4JO2H

Crystal structure of rabbit mab r56 fab in complex with v3 crown of hiv-1 consensus a gp120
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
210
structure length
204
Chain Sequence
b'QSLEESGGDLVQPGASLTLTCKASGFSFGNNYDMCWVRQAPGKGLEWIGCIETGSSDSAAYATWAKGRFTISKTSSTTVTLQMTSLTAADTATYFCARNFDLWGPGTLVIVSSGQPKAPSVFPLAPCSTVTLGCLVKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal anti-HIV-1 gp120 V3 antibody R56 light chain
publication title Rabbit Anti-HIV-1 Monoclonal Antibodies Raised by Immunization Can Mimic the Antigen-Binding Modes of Antibodies Derived from HIV-1-Infected Humans.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system/viral protein
total genus 35
structure length 204
sequence length 210
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jo2H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jo2H01
3BZEA 4FZEH 4AQ1B 5C0CE 5I1KL 3PHOB 2IG2L 1FDLH 3MXWL 4Z76B 4CN6A 1V3JA 1NCWL 4HIHB 3UTTB 1KJMA 4UT7H 4FQXC 4JPKH 4X98A 4WFFD 5CKGA 5CUSH 3HRPA 4QRQA 5EZJB 3WFEH 2ADFH 5ALCL 15C8H 1X7QA 4YHMH 3FB6A 4PJBE 1YQVH 3C9NA 4MNGB 1EGJL 3B9KC 3X14B 5DVOA 5CD5C 1U8QA 4EIZC 5F70A 3TN0C 1HWGB 3GKZA 2N56A 4J1UB 1AXTL 3TNMA 2YD2A 3E6HB 4IS6A 1ZA6A 3LD8B 2R39A 4H88L 4XCFH 2Y4SA 2XZAH 4ZFZA 2FZ3A 4MNQA 3M1BB 4JKWA 4F8QA 4AJ0A 4QHMB 2OS7A 2QL1A 2V7HB 1X5XA 2XACC 1RJYB 4NC1E 4NWTL 4UV7H 2ENYA 3CVHL 4LRNH 5J8OA 1QSFB 3BYYA 2E7CA 2VLJE 1RZFH 2CIKA 2BSTA 32C2B 3DVFA 4CAGA 3ULVD 2Y5TA 3NPSC 3O8XC 5GZOC 1YNTB 4G8GB 4RMWA 1G84A 1MUJB 5SWSD 4EIGB 1TVHB 1A1NB 4Y19B 2CRYA 3VG0H 1KBGH 4FQ2L 1YEHH 4U0RC 3IAPA 3QXTA 3GJEB 4MDJB 5I18H 3NCBB 4HXAL 4ZXBD 3NFNB 4P2RB 5IJKA 1NANH 1K3IA 3D0VA 1I8MB 2DF3A 2VH5L 3F7RA 4TSCH 2FBJL 3I84A 4CBPA 1D5ZA 3TEUA 3V6ZB 4AEHH 3S37H 3CSYB 3L5JA 3MR9A 4KGJA 4ODTH 3HZVA 3FZUC 4WY7L 3I6GA 5H94B 1GJIA 3MFGB 5E8EB 4JFDE 3PGCB 5FO8A 1FIEA 3L1OL 5KOVC 4YHZL 4OGAD 4DKEH 4PLOB 5D96C 1A7NL 4ZNEA 5MEPB 3UTTD 1EO5A 2VWEC 1WC7B 4TUJA 1U6AL 3MJ9H 2YHGA 2ITDB 5D9SA 1PZUB 1RULL 3WFHB 1QKZH 2XRAH 1MCOH 4L8SB 2J5LC 1MCBA 1YECL 1RIUL 4Z9KB 4APQB 1UCBL 3Q5OA 3P4MA 4R7NA 3WNLA 2E9JA 4IIQB 1AIFA 1IM9D 4LNRA 4KC3B 3HCVA 3RKPA 3CFEB 4AEIH 3I75B 4HK0A 4UB0L 2V2XB 1A3RL 3NFPB 5D5MB 3BWAA 1DBMH 5E00A 4YAQB 3D0LB 3ZZ1A 1D6VL 3ALPA 4KJWD 1KPRB 3U0PA 1QSFD 3FQXB 1JMXA 2OZ4L 4HH9A 3V4VH 4I5BB 4W6WB 2IANA 5FYJD 3G6DL 3QUZC 3DI3B 3LKPA 4Y19D 1H3UA 3WS3A 5EOQH 4GKSA 4QGTA 5KG9A 2K7PA 5D1ZC 1JZ5A 3WFZA 2FX9H 4LSTL 4NQEA 1ZLWK 3VGAC 1CS6A 4I3GA 2YSSA 1L0QA 1U91B 1NGXA 1MFDH 3B9AA 3KPSA 4JVUA 1KULA 3BVNA 3KWWB 3BUYA 1EV2E 4MYWB 3C08H 4K7PY 2OTUA 4WW2B 4X7EC 3QQ9C 4YHPA 1CL7I 3BEVB 4P9HH 3BKMH 1VFAA 1AP2A 1JCKA 5D93B 5F9WC 3R4DA 4FQXA 5TE6L 2ZUQC 1CGYA 1OGAB 3BJLA 5C0EB 4GRWH 1RVFH 1CTOA 2PN5A 4FFWD 1JYVA 3MV7A 1JWMA 1IC7H 4LSQH 5B4MC 5E2UH 3HE7C 4KZEL 4JFOB 3PGDA 4X7FC 1CLOL 5I30H 5I16B 1OB1B 4APQD 1FORH 1ULVA 1JGEB 3TBWA 3NAAH 3BKYH 3W11C 3MOBL 1NDGB 3ZE1F 5IVXA 5ESQA 4G6JH 4JZOB 2E27L 3L7EB 5GISH 1N0LA 2EIZA 4U6YB 4RISL 4YGVB 2DLIA 3C8DA 3QDGB 4FABL 3FCTB 1LQSR 1P7QB 4HSQA 3V8CA 3S4SA 5SWZB 1PEZA 3QQ4A 1XEDA 1A6UL 5ICYA 1XCTA 3PIQB 4FQ1L 5ILTL 2X4NA 4BFIA 2XFXB 3VRIA 2HT3C 3PDDA 3RKDD 3TT1L 5T1MB 1KTLA 2VLMD 1VADA 1F11B 1ADQA 2YMXL 4UDUB 3DHJA 5MENA 1JL8A 2CD0A 1RZJH 3UTSA 5HDQL 2V5TA 5EU6E 5BZWA 3V4PL 3ARDB 3JWDL 1JTOA 1QO3A 5DD0L 3U36B 3VXOB 4HS8L 1ZHLA 2X4RB 1VFBB 4HS3A 3TYGL 2FO4B 2FDBP 1UB6B 3OKDA 5HGHB 4XP6H 1T3FB 5DS8A 1CT8A 4RGNB 3VWJA 5BVJA 3QO1A 4QRUB 4M43H 1LO4H 1YQ2A 3HN3A 1P6AB 2BY3A 4PJ8D 4HEME 5E8DH 3LKOB 4PRIB 4G8FA 4MJ4A 2F53E 4HWBH 3MRMB 1I1FB 4G9FA 1D5XA 5JPMB 1M71A 2Y36L 3MFFA 1YZZA 1NCAH 3FB5B 4FQCH 5LGKA 1NFIA 1KIRB 1T1YA 3MUHL 3K1DA 1XGQA 1N0XL 2JJTA 1EEZB 5D7LB 1AHWB 3ECBB 4IOSD 3O2VH 4JB9L 2F58H 4DEPB 4PJHE 3HNVH 4R0LC 1U9KA 1RHHA 2AQ2A 1OLZA 3QDGD 1WCBA 3BT2L 4NBYB 5A2KH 5E0QA 1FNLA 5I8OH 5GHWL 3WIHH 2CH8A 2HN7B 1BMGA 1EFQA 3MLUL 5IKCB 4KJWC 5SWZD 3EYUL 1RPQA 1CL7L 3R06B 4NO5A 5GJSH 1HHHA 2DQDH 5HI3C 1GIGH 4KTYA 3GMPA 3QJFB 3WFBL 2J4WL 4Q9QH 4MJIE 3V2AR 2DQEL 1MJJA 2AJXL 2H32A 3CFJA 5MEQA 5EIQA 2XG5A 2CSPA 1GC1C 4L9LB 2PYFB 4X4XB 1K5NB 1IKNC 2P4AB 1XF3A 4ODHH 5IFHH 1T0PB 4DGYH 1CK0H 4FFVD 1LP9A 4NKOA 2AGJH 2YS4A 4XNXL 3D2UA 5FKAB 5FKPA 4EN3D 2VQ1A 3VXUA 4LGSB 4RGND 1DEDA 1TQBC 3DNKA 5FGRA 2IC2A 4PB9H 3T0DA 1ND0B 1QHOA 5C0ND 1MJ8H 4OCMC 3M17B 4PGDA 4N9GA 4XPBH 3NA9H 2OP4H 2FEDD 3U79A 4F9LA 1IGMH 1NAMB 1OVZA 1TJIL 5EWIL 5HDBF 2DJ4A 3MOAH 4FFWC 2H1PH 3AUVA 1NMAL 1CLYH 2A6DA 4ZYKA 3T2PA 1A8JH 3DX7A 3L6FB 2V5SA 4YBQD 2X05A 5D1XA 4NHUB 5D7LD 3W39B 3NIFE 5J57B 4HUWA 4DZBB 3PHSA 4GAYA 4NZRL 1T5XA 4RA0C 5CCKH 1P4IH 2H26B 