5DLMH

Complex of influenza m2e and antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
216
structure length
216
Chain Sequence
QVQLQQSGGGSVKPGGSLKLSCSASGFSLSTYAMSWVRQTPEKRLEWVASMSSGGSLYYPDTVKGRFTISRDTVKNIVYLQMSSLRSEDTAMYYCVRGGYGTSYWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of monoclonal antibody
publication title Crystal Structure of the Conserved Amino Terminus of the Extracellular Domain of Matrix Protein 2 of Influenza A Virus Gripped by an Antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 216
sequence length 216
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dlmH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dlmH01
2VC2H 2PTVA 4OZ4B 3QWOA 1D6EA 1WCBB 5GISH 4N0CC 4ONHA 4HLZH 3VXSA 2WUCH 3VFMB 2WSKA 5E2VL 1FGVL 5CHNA 3MFFA 3L7EA 1IGYA 1RUML 3VXUA 1U3YA 3KPRB 4MAYD 1F2XK 1NCTA 2FRGP 3S36H 4KVCH 1LK3L 1TCMA 3LVEA 3DURB 5EU6E 1GVIA 1GGBL 3DOSA 2WQRA 2Z93B 2DQDH 1MHHB 1IGIL 3T77A 1TNNA 3WIFA 2AXFB 3VJ6A 2QADD 5BRZB 4CVXB 1BX2A 4UT7L 2DQIL 2GQHA 4XP9L 5DRNB 2CUHA 2Q6WA 2XKSA 3QEQD 3BHBA 1K6QH 4RWHA 3SJVE 5TH2B 3TBTA 3VDBA 1OOAA 3VG0L 4DGYH 3TVMD 4PUBH 5DHYA 2V9RA 4D9RD 4OZ4A 3BUYA 2DYPD 2P5WE 1G9NL 3UTOA 3TNNA 5L2KD 4KKAD 5HHVL 4DK3A 3MRDB 4JVWA 5CBAB 3O41A 4BYHA 3J8F7 3PP3H 4PLJD 3U9PL 4QHMA 4G6JH 4OZGA 3KPRA 4X6CB 4Y4HB 5D72H 4H20H 4QOKE 3B3IA 2FJHB 3BESR 1JNJA 1RUAL 4U1JB 1Q1JL 3PL6D 2IH3B 2EDXA 4Q2ZB 2D03L 5K59E 3SDXF 1JZ7A 1OP5H 4BJLA 1MHHA 2YHGA 1BBDH 4Y88A 4DQOL 3RI5K 4ODTH 2AXFA 5BW7A 4KQ3H 4CVXA 4MXVE 5DRNA 5ESVA 5DQ9B 4LPYA 2JB6B 1MFBL 1RJZB 3MV11 4M6AA 2AK4E 3VXTA 2ARJQ 5EIIB 3VFOB 1WEJH 2BSTB 3UC0L 4Z7WF 3GIVA 1WAAF 1DBAH 2QHLA 1CBVL 3MRDA 5FA3B 5CBAA 2H2SC 1KNOB 3O4LE 2H6PA 3VG9C 1NPUA 1AD9B 1L9NA 2F54B 1GOGA 3HUJB 3K4DA 5KSBE 4Y4HA 3E6FA 2MCG1 1RPQA 3D39B 3PE9A 4JFDD 2FJHA 3KWWB 3RVWC 1C5DA 1UZ6F 1Q0XH 3C60C 3QQ3B 4J3WA 4U1JA 5ALBL 4P9ML 2IH3A 3ZE1F 2FSEA 1QVOB 4I4WB 4Q2ZA 3IXTB 5KW9H 4J2XA 5FGCB 2OI9C 1H3UA 2FL5A 3TESA 3AB0C 4GKSB 1J12A 1E0OB 5EOTB 4MZ3A 5DQ9A 3UPRB 2JB6A 2ZNWA 1RJZA 2GITB 3TO4B 3IJHB 5JMOC 1T80A 2YUWA 4MQ7B 3VFOA 2Z31B 3KLHD 2FX7L 3TEUA 4ODUA 5GSRB 3HMWH 3VRLE 3ZL4L 1FAKT 3T0AA 3BN9C 1KNOA 4PBVC 5LGJA 1V7NL 1PFCA 4E9LA 1AD9A 5JW3H 1YYLL 2ICWI 2OTWB 1TETH 3ZZ1A 3MLVL 3D39A 5F89A 1J1PH 3OGCB 2YPLA 3BT2L 2XTJD 4WUUE 2P8LA 4I4WA 2EDJA 3IXTA 1PG7W 1RVFH 5IBUG 2DKSA 1UQSA 4GKSA 4ZNCD 4XVSL 2OL3L 1YDPB 4N0FB 1YMHA 2XN9E 1KPVB 5EOTA 5CP3A 2KZ1B 4JJHA 4JHBA 1IEBB 3UPRA 4LGSB 4YK4B 4NJ9L 4ZPTB 1CK0L 2GITA 3IJHA 2CO6B 1XF2B 4MQ7A 3MLZL 2DKMA 2Z31A 1PKQB 1UM5H 5T5FH 4LF3A 4EUPG 2C3WA 3P0VH 5IMMB 2AEPL 3P3YA 2WWKO 1OT1A 4HJJH 5GSRA 2VISB 4XCEB 4U6HB 1YEJL 3JTSB 4JHAH 4EQ2A 2IPTH 4WO4B 1AXTL 5DVNA 3GBNL 4PJ8C 4PREB 1A6WH 1FRGH 4RMVA 3O6LL 4HDIB 2X4SB 3OGCA 1JFQH 3RVUD 1JWMA 5IESH 5HYJD 2O5YL 1IFHL 2NLJA 4PG9A 4UOJA 4OSUL 3B2VL 5EPMA 4P0DA 3A67H 4LLQB 5HGBA 3DV4B 3RAJL 4OCLC 2AK1H 1AI1H 5BMFH 4JRXE 1YDPA 1JF5A 4N0FA 4A6YL 2W9DL 4OBSA 3SGKC 2R8SH 2WMPA 3DPBA 5T1MB 3PDGA 5L0QB 4JKPH 4YFLI 3P11L 5I1KH 2CLZA 4IOIA 1PKQA 1VSCA 3T3MF 4TSCH 3C8KA 1QO3B 1FNHA 1S7SA 2VISA 4MNGE 4XCEA 4PYHA 4U6HA 4XPBH 2PO6B 3PHQA 5D1QC 4LK4A 4B5EA 4JGUA 2V5TA 4WO4A 2JE8A 3F58L 4PREA 4X4MA 5IVXF 4HDIA 3OGOE 3MJ9H 4R4NC 8FABA 2ADIB 2FD6L 2GK2A 1YNTB 1H3GA 4LLQA 5DEFA 4R0LC 1FSKC 2CKBB 3DV4A 4MXWL 1R5IB 4ZS6C 4OQTL 1ADQL 2DJUA 1NFDF 3PQYE 4KK5D 4HZLA 1MRDL 4Y19B 4GRLC 5HDLA 1D5MB 4NSKB 3QIWC 5JA9A 5AZ2L 4ZMAT 2D0HA 2Q8BH 3T0XA 4OZHE 3DRTB 1NAMA 5EU7E 3WFCL 1CDIA 1GRWA 1PY4A 1WIUA 3OHXA 4YPGB 2ESVD 2HTLD 1EVUA 4KHXL 3FN9A 1P7KB 3FMGH 2E27L 3AS3A 5JTWA 1PX3A 2PO6A 4HWEL 4LEOA 4OF8A 4ZFFB 4FQPA 2HT4C 5LCVH 1TJGH 1RIHL 1CFQB 4S1SH 4LSDA 3GKZA 3AY4A 5EA0H 4UT9H 4EOWL 2ADIA 4QHNB 4NN6C 5EUOB 1UG9A 3FB6B 3GRWH 2CKBA 2NX5B 1R5IA 5DA4A 1FZOB 4M7LL 1HQRB 2DWEB 3CVHL 4E41D 1RURH 3HI5L 1V8HA 5TE7L 4Y19A 3BZ4B 4HIXH 3VH8B 1JRHH 1D5MA 2A73B 4LOUC 2NY0B 4ZOBA 3GNML 3SKUD 1IAIM 5DD5L 2VDKH 2QR0A 3DRTA 3U4EB 2KQNA 4KMTH 3HNVL 3V4UH 2Q8AL 4R4FL 3MJ8B 4OZFA 1KCSL 1XIWB 1JTOA 1CGTA 1P7KA 1U41A 3BO8B 1XGPB 2P24B 1AHWB 1FORH 4L1DA 3BSZH 5BS0D 3QULB 4WGVB 5CILH 4FQXC 1P6AB 1CFQA 1LO3L 3WS3B 2MKWA 3VXRD 4P23D 1QFOA 5M94B 4LAQH 4HUMB 3QSKB 3VD4A 3SKNB 1X5AA 1Q94A 1FZOA 3PDOA 2DWEA 3GM0A 3RY4A 5IEKB 4XNZC 5DLML 1QFWL 5HYEA 2JLLA 3INUH 1DUZA 4N8CL 4TUOB 3VH8A 2FATH 2A73A 4YHIA 3D69A 4UI2A 1RUKL 4ZD3H 4PJXF 5MEPA 5F96H 4MB5A 5F1SA 2B1HL 4PY8I 1QSFE 3X17A 4Y16C 1XIWA 1G7JA 5C9JB 1B6UA 5ANMA 3ILPA 3JTTB 1M6OB 2P24A 4P5TD 2W59A 1OTSD 3EO9L 3QULA 1DBJH 4NRZB 2GJZB 3NCJL 3REWB 2X89D 4UBDD 2XWBB 5C0GB 1CFBA 3ARFC 3FAXA 3X3GL 1T7YA 3V52H 3DI2B 4RRPG 3NCYP 4TTGA 1KTKE 2EE3A 1A47A 4OCWH 4L3EB 1PJ9A 1RU9H 2H26B 1NSNL 3B9KC 1EFXD 3SDCD 5IEKA 4MAUL 2EDOA 5JUEH 1J05B 1NCBH 4GAYB 1U3HA 1IC4L 3RKPA 4PJAB 2VZTA 3WFZA 3ULUF 1RV6X 5I1EH 3FCTA 1MF2L 1S7QA 4WHDA 3DETD 1D9KD 4YHKL 3GMMB 5EN2A 1YYML 2ZG3A 9CGTA 5C9JA 4X9FA 4O51B 4WFFE 3CX5K 4EJ1C 3GIZL 3MRJB 5CLTA 3WS6C 4L8CB 2GJZA 4GJTB 1IC5H 1V05A 3REWA 1I3GL 4D94A 1CU4H 2XWBA 5KZCD 2A6DB 4FQ2H 3QUYC 1VCAA 3SO3C 