVA 3TJEL 1WVZA 2Z0BA 2VLRB 1EJ6A 4JRXD 4JRYB 4PR5B 3MRKB 3EO0A 2GK2A 1RSFA 1A7NL 3KYKH 1FNFA 5EIVA 3V52H 3CFCH 4MJ5B 3AFLA 4H26B 2H2SC 1UJTA 1A9BB 4JFPB 3N85H 5E4EB 1XGPB 5C07D 4Q6YA 5FIEA 4GKOA 2YD6A 2FEEI 3QDGA 4F33A 1BQUA 2PYEB 2EDXA 3FFCD 1Q0XH 1G7IA 1G9MC 3MRDB 5FOJA 5IFJB 2QSQA 4HC1H 4KC3B 3ZDYE 4MQ7A 5JHDD 1B0WA 2ADIA 3DVGA 5HYSB 2FEEL 2H32H 3ZT7A 3VXSD 2DRUA 1I75A 3C6LB 3MGOA 2P8LA 1BJ1J 1QLEL 3CZFB 5DHVB 3CDGB 1B90A 1MFEL 4ZAKC 2EIBA 5D9SB 5HSFA 5C08D 4KTDL 2YBRA 4O2FA 5D8JL 5T1KB 5J12B 2LU4A 3VGBA 1U41A 2DB8A 5GS1C 3CFKA 2AXFA 2HFTA 3CMOL 4L5FH 4LASH 4RGNC 5T3ZE 2XG4A 1AQKL 1K3IA 1MI5E 2JELH 4GG6B 1SJVA 4HWEL 2YUWA 5EU3B 5L9DL 4NKIH 3KPLA 4ODWB 1S5HA 5I1AB 5HHVL 2GJ6A 4J3OC 4M93C 1EJOH 2ITDA 4O58H 1BGXL 3G6AB 1W72L 4OF5A 5DRZA 3VGHA 4Y5YC 2XPGB 5F9WB 4FTVE 4TPRL 1U2HA 1FCGA 2IBZY 2XI9A 3BFOA 3QG7H 1KYOJ 4NO3A 4PG9B 5CBEB 3DGCR 3H9HB 3NA9L 4KDTA 2ED8A 1R6VA 1DBKH 4MJIB 3O9WB 1M71B 3TNMA 1QBLL 3HC3L 4TSAL 5ISZA 4OZFA 4ZUUB 5CEXB 3GDBA 3R0MA 4I5BA 1HYSD 2FIKA 2JCCF 1DQML 1JPTL 1BD2D 4UNUA 2I9TB 1TQCB 4GMSH 5J0BA 5J56B 4YIQA 5SX4H 5DGQA 1JHLL 4YBLB 2IQAB 5CUSL 4QLRA 4LP5A 3F8UB 1AD9A 2G5BA 5TE4L 1H5BB 4FABL 4OFPA 2BMKB 2C4FT 3K74B 3PWUA 1CE6B 3DHJA 2AXJA 5D5ME 3RIFK 1JF1B 1X5HA 5FYKE 2AW2A 1CICB 3OGCB 3IDMB 4KK6C 4JM2B 5J6HB 2XTJD 5HJ3B 3GSUB 2FATL 4B41A 5CLTA 4JGUA 5CKAA 1EHLH 3K8KA 3EYSH 4LMQE 4O4YL 3EOTL 5CCKL 3FQUB 3T3ME 4OKVA 3T77B 3NZ8A 2EDBA 2MCG1 5T1DL 2RBLA 3GK8L 1MFDL 5LXGH 3VXTB 1URLA 1G6RL 4K3EL 2DAVA 4HGWB 3CVIL 2IQ9L 1YJDL 1KIPA 4NO5A 3VA2C 2BY1A 5E8DL 5EA0H 1F8TH 4LOUD 4JPIB 5GS0H 1D9KB 5F71A 4G9FB 3N06B 5D2NC 4JZJB 5DMKA 3RZCA 3GHEH 5I16A 1KUMA 