5DLMH

Complex of influenza m2e and antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
216
structure length
216
Chain Sequence
QVQLQQSGGGSVKPGGSLKLSCSASGFSLSTYAMSWVRQTPEKRLEWVASMSSGGSLYYPDTVKGRFTISRDTVKNIVYLQMSSLRSEDTAMYYCVRGGYGTSYWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Heavy chain of monoclonal antibody
publication title Crystal Structure of the Conserved Amino Terminus of the Extracellular Domain of Matrix Protein 2 of Influenza A Virus Gripped by an Antibody.
pubmed doi rcsb
total genus 40
structure length 216
sequence length 216
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dlmH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dlmH01
5JW4N 3S4SB 5JIIA 1PG7W 2NY4D 4JRYE 1U95B 5INDA 2YUZA 2B1AH 3HFML 1D9KA 1CG9A 2OYPA 4XMPH 5GS0C 4U1NB 5L2KD 1I3RA 2XFXA 4RFEA 4S1DD 1OARL 4YXLL 4BSJA 2NW2B 3RVUC 3GK8H 3UTZB 4Z0BH 2AERT 4R96B 3AVEA 2R0LH 3HE7D 3ZMRA 4WNQB 4XB7A 5T5NF 4I8DA 5GRUL 1FV1B 2YK1L 1MCWW 3U0WH 1T83A 4OT1L 5H37H 2E9JA 1NMBH 5LAXB 3R1GH 3ROLA 2YEZB 4Y16C 3MRJB 1A7NL 3G6DL 3QIWC 2CRIA 4KQ4H 4OQTA 4XC3L 4Y4FB 3FFCB 2IPUK 1QSFB 3MSPA 1K8IB 2IQ9L 4JKPH 1VGKA 4IRSD 5CIPB 4RISH 2NY2B 3QIUA 2Y07L 4YHKH 4YNYA 4DUVA 5C0BA 4DQOL 2WQ8A 2QLVB 4K23L 2X7LA 4E42A 4LVHC 3ARED 3FRPA 4NUJA 4O4YL 2BJML 2VLLB 3NFPB 3TO2B 3BN9C 2EO9A 5IHUL 4FP8H 5IF0B 2P5WD 3U6RA 1KB9J 2ZKHH 5J11C 5FYLD 4XBGA 3OAUH 2F19H 4WFFD 5F70A 3WFHA 5AAWA 3UTPE 3TJHC 3HMXH 1MF2H 3DSFL 1P7QB 3BESR 3QJFB 3G5ZB 5IFAH 4ZUSB 4A6YL 1C5DB 4FQCL 2AEPL 3BKCL 3RX5A 4JY6A 3QFJB 3TYGH 1A6PA 5DK3A 1NFIB 2QQLH 5DYOB 4AEFA 1NAKL 5CHNA 3HE7A 2HKFL 3O4LB 3QH3B 3WFDH 1RUQH 3UO1L 2I9LA 1NSNL 1CD0A 2K7PA 3GKZA 1KENH 1DUZA 2QHLA 2V2TA 3QULA 4WEBH 2MQCA 1IEAA 4Y4KC 3O2DH 1IGCL 4QYOB 4OLVH 2AJVH 1RJZB 2F54B 3IVKB 1RFDH 3WNPA 4BZYA 3S36X 4KTYA 1HKLL 1TJHH 2QV2A 2P5ED 3AY4A 5C0NC 2WINB 3HN3A 2C4FU 3TT3L 1Q0YL 2JTDA 1RZKL 3MV9E 3NACL 4PJBB 2AXGB 1MCHA 1MPAH 5I2IB 5DFVC 4ELKB 3TH2T 4H8WC 5A16B 1ITBB 5EUKA 5IJKA 3AREA 5JXAH 5CWSA 5D7LE 5TFSH 5J11B 3R0MA 3QCTH 2BSED 3HNSH 4C55A 2HLAB 3U1SH 3P73B 1F11A 5FHAH 4BJLA 4MZ3A 1WZMA 3P4OB 3BQUC 4NQCB 1FZJB 3KPSD 3QUMA 3T65A 4NZRH 1UZ8A 2IGFL 5FEBA 4QGYA 1LEIA 1DZBA 2Z93B 3NZHH 3LN4A 3LQAC 4RMWA 4HUWA 3WD5H 3MNWB 1AI1H 4WV1B 4LHUB 2I27N 1J1XH 1A4KA 3UAJD 1BVKA 1QRNA 2FEDC 3BT2H 4G6FB 5JDSA 3MUHL 3IRPX 2C1OB 4C4KT 1TVDA 4KRLB 4P2QE 2QEJA 2F5BH 2BMKB 1Y6MR 4KY1L 4K9EL 2AK4A 3O8XB 5J9PA 1XH3A 4Y4KB 3H0TA 4FABH 1BGXH 4JLRA 5CP3A 5B21A 1WIUA 3D39B 1A7QL 1UH4A 1AJ7H 3LY6A 3CDCA 3FQTB 1NJ9B 2B4CL 3CPLB 1IZKA 5D7JC 2FJHA 2QQKL 1Y18B 1EXUB 3FL7A 1JZ7A 1BF2A 1OF2B 1U8PA 4PJGE 1NAMH 1NBZA 1FC1A 2D0FA 3T1FB 5HVHC 1F5WA 3WSQH 3P9LA 5GRJH 1QQDB 3HG1B 1FVDA 3HC0B 1IGML 1NKOA 4HHAB 2KQMA 3VRLE 2CUIA 5BJTB 3CD4A 4NRZA 4P9HL 5JW5B 4KGJA 4LLVB 3GSVA 2NW3B 2VSDA 3BQUB 4TULL 5E8EB 2DI9A 2NZ9D 1R24A 4LCIH 5DZLA 3WKNA 3QG6B 2HN7A 4UTBL 2Y36L 1H3WM 3TPUA 1LO2H 5FA3B 1YEJL 2CQVA 3T3MF 5I1HH 3AC0A 2HJFA 4JZNA 1N0LA 2C26A 4NC1C 3MLRL 1YN6A 3C2AL 1HHKA 4IJ3B 3OG4B 2AJZB 3KJ6H 3O3BA 1AP2A 1IM9D 3AFLA 3SPVA 1XF4B 2D7NA 3GNMH 4L3ED 4ZO9A 5EIIB 2XYCA 2ZZUT 1VFAA 3NCYP 5DMKB 1XGUA 1BREA 4ZTPL 3FTGB 2DBLH 5AZEL 5I1CL 3CU7A 3SCMA 2BCKA 3S35H 4KPHH 1TTGA 3U36A 1J0KA 1BWMA 3LKRA 3VRIB 2R2EB 3NTCH 5L7XH 4P49A 4I3RL 5KVGL 5B3NA 4JFED 2Z0BA 3CCHB 4CVZA 3BUYB 1FL3B 4LEOA 3SE3A 1OPGH 3IGAB 4JKLA 1GRWA 4H0HB 2GJ6D 3LIZL 3W39A 5CZVL 5ALCL 3BI9X 4JN1H 3MCG1 5IB3A 4OFVA 2AABL 5ENWB 3QI9D 5FYJH 3OWEA 4NQVB 3PXJA 3P0VL 4J7RA 4JGJA 4ODBD 4ETQB 5L88H 3O45A 1TIUA 4MQTB 4GFTB 4PJCA 5FGSA 1W0VB 4ODHH 4ZAKA 1FE8L 5EO9A 1W72L 1RD6A 3Q6GH 4AENB 5KS9A 4LKCB 1P53A 4JGUA 1HH6A 1JPSL 1A1MA 2XWBB 5FDYA 4PGEB 5BVPH 1IC5L 1FG2B 2R0ZH 2EO1A 3DI3B 4P2OA 4DN3L 3JVGC 5FYKU 1DBKH 3PL6C 2JK5A 1WCBA 3VXMD 4L3EA 5IBLD 3Q5YA 4XAWH 2W0FA 2OMNA 3VXPB 1SVZA 4GQ9L 5TGBA 1X5KA 3BP5B 3KHQA 1ZWIB 2CR6A 3FB7B 2P45B 5HSFA 3FCTA 1YEEH 4LASH 4YQXH 2D2OA 5C1MB 4FMFA 4LEXH 4OZHB 5F97E 5GRZA 4NQEA 1KIQB 3H3PL 3GJFH 1JUFA 5HYJE 4MD4A 2YRZA 5LG1A 3WBDA 4OV6F 1HIMH 4LCWB 1YNLL 1S9YB 4JCLA 4BFEA 4G5ZL 5D2LA 1I1AA 4MA1C 3ILPA 1E4XH 1YDPA 4M8QB 1D6VH 3H3KA 4HBCL 1KELH 5FGCE 1Q9KA 3QI9A 3VXUD 4E41A 2WP3O 5I9QC 1OD9A 5DQDL 4OLUH 2DLFL 2NX5E 2C3VA 3BW9B 3QDHA 4DKEH 4TUOA 1XR9B 1ZHBB 3FT2B 4J8RB 4I5BB 4U1IA 1JP5A 3EOAA 3ULVD 4KK8D 1A9BB 1QFWM 1K4CB 1V7ML 1A7BA 4HS3B 5I71B 3WE6A 4Z7VB 3LS4L 1CLZL 3QQ3A 3RPKA 1RZIB 3REWA 3QUKB 4F9PA 2UWEB 4OKVB 3D85D 4S1QH 1U8JB 4FG6D 3UYRH 1PSKH 2E9BA 5DEFB 5GGSY 3DMMB 3BH8B 1KBGH 2JIXD 4YWGL 2VXSL 5B38B 5LGHL 1C16A 3M17A 4H20L 4WU5A 3B9VA 1KXQE 1XGQB 2HT3C 1LWRA 4JANA 1K5NB 3DVFA 5D1QA 1YEGL 4ZUVA 4ZTOH 4HS8H 5JQ6H 3OKDA 2JCCA 2Q3AA 1RQ5A 3UYPA 1FPTH 4GSDL 1JNNH 3HUJF 1U2HA 4WFGE 1EJOH 1WC7B 3UJIH 4Z95H 5I9QB 3GMQA 1OSPH 4KI5D 5F88B 4PRHB 1RZ8B 4XPTL 4MWFB 1A6UH 5GGVH 2P47B 5DJ6A 2FJGB 3OMZA 1PGRB 1SYSB 2XN9B 1N4XH 3KXFB 5CJXA 4JR9H 1MIML 3EFFA 1UC6A 3T08A 3FB6B 4R4BA 1OP5H 4HWNA 3IAQA 4PP1D 2KZWA 1ZT1A 5HI3D 1WIPA 1B4JH 4QOKE 1R5WB 4OTXH 2G5BB 5DRNA 5BV7L 4G8IB 3EHBC 1OB1A 3MGOB 5ICZA 3DRQB 2NY3C 2ICWA 