3SKOB 5FA3B 3VD7A 3WN5A 4I9WD 1MLCA 3TPUA 2D2OA 3TH3T 1OP9A 4DN3H 2VDRH 2MMXA 5D7KE 5DMKA 4G42B 1BLNA 4NFBA 3LN5A 3S96B 5CGMA 2IAMD 1CICD 4BSVB 4L3EE 1D5MB 5C9KA 1MH5B 2AJUH 4LCUA 4S11A 1DQML 1H15A 4JDVA 4LCIH 1K4DB 3I50L 1FZJA 5J7CC 4OGYH 1EEUA 3CK0H 2R2CA 5ESAA 1CXLA 3GEWB 4S10A 4CN4A 2ZPKH 3BPOB 5FGBC 4YXLL 3TNNA 3FMGH 2QSTA 5DURD 1TNMA 2ZUUA 3S98A 4FZ8L 3QIBA 4LQFL 2VXQH 5K59E 5FF6B 3BH8B 1C7SA 4NP4H 4Y5YB 4NRZA 4X80H 1SEBA 5GJTH 1RIHH 2DQTL 3V5DA 5J1AB 4M7KL 2W91A 1Q8MA 4YPJA 1MWAA 3U4AA 5AD0B 4N8CL 4R4BA 3TBTA 2R56H 4PJ8C 3TZVA 5KSAA 3JWOL 4M93C 3WIFB 2Q3AA 4MJ5A 3X12B 5IK3A 4PG2A 3MRGB 1U3YA 1DQDH 4X0KB 5C09E 1XIWB 4KY1H 5FGCB 5BW7A 4XVSH 5KS9E 4DGVH 5DK3A 1F4WL 4NBXB 4AH2B 1XCQB 5C0RL 1WICA 3L3HA 3V5KA 2B8OT 1FYTD 4XAKE 3C5JA 2LQRA 3GO1H 2FJHA 1JNNL 1ZSDB 3ZKNC 2EC8A 3MJ7A 4OJFH 3S5LA 1LWRA 3GMLB 1PD6A 1HI6A 3Q6FB 1HZHL 1VACA 1WF5A 2OK0H 2R1XB 4XBPA 4YFEA 2B2XL 4F80A 3RX7A 3D5OF 3QSKB 5CHNB 4DVBB 1W2KT 1UGNA 2WWMD 4PLKD 3TV3L 2ZNWA 3KPOB 3KYKL 3RNQA 3HLAB 5AWNH 3VXSB 3EYSH 1JPFA 5IMKB 3WL9A 1QBLH 1KIPB 3BW9A 4GG8A 4LMQI 1SJHB 3TJEL 3UTZB 5C0BB 4FP8L 4HUUA 4GMSL 4AZ8A 3TWCL 1P7HL 5E94B 3RA7H 5CIPA 5DRXB 2FEEI 4Y1AB 4UILL 2HKHH 4MD5B 3BZ4B 4PJCA 2P49B 3ZE0E 5BV7C 4ZS7H 4U7SA 1NBYB 4YEEA 1KTDA 1BFSA 1WJ3A 1G6RL 5DTFA 4EN3C 1YY8A 1FFOB 2BX5A 2F5AL 5B39A 1BIHA 1I9IL 3D48R 2AK4E 1BREA 3LV3B 1YEEH 1T7ZA 1YEKH 5C0NC 4CVZB 5KJRH 2NY1B 5KSVB 1GGCH 4WEBH 4PJ7E 1CG9B 4MQTB 3EO1B 1UEYA 1AGCB 5GRVL 3VCLB 1L7IH 2D7QA 2JCCB 1GZQA 4PJ5B 3AS2A 3GDBA 2AW2A 5KSBB 1CXIA 1IQWL 5HSFA 4FMFA 4LKXB 3Q6GL 1ACYH 1HQ4A 4PP1D 2FIKB 5ECJE 4QO1A 4UT6H 4HKJA 3P4OA 1XGRB 1XF2B 4P2OA 4OV5B 1WQVT 2BHUA 4QF1B 1QBMH 3RY5A 2HVKB 5SV3A 1KJVA 2O5ZL 5CD3A 5JO5A 1F90H 3IU3B 1RZIA 4IOIB 4RQQB 2E7BA 3HC3L 4NO2A 1HHJA 4WUKH 4CMMA 4A2MA 2NW3B 4OQTA 3V6OE 4YC2C 4LAQL 3STLA 1CD9B 1XH3A 5J3HD 1MF2H 3T8XB 5HHOB 4WV1C 4MA1B 3HZMA 4ZPTB 5TDOA 5F6IB 2NY4B 3CXDH 3VXSD 2NYYC 2IAMC 1CICC 4DQOH 1FG2A 5HVHC 1A6TA 4Y4KC 3BIBX 3F8UB 2DB8A 1EPFA 3WNKA 4WJ5B 5C0BD 2NR6C 1JPSL 4X99B 3QPQC 2AXJA 4KTDH 5FYKH 3VMPA 3T4YA 1SYVA 4NQXB 1T1WA 5HGBB 5IFAH 3IDMA 2PXYC 3GMQA 3QUYB 3DMMA 3LQMA 3T0AA 4XWOD 3L3KB 4YR6A 2ZP0T 4L1DA 3WUWB 4M02A 4LVNC 1MCDA 2NZ9D 2ESVA 5EFIA 5F1KC 2UWEE 3CSGA 3BZEB 3FAWA 3QWRD 1EH9A 2XICA 1QLFA 2J8OA 5FGSA 3ZMRA 3MV8A 3QQNA 4LLMA 5HI5D 2CGRH 1AR1D 4I3SH 1DQLH 3SGKC 1KJMB 4X98B 3TYFA 1CIDA 2W59A 1CFVH 1F4XH 4JG1H 3L5XL 4QRQB 3WFDH 3QCUL 4D9LL 3LKRA 1X7QB 2IQAA 3FB6B 1NFKA 4P23C 3ZT5A 3C9NB 1FPTL 1C8PA 3DWTA 1U8QB 4JRYE 1C5BL 1YNKL 3QXDA 3LQAL 1OTSC 1RZKH 2FEEL 3GHBL 2P5EE 3TNMB 5I19L 3UTOA 4NQTA 4IS6B 1A7RL 3VFOA 1ZA6B 4OCXL 5E08L 3E8UH 2WLZA 4ZFZB 1V3LA 4MNQB 2JELH 4JKKA 3VWKA 3OKOA 1RSFA 3V9FA 3G5ZA 1YDPA 3RUGE 1I9JH 4DW2H 5HHOD 1OAYH 3MREA 2BSTB 2NY4D 1NSNH 2Y5TB 5GGVY 5D7JA 1F8TH 1QUNA 2WWMC 3O4OB 2GYSA 5DZNA 4D9RD 4P99A 1N5AA 4TVSa 2JTDA 1DQJA 1RUML 4ODSL 1R3HA 2LV4A 3EAKA 1WEJL 3QUYD 3G04A 4FXKA 1HINH 3D0VB 4QNPF 1KFAL 2GY5A 1Q94A 4NGHH 1CBVH 1D5ZB 3QFJA 1AI1L 4OLXL 1PAMA 4QHUA 4HUVA 2E8YA 1YY9D 3MR9B 1FVCA 3HZVB 2BSED 3I6GB 4HWEH 5IROC 1ORQA 3PV7A 1A7OL 1KNOA 5FO8B 1RZ7L 1JNHA 1MVFA 2Z9TA 4ZMAT 4TUJB 5L9DH 2FD6L 5D9SB 3PP4L 4D0DA 1A6VL 1A0QL 3KLDA 4ZG1A 2V2TA 2XY2A 4P4RA 4XB7A 4WHCA 3P4MB 2ZJSL 4R7NB 4J23A 4M6AA 1AIFB 3N85H 5E7FA 5CMAB 5T3XL 3PWUA 5HYEA 4LNRB 1CLZH 1VENA 3ZO0A 4HD9A 3HCVB 1D5IH 2EIEA 4HK0B 4PRPA 5TF0A 3MLYH 5F9AC 3VU2A 5T33H 1ZXQA 2Z8WC 2BCKA 2HLFD 3IAQA 3AREC 3KLAA 1EO7A 3BWAB 5A2IH 2QQLH 4MNQD 4KMTL 5E00B 3MLTA 5T3XE 1SBSL 2IBBA 1CIUA 2XN9E 4NCDA 3V0VA 3U0PB 1NPUA 4GSDH 1HIML 3FQWA 3T3ME 5DJYA 4HH9B 4KXZH 4U33A 1G7IA 1AD9A 2ZKHH 1WFUA 4X5WA 2IJ0C 4S1RH 4ZO8A 3BMVA 4UNVA 3QRFM 2L7JA 1QR4A 3LKPB 3C60A 4L5FL 3O2DL 3WS3B 2CKBA 4X9FA 4GKSB 1UZ6F 5KG9B 4FA8A 2DBJA 3I6LD 4NQEB 4X4MA 2YSSB 1NGXB 3KPSB 4G3YL 1TITA 5I1IL 4OI7A 4XXCC 1GGIL 2NY5L 3BVNB 4JRWA 3BUYB 5HYQA 4A6YL 4YDIL 3RU8H 4JO3H 2OTUB 5F7DA 1Q9WA 2JJUA 2C9AA 3LZFL 4YHPB 2VDNL 1VFAB 1AP2B 4K8RL 1N59A 4HC1L 3LEYL 4FQXB 1RAMA 3MRBA 1F58H 1EO8H 3M45A 4JFZH 3MV7B 3K3QA 5D72L 1JWMB 2AERT 4JEGB 1UB5A 4BFEA 4HX1A 2CO6B 3UBXI 3VFMA 3PGDB 3W2DH 3WUZA 5J0BA 1IZKA 1KELL 1WLHA 2GI7A 4QHLA 4L4VE 5LBSL 3TBWB 5JHLH 5IVXB 3GSUA 5ESQB 1R24A 2A6KA 2BNRA 4M62L 1JNJA 1MEXH 2E9BA 2EIZB 1AFVH 12E8L 1YYMH 1OARL 4WI9A 2E6PA 2YD6A 1CE1L 3FFCA 5HDLA 2HMID 4PJDF 4S0SD 1NGPL 3S4SB 1MCEA 5LGHL 1LDPL 1YN7A 3QQ4B 5E2WH 5ICYB 2XNAB 1XCTB 2X4NB 1MNUL 4BFIB 2IAND 3H7BA 3F58H 3LPGA 4JFYA 3VRIB 1OW0C 2HJFA 1R5VA 2XQYK 4RNRA 1KTLB 1CGTA 1VADB 3DBXA 3QEQA 5MENB 5I8CA 4FXLA 1JHLH 5BRZD 3UTSB 3I9GH 5BZWB 4NQED 3SDAC 4ACPA 3INUH 2A74B 