3S96A 5F6IB 4LVNC 5IQ7H 4MSWA 2UWEE 3HUJB 2B20A 4ZSOE 2BHYA 1CGVA 1IGFH 1YEIH 3MX0A 4OZHA 3TO2B 3U4EA 1N59A 5F1KC 3HCVB 2NY5H 5INCB 2ORBL 3QFJA 4JKKA 4JJ5B 1UKSA 2BNUB 2D7PA 4LGPB 1I4FB 4LCCA 1L0XA 3VFVB 2VZOA 4JO4L 5J11B 1EHAA 4TRPH 1NBYA 4NKMA 4WFGE 1IM9D 2XZCL 4NJAL 3U30C 4KMTH 2PXYD 5EN2B 2P8PA 3E6FA 3OAYK 5GGTH 1QKZL 4OTXL 4Z0BL 3BEVB 2G60L 3C5JB 3X13A 2WSKA 3D39A 4MD4A 5C0NC 3SKNB 1IEBB 3LN4B 4JB9H 4L3CA 2P43B 3WNKA 5KW9H 4L9LA 3FT2A 2PXYC 4U49A 4PV8A 3DGGB 1U8NB 2VXTH 4M5ZL 3IKKA 4M48L 4WHTB 4P46A 1N6QH 2L7JA 4QCIB 1DQLL 1A6PA 5LJYH 4JRXE 1EEQA 1RY7B 3P4MB 3MJ8B 1HHHB 4ODBD 3QDGD 5IHUL 3ARTA 3S5LB 5SWSE 3VE0A 3RL1B 5C07E 4AENA 4E42B 4ODXA 4XP6L 1KTLA 1PY4A 5GGUB 2EH8L 3KXFB 2AGJL 1S7XA 1AXSB 2O61A 5TQ2H 1NCNA 3O3DB 3EZ8A 2YS4A 3TZVA 3U7WL 2ICCA 4M7JH 3B9DA 1AGBB 1KB5H 1MIEH 1UWGL 3VFOA 5C0RH 1WFTA 3BKCL 1JYVA 1CDCA 3VXSE 3SKMB 1NC2B 1VFAB 3L6FA 3Q2CA 4MD5B 3VXRA 4JFOA 3LQMA 3IFPA 3FMGH 3I85A 2MOVA 4RZCA 5C08E 1R3IH 4PJ8A 5LGJB 3RL2A 2ADFL 1FO0A 3ARXA 3QQ9D 4AL8L 1HI6A 1U91B 3O3AB 1FJ1A 4NPYA 3TA3B 5HDLA 3SO3B 3IRPX 5BS0A 3GFUA 1NQBA 4YEEA 1PZUB 4KVCH 2GJ6D 1GH7A 4HUVA 4OSUL 3QQ9C 1XAUA 5BRZD 4LCIL 1TJIH 1S9YB 4PJXF 3WO3B 2EIZB 5GSRA 2AJUH 3TF7C 5FOBB 4PS4H 5IEKA 5D7LE 5ID0B 3W9EA 4LDOB 4PJBF 5EZJA 4K7PH 4GKSA 4HD9A 2X4UA 4GAGH 5ISZD 4U1GC 4ELMF 3MOAL 4NRZA 1FL6B 2HFGL 3QEUA 2CLRA 2FBJH 1CXIA 1SJXA 4LCWB 1K5NA 2QHRL 3TBWA 4L3EA 1A3RH 1MEXL 2AJXH 1OAZH 2WBJD 3R4DA 2QADB 3L5XH 2CUIA 1FSKB 2HTKD 4PJ7E 2FEDD 3MLWH 5CFHA 5IK3A 2BZDA 4ODUA 3MRPA 2W92A 5E95B 4XGZB 4ONHB 2AABH 2W9EH 1A3LL 2R56H 4Y5XA 3WHE1 2DTMH 3OKLB 4MJ2A 1S9KC 4XXCA 1T1XB 5FF6A 3M1BB 5FYJL 1EEYB 