2HP4A 4J3TA 1I8IB 3VWKA 4Y5YA 4MDJA 4XMLL 4HULB 5TDNB 3IRZA 4NSKA 2O5XL 3M1BA 3SKJL 1JBJA 4AM0B 3EO0B 4XWGL 4ZD3L 1A7OL 1IAOA 3MV9A 1AR1C 1TNNA 4F7TB 3O9WA 4P5TB 5E1AA 5HGHB 5HPMB 2VDNH 1N2RB 5F6IC 4L3CA 2EIZA 4FQ1H 5DD3L 3V5HB 1EIBA 1T5WB 3HLAA 4MB3A 5D7LA 1YC7A 5HGGS 2JJUA 3FQWB 3LS5L 4CGTA 1FNEA 3E2HB 1FO0B 5GSVB 1CL7L 5L8LB 3CFCL 5E2TH 5KG9A 1X4XA 4AZ8A 3FO1A 5IJKC 3RY5A 2DLHA 1EGJA 1QBAA 1MQKH 1K3IA 1YUHB 5GGTA 4K3DH 1TLKA 5K59F 1A64A 1TVBA 3BEVB 4FQIH 5TQ0H 2ZCLL 3MLUH 2HKHL 4XPGH 1BFVL 1QSFD 4JFFB 4NT6B 4UILH 1LK2A 4UBDD 4AEHL 3TO4C 5IOPA 2NY3B 4B7LA 1T5XB 5DVOA 2NY2D 3RKDD 4BH8B 2W9EH 2VYRE 1N64L 3G5YB 1C12A 4X80L 5EFIA 3S9DB 5KSVB 3S7GA 4MD5A 2RFXB 1AE6L 3OKYA 2X4NB 3B9KA 3N1MC 3LB6C 1ZGLB 2YPVL 1Q72L 1EFXB 2M26A 2ICES 4NP4H 3FB5B 4OCMC 4QRSA 3G6JA 3L7FA 4PJGA 4HXAL 4TTGA 2G75B 1G7PB 1K85A 1CXEA 1WWAX 2JB6A 5C9JA 2X40A 3RUGB 1TTUA 1A22B 4XVUD 1A8JH 3CFJA 4BKLA 2HFEB 4Z7NF 4JFDE 4CW1A 5C6PB 2P1YA 5F9OL 5E03A 1U3ZA 1S5IL 1G84A 1F4AA 4NRYA 5HYQA 5JUEL 2AI0H 3V6ZB 4NZUH 1U42A 3QFJD 4HK0B 1AQKL 4XXDA 2NW2A 4PJFF 4PJDA 1OTTC 4TNVF 5KAQG 3O4LD 1NFDE 4U7SA 1XIWA 4R97C 1HNGA 1SY6A 3HCVA 3LEYH 4KAQL 3P4LA 3ARTA 5IROA 1X7QA 4H88L 3TO4B 3MRIB 2F54D 1X5JA 1MNUH 3S3SA 1K8IA 5L2JB 2CR3A 4WI8A 4UV7L 3KPNB 1YECL 2HRPL 4P4RA 1HEZA 4NO0A 2CLZA 2OTUB 1BLNB 1F8TL 2H3NB 2IH1A 2ZUVA 5HYIA 5H2BB 3J7HA 4XP1H 1D5IL 4PRBB 1JGLH 1FNSH 5F3HA 3L6FB 3LH2L 1WTGT 1LD9A 1ULVA 5SWQB 2YPKB 2Z91B 4LDEB 4LLUB 3TBTA 4TSBL 1G0XA 1N6UA 3OB0K 4L8DA 4DGVL 3SCMC 1GHFH 2BZDA 1H15A 5DEGB 2PW2A 1A0QL 4XCFL 2FHBA 4P23C 4NQCD 2OQJB 4YBLB 4Y1AE 1LO3L 2AXHA 1BZ9B 2ATKA 5K9JL 2GYSA 4GKZA 1RHFA 5J3HC 2A6KA 4NZTH 2YPLD 5EG6C 3SE3C 2E8ZA 4XMKL 1T4KB 1RMFH 1H3VA 2PXYC 5DT1H 1QOKA 1H5BC 3DRTA 4XPFH 3T3PE 5A2IH 3KPOB 3O8XD 4ZMAT 5DD5L 5CILL 4PBWD 4OD3L 2BSRA 2IC2A 3MRLA 1KNOA 4H5SA 1NCBL 2N1KA 3PWUB 1U3HA 2WAHA 3D39D 1HH9A 3S36L 4ZAKC 1JPFA 3RJQB 3PWLB 4PJEF 4X7TA 2X09A 1RIHL 2DQTL 4OGZA 2VXUH 2R0WL 1FFNB 2DDQL 3SDYH 4U7MA 2R1WB 1CBVL 4Z5RA 5C8JA 1A6VL 4P2OC 3HC4L 2J88L 4EQ2A 4MAYC 2ITDB 4M1GL 1DEEA 3HG1D 5TPWL 3ULVH 2EYSB 2X2YA 3QUZA 5B22A 5H35B 3W9EB 5HYJA 5MENB 2VLRA 4P23B 4YPJA 4EVNB 4UUJA 4EBQL 2DQJL 1OTSC 8FABB 2X42A 4OF7A 3BGMB 1MCOH 3V52H 2P7TB 4WWKD 4KJWD 5E6ZA 1HXMB 1YQVL 5BZDB 4XPHL 4MX7A 2VWEC 1WFTA 2PXYB 2YPLA 2A6JA 1I3UA 5LWYH 2WBJA 3CC5B 3WL9A 1H5BB 5D96C 3QZWA 4JO4H 2NX5A 4IRJB 2XTJC 1I1AC 4LNRA 4PG2A 1NBYA 2YC1B 3BVNA 3VXRD 2A73B 2ZG2A 5DD6B 4JFYB 2PKDA 5SV4A 4CN4A 1XEDA 2EDOA 1YMMB 1I7ZA 3MLZH 4WEMB 1BQLH 5EU6E 3CX5K 2EH8L 2ZUXA 1A3RH 2ZUWA 3TV3L 5ETUA 3LPGA 3KLDA 2X4TA 3FQTA 4HPOH 4R8WH 3CPLA 3GMNA 1BAFL 4UDTA 4RAVA 4JGMA 1CFTB 5E8DL 4MAUL 3HE6A 4AG4L 3GSWB 4X5LA 3EOBB 4MAYB 3BXNA 5JXEA 4F7PA 1CF8H 4G80B 4RDQG 4DGYH 5T33L 1X3DA 3RVWD 4F9PC 1LE5B 3CNKA 2H8PB 3BAEL 2YD6A 4M5ZH 4AYFA 1CD1B 3PJSB 4WENB 4XNQB 3T77A 4ELMB 3SGDH 4ODUB 4LSPL 3WLWC 1CXIA 1U93A 1IQWL 4KDTC 1WWWX 4R9HA 3X13A 3I9GH 1RJYA 4D9QE 2UYLB 1F6AA 2VH5H 4WO4C 4ODWB 3CIQA 3OKLA 3ZE0E 2CDEA 4ZO6A 3MGAA 1VENA 4WWKA 1UGNA 5BV7B 5D1QC 4IOIB 4KHXL 3HPLB 3QEGL 4NQDB 3HZYB 3INUH 4MJ6B 4JJHA 5IIEB 1OLLA 3DETC 3BDYH 5TJWK 3DTXB 3C5ZB 4Y19E 2R15A 3KPRB 1YEHL 1YZZA 4PJIA 3O3EA 1JGDA 5EA0L 2XA3A 2VXQH 5FFLA 5BMFL 4O5LL 4KRNA 2PW1B 3VXRA 4PJHE 1I8LC 4HGWB 4NWUH 1DBBH 3BWAA 4JRYB 5DRWB 5E2WL 4PJAE 4D3CH 2IBGA 1KJVA 1R5IB 2Q7YA 2R0KL 3OJ2C 5CJXC 1GZPA 2W92A 3RX7A 3U0TA 1G1CA 4R4ND 1BPVA 1NGPH 2R39A 1SYVA 2CMRH 4POYA 1IMHC 1PZ5B 1NGWB 1NMAH 1MJ8H 1OAYH 3T0XA 4K94H 2R56H 1DJSA 2ZCKL 1N7ML 4H0GA 3GSUA 4HZLA 2A1WL 1MWAL 4M6AA 4YXHL 3KS0J 3I6GB 4XRCB 4KK9D 1FNFA 2LV4A 5KJRL 4LCWD 3S4SG 4JCMA 5HYSA 3DX8A 3CU1A 3OJDB 4F2MB 2I9TB 2HT4C 4PGCA 5CP7B 1SY6H 4OV5A 3RY4A 3ARYA 1IAIM 1Q9WA 3VWJC 3L3IA 3QA3B 1JF1B 5SWZA 2VDQL 3VJ6B 3Q6FB 4N90D 5DQJA 3VWKC 4Y5YC 2NPLX 4X6DB 5DS8A 1LO0L 3RWFB 5C2BL 1DQLL 4HUVA 3VFTA 4PTUA 5CIPH 1KGCD 3IYLW 5IBTH 2V5SA 4DCQB 1JHTB 1T7WA 4GLRH 3QUYA 1MCDA 5CKAA 4YDLB 1G9NH 4HIXH 3O9WC 2YMXL 1U8IB 4O2EB 2DQFB 3CVIH 3TH4T 3QRFM 3MLVL 3D0LB 4HKXA 3BZFA 4XBEH 2D7PA 3U2SB 1FGNH 1RUKL 2FATL 1F2QA 4XZUA 3DMMD 3JWDL 4F80A 1LILA 3V9FA 4M1CC 5E2UH 3O6ML 2GY7B 4XH2A 5FK9B 1N5AA 1WBYA 1YPZF 1B3JA 2BVQA 5IB1B 1U92A 1M05A 3BPNC 4YHOL 3K81A 4M93C 4LPUA 3GJFK 1B88A 2YWZA 5D6CA 4OZIE 1KCSH 1KB5A 2V5MA 1N5YL 1T21B 1ZSDA 5GXBB 4Z7WF 2IPTL 3KR3L 4DTGL 1JZ3A 4LCWA 4YAQB 3EKCA 3FFDB 2M2DA 3QWOA 5DA0B 3HRZB 5DWUH 5A2LH 4M7LT 4FQQB 3VWJB 3WHE1 4L9LA 3DNKA 4JM4H 3UTOA 3HZMB 1VKXA 2BSTA 4D9RE 4PRHD 3ZHLA 1P7HL 4OCNC 5E6IC 1E28A 1F4HA 5DJ8A 3X11A 2NTFA 3B9KC 2WWMC 1T2QL 1N6VA 3MA7B 1BVLB 3QXTA 3KXFD 2XN9D 1WEJH 4PGJA 4LSDA 4GG8B 3WIIH 4MXVF 5EN2B 3UTSD 5CBAA 4LSQH 1TZHB 1S9VA 2XRAL 1DDHB 4LHQB 4ZS7H 1A1NA 5DGRA 1MREH 2LABA 5HGBB 5CUSL 1QFUL 2NY5L 4MHHG 3HNTL 1X44A 5I18L 2G9HB 5CZKA 4AMKH 5J6HA 4WFHE 2DWEB 3NIDF 3CDGA 4J3VA 4D8PA 1I3GL 1KCLA 1CDUA 5HHOB 5JOPE 1NFDA 5CJ5A 4NKMB 5KZCB 4PS4H 4Q58C 3TP4A 3MLWH 1CK0H 1IC7H 4D0BA 1D5BB 4M93B 4LDLB 4JFOB 5A2FA 5ADOL 1Q1JH 4I0PA 4JFZL 5K9OA 3QEHA 2BXYA 3GO1L 5CGMA 3BKYL 5B38A 4P2QB 1XIWC 3KPQB 