1LE5A 4JFPA 4O2CA 4ALAH 4OD2A 1EK3A 4JQVC 1ZHLB 4O4YH 4XBEH 4HS3B 3QIWC 4TNWK 5IROA 3OKLA 1CXHA 4BM7A 3OKDB 3VWJB 5DS8B 1CT8B 3HAEG 3UO1H 5BVJB 3QO1B 2CO7B 3GBMH 4URTB 4PGCA 1MPAH 4K23H 5T1DH 1F45A 3GJFA 1CLCA 1SJVA 3OKMA 4UTAH 4G8FB 3MV7D 1AXSA 1X5LA 1BX2A 4KK6D 3IDUA 3NCYP 4G9FB 2YPKA 2ILLA 4OSUH 1KCRH 1D5XB 1M71B 3MFFB 2QLVB 1JTPA 1A9EA 3MRPA 3S36X 4RWHA 1S9XA 2P8LA 1NFIB 4MA7L 1T1YB 4KKBD 4LDOB 5C7XH 2NNAA 1MI5A 4GAFB 1XGQB 3H42L 3ETBF 4P4KD 4DN4H 4Y8AA 3MZTA 2I9LA 3AREA 3V8OA 3GRWA 1CU4H 1RHFA 4KVNL 4TNWF 2C7UA 5DEZA 4JCMA 1RHHB 3H9SE 7FABL 3K8KA 4N8VG 1WCBB 1NAKL 1P5UA 2CXGA 3RWGA 1JGVH 4FQHA 2GITB 5T3ZL 3CU1A 1FL3A 3MCLH 1HHHB 3EFDH 4HUMB 4U6HA 3GMPB 4YZFE 3KS0H 3OGCB 7CGTA 2FLRT 1MCCA 1QVOA 1Q1JH 3HNSL 3GNML 3HNTH 1MJJB 2H32B 3CFJB 4OCYH 1X44A 5T3ZE 3OG6B 4JY5H 5FCUH 5MEQB 1NKRA 5MEND 5DJ0A 5JW5A 4LSSH 1XF3B 3EKCA 2UZIH 1FH5L 1LP9B 1A6ZA 4NKOB 4TVPH 1V5JA 3GBLA 3D2UB 5FKPB 4ORZC 2VQ1B 3VXUB 1UC6A 1N5YH 4NT6A 4JHBA 2AEQH 3ZDYE 3IRZA 4AK1A 5EIVA 4NCC1 3SDYH 3DV4A 4UIKL 4HJJH 4PGDB 4XNMA 4E0RA 5IB3A 4N9GB 4MXWL 4QRPE 1Z3GL 3PE9A 1CD0A 5T5NG 2NY7L 5F96L 4G9FD 1KN4L 5FYLH 5EC1A 5C0AA 3A67H 4K94H 4HG4K 5D2NA 5C3TA 4WWKD 3BDYH 1HH6A 4JJHA 1NL0L 1KB5L 4ZYKB 4KPHL 4POZC 3DX7B 3MCKA 2QBWA 3D85A 4MZ2A 5D1XB 1ZT7B 3SDDA 4CU6A 5CJ5A 4S1DD 4HUWB 5C71A 1EEYA 2A6JB 4YDKH 3MODH 1T5XB 1VB9A 4Z5RA 4EXPX 4YQXL 4QRRE 1QBAA 4LLUA 3U30C 3WN5B 1XGPA 2EDOA 3GK8L 3PDGA 1MLCB 2AJSH 3RAJH 5GRXG 3TPUB 5LQBH 1DBAH 4K9EC 1OSPH 1DBJH 1HEZA 1FRGL 2B1HL 4JKPH 2BY0A 5DMKB 1BLNB 3LN5B 3SHSA 3UJTL 3GMMA 5GRYA 5DJDA 5CZXC 4Q6IA 4U1GC 5F9JA 4Q9RH 4D3CL 4HCRL 2XWJA 3G5XB 4LCUB 1H15B 4HJGA 4JDVB 4MQSB 5F3BB 1FZJB 3N50A 2NXZC 3UZEA 2OL3B 2OTWA 4ZPVA 5ESAB 4EDWH 4UQ3A 5DHYA 3PL6A 3TNNB 4YWGH 1IMHC 3ALWA 3RDTD 2R0KL 4ZSOE 2MWCA 2HT2C 1RJLA 3QIBB 2A77L 2YWZA 5GGTL 2DOCA 1ADQH 2O26U 4PRHE 4G9DA 1RY7B 1I8LC 4NRZB 4HUKB 1SEBB 2X42A 3EOTH 3V5DB 1BD2A 5EPMA 1BFVL 3D9AL 1RK0A 3O3UN 5DJCA 4OFVA 4I0PC 2HTKD 3TVMA 2EDYA 3MRCA 3MRQA 4O9HH 1MWAB 4R4BB 2Z93A 3TBTB 1E6OH 1WWAX 4W6XB 4KVCH 4GRLC 4NWUL 3TZVB 5KSAB 5JR1H 2FJFA 5FM5M 3WHE1 4MJ5B 4KK6C 1U8PA 4WFEE 5IK3B 3SCMA 5B3JF 1S7XA 1UVQA 3O4LA 1EJOL 1UWXH 4CVWA 3WDJA 3DETD 5L2KA 3L3HB 2YC1A 1NBZA 3V5KB 2AEPL 5TDPA 1M05A 3C5JB 4WNQA 4P4KC 5FECA 2FJHB 5ADPH 3DURA 3MJ7B 3GFUA 1NGWA 1BQHA 5AEAA 2XOTA 2LU4A 1J0JA 1HI6B 1GOFA 4D2NA 1VACB 2VKXA 1DQQA 4M6NH 4XBPB 3FAXA 2AV7A 2ERJC 3ZHKA 3NFSL 1TJGH 3RNQB 4XPAL 2DM3A 5B8CC 1JPFB 3WL9B 1KENL 5DC0A 3BW9B 5MEOA 3CX5K 4GG8B 3ZKXC 4M00A 3V4UL 3WJLC 4HUUB 1B6DA 5CIPB 4ELME 2I25N 1U3ZA 2VLKA 2YPVH 3DARA 2EDKA 3IS1X 4PJCB 3RIAK 4FZEL 2DJSA 1ZLUK 3SE4C 2H32H 4DTGH 1WV7T 2F5BL 4G5ZL 4KQ4H 1KTDB 5DTFB 1YY8B 3WKNA 4Z95H 4UT7L 4JPKL 4JFED 2XZZA 1VPOH 5B39B 3J8F7 1I8KA 1YEGH 4RAUA 4R97C 3WFEL 1CDGA 3CDGA 4HQQH 1FGVH 1YQVL 5TE4L 5KSAD 1MHHA 1UM5H 1PW3A 1OP3K 1MOEA 4WFHD 1TDQA 4HHAA 3LS4H 2XA8L 3SDXA 1OT1A 1JPGA 1GZQB 2HT4D 4IDLA 4OZHE 1DFBH 4YFLI 1J0KA 3MUGA 1OTUC 4TPRH 1KLFA 4XZUA 2XZAL 5J11B 1HQ4B 4HKJB 4KKLD 5CS7A 4RGMC 4P2OB 5C70A 3AMLA 4UV7L 3HB3D 5B3NA 1KJVB 5CD3B 1RZFL 5JO5B 3SGJA 1RZIB 4CU8A 4NO2B 3QUXC 5FB8A 1HHJB 4CMMB 4W6YB 5D1QA 3EOYG 3VI3E 3STLB 1XH3B 4KRPD 4CJ1A 4XMLH 5TDOB 2VZ3A 3HZMB 3VG0L 1KBGL 3SBWC 4NM4H 2AQ3A 1MQ8A 3NCJL 4OZIF 1A6TB 4MAYD 1ZK9A 3D1MC 4QXUH 2MPAH 3UPAA 3WXWL 1NBVL 5I1CH 1LGVA 1MJUH 2QQKL 2FSEA 4CUCA 3KR3H 5KANG 3T4YB 4XTRD 3S6CA 1GHFH 4B7IA 1T1WB 5DRZA 3IDMB 5DGRA 2OL3H 4TQEH 3GMQB 3DMMB 5I15H 5I9QB 2BFVH 3RDTC 4YR6B 3U9PL 2G2RA 2KUTA 2ESVB 5EFIB 4LLWA 5D8JH 1FQ9C 2ZOKA 3WXVH 3MJ9L 4ORGA 1QKZL 2XRAL 4CW1A 4XI5D 3FL7A 4XXDA 1QLFB 4WO4C 3MV8B 4ZOBA 4LLMB 1IKFL 4S1QH 3WLBA 2DICA 3D69A 4LLQA 3ESUF 1S7VA 3T65B 2BSRA 3QIUC 1BJ8A 3RZCD 3KGRA 2KDGA 1DE4A 3TFKC 4PS4L 3KPRE 4U6TA 1X5ZA 3IU4H 5IT2H 4OM1H 2PR4L 3LKRB 5DGQA 5DR5H 2IQAB 4OLZL 3LB6C 4TUKH 5IF0A 2P46B 3C8KA 5DJ2A 1E4XI 1DBML 3QXDB 1CD1A 5JA9A 2PUQT 5DEFA 4KROB 3ZYOA 4C58B 4IBLT 3W5NA 3EYFA 4OZFG 3BRGC 3WO4C 1J8HA 1P84K 2ORBH 1A5FH 3IDNA 3DPBA 3VWKB 3OKOB 4GXUN 1VCAA 5LAXA 4YK4C 3G5ZB 1YDPB 3GIVA 3MREB 5JDJA 4BJLA 4E41B 3K1KC 1UJTA 5D7JB 3FN3A 3ULVL 5CEYA 1U8IA 1G0XA 3K0WA 1YMMA 3KJ4B 3BESR 4PTTA 1IAOA 4MMXC 2YWYA 1UFUA 1DQJB 5SX5H 4XC1H 3QG7H 1H8SA 5BV7B 1DANU 1RUPH 4XWGL 1R3HB 3RJQB 5BMFL 3P11L 3ULVE 2HJKA 4WFGD 2EXYC 1I7RA 4NNXA 2HYMA 3G04B 4P9HL 4FXKB 1J0IA 5SWSE 1HCFX 5I1GH 1K85A 1Q94B 4RGOH 4LU5L 3B5GA 3QFJB 4NOBA 4QHUB 4HUVB 4FQIH 2ESVD 5ERWA 5CIPH 1FVCB 3BZDA 3O41A 4L8BA 3CFKA 5HYSG 3RL1A 4P5MA 1ORQB 2VZSA 5C6PB 1KNOB 3MV8D 5I30L 5DHXB 1JNHB 1ZEAH 1JHTA 4H25A 1B6UA 5JZ7C 4OFDA 1VFOA 2UZXB 3BKYL 4X9HA 5LGJA 1Q0YH 