2WBJC 1CFVH 1FFPB 2HTKC 2FEDC 1AHWB 4HS3A 4JQVC 3GMNB 3WN5A 4N8CH 4X7CC 3V0WH 5CBAA 3KYOB 2XTJE 2X05A 4GBXB 2NY1C 3WSQH 4HCRA 2IALB 3TO4C 2J4WH 2XWJB 5IM7A 1WSST 4XNXH 2MHAA 1BF2A 2FGWL 4WJ5B 3SOBL 4B7IA 3QEGL 2LU3A 4JFHE 3WIIH 1UFUA 1RK0A 1T04B 3ECBB 4PGCB 5CJOH 4S1DD 4OCWL 3IJYB 2XZAH 1NEUA 1MWAH 2NX5B 4OCMC 3P0GB 2C3VA 5LGHH 4XXDB 5TGBA 3H42L 3QHZH 4WI7A 1NFDA 2HH0H 4CMMB 5J1AB 4QGYA 1L0YA 1FRGL 2OSLA 3RZCD 3V7MA 1PG7H 5FO8A 1YN6B 2WUBH 1CD1A 3CFDA 3DUUA 3V79C 5I75C 5E6ID 4IRJA 1AR1D 1YECL 4Z7WA 1C5CH 1RI8A 3QFJD 3X3FH 4EUPA 4HAGA 1A6VH 2PETA 4GH7B 3RVXD 2COQA 4HS8L 1AGCA 3KAAA 1CG9A 3QFDA 1JUFB 4MB3A 3ZTJH 1SHMA 4NNPH 5E6IC 2GAZA 4ODSH 3HZYA 3DO7B 3HI5L 4R90L 1LEGB 1KJMA 3CX2A 4YAQA 4I0CC 1OD9A 1U6AL 3LY6A 3RWIB 2HJLB 4NQDE 3D85A 1U8QA 3PNWB 4M3KB 4GS7C 2IADB 3P9MA 1T1WA 1U0QA 1YPZB 3O81A 1CFNA 3QXUA 4JVPA 4LLMB 4KWUA 2X7LA 1G7PA 1HSAB 1EFXD 4K3DL 3TC9A 3G08B 4Z0XB 5DYOB 2V5SA 4KUCD 5KN5A 5CD3A 2ICWI 2QV2A 3CLEL 3EBAA 5TE6H 4Y1AD 3AS0A 5F7UA 2ZKHL 4NQCA 5DUPL 5GRZA 4HUUA 2C3HA 5F8QC 3UTTA 4M7ZC 4BQ6A 3QDGE 4KDVA 1UZ8A 1GHFH 1CTNA 4M43H 1JFQH 4L8SB 5SV4A 3QJHB 5GHWL 3W0WA 4M61A 2ERJB 4GJTB 5AZEH 3UPCA 1EO8H 5KSUB 2DIBA 3TZVD 2JB6B 2Q7NA 4J7RA 3TIEB 2NW2B 2IH1B 3L3HA 4ZG1A 3VGEA 3J7HA 4QHKI 4K2UH 2C1PB 5HVFB 1PZ5A 3KPQA 2YRLA 1FC1A 3DTXA 5DHVH 3VXRD 2BP3A 4UBDD 4G8IA 4M8QA 1LMKA 3DIFB 3U2SA 5E8NA 1KJVA 4ZUSA 4MNGA 4PJ8D 3UTPE 3M17B 1TVDA 3KLAB 4ONGL 2BSSB 1FO0H 4JHBA 2VXQL 2X1PA 4G6KL 3SEPA 3R1GH 3SDAB 1UH4A 2ARJB 1SVZA 4NT6B 4MNQB 3BHBA 1U93A 4UBDC 3FRUA 3VJ6B 5GJSL 3ZSSA 5BS0D 1HSBA 4PJ8C 4NKDB 1VENA 4XNZC 1MAJA 1UVQA 1IT9H 3RY6A 4XX1E 1JTOA 1I3GL 4BH8B 1NPUA 3BVNA 