4KMLB 5FM5O 3V4VH 1JZ3A 4WCYL 2Z8SA 4DVRL 1R3KB 1P4BL 2QQKH 4K3EL 1UWXK 2AERT 4L3EA 5ENWB 3W11D 3DRQA 4IJ3C 3OKLB 3BQUA 4JFOB 4PG2C 1OP3H 2ICWB 4UU9B 3W0WE 5DR5L 1J05A 3KJ4C 4NBYB 3E0GA 3FT4A 5HPOA 3GSQB 4GAYA 4L8BB 1HWGB 1K9TA 3QISA 3GKWL 4XNMA 5CINH 1B0GB 1IGTA 4XC3L 3GMMA 2P46B 2UY7A 3CUPA 3LQAC 4D0CA 2P48B 2XNAB 4U4BA 5IV2B 4J4PD 1I7RB 3QQ9D 4HK0B 2OJZL 3W82A 1JHLL 2PW1B 3MRJA 4HPOL 3I6GA 1UWEH 3VI3E 3U4BH 2A6DA 4G6FD 2RB8A 5F9AC 4ETQB 5BCAA 3UJIL 2WZPD 3TCXA 3B9DA 5DI8B 1FNGA 1TENA 3TJEH 1ORSB 1ZEAL 1VGKB 3DO7B 5ENWA 4UDTA 1UYWL 4WWKC 3OKLA 4KJPD 1XF3A 3ARGB 2ICWA 1RK1B 4PP2A 1YEGH 3MV01 4QOKB 4BQ9A 1CF8L 5ADOL 1HOCB 1M1SA 1KLUA 3JWOL 4KWUA 1WZLA 2B1AH 4D3CH 4R3SA 4P59L 5MENE 3BH9B 2F5BH 4HKZB 5GRYA 2ADFH 2NZIA 1TLKA 4XNUL 1P7HL 4GW5B 1CDBA 1I7RA 3KYMB 3V8CA 5EIVA 2PW1A 1GGUA 1ZSDA 4M7ZB 3OJ2C 2AK4B 4X4ZA 4MX7B 4UOW1 1VFAB 3V6BR 4KI5E 4ETQA 1U8LB 3FB7A 5FM5M 2Y5TA 3LDBC 3PNWB 5C8JB 2AXGA 2HKFH 4AQOA 2DQUH 1VGKA 4AG4H 4EN3C 3DO7A 3O4LB 1MH5A 5EUKB 3PABB 5T1DH 3QCVL 3ZKNC 1A6VH 2VQUA 4DGIL 5KSBB 2D7OA 3HAEB 1RK1A 1KXVC 3ULUD 1KB5B 2KZWA 4HKBA 3TPUA 2Q86B 1KJMA 5TF1H 4OGXL 5IVZB 5BV7B 2K3TA 3BH9A 4U1GB 5JMRA 3UJJL 1F4AA 4HKZA 2VLRA 1WAAE 3IKKA 5K9KA 4GW5A 4Y2DB 5DT1L 4HGKC 1CG9B 4R0LB 3KYMA 3GK8L 4JDVA 1IAKB 5IG7B 2CQVA 4KK8D 3TZVD 1AKJA 1DQJB 3GMQB 5DQJB 1VFAA 3EDKA 4PGEB 7FABL 1U8LA 4O5LL 5C8JA 3S88L 2AJVH 3CNKA 2H3NA 2UUDK 2VC2L 2E8YA 3T8XB 4FFWC 3O4LA 3KYKH 4MA8H 1CDUA 4FOMA 4OAWB 5GISL 3NCYS 2CR6A 2AJYH 4Q9RH 5KSBA 3UDWC 3PGCA 5CEYB 2WUCL 3HAEA 3HE7B 4NN5C 4P2RD 1E4JA 2AV7B 3V95A 5GGSY 1KB5A 4PJ7F 4BK4A 5IROA 4WUUB 1QBMH 2DM2A 3S36L 4KVCL 3N0PB 4DN3H 1J10A 3DTXB 4L9DA 4RX4D 1JPFB 3TA3C 2XG4A 4HH9A 5D93B 3VGFA 3QI9D 4PJGF 4NN6B 4XVUD 2XN9B 2ITDA 5DD1H 2DQDL 4E42A 5I1LB 4U2YA 4XPTL 1F4XH 1I85C 1M4KA 4NBXB 1NGZB 5LBSH 1ROWA 3T04D 4S0SD 1F00I 4PGEA 3S9DB 1K6QL 4PJCF 2VAJA 4KTYA 2PR4L 4DGYL 1UM6H 3T8XA 1S7WB 4NQCD 1ZTXH 2GW5A 3HR5B 4WW2B 2H2SD 3BUTA 4XBEL 1FG2B 1WFOA 4M6NL 3WXWH 5JOPE 3TBVB 1D5ZB 4F15C 4LRNH 4JPIA 5ERWA 4R2GB 3QRGH 3HE7A 4AEIL 2W65B 4X0KB 1DQQA 1QSZA 4G6JL 2Y6SC 1EO8L 1R0AL 4E41E 4XXDA 5D72L 5DK0B 4H20L 1JWUA 5DURB 1G6RB 1RZIB 3MJGX 1OSPH 1MY5A 4J7RA 3PWPA 3DTXA 2F74B 1JPFA 2EYTB 5D7KD 3Q5TA 1P9MA 2QQQA 3EJJX 1SYVB 3HA0A 3ZKXB 4D9LH 4KI5C 1WGOA 5F9OL 3BEWB 5I8OH 1RJCA 4ODTL 4P3DA 5T1KA 4ODWB 4Z7QF 4JKWA 3H3KA 4YDJA 4MYWB 2CDFB 4JM2A 2NY4C 3BKYH 2ZUVA 4AM0B 5HJ3B 2BNQA 1WEJL 3P9WB 1CICD 4ALAH 1S7WA 5JW4R 3HR5A 3OB8A 3VXRE 1R3LB 1DBAL 1FG2A 1A6TB 4UAOB 3TBVA 1A6AB 1D5ZA 2VL5B 4KDVA 5HI5C 1NEUA 1QEWB 2NYYD 2FO1A 1TFHA 5D7IE 4DKAA 2E6QA 2WLYA 1YQVH 5J3HD 5DK0A 1XR8B 5F7YC 4PTTB 1G6RA 1X44A 5C09D 1Q0XL 3T3ME 5BXFB 1T0MB 4Y5YB 5J6HB 3PQYB 2NY6C 3MOAH 5IB3A 2HVKA 3FHAA 1MQKH 4M6OH 3TN0B 3BEWA 3B9KB 3QQ4A 5FFLA 4ODWA 4HK3N 3NIFF 1UM4H 4OZHB 4G9FD 3M1BB 1HHJA 1YN7A 3IXAB 2EDLA 1HH6A 2JIXD 5IVXE 4AM0A 5HJ3A 1IC7H 2VDLH 4LVOB 2OBGA 3QXTA 1SHMA 1R3LA 4C56E 1A6AA 3HMWL 4HMCA 3K7UA 2QQLH 3O3UN 4NOFA 4ZUTA 1QEWA 3BPLC 4PJ8D 1JI2A 4WU7A 4JRYD 1NFDE 4F8TA 2UVEA 4I0PC 2I9TA 2C4FU 3CH8A 4KJWD 2IG2L 5DRXB 4PTTA 1J1PL 3Q6FB 4OQTA 1F3JA 3QFJD 1F2QA 1MPAH 4GAGH 3GEWB 4MMZC 1T0MA 3OKDB 4I18A 5J6HA 3PQYA 4WFEE 5LKNA 3MUY1 5JPMB 3TN0A 3LQAH 4NO5A 1JV5B 4Y5XC 3EOBB 4NCC2 1HSBA 4L5FH 4OZHA 5E6IB 5IJKA 1FL6B 4YHMH 5BVJB 1YJDL 3IXAA 5E4IA 2GTWB 1C12A 2VUYA 3B2UD 1U8OB 3TC9A 4XNXH 4LPTA 1UM5L 1VENA 3P0VL 2ZUYA 4QRPA 4HJJL 3HI1B 2OSLB 3PWUB 3V6FA 1JGEB 2B2XH 1IE5A 2Z0BA 4JHAL 3IDGB 2VKXA 1JGUH 4LHJB 1BQHG 3F5WB 4MAYB 3H7BA 2WBKA 4HD9A 1A6WL 5DRXA 3BXNB 4OF5A 1FRGL 1MRCH 4XCYA 1FG9C 3CVHA 4FXLA 3NIDE 1F6AB 4HSQA 5IESL 3IS1X 1VFBB 3EDJA 4OGAD 3OXRA 5ILTL 3A67L 4LHUB 1I1AC 1XF4B 4OCNC 4WEBH 1AI1L 5BMFL 1JV5A 1KTRL 1WFTA 3EOBA 5DRZB 2VDNH 2QADB 4X99B 4G5ZH 3ZLQC 5BVJA 1QSFB 3QEQB 2R8SL 1U8OA 3BPOC 4JKPL 3TVMB 4KV5F 5I1KL 1H8SA 3KPLB 2DYPB 4HX1B 3FZUC 5L2KB 4FFVC 4P57B 4TSCL 1TVDA 3TIDA 3ARYA 2OSLA 2F8XC 3PWUA 1JGEA 4XPBL 4N8VB 2A6KB 4XXCA 4MAYA 4LFHD 1C08A 1FE8H 1AD0B 1S7UA 1YEEH 3BXNA 1EZVY 2BY3A 1JPTH 3MJ9L 1VDGA 2YWYA 1F6AA 3PL6B 1A6ZB 1VFBA 4LCCC 3UEZA 1BJ1H 1HNFA 1GCFA 3VCLA 4GAJL 2ZZUT 1NGWB 4M3JA 3LKQB 3MLRH 3C09B 3QXAB 4X99A 1EIBA 3ZSTA 1OB1A 2ZPKH 3VFTB 4JO4H 3QEQA 5A40E 1RHFA 3UZQA 3TVMA 4CMHC 2GK0B 1E4XI 3KPLA 2DYPA 4HX1A 5L2KA 5DJ2B 2YK1H 1WUNT 3CSBA 1WQVT 1RZ8B 4BSVB 4MJIE 3FMGL 1TQCC 3BZFB 3ARZA 3PV6A 3HG1D 4RFNC 3P4OB 4N8VA 3JZ7A 1ZS8B 4WI6A 4AQ1B 2A6KA 1N0LA 2X05A 3WHE0 3RGVC 5LCVL 1TJGL 3HC4H 3FQNB 1ZT1B 3HZKB 1LE9B 1IQDB 1K5NA 3QWQB 2ZP0T 5HHQB 5EA0L 4KKBC 3PL6A 1A6ZA 5HVFB 4HKXA 1DFBH 3MV8D 2XXMB 4OLWH 3W0WB 3MLTB 5B38G 3GRWL 4XTRC 1NGWA 2Q76B 4OGYL 2AS5M 5KVFL 1RURL 3QXAA 4MHHG 1NANH 5DD3H 3VFTA 3RIFF 1JRHL 3C5ZC 4NN5B 1F4YH 3ULSA 4PJHA 2UYLB 4Y16D 2L0DA 4F3FB 4NQDD 2VDKL 3CK0L 1C5BH 1BWWA 2DD8H 3MXWL 5DJ2A 5CZVL 1MIMH 2X7LA 1FORL 1ZS8A 3ARFD 2YA1A 4PGCA 4DKFH 1TQBB 5E94B 2JJTC 2UZIH 4XZUB 3QBTB 3FQNA 5CILL 5D6CA 4IHOB 1IQDA 4JFDA 2BOCA 4NUGL 5JW4M 5EFIA 1T83C 4GQ9H 3IAPA 5DYOB 4S1QH 5KJRL 4MQSB 4DWHA 4LAQL 1NDGB 5DVMA 2W0KA 2Q76A 5D6DA 