4D0DB 2FX7H 4M5YL 2V2TB 3IKKA 3PQYA 3BWUC 4G6JL 3TBVA 4KQ3L 4P4RB 5GISL 1A4JA 2EH7L 1NKOA 3PWUB 4I2XA 4S2SA 3UTTE 3FO1A 4OLWL 1JF6A 4KROD 5ACZA 4PRPB 3MGAA 4KKLC 3ARFC 2BCKB 4HBCL 3KLAB 4JDZA 3HB3C 1PY9A 3MLTB 2VOTA 4MNGE 4W68A 3VWKD 1FCCA 3V0VB 1F97A 3FQWB 5DZLA 5DJYB 1V7NH 1S9YA 2PW2A 3RTQC 4TOYH 5HVHB 2ADIA 3C6LD 5IV2A 4AYFA 5JXAH 1RZJL 1G7IB 5D7JD 1AD9B 3MV9A 4KRPC 2WQRA 1AQDA 2WP3T 4X5WB 1YEJH 3G5YA 1PVHA 4K7FA 1AC0A 3LN4A 3NIGE 4MD4A 4IOFD 4OQTH 1KJ2A 5FYJL 3C60B 4JQXC 1QSFE 4MAYC 2CJUH 3F5WA 2CKBB 5DUMH 3FTGB 2PXYB 1ZAGA 2VSDA 1CI5A 1T89A 3QXVA 4WI3A 1ZLUH 4P5TD 3CJJA 2HWZH 1E4XL 4G8GE 5F9DC 4XTRC 5FYJE 1J1OH 3R0MA 4PP2A 1C5DA 5JOPD 3ZDXF 3QFJD 5EO9A 4Y19E 4R9HA 3VXPA 4MS8C 5HYQB 3LEVH 5IQ7H 5HHVH 1FNAA 5F7DB 1BQLH 4I4WA 5DLMH 4OCRL 3RVVD 3QO0A 4P2RE 4X9IA 1CDBA 3QIUA 1N59B 1NCAL 4JDTH 1S9VA 2R23A 3L3DA 4G8EA 4NQUA 3OR6A 1UB5B 2Q8AH 2A2QT 1JZ7A 4HX1B 3VFMB 1W72L 2GUOA 2GCYA 3RVWC 4POYA 4QHLB 3ESVF 3O6KH 3GJFK 4XH2A 3U46A 4GQ9L 3O6MH 2Q87A 4U6XA 2EXWD 5E4EC 3GSUB 43CAA 2B0SH 1R24B 2A6KB 2BNRB 4K3DH 3QWOA 4KTEL 4P48A 2DQDL 4GG6F 2EC9T 4PJEA 1GIGL 5FFLA 4L3CA 1KJ3L 1WT5C 3DOSA 3FFCB 5EUKA 3AM8C 3S3JA 4F7CA 4Q9QL 1FFQA 2FH8A 2HTLD 5GGVH 4D94A 1DDHA 1DUYA 1YN7B 1A2YA 1DN0A 3ARXA 5D7IA 1BJ1J 4IRJA 4ODHL 2VXVH 5IFHL 1QP1A 1MIEL 3H7BB 4JFYB 2HJFB 1R5VB 3BPLB 2IBZX 4CNIA 2DIJA 3KLHC 4LARH 3QAZC 4RNRB 4X7SH 2BVQA 2AGJL 4EQ3A 3DBXB 1PG7W 3QEQB 1OAZL 1OWRM 5I8CB 1IAKA 3K80A 3MBED 2OYPA 1GAFL 4XHJD 4AG4H 1LE5B 4JFPB 4O2CB 4JGJA 4OD2B 4AM0A 1II4E 1QD0A 2VLME 3OKLB 2OP4L 1V3KA 5BV7H 1N8ZA 5EOCJ 5C0JA 1S7UA 2CRIA 4PGCB 1CDIA 3MLSH 1CLYL 5F71A 3OKMB 1LEKA 3CAFA 3FOLA 1AXSB 4BH7A 4M9OA 1BX2B 1HDMA 4HUXA 1G1CA 2YPKB 4DFIA 5EBMA 1A9EB 3MRPB 4B7LA 5IESH 2P8LB 2P8PA 1CGSH 2NNAB 1OGAE 1MI5B 2WWKO 5D4QA 5IGXH 3OGOE 4PJFA 5FHBH 1U42A 2CMRH 5I1DA 1FN4A 2I9LB 1DVFA 3AREB 2BNRD 2VDRL 3GSWA 3NH7L 2EYTA 5DT1L 2C7UB 2VITA 3QCVH 3GBNH 4HKZA 1T1ZA 5FUCE 3FFCD 2A6IA 2XV6B 2AJUL 4MD0A 1IQDA 4FQHB 5HYJA 4LCIL 4GBXC 4PJIA 1UJ3C 1FL3B 3FQUA 1MQKL 1TCRA 4U6HB 5C08D 1LO2H 2IH3A 4ERSH 3FMGL 1QVOB 3QDGE 3C6LC 4GFTB 1LEIA 2OQJA 3N1PC 4MHHG 5FHAH 2A0LD 5DJ0B 5SWZE 3T08A 2X5PA 3UMTA 5JW5B 2HAZA 3ZE1E 4Z78A 3DX6A 4ONOA 4X80L 2DN7A 4Y4FD 1A6ZB 1UENA 4P5TC 2P8MA 1NFDA 2CKBH 4NJAH 3RY4A 1M6OA 4NT6B 5GGQH 3JV0A 4K71C 3CMOH 1NC2D 1B9ZA 1VHPA 2Y25A 1YJDC 3CPLA 3DV4B 4MJ6B 4BYHA 3LOWA 4E0RB 4XNMB 5IB3B 4AY0A 4J12A 4NPYA 4C55A 4KUZH 1CE6B 3CD4A 4WHDA 4RGNE 5GSRA 4TUOA 5EC1B 5C0AB 1FVEA 1K6QL 3TT3H 5D2NB 3B9DA 1HH6B 2AJZA 1JGUH 3MCKB 3BGFB 3D85B 4DGIH 3SDDB 1CDCA 1U3HD 4PJHF 1EEYB 4HZLA 3R1GH 4LPVA 1PG7H 5EBWA 4Z5RB 4OKDA 1FV1A 4LLUB 1XGPB 3U83A 2UVFA 3WDHA 3DYOA 4NM8L 5DD5L 5AWNL 3O6LH 2RFXA 1HEZB 5D7LE 3UYOD 1C1EL 1BP3B 5C07D 3GMMB 5DJDB 1KXTB 1S8DA 1BGXH 4Q6IB 2DLFH 3BP7A 2DKMA 1F5WA 5F9JB 2X1PA 1LEGA 2XWJB 3HRZA 4X6FA 2NY3B 4HJGB 4LSPH 2EDNA 2OTWB 4ZPVB 5E9DB 4KDTC 4UQ3B 2WSKA 3D87B 4NC1C 5DHYB 3SQOH 3U7YL 4Q6YA 3HKFA 4IM8A 3PL6B 2QSCH 3KG5A 1R3JA 1NEZG 3IFNL 3MBEC 1BBDH 1RJLB 1CGXA 1B90A 3JSSA 1YEEL 2NW2A 4XMKL 1LO0H 4KKCC 3SDCA 5L7XH 5KJRL 4G9DB 5DQDL 1GGCL 2EEAA 1AY1L 1W8OA 1C12A 3MRDA 3PWNA 3VXMA 2IFFH 1BD2B 5EPMB 4Z7WB 1RK0B 4QXGL 5DJCB 3TVMB 2P42B 2ED8A 3MRCB 3MRQB 4XCCH 2Z93B 1NAML 1T7WA 2FJFB 4OBRA 4BA8A 5C2BL 1U8PB 2WANA 3SCMB 4NO0A 3SKMA 1UXSA 3B9EA 1S7XB 3QDAA 3ZHDA 1UVQB 5F97E 1F90L 3O4LB 1U92A 4KKAC 3SDDD 2GJJA 4NZDA 5L2KB 2YC1B 1NBZB 4F7EA 1H3XA 2PETA 2R8SH 1M05B 4WNQB 5FECB 5IJVA 4UDTA 3ZYIA 3DURB 1MF2L 1NGWB 5HGGS 1BQHB 1F2XK 1KTRL 5HYIA 1UJ3A 2YN3A 2KQNA 4M3KB 1KYOJ 3SQBA 1TPXC 4DQOL 3OKYA 5T1KA 2AV7B 1WCQA 1FYTE 3RVTC 2C26A 1UM6L 2M2DA 1FZKA 5E8NA 4HGKC 2YRZA 3P30L 3UX9B 5I6XB 4NQCA 2NY3D 4L4TA 5D7SH 2E7LC 4QYOA 4FQQA 1QFUH 2WLYA 1A6WL 5MEOB 3G9AB 1I85A 5FYJU 5IWLA 3PL6D 5E6ID 1W8NA 3HA0A 4B5EA 3LEXA 5CINH 1ZVYA 2BVOA 2KPNA 3WJJC 2JLLA 4WCYH 4R7DA 4OFIA 4Y4FC 2CGRL 4I3SL 4DUXA 1DQLL 4HJ0C 3EYOA 4F3FA 4WWID 4WTZA 5GRWA 1G7PA 3TVMD 4LFHG 1I8KB 4RAUB 3EO0A 3CDGB 4ELKA 3HUJA 3KHOA 5F7WC 1MHHB 3MUY1 5TH2A 4HHAB 4HIJA 3SDXB 1JPGB 1QLRA 1S7RA 2V5MA 4EUPA 3VG9B 4XB8A 4XP4L 5C0CA 1E4WH 3MUGB 5SWQA 3LH2H 2BXZA 3NCEB 4XZUB 3E8UL 1I1AA 4P3DA 1L4IA 4JPWL 5L2KD 5HVGB 3ZDZE 3U30B 3GSNH 1MFCL 5J1SC 4QWWC 3OKKA 1I9JL 4PJBA 4G6AD 4PY7A 2F19L 1NSNL 4U1NA 1WAAE 5FB8B 5E2VL 1F8TL 2YBRA 1MAMH 5D1QB 3SE3C 1IAIM 1KEGH 5GRZA 3PXHA 4N90D 4BQ6A 2DRUA 3MLVH 4OLVH 4PBWD 1JZ8A 3O11A 1UWGH 3KAAA 4FTVD 4UOJA 3BGMA 1HINL 3MA7A 1AO7B 4HAFA 5GRVK 2QV2A 3RGVA 3TA3A 2FSEB 3EZJB 4HIIA 4JR9L 3ZE0F 4EI6A 5CGYD 2VLKD 5DRZB 3VXSE 2XXCB 3CVHA 5F21B 5EO1A 1C16A 1OT2A 4KJQD 4OF5A 3UDWC 4OLUL 2G2RB 5C0BE 