3O2DA 2GJ6E 1IARB 4KFZC 4Z7QE 1ZLSH 3N9GH 4J4PA 1ZA3B 5B39G 4N0YH 4NUGL 4Y4FB 3QCVH 3UJIL 1UZ6F 5CIPB 5EO9A 1GCFA 3A6BL 4LAQH 5IG7B 5TJWK 3QAZC 1QQDB 1X7QA 1BLNB 4NQXB 2H6PB 3HNTL 5ISZE 3HMXH 4UQ2B 5C8JB 3Q6GL 4JFEB 4UV7L 2F53B 5DJXA 3DX8B 1IMHC 1ED3A 3WNNA 2CIKA 5GRVK 3IDJB 4CDGC 5E00A 1MFCL 1Y0LB 2Y06H 3F5WA 4J1UA 1FNSH 1WCBA 3S9DB 1R0AH 5HYIA 5EOTB 4JVWA 4LIQE 3WFEH 4YFDB 4FQQA 3SGKC 2Y7QA 2DI7A 4MHHG 1U42A 3N1FC 3D2UA 4GW5B 1QVOA 3TBSA 1FORH 4YHOL 1S7RA 3V4VH 4NOFA 2PW2A 4WRLA 4OZGB 4ZXBD 3LQZB 1JHTB 1NBVL 3GMRB 3ZHLA 5C86A 3RGHA 2LFGA 2VERN 3UC0L 5I1GL 4NUJB 4FQXB 3H3BC 5HHXH 1DQQB 2YK1L 4ZXBC 1N8ZA 5C70A 4XCNB 5A43C 1F4XL 1TZGH 1YMMB 1T83A 3CVHA 2GT9B 1VACA 1AKJD 1KCKA 3IXTA 4RAUB 2Y72A 1CF8L 3QBTB 5TF1H 2AV1B 3JBG7 3GIVA 3HMWL 3QCTL 5FYKU 1WFOA 2Q3AA 1MUJA 7FABH 3JV6B 2WIMA 5ERWB 5A2LH 3QI9B 1LHZA 2O5YH 3IJHB 1U8KB 3O0RL 1TMCB 1T6VN 2R2EA 1RZJH 3S3SA 3NBNA 1HKLH 1T20B 1A5FH 2H1PL 3DX6B 5LG1A 5DK0B 3CFBA 3MRFA 1N4XH 4R3SA 4IRSA 1Z9OA 3ZL4H 4IRJD 4Z77A 2X70A 4LPXA 5EBLB 5I19L 3NFNB 3UTOA 3PABA 3LSOA 5DFWH 4EXKA 5KVEH 2HFFB 4OZHE 4DTGH 2AERT 3GNML 1FZMB 4YHLL 1O0VA 4WVRA 3QFJE 2VDPL 3RVVD 5IVXF 1P4LB 3DUSA 2DJUA 1MQKL 3F7QA 4PJIB 5ACLA 4YXLL 1FFQA 2PTTB 4XX1G 4MS8D 4I3SL 3D85D 1KLGB 3RVVC 3T4YB 5IMMA 3ETBF 4HFUH 3C60B 1I7RA 1OAKL 2HFEB 5HTSA 4ESKA 3O2WL 3HS0A 3O6LH 3WNOA 3D39E 2JE8A 4GSDL 4WWKA 4LHUB 4MS8C 5BV7C 1HINH 2ZUXA 3MXVH 1TZIB 12E8H 2D7OA 3FQTB 4NQCD 4Y4KA 4OZFG 1QA9B 4Y16B 3B5HA 3BZ4B 4D94A 1E28A 1SEBB 3UTTD 4P2QD 3T2PA 3QQNA 3MA9L 4IIQA 5JA9A 4JKMA 3QQ4B 2V5YA 3CUPA 4XB8A 5EU4A 1P84K 3W0WD 4PB9H 2CDFB 5EO1B 5DD1L 5E7FA 5DK2B 4UINL 5F7DB 5T1LB 4HKBA 