4GO6B

Crystal structure of hcf-1 self-association sequence 1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
210
structure length
168
Chain Sequence
QWFDVGVIKGTNVMVTHYFLPPDKKQELQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWLQENKRPMSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords HCF N-terminal chain 1
publication title HCF-1 self-association via an interdigitated Fn3 structure facilitates transcriptional regulatory complex formation
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 168
sequence length 210
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4go6B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4go6B01
1TZGH 1FL3B 5ICXA 4KDTA 2DQFB 1KTLB 4R4BB 1GYAA 3BFOA 2EE6A 4QHLA 2BXYA 4EDXB 3MRHB 1QRND 3VXPA 1PD6A 2FO4B 2IQ9L 1EMTL 3IDMB 4K3HA 5BVPH 1OGAD 1I9RL 3G6DH 5BOZG 4PRIB 4DZ8A 2OR7A 2YBRB 1P4IL 4NQVB 5D1ZC 4MCZB 4JGJA 1I8LA 2ERJC 5JDSA 3ARBB 5JA9A 3GIVA 2FX7L 5EDXA 4LHUG 4RAVA 5SV3A 2R23A 5CZXD 1S7TA 4ZTOL 1GZPA 3ARDD 4N0YH 4OJFL 1YQVH 4XXCA 1BD2D 2FATH 3BN3B 2IH3B 4H20L 1RVFL 1MCWM 4LCWE 4EBQL 1Y0LB 3DX8B 5EBLB 2E27L 3K81A 5SX4H 3TWCL 4X7TA 4RMVA 3ULVE 5F7EL 4XMKH 1AR1D 1KFAH 3L6FB 5EU7E 1FH5H 5ISZD 2XT1B 3VXSD 1QLRA 2NYYC 5IB2B 5CBAB 5JHLL 3H6JA 2Q3ZA 5CEZE 3ULVC 3QWQB 5EU7C 3ZKMD 3OJ2C 5D6CA 3P30L 3VXMD 4WUKH 3WFBH 4Z7VF 3HAEG 4MQSB 4P9HH 4LSRL 1FFOA 3ARXA 3LKNB 1Q9OA 3B2UD 3D39E 4HQQH 4MA8H 4MZ3A 3UX9B 3VFGH 2NY0D 3GFUA 1M7DA 3JXAA 4EVNB 1OB1A 3OGCB 1Q0XH 3OPZL 1EEYA 3NIGF 1DVFC 1KJMA 5FFLA 1DQJB 3MFFB 5E2WL 3QIUD 5C7XL 3IETB 1UA6H 2HRPL 4Y4KB 1I3GH 3JWOH 3PQYE 3QO1A 4G6JL 1G7JA 1MHPH 3IDXH 5IUSA 1IFHH 2FX9H 3HE7D 3Q1SL 3STLA 4RX4D 4PJAE 3CMGA 4X6EA 3HZKA 1N8ZB 3BAEH 1FVDA 3QUXD 4MA3A 1GC1H 1B4JL 3IDNB 3KJ4B 1F4HA 3HPJA 1OLLA 5I18L 1XGTB 2EZ0C 2A0LD 4UUJB 1I9IH 1RV6X 2YR3A 3CC5B 5JW4M 1FRGL 5K33A 4Z18A 3GSWA 1T0MB 4K8RL 5GGUA 4TTGA 1RFDH 4XNUL 4YDLB 1ONQA 1JV5B 3TYFB 2D7NA 3M17A 5ITBH 3HUJB 4ZNEA 4MJIE 3S36H 3GMQA 1BWMA 1GHFH 5BXFA 4UMGA 3M8OH 5TH2A 5BRZE 2P49B 1OTTC 4MAYD 4WTZA 3GMNA 4Y16D 3IVKA 2VMFA 1A6ZA 2NY1B 2V5SA 5C0AE 3RVTD 3ZL4H 5EC2B 4L3EB 5IMKA 1DBKL 3GBNL 2J8UF 3OG6B 4XH2A 5DJYB 3MLUL 1HEZB 1A1MB 4FFWD 3ZHDA 1PKQA 4H5SA 3V5HB 1XF5B 4L5FH 3MV9B 2UWEB 1M7XA 4ZUSB 3L5WA 3I6LD 5EN2B 4OZHA 5F88B 5IF0B 4JFFA 3CZJA 3V9FA 1YY9D 4EZMA 4CVXB 5SWQA 4AIXA 3PGDB 3I85A 5T1DH 1YEEL 3GUTA 1YN7B 4I2XA 5IIEB 3GO1L 4RBPH 5SX4I 1UCTA 5E03A 5F6IB 4PP2A 4Y5VB 3ARTA 4IOIB 4P23D 2G2RB 3UTTD 3MRJA 5CJXA 2BHZA 1CLZH 1KPRB 2BDNH 1HYSC 1O7VA 3MRCB 2A9ML 4Y0GA 5F9WC 1OTSC 1BHGA 3MR9A 4JO2L 3WKMH 5FCSH 2FHCA 4N1HB 2DQTH 4QRPA 4HGWA 2FR4B 1XGRB 3FQXB 4CADA 2Q86B 4RFNC 1IEBB 4JPVH 4Q9RL 3C5JB 1IGJA 5BZDA 4OV6F 1LQSR 4JO3H 5C0BA 4OZIA 2JK5A 2OSLB 4JHWL 1HHKB 3VH8A 2Z31D 5TDOA 1FG9C 3TBYB 4WHYH 3SGKC 1Y18B 4FQXC 1D9KA 4WCYL 4KKAC 4JDVA 4IDLA 1KCVL 2A6DB 2FBOJ 1F4YL 4JJ5B 5D6DA 5A16B 1FNFA 3RBGA 3V52H 3H3PL 3QIWC 4L4TA 1OSZB 2PUQT 3WYRA 1CXIA 3L5IA 1GGIL 3C6SA 5C1MB 3V4VH 4IDJH 2R69H 5JW4N 3C6LB 3WV0A 3TYGH 3W0WD 5E9DA 1BFVH 5B21A 5I76A 3V4PH 2Z92B 5IM7B 4KGLA 3TJHC 4PREA 1E6OH 3LQAH 2PYEE 1VSCA 2B20A 2NX5E 2ZSWA 3LRGA 3MRIB 5MEND 1WFUA 3MLWH 2PTTB 3B3IA 4ODSL 3HMXL 5BS0B 2F8XC 1KELL 3WNMA 4F33A 5GSVA 3O3DA 4JRWA 5D8JL 1EUUA 3DUUB 1KLUB 5C0DB 5T3XD 3RJDA 5FO8B 1KT2A 1MLCA 4JZJA 5CCKL 1FAKT 2XN9E 5CEZH 4PTTB 4LSSH 1JWSA 4D8PB 1EGJL 4UTAH 4U1SB 3PV7A 4RGMC 5J3HD 5L2KA 3RVXC 4P2OB 5C6WH 5MP6L 2VLJD 5DEGB 1TMCB 4RMRA 1BOYA 3RL2A 5D7SH 5DHYB 3STZA 5JPMB 1ZLVK 5DQDL 4RA3A 3ILQC 4UDUA 4POUB 3ZE1F 3FJTA 2F58L 1X5AA 2I5YL 2R2EA 4NWUH 3RGVB 3C9NA 5CLTA 1DBJH 5CILH 5EU3A 3KR3H 4HDIA 3B5GA 4LARL 4ODWB 3RY6A 1NGYA 5CSGA 4G8IB 2VITB 4U1KB 4CN6A 1J5OH 1QTYT 5JR1L 5DQJB 1JWMB 1V05A 2R2HB 4E42A 1P2CA 4K23H 2Z93B 5J06A 1QFPA 1CWVA 2HLFC 2ID5A 4P5KA 4XVUD 3SQOH 4YDJA 4G42B 4YHKH 2E7LC 3ET9F 1FFPA 1VADB 5I1AA 5D7LA 5D2NE 1U8PA 1XGYL 3BQUB 5GRJL 5IVOA 4MXQC 3TO2B 5DJ2A 4K71C 3RWJB 3IDJA 5FHAH 1KTDB 5ECJE 4FFYL 5B38G 1RUKL 1JYVA 5KZCD 3KPMB 2C9AA 4WO4B 1SJEA 2J2ZA 1FZJA 1HNGA 2OXHA 1MCDA 5D2NC 4JY6B 3FKUS 1QFUL 1RJLB 2EDKA 2G75B 4X5WA 4EN3D 3LKPB 1JNNL 3MROB 4OKDA 5HYQA 2D7MA 1BVLB 5A2FA 2EC9U 3JV6B 5CZVH 5CSZB 2J4WH 4HMCA 3WFDH 3D85D 1J1XL 4ZFOB 3G9VA 4G6FD 4K9EH 2P5ED 4K7FA 3U1SL 4QWWD 5AD0A 1NCBL 2KZ1B 3KYKL 3DHJA 3FQRA 3F58L 4GH7B 3PDOB 4IRSA 1OSPH 2R0ZH 3WLWC 1YNKL 5E8NB 4KK5D 3CFEB 3CH8A 3DX9B 5CP7A 5EA0H 4PJAF 5KSAC 3RDTC 1KN2H 4LVHC 3FOLB 4NPYA 3DVNA 3IFLL 3NCCB 1UKQA 1RAMA 1QR1B 2R29H 4M6ML 4NBZB 4XX1E 3PIQB 1Z9MA 5KSVB 3RA7H 1OAXL 3PNWB 1QSFA 1YY8A 1R24A 4PJDB 1JZ6A 1G0XA 3BSZH 4TSAL 1MUJB 3EDKA 5IR1A 1NFIA 4H1LG 1O7SA 3MOAL 4H25A 4N9GB 3MJ6A 1JGLL 1DEEA 2O5YH 4CU8A 4OV5A 2KZWA 3FMGH 3UTSB 4CMHC 4P48A 1P5UA 5AZEH 5FGCB 4I18B 1NGPH 1A6TB 2P1YA 1NC2D 3BKJL 4Y5YB 5GRVL 3RY5A 2A38A 3MLYL 2P43B 2XZAL 5EU6B 3KS0H 2Y06L 2EDYA 4YAQA 1X4XA 4ZO8A 2CXKA 1BPVA 2GCYB 3KYNB 4DWHA 1S7UA 3D9AL 2FZ3B 4Z7UB 3ABZA 4ZFFB 1Q72L 5JOFB 2OJZH 4XAWL 1DLFL 4LLQB 1F97A 1NMAH 4KK6D 1Z3GH 3HE6A 5HVHB 5C9JB 4AEFA 3PWPE 1DFBH 3ALPA 3X13A 3WFZA 1CF8H 1I3UA 5T5FL 1AFVH 