1MJ7H 1CGWA 4I0PB 4JM4H 3BSZL 4LLWB 4ETQA 1A47A 4OD3L 5L9DL 2ZOKB 5I2IA 4ORGB 1ZS8A 4CW1B 4PJ7F 4XXDB 3S35X 3WLBB 2FECI 3D69B 4ZFGH 4OTXH 4LLQB 3OJMB 1JWSA 1IEHA 2BSRB 1G7JA 1GGYA 1P84J 1DE4B 1CLZL 5ADOH 4PGZA 4JO4L 3SE8H 3MLYL 4CGTA 3JWDC 1REIA 5IF0B 4FNLL 3UC0H 3C8KB 1G0DA 2QQLL 5DJ2B 5J13B 3U7WH 2VR5A 4NKDA 1QFWM 4LVHC 4PRAA 4YDJA 1CD1B 2CQVA 3BFOA 3RY6C 4GSDL 3SKNA 2IPTH 2JCCE 5DEFB 5D2LA 3PWPA 2FGWL 3EYFB 5ACLA 2VE6A 4KI1A 5KSBE 1J8HB 4GUPA 4GJTB 5CJQH 2ZKHL 3IDNB 1BF8A 3ZT6A 1SYSA 5LAXB 5JHDD 2OLDA 1INEH 4O5LL 3GIVB 3ULUD 2XTJB 4JRXB 1PLGH 4OM0H 3WD5H 2E7LA 3NCCB 5BS0A 3CDYA 3E6FA 5CEYB 1U8IB 3O6FA 2B5IB 1YMMB 3IXTA 4I0CC 2BC4A 3DTXB 1L7TH 4PTTB 5GGRA 1IAOB 4WGVB 4KV5F 1S7WB 1TZGH 1YC7A 3H8NA 4G7VH 4UQ2A 4Y0GA 1E4KA 5HHOE 5AUMA 3RU8L 3ZYZA 2HJKB 5CFHA 3HG1D 1I7RB 4NNXB 1IT9H 2OZ4A 2BDNH 3E0GA 2WIIA 1JV5A 1NC4A 4MQXD 3HMWH 4KK9D 1F58L 2EE3A 5DJAA 1EO8L 1WIUA 4D9RE 2VLRA 5ERWB 4R97B 3WUWG 2W9EH 5GGRY 3O41B 1QACA 4L8BB 3HC4H 3E2HB 3CFKB 3RL1B 4P5MB 4KAQL 5BJTA 3TO4C 3ZE2E 1A14L 4FQJH 4H25B 1JHTB 2FB4H 5JHLL 1RJCA 5LGJB 3JV6A 3PQYB 4R26L 4HULB 3TBVB 2AK4D 4ENEC 4RGMB 1A4JB 1MEXL 5B38A 5DJ6A 1MCHA 4KK5C 1AFVL 3GSXA 1QLEL 2ARJQ 1YYML 3OF6A 3X3FL 4Z7VA 1C08A 3MRJA 4I2XB 3OWEA 4S2SB 3BZFA 3X3GH 6FABL 3FO1B 2R29H 5ACZB 3BDXA 5K9QG 5IHUL 2YRLA 4JDZB 1J8HD 3SE3A 3WLWD 5E2WL 4XNZB 5H37G 3RUGF 3IDYB 3EW3B 2V2WA 2XTJD 2ZUSA 3C2AL 1EBPA 1S9YB 2PW2B 2DM7A 4AIXA 2ADIB 3NZHH 5IV2B 1JHLL 4XPGH 4IJ3B 2B1AH 1DEEA 3MV9B 2FECL 1AQDB 4MNQE 1YMMD 4K7FB 2DBLH 4OT1H 3LN4B 3INUL 4MD4B 2YD8A 2D0HA 1KJ2B 3PUCA 4ALAL 3F5WB 3ULUH 2ZUWA 2GK0A 2ICWJ 3H3PL 4Y7MA 4FQLL 3UO1L 3O2WL 3RI5K 3GBML 3GGWB 2XQBL 1MPAL 2IBGA 4K23L 4PP2B 1C5DB 2OMNA 2NY2B 5EO9B 4HPYH 3SN6N 3VXPB 1IGFL 3F12A 4KJPC 5HI4C 5HD8C 4KJQC 5H35A 4I4WB 4R90L 1TZHA 3LDBC 5FV2A 5IVOA 4OSUL 3DSFL 3I6LE 5EUOA 3D39A 3QO0B 4X6CB 3QIUB 4XC3L 1JTTA 1S9VB 2R23B 3L3DB 4NKMB 2J88H 4G8EB 3G6JF 3OR6B 4PD4K 5J12C 2C3GA 1J7VR 2O93L 2Y07H 4L1HA 5T1LA 4PV9A 3T2NL 4F58H 2WBJC 2GUOB 2GCYB 2JJSA 3BIKA 3U46B 4XH2B 4ZNEE 4U6XB 2D9QB 2X4UA 4G6MH 5D7IF 3RI5F 1JGVL 3LHPL 4QNPE 5F7KC 43CAB 2D7NA 2BRRH 4W70A 1P4BH 3IDIA 5E2TL 3QWOB 3MCLL 4ZTOH 5IEKA 4PJEB 4AIOA 3T3MF 4L3CB 5GS2D 5EUKB 1Q1JL 1J12A 4F7CB 3FT3A 3QB7C 3MXVH 5IVNA 4OCYL 4JY5L 5FCUL 3JWOC 2I60H 1DDHB 1DUYB 5DMIH 1A2YB 3CZJA 4OLYH 1ITCA 5CEZH 1DN0B 5D7IB 4PJXA 3MV9D 4LSSL 4IRJB 5GRJH 1YPZA 2PTUA 2VN4A 3GM0A 2UZIL 4TRPH 4CNIB 2AXHA 1GXEA 4XNYL 5HHPA 1INDH 1IVLA 2BVQB 1ZGLA 4H20H 2VDMH 1NGZA 1IAKB 4U1JA 4K7PL 4C4KO 4IRZH 4NHCH 3KJ6H 4YBLC 3V7MA 4EBQL 4Z7NF 2IANE 2ZCKL 3M1BA 4V2BA 3C5SA 1B4JH 3SDYL 3EJJX 3MC0A 4HJJL 4Y4HA 1NMBH 1MCRA 2NY2D 3SGEH 3IKCA 4O00A 3OZ9H 4R8WH 1N8ZB 5K9KA 1S7UB 4NQEE 3KPMA 4U31A 4K94L 1HYSD 4GXVH 2NX5D 3MLWL 5FO9A 3KPSE 3BDYL 1LEKB 4YHKH 2OJZH 5JXEC 3FOLB 1Q9OA 4BH7B 4Y16A 1HDMB 5FAAA 3VFWA 4GQPH 4HUXB 1NGQL 5EBMB 2QADC 1MSPA 3I3EA 3LSOA 4PGJA 2IADA 2GFBA 1ZT1A 4OB5H 2YA1A 3RAJL 4PJFB 4Y5VC 1AGFA 5LQBL 5I1DB 1FN4B 3MV7E 1DVFB 3MRNA 4HWBA 3JVGA 1DBJL 2BVYA 3GSWB 5E4IA 1I7UA 3GI9L 2EYTB 3LKQA 5I1JH 2VITB 3V7AG 4HKZB 1T1ZB 5GSVB 4Q9RL 3IVKA 1I3VA 4U1KA 4MD0B 1IQDB 3WLWC 1ZWIA 5HYJB 3QNYA 5IVXE 2QHRH 1WC7A 4PJIB 3FQUB 4ODUA 1FLRH 2ITDA 1TCRB 2JIXD 4Y2DA 3S4SG 3V7AE 3IFOA 4A2LA 4IRJD 2IH3B 4L8SA 2VXUL 1CGVA 3AAZA 5F1NA 1NFDF 1LEIB 2O5XH 2OQJB 3WIHA 1U2CA 3GHEH 1IAIH 3NCMA 4RFOH 1ETZA 3V6OC 1T2JA 4J8RA 3GSQA 4J4PA 4XVJH 4Z78B 4R96A 1QZ1A 4Q74A 3DX6B 2ZCLL 2EZ0D 1BJ1H 3EOTL 4YAQA 1TCMA 2PCPA 3D0LA 3IFLH 3MMEB 4JFHE 5DD1H 5H8DA 1KJ2H 3UYRL 2P8MB 3OB0H 4U7MA 1NFDB 4O9HL 1M6OB 1EAJA 5MENE 2H8PA 1D9KC 1X6LA 3QA3A 4PJDE 5JR1L 3CDFA 3O0RL 3CPLB 1G9EA 1OM3L 4QRSA 4TSAH 4OIIH 5DQ9A 1T03L 3IFPA 4NPYB 5KAQG 1A7PL 3QXAA 4KDWA 5GSRB 4TUOB 4MA8H 1FVEB 4J6RH 5A1AA 5ADPL 2VISA 2AJZB 4RFNC 5HHXL 2Y6SC 3CLEH 1MRCH 4QHNA 1TENA 3ZTNH 1DVFD 4GAJH 4M6NL 4G9FE 4HZLB 5ISZA 3T3PF 4I8DA 4LSRH 4GS7B 5EBWB 4C56A 2GSGA 1FV1B 5C09A 4I18A 2IBZY 5F93C 3UTQA 1PDKA 5HYJD 1MCWM 1VKXA 2R0LH 3RIFK 3MNVA 1QFWH 2DMBA 3MRHA 5GPRA 2EH8H 3EDJA 1S8DB 2XWTA 3BP7B 1AQKH 4GKOA 3UAJC 1LEGB 3HRZB 1UKSA 1JGEA 1FSKC 4X6FB 5A2LH 5LWYH 3UROR 1CVSC 4YX2L 4LLDA 3LQAC 4M48L 3C8HA 1N26A 4KQ4L 4WW1A 1R3JB 4U49A 3BJ91 4NYLA 4I0KA 4QOKA 3VGEA 2Z8VC 5F9OH 5I76A 2NW2B 3F65A 4HQQL 2EEBA 3SDCB 1TZIA 1C12B 3MRDB 4GKNA 4OZGA 3PWNB 3VXMB 1T7YA 3RIFF 2RR3A 1K4CA 3FRPA 2FHFA 3OAYH 1J10A 4JG0L 4UINL 4TPRL 3VE0A 4P46C 3VXUE 1HYSC 5L6YH 4I48A 1NUDA 3ARRA 3QH3A 4ZUTA 5T5NF 1SJXA 3H0TA 5F1SA 3U2SA 2X4OA 4NO0B 3SKMB 4F7TA 4CL7A 4U6VH 1BWMA 3VXOA 1WTGT 3MQIA 1U92B 5E24E 1VGEH 4J3SA 5DO2D 3C5ZC 2X89D 3I2CH 4F7EB 5IJVB 4UDTB 