1L7TL 3BE1H 1RUKH 4IHOB 2QSVA 4OB5L 4LU5L 1IL1A 4MCZA 3FQNB 5J9PB 1VDGA 3QUMB 1AQDB 3VXRE 2CK0H 4OF7A 1NGPL 2VKXA 4UIKL 2AKRA 4X6BB 4XP1L 4EI5A 2OLDA 3OKEB 1WEJL 4RMWA 2Q7YA 5EDXA 2HT4D 1OWRM 2VLJB 4XP5H 4Y2OA 4OT1L 3UP1A 2XIDA 3QDJB 5KSVA 1U8HA 1II4E 5JW5B 4MDIB 2ZOKB 2FX9L 1A47A 4PRNB 1MLCA 5BS0E 4LP4A 5ANMA 1I1YB 1HHKB 1UQSB 1ZHLA 2HT4C 1EVTC 3FCTB 4DQOH 1ORSA 5EPMB 2Z91A 1I9IL 4J4PD 3C5ZA 2YPVH 3D0LB 3GJFB 4KJQD 2ICWB 4QHMB 4N0FA 1JYWA 4F7EB 1UEMA 4AEIH 4G8FA 3BN9D 1QRNB 1CDGA 1OWWA 4GW4B 4L29B 4N9GB 4Q7DA 2RGSA 3O3BB 1D6VH 1NMAL 3GJEA 4R0LA 1KBGH 4WFFD 3EO1A 1KENH 2F74B 1PLGL 3UTQB 3BN9C 3UYRL 1QLEH 4DGYL 3ARGA 4NRYA 1MFEH 2YD8A 3WE6A 3MUJA 1LQSR 3T2NH 4L3EE 4FQCH 4P5MA 1WBZA 1V7NH 4AT6A 1MCWM 4OD3L 3U7YH 3OB8A 2R0LL 3Q3GB 4LLVB 5BVJA 3WIHH 3D2UD 5KSAA 1N7ML 2QR0B 4OGXL 4XBPB 1AQKH 4ZUTA 5C9JB 4WUUA 7CGTA 4B7LA 3T09A 5IMLB 4WEMB 3E8UH 4PP1D 2D0FA 4QRUB 4HWEH 5L9DH 4O51A 4YUEH 5HHVH 3AMLA 1DZBA 4QXTB 4JQIL 1BGXH 2QQLH 4GRLA 2OX5A 4XRCA 4B53A 3FQRB 1PGRB 4NZUH 2D31A 2YD9A 3LS4L 3RWFB 3FHAA 5FXCH 4F8TA 4OUUA 5FV2A 2X4TA 2ARWA 2DDQL 3RY4A 1IE5A 2F54A 2CMRL 4I18A 4WW2F 4TSAH 4PJGB 1EAJA 5IR1A 2VZ1A 2V2TA 3QJFA 4UNTA 1T1ZB 5L8LB 2VDMH 5ADOH 5M94B 1JPTH 1T83C 2F15A 1UJ3A 4HW6A 4DWHA 1GGUA 5E8EB 1ZLWH 1RV6X 1R3KA 4LLYA 2QL1A 1NGZB 4O2CB 2IBZX 4XVSL 5T5NG 3THML 2YRZA 2PF6A 5DD0H 5CUSH 1GPOH 1LEKA 1FBIH 1H3UA 1NCDL 1NFDE 1T0MB 4NO2A 4YGVA 5TE4H 3ZYOA 4IRSD 2NMSA 2P42B 1JZ3A 4HT1L 2E8ZA 1EH9A 4TOYL 3GMLB 4BM7A 3G6JA 1CLYL 4JFZL 4X6EA 4X5WB 2DYPA 2IPUK 4D0BB 5IW1B 5CMAB 4Z7WE 1JGVL 2YUXA 3TBYB 4NN5B 1ROWA 3BN3B 1EGJA 4F2MA 3BUTA 2FX7L 4UT9H 2DWEA 4CN1A 4Q97A 1LO4H 5JW4Q 5DWUL 