3FQTB 1MRDL 3CDGA 1DTUA 3X17A 4NBXB 1U8IA 4Y19D 4XPBH 1F2QA 1XCTB 1EBAA 1F58H 2V17L 5I1GL 3UYRH 4EI5B 4NNPL 3GI9H 1ZHKA 3LS4L 1MFAH 4W6XB 3BIAX 4K8RC 1QFWH 4EUPB 3NFPB 4X7EC 3V7AE 2AV7A 3BMVA 2E9IA 1YN6A 3BZEB 4LSUL 1H5BB 4KVCH 2H32H 4LKCA 4OUUB 1OP3H 1A9EB 1CI5A 4O9HL 5DZOA 4DW2H 2JCCA 5HHMB 1MQ8A 2YPLB 3RU8H 3BPOB 3S6CA 5KSUA 3L7EA 5DURD 3O8XC 3V5KA 1A2YB 1GGBL 3RPIB 3ZYJA 1OY3B 2V5TA 3VXTB 3P4MA 1VGEH 1Y6MR 1XCQB 2VO5A 3VDCA 1IGYA 1WC7A 3RTQC 3RUGB 3WNNA 4ETQB 3N06B 5LGHL 1CVSC 2X4UB 4LDEB 3S35X 5GJTH 5TE7L 1B90A 4NJ9H 4M6NH 3U9PL 3G04A 4QRRB 5CJQH 3FFCA 5H37H 2A2QT 2A73A 5F3BB 2N56A 1NUGA 1KPUB 4K3DH 4GBXA 2X7LA 4ODUA 2CIKB 2HMID 4PJ7E 3Q6GH 1YUHA 4KUZH 2VDPL 1RHFA 5E8DL 3LAFA 1AGDB 4JFDB 4JFEB 5SV4A 3HG1B 4LSVL 5CWSA 5DTFA 3TO4B 4K3EL 4BFIA 1KBGH 4NCC2 5D5MB 3RWCA 3EJZD 1C5BH 4LPXA 1H8SA 2B39A 2IQ9H 3TFKC 3VG9B 3KHOA 1JNJA 4NM8L 2AXFB 1I9RH 1X7QA 4Q97A 1YMHA 3GHBL 1K2DA 3FN9A 1P4IH 1ETZB 3T0ED 1HQRB 1QBML 2BSED 2CKBB 2EH8L 3MZGB 4GAGH 5IVXA 4GAJL 1LNUB 2L4OA 2PN5A 5K9JL 4L8SB 3VMNA 1QP1A 2Y07H 1AKJA 1SJHB 3HI6L 4OJFH 4PJ5E 1AP2A 1GRWA 3EO1B 3KYMB 4JVPA 1DE4A 1C12A 1GVIA 3I75B 3EFDH 4TSCH 1NGQL 1MWAH 4ODXB 2VLKD 3MFGB 4KK9D 3O6FC 4K7PL 3T2QA 1J9CT 4RQQA 4EBQH 4LVOC 2OM5A 1AGBA 3CXDH 3ARFC 3DUSB 4RGOH 4PGEB 4XNYL 5TE6H 4G8EA 5F7EH 1SY6L 3P9MA 1EXUA 2R8SH 1J7VR 2XWBA 1OQXA 5MEOB 1HHJB 3N9GL 4V1DE 5JHLH 3MUGA 5B8CC 2DIBA 2W0LA 1MQKL 3F7VA 4P2QA 1ZVSA 5FM4A 3I9GH 5JXED 1GGTA 3H9SA 4MQTB 4LF3A 3AC0A 3P30H 4MMXC 1WLHA 5E5MA 1UVQA 5EO0A 3REWB 4HGKC 2NXYD 3AREC 3MRDA 1DL7L 2F53A 4H0HB 3KPRA 3UZQA 2JJSA 4TSBL 3TH4T 1U8NB 2F19H 4S11A 4WFEE 1FO0H 4PJ9D 1QFWI 5CP3H 2X4SB 1K4DA 2R4SH 2Z91B 4E41D 5T3XL 4YUEH 1ADQL 1WT5A 2J8HA 2JF1A 5DJZA 5E2WH 5C7XH 1T1YA 1NCWL 1Q9KA 2E6PA 2NW3B 5EOCL 1NC4B 4XAKD 5D2LA 2FRGP 1ACYL 3MV7D 2A1WL 3O4OC 3Q1SH 2VE6A 5BOPA 1I8MB 5DXWA 3H9HB 3OG4B 4MNQD 4LCCB 3TV3H 3D3VD 3PWLB 3TCLB 5HGGS 4WUUD 3QIBB 4PY8I 3MTRA 1CE6B 2B4CH 5DD6A 4UT7H 2DS4A 5ACLA 4GW5A 5EORL 3ISWA 1RJZA 4JQVC 1P7QD 3B9KA 5EU4B 3MBXL 4YWGL 1ITBB 3IB4A 2W65B 5IW6B 1JMXA 1FRGH 2C3VB 2EDFA 3WHE0 5FYJH 4Q9BA 4KJPC 4PJHA 4XNUH 5H94A 3VFUA 1N5AB 2GEEA 2VQ1B 1T3FB 4LHUD 3FT4B 5LGKA 2OZ4A 2H45A 3CSPA 5CIPH 5DHXB 3QT2A 4TUOB 1P9MA 1HKLL 3ZTJG 1JJUA 3LN9A 3P4OA 3SJVA 4M48L 4OAWA 2X9XA 3IRPX 5A43C 2WV3A 2N1KA 3V5DB 4JE4B 5A40E 2PO6C 3BGMA 1SM3H 1QRNE 1TVHB 1FNGA 1P69B 3K2UL 1JK8A 5F93C 1SMOA 2WW8A 3ZT6A 2HT4C 1KNOA 4YJZL 1OGAE 2XQYG 1DBKH 4HWZA 2FSEA 1F11A 5HPMA 3QHFL 2XWTB 1BF2A 4JLRB 1T1ZA 5M95B 4P2RA 4YGVA 1RMFH 3WS3A 1OP9A 1A14L 4RFOL 2D0HA 3C5ZA 2R0WH 3QUZD 1DN0B 1T0PB 1J8HA 1BD2E 1LDSA 3AXLB 1XF4A 4KI5D 4J3TA 5DD0L 1YEEH 5I2IA 3O11B 3RL1B 3IU4L 5CZXC 1DR9A 1QLFA 3ARDC 2ZUUA 1K8DB 2O5XH 3BPCB 2NY2B 4K94H 4JO2H 3VFRB 3H0TA 1MJ7L 5ISZE 3VXSE 4MS8D 4I3RL 4WWKA 1OLZA 1FN4A 4W70A 5F9JA 2XFXB 5DUML 2DKMA 1QYGH 1IGCL 5JW3H 3HCVB 1NBZA 4NRXA 1AR1C 1CG9A 2AV1B 1F3DH 4C56D 3VXME 3L3GB 3VXQB 2X1XR 3K2MC 3QEGH 2W60B 3VXRB 2UY6A 3QPQD 1N0XH 4Z7VA 4TNWF 1KCVH 1R5WB 3WO4C 1KJ2H 2JB5L 3QDMB 1WBZB 3CAFA 4YIQB 5DRNA 3H3PH 4X4MA 3OXSA 3D87B 3AB0B 3ZKMC 1GGIH 4UV7L 2UYLA 1OQOA 5FOBB 3TCXA 4X9HA 4NO0B 3E2HC 4N9OB 1BM3L 3B2UC 4O2EA 2AK4A 2X9WA 2NY0C 4OZGE 4GAFB 3DETD 3KLSA 3DVGA 3E0GA 4S2SA 5EUOF 3CVHL 3QHZL 4ODSH 3HMXH 4BSWA 3MUY1 4OGXH 1A4KB 1MI5B 2YMXL 4ELME 5D8JH 1U91A 2AS5M 2DJ4A 3QIUC 1WZKA 5EZOH 2HJKA 4PJ7F 3AM8C 4NQSB 3P9WB 2HA1A 2P8LA 5L0QC 3EBAA 4LCIH 4O4YH 4QXTA 1EGJH 4YHLL 3HE7C 5SWSB 3NCYP 4U1JB 5GGQH 3TJEH 2ICEA 5MP6H 1T0NA 4DVRL 4X5XA 4KMQA 1P6AB 3BE1H 3KPQA 1FIGL 2PXYA 3ALXA 2A0LC 4Z5RB 1U3HD 3DXAB 5I1KH 5ICZA 1VEOA 5JNYB 4L4VB 4M7JL 3K46A 4N0RA 2EDEA 2W1NA 2IFGA 2MCG1 2IGFL 2DLTA 1LEGB 4QYOB 5KOMC 2I5YH 4EIZC 1S5HB 5GRUL 4QRSB 3D69A 4CUCA 3W11D 3RZCA 4Y5VC 5LBSL 5D7KE 3I6KA 4B7IA 3A0OA 3SE8L 4JDZA 4Y2DD 1RZ7L 3IGAA 3VFWA 35C8L 5GISH 4NT6A 3SN6N 3LD8C 2J8UA 4MAYC 1EH9A 3OX8A 2RB8A 5GGVH 4IHOB 4XP4L 4XGZA 1QR4A 4Y16C 4N1EA 3RWGB 4RMQA 3I6LE 4N68A 43C9B 3MO1B 3RVTC 7FABL 4OF8A 4FFWC 4D9LH 2EYTB 4O5LL 4PJGB 5GRJH 4M3KB 4FZ8L 3U46B 3UTTE 4FFYH 1CK0L 1FHGA 2DI8A 1AGEB 1YY9C 4S1RL 2BSSA 3ES6A 3ULUL 3MLPA 4ZXBD 1T4KB 4X99A 1S78D 1S7XB 1AGCB 2GW5A 5JZ7D 4YHIA 5MI0B 3FT2A 1JNNH 32C2A 4P23C 3BRGC 4Q58C 3O81A 3CFBA 5GGSA 3LKOA 4JY5L 2C4XA 4DN4L 3W39A 1IKNA 5AWNL 1AO7D 2VSCA 3GSNL 4S1SL 1NCBH 3HC4L 3G5XB 1TCRB 1KJ3L 3KYKH 2HJLB 4NC1E 1XEDA 3OF6D 1NQBA 4QRTA 4B50A 3T8XB 1FL6B 1UEMA 1M7IA 1YNKH 2QQKL 1HYRC 1NCDH 5BO1H 3GSXB 1D5BB 3ARGA 1VACA 4URTB 1RURL 4NGHL 2Z31C 3OMZA 4Z0BL 3IFLH 1KIRB 5TJWK 1LD9A 2GK2A 1NCTA 4NC1C 2X05A 3RIAK 3W0WE 5BZWB 5C8JB 3O3EA 3S5LB 5LWYH 4PBWD 5E4IA 3L3DA 4L8DB 1OAXH 3H7BA 3MGTB 4U1NA 5LQBL 1OARH 3TLRA 5CFHA 4TSAH 4BQ8A 4NQEB 5MENE 5D96B 5C09B 3SEPA 3CFDA 5E95B 3TIEA 4LQFL 2YXMA 3V0WL 5T3XE 4HIHB 1JGDB 1B3JA 1CXEA 1KXVC 4I48B 4HKJA 3BKJH 1AI1H 3MLYH 3FB5A 2P44B 5KJRL 4OQTH 4DFHA 5I1CL 5D1ZA 2CUIA 2VLJE 2H26B 3QXWA 2F54D 1RY7B 4I3SL 2C4FU 1X5IA 2X1WL 5SX5H 3DTXB 5DJDA 1U8MA 1DLFH 4HKXA 4HKBA 2Q7NA 2NY7H 5J3HC 1T2JA 2E9JA 1YPZE 5DK2A 1BIIA 4OT1H 1MRDH 4JRYA 4HJ0D 