4K3JL 5BS0B 2AJ3B 2R1YB 5EO1A 4FZEL 4A6YA 4G6KH 1RUPL 4NPYB 4GAFB 5IW1A 4JO3H 1EDQA 1QFOA 3RL2A 1A4JB 1M6OB 5GRWA 1HSBA 5CEYB 1MELA 3IU4L 4P5TD 1BJ8A 3CLEL 3MBEA 4N1EA 3D25A 4PJ7F 2V5YA 3B9AA 2CXKA 3L3DB 3MNZB 4LHUG 5E6IB 4M6ML 3TNNA 3TNMB 2VZ1A 2EC9T 2ZSWB 3D2UA 1NC2A 2DLTA 3GHEL 1WBZB 2Q1EA 3MRKA 4EN3A 1AXSB 2XZCL 4OIIL 2W9LA 4OCWH 4H1LA 3G6AA 4Y1AA 5DJZA 3PQYB 2VDLH 4M9OA 3UTSA 1J0HA 1F02I 3QWRD 3BIAX 3MUJA 5EPMA 4JDZA 4JY4B 4XCYB 5C09D 2NR6C 1EA9C 3GIVA 4JO1L 1DQQA 4H8WH 4ERSH 2CK0L 4GRWE 4LKXA 5EUOE 3VFOA 1EBAA 4DN4L 3VMPA 2ARJB 4WU7A 5ESQB 5HD8C 2HJKA 1JIBA 1CGUA 3L3KB 4PGBA 3MRNB 3P77A 3CK0L 3MRQB 1WAAF 5FO8B 2NY1D 2OK0H 4ODXA 3U9PL 3GMRA 1CDGA 3BKML 4OIBA 4POZC 3T4AA 4Q9RH 3IKCA 1P4LB 4XHJD 3SE9H 5GS1A 4CMHB 1S7SB 4OFDA 1RZ7L 3HAEA 5F9JA 1AR1D 3WFCH 3C08L 1T04B 3GSXA 1R3KB 5BRZD 3EJZC 3K80A 4APQB 3IDGA 1MRCH 4GMSH 4RIRA 5HGHA 1CFVL 1UEYA 3OR6B 4PJXE 2DTSA 3I6KB 4XVTH 4HIJA 4N1HB 3ULUE 4F3FA 1JWUA 3EYFB 3UEZA 2DWDB 3FOMB 4KUCD 1OOAA 5HGDA 4XWOD 5IVZA 4P3DB 2V2WB 4W6WB 5CD3B 5I8KL 1PW3A 4HWBL 4P46B 3QO0A 3O6LL 1KCRL 3QQ4A 3MRHB 2ESVE 1MCNA 3PWJA 2A74A 2PTTB 4HT1L 2VZOA 5L0QC 4X6BA 3EZ8A 1DBML 1GC1C 4GRLA 1YUHA 4NFCA 1S9XB 1G7IB 5FYKL 5C09A 2X4OB 1V3LA 4JFHE 4KQ3L 1UACL 3JV4A 5MEPA 1KJ2L 2F8XC 1BFOB 1RZJL 2WBJC 3VD9A 1ORQB 5LKNA 3IXAB 4EXPX 5FDWA 4XVSL 4PLKD 2NYYC 4E0RA 3S5LA 5I1IH 1MIEL 1S5HA 5EU6A 1CGYA 3FZUC 3TVMC 1WZ1H 1RK0B 2FX8L 1FN4A 5C70A 4IIQA 2CH8A 3LB6D 1QLEL 5B8CB 3H9SE 2QSCH 4YUEH 4OZGE 4F9LC 5IGXL 4XVJL 1GGYA 1C5BL 4QHMA 1TETL 3NIGE 3BPOC 3O0RH 1PLGL 3ECBB 5BO1H 1JWSB 5GSRB 4LPTA 4J6RH 2DB8A 3UC0L 4O51B 5BRZA 1MCFA 3BZ4B 3SGJA 5KSBF 1OTUC 4ZFZB 3HE6C 2X4QA 3SOBL 1UWXK 2OL3B 2IQAB 2GTZA 1ADQH 5JXEC 4NWTL 2BDNH 4RRPA 4MMXC 4XI5C 1TQBC 3EDKA 4FN0A 4EOWL 3S88H 3EGSA 4YHNB 3L3HB 2UV3A 3KYAA 5C08E 1MH5B 3OXRB 4QXUL 3QHTC 5BZWA 3HFMH 3C60B 1MFDL 1J1PL 3PWPB 5D1XA 3IDYC 3IJSB 4JPWL 4Y19A 1OARH 4LMQE 1X5YA 5CEZL 5ILTH 2BRRL 5IESL 2BK8A 1T0MA 2W60A 4GW4B 1J9CT 4JG0L 4M48L 3TVMB 3MXVL 5HDLA 4HC1L 4AJ0A 1A7NH 4PRDA 2G5RA 1CD8A 4XC3H 3HA0A 5DRZB 3N1QC 1T1YA 2X4PA 3ARBA 5L8KB 2IQ9H 4KKLC 4C56A 3DVNA 2DM2A 3MLYL 1U0QA 1UVQB 1K8DB 2HFFB 1W72A 1XF1A 5DUBB 1RUAL 3K8LA 4L4TB 3ARFC 1FVEB 1F3DJ 1QTYT 4CVUA 2Y07H 1PVHA 5MEND 2LU3A 2X1XR 2XA8L 3TZVC 3PV6B 5I15H 3SKOA 4DQOH 3VCLB 4YO0B 5CLTA 1L9NA 1JNLL 3S98A 1U91B 4G8EB 4ODVL 3LEVL 1Q0XH 4PTTB 2J5LC 5F9DC 4NQSB 3BD4A 1AGBB 4ZYKB 1LP9E 5I8CB 2KZ1B 2FYYB 1YJDC 2R2HB 4NN6B 3UPCA 4WHTB 1L4IA 3SGEH 1OAKH 1LNUB 5F1IB 5JHDE 4IRJD 1MHEA 1ZTXH 3QUXA 5EBMA 5KAQF 3O4OB 5JHLL 3SO5A 4UV4H 3IDYB 4DZ8B 3RY6C 5CEXB 3DOSA 1HOCB 1SEBA 1ZVHA 5MI0B 2AEPH 3CLFH 3E6FA 4PP2B 1UWEL 3JWOH 4ZPTA 5I6XC 2D3VA 4QHUA 4YHML 1KPRB 4LLDB 4O2CB 4HQQL 3VW3L 1G7LA 2HKFH 3KLHD 2ARWA 4MVBD 4AIXA 5E99L 3OZ9H 4LU5L 4M7LH 3UO1H 1L7IL 3O3DB 1NSNH 4LVOC 2FR4B 4N0YH 3T2QA 1NL0H 1IGCH 3B43A 3V4UH 4WW2A 3KDMA 3RIAK 5J1AA 3AMLA 1TMCB 3NFNA 1CI5A 1FRGL 3ARFB 4MJIE 3RNKA 5I75C 3E1F1 4FXKA 4HJ0D 5DJDA 2GAZB 2BNRE 4QOKB 1MHPL 3A6OA 4PJ8C 3TT3H 3PP4L 3TZVB 1Q0YH 5FOBB 4MB5A 2N56A 1RZKH 2HLFC 4PUBL 3NACH 1R3LA 4R2GC 3L3OA 1MJUL 1QA9B 3CZFB 3FB8B 4RAUB 2QBWA 3LEXA 4NYLA 3LV3A 4MSWB 3OKMB 3C8HA 4LQFL 1WVZA 4NQDD 4ZUWB 1OGAA 4G7VL 3BPLB 4F7CB 4L8SC 2BNUA 5CSBA 3VD4A 4HV8A 3C5ZD 5ICXA 3KPRD 2XNAA 2IGFH 3OXSB 3Q3GB 4CVWA 5BXFB 4L9LC 2WWKO 2HMID 2P48B 4YHZL 3DV4A 4LCUB 3EYOA 1Z9SA 4G6JL 4LVOB 3MUGB 5I19L 3H42H 1JRHH 4KY1H 5IVXF 4K9EH 5IVOA 3IFOA 5D71L 2VABA 3LHPH 4FQHB 5ABDE 43CAB 2VLMD 2COQA 3ET9F 2FX7H 1HI6A 4XP5H 1NLDH 1A7QH 1LEKA 4L8CB 2CRMA 2FEEL 1FO0H 3M07A 4GW5B 4HIIA 4FQ2L 3VFVB 5K33A 5I75B 3CMOL 3QO1A 4BZ2L 4G80A 1H3GA 5ITFB 4QXWA 3T8XB 3WLWD 2E7LA 2H32A 1D6EA 3B3IA 3B2UC 3EYVB 3V6OE 3ARUA 3O6KH 1LDPL 1WT5A 4R2GB 3RAJH 3ULVF 1UYWH 4S11A 4PRNB 5DJAB 1RZGB 3RIAF 4HLZH 4TSAH 4YEEA 3ULSA 3RWDB 3GSOB 3P3YA 1NCDL 1S9KC 4RZCA 1TCMA 3DARA 5ICYB 3IDJB 2EH7H 2E7BA 2IFFL 4P9HH 4K2UL 5I1GH 5DC9B 3DETD 3IDXL 4TULH 5JDJA 4L8SB 3BP7B 4NKDB 3PNWA 3CFKB 4G9FE 4IRZL 4S10A 3RU8H 2DQDL 1EEYB 1ZA3A 3MROA 3NGBC 3STLB 4HSQA 3THML 1DQMH 5JR1H 3MBEC 1S8DB 1IC4L 4UTBH 1G1YA 1XR8A 3DVGA 5A1AA 3MGTA 2FDBP 2CK2A 2X9XA 4X98A 3LRSA 1YN7A 3ARXA 1U8KA 4CL7A 3LKQB 1MCSA 1XF3B 4LL9A 4LRNL 1JN6A 4ZFGL 3C5SB 4JFDB 3DUUA 3DO3A 3VRJB 4EN3C 2YXFA 1FZKA 5D5MA 1A2YA 4G7YL 4X6CE 3C2AH 5C0AE 3QEUB 4BQ9A 5A2JH 1LK3H 5INCA 2AJXH 2KL6A 5IMKA 2V2XA 4AL8H 2MHAA 3PHQA 1F00I 1BQHB 4RDQF 1FIEA 1K9TA 3GSRB 4ZTPH 1M7DB 2FIKA 5AZEH 3C5JB 1BF8A 1T66C 4L1HA 4EDXB 4KI5F 4LBEB 2PCPA 4I13B 1Y0LB 1QBML 2HT4D 1MCKA 5HHVL 4EUPA 1VACB 2D0HA 1KPVB 1KEGL 1HCVA 4PV8A 4I3RH 1OSZA 1TJIL 5KVGH 3JTTA 1EEZB 2EYRA 3WIHH 1ONQA 4QXTB 1K4DB 3WS6C 5EU5B 2V9RA 3LIZH 1UJ3A 2VISB 5CZVH 2J8OA 5ALCH 5JPMB 3B8SA 2OR7A 5GS1C 5D9SB 5D6DA 4LIQE 1JHTA 3QRGL 5DZOA 4Q6IB 3NOIA 1XGPB 1LEGB 1ORSB 3B83A 2PO6D 1HYSD 3GSQB 1W72H 1MCCA 3GK8L 4Z0BL 2R0LL 5E08L 5HHOD 1O7VA 5KZCD 4M1CD 3QXWA 3U0WL 4QRPE 1NMBL 3G6JF 2B4CC 3S8WA 2XY2A 4P5MA 3QSKB 2XV6B 4GRLC 2A83B 1DVFA 1HYRC 3C8KA 4X6EA 4JKPL 5CMAB 4Z7UA 1PQZB 5BS0D 5I66A 2GT9A 5IKCB 1ED3B 