2VLKD 3AM8A 4GBXC 5C0AE 3INUL 5I74C 2FATL 2YD7A 3MYJB 5TQ2L 1MJ7H 5MENB 2UYLA 2VE6A 4ZD3L 1NH6A 5F96L 3RWJB 3DROB 4MVBD 1G7IB 1LDSA 3QXUA 4QRUA 2L4OA 1KJ2L 4MD0B 3WNPA 2HYMA 2DBJA 3L5XL 2FEEI 1VFUA 2R9HC 3U7WH 4Z18A 5LGKA 1DBJL 4Z9KB 4F7MB 4PJBF 2AGJL 3VWKD 1R3JA 4IHOA 5DDHB 4YPJA 1D5IH 4G42B 3TT3H 3I75B 3DMMC 4M9PA 4OCWL 4U6YB 1RU9L 2X1PA 3VXOB 5TQ0L 4IRJC 3SKOB 5D7KE 4PRNB 3B5HA 5JUEL 1NCBL 3KYNB 2H32A 2L7UA 3UBXG 5I15L 2B0SH 4Z7WB 3RWJA 4Q97A 5I1EL 1G7IA 1KPRA 5IHBA 3QRFM 3NPZB 1J86A 1J18A 1I3VA 4MD0A 4KUZL 4JY4B 4MXQD 4HS6A 5DZOA 5GRVK 3MO1A 1TTGA 4ZUSB 4XB8A 5FYJE 2HJKB 1FN4B 1K4DA 4FQ2L 2R1XB 3VFVB 2H45A 4G42A 4K55A 15C8H 3SDXA 3V4VL 5EC1A 5HYJA 4WWKD 5E9DD 2QQKL 4U6YA 4BFEA 2OZ4A 3FO9A 3HPLB 2WANA 3SGDH 3MLSH 3LB6D 3VXOA 3SKOA 5J1SC 1EX0A 5EZIL 5CGTA 3U36B 3ILQC 3CXDH 3SDAC 3OKKA 4Z7WA 4PRHD 2NW3B 5CINL 4GRMB 4O00A 3QPXH 2ZUUA 4HBCL 5JHDE 1UXWB 5C86A 3U0PB 1G9MC 2ESVB 2VXSH 5JNYB 2IPUG 5C0CD 4ZUSA 4P2CG 3VGAC 1UWEL 1PG7X 2NZ9C 3GBLA 1FN4A 4N9OB 3U4BL 1A2YB 4OD2B 2R1XA 3MRHA 4PJ7E 1WTLA 1Z9SA 4MGXA 3T4YB 1AY1H 4I9WE 1B4JH 3UJTH 3TJEL 3ZKND 1UH3A 4W6YB 3EBAA 5FF6A 3HPLA 4G8GE 4FHBD 4PJGE 2X40A 2VDOH 4E41B 5KN5B 1I9EA 3MOQA 3K8KA 4BA8A 4N5ED 3L3JB 1IGCH 4D3CL 2X4QA 5L7XH 1NMAL 2NW3A 3WO3B 4PJCE 4LQFL 2NPLX 1UXWA 4KK6C 5F6IC 3QUZC 1JCKA 2Y72A 2ICEB 2ESVA 2ADFL 5TE6H 2QKIA 5DMKB 5JPNA 3BZEB 5JNYA 5SX5H 2FYYB 4M7JH 1FNEB 2APWA 1YNLH 4YWGL 4PJIA 4AY0A 2MFNA 4QWWD 1RZKC 5B21A 5DMIH 1ND0B 4OD2A 3T4YA 3VXRB 4P23B 4I5BA 1SJEB 3DHMA 3T0DA 4AG4L 3FONB 3EYFA 4QXGH 3WLBA 3NFNA 4JG1L 5T1DL 3C6LD 1QQDB 1A6VL 4E41A 4WUKL 4KTEH 5LAXA 4YHPB 3VFUB 2FEDC 4YHYC 4I0CC 1U8HB 1HEZA 2Y07L 4ZS7H 3BKJL 4J1UB 3TA3D 5TF1L 3V5KB 5DZLA 3MQIA 5DJXA 4NKMA 3L3HA 4W68A 5CJ5A 5EBWB 2EEAA 2E7LC 4KUCF 5DMKA 4LCCB 3BZEA 1FPTL 5D8JH 2B5IC 2RCSH 3MC0A 4NO0D 4WW1B 1ZT7A 5BS0A 2VZ1A 3WFDH 5IVXB 3FRPA 4B7LA 1ND0A 2UY6A 3DUSB 5IHUH 2A74B 4MSWA 3VXRA 1T22B 1MAJA 2AJVL 1SJEA 1RHHB 4CMHB 3FONA 3MCKB 4NP4H 2AXJA 1U8JB 3KYKL 4MA8L 1NFDB 1EFXB 3SDCB 1QQDA 2Y6SD 4FQJH 4Q9RL 1ZHLB 3MNVB 4RFNB 4KJYB 3VFUA 3NIFE 3A0OA 5FCSH 5AAMA 1U8HA 4OFDA 2BSED 5IR1B 1BQLL 4XX1E 4G6KH 2A77H 4HK3J 2NR6C 5IBTH 2CKNA 3PP4H 4TVPH 4F33B 1WISA 1FYTE 5EBWA 3ZHKA 4O9HH 4WGWB 3PG2A 6CGTA 1NCNA 3ZT7A 1MCQA 2AQ1A 2VLJD 1I1FB 1U9KA 4P5TA 4RAHA 4UQ2A 3QUXC 5HYQB 4NT6B 4DVBB 1EFQA 3EOTH 2BRQA 4JPKH 4RSVA 5IVXA 4NC2B 4TPRH 4K3DL 2X89A 5LBSL 3DUSA 2A74A 4WIQA 5F7FA 2WBJC 1T22A 3M17B 3CFEB 1KCVL 3UTTE 1I1YA 1T4KB 2P43B 2OXGA 3I6KB 2AJ3B 1UM6L 1ZTXL 3SGEH 3L3GB 3MV7D 1U8JA 1LD9B 3QEGL 1T20B 5C07E 1WICA 3VRIA 1EFXA 1DQLH 3SDCA 2ZUSA 4LRNL 1LO5A 3FRUB 1QFPA 3QRGL 3AS1A 1CIDA 5F88B 3OX8B 5F9JB 4J3UA 3SE9H 4APQD 5I76B 2NY2D 1GIGL 1L7IH 2RHEA 4YUEH 3MOBH 1A4JA 3S7GA 5INCA 1D9KA 2ZUXA 1FZMB 1KTLB 2VN7A 3GMLA 3PF2A 3U0TB 2IQAA 1RUQH 4JZJB 1XCTB 1T1WA 4LMQI 4HGWB 4D9LL 5L2JB 1I1FA 3ESUF 5I0DA 5HYQA 2FHCA 5GGSB 4NT6A 5I8OL 4K2UH 3RL2B 2R1WB 2KKQA 1OVZA 4M9OA 4IRSD 1J8KA 3TCLB 3N1MC 4HWBA 1HQ4A 2R23B 3H9SE 4G6FB 4HG4K 5C2UB 3I02B 2X9YA 1KIUA 3BRGC 3BKYL 4HUNB 5BOZG 1C16A 1T4KA 2ZCLL 2AJ3A 3O8XD 3L3GA 5HGGS 5BZDB 4NYLB 2CIKB 2C9AA 2M8XA 3P9LB 4I0PD 2HJFA 3WIHL 4JHZA 3O2VH 4X7FC 3OX8A 3MR9A 2VQ1B 5F9JA 1OP9A 5ESQB 2OLDA 3LKOB 3F65A 1OTTD 3D0LA 2Q7NA 4CU6A 5E8EB 1TJHL 4PD4J 1T2JA 4KUCD 1FZMA 1KTLA 3U0TA 4JZJA 5HDBF 3FJTA 4HGWA 4K8RD 4X9GA 5KVDH 1MQKL 1A3LH 4M6OL 3FQXA 4J4PA 3WIIH 2NXZB 1IGFH 3QP3A 4EQ3A 4PB9H 1UM4L 4JFHD 3TCLA 2E8ZA 2R23A 3VMNA 2R2HB 3RIAF 3DXAD 3IRZA 3CX2A 4K94L 1AGDA 1MCSA 1EXUA 4WHTB 4X5XB 2ZCHH 1IC7L 4MJIB 2VDLL 1OGAD 4HGMA 2VNCA 2YUXA 2GHWB 3MRGA 5BZDA 2YUZA 1ZWIB 2CIKA 2EH8L 4OI9A 2CMRH 5DVLA 2QQLL 1VKXB 1QFUH 3MJ9A 5MHSE 3WJJA 1DDHB 1AQKH 1LVEA 3L7FB 4PJXA 5FK9A 3KPQB 1UJ3B 3I2CH 2VQ1A 4F37F 1BZ9A 3GJEB 5ESQA 5DJAA 1N3NA 3LKOA 2D7TH 5KVGH 4OIAA 1WWCA 2HFEB 2V6HA 2UZXB 4KAQH 3AFLA 1CCZA 1EJOL 2HLAB 4M02A 1MPAL 3B43A 3BGFC 4GAGL 3AMLA 1MCIA 1G9MH 1XMWA 3LQAL 3T0EE 4L5FL 5F72S 4ZTOH 3TZVB 2HG5B 5EO0B 1NEZG 2ENYA 1FL5A 4MCYB 4XNXL 3UTQB 3GUTB 2PTTB 3C5SB 2C3VA 3O3DB 2F19H 2CLVB 3DX7B 1I7TA 2A9NH 5I16B 4XMKH 5C0ND 1VKXA 2P7TB 4I1NB 4OV5B 1JGUL 1YPZF 4X98B 5E56A 4XP4H 4P4KD 32C2A 4JVPA 1NCCH 2MHAA 4S1DD 5A3ID 1N0XH 5IIEB 1MRCL 4L8SB 2VAAA 3IKCB 2X4TA 4PRPD 4P3WA 2AI0H 4DTGH 1P1ZB 4R90L 4XVJL 5I2IB 4PRHE 2EIBA 4ORZC 3QI9B 3PHOA 3CLEH 4DKDC 4QT5B 5E6ZA 5JXED 1IAII 1ZA3B 3MLYH 4U6XB 2LTQB 5DS8B 2VDNL 1WITA 4ONGL 2WUBH 5ELIA 5C0CE 3TPKA 4G5ZL 3TZVA 3VD9A 3QQNA 3QWRD 5CZXD 3ES6B 5F7KC 2HG5A 4Y4FC 5A2IH 1G0DA 1RZKH 3GMPB 4MCYA 2AEQH 2GY7B 2PTTA 3C5SA 3O3DA 3L3IB 2CLVA 3GJFK 2A6JB 3DX7A 4NQCB 5H37H 3WN5B 1CD0A 5F6IB 2BVQB 3MBEC 5I16A 2AKRB 1EH9A 1KBGH 1DJSA 3RGVD 5D1ZD 2ADGA 4P2RA 4L4VD 3VFRB 4JGMA 4NZTL 1KCUH 1U8KA 3FO2A 3RZWA 2ZUQC 1X5GA 4BQCA 3IU4H 5HYSB 4KKBD 4YXHH 3WBDA 5F3BA 1I8LC 1XAUA 2X4NA 4H1LB 2JCCE 3IKCA 2R0KH 1P1ZA 5KVEH 4JZNB 3S37H 4RX4A 4UDUA 3WDHA 2P49B 3BGAA 1TMCB 3QI9A 4JZOA 1P4IH 3AU1B 4PJEF 4QT5A 4Q0XH 1DSFH 1ZA3A 3PWVB 1QRNE 4U6XA 5FYJH 1S9YB 2ZPKL 4JO4L 1KJ2A 4R97C 3RKDC 1MCDA 1FDLH 1XGTB 4M1CC 5D7JD 