5C08B 1SEBA 1YEHL 3RI5K 3QRGL 1U58A 3TIDA 4NDMB 1MVUA 2EDQA 3JV5A 1MAKA 3BIKA 1EEZB 1CIDA 2Q8BL 4NNPH 3LS4H 4DJMA 1ZHBA 5JW4R 1WBYA 3MLZH 2YC1A 2LQRA 3CFKB 1F90H 5DK0A 5K9QG 4LSUH 4OZFH 5EPMB 1YDPA 25C8H 3OTTA 4BQCA 1PW3A 1QSEA 1ZA3B 4O9HH 3CH1B 2EDBA 4U3XA 1DQLH 4BZ2H 3MBED 3X3FL 3MV8D 4NKIH 5DQ9B 4UQ2B 3B2VL 1U36A 1INDL 2IQAA 4NJAL 4XVUC 2BERA 3LKSA 1FYTD 4ZUWB 5DVKA 1XAUA 2W91A 1U9KA 4KVNL 3QWRA 1PQZB 2QQNH 1PJ9A 2M1KA 2Z8RA 1S9VA 4PIRF 5GS0H 3FO1B 1DBMH 3B5HA 3TM6A 3D39A 4Q6IC 5I1LA 2EKSA 1QSZA 4JGMA 4CBPA 4P4KD 1XF3B 4W6YB 1T03H 3W9DA 2P5EE 5DFTA 4FQJL 5IHZB 3DI2B 5GS1C 4EN3C 3WNLA 4M7KL 4WFFD 4P57B 1BBJA 3EDEA 1INEL 4GAYB 4OZGF 3VXOB 4LSVH 3JUYA 4UT6H 5I8CA 1IM9D 5SWZA 4K3EH 3HMWH 2EIDA 4QWWC 3U36A 1NGXA 4ELMF 2O61A 3GIZH 4NM8H 3QJHB 4PJAA 5KW9L 2NNAA 4J8RA 3L7FB 3GHBH 1JPTL 2XKUA 4OCWH 5J57B 2VXUL 1A7PL 1QBMH 2EH8H 2O5ZL 3FRPA 4KK5C 4QRQB 2OK0L 1GPOL 1I7ZA 1JF6A 2VDKH 4FXGA 4EIGB 1YEFH 2WIMA 2HFEB 3FT3A 4XCNB 4XPFL 2NY3D 4HX1B 4LFHG 1I3RB 2EIZA 4PLKD 4YR6A 1A1NB 3KPSA 5EB9A 1NGQH 4WGWB 1IQWL 2YUVA 3O9WD 3P4LA 2EC8A 1IC5L 3SE3C 4JQXC 5EIIA 4MJIA 3QFJD 2DD8L 3UYPA 3WIFA 4XNYH 5BMFL 1LEKB 1YNTB 3S36X 5I1IH 2NPLX 5FOJA 3IFOA 3DURA 1SY6H 3QULA 1QBBA 5BRZA 1NGWA 2YPLE 4NO5B 1AHWB 1P6FA 3AUVA 3WUWA 5IFHH 4JFQA 4UTBL 1UB5A 3N9GH 3U7WH 3HZVA 4LOUD 1FQ9C 1IM9B 1MQKH 3OSKA 3FO0L 3VDBA 2Q87A 5ESAA 5ICXB 4YPJA 4OLUL 3BP5A 1A47A 4BM7A 4HKZA 2YZ8A 1HXMA 5DZLA 1WAAE 3RWFA 4QRRE 2BXZA 3VXPB 4X8JA 1DL7H 4YBQD 5AG8A 4Y19E 3I84A 3QUYD 4G8GD 4RNRA 1G6RH 1MCJA 4KK6C 4DZ8B 4EXPX 4J6RL 4M62L 1S7QB 1P4BL 1UKTA 4OZ4A 4XXDA 5CGTA 4PRPD 1BX2A 5JDSB 2EDRA 3T1FA 3GIVB 1QA9A 4RIRB 5T3ZD 4RAVB 4YE4L 2R23B 1GZPB 4O02H 4JVWA 4LU5H 3JTSA 1EIBA 4GSDL 2BVPA 3L3OA 2FB4H 5EOCH 1MCSA 3B9VA 3BX7C 3CFIC 3P0GB 5CJ8A 5GQBA 1ACYH 3U4BL 1TITA 3ZKXB 2DTML 4J3OC 3TZVB 4BKLA 1BLNA 4CNIA 4X7TB 1ZGLA 3PP4L 3WFEH 2GSGA 2IBZY 4GLRH 1CDIA 1DSFH 3PWNA 2R4RL 4OD2A 3VG9C 4YWGH 3MBXH 3MYJA 5M94B 4MX7B 4R8WL 4AT6B 1QLRB 4TOYL 5INDA 2P45B 1K4CA 1U2HA 2FBJL 2BK8A 2E8YA 4RRPG 3QNYA 4RISH 3GHEL 4L3AA 4AENA 1FFOB 1PKOA 2CGRL 4A2LA 2RHEA 2FCBA 4MA7L 2D2OA 2IPKA 4AG4H 1M7DB 2PYEA 3L3IA 4LLAA 3K2UH 2HMIC 3D25A 2NX5A 2C5DC 1U92A 1NBVL 1EEYB 4U0QB 1UGNA 1BQHA 4AZ8A 1KJMB 5DEFA 2Q1EA 3T0EE 1V5JA 1TTGA 4DKEH 5KVEH 1JUFA 2XN9A 1NAML 2WIIA 3QJFB 2H32A 4NQXA 3QO1B 1CFNB 1S9XA 1G7JB 4F3FB 3EJZC 1FJ1A 3CZFA 2YD9A 5I1JL 3STLB 2XI9A 3SY0A 2EE2A 4X6EB 3HZKB 3ROLA 3QXDA 4MA3B 3T0EC 2VLKE 4M7ZB 4NQDA 5LKNA 5DD0H 2V9TA 1FZOB 3QI9D 3HPJB 5I8KH 1YPZF 2YKLL 2Q20A 4NSKB 1AQDA 4DKFL 1YA5A 3EYVA 5GJSL 4FMFA 3TBTA 3GSWB 4ZOEA 1C7TA 4NZRH 2DQDH 2QHRL 1ONQB 1MJ7H 1P4LA 4KK9C 1MRCH 2OL3L 2F74A 3FO9A 3GB7A 4JKKA 3M17B 1CGTA 1DQDL 2E7LA 5AZ2H 3GSUA 2NTFA 5DUMH 3GMQB 2PNDA 5BVJB 5BXFB 3I50H 2DF3A 4HWEH 4PJCE 2WWKT 4M8VA 4XNZC 1A22B 3GMNB 2QKIB 1F13A 2HWZL 3SO5A 5CD3A 1C8PA 2OR9L 1LO2L 3RHWF 1HHIB 4KKNA 2JB5H 3QBTB 4XH2B 4YXLL 1YECL 5D2NA 5JXEC 3NCFB 2FH6A 4RAHA 1PKQB 4H5SB 4HD9A 1D9KD 1DBAL 4OFIA 4E41E 1MLBA 2NXYC 2GY5A 3WE6A 1BM3H 5AEAA 3PF2A 4JFFB 5KTEH 1OOAA 4D0DA 3NPSB 4PJ9C 2VZVA 2AEQL 4XAKE 5SWQB 3O6MH 3MV7E 3GUTB 1MWAA 1A7QH 4I2XB 3QHZH 3KNBA 4MNQE 1HDMA 3DMMD 3WIIH 3D3VE 4PP2B 4WUUE 4NFCA 4HLZG 4R4FL 2YMXH 4GLRI 4MAUH 3MRJB 1IARB 3QG6A 2XNAB 3RDTA 2BY1A 4KWUA 3MR9B 3O3BA 5IB3A 3IDGA 4QRPB 4HGWB 5C86A 1LE9A 4CADB 4GRWE 3K8KA 3TA3A 3SO3C 4DVRH 2YRLA 1W0VA 1IGJB 4A6YL 4NZUL 4OF7A 5BZDB 1BJ8A 5C0BB 4OZIB 1VFUA 2JK5B 5K9KA 1CDCA 1WZ1L 4DVBA 5FF6B 1LP9F 3VH8B 4QXGH 5TDOB 1N6VA 5L2KD 4X6DF 2B1HL 6CGTA 4JPKL 4JDVB 4QY8B 1U8HA 3VJ6A 5DD1L 2HTLD 4PUBL 2HH0H 2OTUA 5EWIH 2OS7A 4L4TB 5LBSH 1C5DA 1BZ7B 4DEPC 3C6SB 1ZT7B 5CP3A 1INQA 2DQHL 4XNQA 1RZ7H 5J6HA 1G0DA 4M6AA 3OWEA 4HGMA 3P0YL 5E9DB 2HVKB 5I76B 4DGVH 5T1KA 2RJMA 4HPOL 4YLQT 1HH6A 5K93A 4GQPH 4ODHL 2ZSWB 4ZFZB 5HI3D 3GJFH 3MJ7A 5D7JB 3U4AA 5E8EB 1CXFA 3B3IB 4PV9B 4S1QL 2LAAA 3O3DB 4KI5E 1U3YA 4O5LH 2D7TL 2ICWI 1CFQA 1KT2B 1MLCB 3KXFD 4JZJB 1FV1A 4FZ8H 4HFWB 1RUPH 1JWSB 5AYUL 3MA9H 3INUL 1W0WA 3L3HA 3MRRB 2Y5TB 1A6PA 3QUZC 4S1RH 3O6KH 4OLXH 3ULUH 3B4NA 2ENYA 4H0GA 4KI5C 1V3JA 3IDYB 3RAJL 2D9QB 5CIPA 3QUMH 4UDUB 4L9LC 2VNCA 5FEBA 5DMKA 5IOPB 1RK0B 5AWNH 1I8KA 2R2EB 5SWSE 3MRQB 4C56E 2CO6B 3GSNH 1JPST 4S1SH 1BJ1J 4MS8C 4GRMA 2EECA 2OJEA 3O3AB 5B39G 4HDIB 1RPQA 1NGYB 2QQKH 3JWDH 3TF7C 3DXAE 3RTQA 1HILB 2ADIB 4WI5A 1P2CB 3U0PA 1SEQH 2WZPD 2IPUK 1J1OL 4NGHH 2KUTA 3CK0H 2B1AH 3LDBC 4FFVD 4N8CH 3QPQC 1Q1JH 5E4EC 2VL4A 2ZUQB 4LGSB 4YDJB 4Y4FB 2EXYD 1FFPB 4P4RA 4XCFL 5LQBH 5D7LB 1U8PB 3OHXB 3PWVA 5IHLB 5DJ2B 1FE8L 3SDYH 3IDJB 5EUOA 2B2XL 2GFBB 2MNUA 2R0KL 1NBQA 4LQFH 5DA4A 1RZJH 2EDJA 4HUWB 2FL5B 3V0WH 2ATPA 3ULUF 1SJEB 1FZJB 3DETC 2Z9TA 4QOKD 2VL5B 4BZ1L 1CGSH 2C3HA 4WW1B 1LGVA 1QACA 4X5WB 1VFBA 5F3HA 1NSNH 5HYQB 4U0RB 4PJGE 4WV1C 2R1YA 1Q9LB 5FUOL 1QVOA 2B0SL 3CLFL 4PRHD 2C7UB 4I3SH 4HIJA 4KRPB 5AD0B 4GXUM 5KN5A 5C07B 4M5YH 3FQRB 1Q0YL 1XH3A 4IRSB 5EO1A 2AQ1A 2EDWA 5I15H 4G5ZL 3O6FA 3DI3B 4MXWH 5T3ZL 3KPOA 1R3JA 4OCYH 1KJ2A 4UU9A 3GSQA 4M4RA 1U3HC 1YEHH 4NPYB 2BVUA 3QH3A 4PJ5A 3HE6D 3VWKB 