1FNGB 2VNCA 4I48B 4KJPC 1REIA 1I9RH 2YBRB 1FL6A 3H9SA 2EZ0C 4OD1L 4YHKL 1S7WA 1S9WB 3U4EB 3H3PH 4Y88A 3DO7A 1YEIL 1J88A 2NTSP 1WITA 4PJDF 1B0GB 4GW1A 5E6ID 2GITB 4WDIB 5FUOL 1OWRM 1KJMA 1YNLH 3SGDI 4FP8L 4JHWL 3ARDA 2I07A 3T0EB 2ZKHL 2AEWA 2F19L 1IGJA 1X5FA 4HBCH 3PQYD 5B39A 1NGZB 3DURA 3HMXL 2F5AL 4W4NA 1MF2L 1CICA 1OAXL 2F8VA 3JXAA 5HGBA 4YDVB 1PX4A 2APXA 4UOJA 1F4XL 1MLCA 4X0KA 2PO6A 1C08A 4UT6L 5EC2A 1YNKL 4F8QA 2ZNWA 1U36A 2EXYC 1UCTA 4FHBD 5JO5B 3VU2A 1RUQL 5C0DA 4DJMA 3OKKB 5IQ9B 2A6IA 1A14L 1IRAY 1S7VB 3LS4H 1CLZH 3KPMB 5CBEA 4IS6B 1NGYA 2K3TA 4OLVL 2AJVL 1ZV5A 5EZJB 1RFDL 2VQTA 4PG9A 4PRPB 4PBVC 3LRHA 1TJHL 1G6RB 3REVA 1FZMA 1H3PL 3UJTH 5K9KB 5AUMA 1N3NA 1BD2B 2ICCA 1VGEL 4KC3B 1CTOA 3KPLA 5GGSA 2A6DA 3SDDA 4APQD 4YWGH 1UB5A 2VXSH 5LGHH 1FORL 4H20H 4JAMB 4N1CA 3CSYA 4LSTL 4XHQA 3BZEA 4ORGA 5TE7L 1WK0A 1MPAL 1SQ2N 1DN0B 1P6FA 4ZPVB 1J05A 5IHZA 5TFSL 2GY5A 1MJJB 3BP6B 3QCTL 4PGDB 3HNSL 3ARBC 3U1SL 4GSDH 4P46D 3ZSSA 3VXTA 3QNYB 4EI5D 5FHBH 1LP9A 1ZS8A 2ITCB 3GGWB 2FZ3A 2X4UB 4X8JB 1NQBA 3PWVB 3QFDA 1AI1L 4L4VD 1R5VB 4JPIA 1P7KA 1LO5A 2GK2A 4KGLA 2H32H 4GLRI 3BT2L 1HHIB 1MIMH 4NQUA 1U8LB 3DROB 4XCCH 3WN5B 4PJBF 4X9FA 5DD1H 3OKOB 4DKDC 4FABL 1BGXL 5GGVY 2ED8A 3FT3A 2WBWB 2FBJL 1AJ7L 4BUHA 2VMFA 1JWMB 2X5PA 1NCCL 5BV7H 5T1KB 2GIYA 3LVEA 2WLYA 2WWKT 2VE6B 4PJHB 5GGRY 3BRDA 3ALWA 4M6OH 2R9HD 3BUTA 2Y7QB 4PJAB 3WSQL 5GRJL 4XMLH 3U48A 3L5XL 5FOJA 1OAUL 4ZUTA 2X89D 1FYTE 5C0FB 1A9EA 1J8HE 3G5VB 1XGRB 1N0XL 4IOSD 3SKJH 4HH8A 4NQXB 4U1JA 1HXYB 4XWGH 1LO4L 5GRVK 3TBSB 1T1ZA 4GS7C 2ZJSH 4WUKH 4PJ5E 2V5RA 4LSSL 4DVBA 5DD3H 3JTSB 4OB5L 1MRFH 4EI5A 1ZHKA 3C60D 3QXAA 4MJ2A 1CD9B 3LS5H 3PWPD 5CD5C 4PR5B 1LO2L 4MHHI 3OKEB 4U6YA 3VGAB 4WUUE 1CL7H 5J12C 3CFCH 3L3JB 4L4VA 3VGHA 5FM5M 1QHOA 1T0NB 5JTWA 5IEKB 5MERA 5F8QC 3S6CA 2HVJA 3KJ6L 2NYYD 1CFNA 2YWYA 4I2XA 3GNML 2MQ0A 2Y5TB 1S7RA 1MUJB 2ZCLH 4KJQC 1UA6H 3RKPA 1V3JA 1BFVH 2Z4QB 2DBLL 3MJ7B 5ERWB 4XPAH 4AEHH 1JMZA 3QDJD 3O6FB 3I6LE 4L4TD 2VDOL 5T5FH 3NTCL 2Z31B 5DMGC 5DHYA 1KT2B 1GGIH 4X80H 4YDJB 4KJYB 3D48R 3VXNA 1AIFA 1UXWB 5CEZE 2X4SB 3UBXB 2YD7A 2YPVH 1Q72H 4N8VB 1IAKA 4PJIF 3OAYK 4L5FH 3V6OA 3DV6A 2IANE 4HXAH 4JN1L 3O3AA 5TDPA 1IEHA 3RWJA 4W81A 3GUTB 4M7ZC 3TCLB 4MS8C 4OZIB 5FIEA 3ZHDA 1CE6A 4PV9A 3WEXA 1MVUA 2CIIB 4LPCA 3C9NA 1MCQA 3MLTA 4IDLA 4TNWK 4B0MM 4YK4C 3K74B 8CGTA 1MWAA 3Q6GL 4JFXB 5JUEH 4JM2D 3FQUB 2UZIH 3QIBC 4KK5D 1ZLVH 5ID1A 5BVPL 3HUJE 4UINH 3LN5A 3NN8B 4XAKE 3ME0A 2R0ZL 1MFCL 1NC4B 3EJYC 1VA9A 3R06B 3UZQA 1MLBB 1DBKL 4RX4A 5HY9A 2XKNB 2OJEB 4OZ4B 2OZ4H 1R3IL 4XAWL 3IETA 3F7RA 1J5OL 2Q76B 2C3XA 5E70A 3PIQB 1TVHA 4UV7H 2HRPH 3O11B 4YQXL 1ZGLP 3ARFD 2BOCA 4LEXL 3QDJA 2B8OT 4CN6A 5DHVA 5LVEA 2MPAH 1MI5A 2HJLB 1D5IH 3ILQD 2DOCA 2QL1A 4F33B 2JE8A 1N59B 5E5MB 5IT2H 4NRXB 4TPRH 1HIML 1AGDA 3KWWB 4P2RB 2GTWA 5FGRA 5HPOA 1FZOB 5F71A 1XZ0B 1NDMB 3VD5A 2P8MA 4ZFFB 3MRMA 4R3SA 2OCFD 3AROA 4M7ZB 5HHQA 5ALBL 3WJLC 1U8NA 1D6VL 3SO3B 2VC2L 4ZYKA 1TPXC 3X14A 1KELL 5JLZB 4Q2ZB 4JVUA 5HHNB 2FYYA 1A0QH 4XCFH 3U79A 5JNYB 4BFIB 2DICA 4RGMC 1LO3H 2O5YH 4XNYH 4DKEL 1XF5B 3QQNA 5K9JH 3MRBA 3ZO0A 2PYED 3MJ9H 1WZKA 5KN5A 5KVDL 3EAKA 3FOLA 4LNVA 4M43L 3MV7B 2VITA 3QIBB 3VA6A 1JNJA 1CDYA 3OHXA 4OZHF 1QO3B 2MKLC 4XMKH 4YDKH 4JM2A 2QADC 4R0LA 1IGYB 3WO3B 1UJ3C 4XNUH 4KK6D 3ULUC 4TNWF 5I8OL 1M4KA 2WUCL 5D6DC 1BOGA 4HKBB 4HWZA 3QAZB 1KTDA 4J1UA 3O3DA 5DD5H 2DL2A 2Z92B 4OGAC 1OD7A 3F62A 3UYRL 5EU7E 1NCBH 1X5ZA 3S36H 3CXHK 5FYLL 3BMWA 3V0WL 2QKIA 3NCFB 1Q8MA 3HPJA 2DDQH 4U0QB 4TSCL 4U1KB 4UT9H 5EUOB 5K59E 2DL9A 2VL5A 2HLFD 1PYWA 4ENED 3ZT6A 1MSPA 4R2GD 4X9IA 1Q38A 5C0CE 5CINH 5FOBA 4CNIA 4ZTOL 4I18C 1ZA6A 5JQ6L 5DDHB 4G9DB 1DVFC 4LLYA 1XGYH 5FA4A 4Y8AA 1FPTL 5DK2A 4Z7VF 3TBWA 1YEDB 1NLBL 1G7HA 1VFBA 4RGMB 4HUMB 4Z95L 3W9DB 4GBXB 5D93C 4N0FA 2UWEF 3L5WA 4JN2B 4EBQH 2DQJH 4R7NA 3RI5K 3W0WB 5MEOA 1I8KB 5GGVL 3AB0C 1MOEA 1AKJD 2HFGL 1YQVH 1N4XL 2PYEA 4XPHH 4XCNB 2QADB 4KRPB 4PJXB 1ZVSA 4PIRF 3BFOA 2EDQA 4NCC2 3H9HB 5F7EH 3ARDC 1EAJA 3LKPB 3HTLX 5D8JL 1HHGA 2R4SL 2WANA 4UNUA 5I76B 2R8SL 4ZNEE 3OGCA 1TXKA 3SDAC 1KIRA 3JUYA 4E9LA 4NCDA 4Z7NE 1B4JL 1IGTA 1MCWM 3MX0A 1YNTB 1CICC 4OTXL 5CCKH 1NPUA 3PHOA 2ESVB 3EFDH 2IALB 1QFWH 1CXHA 4P3CL 4HK3J 5CKGA 1I4FA 2GJZB 2EH8H 2OM5A 4RCAA 2EYTB 4C83B 2D9QB 3CFEA 5H94A 5E8DH 4KKCD 3NCYS 5E0QA 5GIRB 4FOMA 3DUHA 1HDMA 1GAFL 1KEML 4I18B 4HXBL 4LQ1A 4JEGB 5E9DE 3BZDA 1VEOA 3VFSA 4U6TA 4RBPK 4FQXA 1FFPA 5E4IA 1QVOA 2D0GA 3NIFF 4XNMB 5D93B 1IQWH 5A43C 3FKUS 4X99B 3VFUA 5JW3L 5DO2D 1GPOL 4OZGB 1IE5A 4XP6L 4NCC1 3SDDC 2HG5A 4Y4HD 2VUYA 2MQ3A 4N0UA 1X4ZA 2JF1A 1YY8A 1AKJA 4KKAD 4F15B 3FONB 4CU7A 1LE9B 5E2TL 3W81A 4QHKJ 3QEGH 3SGEI 1ZEAH 2I25N 3JSSA 4KKBD 5IR1B 4MNHB 5IW6B 1MQKL 3P0YL 5TE6L 4NO2B 4F57H 3SDAB 4MLSA 1YEHH 5F3BB 1QEWA 1I8MB 4X5WA 4U1SA 3SJVE 4FQIL 2BFVL 1IL1B 3R0NA 5TQ0L 3MLUL 4M4PA 3RBSA 1KG0B 4XGZA 4XPGL 3ARVA 5C08B 2Q8BL 5E94A 1H9VA 4LPXA 4UILL 2NLJB 5E8PA 5E2WH 4M02A 5HHXH 5T1DL 4OF0A 5EOQH 2IBZX 1AC0A 3RL1A 3O3UN 3FRUB 3LOWA 2W9EL 3OKNA 1HQ4A 2H2PC 4ZOCA 2ZCKH 1YC8A 3MTRA 1N7MH 