3WNKA 3BFOA 4DN4H 3L3IA 1CICB 3CFCL 1NDMB 3SCMB 4NQCA 2A6JA 4JHWH 3WN5A 3HPJB 1MEXH 2BVQA 5JXAH 3EDEA 2X09A 1A8JH 2HVJA 2BY1A 3GSUA 3QNYB 3MYZA 3VFRA 3NFPB 2BRRH 3MCLH 3HC4L 5HYSA 4F7EB 3C60A 3UZEA 4TOYH 1FFNB 4BSJA 4H1LA 4KRMB 5FYKH 3S6CA 4NIKB 5C09B 3T0EC 2AP2A 4P2OC 4CU8A 3QYCA 5B3NA 3AU1A 2FLBT 4OLWL 5D2NE 4ENEC 3PWVA 1EBAA 4TRPH 5AG9A 4HT1H 5FDWB 1DBKH 1F6LL 1S9YA 2LABA 3MRMB 4HIIB 5HVWA 2EYSB 4GRWE 5DD3L 3MNWB 4G9FB 4RFOH 1H5BB 1F4YL 2BVOB 5JHDB 1XGTA 3DIFB 2UWEF 3QXVA 3EYUH 2JIXB 3SEPA 1EUUA 3BPNC 5SV3A 1RMFL 3Q6GH 1C5BL 1CICA 1NDMA 1BGXH 2G5RA 4JN1H 4N0YH 2DD8L 3HPJA 3BYYA 3TBYB 4XNYL 3HI6H 5DF0A 1WWBX 4GLRH 2XKNB 3QNYA 4PJ7B 1T6WA 3CIQA 3NFPA 1MCPH 2Q20A 3NTCL 3B5GA 4DKFL 5D70L 2VLLB 4DAGL 3NZ8B 2NXYC 2DAVA 3MODL 2UZIL 2P5ED 4HLZG 1W0WB 3O2DH 1KUMA 4H0HB 4UOW0 2YSSA 3X13B 1BVKB 2Z35A 4GQ9L 5F7DB 5C09A 4S1QL 3TBWA 4PJGB 2Z8WC 1KTDB 5EZOH 3HZYB 3O9WD 1BJMA 5SWZE 1KGCE 3TH3T 3RDTC 4ZXBC 2GUOB 1X4ZA 1F11A 4XRCB 5ACZB 5FDWA 1IGML 2MWCA 2P4AB 4YDLC 1P5VA 2VITA 3MRMA 2EYSA 3MRCA 4HIIA 1WLHA 3MNWA 4G9FA 2EZ0C 3H3PH 3HMXA 4PJCB 4CMMB 2BVOA 1MJ7L 4N8PA 5E2TH 5T3XE 1SMOA 2JIXA 1OHQA 4OTXH 1QSEE 1ZLWH 4L3CB 2P45B 3SE8L 3X11B 1NBYB 2J6EH 1QOKA 3BVNB 3U7WL 3MV7E 4PJ8A 1D7FA 4JRYA 5HD8D 3UAJC 1DCLA 2VLLA 3NZ8A 2RFXA 1W0WA 4YQXH 5TJWK 3S36X 3TNMB 3CDGA 4Y4KC 3X13A 4IEFB 1BVKA 1PYWB 4G7YH 3QFJA 1K4CA 1WT5C 1XCQB 5CAYB 3HS0B 4O2CB 3CGTA 3HZYA 2I26N 1UJTA 1NUDA 4ZFOB 2NW2A 5DEGA 2GUOA 5ACZA 1Q8MA 4U0RC 3SGKA 5T3ZD 1KYOK 4CVZB 4XPFH 4CMMA 4DJMA 4G6MH 5CEZE 5CIPB 3MRFA 4EI5B 3CFBB 2HLFD 3QIBC 3OR7B 4NRXB 1ZOXA 5DMYA 3P4NB 1CD1B 2E9WA 1MWAB 5FYLD 3SO5A 2VJXA 1G7LB 1UA6L 2FB4L 3E8UH 3ARTA 3WYRA 1BM3H 1FVEB 4UNUA 4JAMB 2EDEA 3GI8H 3QJFA 3P4LA 2WINB 1PQZA 4KK9D 3SGJA 3VW3H 4WVRA 4ISVB 1T21A 1ZLVH 3TNMA 5D2NC 4FFYL 4OLZH 1PYWA 4D0BB 4GXVH 2A83B 3HS0A 4LNRB 4TNWK 3D0VB 4ZFOA 4BKLA 3DSFH 4GRLA 4IOFD 4JPWH 1A1MB 2CUIA 4LVEA 4XCCH 4CVZA 3LH2H 3QB7C 4K8RL 5CIPA 1MVFA 5C0BD 4JFHE 1R6VA 1MUJB 2CO7B 4GS7C 3RWCB 2OR9H 5GGVL 3OR7A 3IU3A 4NRXA 1MI5D 2X1WL 4JDZA 1CFVH 3BGFB 4GW4A 1CD1A 1MWAA 3G5XB 4JFXB 1G7LA 4MJ6B 1XGUB 4QTIL 3S4SG 4N9GA 4PRBB 2AJXL 4JAMA 3FN0H 3QDHA 1GXEA 4HKJB 2WINA 2F9BT 3C5JA 5I1AB 3J7HA 5SWSD 3EYSH 4NZUH 4ISVA 4KMQA 1OQOA 1T1XA 4JO3H 5D5MF 5TPWH 4BSWB 5C0EB 4N5UA 3GB7B 3RUGE 1AY1L 1HSAB 1B4JL 3UJTL 5C07B 2A83A 2AV1A 2OTUB 4F58H 3TJHC 1C1EH 4L3AA 3WCYA 3HLAB 4KROD 5LJYH 1U93A 2E5EA 3MZTA 4X7CC 2VDOL 3W39A 2FEDD 2NY3C 2R0LL 5C70A 5IQ9B 5DJDB 1LQSR 2EE9A 4FZEH 3MXVH 1N26A 5L7XL 4NQDB 3EYOB 1MUJA 4MA7H 3RWCA 4MDIA 1ZKAA 4OKDA 4F8QA 3OSKA 1I7ZB 3MA7B 4I77L 2X44D 2X1XR 5TE6L 3G5XA 5B39A 1S7RA 3X3FL 3H9SB 3CVIL 3HG1A 2N4IA 4PJFE 4PRBA 4M7JL 4HKJA 3EJZC 5I1AA 4NDMB 1CVRA 4ZFZA 5DMIL 4BSWA 5C0EA 4M1GH 3T08A 5HVHB 4YDVB 3GB7A 4NZRL 4ZFGH 2WBWB 1CLCA 2R0ZH 2OTUA 5J0BA 3HLAA 2EXWC 3MV8A 4HPYH 4QXGL 5FKPB 3DI3B 4DOHB 2BHUA 1BMGA 3DGGA 1UACH 4OCSL 2VLKB 4GMSH 3OKMB 1KCRH 3OF6D 5TFSL 3TYFA 4QNPF 3RY5A 4KTEL 1I4FB 2C1PB 4L9LB 3DVNB 4ZS7L 4Y16A 4NQDA 3KYOB 3EYVB 3O81A 3T2PA 4B41A 4UZGA 2MQCA 3MA7A 3QUXD 4ZAKC 4LKCB 3SPVB 1DL7L 1X5IA 5K9JH 4QYOB 5D8JL 2RCSL 4HV8B 4MWFB 4BFGA 3ARFA 5I75C 5KS9F 3FT2A 2WBJD 3KJ6H 5DGQA 4NDMA 2IF7A 4WNQB 3VWKB 4BZ2H 2ORBH 3QZWG 5IHUL 1DQTA 4YDVA 3D3VE 4NBZB 4JLRB 3ELAT 3WIHA 4KQ4L 4W6WB 1CXEA 2FBOJ 5FKPA 4NP4L 5HDBE 3IDMB 4Z7UE 2VLKA 5DK2A 3OKMA 1JWSA 5IHZA 2E6PA 3M8OH 1HXMB 4UIKL 4QRRD 1A14H 3MV9E 2E7MA 5DJ8B 3RJDA 2XA8H 4ZSOA 4G6KL 1KFAH 3ARBD 2A77L 5IBTL 3EYVA 2V17L 3I6LD 2JJUA 3Q0HA 1ZHBB 1MJUH 3DJ9A 3PP4L 4TVPL 1A7OH 5DMGC 3BD5A 2UUDH 3T0EB 2YPVL 5EU5B 4PJDE 4O9HL 1MCHA 4P2OB 4QYOA 4HV8A 4MWFA 2D9QB 3WDIA 3HRZB 3EOTL 4JPKL 5F9WB 4WNQA 3RY6C 3LRHA 3VWKA 4PY7B 5HY9B 5D7SH 1RD6A 4P46C 2G75A 4HLJA 4RGMC 3MSPA 2ENSA 5HHXH 2IBZX 4X4YB 4JREB 1ZVSB 3O6FC 4O58L 4G7VH 4NRYB 3G5VB 3IDMA 3IDIA 1UGNA 4N90D 4LSSL 1ORQB 1U8IA 4GUPB 3TFKC 4DCQB 2NXYB 5FUZH 2DMKA 4PRHB 5B4MC 3UTZB 4G9DA 4YUEL 3MOBL 4JFED 5CSBA 4HWZB 4XHJD 3G5ZB 5DJCB 4PJ5E 1ZVHA 1OAUH 5EU5A 1NKOA 4K71B 1AP2A 5C0CB 4JQVC 3RDTB 4ZXBB 5J1TC 4K2UL 3HRZA 1JUFA 4KTDH 3ZYJA 1YPZE 1EAJA 5HY9A 4P4RB 2CGRH 4HFUH 1X7QB 2I9LB 3NIGF 3RBSA 4Y5VC 2IQ9H 3UCRA 3G6JF 1KLFA 1NL0H 4LVHB 4WWKA 5E4EC 5E9DA 3TO2B 5B8CB 1OTUC 2E9IA 4NWTL 4NRYA 2I5YH 2P44B 3IDNA 4TSBL 2PCPB 5D96C 4GG6F 4IM8A 4OM0H 2X42A 2CH8A 1EEUA 1ORQA 3O2VL 4GUPA 3FB8B 3U79A 5AEAA 4RFEB 1A21A 1EV2E 3IS0X 4PRHA 2MQ0A 1G7QB 1JMXA 2G5BB 3G5ZA 5DJCA 4Y4KB 3OQ3B 3K2UL 1RZGB 3LPFA 2EDHA 3RWGB 5C0CA 1N6VA 3LOWA 4HUUB 3WIIL 4PJBB 4BH8B 4U0RB 4PB9L 5TDNB 2CRZA 1J87A 4P4RA 4X6DE 1X7QA 2I9LA 4G8IB 4M6MH 1A0QL 3LPWA 3ZKQD 3TO2A 2ZCHL 4JCMA 2HTKC 2MCPH 1INEH 4N0RA 3IDJB 5CJQH 2PCPA 1RIVH 4GRWH 1IQWH 1QFUL 4AENB 3VFSB 3IJSB 1AQKL 2ZUWA 3FB8A 5LG1A 4XBPB 4RFEA 1ZMYA 2PF6A 4K7PL 1EEQA 3IT8D 5KVGL 1G7QA 1NC2D 2CDEB 2LU4A 5T3ZL 2ZKHH 4KAQL 2DI7A 4G8EB 1VACA 3GHBH 1RZGA 5EO1B 5GJTH 2FO4A 1LP9F 4WRLA 4M3KB 1BFOA 3RWGA 2GY5A 3MRRB 4NO0B 4HUVB 1G9ML 1FC1A 4PJBA 2D9CA 4TNWF 3LKRA 4AMKH 3TH4T 2K1MA 3WUWG 4BH8A 5JDJA 4AEHL 2EO1A 5TDNA 5ICZB 3LIZL 5GGRA 5HYIA 