1RD6A 2MQCA 5F70A 2Z35A 3ZZ1A 5KBNC 4DKAA 1QSFB 3W11C 1R24B 3BPNB 5B8CA 1NFIB 2RFXA 3IFNL 3TBSA 2DQGH 4NCDA 5DVLA 5BQ7A 4YDKL 4H25B 4Y2DC 3C09C 3SDCD 1DEEB 4OV5B 3HMXA 3NFNB 4WI4A 5C6TH 4M6OH 4WFGD 4HEPG 3X3FH 1FZMA 3IJHB 3AREA 3EJYD 2O93L 3B2VH 4HXAH 2W0FA 4PJCF 1IM3B 1C16A 1EGJA 1OW0C 1QBLH 4D9QD 2H3NA 3MJ9L 3LIZL 4KVNH 4YAQB 4CAGA 3MREA 3E6HA 4AY0A 4XC1L 2QSTA 2L7JA 3T77B 1S7UB 4XWGL 4X0KA 4MJ2A 3RIFF 3JV4B 1NMBL 2Y5EA 1WICA 4K3JH 2OLDA 3MRBA 3BJ91 4EI6A 1HN1A 4B53A 5GGSY 1I1YB 2X4QA 4XVSL 1AO7E 4ZXBC 1YEJL 1S78C 4FQJH 3ZDXE 2W0KA 3L9RA 5JZ7C 4M7KH 1A8JH 3FFCD 1U8IB 1A0QL 2VAAB 4JQVA 2APWA 1JIBA 3C5SB 3HAEH 1CLOH 1JPTH 4OIAA 4LSPH 1YN6B 3MRFA 4Z78A 3H7LA 8FABA 3U9UA 1JVKA 1A7PH 2O5ZH 5F97E 5TQ2H 4EKXA 2VLMD 4LKCB 5ALBL 1GPOH 3PL6A 4NQUA 5HDLA 4GRWF 5IWLC 3DJ9A 3JZ7A 2JCCB 1JF1A 4I4WB 4PG2C 4GXUN 4TNVF 3KLDA 1GZQA 3V5KB 1RZGB 5I1EL 4FNLH 3FQNB 3AMKA 2X89A 4U1HA 4WTXA 3LKRA 4J23A 2ICCA 1EVUA 2CLVA 3P4MB 1ZGLM 1IQWH 1T7ZA 3OXRA 1IGYB 1WC7B 5FM5M 4BZYA 1IC5H 1R0AL 2DD8H 4QGTA 1OVZA 4P5MB 5KS9B 1WWWX 4ONHB 3T1WA 4GG6E 3GNML 1CBVL 3G04B 5D1XA 1FVEA 3DNKA 4YHNA 3O4LA 3U82B 1EZVX 2HKFH 4PV8A 2F54E 3C60D 4UTBH 4GBXB 2X4PA 2X7LB 3EOAA 3ZSSA 3LS5L 2B5IB 3VW3L 4KUCD 3FO0H 5JOEA 4KGJA 1Q8MA 1WIOA 2GJ6A 4U05A 3VMOA 4HJJL 1P7KA 2VXTL 5D9SB 4AEHH 1YMMD 5CWSB 1OAUL 2FGWL 2WP3O 1FAIL 3N50A 5DTFB 4F8TA 4BFIB 4G3YH 4P2QD 3RWCB 3NN8B 5GSRB 5E5RB 2LU4A 1CIUA 1XGQB 4KI5F 3UTZA 1U42A 4XVJL 1BD2A 1X7QB 3H9SD 1YMHB 4J6RH 1K2DB 1QFWM 5C92A 1P4BH 4MGXA 1KG0B 4YK4C 1DANT 2XZZA 2F53D 4HJ0C 4YE4H 5FA3A 5AG9A 1AKJB 2D31A 3GJEA 4BH7A 1AP2B 1DE4B 4YEFA 1C12B 4GSDH 1CICA 1IEAB 2RGSA 1LK3L 5TPWH 3VXSA 3U4BH 4XT1C 5DR5H 3OB0K 4RQQB 3OKNB 1AIFA 3MYZA 3PP4H 3GEWB 3THML 1FYTE 4G8EB 5ALCL 1IAOA 3D0LB 2QQQA 1RUMH 3P9MB 1EXUB 2R4RH 4HV8A 1LILA 3VXMA 1AD9A 4F15C 5F9OL 5IBLD 2XWBB 5E08L 4IOSD 5CGMA 2H1PL 3SDAA 4R8WH 3MBEC 1S9KC 4HT1L 5IK3B 2BCKA 1SYVA 1OAKL 3FO2A 3MUGB 5HHOA 4U1IA 4XC3L 5D70L 3F7VB 5FYKH 4DTGL 5HYSA 1OL0A 4LCUA 5F1KC 1H0DA 5JLZA 4W4NA 4G9FB 3VGAC 4LFHD 1HKFA 4J1UA 4LF3B 4OB5H 4GUPB 3BHBA 4PGDB 1MHHA 4PJFA 4XMLL 4E0RB 5E5MB 1FG2A 1M71A 1UVQB 4WFFE 2RAMA 2HLAA 1W72L 2XA3A 3MRDB 5IG7A 3KPRB 2O26U 3OJDB 1PX3A 4J3VA 4P4KC 1MJ8H 1G9MH 3TNNA 4MA7H 4OZGA 4DUXA 1IVLA 3H8NA 3HE7A 1MAMH 4BUHA 4RX4A 1K4DB 5DHVA 3QQ4B 5INCB 3QUXA 5I75C 3RNQA 5CLWA 4ELMA 1IGIH 1U2CA 2WNGA 2AVGA 1B0WA 4RWYL 1T1YB 2BOCB 4DFIA 4OZFA 4PYHA 3DPBA 1NAMH 5H35B 1RZIA 5I1JH 1QLEH 2VE6B 3IKCA 4ELKA 4KDTC 4LRNH 3T3MF 2WINA 2VLRA 3CMOH 3O2VH 4LPVA 5J9PA 3QEHA 5DJAA 5GHWH 4GFTB 2F8VA 4Q9QH 4GW5B 4IRZH 3FB7A 4KROD 5J1TC 5JIPA 2YKLH 3B9KB 3QFJE 3C5ZD 2NY3C 2PR4H 1J8HD 1UYWH 5T1LD 3ZHLA 1I9JL 2BRRL 2X10A 2YOCA 1REIA 3UJTL 4PLKC 1YEIL 1I8LC 5H94B 3VFTA 4HH8A 2QHRH 3VFUB 1KCRL 3MRKA 4Y16A 3MMEA 3O9WC 2OL3H 1T21A 3VFSA 1H3XA 3VI4E 4KQ4L 4QF1A 5I17B 3OZ9H 1ORQA 4OSUH 4KPHH 3SJVB 3MV11 4HF5L 1S9WB 2DL9A 4OAWB 3BO8A 3GSOB 4G7YL 1GH7A 2J7LA 2Q76A 5J12C 3BGMB 2VR4A 1UXWA 4JKPL 2HWZH 5GRWA 5JHDB 1FORH 1JK8B 2OR9H 4APQA 4LOUC 1V3KA 2ZCLL 5C70A 4P9MH 1LO5B 4JHAL 4G8GE 4YXLH 4HWZB 1MCEA 1F11B 2FSEB 5C2UB 2ZUTA 3HC0A 5HPMB 1YECH 3BH8A 1R3HA 4KV5E 3LEVH 4PRPE 1T1ZB 2VUYA 4P2RB 4IS6A 2X70A 1MY5A 4P23A 5T3ZE 4YGVB 5CINL 3WS3B 4YBQC 3QUYC 1KYOK 3K4ZA 1YEDB 2J3SA 5FB8A 4C54A 1MCFA 3PGCB 1XF4B 4OCXL 2UUDH 4K3GA 3T2OA 4IIQC 4TTDD 1J1PL 2AK4D 2CPCA 3LCYA 3ZDXF 1ZHLA 1K3ZA 2RR3A 2EYRA 3BW9A 2Z31A 3O6LH 3X3GL 1SY6A 3H0TB 4UB0H 2FJHB 4WWKB 1HQ4A 1FN4B 3S37X 2X9YA 3ZHKA 4CJ1A 2D7PA 5F9JB 1HIML 1HCVA 4A6YH 5EUKB 4PGCB 5J11B 3NACH 1NBZB 4NRXB 1WZ1H 1CG9B 2F8OA 3VWJA 1VGKA 2YPVL 1CD1A 2ED9A 4JO4L 4Z7VB 5DD1H 4NNXA 1IT9H 2BFVL 1CQKA 3W5NA 1JWUA 1A7RH 1G6RA 5LAXA 4ZNEE 2DAVA 1HOCA 4GMTL 4YDVA 1G7MA 3ETBF 1NMCC 5TF1L 2DQHH 2AXJA 5DF0A 4NZJA 1PZ5B 3B6SA 1C1EH 5C0CB 3P0YH 4O2EB 3RZCD 1ADQA 1B0GA 3TNMB 2AKRA 4HPOH 4ONOA 4GG6F 4XP5L 2DQJL 4NP4L 1BECA 4ODHH 3EJJX 3QXAA 2G5BA 4X4ZA 4DCQA 4BSWB 3F5WA 2VLJA 4S1QH 1IAIL 1Q94A 3QWOA 2DRUA 4GKSA 2HJKB 4F9LC 3GKWL 3QQ9D 4IEFB 4KHTH 1IL1A 2CIIB 2P8LB 4OZHE 5E00A 3X14B 5ILTH 5T1MA 4H1LH 3C87A 3INUH 1KYOJ 5DEZA 3D18A 2NY5H 2AK1H 1WJ3A 2ICEB 1T0NB 4X5XB 4I2XE 1F02I 3KPQB 3QI9C 1ZHNA 2PXYB 4OD1H 1NLBH 2ITCB 3RAJH 5DUPL 2IMMA 4XZUA 1CD9B 2DMBA 1A3QA 4L8BA 2XPGB 1GGCL 4P3CL 2WLZA 2GJZA 4QHNA 3I6KB 5CJXC 4OZIE 1QOKA 1AY1L 3DGCR 3R06A 1NEZB 2ADJA 4JDZB 3OKKA 5AUMA 5E1HB 3IGAB 3OR7B 4TNWK 3DX7A 4ZUUA 4N8VA 2J8UB 1Z9OA 1EV2E 4Q6IA 4PJIE 5MEQB 1A02N 3MGOA 1ZLWK 3RWIA 1R6VA 4Y4HD 1YJDH 3ARGD 1FZKB 4HSQA 1MPAH 4XP9L 5EOTA 3FN3A 3FRUA 3GI8L 1D9KC 4EN3A 4TVPH 5E9DE 1FE8H 1U95A 2CDFA 4XP1H 2ICWA 2R0KH 1TCMA 5FA4A 3D85A 1SQ2N 1UH4A 1CLCA 4TQEH 4LCYA 3FTGA 3BKYL 4YHIB 1TENA 3AROA 3QDHA 3DMMC 3FT2B 32C2B 3Q6FA 1WISA 3L3JA 3FCTA 3CFBB 4YDIH 3LKOB 2VIRA 1HINH 2B0SH 1G7PA 2VOTA 3W39B 2AXGA 2V9QA 5I8OH 1FLRL 1NCCL 1L0XA 4NWTL 5L2KE 5I9QB 4JG1L 4RGND 1LP9A 4QRTB 3QAZB 4BQBA 1OAYL 2YD4A 4G8FA 4P49A 5DDHB 1QNZH 2BX5A 3QXVA 4KTDL 4X6DA 4G5ZH 5DD3H 5F7MC 1WWAX 4RAUB 1VACB 1IILE 2PF6A 1WITA 3VFPA 5GGRY 1JZ4A 3HTLX 1RJCA 4L3CA 4JAMA 4JM4H 1R3IH 