4EI5A 1U8JA 4X4ZA 3SKJL 1IBGH 4XMLL 4X6DA 2CK0L 3TIDA 1KXQE 1UJ3B 4NM4L 3PDOA 4BZ1H 4PRIA 2VN7A 3L3GA 4JO2L 4X4YA 5T1KB 3P4LA 4NQDA 1IFHH 1OHQA 4RRPA 5J6HA 5I1CL 1FZKB 5E8NB 1N64H 1MJUL 4NQCB 4JHWH 3KR3L 4OUUA 3VA2C 4ZUWA 3QPXH 4QYOB 4FQQB 3WYRA 1EDQA 5TQ0H 3NZ8A 4JZNA 4RBPK 2B4CL 4M03A 3LEXB 1UCTA 2BVOB 5DUBA 3S34L 3WXVL 1P1ZA 4R7DB 4YDLB 1S5IL 1MFAH 1P9MA 4K71B 3SDCD 3CSBA 4KI5F 1CDYA 1HHKA 4Y5XA 3EYOB 3RWCA 1KB9J 1G7PB 3A6BL 4LASH 3EO0B 2DI8A 3IU4L 1R0AL 4OM1L 3EDEA 1P69B 4ELKB 1MWAL 3HUJB 5GRUH 3SPVA 4XHQA 1DP0A 3IF1A 5TH2B 3DGGA 4HIJB 4RMQA 1QLRB 1S7RB 3ROLA 4EUPB 1JHKH 4LPYA 3RL2A 3TF7C 5C0CB 4LCCC 3SO3C 3UJIH 3FOMA 4M4RA 5SWQB 2AJYH 1I1AB 2CRZA 4P3DB 3A6CH 4UBDC 1DLFL 1FGNL 3W82A 4OZ4A 2ZSVA 4WFHE 5CJ8A 3H6JA 5E8OA 4U1HA 4PYHA 3BOVA 3OKKB 3BPNC 4PJBB 5I75C 3MJ8A 2W65A 2OR9L 4U1NB 4PJ9A 4K8RC 3S5LG 4PJGF 2YBRB 1IILE 1HQRA 2OCFD 3MACL 2P5EA 5T1KD 2EKSA 2CK2A 4O58L 4GW1A 4M7JL 1Y18A 3DXAA 3QG7L 4XC1L 1WFNA 4L4TD 3O11B 3P40A 3OPZH 1MCFA 2CDEA 3M8OL 3BGMB 3VRLE 3MA7B 4JN2B 3MRRA 5F8RC 3MBXH 3RGVB 2LTQB 3GSRA 1M7IA 1OPGH 4RGOL 3TA3B 3VFGH 2XKSA 4HIIB 5FA3A 3CXHK 4FQIL 4EI6B 3VFSA 3UCRA 2NXYB 5IR1A 1NMCB 3CVHB 5EO1B 2YKLL 1TJHH 1C16B 4Z7OF 3BN3B 2E9IA 1I1YA 3S36H 1UXWA 1ZEAL 3CVIL 2HVJA 1SEQL 4X5LA 1CFTA 2VDPH 5C0IA 4ETQB 3RVUC 5I2IB 2FX7L 4M1DH 1ZS8B 4PJCE 3VFPA 2AJVL 2JE8A 5B39G 3VH8G 4DWHA 1UM4H 5MI0C 1OAKH 1MCWW 5DUPL 1JWSB 1GZPA 2C4XA 4K3JH 3JTSA 4NN5B 4PRHD 5BO1L 2ZWLT 1H5BC 3ZHLA 1S78D 4HPOL 2DTML 3LMJH 3B8SA 4KI5D 4WI5A 5AYUH 1I1AD 1OQOA 1FNHA 1L0YA 3QFDA 1NJ9A 3C09B 4JFXA 1YA5A 1GPOH 4NKDB 4PRAB 4XX1G 4YDJB 2D4DA 2Z31D 4HGWA 4ODXA 5IHBA 4HLZG 3SKNB 2HKFH 3ARBC 4EEEA 4RMRA 5D2LB 3BIAX 5DO2C 3MRFA 3PWPB 3FN0H 1TPXB 1V7NL 2VE6B 4P2QA 1MVUB 4TOYL 2VZUA 4GUPB 1J87A 3T1WA 2ZCHL 3MX0A 3MOQA 1CXFA 1YEJL 1SYSB 1Z9MA 4BQCA 3UJJH 3WS6C 2Z8SA 1HCVA 2AKRA 5IBLC 4CMHB 5DUML 2J1KA 4R4ND 4YEFA 4LEXH 4P2CG 5BS0B 3CC5A 3E6FB 4K55A 5ID0A 1KCSH 3O6FB 4N9OB 3IXTB 1ODAA 1ZGLM 2EO1A 2BC4B 3TLRA 5GGRB 1RUAH 1LK3H 3TA3D 4UQ2B 4M61A 2OSLA 3T0VA 1N6UA 1VEPA 1ZSDA 1QNZH 5BOPA 1RUQH 5AUMB 5IQ7L 5HHVL 3RZWA 4TULL 4NZUL 5JQHC 4R4FL 4WUUA 1CDJA 2WIIB 1JV5B 1NC4B 4ONFH 3RWDA 4JDTL 5DJAB 2HH0H 2VO5A 1QFHA 2MQ3A 3AY4A 1JRHI 2GTWA 4W4OC 1YEIH 4Z7VF 2VIRA 1UKQA 1YUHA 2YR3A 2Q8AL 5BJTB 4WFGE 4GXUM 5E03A 1P2CA 2X1XR 4GLRI 1H3PL 4EOWL 2JF1A 1KC5H 1YJDH 1M7XA 3O6ML 1FZMA 2ESVE 4P9MH 3JV6B 2R4RH 2B0SL 3T09A 4K3DL 3GI8H 3MV8E 5B38B 5DJ6B 4XPTH 4Z7VB 4A6YA 3RVXC 1C08B 5TPWL 3MRJB 5C6WH 1NBYA 1IC5L 2EE9A 3P3YA 5EDXA 4DKFH 4EUPH 1LE9A 3DVIA 3HMXA 5GGVL 2FLBT 3HI5H 1JNLL 4I77L 2DQIL 2PO6A 3LV3A 4L4VA 2X4SA 4KK8C 1WBYA 1H8NA 5KZCD 5I71C 2VXVL 2I9TA 2WNGA 2PYEA 3PXJA 5C6TL 4YHOH 3BQUC 4L4JA 1M1SA 1EZVX 1JIBA 2V2WB 5I1KH 2AQ1A 4G7YH 1JJUA 2V9RA 3FRUA 3MZGB 4FG6D 2IG2H 4U1MA 3WNMA 1DEEB 1OSZA 5EZOL 4F9PA 5JQ6L 1MIML 2VXSL 2LABA 1FAIH 2LFGA 5FUZL 4P3CH 4QF1A 1S7QA 4DOHB 2GK0B 5BQ7A 3CSPA 1N2RA 5LCVL 5I73B 1K8IA 5K33A 4LSVH 1CF8H 3BP6A 1AJ7L 5CJOH 3SOBH 3A6OA 3QDMA 3AB0C 3WV0A 3F12B 2VLRD 2MCPH 3SJVD 2GT9A 2NTSP 5H35B 4OCNC 1BF2A 1TZHB 4NWTH 2DLGA 1JWUB 5EUOB 1GOGA 3CVHH 4GRWF 1BIIA 1UT9A 1X6NA 4YUEL 2FYYA 1H5BA 2I5YH 4HMCA 3RHWF 5M7QA 3KXFA 3UPRB 5J6GA 5JOPE 3QFJE 3S3SA 2LU7A 2CMRL 5T1LB 4PV9B 3GMNA 1S78C 5F7HA 1TQCC 4KI5C 3DVGA 3BIKB 1A7QL 4NUGH 2BJMH 1RFDL 4GRWB 1NUGA 5I0ZA 4N5EC 1V05A 2X4UB 4HXAH 4PJXF 4IMKC 2BZDA 1YPZF 1OL0A 3BD3A 3IDIB 4JANA 2Z31C 2VH5H 3NIDF 5IB2A 5IEKB 3RWHA 2R69L 4IRSA 4ERSL 2CLRA 3T4AA 4K07A 3FT3B 3IXAA 4RMVA 1JRHL 2R4SL 4E9LA 5FHAL 2APWA 5AZEL 4PRPE 1D7FA 4M7ZC 5AAWA 3C87A 3L1OH 4BFBD 1R3LA 3O9WA 3RBSA 3NIGF 2WMPA 4PJXB 1A7NH 3I3BA 1YPZB 4HF5H 1U6AH 4ZAKC 2XZQH 4X6EA 3ZSSA 5HHPB 25C8L 2D7MA 1AGDA 1ZGLB 4NN6C 1NGZB 4U1JB 1UCBH 5ITBH 3GMRA 3PABA 4YHYC 1CFBA 4JM2C 5GGQL 4QKXB 3C5SB 3BD5A 4Y4HB 3BX7C 4UB0H 3BN9D 3IKCB 2FX8H 4KUZL 5K9KB 4LPTA 4NN7B 3D39D 3O3EA 3ILQC 3KPMB 3W0WA 4FOMA 2D03H 1PG7X 4X4ME 2OZ4H 3TT3L 4PJAA 2J3SA 2GHWB 5F7EL 5FO9B 3UBXA 3S88L 2YA0A 4MWFA 1Q9OB 2CUHA 4Y16B 4OF8A 4H0HB 5T1LD 3VFWB 2A73A 4I3RH 2WM0A 4WTWA 3QI9A 1M4KA 4XVUD 5JTWA 4HDIA 2XKUA 3LSOB 2IADB 1ZTXL 2GFBB 1ZT1B 4N0FA 4QRPA 3G6AA 5DC4B 4G6KH 1ZVHA 1AGFB 3F6IA 4LSTH 3MRNB 4R2GB 1KPUA 3ZDXE 2DQFA 1I7UB 1RZGA 1TFHA 1J5OH 4ZO9A 3LKQB 3CIQA 2G5BA 3IVKB 5I0DA 3Q0HA 4U1KB 1ZWIB 1I8IA 5DK0A 3QNYB 5D5MF 5IMMA 5JMRA 4QT5A 2VC2L 5F7FA 1PX4A 4ODUB 2BNRE 5TE6H 1KB5A 1X5JA 4Y2DB 3IFOB 3SQOL 5BVPL 2J8UA 4PG9A 3J7HA 3AAZB 5F1NB 5IMOA 1TMCB 4FG6C 3FHQA 3FFCE 4JZJA 5CMAA 1E6JH 3ARGA 1BBDL 3OXRA 3PHQA 1NEUA 1U41A 4NJ9H 1ETZB 4J8RB 3GSQB 3T0EA 5C08E 4HKBA 3BMWA 4R96B 3MOBH 3BKCL 2PCPB 4Y4HD 