4F9LC 5J11B 3RTQC 4KGLA 2ED8A 2F19L 2A9NL 3IDJA 3C6LA 4V2CB 4XMKL 5DRWA 1J8HD 2NY5C 1QR1B 1OM3H 2P8PB 3VFSA 3IJSA 4I3RH 2DTMH 5KSAD 5ICXA 4XBPA 5T3XH 1D6VH 1CXFA 3V6ZA 4LBEB 4OQ1A 4PGBB 4XP4L 2ATPB 4LPWA 1NCCL 3O11B 1N0XL 3TA3A 3AXLA 1QFWM 3QDJE 5SWZB 4DTGL 2AI0L 4OCRH 2ZUTA 4NQVA 3HC0A 4G8EA 3O45A 3JXAA 2EDBA 1BEYH 1OWWA 2NY7H 3IYLW 4NCDA 4LNVA 3CLEL 2ARJB 2Q3AA 2VLJB 4PRIE 3SDDC 3KXFE 3MLYL 3IDXH 4X8JB 3RKDD 2I07A 2WUBL 5ICZA 3L3KA 1A7BA 4K23L 1FJ1B 1JF6A 5SWQB 1KJ3H 1QYGH 5C9KA 2ICCA 2FH6A 2AEQL 3I50L 3UO1H 1K3ZA 3H9YA 3MV7B 3G04A 2G2RA 3ZTNH 2LVEA 3VXQB 1JIBA 1MFAH 1KBGL 4AZ8A 2P8PA 3OAZH 2XFXB 2JK5B 2VABA 1FNSH 1A3QA 5CEZH 2BMKB 1KCUL 4JFQB 3W81A 1H15B 3IU4L 2ATPA 2FLRT 5IMOB 2NY2B 4YGAB 3O11A 1DVFC 4YXKH 2BNRD 2BVUA 4PJ9C 5IFHH 1T89A 3LRSB 4U7KA 3IB4A 3LN5B 4MDJA 4Q0XL 2VLJA 3CSPA 4HCRA 4XI5C 3ULVE 4IRSB 3IFOA 3ZO0A 5I8CB 1FJ1A 5HHOD 5BQ7B 1JNHA 1B4RA 1E27A 1A3RH 1FQ9C 5SWQA 1I9IH 4DN4L 4OF3A 3O8XB 5CKAA 4JHWL 4YNYB 1KENH 1T5XB 3VXQA 4YC2B 2P1YA 5DFWH 4U3XA 3EZ8A 5D7LD 1VPOH 1AR1C 4OD3L 2BRRL 3MCLL 4JFQA 3VE0B 1H15A 1MJ8H 5I75B 4JN2A 4P99A 4APQA 5IMOA 1EJ6A 4TOYL 3HE6C 2YKLH 1QBAA 1QNZH 2CPCA 3L3OA 2RBLA 1DN2A 3P0GB 4NWUL 5FYKL 4JQXC 3VXSE 1NGPL 2Z91B 1A9BB 3BP6A 3HNSL 2BVTA 3VGDA 2P8MA 1WFUA 3VXUE 1ZE3C 2DLFH 3LRSA 1E4KC 2AEWA 1HHKA 5J7CC 4ZOEA 2HMIC 4TRPL 2W60A 1DBKL 4U6VH 1O0VA 4IRSA 1JTTA 2H1PL 5BQ7A 4CW1B 3DXAB 1KCKA 3EYUL 3Q6GL 5EWIH 2ZG2A 1X5FA 1JNNH 3O8XA 1OGAB 1WVZA 1FZKB 5CLWA 4JN1L 4N0YL 4ZYKB 5CEXA 3ZDXE 3HI6L 3P30H 2A1WH 2BOBA 2ZWLT 4I0PA 1C8PA 1N5YL 3CZJA 3VE0A 2N7AA 3RUGB 5GIRA 3U6RB 3OKNB 1H3XA 1LO0H 3DVFA 5GS0D 4U1MB 5A2JH 1A9BA 3QIUD 1ZGLM 5EU4B 3VFNB 1BPVA 3KHOA 5EZOL 4JB9H 3KPRE 4OZGE 3ZTJH 2GAZB 1B0RB 3I6LE 1XH3B 3O6FB 1F45A 2FDBP 4OLUL 1TNMA 4XNQB 4CW1A 3DXAA 3TYGH 3QIBD 5E2TL 5D5ME 4LRIA 1U3HD 2BFVH 4W4OA 5GZOC 5JIIA 3FQUB 1CS6A 1F97A 1OGAA 5C0IB 1JGVH 1QHPA 1X5KA 3IDYC 3SKJH 3VXMD 1FAIL 1ZLUH 4CJ0A 4LARH 4FQLH 2EO9A 1N64L 4LSPH 1WZMA 2EDYA 4FQQB 1Q9OB 3B9VA 2BC4A 3HCVB 5GJSH 3OKNA 4P4KB 4YQXL 3WE6B 3U48A 4PRPB 2CJUH 5EU4A 3VFNA 4Y1AD 5EU3B 5F7EH 5IB4A 3ULVC 2C26A 1B0RA 3FQRB 1XH3A 1HINH 1NCDH 3D1MC 1Q9WB 5D96B 3RZCD 4LVNB 3CFDB 3GHEH 2HKHL 1Y6MR 1W8OA 4XPFL 5GGTA 4G6ML 3G6AB 5JA8B 3SQBA 5MI0C 5TF0A 1H9VA 2R15A 5EC2B 3OXSB 5IMLB 5CSGA 2XRAH 5IMKA 1NFIB 1MNUH 4RAUB 3E8UL 5D1ZB 3E6HB 1BM3L 2VXTH 4YHOH 5J89A 1Q9OA 3D3VB 3VW3L 3OAYK 4P4KA 4IS6A 1LK2A 3ZE2F 3EJYC 3DO3A 3WE6A 5D9SB 1H8OA 4PRPA 5JW5B 5J12B 4GXVL 5EU3A 2V2TB 5GZNC 2CR3A 4NZJA 3OV6A 5F8QC 2NY3D 4ZPVB 3FQRA 1UB6A 3DSFL 3D39E 3EO1B 5JXEA 3V4PH 1U2CA 1LO4H 1Q9WA 2YPLE 3SOBH 1Q0YH 2Y23A 2IPKA 4R7DB 3CFDA 4PP1C 3QWRA 1YY9D 5IBUB 4EVNB 1RJLB 3L5WA 4RWYL 3G6AA 3A6CL 4U05A 5JOFA 5KAQG 3PJSB 3EHBD 3GI9H 1G7MB 4JFPB 4ZOAA 2OR9L 4NZDA 4HXBH 4B50A 4JFZL 4YDIL 3BIKB 3QDGD 1KB9J 3GSNL 1CFVL 1NGXA 5HGDB 5KSUA 3RGVA 2XACC 5D1ZA 5K9QG 1QA9B 5FDYA 4L4VA 3R1GL 4EUPB 1A7QH 3QJHB 1R24B 4NZUL 4M4PA 4NFBA 4JO3L 4HHAB 5E2WL 1CXHA 3KNBB 3NA4A 5D9SA 3RTQB 5JW5A 2R4SH 4BH7B 1MHEA 2Y5EA 4M93B 1C1EL 1Q9KB 5FGRA 2YPKB 5KTEH 4URTB 2VUOA 3QA3B 1NBZA 3EO1A 5DHVH 1X5XA 1LEGB 2DLIA 1PAMA 4QCIB 1DZBA 3OTTA 1ZA6A 3LMJL 2BK8A 3ZT6A 3RVXD 5BW7C 1T04B 4FZEL 4HEME 4EVNA 2C5DC 5D7JA 3LQZA 3A6BH 3PJSA 3QNXB 4MNHB 1G7MA 4HMEA 4MA7L 3L1OH 5GS1B 4WEMB 2WNGA 3P40A 2HFTA 2FJFA 3BIKA 1W72H 1DLHB 5DHVB 1KEGH 4ZUWB 5H35B 1JYWA 1YPZB 2BDNH 5ESAB 5IB2B 3CZFB 1PKQE 4EUPA 3QJHA 4LHUG 4HZAA 4LASH 2P5EB 5ITFA 4HHAA 4M1GL 4Y4HC 1P84K 2D2OA 3KNBA 4P5MB 3TIEB 1F5WA 1KC5L 4ZFGL 2XKUA 3QR2A 2ZNXA 1S7TB 3C08L 4GBXA 3O9WB 1Q9KA 4HPYL 4V1DD 5HHMD 2UV3A 4RGND 3QA3A 3DX8B 1T2QH 5HGAB 2YD3A 1UACL 1LEGA 4GMSL 1KCRL 1FL3B 1B3JA 2GJ6D 2Y7QB 1ZGLP 1TVHA 5C0DB 2YXFA 3U82B 4KXZH 2XQYG 2F15A 5DMGD 3AS2A 1YMMD 4KY1H 1YEHH 5F7NC 4MLIA 5GS1A 1KT2B 3G6JE 3CPLA 4QY8B 5DC9B 3RWFB 2EEBA 2V2XA 3ZMRA 5K9JL 1NMCB 1YPZA 2PN5A 5IB2A 3CZFA 1UB5B 3JVGC 4GG6E 1CL7L 4CNIB 1T03H 4MMXC 2P5EA 5EZJB 2X9WA 4BZ2L 3PWLB 3O3BB 4KDTA 4KKNA 1GL4B 3GO1L 1JYXA 4CAGA 3MUZ1 4PJEB 1S7TA 3O9WA 2YA0A 1Z9LA 2BNRE 3OPZH 3DX8A 5HGAA 5ID1B 4XAKE 4OFYD 4CKVX 2APBA 3ZYOA 4QLRA 1FL3A 2DMBA 2Y7QA 1DP0A 2M2DA 5DEZA 3PHSA 3LRGA 4KFZC 4QRSB 1P6FA 1T1YB 4OCXH 5C0DA 2IADA 1A14L 2I27N 3U30B 2XA8L 5JDSB 4R7NB 3QUMB 2OMNA 3D9AH 4OCMC 1SY6A 1HZHL 3E2HC 3HE6B 1KT2A 4POZC 1MJUL 4QY8A 2Z31C 3HHRB 4Y19E 5F7WC 5GS3A 3KPNA 2GFBB 1AJ7H 4WFGD 3PWNB 5GQBA 5CBEB 5DSCB 4OJFL 4HJGB 2Y25A 5IOPB 4LCWA 4CNIA 4EXKA 4OT1L 5EZJA 3PWLA 2DI8A 5HHXL 4PJEA 2JF1A 4XMPH 2BNQD 2FGZA 2IGFH 3FQWB 5HXMA 5ID1A 1LP9E 4NO2B 4UB0H 2UVFA 1FH5L 2YXMA 4QRSA 1T1YA 2UWEB 3QDJB 3VD5A 5JDSA 1M05A 3QUMA 4YK4C 4HUXB 4Z5RB 3U2SB 4YDKL 3RA7H 4PRIB 3D5OF 3KXFB 1MI5B 1FZJA 4NJAH 3T3PE 2GFBA 2DI9A 4WI8A 5EG6C 1IT9H 4DEPB 3PWNA 5DSCA 5CBEA 4HJGA 4X83A 3FQTA 1FCGA 4TULH 1KJVB 5IFAL 1QKZL 1VB9A 4KTDL 5SWSB 4YHNB 3N1QC 1JN6A 3S5LA 4WO4C 2CGRL 4HFUL 5ANME 4K3JH 2IQ9L 1Z0NA 4I3SH 4TUKH 2ITCB 4KROB 4KVNH 3FQWA 1BJ8A 3AC0A 4NO2A 3ULVH 1CE1H 4FP8H 4OM0L 5HI4D 3HFML 2UWEA 4WI7A 2VDMH 3FOLB 4XWOC 1II4E 2DTSA 4IDJH 5IFJB 5C0BA 1JHKL 