2EDXA 3HZKA 5DMYA 1GL4B 4K8RC 1ZAGA 3T4YB 3RWHB 4YXHH 2EC9U 4RSVA 3SKMB 1CT8A 4QHNA 1R3HB 5J6GB 1QSEE 3LSOB 2BC4A 5KJRH 4RMRA 2N7AA 3T0ED 4DOHE 1P69B 1DUYB 1FYTA 2VISA 2P24A 1KJ2A 4HG4K 2NZIA 4L1DA 5D9SA 2O61B 1J10A 3NVQA 3DLQR 3GMPA 3SHSA 4Y4HA 1CVRA 2GFBB 1RJLB 3GSNB 1BHGA 4PJ5A 1I7UA 4RGNE 5C2BH 2AI0L 4NZUL 6CGTA 3CXHJ 5EDXA 4BSVA 4LCCA 1BIIB 1NCTA 1FCGA 3U4BL 5AWNL 3RGVA 5EBGA 3RVXC 1H8NA 4K07A 4JFPA 3V5KB 3C87A 4QTIL 1J86A 2R1XA 3MLVH 1EPFA 1G7MA 2IWGA 1EMTL 2FH8A 3MFFB 1KXVC 1AR2A 2ZUSA 4DGIL 2VIRA 3RUGF 1C7SA 4ESKA 4F7MB 1RUKH 2FATH 3QDMB 5CZXC 4PRPD 2AV1B 4YE4H 4NQTA 1JRHI 5IW3A 1FL5B 3JWDH 2HRLA 4KUCF 1BD2D 4YR6B 4HX1B 3A6CH 3JUZA 4XP1L 1JGLL 1FNSL 4DUXA 1CN4A 3H2WA 5D7IB 2OXGA 4WCYL 3V7MA 1WBXA 4OKDA 5DSCA 5F7DB 3ZE1F 2AQ3A 4J3OC 1N5YH 3QDGB 3R8QA 4M6NL 2IPTH 2LAGB 3KR3H 4MJ5A 4DTGH 5HI4C 3UTQB 1AD9A 3X17A 5LGKA 5JQHC 2X1OA 3ZDZF 4F7EA 2WM0A 5I17B 3AUVA 5EBLB 5DJYA 2CKBB 5F9WB 3T2NH 1FCCA 3RDTC 1B2WH 4MJIB 4HC1A 2IADA 1JK8B 1JPGB 4NZTL 1SVCP 2BNRB 3KPPA 1HKFA 5GZNC 1T2QH 2DQCH 4GH7B 1VDGA 4N9GA 2IAMC 1A3QA 1D5MB 5DJXB 1YY9C 1MHCB 3UPRB 3V6OC 1VFOA 4S0TD 2XRAH 4XPFL 5C07A 5GZOD 5DHXB 1DR9A 2F53E 4U0RC 1HN1A 3QB7C 5T3XL 5CUSH 1QFUH 2YN3A 3HNTH 3AAZA 3ARZA 3HUJA 1ETZA 4O02H 1I3GH 3KYMA 2AAVA 3NZ8A 1QR4A 2EICA 5T1KD 5T1MA 3D18A 43C9B 2VXUL 4JJ5B 4R4FL 3ES6B 3VH8A 5JIKA 5I1LA 4OCSH 4GKSB 4MA7H 3WLBA 1RJCA 3WIFB 2OTWB 3BP4B 3BKYH 1FJ1B 3ULVL 4K3JH 2HTLD 5CGYC 2LFGA 4FZEH 1UCBL 4PLNC 1RUPH 4YHPB 2CRYA 1T7VA 5EOCJ 3VXQA 3G5XB 2NNAA 3RVVD 3NFSL 5F7MC 1U8OB 4LOUC 3IU4H 1NH6A 3CLEH 2EDLA 3RDTB 3P9MA 4JQIL 2IPKB 5DMJB 3LD8C 2DQIL 1I7TB 2VLKE 2FBOJ 3GHEH 2IAMB 3TYFA 4HK3N 4O2FA 4X8JA 5LWYL 1HSAB 2H26A 2XZCH 4JO4L 3QPXL 3ZKMD 4ZFOL 2HVKB 5BCAA 35C8H 3QEQB 2GUOA 2QHRH 4MQXD 3WS3A 2OLDA 1T1WB 1S7XB 3D3VE 5F9AC 2NQCA 3ARGB 32C2B 3RZWA 1S7UB 3IDNB 1CLCA 4G43B 3AS2A 2D03L 3LKOB 3FN9A 4HFUL 4G9FB 4DN4H 2UZXB 1HQRA 2DD8H 1CIDA 4OZFA 1A3RL 2YN5A 5EORL 1C8PA 1JNHA 4HPOL 4R8WL 3MYJA 2CLVB 4HG4J 1JZ5A 3ZT7A 3O6FD 1EERB 2MKWA 3CK0H 4GT7A 4Z77B 4MCYB 1IAMA 2Q6WA 2Z31D 4PBXA 4X4YA 3VFRB 1CF8L 2JLLA 3U9PH 4HWEL 2P8LB 4DGYL 3BKMH 2V9TA 1J0YA 4ZUUA 2V7HB 3UTTB 4X6CB 4UU9A 5C0AB 1RZ7H 3MOBH 1SJEB 4M9PA 5CLWA 1CGVA 2XG4A 3C08H 4HUXB 1F97A 1D5ZA 4UIMA 5C6WH 3I9GL 4N0CD 4CADA 1YPZE 2AP2A 3U30C 3SDCA 3LQMA 2VH5L 3LD8B 1T03L 1TCRB 5EBWB 4OCLC 4HWUA 1QSVA 1AC6A 4U1HB 3INUL 5I8KH 4HWBH 3O6LH 3BDYL 1NUNB 1KCRH 2WIIA 3V4VL 3P4NB 2OI9B 4HT1H 2VXQL 1BQHG 3HZVB 3KNBA 5J1SC 1BX2B 1DBBL 4L8BB 5DJ2A 2LVCA 5FYJE 4KQ3H 4ZNEA 4HS6A 3EO1B 2X4RA 2Y1VA 5JA8B 1KJ2H 4V1DB 2OR8A 4P4KC 1NEZA 4JE4B 1OAYL 1MJ8L 1Z5LA 2R56L 4XVSH 5DZNA 3WNOA 3OX8B 1EEUA 1CLOL 3PDDA 1MIEH 3ZLQC 3BRFA 5HJ3B 4YPGA 1RHHB 2BVOA 2FX8H 4WFEE 5JOPD 4PJFA 1QLEH 3NIDE 1A6ZA 2PUQT 4LLAA 2XXMB 4P2RD 4QRPB 5IGXH 2IBZY 3HB3D 1C5BH 3P0GB 4OIAA 1TETH 5C0BE 4E5XB 1BBJA 2EDNA 3KYOA 5HDQL 1PKQA 1CU4H 3U30B 3UC0H 3VE0A 5E9DA 3F7YB 2CDGA 1ODAA 2NY6C 2I24N 2X70A 4DZBB 5FCSH 5EU4A 3OQ3B 2A9NL 4NO3B 4HJJL 3ROOA 3BMVA 3H9YA 3U7WH 4NWTH 4RNRB 1JFQL 1K2DB 1M7IA 3MV7D 1K6QH 4GUPA 4WW1A 4YBQC 3E6HA 5L2KE 4HIXL 2VQ1B 5T3ZL 4QXUH 3OG6B 2OXHA 5GRYA 1MFDH 1J1PH 2ATPA 4MNGA 2AKRB 4DUWA 3QXDB 4KUZL 5FKPB 5FECB 2C3GA 4JPWH 4FMKA 4HGMA 1NMCB 3O41B 3QPQC 3CVHA 1FGNL 3MPCA 3WKML 1F4WH 2YA0A 4K3GA 3TA3A 2BRRH 4P4KB 5IESH 4JZOA 3SQOL 4QRRB 3GMOB 4NN7B 4RQQB 4X6DF 3MXVH 3L1OL 4NGHL 4OFYD 2BSSB 3TBVB 3RVTC 4ZO8A 4OI7A 3MMEB 4TUJA 3VFNA 3MRFA 2XKUA 5C3TA 5DXWA 2XQBL 2CKNA 2I26N 2AXJA 1T20A 3MLYH 2QR0B 3R8BB 1JV5A 5FKAA 4YC2C 4OLXH 3GEWB 3V6BR 5E8OB 1JZ8A 1QSEA 3WFBL 1WAAE 4GBXD 5IEHA 4PJEA 2P5WE 3IB4A 2ZCHL 1OWWA 3W0WD 2GSGA 1RSFA 1JNLH 2AGJH 3LEVH 2E6QA 4WFFE 4OF8A 4DK6A 1A7RH 3GBMH 1WEJL 5FF6B 3WIIL 1G6RH 4N5UA 2QADD 4KRPD 4OAWA 5CS7A 1MCIA 2BNQA 3QCVL 3TBYB 1I9JL 2JJVA 1HHHA 1MREL 4Z7UF 3PGDB 4L29B 1UM6H 3OR7A 4JQVC 1VSCA 2ARJQ 1A6AB 4AMKL 1CL7I 5D1ZA 3MO1A 4D0DB 1MHHB 3IJYA 1UWEH 4GAYB 4OJFH 1B0RB 4YHIB 3DUSA 3RWCA 2XPGB 2CDFB 3ETBF 4IOFC 4XXCA 1KIPB 4HQQH 1OCWH 1U8QA 3VW3H 2P43B 5L8JB 4TTDC 4LCCC 2WSKA 5E99H 3V7AG 5DK0B 5FB8A 1L7IH 2R69L 1Q1JL 2A0LC 3TIEA 3I75B 1DSFL 4K7FB 3FQXA 2ZSVB 3GJEA 2P5EE 3HMXA 3RGVC 4ZSOB 2ORBL 3C6LA 5IBUB 4XCEA 4G6KL 4KI1A 5ISZB 3MQIA 4YXKL 5T1LA 5ANMB 1AGFB 1EHLL 4HCRH 2W65A 1MHPH 5EC1B 4TVPL 5SX5H 3DGGA 4PUBH 5F1SA 3DIFB 4GBXA 3WO4B 3BIBX 1MJUH 4GKOA 3O2DA 1AQDB 2RQ8A 4H26B 5IB2B 2L7JA 3ESUF 3KPSE 1X5LA 2F74B 2C7UB 4BSWB 2VDLL 3WHXB 4IMLB 5ID0B 4RGOL 5DVMA 4KU1A 2NXYC 4MCZB 1J8HB 3SDAD 1WFNA 5KSBE 2ZUQC 3UJJH 3RTQA 1JTTA 5IM7A 1FNAA 4H8WL 4NZJA 4ERSL 2FSEA 2CPCA 4YHZH 4UB0H 3SGKA 1HILB 3F12A 3IU3A 3RWEB 1RUMH 3RIFK 2JJSC 4G6JH 2EDRA 4EJ1C 4X5XB 2DIBA 4JZJB 5I1DA 1P9MC 3KYKL 5IMMB 4WUUB 4EI6B 3DX7B 3LQAL 1KJ3H 2YHGA 5CJOL 4AIOA 4U6HB 4Q9RL 3FO2A 4D0CA 3QG7H 3QCUL 3BPCA 2M8XA 1YMHB 2RB8A 3V5DA 2HFTA 3RX8A 3CMOH 3WFCL 2EXWD 2PYFB 3GRWH 2ICWJ 4NO5A 3I84A 2H9GA 4ONGH 1LDPH 15C8H 1ZT7A 4JRXB 4YBHA 3KLAB 4LPYA 3GMMA 2CD0A 1QR1B 1S7TA 1NCDH 4B41A 4HKJB 4D9LL 2IFFH 5I73B 1DE4A 4J4PA 3IDXH 4QNPF 2VLJD 4PJCE 4LGPB 1F4YL 3TF7C 