3QG6A 1TLKA 1PSKL 2E27H 1N6QH 4GG6E 4RCAA 8CGTA 3HPLA 3LDBB 4RISH 2ED9A 1H3TA 1K3ZA 2Q86A 1K2DA 1E0OB 2H8PB 3QA3B 3AU1A 3B5HA 5C1MB 3HE6C 3ALXA 4DK3A 4ZSOA 1IGIL 1T4KA 4G8GD 4N0YH 2AS5M 1J8KA 4QRSB 2DMKA 4MB5A 4WW2F 4LCYA 1SHMA 1A6UH 5DQ9B 1ZLSL 3IFPB 4FQ1H 4Y16D 3QXAB 3F7YA 2NLJA 4F57H 2ZUYA 1IEAA 4JVPA 2BY1A 4F15B 4M5ZL 3TT1H 4P2RD 2KH2B 2YMXH 5D6DC 4P59L 2VISB 4MLSA 3L95A 2R0WH 4QHNB 5HDQH 4LF3A 1F00I 3V4PH 2FH6A 4R2GD 5ISZB 4HXBL 3GRWL 4C56B 2GSGB 4HS8H 3EOBA 5C09B 3TYGH 4LCWA 4I18B 1FL6A 3UTQB 1YYLH 4Z18A 4KGLA 1VKXB 4PGBA 1QFUL 1T6WA 3MNVB 1XGUA 4QTIL 3EDFA 3MRHB 5KVDL 4LVOB 4Y2DD 3B9KA 1IL1A 2XWTB 4ZD3H 3L7FA 3TN0A 2B7DT 2JK5A 3MPCA 1T66D 5CINL 3V5HA 3Q2CA 2Y36H 4WCYL 3U0TA 4OZGF 5HXMA 4LLDB 1Z6JT 2NY0B 2X6MA 3TP4A 2J12B 5C07E 4WW1B 1N0XH 2LU3A 4NYLB 2X4PA 2UVEA 1PKOA 4QOKB 4ZFOA 1MY5A 2FWOB 5I76B 5KTEH 4KZDL 3O8XA 2DQUH 2E6QA 3BN9C 1TZIB 4ELMA 1XGYH 2ATPA 4GKNB 2XNAA 4OZGB 4Z0BL 4F8TA 1Y6NR 3F62A 4PUBH 1FIGL 1K4CB 3ULVC 3EYUH 1CL7H 1F2QA 1MELA 1MCKA 3LH2L 1UH4A 3VE0B 4LLAA 3VDAA 4I48B 4V1DA 3WFBH 5CBEA 3QUKA 3QH3B 4XBGA 3B6SA 4ZUTB 2DQEH 1QPXA 3H0TB 4F33A 2X4OB 4F7TB 1T6VN 3U2SB 3SGDI 2A74A 5ID1A 5GS0D 1IC4L 4P9HC 2UZYB 4ZXBC 3P0YL 3I3DA 4UAOC 1G1YA 3LAFA 5DMJB 5INCA 5ISZD 4EI5B 5BOZG 4OZHA 1FNSL 1U8JB 4HK3N 5D2NE 1SY6A 4XNXH 3RX8A 4X6DB 3K46A 1HHIA 1OGAD 3TIDB 5DVNA 4OFYA 3PDOB 1Q0XL 4ZDHA 3PF2A 3L3GB 3ARPA 4X4YB 3NGBC 1QYGL 4OGAC 1NLDL 1ZLVH 4NQDB 1U8NA 1D6EA 3H9YA 4ZOEA 5J6HB 4UMGA 1FZOA 3ET9F 3L3OA 4O02H 4OUUB 5EWIH 5F44A 4ZUWB 1EVUA 1MHEA 2BOCA 5DI8B 5CSZA 1PKQA 1NMAH 2NY0D 4RDQG 4RX4A 3NZ8B 4JZNB 4J3WA 4JM4L 1NCNA 1QPPA 1DCLA 5F3HA 4MA3A 5DUBB 3LD8C 1P1ZB 4NZRH 4BFGA 1P7QD 5HPMA 1BZQK 2GITA 1T83C 3OX8A 4ZFGL 5ICXA 5IW6A 1HHKB 1AKJA 1T20A 4Y5XB 1D3CA 3QUZA 1UADC 1GH7A 3OGCA 3RWCB 1RZJC 2GAZA 4R3SA 1K9TA 2LVCA 1BOYA 5DA4A 5DF0A 5L8KB 2DKSA 2PF6A 3UC0L 5D1ZA 4UOW0 3SPVB 3IF1B 3DGGB 5D6DA 3ARDD 3ROLB 3RL2B 1BD2E 5KOMC 2IPTL 3FOMB 4HFUH 5DHVA 4YXLH 3ARZA 1R3IL 4OZ4B 2ZSVB 4FZ8H 5D71H 3ZLQC 4EI5D 1DBBL 1INEL 4U1HB 5E8OB 5IB1A 1I9RL 4LQFH 4FFZL 3MJ8B 2EIDA 1PLGL 5GS0H 2W65B 5F72S 4PJ9B 3O4LE 1BQHG 3HE7A 4NRYA 4PRID 1Q72L 4JGUA 5ELIA 4QHKI 5L2KE 2DQTH 1HQRB 2P5EB 2EKSB 5TFSH 3K4AA 4NQDD 2PNDA 3QHFL 1TZGL 4GW1B 4N8CH 1S9WA 1Y18B 3DXAB 2D4FA 2EC9U 3BRFA 3JWOH 4APQC 3FT2A 4HUNB 2CDEB 1ZT7A 1IT9L 4IIQC 1T66C 3HMWL 3MRRB 2A6JA 4N90E 1NCCL 1M7IB 3GSRB 1F4WH 3FO2A 3VFSB 2W9EL 1E4JA 4M1GH 5C0RH 5EH1A 3L5IA 5IR1B 1H9VA 2UY7A 2C4FU 4P57A 4FTVE 1JNNH 4FQJL 2VZVA 3ZL4L 1AR2A 2SEBA 3WHE0 1I1YB 3MSPA 3U4EA 1UXWB 1YNLL 4FXGB 2HVJB 1CFTB 1HZHH 5C0IB 1G9NL 4PRBA 5JIIA 1FO0L 2VLKE 2B2XH 3EIFA 3G5XA 4GMTL 4H8WL 3VFPB 5F3BA 2OL3A 3MRLA 4KMLB 3L5WA 3U7AA 1GZPB 1RURL 3JTSB 3TV3H 2P48B 2D7TL 3RKDC 3KYKH 4W4NA 4XAWL 1OTTD 4Q7DA 3X3GL 5DJXA 3TJEH 2AK1L 3ZDZF 4FP8H 4NNPH 3BE1L 1IEBA 3QFDB 1NJ9B 4JFXB 4HGWB 4ODXB 3SDXE 5IM7A 3BISA 1BHGA 2V5YA 1WAAF 5AAMA 2H2PD 3MRFB 4CDGC 1DN2A 4P2QB 5LXGL 2MOVA 5IG7A 5MP6L 4PJ9D 1G9ML 3S97C 2W38A 2AJ3A 4XPGL 2B1AL 3KYAA 3U4BL 5D93C 4DVRL 4OF7A 3ZT7A 4OT1L 2YZ8A 4LGRB 4OUOA 1WZ1H 3OJVC 2P43B 2AKRB 3ULUL 35C8H 3LS5L 3DXAD 3CC5B 5ID0B 2A9MH 2V7NA 2W60A 4E5XA 1Q9KA 4NUJA 1IM9A 2WWKT 4N1HB 3LN9A 5FUCC 5DVLA 5JHDE 4R0LA 3ULUE 4M61B 2OSLB 2DQHH 4MB4A 3Q6GH 1IC1A 2ARJA 2XKNA 3G9VA 1OD9A 2YUZA 4WUUB 1MY7A 4JO1H 3AMKA 3RWDB 5CILL 4K2UL 3IGAA 1FNFA 2GTWB 2J88L 3HC3H 5HVWA 5FYKD 2RHEA 5SV4A 2VIRB 4XCYA 1YUHB 3UEZA 2Y07L 1VGKA 4F58L 3G08A 3HG1E 1P2CB 1IKNA 1VFUA 4C59B 1TTFA 2G60L 4LCCB 1FZMB 4G6ML 5MHSD 2BRRL 1MFNA 1P4BL 3ARDC 4U1IA 1JPSH 4A6YB 1NCDH 2JCCF 4FFVC 2PTTA 4TTDD 5I75B 1X4YA 1YEFH 4RFEA 5KSBF 1Y6KR 5DA0B 4LFHD 1FFPA 1LE9B 1RZ8A 2BOBA 4P2QD 4RGNC 5DMIL 2C3VA 5AG9A 4OLYL 2PO6B 4L4VB 2X4SB 1WBYB 3NTCL 5GRJL 2I9TB 2PYEB 1UYWH 4TRPL 2KKQA 2FEDC 3TH4T 4J2XA 4DK6A 3FRUB 1BVLA 5LJYH 2VDML 4U1MB 4MDIA 1BOGA 1OSZB 1J8HE 2NTFA 1XIWD 4ZUSA 2N7BA 2DQGL 4IRZL 2MFNA 3HR5A 3L5XH 4PREA 1B4JL 1TNNA 5SX4I 3QCUH 1NMBL 4K3EH 4YBQC 1S7QB 2XTJE 1AHWC 4FQPA 4CKVX 5BQ7B 3LRHA 1C5BH 1YNKH 3DX9A 1N2RB 1K8IB 4WUUD 3GHBH 1YMME 3BP6B 4GXVL 1A7RH 1YC8A 4OCXH 3I02A 5E08H 3QDMB 1BEYL 1FC1A 2DQCL 3ZE2F 2GT9B 2NY6B 2XT1B 1IGCH 1BIIB 5DK2A 2FYYB 1H5BB 4X8XA 5FGBA 4JJ5A 2AV1A 5J6GB 3KXFB 2X9WA 3I85A 1HSBB 5C0GB 3GSOA 4L9LC 2WV3A 4Y1AD 3GMNB 4KV5E 4Y8DC 2X41A 3BRDA 2NPLX 3DVGB 5I1JL 1RUMH 4X83A 3JV4A 4X7CC 4Q2ZA 5TQ2H 3BP4A 3K4ZA 1WEJH 2DJUA 3PQYE 4LAJH 4JANB 5BCAA 2ICCA 1KFAH 5I74B 2PO6D 3O3BA 5IB2B 4PJ8A 3H9HA 3RWHB 3VXRA 3WFCH 1AI1H 4IRSB 4LRIC 2H6PA 2CLRB 5IW3A 2NY1D 3T4AB 5HGDA 3IXAB 4UNUA 3T65A 1QTYT 3EJZD 2Y06L 4PJ5D 1R3LB 3O9WB 3H9SB 2DQJH 1QHPA 4DUWA 