2V5RA 1EO5A 3RX5A 4HIEB 1URLA 2J8OA 1U6AL 1IZJA 1MI5A 1CL7I 3ZDZF 1MFCH 5DJZA 4NM4H 3WNOA 4NQSA 1I3RA 5I17B 4XVTH 3REVB 3VXME 2PO6C 2EDRA 5SWSA 1Z5LB 5DWUH 1QLFA 4POUB 1DE4B 1AGCA 4M6ML 2EIEA 3AY4C 2IAMD 4EIZC 2W9EH 3G5YB 2ITCA 4W6XB 4YH6A 1INEL 5FM8A 2MCPL 4NGHH 1RIVL 4HMDA 1IQWL 5J13B 1D6EB 4RRPA 3QO1B 4ZDHA 1VEOA 2PXYD 3LN9A 3VXSB 4LCIL 3FOLA 5CZKA 3STLB 2EDWA 5GS2H 4JO2L 5IFJA 4HIEA 4FRWA 2ZKHL 4MS8D 5EBMB 1NCWH 4CRPA 5C08D 4ONOA 2GT9B 5I17A 1T5WA 4AMKL 2Q1EA 3SE4A 4M8QB 1EGJL 4DUXA 1IGJA 5JZ7C 1Z5LA 5DD0L 5ITBH 1UWGL 3MRLB 1DE4A 3VJ6B 3V5DA 5I6XB 1BX2B 4LCUA 5D1XD 2DM7A 3BHBB 1LHZA 4OIIH 5K9OB 1LEKB 5DHYB 2VZ3A 5FKAB 3BUYB 2VB5A 3KG5A 5CUSH 3TNNB 3OF6A 1OM3L 1BOGA 3BDYH 3QO1A 4O2FB 3MLUH 1JE6A 3O41B 3UTSD 1XGRB 2CIIA 3STLA 4J12A 2A0LD 2NY0C 4QHMB 4OZGB 5FM4A 3C8HA 4OCRL 4YE4L 5EBMA 4HC1A 3CXHK 3B3IB 4ODHH 3QUXA 2NY7L 5HTSA 4XI5D 1XIWC 3BEVB 2GT9A 3N85L 1AFVH 1ZT4B 3QDGE 3FB5A 4M8QA 4Y0GA 5D5MB 1AHWC 2WBJA 2I24N 3MRLA 3IFLL 3U1SH 4LAJH 1FLRL 1QP1A 5ESVB 4NCC1 1QYGL 1D5BB 4X4XA 4PYGA 1BBJB 5I1CL 3VXTB 5K9OA 4CU7A 1AGEA 1LEKA 3QCUH 5EDXA 5FKAA 5I1JH 3GIVB 1AR1D 3EYQC 5J57B 3D48R 1MFAL 1SEQH 4FG6C 4O2FA 1FNSL 5CEZL 4QRRA 5IBLC 5EULV 1XGRA 3AROA 5BO1H 1HIMH 1TZGH 2H6PB 3HNTH 4JG0H 3ARBA 5E8DL 4DFIA 4XPGH 5HHPB 4YXKL 5L6YH 3E6FB 4PGZA 4UUJB 4NQXA 4LGPB 4WU5A 5DK3A 4NQUA 1AH1A 2X4UA 4FQ1L 1CE6B 3DSNA 1C5DB 2YC1A 4YZFE 3BEVA 1FO0L 2FSEB 4EIGB 4O4YH 1QUNA 1ZT4A 5FO7A 2FL5B 4UV4H 5D5MA 5AZEH 4X8XA 2VLRE 4HWNA 4EDWH 5A2KH 1A3RL 4DUWA 1D5BA 2VLME 1BJ1J 1BBJA 3G6DH 2V7HA 3JV0A 5F21B 5KSVB 3GJFB 1U42A 1HE7A 1KENL 4ONFH 5E95B 3GDBA 2I25N 4L8DA 4M00A 2OX5A 4RA0C 3VGBA 1TIUA 4ODUB 1OAZL 1VPOL 2XWJB 3T09A 5JO5A 1NBVH 4C4KT 5LGJB 2GJ6E 3R0NA 4P2QD 2CUMA 2WIIA 2YKLL 4JFEA 1QNZL 5HHPA 5E5RB 1JNLH 5CP3H 1SQ2N 4UUJA 5F89B 2ZOKB 4MHHI 1CE6A 2SEBB 1MOEA 1P69B 2YPLB 3VFWB 5LXGH 5JR1H 1GPOH 2IEPA 2ATKA 1MFEH 5F7LB 2P8LB 1Z3GH 2W92A 1N7MH 3LSOA 1L7TH 4U6VL 2XZZA 3VRJB 3QG7H 2XZQH 1UQSB 4NQED 4W70A 1M7DB 1J0YA 4MCZB 2QSVA 1YMHB 2FBJH 3FO0H 3ZE2E 1UH2A 2F53D 3K1KC 1ES0A 4MD5A 1IJ9A 5EWIL 5KSVA 2FZ3A 3E2HB 4D8PA 1TTFA 5INDA 4DZBB 3GJFA 3GBML 3IFNH 3ZSSA 2A2QT 2K9UA 5C7XL 5DC4B 1L0QA 2EKSA 4LF3B 4Y89A 2B8OT 2YOCA 5ECJE 3P30L 4P5KB 4F2MA 4UV7H 2XWJA 1AE6H 3BE1L 2J8UA 3FFCD 5ETUB 5ACMA 3RX8A 5FHBH 4U31A 1LO0L 4YXLL 2GSIA 2HFFA 1CQKA 1UZ8A 4PJIF 4G43A 4F9PC 2QTEA 2ZOKA 1JWMB 4JB9L 2SEBA 4FQHA 3VFWA 3VWJD 1NLBL 3DVGA 5KS9A 2NLJB 4PG9B 4AH2A 1YEFL 5EPMB 5HGBB 4LKXB 5B3JF 3PWPE 3VRJA 2YMXL 4RQQB 4QXUH 1M7DA 4MCZA 3GSNA 4D9QD 3U7YH 4Z7VF 1P53A 2WW8A 3WNMA 2IBBA 5FGBA 1WIPA 5ICYA 2QBWA 3M45A 3L9RB 1DBBH 5CCKH 4EEEA 1I1RA 4DZBA 3SKJL 5J06A 2CLZB 4IOIB 1K8DB 2CSPA 4LARL 4WI5A 3C8KB 3VDAA 4DK6A 4IRZL 4FQLL 4P5KA 2BNQE 4OF0A 4DZ8A 1S7SB 1MCRA 2RJMA 3ARGC 3S35L 4LSPL 5KSAB 5ETUA 1DUYB 2APVA 3BDBA 3PHQB 3W2DH 3HUJF 2DQJH 1NC2A 2C3XA 4JRWA 2CJUL 4JQIL 3BGMA 4Q6IA 8FABB 4WDIA 4EKXA 2FIKA 1NAMH 4PV8A 1VADA 4H5SA 2YD8A 3UBXI 2R2CA 1NCDL 4G80A 4LKXA 5DEFB 3T65B 5BZWA 2B39A 4RQQA 2EYRB 4M7ZC 1A7PL 2FJGA 2XI9A 3G6JB 4HZLB 1Q72H 1DQDH 2DLGA 1J1OL 3L9RA 3P2TA 5IW3A 3Q48A 1AGFB 2XRAL 1NAMB 4FS0A 4GG6B 1GGYA 1K8DA 1MNUL 1J8HA 5GHWH 3OHXB 1AC6A 2AABH 3MGOB 2CKBH 5KSAA 1DUYA 5C1MB 4H88L 4LEOB 8CGTA 2J8HA 4M62H 5E08H 5E7FA 1N4XH 2BNRB 2YWZA 5BV7C 3VDCA 4U1GC 4X7TB 3T0BA 4UNTA 3O3EB 1QRKA 2VIRB 4Y2DC 5BRZD 3T65A 4LLMB 2VDPL 4OZFH 4XPAH 3SOBL 3GSRA 3T2QA 4NPYB 1HHGB 2EYRA 1YEKH 3C9NA 2ID5A 3G6JA 3E3QE 1OAKH 1YEIH 3GI9L 4YHLL 1MLCB 4BZYA 4UTAH 1P4LB 1A1NA 4NKDB 2QR0B 1AGFA 4GG6A 3LPGA 1IKNA 3FO1B 1NUGA 2O5ZH 3NAAL 3G08B 3MGOA 3D6GA 4IMKC 4OZFB 4NN7B 3UYOD 3QCTL 5DFTA 2QLVB 3UTPD 3JBG7 4X5WA 3DV6A 3HE7C 1A7QL 2NY5L 4FMFA 1PD6A 4QRPE 3WKNA 4OFKA 5FB8A 5I19L 1K85A 2HN7B 1K8IB 1U3JA 2BNRA 4XAWH 1WFNA 2CDGB 2DDQH 3V7MA 2ED9A 2PYED 1LP9B 4WFHE 4X7TA 1R5WA 5E8NA 2XWTB 5D93C 3O3EA 2VIRA 4AIXA 3JV6B 4LLMA 3UZVB 3SY0A 2NY1B 1Q94B 3MRQB 3PDOB 4NPYA 1HHGA 5TE4H 1SJHB 1YC7A 5HHOA 1Y6KR 3A6BL 1DUZB 4YHIB 3D69B 4JM2C 1MLCA 3L1OL 5MEPB 1P4LA 4NKDA 5TDOB 2X1QA 1W72L 4WW2C 2C4FT 3FO1A 1RZFL 2APFA 2ZCKL 5JORB 3VFGH 5D7LA 3G08A 4BFBD 2F54D 1FV1A 1G7JB 3S5LG 5F6HJ 5ANMB 4R2GC 3MLXH 3ILPB 4K7PX 1V5JA 4KRPD 3ARED 1RFDH 1RZJC 2HN7A 1E28B 1K8IA 2W0FB 3QIUB 2CDGA 3KR3H 1LP9A 3BP5B 1BQHA 4KJQD 4RAVB 1TPXC 2WWMC 3KAAA 1INDH 2XWTA 1T2QL 5MEQB 3MREA 3JV6A 3ZKXC 4YIQB 1IEAA 3MRQA 1UCBH 1LGVA 4X7DC 1SJHA 1UCTA 3TO4D 1N5AA 1X4XA 2AVGA 1A7NH 4POZD 3VI4F 1U3HB 2J5LB 4KY1L 3LQMA 4J6RH 4X7SH 1DTUA 5TDOA 3FCTB 2W1NA 1S7QB 3ARDD 3VXMB 5CWSA 3QEQE 5EN2B 2LVCA 3VXPA 1ZXQA 4UAOC 5EB9A 5JORA 5H37G 1S5HA 4P2YA 4D9RE 1UADC 1T03L 1C7TA 5L2KE 1RSFA 5CGMA 1WT5A 3OAUL 3NABH 5T1LD 3TP4A 4AEFA 1E28A 2W0FA 3QIUA 3RVVC 5D71H 4Y1AB 3LKSB 4I48B 4NKOA 3BP5A 4RAVA 2W9LA 5C6PB 3MA9H 5EUOF 3OPZL 4S0TD 4Y5YC 5MEQA 3MZGB 5E6YA 3E3QC 3ROLA 2GSGB 4YIQA 3ZT5A 3TN0C 1IARB 3DRQB 5IKCB 3BQUB 3KYAA 5B38B 5IEHB 5IJKC 3QIBA 3FT4B 5EU7C 3EUUA 3D9AL 2ERJC 2HT2C 4ELMA 1XEDA 2YRPA 4XNMB 5JW4Q 2Y06H 4LVOC 3VXMA 5HSFA 2FX8H 4PJHE 1IGTB 5DJ0A 1AJ7L 1FGVH 3OG6B 3TT1L 3WFHB 