3O3EB 3EHBD 3L3DB 4DZBA 3SE4A 2DMCA 1RIHH 4JRYD 3PHOA 4CVWA 2CMRL 3H7BB 2HTLC 4JM2D 3UC0H 1NC2A 4K7PX 3IFNH 1VHPA 3MC0A 3EOTH 4P2YA 4ZOCA 3TIEB 4MJ6A 4H88H 2ZOKA 3KXFE 3RY6C 2K1MA 2HFFB 1JBJA 3IDUA 4HKJB 5HI3C 2WUCH 3FB5B 1KEGL 1QSED 4LP5A 4OCLC 3GRWH 5D1ZB 2DDQL 2ERJB 4XC1H 5E1AA 5EU5A 4XWGH 1A6WH 1XR8A 1GGYA 1NMBH 4HJGA 4Y19A 4POYA 4ZO6A 5DJDB 4KV5F 1U8MB 4Q74A 4HKXB 1I9EA 3QWRD 4LBEA 4J3UA 3QQNA 4XVSH 4JN1L 1CCZA 4ZYKB 3TPUA 1YEJH 2E3VA 4OTXL 1ZEAH 3R4DA 5EOQL 2CKNA 1SEBB 1LDPL 3V6FB 1MHEB 1A0QH 1U58B 3TIDB 1AE6L 5AAWA 1NCAH 4OF6A 1OP5H 2VH5L 2H8PB 2AI0L 2Y7QA 5J89A 3QUKA 1F4AA 4LCWB 1ZHBB 4U0RC 4BFBD 1BZ9A 3HNTL 3HR5A 5DK0B 3A6OA 1X5HA 5SWZD 5ALBH 1UM4L 3GJFA 3NZ8A 4PTUA 1LO3L 1MIML 1KJVA 5HSFA 3DX6B 5LCVH 5DRWA 4U31A 5E94A 4MNHA 3GKZA 1DUYB 4FFVC 3OAYH 2IQAB 1QSFE 1SVCP 2EXYC 5IROC 4P46D 3MRNB 4G6AD 3FQUA 2P48B 1JZ3A 2DQCL 1R0AH 5F1IB 4QOKE 4L29A 2AEPL 4OM1H 4QNPF 4AH2A 1S9VB 3NGBC 3D0VA 2QBWA 3IKKA 3KPSD 3V6ZB 2AJYL 2V2XB 5C3TA 3D39B 4AIOA 5I1LB 2EKSB 2GJJA 1IKFH 3MODL 5EIQA 3OKYA 3QDGD 4PRHE 3K74B 3W9DB 2YUZA 5IESH 4U33A 4RFEA 1TZGL 3U2SA 3GSNA 1B0RA 1K6QL 1VPOH 3QZWG 3AS0A 3UTPD 3P77A 3T0EA 5C0IA 3SOBH 5I19H 1UCBH 2VXTH 1NAKL 5MERB 2CO7B 5BVPL 3PQYB 1OAUH 2FGWH 3OBAA 3WS6A 3UPRB 1GSMA 3EDJA 5I8CB 1NH6A 5F21B 2EO9A 3NA9L 3FB6A 3RFZC 3MCKA 3U36B 1NGXB 3ZTJH 4PJAB 2RIKA 2EDOA 4J8RB 5EG6C 1I1FB 5BJTA 4OZHF 5IB5A 3SE9H 2V2WB 1FC2D 3UBXB 1I7ZB 4FXGB 4KKBD 4N0YL 5I8EB 1IGMH 1SBSL 5HGBA 3FT3B 1M1SA 1YQVL 3MUHL 4MA1C 1LK2A 3QSKB 2FATL 1GXEA 2EIZB 3HE6C 1DN2A 4P99A 4MNGA 5KANG 3LEXB 2LFGA 4ODBD 4WU7A 4YR6B 1QPXA 8CGTA 1LK3H 2WANA 4WFGE 2XTLA 3BUYB 5JA8B 2DI9A 2IWGA 2CJUH 4LASH 3N1PC 5EIIB 4MJIB 4BK5A 1S3KL 1C5CL 1KFAL 5TF0A 1FH5L 2D3VA 2I24N 2J1KA 2KL6A 3SDCC 3THMH 5E6ID 1JYNA 5JXEA 4D9QE 5DYOB 3IFOB 3DURB 4ODVH 3QULB 5BRZB 1NGWB 5F9OH 3KYOB 4KMTH 5E08H 2H1PH 4JFQB 4CW1A 1RK1A 3EJYC 3PG2A 4HT1H 5C0AB 5IQ7L 4XHJD 4M5ZH 3W9EA 5SX5K 3TH3T 2Y72A 2VKWA 4PJ9A 2DTSA 4YQXL 4M43L 4QXUH 4XRCB 3BP5B 4PJIF 4NCC1 2E6QA 1HXMB 4HQQL 4MA8L 3RWFB 4XMLH 4E41A 3A6CH 1Z9SA 3FFCE 2H9GA 4X8JB 3VFGL 1ZOXA 3S96A 5F9WB 2J6EH 2W59A 4PY7A 5FYLH 1LE5A 4OZ4B 1URLA 2HG5A 2XKSA 1QHOA 4UNVA 2CUMA 1BX2B 5JO5A 1F42A 4RFNB 4MNQA 3T1FB 3D3VA 1UA6L 4R3SB 1U8JB 2OYPA 4CU6A 4GW4A 4UIMA 5GGVY 1KTRL 4RWYH 3JTSB 3IDXL 2VLME 5TQ0L 1IFHL 1P7QA 1R3KB 2BVPB 3ESUF 3VE0B 3L3OB 3PV6B 4H26A 3BGFC 3C2AL 4N0CD 1NCNA 2HVJA 3P3YA 3T0XA 1WTGT 4BKLB 4QHMA 1CTOA 4LHUA 5IVXE 1ZGLB 4NN5C 2GSGB 3QIWB 1I9IL 4HK0B 1QEWA 4LDLB 3PWNB 3SKNA 4OD2B 4TN9A 5TFSL 1PVHA 1RFDL 3MYJB 2K7PA 4PJEF 4HULB 3DYOA 2BRRH 5FECB 1WCQA 4NQDD 2VZOA 5INDB 1YEIH 3MLTB 1K8IA 1KCRH 2CD0A 1BOGA 5ITBL 5HGAA 5KVFL 3LPFA 2AEWA 5C0ND 2JE8A 3ZKQD 3OKOA 1GAFH 4IBLT 1GHFL 3QNYB 1DDHA 4KQ4H 3I2CL 3M8OL 2MHAA 1X5JA 4OIBA 4X83A 2XY1A 4HF5H 4AENB 5GGTH 2LU7A 1NEZG 1YMME 3QCUL 1M05A 3C60C 2BNUA 1X6NA 2PYEB 3L3IB 3DSFH 1OAQH 3K4AA 4P2QE 4RZCB 2NX5B 1JNHB 4RGMB 2Z0BA 4JHAH 3W2DL 1U92B 3QUZA 3AS3A 4YPGA 3H9SE 1BQLH 5DEFB 4FQ1H 3HAEA 4FP8H 3P73B 5E2TH 3OAUL 3ZT7A 3I6GA 3SDXF 2BVOA 2WIIB 2F53E 2XN9B 2H32B 4NQXB 3KPRE 1JHLL 5CINH 1FJ1B 2FHBA 2XG5A 3ZO0A 4GG8A 1XIWA 3UMTA 4EUPH 1TTFA 5T1DL 3ROLB 3QXDB 5DJ0A 2VRAA 5ADPH 3CXHK 2DWEB 4NQDB 3UCRA 5HD8D 2VXVL 2BDNL 1PYWB 2JJSC 5KAQG 1WK0A 3EYVB 2BVQA 3WKML 3TBTB 4P5TA 2DQTL 5D2LE 3V8CA 1NUNB 2VDNL 4JPVL 4K2UH 1P4LB 4HIIA 2QHLA 3GMLA 2F74B 3GB7B 1WT5C 4PB9L 1TIUA 1T22A 1AXTL 1MFDL 1HIMH 4HUKB 4PJBE 3GSUB 2NTFB 3WBDA 3LZFH 4ZG1A 2DQEH 3I3BA 3HI5H 4CMMA 4KDVA 4AQ1B 1AC0A 5IBLC 2YPVH 4K71B 3TA3D 4PJHE 1I7TB 2VN4A 2ZJSH 1WWBX 2P5WD 2A6IA 2IPUG 4OUOA 3W5MA 3S88H 4XPGL 3EOBA 4IDJL 4MB3A 5D2NB 2R69L 3TYGL 4GMTH 5IBUB 1BFVL 1D5ZA 2Q7YA 4F7TB 12E8L 4RA0C 1JZ2A 1IQDA 1RULH 2ZUYA 3WE6B 2CRYA 4U6YB 1E6OL 2P46B 3UTOA 1X5FA 4D0DB 3NABH 4U6VH 1TPXB 4R96B 1AGFA 4XP5H 2DQJH 4NP4H 1EFXD 1XR9A 3KNBB 1HDMB 4HS8L 2GI7A 5H2BA 3U48A 1IAIH 5T1KD 5A2LH 1QFHA 1QO3A 1A7NH 3QG6B 5E8PA 4BSVA 4LSSL 5HHPA 3LN5A 4UTAL 4WHDA 1MCCA 3GKWH 3RDTB 5KSAB 4LVHB 1P1ZB 3P11H 5IB3B 3IDGB 4IJ3C 2HKHL 1J8HE 3O45A 3CGTA 3FFDA 4BH8A 3CXHJ 5I74C 3K3QA 5D7SL 2VDLH 1G1YA 4KQ3H 5K9KB 4HUNB 2H6PA 2YA2A 3CPLA 3M45A 4KROC 4PG9A 3VD9A 1M6OA 5FKPB 3C5ZC 5DUPH 4U6XA 1TZIA 4NWUL 3UPAA 5FYJD 4RMSA 1U8HB 4HHAB 5CILL 3KR3L 2XWJA 4CMHB 4LNRA 1GGCH 4P3CH 4OKVA 1J5OL 1AQKH 1C5DB 3P4NA 3NFSH 1Z5LA 1FNEA 2DM4A 2QEJA 1INQB 2FNBA 4XNQB 2IH1A 3RHWK 2AJXL 5D5MF 3GDBA 3ZKSD 2XZQH 2G60L 3SQOL 4YHKL 3RWEA 5HXMA 1NAMA 3QEQA 4GS7C 1G0YR 2BSRB 3CFJA 5T33L 4X4YA 3MJ7B 2NY6D 4I77L 5F89A 5DJXA 2PTVA 2A6JB 4ZXBA 1H9VA 4MD0A 3IJYA 3SDDA 4PS4H 4I1NB 5FHAL 4I0PD 1YEGH 3GI8H 3BOVA 2D0FA 1FV1B 1FBIH 4CN1A 2AK4E 3DRQA 1W0WB 3L3HB 4LMQE 4AEEA 2Y36L 2I9TA 3NBNA 4OI9A 2VDMH 3IU3A 1AO7A 3PWPB 4N0FB 5EOCJ 2MWCA 3T4YA 1F4XH 1EJOH 3OF6A 3BKYH 4MMZC 5CZVL 3WJLA 2XICA 2OL3A 4TTDC 4R0LC 3PHSA 3FZUD 3CFCL 3REVA 4K9EL 3FB8A 5F6HI 5DMKB 3ZDZE 1QD0A 3B9EA 1NCCH 5JQHC 1MCNA 1R3LA 4NWTH 3O8XB 5J1AB 5EA0L 1TQCC 1KN2L 1KULA 3RTQB 2NY6B 1BQSA 3RNKA 1F3JA 1UFUA 3DBXA 3RVVD 3MOBL 3ARSA 2LVCA 2ZNXA 3UBXG 5A2IH 1N64L 