4W6YB 5KS9E 5IMOA 1N8ZA 2ZUQB 4LCYB 2DQDH 3WFZA 1C5CL 2IANB 1X9QA 4HJGB 3X12A 4GXUM 1JTOA 3ESVF 4PJ9C 3EYUL 2KQNA 3X3GH 3RZCA 3D3VA 4LRNH 2FWOB 4PY7B 4ZFGH 3S96A 4L3EE 3QDMD 5FUZL 4PRIB 4G6ML 4QTHA 3UBXG 5I1IL 4XPBL 4OSUL 2WMPA 5FM5O 3DXAB 4N8VG 1WZ1L 1CQKA 1KF9B 4Y5XA 3C6SB 4JFQB 1QUNA 1RK1B 4ZQKB 2BY1A 3RIFF 2QSCL 2X05A 3T4YA 4QLRA 3F5WB 4NQEE 5BVJB 4JREC 4R7DA 3NCMA 3O0RL 4JFEE 4WI2A 4UDUA 3QDGD 5BO1L 1DQDH 4J6RL 1XAUA 1QACA 3LKNA 1QBMH 5HHVH 5DTFA 4G8FB 1IGIL 2Z8RA 1KEGH 1KTLB 3JV6B 1TJIH 2GJ6E 5EU7C 3SDXA 1GZQA 4MNQD 3L95B 4I3GA 1EHXA 1CVSC 3CUPA 2B1HH 1DL7L 1ADQL 4GO6B 1U58A 4ZXBD 5D2NE 2BVPA 3EDDA 1GGCH 3S88L 3BJLA 1TZGH 4ONHA 1H8OA 1L7TL 4FTVB 2VLJA 3GB7B 3QRGH 5GGUB 3RVXD 3C8DA 4UQ3A 4Z7WA 2F8OA 4R90H 2V5TA 3SDCC 5LJYH 5A3ID 2D31A 3RGHA 4PJ9B 3BO8B 3MACL 1JYWA 1XT5A 1T7YA 3RPIA 2HWZL 1DQJA 5E08H 5ILTL 1NUFA 1T22A 3KAAA 4JVWA 4Z0XB 3KYNA 2YSSA 3VXME 3BH9B 3V6FB 4NNPH 5AD0B 1BMGA 5GJSL 4CVXA 3QXUA 3SY0B 1QFWI 4RFOH 1WLHA 1ZHLB 1GH7A 3RWGB 3I02A 4LRIA 5F7HA 4JREB 4FQLL 1UM4L 1U8MB 1VFUA 4LF3B 2J12B 4FQJH 2Z8VC 3RWIB 1U8HA 4XNXL 3ZZ1A 4X4XA 3ZKND 3H7BB 5DRXB 2JCCE 3MZTA 4LLWB 4OD1H 1EAPA 1BVZA 5I15L 2R2BA 5LGJB 1YEIH 1Q0XL 4MNQA 3QNZB 1J11A 3NA4A 1T3FB 5FUOH 2VKXA 1F3RB 2DI7A 3BKJH 4ZXBA 4MD0B 4JHWH 3OB0H 3VXUE 5ESAB 1ND0A 1NANH 1OAKL 5C0CB 3LKSA 1ZTXL 3NH7H 1Q9OB 3QNXA 1INQA 1ZLSH 3QEQD 2F5AH 4UV4L 2VZTA 5E5UB 2J3SA 1VEMA 1OAXH 4NNYA 5GISL 1NBQA 3KS0H 3CLFL 1F4XH 3ARGD 1WUNT 5L2KA 3GJFA 3JWOL 3MCKB 3G08B 4UT6H 4PJ7A 1YNKH 4G9FD 4U6XA 3OZ9L 4M7LL 5IJVB 4Y16B 5F6HI 1A14H 5M94B 3MRPA 3QIWB 4N0YL 3TC9A 3MRGB 3AXLB 1DLHA 3GI8L 1UJTA 2F58H 2Z35B 1NL0L 2E6PA 3V4UL 1AD0A 2MCPL 4B5EA 1I1RA 1OP9A 1Z6JT 5BQ7A 5CAYB 3HI6H 3BP4A 3UTTD 4IRSA 1JGEA 3WXWH 1H3PH 4LSUH 1M71A 4OLYH 5C0AD 2VN7A 2XXCB 1VGEH 1X6LA 4HUUA 1NKRA 4I1NB 2XY1A 1JE6A 3PABA 5F6HJ 5CFHA 1JHKH 5AYUH 1FORH 1HHJA 4JM2F 4HIEA 4GKNB 4LVHB 4LSTH 3SKNB 1D5XA 5TE7H 3VI3E 2P8PA 3PDGA 4LP5A 3BE1L 1KPUB 5I1EL 4ODTL 4GAGL 1WAAA 5I1JH 1SJHB 2EIDA 4KI5E 1T7XA 4UTAL 1S7QA 4WGVB 2P5WA 3MR9A 2QSQA 2Q8AL 2VKWA 3W11D 3JV5A 1G9MC 5JORA 5ACZB 3HI1B 3BGFC 3IDMA 5F8RC 3U9UA 4BYHA 5C0EA 4IBLT 3VG0L 3ZKQD 1G7QA 5JW4R 2Y72A 1CXLA 3H42L 5DA4A 1SMOA 1J1OH 1JRHL 4V1DD 1IVLA 1GVIA 2AXFB 3AU1A 3IFNH 1WIOA 5LBSH 3LHPL 1EBPA 5TDOA 4RGNC 3FO9A 2FHFA 5DQ9A 2FX7L 4XP5L 1NLDL 2RJMA 2FBJH 4AT6B 1FO0L 4QT5B 1NCCH 2D7QA 5D1ZC 2VZSA 3SJVB 2RR3A 1IEBB 4NHUB 5E8NA 3I85A 2P5EA 4OGYH 1UXSB 2DYPD 4XTRD 2ADGA 4NC0B 4QRTA 4XXCC 4G8GB 1TZIB 3G6JE 1JL8A 3CH1A 3O6KL 5HHMB 1INEL 3RAJL 4G6AD 1UYWL 2EDJA 5GGRA 1CFSB 2EE6A 1H3UA 4TSAL 3L3GA 5EU3B 3GBLA 3L5XH 2H1PL 2QTEA 1OAUH 1SEQL 4Y2OA 4QRQA 1XCTA 2SEBA 1N0XH 2EH7L 3DBXB 2A9MH 4OD2A 3C6LC 5TF1H 2XWJA 1P84K 1I7RA 5DR5L 5I1GL 1LO4H 4HDIA 3GM0A 5FUCE 5DI8A 3ZT5A 3RHWK 1L0YA 4AIZA 2PETA 1DQTA 5LQBL 4LSSH 4HF5L 3RU8L 5JR1L 1DQML 1S78C 3KPSA 4OB5H 4EDWL 2FGWH 3L7EB 5C0IB 4Z9KB 4G42B 3MJ8B 4PJDE 4XB8A 4DOHB 1BZ7B 1SHMA 2BY3A 4U1LB 1Q94B 2EEDA 3FT4A 2QQNH 1R3JB 5EOCL 5KSBA 2P44B 4PB0L 1AGCB 5C0JB 3U0PA 1CFQA 3TN0C 4N5ED 2OSLA 2H6PA 5K9QG 4RGNB 4QRRD 1KLGB 3VXOB 1LK3L 4GG6A 1OY3B 2AJXL 4WJ5A 4MZ2A 4AL8L 5IQ7L 5TQ2L 3EOTH 1MFBH 5ESVA 2UUDK 3RTQC 1XF2B 4M1DL 5D7JB 4CAGA 4HUKB 1GIGH 3UZVB 5CSZB 3BHBA 3SGKC 5F7NC 5DJ0A 2IH3B 2VRAA 3PDOB 4MXQC 1F2XK 1T7ZA 2DYPA 1VB9A 4LVNC 5HVHB 2VDOH 1BEYL 1XGTB 2BVTA 2R4RH 2RHEA 3A0OA 1ZT4A 2W07A 3IJHB 2DMCA 4EZMA 2ICEB 4PREA 4YIQB 3HNVL 3WIHL 2I5YL 3FQNA 5JOFA 2AV7B 5IG7B 5IB5B 3NCJL 2CIKB 3DYOA 3MRDB 5DUML 2APWA 2W0LA 4NC2B 5IK3B 3VDAA 5KSAC 4JDVB 5E00A 1UENA 1NGXA 3RNQA 1MJ7H 1A6TA 4Y2DC 1XCQB 4IHOA 3STZA 4HIHA 4LDOB 1AGEB 4UQ2B 1ZHNB 3NBNA 2FJFA 3MRRA 3V0VA 1JGUH 3T0VA 5F96H 3RHWF 2Z8WC 3O4LE 2RBLA 3D69B 4J3UA 3TN0B 3QQ9D 4NNXB 3FQRB 1YEFH 1MFCH 2J1KA 4J4PC 3HS0B 3IFPA 4Z76A 3WUWB 2F54E 4LFHD 1IM9A 4ZDHA 2FO4A 2XT1B 1VHPA 4QWWC 1R3IH 1OGTB 3KG5A 2FL5B 4NDMB 3Q5OA 2GHWB 5F89A 2VAAB 1J5OH 5DEZA 3TBVA 1RU9L 2F53B 2D7OA 5I1AA 4KWUA 4LAQH 5ISZD 3DX9A 3IAPA 1I1FA 5SWSB 1I9RL 1IILE 3RZCC 3LRGA 5JZ7D 1AO7B 2NMSA 1A5FH 4KMQA 5T3XD 2GK0A 4JFEA 3SEPA 2VLRE 3S34H 5FO9B 4Y5XC 2YD2A 4Z8FL 1UQSA 3MLSH 3P4MA 4HFWB 1UB6A 4NQCE 2GJ6A 4QY8A 5KSAB 5ALBH 1F3JA 3TIDA 4XP9L 2VC2H 5FF6A 1T2XA 4YFLF 4HMCA 4Y2DB 2YPLE 5D2NA 1J8HD 4QHLA 2G2RA 4LLMA 1KV3A 4QCIA 1J12A 4FFZH 5C6TH 1F13A 5JPNA 2ZOKA 3GBNL 5KVDH 4M43H 3BEWB 4AH2A 5KSUB 2ADJA 1DP0A 3MV8B 1KCUH 1P2CB 3BIKA 2YKLH 2GI7A 5I16B 5I8OH 2A0LD 2VLKB 3PL6B 4OUUB 1FVCA 2WUCH 4MQ7B 1D9KC 4WUUD 4NKOA 4PB9H 1NAMB 1QLRA 3G04B 3VXSB 3GM8A 3VXMA 3N1PC 2DKSA 1PFCA 3IF1A 5CJQH 1W0WA 4P2YA 1P84J 3UJTL 3UZEA 3CFBB 4OF6A 4U1MB 5FYLH 2EKSA 1ES0A 1HINH 3V0WH 5IMLB 1ZVYA 4QF1A 2HT2C 4CMMB 3HG1E 4BQ6A 4TSCH 3MRCA 2V6HA 3P30H 4LLQA 1T83C 2GCYB 3HR5B 5SX5K 1WISA 5MEQB 4JRXD 2KH2B 5EZLB 3KLSA 1KLUA 4MA1B 5IVXA 2A77H 4LRIC 4P5KA 3I6LD 1T1XA 5IFHL 1I1YA 1FG9C 2BRQA 3LQZA 2L0DA 1NLBH 3ZYZA 4Z78A 4BSWA 2G60H 2Q86B 1JVKA 3QIUC 4YFLI 2XWTB 5FHBL 1P6AB 2FD6L 3VXUA 3VFWB 2ZOLA 4OI8A 1NDGB 1ZXQA 1PDKA 3L9RB 3MNVA 2HFGH 2J8UA 4PJIE 3V8CA 3IDIA 1YPZB 5TH2B 3TT1H 