1G6VK 1RUMH 1TTUA 3CUPB 3MUHL 4D0CB 2HP4A 1KN4H 4LSVL 1GYAA 4GXUM 1WBXA 4ZNEA 3O4OB 1KN2H 3I6GB 1UT9A 1MHCA 1BWMA 1GGBH 4TQEH 4Y1AA 3LKSA 4I48A 3F62A 5JIKA 4Q7DA 5F1NA 1IGIH 2B20A 1Z0MA 1FNGB 2IGFL 3RNKA 3VFPB 2X4OA 4JFDE 2DQIH 2GSGA 4XWOD 3RZCA 4UDTB 4TNVF 3WHXB 5IKCA 5E24E 4IDLA 2HT3C 1XF3B 5E6IC 4ZOCA 5B38A 5IEHA 4PP2B 4K7FA 4I3GA 4K07A 2M1KA 1KLUB 2E3VA 1NGQL 5DUPL 4R3SB 1EGJA 3DNKA 1V3LA 5CGYD 1HI6A 1AXSB 3QDGB 1JPGB 4NJAL 1OD9A 1F58H 3WFHA 3MLWH 1CGUA 4Y8DC 1A5FH 4JCLA 4LIQE 4IMLA 4TUJB 5JQ6H 3BKMH 3P4MB 1GAFH 4MAYC 1ZSDB 4LSRL 1RUAH 5DJ6B 1Q1JH 1KG0B 2D03H 1GGCL 2IWGA 3FB7B 5E8OA 4I3SL 4TUKL 2Y5TB 2AXGB 4KVNL 3VFPA 3ULVL 3NA9L 1MH5B 1QFWI 4Z7OF 2XTJE 1CE1L 4FP8L 3WHXA 4XPHH 1MFBH 4Q9CA 2QADC 2VDML 2Z92A 4IDJL 4PJAF 2OR7A 5HI3D 4KKLD 2DWDA 4HKBB 1BHGA 3TVMC 4NNXB 3TPUB 4D9QE 1KJMB 1AXSA 1U0QA 2Z4QB 1JPGA 3QDGA 4KKAC 1LEIA 4ODBD 1MFCL 4POYA 4MNQD 4NM4L 2O93L 1H3WM 3NBNA 2VLRB 5K9KB 3AMKA 1PG7H 2VR5A 4PLJC 2CLRB 4TUJA 3V6OE 4LQ1A 2OM5A 3P4MA 3QDMD 1I75A 4JDVB 4YX2L 1PLGL 3HAEH 1U8MA 5HDQH 1X5JA 5DJ6A 5L8LB 3MNZB 1AKJB 1KG0A 1KB5H 1R3IL 3LS5H 4JFFD 3CLFH 2IALB 2XPGA 2NX5D 3W9DA 3PL6C 4YR6B 5BV7H 2H3NB 1BAFL 3F7PC 2VSCA 2VXQL 4NGHL 1B90A 1YA5A 4N0CD 2G9HB 2GJ6B 4NHUA 4CL7A 3SDXE 4B7IA 5HYJE 3C09C 2WP3O 3QHTC 1ZV5A 3PGCB 4LP4A 1FO0A 1YMMB 5C6WH 3JUZA 2XT1B 4FZ8H 3CMGA 4NNXA 2Z4QA 1ZAGA 3ZL4H 3UBXA 2LU7A 3MACH 1V7NH 4Z7WE 3C87A 4HH9B 5E2UH 2ITDB 4E42B 3MLVH 2CLRA 3NMEA 5ITBL 2C3HA 1PEWA 3GMOB 1GC1C 4XX1G 3MNZA 2XQBH 2FHBA 4WTXA 1OAQL 1MCWW 3V0WH 2IALA 3K8MA 4V1DA 1G84A 4FG6D 4YR6A 3QEUB 4Z76A 1FYHB 1UZ6E 4LLDB 3G9VA 2DQHH 3S34H 3BX7C 2G9HA 3ZE1E 5D6DC 3NH7H 2GJ6A 2O61A 1CXLA 3BDYL 5GSVA 3MBXH 3RIFK 1CGXA 4NJ9H 4JPIB 5ERWB 3BN3B 1DQQB 4YEEA 1LMKA 3T0WA 1ZLSH 1YMMA 2DL2A 2AEPH 5K59F 4XXDB 1UKQA 1JWUB 2KBGA 4ODHL 2XZCH 3KLHC 3PWPB 2OL3B 1RZ7H 1MAMH 1YEJH 1IMHC 3RHWK 5IP4A 4KH2A 4R4BB 5IJVA 1WWWX 1XGYH 2ESVE 1TQBC 4P3DB 5T1KB 3GMOA 2WQ8A 5F1OB 3UTPE 1JZ4A 5H94B 2R2EB 4YDJB 1Y18B 1Q38A 4JM2B 4XCFH 1RZJH 1VERA 4AIZB 4PJIE 4ZUUB 2BNQB 1G6RH 3ECBA 3QEUA 4PUBL 3QCUL 4LLDA 5I1JL 4OFYA 2IAND 1SEQL 4LHQB 5JOEA 1BZQK 2D0GA 3IF1B 2DM4A 5BO1L 1HIML 5E1HB 3HNTL 4JG0L 4XPGL 4QTHB 4Z7VE 3RVWD 3C60D 4NO3A 4JQVA 1T2XA 2OL3A 3BRFA 4OUUB 4YFEA 2AQ3A 4A6YB 1TPXB 4JKMA 1QBBA 3OG4B 4R4BA 1H0DA 5IB3B 2HVKB 4XH2A 3F58H 1J0IA 4Z7NF 2EICA 4UV4L 1QG3A 1BBDL 3QQ4B 3GMNB 4EDWL 2JJVA 3MROA 4N68A 4KQ3L 2YN3A 4U3CA 3V7AG 1JGDB 1E6JH 5H94A 1HHJB 2FD6H 1YN7B 2R2EA 3RVUC 1Y18A 4TSAH 4OB5H 3G6DL 4M7LT 5BS0E 5I66A 2EDNA 1HH6B 4AIZA 3VRLF 3DUUB 4ZUUA 3JSSA 4OQTH 4ONFL 5C0JB 4MD4A 2V5MA 3BN9D 1L0XA 1MRDH 2AJUH 2FWOB 3IF1A 4ZUTB 1NBVL 5EU6D 2CXGA 5I9QC 3FAWA 4WU7B 3QO0B 2A9MH 4OF7A 5T5NG 4QTHA 3VA2C 4MLSA 1JNLL 2I9TB 1UH4A 1UXSB 3ZHDA 1I7UB 1F3JB 4WENB 5LXGL 1W8NA 2DICA 4OUUA 5ALCH 1BFVH 4A6YA 1MFNA 1GPOL 5JR1L 1Z3GL 3SJVD 1N7ML 4I18B 5KW9L 3QG7L 2XZQL 2P5WD 4NO5B 2J3SA 3GMNA 3EIFA 1HSBB 1U58B 2FX9H 2FBJL 1JGDA 3WJLA 2IAMB 5L8JB 1C12B 2ERJB 1P2CB 3DUUA 3OMZA 2V9QA 4M7LH 1M7XA 5C0JA 4OLVH 1J7VR 1KACB 4QOKD 3NCCB 4QRPB 1S7VA 1L9MA 3V6FB 1RK0B 1AE6L 2FWOA 2PXYB 4QO1A 4EBQH 5DD5H 4DFHA 4ODVH 3QO0A 5JW3L 3HNVH 3H7BB 1TETL 2Q8AH 3MRBA 1MREH 4R4FH 5FO8A 1UXSA 3O6KH 4XCYB 3CVHB 1I7UA 1ADQA 3OJDB 3TLRA 1GOHA 2HTLC 4LEXH 5DZNA 1CLYH 1QTYT 3OXRB 4OM1H 1EHAA 2AK4D 3NGBB 4F9LA 1RVFL 3L95B 1I3UA 2VTFA 4FQIH 4NKQB 2WLZA 3BWAB 1DEEB 3STZB 1U58A 1U92B 4WI3A 3U7YL 1J0JA 1CLZH 3H7LA 2IAMA 1DBBL 5CCKL 1P2CA 5CP7B 5HGHB 3BISA 4A2LA 5DLMH 5T5FL 3TIDB 4N8CH 5D1QD 3L3DB 4AL8H 1RK0A 2PXYA 3UTSB 3QG6B 2XOTA 3W2DL 2JTDA 2B1HH 2IPTL 2CD0A 4R4ND 1C08B 5F3HA 1S7UB 1REIA 1HYRC 5IUSA 2D7QA 1JFQL 4Y2DD 3OJDA 2NTSP 2VKWA 5C08A 3EO9H 4ZS6D 3MJ7B 4EDXA 2KDGA 3L95A 3VCLB 1M71A 4GRLD 2AK1L 4NNYB 3BWAA 5I73B 3QIWD 3WD5H 1DEEA 1GZPB 3STZA 1U92A 1Q72L 1OB1B 4U1LB 4CVUA 1DQDL 3PWJA 1W0YT 3OR6A 4P23C 5E2JA 5D1XA 5CP7A 3I3EA 5HGHA 2VR4A 4RGOH 5IW1A 1A02N 4MJ4A 1TXKA 4LSTH 1IC4H 3L3DA 5KAQF 1MQ8A 2CKBL 2HT4D 3PV6B 2OYPA 3UTSA 4AT6A 1BFTA 3CSYA 3QG6A 1X6NA 1CTNA 4YO0B 3LKPB 4LPVA 2X41A 4ZO9A 5E08L 3U9UA 1N4XL 3OKOA 1YYMH 2BSRB 4PJXE 1K5NB 1S7XA 2Y9RT 1PZ5A 3CSGA 4QHKJ 3MJ7A 4HKXB 3R8BB 3BIAX 1VFOA 3MGAA 5GGUA 5EOCH 4XPAL 4KHTH 4NNYA 1YEKL 4LOUD 1F02I 1GZPA 4UBDC 4U1LA 3OAYH 1OAKL 1YEIL 2A6IA 5H8DA 3ULSB 1AR2A 4PJHB 1X4YA 1GC1H 4H8WC 2AAVA 4UTAL 2Q8BL 3SE3A 1MCJA 3G9AB 5DA0B 5F93C 1NC4D 2Q3ZA 5E5MA 2O5ZL 3SDCC 1QLRA 3GKWH 4JQXA 2X7LB 4FQXD 3N9GH 5F71A 4P2QB 4ZTPH 4PGCB 4YO0A 1RAMA 3LKPA 4XC3H 3N1FC 2ZSVA 1T7ZA 2BSRA 2DDQL 1MVUB 4S1SL 5D6CB 4JRXD 3ULUE 4JFDB 1D9KC 2BOCB 2EKJA 5EFIB 5FCUH 2HWZH 1RULH 1IM9D 4UT9L 4YBLB 1EMTH 4QXTA 1YJDC 4LIQH 4I2XB 1IAMA 2RR3A 4HUKB 1IAOB 5IF0A 4ODSH 5L88H 3W9EB 5TE4L 3KPMA 2N1KA 1JGLH 1TZHA 1MCBA 1FVCA 3EZJB 4HIXL 2F8VA 1X3DA 2VE6B 5F44A 1SMAA 1UYWH 5CJXA 2ZJSH 4GG8A 4KMTL 2BNUA 1NEZA 3V4UL 4QRUB 3W11C 3WO4B 4ZUVA 3RHWF 4P2QA 1HN1A 2B4CC 3BSZL 3KGRA 1RFDL 3NVQA 1CN4A 3PDDA 4KGJA 1R3JB 1MVUA 2H32H 3BMVA 4P2RE 4YBQC 1F13A 3KR3L 4OFIA 3L6FA 2XTJB 1INDL 4M5ZH 3TWCH 3B9KD 3VWJB 4JZJC 4I2XA 3K4AA 3MCG1 