2JIXA 4HMDA 1GL4B 2GUOA 3I3EA 1ZS8A 3Q2CA 4NIKB 4JFYA 4P4RB 3TVMD 4TRPL 5HBBA 1Z6JT 3MLSL 3U79A 1ZSDB 2O5YL 4LQ1A 3PWVB 1D6EB 4GG6A 3FMGL 1IAII 4OCNC 5EUOB 3TH2T 4ZAKD 4EOWH 4MJ5A 3RZCC 5AZEL 1CD8A 4LLMA 1P53A 1UXSA 4QHUA 4KUCF 4ZOBA 4PJ7B 2OX5A 4NQCA 4PRNA 1NANH 2FIRT 3PXJA 1JP5A 1VFBB 1PGRB 1KEGH 5B3NA 4JREC 4U7SA 4WGVB 5T5NG 5DRZB 4KXZH 2OJZL 4A6YA 1QVOB 5B38A 3QQ9C 3JWOC 2ICWJ 1NMAL 2AERT 2P42B 4HIJB 4E5XB 1Z3GL 2J88L 5JIKA 3F6IA 5KN5B 1E27A 4FQHA 4HBCL 5ESVA 1XH3B 5EO1B 4JPWL 4JN1H 3O6FB 3KPOB 1R3JB 4XPBL 3JSSA 4LVOB 2XV6B 1F58L 5IEKA 5IJKC 3ARFB 1LDPH 3UYRL 3QH3B 4PJ5B 1ITCA 1AE6H 1K5NA 1MFAL 4D2NA 3ZLQC 2BY2A 5FV1L 4W6WB 1QFWL 2AQ2A 2AI0H 1RQ5A 3MV8A 5L7XH 1K3IA 3H2WA 5FKAB 5L8JB 5B8CB 5D2LF 2OCFD 3HNTH 3TBSB 4D0CA 3N85L 4PRIA 5DI8B 1FYTA 5BQ7B 5JPNB 2FIKA 5F9DC 2YBRA 1UACH 1IKNC 1KEMH 3GJFK 4DW2L 2UVFA 1UM4H 2DN7A 1LO3H 3ARBA 1MIMH 1CVRA 3EDFA 4UIKH 4X80L 2BY3A 1S7VB 1UJ3C 5F7FA 4PJBF 4V1DB 1FZMB 3AREB 4UV4L 5K9QI 3VFVA 1VGEL 4PLOB 4P4KA 1C16B 5FGBA 3KDMA 4Y4HC 3PL6D 4FMKA 4F2MA 3ARGC 4H1LA 3HN3A 4IRJD 4PJHF 2H3NB 3RVWD 4M6NL 2AEPH 1Y0LA 3CVIL 1I7UA 4X0KB 5ENWB 4K3DL 3HB3D 4LLUA 4MLSA 5IQ9B 3PABB 3MODH 1BBDH 3MRBB 3F65A 2FLRT 4FQIH 5EO9B 4EI6B 1UM5L 1B4RA 1PG7H 4KUZL 3MNVA 3O4OB 4ORGA 2YK1L 5CBAA 3L9RB 4RGNE 5D1XD 3SHSA 1K6QH 2CDEA 2MTPA 3O4LD 3O2DL 2YRZA 1UH3A 1KBGL 1NAKH 2ZUXA 1C5BL 2BSTA 1HCFX 3LQZA 1L6XA 1KLFA 3NA9H 2XKNB 4MVBD 3LKNA 4RGNC 2NTSP 2GJ6D 4GAGL 4BQ6A 3ZE1E 3MRFB 4JFXB 1A7BA 5DFWH 4Z78B 3U9UB 4JRYE 2DJUA 3O9WA 1B9ZA 2Y07L 1SBSH 2ZNWA 3QFJA 3ARPA 5EZIH 1S7WA 3EFDL 4TSCL 1MWAL 3WKNA 4OBSA 1E28A 3VCLB 3EHBC 2PO6B 4Y4KA 1IAMA 4U1HB 5FGSA 2JB6A 4FQLL 3CXDL 3KJ6L 4JM2C 3QXUA 5TE6L 3OXRB 4RGOL 4V2BA 1NANI 5EBWA 3HHRB 1CR9L 1S3KH 5FYJU 4CDGC 1C5CH 4Y8DC 2R8SL 1N8ZA 2YD7A 1CICD 1QSEE 4WENB 1FVEB 4KXZI 4Z7OE 5HDQH 5I73C 1XGTA 3G08B 1QRNB 4UUJA 1JHTB 2EDLA 1WFOA 3EOAB 3LQAC 1KENL 5IQ7H 4NKMA 1OGAB 3QUYA 4G8GA 3I9GL 3NZHL 5FO7B 4MJ4A 2JELL 4YQXH 4M43H 4PRPA 5C0GA 4Y1AD 3SDAD 5JUEL 1TQBC 4IIQA 4Z7NF 1ZLVH 3L5XL 2VSDA 3HUJA 5HHOD 5F1OB 4CDHA 3ARDB 2F19L 4MQ7A 3RJQB 1FO0L 3UTZB 5HHVL 1DQQA 5IJVA 3O0RL 1BD2B 1AH1A 1TNMA 2IALB 2R4SL 4PBXA 2QQLL 4YUEL 1QFOA 1GOGA 3GMRA 2VABA 4L3EA 5EC2A 1EAPB 5FA3B 3DRTA 1TTUA 3CLEL 1UC6A 15C8L 1I1AD 2D31B 3GJEB 4BH7B 1ORSB 5SWZE 2NZIA 5TQ0H 1DUZB 3BP6A 1MH5A 1UWXK 4KI1A 2BHUA 2UWEA 5ISZB 2COQA 3C2AH 4ZUSA 3TV3L 3VXSB 3BEVA 2B4CL 1EVTC 5F88A 5IF0A 4UT7L 2DYPD 3ZDZF 1KB5L 3WO4B 1AIFB 4TNVK 5E7FA 3PGDA 4J4PD 5CBEA 3DV6A 4OLVL 4HV8B 3VXMB 5FYJL 3MJ9A 5TFSH 3T0BA 3TN0D 2UV3A 2VLRD 3KPSE 2G2RA 1JYWA 3E2HB 2BCKB 1SYVB 5HYJD 3HNSL 1T04A 4HLZH 1F3RB 1J10A 3JTTA 4P46C 5EBGA 2NY0B 4G6AC 2NLJB 5KVFH 5JLZB 3V0VB 2FR4A 4J1UB 1IEBA 3UTQA 4KH2A 1F4WL 3BHBB 1MHHB 3I2CH 5GS0D 1FG2B 1M71B 3UTPE 2HLAB 3X11A 1SM3L 3C08L 3QIUB 2VQTA 5F1SA 4F9LA 1JGVL 5L0QB 3QCUH 3T08A 4OZGB 1Y18A 3HE7B 1F8TL 3WHE1 1LEIA 1V3MA 3W2DH 5DHVB 1JE6A 2JLLA 3QUXB 2A6DA 3MJGX 5JW5A 4ELMB 3LOWA 3RX7A 3OAUH 1BAFL 1RMFL 3QI9A 4APQD 4LMQI 3MNWB 1JHLH 2R0WL 3Q0HA 4K9EC 1II4E 1UZ6E 3C6LA 1CL7H 2XY2A 5TGBA 2C3XA 1CQYA 1KIQA 1FSKC 3CSYB 1ULVA 2MOVA 4XNMA 1MNUH 4X98A 1JN6A 1ND0A 1VENA 5J9PB 3QEHB 5DJAB 2BRQA 4U3CA 4DN3H 5KVMC 1FCGA 4N90D 3ROOA 4KKBC 4FTVD 3FB7B 4EDWH 3MRIA 2VXVH 2O5XL 2PTTA 3FAWA 3QDJD 4HK3N 4R7NB 5IV2B 4YNYB 4K94L 4XPHL 3P9LB 3WLBB 3LD8B 3VFTB 2VDNH 1KLUA 4MAYB 5FV2A 5C0DA 5FO8A 3P2TA 4Y16B 3MMEB 4PTTA 4CVZA 1QYGL 4U1SA 3VFSB 4PB9H 4QF1B 1AXTH 1MFDH 5JW3L 1EO7A 4P2OA 4XPAH 1G9NL 5E6IC 1MFNA 4FHBD 4JFHD 2DLIA 3QEGL 3S4SB 1N0XL 3RX8A 5DHYA 4FQCL 1UXWB 4PJIA 4BUGA 1KJ2L 4XCEB 2MMXA 1FVCB 3IAGC 4XHJC 1JPSL 1T5WA 2E7MA 3I02B 4PGBA 2HRLA 2GAZB 3HC0B 3VWJD 5ESQA 1F6LL 4XPGH 3BH8B 4NOBA 4NHUA 4M00A 1J0YA 5HGDA 3DMMA 4ODWA 4XHQA 12E8H 1J87A 4P23B 4U1KA 4WWID 3UTTB 4EEEA 4NZDA 2MJWA 3WO3B 1UWGH 3ARZA 1UM6H 5E56A 5FB8B 2Z93A 4NC2B 1KN4H 3NA4A 4JFPA 4OFPA 3WIHL 2J8OA 4KDWA 4OGXL 3LPWA 4HS8H 5EZOL 1VADA 1HZHH 1MCRA 4LCIL 3T09A 4O4YL 1ZHLB 1PY9A 4KZDL 3IAPA 2EYRB 3F8UB 4LKXB 5KG9A 2Z31B 3BQUA 3TO2A 3HNVH 5GGQL 3TJEL 1UH2A 3RWJA 2HKHH 4N0CC 1HQ4B 3BE1L 5K59F 4NQDE 4PJEA 4YGAB 3MRGA 1OPGL 5I1KL 2V7HA 3HC3L 1R5IB 4U2YA 2ARJB 4GQ9L 5HYFA 2VZUA 1VGKB 3MROA 1CD1B 3W0WB 4F7MB 4ZSOE 1BVLA 4JM2F 3EYFA 4FXKA 4GXVL 5CSZA 4O58L 4UDTA 1S5IL 2H41A 2DICA 1W72A 4ZFOA 3HKFA 1JWUB 5LAXB 5C0NC 2LTQC 1HOCB 2J6EA 5GISL 5MENB 1G7MB 4JJHA 3VD7A 3B6SB 3E8UH 5GGVL 5E8NA 2AJXH 3CFEA 2NW2B 3DX9A 3LRSA 3MGAA 3OKMA 1B0GB 2G60H 3KXFA 3PWUB 4NKOB 1CL7I 4PJ8D 1QR1A 3SDXA 5DZNA 3EO9L 4Z7OF 5T33H 4D9LL 1WFNA 4I77H 3F5WB 2VLJB 1XGPB 4PJDA 2KKQA 2R2BA 3QWOB 4POZD 1LVEA 5C0JA 1JZ8A 3DGGA 3L1OH 5E00B 3ARYA 5T1MB 2N7AA 5FM8A 3D18B 1YPZB 2X4NB 2R2CA 4LVNB 2Y36H 3UTSA 1SJXA 3S7GA 4I18A 5HD8C 1ZHNB 5F1NA 4MD5A 1CU4H 2APFA 1XZ0B 5ETUB 3HA0A 5EU6A 3CFCH 4MYWB 2HJFA 2YD8A 1TPXC 2I27N 2GCYA 3KYNA 2XTJD 5GGTA 4Z7UA 3SKMA 3EGSB 2BNRD 4ZFFA 3B83A 1NCDL 1L0QA 2GJZB 4JN2A 5BO1L 4KAQL 2PTUA 5GS2D 2P5WE 5IROA 2ADJB 2X4RB 1M4KA 4AK1A 5AUMB 3MXVL 3DX7B 4ZUUB 4N8VB 3MOBH 2YUXA 2LE9A 3TA3C 3ZYOA 5LWYL 1T6WA 3LSOA 