4S2SA 3DHJA 3VXRE 1IQDA 5DVKA 4XCCL 1P1ZA 5IB4B 1HILA 5DD1L 5D8JH 4PRID 4BH7A 1F3DH 5INDB 2R4SH 4J3XA 1D9KB 2R8SH 1CG9B 4BUGA 2JKXA 1JHLH 2DMKA 2NY4C 4BELD 3DXAD 5HGAA 3LMJL 3DX6A 1I3RB 5KTEL 2XFXB 4RFEB 3SKUD 3D85A 4PRAA 3X3FH 4P3CH 3MREA 3OB8A 1BOYA 4S1DC 3K46A 4CJ1A 4WIQA 3HE7C 4M6OL 5F7UA 3VFMA 4ZFOA 2JIXA 4HMDA 3ROLB 5IFJA 1I3VA 1I1CA 4LSRL 1GAFH 1KEMH 3B6SA 4HXBH 1BP3B 4N8CH 4WI6A 4P57A 2FNBA 1VGKB 2E27L 5C0GA 5JMRA 1G7JA 5SWZE 3UYOD 5C7XH 1VADA 2ZJSL 3CZJA 4WUKL 4IRSC 5SX4H 3QIUB 3AY4C 3DYPA 1DBJH 4FZ8H 4S0SD 2X9YA 4FTVD 4GRMA 3ZTJH 5JW3H 1ACYH 1GPOH 1MRFL 4XP6H 4YNYB 1AHWA 4JO2H 3GIZL 5C0BB 3ISWA 2LE9A 5FV1L 4LCYA 4YHYC 2X7LB 4NN5C 4E42B 2XACC 4NUJB 5F1NA 5HHPA 5IWLA 3ZTJG 3AREC 3U6RB 3HR6A 3P0YH 5TE6H 5EOTA 4XBGB 4LGRB 4K71C 1FYHB 4U05A 3U46A 3QJHA 3WFHB 5FO7A 2DQGH 3WFEL 3ZE2F 3D0VB 4M61A 4YGVA 2BFVH 2CLRA 2VERN 1MVFA 1UA6L 4Y4FD 1H0DA 3FFCD 1UZ6E 2B5IC 2Q8BH 4JY6B 4XPAL 3C6SA 1E6OL 1A6WH 5T1DH 3F7PC 3B2VL 2Y06H 4CDGC 5CHNB 3HE7B 5GS3A 3MZGB 2F15A 3PWNA 3IXTA 4M62L 5T5FL 2I9LB 3SBWA 5T3ZD 1E27A 1DUZB 3PGCB 1P4BH 1GGIL 4LCWE 2V2TB 2BOBA 3QULB 1IEAB 1KUMA 2DI8A 2DIJA 1FFOB 4Y5VA 4OGXL 1CDHA 4L5FL 1QSZA 4MDIA 2GSIA 4KFZC 4HH9A 4KHTL 5F6IB 3GMLA 1IJ9A 3F8UB 1Q9LA 4N90E 4I4WA 1E6JL 3ZYOA 4ISVA 3S4SA 5GS0D 1U95A 1KGCE 2HYMA 1P7QD 3W82A 1UWXH 3A6BH 4MJ4A 5C92A 4U1NA 5EUKB 3RVUD 1ERNA 3AREB 5CWSB 2PTVA 1B6DA 1AH1A 2UZIL 4Z7VE 5GJTH 1YA5A 4JPKL 5E95B 2PF6A 4K71B 4UINL 1F11B 3UTZA 3K1KC 4R96A 3AM8A 4WY7H 4WNQA 3VDBA 3U4BH 2UWEE 5AWNH 4Y16D 3QUMB 3T65B 1FV1A 1UZ8B 3QIWD 1LEIB 2OZ4L 5LAXA 2B5IB 2YEZA 3LN4B 3MRJA 4QTIH 5KVMC 4HUWB 1EMTH 3E8UL 4TUKL 4Y4FA 3FFCA 4DGIH 3RWGA 1QSFA 2JELL 1A4KB 1BVKB 1QRNB 5JDSB 3BDXA 3WDIA 5CIPA 4KKNA 1P4IL 4P59H 3UAJC 1OHQA 2AK4B 5J9PB 1XH3B 2MPAL 4M7KL 3H0TB 1MCPH 1PBYA 4JLRB 5IT2L 4TPRL 4LLWA 2FEEI 4WCYH 3IS1X 4HPYH 3BN9D 4M6NH 1LGVA 1AY1H 3ARRA 2FJHB 2VLLA 3NFPA 3TO2A 4P9MH 4PRHE 5GGTL 5IF0A 2VZUA 3TJHD 4F8TA 25C8H 1U8PB 2O5YL 4XNYL 3KXFE 2XN9E 3OJVC 3P9LB 5GS2D 3UTSE 1FVDB 1P7QA 3MJ9L 3QJFA 3G5ZA 4ZUSA 1C5DA 4ODSL 3P11H 2YXMA 4NRZB 4LHUD 4YDKL 2XZQH 3QFJA 4LFHG 1O5DT 3NIFE 3GSVB 4G6FD 4XNUL 1NFIA 3K2UH 5DYOA 5L9DL 2W9DL 3B5GA 4R97B 3N9GL 5IBUG 1R24B 3O4LA 3QH3A 5T3XH 1A21A 1QFPA 3ABZA 4Y4KD 4TVPD 2HN7B 4DW2H 3TPUB 2WP3T 2P46B 4QYOA 3IT8D 1RJZA 3F7VB 2F54A 3MLXL 3IVKA 5C0ND 2HJFB 4JZNB 4R4FH 2M1KA 4KH2A 1YN6B 3ZYIA 3MOAH 3GZKA 2QSVA 1HHKB 4UT9L 4G8GD 2EDFA 3O3BB 2WINA 1AP2B 5HHMD 3SPVB 4KZDL 5CINL 2D7TH 5DFVD 5IV2B 3K8KA 1VFAB 1XGUB 2AXGA 1UCBH 4PJBA 3WYRA 4OLZH 1XGYL 5I2IA 3SCMB 1IT9L 2BCKB 3Q5TA 4ELKA 5A16A 3CJJA 3NFSH 4KTEH 3U36B 3BQUD 1EZVX 2HLAA 3KJ4C 1GCFA 3P73A 1HNFA 3K4ZA 4G3YH 3P4OA 4NQCA 4CVZB 4JQIH 2HTKC 2YD5A 1FZJA 4LEOB 3CAFA 1N6QL 4ONFH 2DQIH 2Z93A 4GQPH 1LDSA 2X44D 2FEDD 4UZGA 3W39B 3MNWA 5C09E 4WV1A 1EHNA 4FS0A 4LHUA 3QPXH 5EUOF 5F7EL 4AQ1B 5IB3B 3KVQA 3NPZB 2C1OA 5D7KD 2BMKA 4RGND 4W6XB 3O45B 3QI9C 3O8XA 5D2NC 4Y4KA 5CCKL 2XZZA 3EFDL 4PJCB 1QFWL 4ZAKB 3JV0A 1X5IA 2VDMH 5EO9B 4YZFF 2D03H 3SE4A 5KS9B 4HFUH 3D39A 3SQBA 1EO8H 5B3JF 1HH6B 5D7JD 5EORH 1PY9A 1A1MB 3GDBA 1NJ9A 4S1SH 4X7EC 4PGZA 3ALXA 4NOFA 2EDEA 3EDEA 4P2OB 1Y18A 1EXUA 3G9AB 2JJWA 2JK5B 1OF2A 2D7MA 4PJXF 1WCBB 3T1FA 5BRZE 4HWEH 4L3EB 1VFMA 1CFSA 2W0FB 2B0SL 4X9GA 5DVLA 1QQDA 3HG1A 3HC0A 5TGBB 3RUGE 2AJYL 4HHAA 5IBLC 3FAXA 5BJTA 1IGFH 2R29H 4RAHA 3FCTB 5JW5A 4LLVA 2YZ1A 3IFLH 3BQUA 2NW3A 5F21B 4NQEB 1T03H 1E4JA 5E8EA 4FQPA 1JUFB 4MD4B 3QG6A 3ZDXF 3RFZC 3ZE1E 2MTPA 5D96B 1NANI 1ZEAL 5D2LB 1QZ1A 2XTJB 5FA3A 5GQBA 1I1AB 3ILPB 2YD1A 1M7XA 1YDPB 3V4VH 4F57L 5M95B 1FHGA 3U7YL 1Q9KB 3QI9B 4E41B 2OR9L 4CJ0A 2AJZA 2C3VB 2IFGA 4TUOB 2OL3L 2Q7NA 4U1IB 1XF4A 4X6FB 1TTFA 5EIIA 3EOAB 3MUY1 5HHXL 5EOQL 4KMTL 5DMKA 1URLA 3FTGA 2EDKA 1OT2A 4KK8C 1GC1L 5SWSD 3NIGF 1U2CA 4NBYB 3WE6B 1L0XA 1J0ZA 4C56E 1AO7D 3QQ3B 1VEPA 3N1GC 1CLOH 5EZIL 3REWB 2FO1A 3VRIA 2R2EA 5HBBA 3VFGH 5EULV 3CCHA 2EEBA 1E4WH 3BUYA 1FL3A 3NABH 3IGAA 4FG6C 4ZODA 5HDQH 1T6VN 5KSAD 5E4EC 3J8F7 4WO4B 4YH6A 5E24E 1C16B 1CLYH 3M17B 4WU5B 4Y2DD 5ENWA 5KANG 4NQVA 4RA0C 4JANB 4U2ZA 5D1QB 4ETQA 4OCRH 4ZUVB 2A9NH 4HJJH 3OKDB 2JCCB 1W0VA 4C4KO 1JFQH 4YLQT 4AENA 3N06B 4LKCA 3VFPB 4EXKA 3T0BA 5T3ZH 3MV8D 2XWBA 3GMQB 3CX2A 4TRPH 4PGEA 1OP3H 1FG2A 2ENYA 2VLKD 3PL6D 4JB9L 4KUZH 4QWWD 1NBVH 1FH5L 5DJ6B 4J12A 4KI5C 3VXSD 4F58H 3VXPA 1ADQA 3WKMH 4YE4L 3SDXF 3EFFB 1MY5A 3BP5A 3CSPA 3BGAA 5IWLC 1ZWIA 3T09A 4R4BB 3SQOH 3FB7A 3A6CL 4TYUA 3Q0HA 3V4PH 5GS0H 4XNZC 2DTMH 4ZS6C 4AY0A 1ZT1B 3ZDYF 3MV01 4OZHA 5EIQA 2L4OA 3L1OH 4NGHH 2YRLA 4PP1C 5HI3C 1KIQA 5DRNB 2ENSA 1OB1B 1ZKAA 5MENE 2XQBH 2VUOA 3TM6A 1S9YA 5E4EB 5J7CC 1W8NA 5ICZB 4RMUA 1JGVL 3BD5A 2ICWB 4M8QA 2V17L 3WFBH 3T2NL 5C9KA 3VWKB 4Y5YB 4MDJB 1B2WL 4Q74A 2ZCHH 5J06A 2VXVH 4NSKB 3M1BB 1OGAE 3V95A 3BW9A 2DQCL 1XR9A 1ZHBA 3FT2A 4J8RA 4I5BA 1IAOB 4XC1L 3MV9B 3D6GA 3O9WB 5E1AB 1A9BA 1K4CA 3QCVH 2IMNA 1I9JH 3GHBL 4HS3A 1OQXA 4L3CB 5D7IF 2EIZB 2KBGA 3HLAB 5D7LB 1RZFH 1MFAL 3JVGA 4Z7VA 5K9QI 4CN1A 1RZIA 1FNEB 4O02L 3QUKA 4K94C 5FUCC 1YJDL 2UWEA 4OKVA 4AEIH 5KG9B 1U8JA 