1SM3L 2GI7A 4LSSL 4O4YH 4G6JH 1I1FB 5CCKH 1FFNA 5CEZD 3IJSA 4P2RA 2GTZA 5HHOA 2XT1B 4L4TA 3MA7A 4N68A 5D5MF 4XC1L 5E03A 4JGJA 5IB1A 1EAPB 3PV6A 4G5ZH 2IQ9H 4FQ2L 1YJDH 4WWKD 4JLRB 1EXUB 3LKQB 2AJZA 4TNVF 1DFBL 3WL9B 4LKCA 3B9VA 4Y4KD 4HAFA 1MCOL 3QXAA 4UNVA 2WIIB 3CNKA 3C8KB 4JN2A 3SGDI 4ZFFB 3TN0D 4HIJB 4NQCE 3V0VB 2DOCA 4P23C 2Q8BL 5EO0A 4LPWA 4MDJA 5DI8A 3U9PL 4XNYH 1KIQA 3UTTE 3C6SA 3MV8A 4NO0B 1PAMA 3DSFL 5IVNA 2A83B 4U7SA 3TN0C 2ORBH 1Z2KA 4PRPA 3W9DB 1KCRH 3SE3C 2VAAB 3NGBB 3W0WE 5FB8B 2CGRL 4FA8A 2NW3B 3K2UH 2VLLA 4JO4H 3HE6D 2Q6WA 1NFIA 4N8VA 1P7QB 1TENA 3T3PF 3KPSB 5BZWA 3LKNA 4JR9H 2UWEF 5D72H 2APFA 3P0VL 1I8MB 1QKZH 2CKBA 2AJVL 4EI5D 3BGMA 4MNGE 2QEJA 3HE6C 5SX5H 1WBXA 5D96B 2YXMA 2DIJA 5F93C 4PJFA 3RHWF 5L2KA 3LRHA 4MNHA 4MX7B 3RIAF 2CLZB 2N56A 2QQQA 4Z76B 4O2EB 3BQUB 1FZKB 4EI5C 3TV3L 3MRQB 1DQLH 3ARYA 5K9JL 4J3UA 1MVUA 2J6EA 3FAWA 1P4IL 1WFUA 3V4PL 3C5ZD 2C3GA 2P24A 4HH8A 2Y9RT 3ULUC 3RDTA 1IBGH 4NQSB 3QZWB 1I7TB 2OMNA 4HFWA 1RFDH 2AGJH 5TFSL 1MRFH 1S9XA 3W39B 1AIFB 4NN7B 5CIPH 5ICZA 2FJFA 2CRYA 2P5WA 1Q9OB 1R3LB 5BXFA 1RIHH 5IIEA 1YEHL 1UC6A 5KAQG 4P9ML 3QULA 4KI5D 1XCTB 4WFFE 1RZKC 3BKCH 3ARGD 4KHXL 4WI2A 3P40A 4UAOB 3P73B 5FK9B 5FKPA 2GJZA 3KPPA 4M9PA 1SQ2N 2DJ4A 5DO2C 1YEKL 5E1HB 1YY8A 4R0LC 1MHPL 3RVUD 4Q9RH 2YA2A 4KK9D 4X5XB 4IOIB 4F58H 3VG0H 1U9KA 2WWKT 2J88L 3MXWL 2ADFH 3QQ3B 4K55A 4QY8B 5KSAD 4QNPE 4CL7A 4ZOAA 4WGVB 4J8RB 4NQED 3MCKA 5E08H 3JTSB 4OLWL 1A7OL 3RVUC 5AWNH 1JPGA 4KK9C 2ITCB 3NCMA 2FO4B 5DK3A 3ZYZA 4UUJB 1W8OA 3QUXD 5CGMA 4OSUH 4GRLD 2EEAA 1INEH 5H94B 3DROA 2ZOLA 3BPNB 3IYLW 4LCIH 4D0CB 3HI1A 4QF1B 2YWYA 4HEPG 3O4OC 1F4AA 1HIML 