1N64H 3MLXH 3NVQA 4Q6IB 4CU7A 1XCTA 4UOW0 3RWIB 5KZCB 1OARL 1DANU 1N2RA 2H2PD 3G6AB 1A21A 4TRPH 4QOKA 4X6FA 1DJSA 3MLSH 5EOTB 2GSIB 5GS1B 4EN3B 4MB5A 1HHHA 1MIEH 1DCLA 2CXGA 1H5BA 5IVZA 2CDFB 4YC2C 1A3LL 2ICWB 5JXAH 5FA4B 5HI4D 1A9EA 2MCPH 4PRHA 3D85B 4G6FB 2ENSA 2P5EB 5I1DA 1AI1L 4OQTL 1MEXH 3NIFE 3BKCH 4H8WH 3Q3GA 1FDLL 3FTGB 1A2YA 1CD0A 3RPIA 3VXTA 1VB9A 3Q6FB 4G43A 3ULVD 3FCTB 1XCQA 2IAND 3RUGA 2NCMA 1PZUB 2VIRB 1NUDA 1G7PB 2AXGB 2NY7L 3N0PB 1RUQH 2J88H 4G80B 4JANA 1LP9B 4HBCH 5FYJE 2BJMH 2ESVD 2G9HB 4I0KA 4OT1L 4F7PA 4G8FB 5F3BA 1KPUA 4X6DB 4JPWH 2B4CC 1UZ6F 1ZA6A 4Z6AT 2XG4A 3GSVA 1FNAA 1WVZA 3VFPB 3SDCA 1DVFD 2J5LC 4L3CB 3WHXB 1AGDA 4TVSa 3EYQD 2HTKC 4RMTA 4DZBB 3CSGA 3MLZL 2BNQD 3PHOB 5D5MA 1F90L 4MWFA 4TUKH 3QG7H 2AABH 25C8L 1BIHA 4WDIA 4WI2A 1NC2B 2JJVA 3N85H 1X5LA 1I7RA 1DQLL 2YWZA 4BZ2L 3CVHB 2C3WA 4NKIL 1CDYA 4X80H 1LNUA 4MJ6B 3IF1A 1BREA 4X9FA 1S7RB 2ZOKB 4UV4H 1SJHA 3EO1A 3CU7A 4M1DH 1IGTA 2NXZD 1MCKA 2QQNL 3EO0A 1UADC 2NY6C 1S8DA 1BJMA 5GS0L 1DBML 4I0PC 5E1AB 4YHPB 5EU5B 5EUOE 3CVIH 1XR8B 3DUSA 4PGEA 1JTPA 4Y19B 3PJSA 1T03L 3K8MA 1BVKB 4L8CA 3L95A 2XOTA 2A77L 1UM5H 5MEOA 1HHJA 3ULUD 3TPUB 1EBPA 2YK1H 2VDQL 4CVUA 5IB4A 2KH2B 4ZODA 3O2DH 4UT6L 1ZLUK 3FZUC 1ZWIB 2PETA 3X12A 2KDGA 3HMWL 4LEXH 3GIZL 4K94C 4HXBL 5DC9B 5DLMH 1H3WM 1A7OL 4MDIB 4NKDA 3QUKB 2IPTL 4O2FB 4OCWL 3REWA 2WQ8A 5DURB 5J13C 1AXIB 5IBTL 1BZ9B 2VDKL 1YEFL 1RHHB 4HC1H 3KAAA 4YH6A 4AL8H 2E8ZA 4GJTB 3GJFB 3NZ8B 4PTUB 5BV7L 4KJYB 1KJVB 3VD5A 4R97C 3V6OE 3HI1A 3RVVC 1YEKH 1WGOA 2WMPA 5HGHA 1ZV5A 5E94B 3BPLC 3FONA 5FAAA 5TDNA 1JZ5A 4PGZA 5JMRA 4HAGA 3C60A 2NW3A 4WI8A 4FQLH 4I9WE 3KJ6H 3TVMC 4AYFA 5I1IL 5IMMB 3H9HA 4LCCA 2D4FA 1CR9H 2AQ3A 4PR5A 3V6OC 4AH2B 3TCLA 5DMYA 3GMMB 1CE6A 1YZZA 4LEOB 5IFHL 1VFAA 4ZAKC 3U7WL 1YMMA 4Q0XL 3KPPA 3T4AB 5CS7A 4U1GC 3D2UD 5EU4A 2VJXA 3MRMB 4RFEB 1KENH 1PEZA 3AFLA 3U2SB 5DS8A 3S4SG 3NZHH 1QZ1A 3GSNB 2JELH 1N5AA 1MJUH 3T0EB 3P77B 1T3FA 5C0IB 4TUJA 1IC4H 5F71A 3WL9A 5JUEH 3MRPB 3L5XH 3G9AB 1CYGA 3E1F1 1G6RL 3FB6B 2OQJA 3MCKB 4XBGA 5HHVH 1ES0B 3O0RH 3SKJH 3NAAH 4YHOL 3V5DA 5BJTB 1ACZA 4XNXL 5F7DA 2VLKB 3CNKA 3D1MC 1D5MA 1TVHA 2QQLH 2APBA 1WV7T 4I5BB 4O02L 4KHXH 5DC0A 4LU5L 5HGBB 5HHQB 3GGWB 2VR9A 3MJ8A 1LK2B 3CLEH 1I85C 2NY4D 2XWTA 15C8H 2FB4L 4ZQKB 1GIGH 3LQMA 4OM0L 1AC6A 4WU7B 4XNZB 4AMKL 4NO3A 2X09A 1CDUA 3G5VA 5IB1B 3O41A 4OFDA 3WFEL 1KB5H 4PJBA 3G6JF 1DN0A 1DSFL 1H15B 1J0KA 1JI1A 3QCTH 1D5IH 1MFBL 1L7IH 3AXLA 2R39A 4PJCB 1CN4A 4OLVH 3SCMD 4X8XA 3RL1A 2NXYB 3HNSH 3W9EB 3PL6C 3OJMB 5BW7A 4RISL 4PJ9B 4IRJC 3RVWC 4P2CG 2WBJD 1F4WH 1PX4A 4GRLD 4E41B 4WEUD 2XFXA 3O4LE 3OR6B 4NRYA 1FYHB 5ID0B 4AG4L 3HB3C 3C08H 3CDYA 3S96B 1JGVH 5CJOL 3RBSA 4OFKA 1LE5B 1MREH 3BP7A 1EHXA 2HG5B 2ZCHH 3BWAB 3MV7B 3TC9A 5JO5B 1F8TH 2DIJA 3GK8L 3VFOA 4MNQB 5D1XC 2GJ6E 3D3VB 5MEPA 1R5WA 4WUUB 3SO3B 4DKEL 4R6UA 5KVEL 1NDMB 4O2CB 4D9RD 4GW4B 4YIQA 4UIMB 2IBZX 1BAFH 3NIFF 1BGXH 1RZFH 3QA3B 4NN6C 1TZHA 5DJ8A 1P7QB 1HXYA 4JRXD 1X5YA 4XVTL 4BQ9A 5T1LA 1D6VL 4GRWB 2HVJB 4J3SA 1FFRA 4MVBC 2VC2L 4WRLA 2AJUL 4HZAA 1HK6A 3WFHA 5FXCH 4LHUB 5I8KL 3KHQA 4X7SH 4Z77A 4DEPB 3SKNB 4JY4A 4NZRL 2DQDL 1XIWD 4DQOH 1MI5A 4XPHH 3CD4A 1IBGH 1FCCA 4U1MA 4QEGA 1MRCL 4NQSA 1K8IB 3NTCH 5D1QD 1BOGB 2VKXA 1MF2H 3VG0L 5AZ2L 2MKLC 3OKOB 3DUHA 1DDHB 3I50L 4P5TD 5MHSD 4HWEL 1AD0A 3B8SA 5EZJB 5HYEA 2MHAB 1G9NH 1CICC 3NOIA 4KTEH 3N1GC 4M8QB 1YYMH 3SKOA 4R2GD 5I66A 5JNYA 2A74A 2WP3T 4FQCH 4L4VA 5HHOE 1U8LA 3VFMA 1TLKA 3U7YH 1JPSH 4RRPA 3QUZB 2PCPA 4DKDC 1L7TH 2P8MA 4YPGB 1S5HA 1YNLL 4QRSA 3PP3H 4PJFE 1VFMA 3SDAC 2ZUWA 4FA8A 2QADD 4DK6A 2OTWB 3I6GB 4M7LH 4UINH 2Y25A 3G5YA 4R0LA 5JDJA 5KTEL 3LEYL 4L9LB 2CRZA 2RCSH 3O6ML 4GG8B 4UBDD 3L3KA 3PWJA 1A7QL 2HFGH 3WIHH 3WIIL 3VGHA 4F37F 5GRYA 3ULVL 4MAUL 2V6HA 43C9A 4IMKC 3MO1A 3UP1A 2FD6H 4OIIL 2EKJA 5TE4H 4JZOB 2BVQB 1I1AC 5FHBL 3ARRA 1TETL 4KZDH 4C56B 2C1PA 4HIIB 3GMLB 2VLRE 3LDBB 3QUXC 5E4EB 3A67L 1PAMA 4HFUL 1JHKH 4XB7A 9CGTA 2XACC 1T22B 5DVOA 3J7HA 1OPGH 4QXGL 2EDTA 3HC3H 4J4PC 3WFCL 1S7XA 1AGCA 3RKDD 4GQ9H 4CMMB 4LSDA 3TN0C 3S3PA 5CZKA 4GXVH 2X4OA 2HH0L 4C83A 5EWIL 4O58H 1I1CA 2A6IB 3VDAA 1S5IH 5E99H 3HS0A 5FYKD 4RMUA 3KWWA 1NEUA 4Z95H 4MD4A 3EOBB 3DO3A 3G5XA 1TCRA 4EUPG 3T8XA 1FL6A 1D5ZB 2Q7YB 5GS0C 4DGVL 5D71H 4DUWA 5DRXB 4WV1B 1IQDB 4OGAD 1D5BA 1KXTB 4M1GL 4MZ2A 3V7MA 4L1HA 1ZVHA 2GHWB 1VKXA 2IAMD 5EC1B 3EO9H 1NBYB 1XR9B 1A1OA 4U1LB 4TULL 1X44A 5H2BB 5E8PB 1RUPL 1H3TA 5HHPB 4N90E 3MA9L 4FTVE 3VXNB 5IJKA 4APQC 4FZEH 1U3HB 4NQEA 3QEQD 3QDJE 5C09A 3O6KL 4OLXL 3O45B 4ZPTB 3FFDB 3SDDD 3BGAA 4HUXA 4PRBA 4ZD3H 1DZBA 4OCRL 4GOSA 3PHQA 2UY7A 1D3CA 3V6BR 3QUML 3LY6A 2C1OB 3MPCA 4I48A 3CPLB 2R15A 4PG9B 1M6OB 4Y2DB 3C09B 4U6XB 4QHKI 1TZIB 3CX2A 3TEUA 4YO0A 2H26A 2ZUVA 4FRWA 4JFHE 4Y2OA 1UJ3A 2XWJB 1V8HA 4FQQA 3LHPH 3LB6D 4LNRB 1T83A 1U93B 2ZPKL 3JWDL 3P4NB 4KAQH 1ZXQA 2KQMA 4Y4HA 2CRMA 5C0EA 1TVDA 5TDPA 2WQRA 1SEQL 3DROA 2BOBA 3MXVH 2FEEL 2X42A 2VAJA 1UQSA 3CK0L 4NZTL 3EYOB 2B1AL 1UZ8B 3K1DA 2P8PA 1Q1JL 4N8CL 4Z7WE 1E4KC 4OGZA 5C08A 4BYHA 3RWEB 2PW2A 4N0UE 2CQVA 1NAMB 4JZNB 