2KDGA 5FV2A 3FO1B 5DEFA 3DMMA 4OCSL 4XNZB 4MA7L 3BPNB 2R69H 2ED9A 3BH8A 1F42A 1DSFH 1TVBB 4Q0XL 2EEAA 2HT3D 4CMMA 5GS2H 3WUZA 5B4MC 2ORBH 1OAQL 5BW7A 1XGQA 1O7SA 1K5NA 3HC3L 5IROC 1LK2B 4YEFA 5IOPB 2NXZC 4YXKH 1Z9OA 4FFYH 4UBDC 1UKQA 1EHLH 3QIUD 4PYGA 4K7PX 4WHDA 3G9VA 1C12B 4TVPH 2NY2C 3RKDC 1WC7A 5EFIB 1IC1A 4MD5B 1G9NC 3V8OA 4NQDE 3B9KB 5DD0L 5F88A 4PRHA 1RZ8A 4MWFA 4QRSB 3G6JB 3L7FB 2FJGA 4PJGB 3L9RA 2IF7A 1SYSA 2XN9A 3KXFA 2JB6B 5C9JB 1EZVY 4RGOH 35C8L 4I9WD 2QHRL 4U6VL 3FB6A 4Q9CA 4OM0H 3CFJB 4BKLB 2XKSA 4LARL 3VGEA 3WJJA 4OQ1A 4CW1B 4XVUC 4WI7A 3WXVH 5D5ME 4HUNB 2BVUA 4NRYB 3EHBD 5HYQB 4W70A 1KB5L 1VESA 2DD8L 1R5WA 2G5BA 4JFFD 4G8IA 4MA8L 4XXDB 1G9MH 2VLME 2NY3D 3R4DA 2YUWA 4BZ1L 4PJDB 3UX9B 1JYNA 1QKZL 3MGOA 3S37X 1V8HA 3DRQA 2ZUYA 4NJ9L 2R2CA 3KYKH 2LQRA 1XIWB 3LQAH 1I8IA 2B2XL 5CJOH 4A2MA 3HCVB 3QCUH 1X7QB 1CR9H 5TDNA 1EFXD 3MOBL 2NXZB 4AM0A 1U3HC 4WTWA 3EO0A 4P4RB 1HEZB 4NO0B 2CLZB 5HVFB 2E7CA 1MAKA 4F7TA 5H37G 4P5TA 5HPMA 1N2RA 1WFUA 4X6DE 3I3BA 2IH1B 2DLIA 1U6AH 2CUMA 3V5HA 1R6VA 1T5WA 2VZ3A 5F3HB 5JW4M 1ROWA 2IG2L 3FQWA 5KOVC 1LD9B 3TBTB 3ZTNL 4URTB 4D9LH 1FO0A 3DVIA 2O5ZH 4L8DB 4X4MA 5GSVA 3QUZC 5ADPH 1H15B 5MHSE 1F4YH 3U4AA 2PW2B 4J3WA 3QWRA 4OCXH 1AXIB 3CGTA 1A7PL 4I0KA 1C5CH 4X6CF 3N0PB 2ATKB 5KOMC 2XTLA 3BEVA 4GKZB 3D0VA 2A6KB 5DUPH 2W1NA 4DK3A 1Z0MA 1SBBA 3I50L 3TO4D 3EYUH 1FLRH 1WFOA 5D72L 3PP3K 4JFFA 4NT6A 1QRND 5FUZH 3DRTB 4G6MH 1RURH 1BJ1H 4I3SH 4QXGH 4WV1C 4Z7UE 1T5XA 4JG1L 4HLJA 4XPBH 4OSUH 2DF3A 4BH8A 4ORZC 4PG2C 2AK4D 1FDLL 3G5YA 1CYGA 3PGCA 2BSRB 3MRLB 1KNOB 4H5SB 3IS0X 5KSVA 3O8XC 5E6YA 4F37K 2RFXA 4CBPA 1U3HB 2X4NA 1HH9B 1ZGLA 2A38A 2N4IA 3NCCB 1JPFB 1EFXA 1FFOA 5DC0A 3MXWH 3FB5A 4ZOBA 3SE4C 4X7TB 1CU4L 4GMTL 3AS3A 2G75A 1G7PA 4OM1L 1IGIH 3F58L 4Y7MA 3I3DA 3RUGA 1OQOA 3KGRA 2V9QA 4Z5RB 3ARSA 5C8JB 4BFGA 2HFEA 1IKFL 3GKWH 3OPZL 3F6LA 1DL7H 1DEEB 4NM4L 3U7WL 3OAYH 3A67H 2FLBT 3QUZB 4GG6F 1UG9A 3TWCL 1P5VA 4Z7OF 1K6QL 3WUWG 3V6ZA 5L0QB 5HYJB 4P2CG 1L7TH 1L6ZA 1OTTD 5IHBA 4HK0A 2VLRB 4O9HH 1QBBA 5J13C 4UUJB 4OCYH 3ZYJA 5HHOE 3MACH 3WIHA 2HWZH 5FGCB 4MX7B 4NFDA 1F4WL 4WWKC 2YPLB 4QRUB 2A6JB 4KJWC 2V7NB 2WBJB 3TO4A 3WL9B 1PEWA 3QZWB 3MRIA 2NX5B 3IAGC 5L2JA 3EBAA 4LNRB 3IKKA 1KCKA 3KPNA 2ADFH 1NBYB 2OTUA 5BS0E 3BVNB 3ZKXC 5GJSH 1BLNA 2H3NA 2Y4SA 1KN4L 1K3ZA 5H2BA 1Z0NA 1WQVT 4PRBA 1E4KA 1OM3L 4IJ3C 2HAZA 3BPOB 4FQLH 1UM4H 1ACZA 2WIMA 1I7ZB 3L6FA 3QXVA 5SWQA 2YPKA 2Z91A 3OBAA 4LLUA 4XNXH 4OLXL 3SCMD 5ETUB 2X4TB 3GMNB 4UDTB 4RAVB 4P23D 3HE6B 5DEGA 4F37F 2EC8A 1KOAA 3BXNB 2AGJL 1SM3L 2OQJA 4F7PB 5J3HD 1TQBB 3PQYE 1A7RL 1BZ9A 3GBML 1PY4A 1DLFL 4UIKH 7FABL 1G6RL 1ZLUK 5DVNA 5SX4I 2PXYD 3OTTA 3RVWC 1OAZH 3T77B 5FXCH 1U93B 1IAIL 5J13B 3WHE0 3X13B 1T4KA 1RJYB 1UM6L 1TFHA 3KPOA 1F6AB 5GISH 3OKLB 2CDEB 4WWKB 1YMMD 4ZAKD 4OJFL 3NAAL 3H7LA 3LN9A 1BIHA 3PWUA 1OCWL 1C1EH 4QNPE 3PWLA 3F7VA 4TQEH 3ZKXB 3QUYC 4PJIB 3O3EB 1JGDB 1FFNA 2R1WA 4P2OD 3GI8H 3VXRB 1BZQK 4C57C 4MAYD 2MCPH 2X1WL 3BWAB 3LZFL 1EEQA 3VGBA 5M7QA 2ITDA 3VI4F 5IV2A 1KJVB 1BBDH 2Q7YB 2EYSA 1GZPB 3U0TB 2DM3A 5A2KH 4HCRL 5H35A 3W9EA 1SYVB 1IBGL 3BJ91 3M8OH 1OTSD 5MENA 2CO7B 4P23A 1LMKA 4R4NC 3GSUB 2HTKD 4HZLB 4EVNA 2J5LB 4FFWC 4NQED 1IZJA 1WWCA 1OT1A 8FABA 3BGMA 3BE1H 5I1EH 1KC5H 2P7TA 4ODTH 4GAGH 4B7IA 1A02N 1HXMA 1A3LL 4KK9C 5AYQA 5BZDA 5HYSB 3DX8B 4UTAH 4NUGL 2E7MA 2PXYA 2XTJD 1I1AD 2Q8AH 4AK1A 4K3EH 3CC5A 4K7PY 3GI9L 1H5BA 4PGCB 4OV5B 4Z18A 4IRJA 4L4VE 1Q9WB 3L3IB 1VCAA 5SWZB 3UJJL 4E41D 2YC1A 3BSZH 5I6XB 4OQTH 4EKXA 5DQJB 2A73A 5DD6A 4NKIL 5DS8B 1DBAH 4JFYA 3VG0H 4UB0L 4HUVB 1RPQA 3VFTB 4I2XE 4PTUB 4JRYD 1YMMA 1RUML 3LDBC 2FECI 3QUYB 4KV5F 2JJTA 2AQ2A 2H41A 1WZLA 1KJ3L 5I71C 1CFTA 3QG7L 3GSWA 5C2UB 3EOBA 3QHFL 4ZOAA 3H8NA 1J18A 4MAYA 4CRPA 2C3HA 4HKXB 3BZFB 1WGOA 3GRWL 3D9AH 1LE5A 4XZUB 3JBG7 2H8PA 4PJ8B 1IFHH 1CD1A 3PJSA 2J8UF 5DLMH 4XH2B 4XNQA 1N5AB 1WBYB 4ELMA 4ODUA 1B9ZA 4ONGL 3DMMC 2BVQB 1INEH 1U92B 15C8L 3VMOA 1M05B 1FAKT 3FRPG 4WO4D 5L6YL 4I0PC 2UYLA 2H1PH 1BQUA 1SEQH 5D6CB 2BVYA 2FIRT 4ODWA 4YGAB 5D1QD 1KB5B 1ZSDB 5BW7C 4RBPH 5DR5H 1YYLH 1EUTA 1YYMH 3HMWH 4IOIA 3HPLA 3QWOB 4NQDA 3JWOC 3HZYA 3PWPE 2X1QA 4MJ6A 5IIEA 5LQBH 4L9LB 4HF5H 4M00A 2VDKL 3DTXA 3C5ZA 5F7LB 3ORJA 3KPRA 4EDWH 4M7JL 1EO5A 1VKXB 2BSTB 1E28B 3E3QE 2PW1A 5DJ8B 5DMIL 3X11B 2OBGA 2NTFB 3LDBB 3X3GL 4HGWA 1JZ6A 4GAJH 4C58B 4X6FA 2H45A 5EOCH 4JRYA 4HKZB 4PB0H 5DRWA 3UTPD 5CBAB 1S9VB 1R5IA 4OBSA 3ARPA 4HAGA 1A1NB 3B5TA 2LU7A 3F65A 2K7QA 2PR4H 1W0YT 1PZ5A 1NGWA 3AS0A 5IQ7H 3NA9L 4Y0GA 5TQ2H 1PJ9A 3QDJE 3WJJC 5J6HB 3CDGB 4L4TE 4D8PB 1RZKC 3I6GA 2Q3ZA 4XRCA 1MI5E 4M1DH 1NFDB 1DQDL 1KULA 3EDFA 1F90L 1B6UA 2ED7A 4D0BB 4KDTA 5D70H 5GHWH 5KVEH 1BEYH 3OJDA 3VWJD 4I0PB 4F2MA 5K9OB 2I9TA 3QUMH 2B7DT 5CP7A 4V2BA 3QEHB 4WO4A 3VWKD 4BK5A 3HNVH 3QT2A 2I5YH 2B1HL 3QA3A 3UDWA 1JF1A 1KSRA 3DECA 5EO1B 4A6YB 2X9WA 4M8VA 3VJ6A 3Q6FA 3NCJH 1T80A 1GGCL 4X6DA 5IW1B 1TZGL 2KPNA 3RWFA 1YEKL 4JY5L 5DUMH 3RL2B 1HSBB 3MV9D 4GXVL 3O9WD 1RIVH 3NGBB 4DCQA 1GXEA 2WNGA 3MBEB 3D25B 1D3CA 3VFPA 1OP3K 4R90L 4P5TC 1QFHA 5CP3H 5D7LD