1MCKA 4J4PC 5HVGB 3QQ9C 1IAOA 4M5YH 4NQEA 1CXIA 3W9EA 1J0ZA 2DIAA 1OGTA 4LCYA 2HT2D 3CFKB 1A7NL 4XCNA 4HH8A 2F53A 2H32B 3V2AR 2EDFA 1Z9OA 4J6RL 4X7SL 1KPRB 5FXCH 5HDOA 5IB1A 4DGVH 3WSQH 1JYVA 2OZ4H 4KJPC 4O2EA 4Z7OE 4HS6B 4NQCE 3FFCA 2IANE 3MO1B 1CGSH 1QHOA 4OGXH 4RBPK 3GSWB 3EFFB 3QHZH 3QUYD 1PW3A 1K4DB 2MOVA 3V52L 2V7NA 2R1YB 4BFIA 5HYJB 3SDXB 3VWJA 5EC1B 3GK8H 1ZGLA 1N6UA 3FO9B 5E6ID 2HRPH 2NXZC 5E00A 3JV4B 7FABH 2XIDA 3RIAK 3AVEA 3CFKA 5I9QB 2LQRA 5DQDH 1WCQA 3OKKB 4UQ3B 4H0IA 2V9TA 5CJOH 2BHYA 2Y06L 2FX8L 3K81A 3UROR 2ZG1A 3ALXA 1HWHB 3V6OA 1AIFA 3VI3F 1KF9B 1KN4L 4X6BA 1FHGA 4F37K 3KPPA 3RRQA 3ULUC 1BECA 3CC5A 1UJ3C 3GSWA 3EFFA 3H2WA 1KN2L 2JB5H 1IC5L 1CU4L 4MA1B 3FL7A 4TQEL 2D4DA 3MRHB 1Y6NR 4LHUD 3DX9B 2R1YA 1XF1A 2EECA 4Y2OA 2DMCA 4ODXA 4XPTH 2W91A 3F6IA 5FF6B 5C09E 1JRHI 2HAZA 2YD1A 1YNKH 1QSFD 3JV4A 1FIEA 5AAWA 1IILE 4KK8C 5FECA 3TZVC 2PR4H 5CS7A 5JW4N 1BP3B 4UQ3A 4XMLH 4XBEH 2X4QB 4M6NH 5IHLB 1WCBA 4G9FE 1AQDB 3VFMA 4AEIH 2LU3A 1F58L 3MLWL 2QKIB 1EO8H 3H6JA 1R0AH 5JPNB 4KI5F 1A5FL 2WAHA 4C83B 5JQ6L 3BKML 1T7XA 1GAFL 4PJIB 5M7QA 1C5CH 4MJ5B 3DURA 3A6OA 4L8SC 4JRYE 2PYEB 3FTGB 4G8FB 2Z93A 4EN3D 4I5BB 3DX9A 2QHRH 4JY6B 5F9OH 4JKKA 1J11A 3QI9C 4XVUC 5BRZA 1IC1A 3EYFB 3WLBB 3ZTJG 3NFNB 5GRUH 3QFJE 3L5IA 2EDQA 4P3CH 2LTQC 4XPHL 4Z7VB 3SBWA 5TH2A 1UKSA 5LAXB 4N1HB 1YEGL 2QJDA 3THMH 3BH8B 2VZVA 4WFFD 5EZLB 3DBXB 1HEZB 1KXQE 2B1AL 1WWAX 4PGJA 3HN3A 1OF2B 5DJXB 4NKMB 3WN5C 3L3HB 1AQDA 2QSTA 2F5BL 1V7MH 2F58H 2QEJA 4X6CA 3JWDC 1PG7L 1IEHA 4LMQE 4C83A 1EEZB 1ZT7B 5IT2H 4KRPB 3AREB 5BS0B 3NCEB 2VH5H 5HDQL 4MJ5A 1KB5L 2PYEA 3FTGA 3LS5L 4G8FA 4MSWB 4FFWD 3CLFL 3CU1A 3W0WD 1BZ7B 2DRUA 1EHXA 3HTLX 4JY6A 4OZIF 2HKFL 5BV7L 2DQUL 2XXCB 4RDQG 4WJ5B 5IWLA 2ICES 4Z7NE 5AD0B 4Z7VA 1KULA 5EIIA 2BSTA 3BH8A 5J4MA 4Z7QE 5EZLA 3DBXA 4FZ8L 1CICC 2H2PC 1E4XH 3SCMC 3ARDB 5FA3A 1OF2A 3JVGA 1BQUA 4H8WH 3MACL 2AQ2A 2F54A 5E2UL 4M61B 3S35X 3HUJA 2NYYC 4PLOB 2FGWH 2IG2H 1EEZA 4P5TB 4UQ2B 1T7VA 3QAZB 3AREA 3WUZA 3KWWA 3KPSD 5J3HC 5T1LB 3QQ3A 3S4SB 2XQBL 1QVOA 5CMAB 3V0WL 3CMOH 1BZ7A 1I1YB 4J23A 2DQHL 4WWID 3S34L 5I1GH 2HFGH 3NH7L 4WJ5A 3VRIB 1YJDH 3MBXL 5AD0A 5MEND 2AJYL 1LO5B 3H9ZA 3TO4A 3WFBH 1H5BC 1ZLSL 4HWBH 1BF8A 1QBML 5CD3B 1A4JB 4WV1B 3ARDA 3LCYA 4DN3L 2XZCL 5INCB 1D9KB 3DYOA 1RZ7L 1MAML 3GMLB 4KI5D 2IQAB 1T1WB 2OTWA 4M61A 5DD1L 3B83A 5CJ8A 2CRYA 2QSCH 3Q1SH 4M7KH 1XGYL 1F4XL 2IFGA 2NY4D 5T1LA 4KJWC 1HQ4B 3HG1E 3S4SA 2OXHA 5KZCB 1NFKA 2B4CH 4H25B 1PZUB 5ILTH 2FNBA 4OI7A 4XCFL 1RZJL 5CMAA 4L4JA 1C16B 1G6RL 3WNNA 2X1OA 5D7IF 5HI5D 4HF5H 1KPVA 1RY7B 2W0PA 1IEBA 3WXWL 4YHZH 2DQTH 4ZPTA 1A64A 3MV8E 1XF2A 2HJFB 1WBZB 3LD8B 3MR9B 2OTPA 3B2UC 1IM3B 5IMMA 2DBLH 1XGQB 3D0LB 5DUBB 4IIQB 5CD3A 5GGRY 4WV1A 1OSPL 2YS4A 2NY6D 2PKDA 3JTSA 4NQDE 1J5OH 3FQXB 4M1DH 3SGJC 1MCEA 2X4SA 2RGSA 1F4WH 1ZHNB 1E6JL 4H25A 4TSAL 4OB5L 5IK3B 4GAJH 4OGAC 1AGDB 1F6FB 1EXUB 4QGTA 3QZWB 5AYQA 1U36A 4ALAL 3MRGB 3PXJA 4OLEA 3R06B 2AJUL 3RWHB 3O6MH 2BY2A 2YD4A 5T1MA 4DOHE 3WNLA 1WBZA 4PJXB 3OJMB 2A9ML 5EORH 5FK9B 2VLKE 1IM3A 1BZ9B 1YQVL 4EI5C 5DJAB 1N3NB 3ARWA 1XGQA 5DUBA 1QO3A 4IIQA 5I0ZA 1GHFH 1GH7A 4X6EB 4KV5E 4MNQB 1BFVL 5ALCL 4ZSOE 1OY3B 3MOAL 2JJSA 3QDMB 4P9HC 2FX9L 1ZHNA 4GKOA 5JOPD 3ULUH 2VYRE 2J12B 1YNTA 2HJLB 5IK3A 1GJIA 4JFFB 1FL5B 1JJUA 4OGYH 2C3VB 1L0YA 5KVFH 3QZWA 4WTWA 4OLVL 1MHPH 4YAQB 1I7TB 2X10A 4Q58C 3R06A 4NSKA 3RWHA 2RIKA 4EBQL 3OZ9H 3CK0H 3NIDF 4ODVL 1JVKA 4BELD 1TVBB 2CRIA 3MXWH 2X6MA 3BIBX 1MREL 5CZVH 32C2B 4DKEH 4YPGA 2PNDA 2MHAB 4K3HA 3BJLA 4UNVA 3O6KL 5GRJH 1CYGA 2VAAB 2X4TB 5HPMB 4X6EA 1OWRM 1I1AD 4MNQA 4LEXL 3BZDA 4ZFFA 1CLYL 4OM1L 3PHOB 1G1YA 2DJ4A 3BJ91 4FQIL 4NHCH 1NCUA 3QDMA 4NUGH 1ZLWK 5KJRH 4YHML 4QHNA 1CLZL 5CKGA 4KDWA 3BD3A 2HJLA 5EUOA 3FB6A 4JFFA 3FZUD 4AJ0A 2NX5A 4FFVD 1HQRA 3BP7B 1OW0C 3C8DA 4WTZG 3DLQR 4YAQA 3BZ4A 5TQ2H 5E9DE 1HYSC 4AL8L 2B2XL 2ADGB 3U4EA 4P2RB 1U8KB 3FO2B 1S5IH 1TVBA 1KJ2H 3GRWA 3MJ8A 5F3BB 2X4NB 3TGXA 5E1AB 3L5XH 1UC6A 3BO8A 1XGPA 5HPMA 3F7RA 1AHWA 4UDUB 4JZOB 2AGJH 1T0NB 4HQQH 3RI5F 4QXWA 4WEBL 3WS3A 4RMRA 3WD5L 3JWDH 3R8QA 3BKCH 4C56D 1KJ2B 5HVHC 4HULB 2WIMA 3SKNA 1JTPA 1NKRA 2PTUA 4H1LH 5TQ0H 3BP7A 3AAZB 1BIIB 1MSPA 4RGOL 2B7DT 2IANB 2WK2A 1X5YA 3BW9B 4N1EA 4TUOA 3VG9B 4LSTL 1ZLVK 3NCFB 3L5JA 5I15H 2HVJB 1ZANH 3GSUB 4L9LC 4OFPA 4WFED 4JY5H 1FE8L 4MVBC 1YEEL 3C60B 4KUZH 5GGVY 5E1AA 1JPTL 3JTTA 5DUMH 1N2RB 1M6OA 2H8PB 2OI9B 4E5XB 4XTRD 1S8DB 5FOJA 3AB0B 1P7QD 1B88A 4NRZA 2YN5A 4QEGA 1T0NA 5EOCL 5E8PB 5C0GA 4K94C 4KHTL 3C5ZD 3MLRL 4ACPA 3V79C 1XF5B 2C3GA 3VWKC 3F8UB 4TVPD 4PJBE 3WUWB 5K9QI 1GC1L 1ITCA 1EEYB 2H26A 5CJBA 3AAZA 1BIIA 3B6SB 4UILH 2IANA 3D18B 3BW9A 2EH7H 2YK1L 1F3DH 5EZIH 1RI8A 2OMBA 4PJAA 4NFCA 5EU6B 3N9GL 4ZTPL 4YBQD 2YD9A 4HBCH 1FC2D 3D85D 3HMXH 2MKLC 4O51A 2YSSB 5FCUL 1BREA 1RULL 2HWZL 1E4WH 1N2RA 2Z35B 2H8PA 3KPOB 3TBWB 4E5XA 1EMTL 1S8DA 4GBXD 4MXQC 4LIQL 1DFBL 3SJVB 4L8CA 4CDHA 1KIQB 2FH8A 5E8PA 3Q3GB 1F11B 4P48A 4ODSL 5L88L 2P5WB 3N1PC 5F9WC 5GRXG 2VSDA 2VITB 1XF5A 1JGLL 3MRCB 4X9IA 5E99H 1QZ1A 1R3KA 3UXFA 5C0FB 3WUWA 5