1MFCL 3QEQB 3CFJB 4X4YB 4TYUA 3LKQB 1EEZA 3MZTA 5F89B 1B6UA 5DJXB 4ZDHB 3VWJC 5DUBA 4ZXBB 5ELIA 3M1BA 4MD0B 3IJYB 3SDYL 1KLGA 1IAIM 1RZJL 2HT3D 3FL7A 2JIXD 3PDDA 4KK8D 2BHYA 5ANME 1OCWL 1A3LH 2DWDA 4ONFL 1CGSL 1ZANH 3B43A 3TT1H 2I9TB 1AO7B 2WUBL 4C59B 1NSNL 5DQ9A 4UQ2A 4DGIL 1FDLH 3VFNA 3F12B 1ERNA 2OL3B 4C4KO 4ZUWA 1OM3L 2YN3A 3REVB 4JKLA 1EPFA 4NQCD 3W81A 4M5YL 5L2JA 5IMOB 3UYOD 1R3LB 2UVEA 1N5YL 5I15L 4MXWL 3VXUD 2OZ4H 4FFZH 4OCYL 3VRIA 1JCKA 1UB6A 4JM2A 1JRHL 3AVEA 1LO4L 4XWOD 3MNZA 4NUGL 4BFEA 3RNKB 4MCYB 2IG2H 3DARA 5L9DH 1F3JB 5BCAA 2WLYA 3DO7A 4LVNC 4WIQA 1CFSA 3VXOA 5B39A 4WFED 1ZS8B 2DQGL 3B5TA 4JFYB 3T0WA 3L7FA 3QB7C 4EXKA 4GG6B 5C6TL 4M6OL 5HVGB 1PEWA 4MJ5B 5DMGD 4ERSL 2HFEA 4HXAL 2F54B 4QHUB 3QNZB 4NFDA 1GGUA 2FH8A 3EZJB 4G7VL 4HX1A 4PJ8C 1TNNA 4PRID 3EDDA 5DC4B 1QBLL 4M61A 4PRNB 1A1NA 5LJYH 2DQIL 3ARBD 1RZKL 1NFDE 5L6YL 4ZFGL 4YK4B 4POZC 1UG9A 4K3JL 1H3PH 2X4TB 5HI5D 1H3GA 4XBPA 2CUHA 4O00A 1YNTA 4PJFF 3WXWH 5AAMA 4NO5A 2NR6D 3WJJA 5ESVB 4FQHB 2A77H 5L8KB 5L8LB 2XTJE 4B5EA 1QBAA 1U3ZA 1YQ2A 1Z9LA 1D5XA 4GW1A 2VDQH 1U8QA 2DLHA 5IEKB 5AYQA 3IRZA 2AEIT 1K5NB 2OBGA 3VGBA 2CK0L 2EIBA 4F15B 1EDQA 2XTJC 5F6HJ 1CLOL 4HXBH 1LP9E 1K9TA 3MBEB 5F44A 2AJVL 1A7OH 2EYSB 3BZ4A 3MV8B 2IPTH 4LSPL 3FOMB 4X6DE 5TQ2L 5IBTH 4OLWH 5I16A 2XA8H 2EDHA 2GK0A 1LWRA 4G6ML 4P46A 4D0CB 1FYTB 5LXGH 2FIKB 1S7QA 3V8OA 1OT1A 1CGVA 3VGAB 5DGRA 5BV7H 4S0SD 5KVGH 5JQ6H 1IJ9A 4XMPL 4JCLA 4RIRA 2AJZA 1G84A 4FNLL 2FEDD 4XP6H 2WAHA 2ZOLB 3H3KA 1ZMYA 3VFVB 4P4KB 3KDMB 4F2MB 2H2PC 3QDGA 2P24A 4H1LB 2ZWLT 5I71C 4W68A 1WBXA 2SEBB 2BC4B 4Q9CA 4TVPD 3TZVA 5I1HL 5I75B 1I7UB 2HKFL 1A4JB 4Y4KD 5D7IE 5FYKU 3SE4C 4LLUB 1FGNH 3WNPA 1GOHA 2IANE 4Q0XH 5HI4C 2BMKB 3GMPA 3LH2H 4I3GA 3U6RA 1BJ1H 4MX7A 4AT6A 2I60H 3MNVB 4ORGB 3CUPA 2EE9A 4AEHL 2ESVE 2CDEB 4UOJA 1IE5A 4QHLB 4UAOC 1T5XA 2VQUA 1RIVL 4F8QA 4G3YL 3BD3A 2BSTB 3TBVA 3LQZB 2NY3B 4ONGH 3ELAT 4Y7MA 4YHML 3SGDH 5KSBE 2FECI 4X6CE 1J05A 4YHOH 3ZE2E 4XNXH 3O9WB 2BNQE 4KMLB 1S7TB 2ARWA 3R1GL 3QFJB 1S7WB 4GKZA 5E6IA 1ZVYA 4OM0H 5TPWL 1J12A 4FN0A 1E28B 4AMKH 5DR5L 3T0DA 3EYQC 4XBEL 5J12B 2KQNA 2NY1D 3QJFA 1CFNA 2JB6B 4L3ED 4F3FA 3KGRA 5EBWB 1RUML 5KANI 1BF8A 1J0HA 1MFBH 3MV9D 3RQ3A 4XPTL 2PW1A 4NN7C 1FZOA 2QSQA 5E6YA 4CGTA 4NSKA 5FYKL 3RVUD 1KB9K 4NKMB 1NDGA 3QUYB 4G8GB 5E8OA 2NXZC 4YHYC 4OB5L 5D6CB 4Z7WF 4PRPB 5GXBB 3ULUE 5C0GB 3H3BC 5ABDE 4IIQB 1Q9OB 4KJWD 1MJ8L 1G9ML 4ETYA 5CD5D 4MQ7B 5BVJA 5F7HA 1OB1B 5IJVB 1DQQB 1MAML 5CJOH 4L9DA 1F5WA 3ULUC 2QKIA 4I0CC 5D7KD 3GK8H 1IGIL 4MHHG 4QCIA 1HHIA 3GMRB 4PB0H 2VABB 3G5ZA 4Y5XC 1CXKA 3DRTB 3IT8D 3BD5A 1QQDA 5FGRA 1MVFA 3BP6B 1MH5B 3RX5A 1QLEL 4XVTH 4LRNL 1D6VH 3CMOL 3BEVB 3O2VL 3U4EA 1FVDB 4I8DA 5GHWL 1NKRA 2VC2H 4Q9QL 2AJUH 4IRZL 4UNUA 3WS6C 4F7CA 3JWDC 1CDJA 3BUTA 2PR4L 1UYWL 5CBEB 5L88H 3C6LD 3DV6B 1MY7A 1NMCB 5GGUB 1N3NA 3BZFA 4MNGE 4OFYD 4ZSOA 3VGFA 5KAQF 1N4XH 1T04B 2XNAA 1T2QL 2GT9A 3JTTB 5GS2H 3VG0H 3OZ9L 5BS0D 1A5FL 4OSUL 4KPHL 2YD1A 3UTQB 3GM8A 4WW2C 5TH2B 1OT2A 1CLYL 3BP4A 1OWWA 3X11B 3MLVH 1TJHH 1FORL 3IVKB 1SYSA 1RZJC 1IEHA 1JI2A 3O2DA 2YD5A 5FF6A 1A6ZB 4P9ML 1W8NA 4Z0XA 1KB9J 5IMKB 3K80A 3SGDI 4Z8FL 1CE1L 4P2OD 4X7CC 1LEIB 2I26N 3LEVL 4QY8A 3L5HA 3S5LG 1YNLH 4RDQG 4KZEH 5JW5B 3ME0A 3L5WB 1IMHC 3QI9B 1BZ7A 4HC1A 3JUZA 4OZHB 1ZT7A 2DMKA 3LEYH 1NFDF 3RGVD 5TGBB 2JJUA 4WJ5A 1KIQB 2VDOH 2HVKA 1GJIA 3BDXA 4XNMB 5HTSA 4X98B 1JN6B 1ND0B 3ULVH 4HUVA 3ROOB 3FN0H 2ICES 4ZFZA 5D7JA 5E8EA 4OIIH 1CFBA 1WZMA 4F9PA 3ESVF 3O6LL 4PV9A 2NY4C 5FHBH 1TVBA 4UB0L 3G6JA 1TETH 5ADOL 1KCSH 2MKWA 1IC1A 1QRKA 4HFWA 4CVZB 3A67H 1G7LA 3GMOA 4HFUH 2P5WA 5ACZA 3MRRA 2Y5TA 3U30C 3R0MA 3NACL 5FUZL 1BFOA 4ISVA 4JR9H 3BQUD 3WFCH 4WHTA 1ODAA 1D9KB 1ZT4A 3SCMC 1SMAA 5EFIA 4PJIB 4MSWA 4ZOAA 1IT9L 4WO4D 5GGRA 3SPVA 2CSPA 1A7RL 1T5WB 5IOPA 1RK0A 4PGBB 1W8OA 1FO0A 3ULSA 1IAKA 3MRQA 5ESQB 3AU1A 4UI2A 3OKDA 1EFXA 1C1EL 4NHUB 2XQBH 3O3AA 5DO2D 2WBJC 1RZKC 2W9DL 5HGDB 5I6XB 1CDHA 3DMMB 4GRLC 5GIRA 3IAQA 4D9RE 2X5PA 5K9OA 4PREB 1HILA 4M1GH 2ADIA 4JG0L 1ROWA 1CXLA 5IMLA 1YYLH 5FYLD 2FJFA 4JRXE 2VWEE 4JFPB 1XF2A 4LSQL 5D7IF 4DAGH 5IFAL 3ULVF 3ZTNL 4F33B 2VZTA 5GSVB 4NOFA 1BMGA 4TULH 4Y4FA 1U6AL 3FQWA 4KHTL 1ZT1A 5IEHA 1OF2A 1V7ML 1KB5A 3RY4A 5ILTL 5FIEA 1NL0L 3R8QA 3OHXA 1EAJA 5KG9B 2NY5L 4XI5D 2AK1L 2VWEC 3MXWL 5L2KB 1NCUA 2DKSA 1G9EA 5F9AC 2D7OA 2GFBA 1NPUA 4X7DC 4JPIA 4LSTL 4HUWA 2FL5A 4PJEB 3RL2B 4F58L 2ORBL 2V2TA 4OD1L 4PRDA 4YEEA 1NLBL 3MRGB 3STZB 4OCRH 1JPGA 2V7HB 5D93C 3V95A 1E4JA 2VL5A 5KSBF 4X6CF 4WW1A 5DT1L 3IJSA 3ZE2F 4N8PA 4WEBL 5MHSE 1XIWC 3DVIA 5C3LD 3UTSD 3C9NB 3EYFB 4FXKB 5HYIA 1V3LA 2A9NL 1Q9LA 4UDTB 5EU3B 3FAXA 1L0YA 2C7UA 5DMIL 1W72B 5D1QC 3UDWA 5B22A 2ZPKH 4OLYL 5EU6D 4G6KH 4M7LT 5C07A 3S37L 4P5TC 4E42B 5CSBA 2BY0A 4NZTH 1UKSA 4YXKL 2VLLA 4I0PA 1G1CA 3LRSB 5HVWA 4P5KB 3OKMB 4R2GC 3KXFB 1YJDL 3LN4A 1QG3A 1MPAL 3SDXB 1MFCH 3VWKA 5I1AB 1ED3A 3BXNA 4JCMA 4TVPL 5KVDH 4NBYB 4NHCL 2R2BB 2QADC 4XP1L 2VISA 4RBPK 5C0JB 4PLNC 4S0TD 3QFDA 3DGGB 4EI5D 4LPUA 1OCWH 1KCUL 3K0WA 4ONFH 3NFNA 4TQEL 1XF1A 4UBDC 1MHCA 1DLHA 1DQTA<