1MJ8L 1KTDB 2F54D 3QUXC 3CC5A 4NCC2 5T3XL 1JNLL 4X4XA 4XBEL 4OM1H 5DJZB 2F5AH 5I8OL 4ZMAT 4OCXH 5C1MB 5C71A 1I3RB 5E5MB 2BVPB 1FVCA 5CKGA 3B8YA 2PYFB 4LKXB 1FAIL 5CD5D 5K9KB 1M7IA 2NY4D 3L3DA 4I18C 2A74B 1NUGA 5FO9A 1D5MA 3LPGA 4HBQA 1QFWM 1DE4B 4X7SH 4G7VH 1DLHA 2BSRA 1NMBH 1UM5L 2X4QA 5DRWA 1NDMA 3IFNL 5F9OH 4YE4H 2IJ0C 3VXUD 3KPNA 5GGSY 1QZ1A 2C5DC 2V5TA 1KPRA 1UJ3C 5CD5C 3ZYIA 1CDIA 2NY4C 3RWJA 3DRQA 2Q86B 3O8XA 2BDNH 4OZ4A 1PDKA 4WNQB 3S34L 1A7PH 1G7HB 3T65A 4K7FA 5INDB 3FT3B 3HZVB 4UILL 4DN4L 4PGEA 3CFEA 2BHUA 4PJ7F 3MJ7A 3K3QA 4JREC 4UU9B 4M9OA 3LOWA 5DJDB 3BAEH 1TETH 5J6GA 4L4TD 3SKJH 3BIKB 4PTUB 5CEZE 2FGWH 2HJKA 3O3EA 3QXWA 5A40E 5LCVH 2G75A 1S7UB 3DYOA 3LQAC 4YZFE 1D5IH 2EH7L 4IMLA 4AMKL 2BY2A 3K2MC 4UQ3B 1OGAB 3A67L 4NZTL 4OM0L 1G7LB 3H9SA 1LP9A 2DQUL 3LKOA 3NZHL 3PWLB 4KQ3L 1CFSB 4EQ3A 2VDQL 5F6HI 3LKSA 4GAFB 1ZSDA 1GC1L 4G3YH 4JY4A 2HG5A 4U1KB 2X10A 1EUUA 5HHMB 4F7PA 5C0AB 1F6FB 5F7NC 3NH7L 1U8JB 2D7QA 1ZTXL 2GSGA 5C0IA 5AZ2L 3BP5B 3TESA 1NAML 3MCLH 4A6YA 2LAGB 1YECH 4JY6B 4MD0A 4XPTL 1D5ZB 1QFWI 3MRHB 2YMXL 4PRPD 5IFAL 3BP4B 1FVDB 1LWRA 2EDFA 2RCSH 1AJ7L 5HHQA 4TUOA 3AUVA 4AM0B 1PYWA 3QIBA 3AB0B 5BO1H 2AEPL 3HI5H 4OFYA 2DI8A 2VITB 1MJUL 5A2KH 1QFWL 4U1NB 3FQWB 1BZ7A 1IEAA 4ODTL 3BMVA 4GOSA 1RQ5A 2GEEA 3EFFB 3MRLB 4JDVA 3QNZB 3GHBL 1OP3K 3ARFD 3QUMH 3CXHK 1C5BL 1UB5A 2R1WA 5L2KD 3FO9B 3MGTB 4K3DH 4XNQB 2B2XH 3D69B 1SBSL 1OAYH 3Q5TA 2YPLA 3CLEH 3PDOB 5CJXA 2Q76B 3ARFC 1A9EA 1DBBH 4P48A 4AEFA 3BO8A 5DUPH 3LS5L 5DEZA 1DN0A 4YEFA 3HI6L 5ANME 4WFED 4U1HB 3MLYH 3ARVA 3BZDA 3GJFH 1NC4A 4KKLD 4PRDB 1CGTA 1ERNA 4GRMA 2I27N 1XCQA 3MSPA 4LSVL 4M6ML 5CWSB 3EO9L 4W81A