1I3UA 4ETYA 4XVJL 4LKCA 1Z5LB 2FD6H 5K9OA 3PP4H 1A6VH 4X6EB 4YJZL 4M3JA 1AGDB 1KJ2L 1B0GA 2AABL 2QJDA 3GMRB 4JLRA 4N8VB 4PJAF 3PABB 1WBZA 3MV9E 1Z9SA 2D7OA 3CLFH 3RX5A 2ADGA 3QDMD 1UWEL 1GGBL 4TSAL 2FBOJ 2WUCL 4XPHL 4MXQD 2FHCA 4XMPL 3HTLX 4BQ8A 3AROA 4E41A 3O3EB 4NOFA 1HIMH 1OAQH 5DD6A 3W0WB 4PLKC 4PJAB 2ZUVA 1GOHA 4J6RL 1A3QA 2WUBH 3UBXB 1RJZA 1TTGA 4MWFB 4RIRA 1W0YT 1BVKA 2A73B 4OCWL 1XT5A 2JB5H 3QI9B 2KL6A 3BPOC 2FATH 4LPWA 4HDIB 4QRPB 4N0FB 2QTEA 3G6AB 1JYXA 2NX5E 4EN3A 5FA4A 1B88A 1EZVY 1Y0LA 2DAVA 2ZG3A 3MLXH 2BXYA 1KPUB 2R0LL 2DQFB 5I1IH 1RZGB 4Y5YC 4X6BA 2NY5H 5IEHA 2VDQH 4IRSD 4XPFL 4A6YH 2G5BB 1OCWL 3IJYA 5EZIL 1PJ9A 4IDJH 3FQNA 3LZFH 1I8IB 5DK0B 1JVKA 1KIQA 5IMMB 4QT5B 3Q3GA 4KRNA 5CGTA 3LEYH 3HMXH 1KB5B 1HE7A 1OF2A 3G6JE 2J8UB 4PG9B 4RWYH 3KYMA 8FABA 5IMOB 1QRNA 5D72H 4RAHA 4J3UA 2EDTA 4JZJB 3ARGB 3IDGA 5FCSH 3OXRB 3WE6A 3PHQB 4K3GA 4M7LH 4PP1C 1CTNA 1KELH 1A02N 3S35H 1JMZA 3T0EB 5D7IE 4HKBB 2P47B 4LQ1A 5A3ID 3QG6B 2V6HA 3C6SA 1KEMH 2QQQA 2E3VA 2UUDH 4M62H 4WV1A 5CSGA 5ALBL 4HEPG 3IAGC 5I1HL 3HPLB 3PP3K 3BP5A 1ED3A 4TN9A 12E8H 1JFQH 3K2UH 1OARH 1K2DB 1V3MA 2IAMA 4OFKA 2Q86B 1CICA 3HS0A 2HLAA 1CE1H 3AU1B 4Y4KA 3V79C 1PZ5A 5J3HC 1E28A 4ZSOB 3W0WD 1NGPH 1T4KB 2FCBA 1C5CL 5LGHH 2VL5A 4LCYB 1PGRB 4U6VL 5CZVL 1VGEL 3FTGA 3F7YB 4HS6A 2NLJB 1NCUA 2PXYA 3JUYA 4QY8A 1IEAB 4Q0XH 1CQKA 4LP4A 3VXQA 4PLNC 4PIRF 1IBGL 3L95B 3IS0X 5ITFA 4P5KA 4Z7NE 3K2MC 4LF3B 4JFFA 4XWOC 3GKWH 1T2XA 2I07A 1TTUA 3P0VH 4F7PA 3U0WH 1VERA 2NZ9C 1OOAA 3EOBB 3MGTA 3NN8A 4LCWB 3SGKA 5IVXF 1FL6B 1N64L 3HAEH 4M7ZB 2QQNL 4JHWL 3UPCA 2K1MA 4PJFE 3DYMA 1BZ7A 4PGBB 1MHCA 3DHMA 1XGUB 2NY1C 2HG5A 5HI5C 1AR1C 3EGSA 3N9GL 4JN1L 4P23A 2FL5A 3B9KB 3VGGA 5TQ0L 1IL1B 4ESKA 1RUKH 1NUNB 2E6JA 3MRKA 5JIPA 3IDJA 3L7FB 2OMBA 4WI2A 3TN0B 1IE5A 2JK5B 3ZYJA 1EHAA 3V5HB 4UI2A 1FFRA 2VDKH 3ARGD 5HYJE 5DRWA 3U0TB 1UWXK 4JM2B 4PJIE 1LHZA 4LHUA 4MA7H 2EDJA 3QEGH 2Q20A 3T0ED 3V52L 4PLJD 1H0DA 3DYPA 1QR1A 3HZYA 3ISWA 1HYRC 2V17H 2P1YA 5FK9B 2X4PB 4ZFOB 2YXMA 4LASL 5I8KH 3VFTA 3NPSB 2Z0BA 3O8XB 5TJWK 1WUNT 4ELMB 2ATPB 3K8LA 1BAFH 3B3IA 2O5YL 2NY4C 5EO0A 5T3ZH 3WSQL 4HBQA 2Z4QA 3EYQD 4K3HA 4WENB 3UJIL 4TVPD 4L9DA 4U0RB 3HFML 4KJYA 5F89A 1NFDE 4V1DB 1JPTH 1WFTA 5CBEB 3QUKB 3TM6A 3GNMH 4L8CA 4XBGB 3B6SB 5KAQF 4F33B 5ID1B 3MNZA 3KPSD 4Q97A 3VW3H 1CD8A 3QUYC 4MAUH 5INCB 1FH5H 1FBIL 1HK6A 1KPVA 5FYLD 2DL2A 4OZHB 3CFCH 5CLWA 1YY9C 2M26A 5D96B 4BSWA 4LCWD 1DR9A 4FQXD 1HHIB 5DWUH 2CIIA 2MKLC 1IARB 4ZDHB 4XP1H 4UV4L 4UIKH 2J5LB 3OPZL 1U8NB 3B9KD 1IGYA 1D6EB 4MXWH 2DMCA 1FZOB 3L3OB 5F96H 5KVFL 2VNCA 4NZTL 1MHEB 3OAZH 2BOCB 3N0PB 5CSZB 1PKQB 4X8JA 1TJHL 1MREH 3U9UA 5C0DA 5F7NC 4XNUL 3EJYD 1KB5H 4KPHH 2C3WA 3GM8A 4P0DA 3S36L 1HKFA 4Y89A 3BEWA 5F3HB 3T3PE 2CDFA 4MA3B 2HLFC 4WHTA 5HPMB 1T2QL 3OX8B 1UM4L 4N1CA 3O8XD 5GZOD 5ICXB 2W0FA 3GK8H 5IW6B 3RBGA 2AEIT 1AKJB 1T20B 1LP9F 2BY2A 2CDGA 4K3JL 1F6FB 3QUZB 4OGZA 2YD7A 4YHIA 2GAZB 4R3SB 2XY1A 3LMJL 1DL7L 4H0IA 2BNQA 2VDLL 4JFHD 1O0VA 2V9QA 2D9CA 5AYUL 1WISA 5D1ZB 2E8ZA 4D3CH 3O4OC 3UTSD 3STBA 3VGAB 4HZAA 3TC9A 1GPOL 4JAMA 4XCEA 3WMSA 1U8MA 1HOCA 4XXCA 1OD7A 1ZA3B 4KHTH 4H1LA 5DHVB 3FZUD 3KPRB 3VWJD 2R0KH 3QR2A 2W9DL 1MCPL 2ZG1A 5F9WB 5IB1B 2ZUQB 3VDCA 1UA6H 3QWRA 1U2HA 4BUHA 2A77H 1L9MA 4MJ6A 1KSRA 3QRGL 4I1NB 5DQJA 1FE8H 4OFYD 4ZS6D 3HE7B 4NRYB 4EKXA 1F3JA 5AG8A 1KCSL 1KCLA 5HHNA 1J1PL 3BAEH 3W9DA 1BFVH 1CE6A 2BSSA 4WI7A 2C3XA 3GSNA 2XZCH 2V5RA 1DLHA 3ARWA 1RUAL 1S9WB 4XP9L 4OD1H 1QNZL 1KCUH 3FT2B 4WIQA 5EU5A 4UOW1 3REWA 2W92A 2IGFL 1F4YL 3AS3A 1TETL 1KN2H 2AI0H 3FO2B 4ZUVA 4LIQH 4NQCE 1YEIL 4L4TE 2AEPH 4P57B 3EOAA 3PP3H 5DRNA 1U36A 2SEBB 5E5MA 3U4EB 1AKJD 3DUUA 4YHLL 2BHYA 2HMIC 1OW0A 2YPLA 3QUZD 4PRBB 3MLZH 3CMGA 1T7XA 2E7MA 4WTZG 3MRLB 2GTZA 5E9DA 3UTPD 3L5WB 5D1ZD 4XPTL 4YE4L 3SDAA 4OF6A 2YUWA 3PNWA 4C83A 1KENH 4C4KT 4M6MH 4CN1A 4JQVA 5SX5K 4OFPA 2AP2A 3QIWA 4X9GA 5DJXB 4HIEA 4XP5L 3V4UH 4UTBL 3HI5L 3QZWG 1IEBB 1P4LA 3D2UD 1U0QA 5ANMA 3VXUD 2CR3A 1NUFA 1NCTA 1CDHA 1BM3L 1F3RB 5IM7B 4P49A 4YHOL 1MRFL 1RMFL 2HFGH 4Z7WA 3LRGA 3DO3A 4KI5E 4G7YL 4ONHA 2F5BH 1AGEA 5IG7B 4S0TD 4EXKA 4G5ZH 4K94C 5B4MD 2AJ3B 3HE7D 3NGBB 1MRDL 3THMH 1EEQA 1OAUL 2Z91A 1F13A 2DLTA 2UV3A 1DBKH 1FAIL 3WKMH 1NANI 2A1WH 1A3LL 2DDQL 4DKAA 4P3CL 1SY6H 1Q9LA 3W11D 1JBJA 5TE4H 1E27A 5KANI 1KCVH 3VRLF 1AGBA 1EFXA 2V7NB 2W60B 2P45B 2XA8H 1Q9KB 4NUJB 4E5XB 5D1XD 1IM9B 4KKBC 4LSVL 1CF8L 4R0LB 5EORL 5CJOL 3SOBL 2J6EA 1HXMA 1V7ML 4NKIH 1ZE3C 3O81A 4Z7UA 2MCPL 2ARJB 1CZ8L 3EJYC 2XKNB 4EQ2A 3LIZL 4J3TA 3NVQA 5KVEH 2G5RA 1NH6A 4U7KA 2I5YL 1H8OA 3IGAB 5JUEH 4PJGE 2HT3D 4PJCF 4OCSH 4HAGA 2RJMA 4XCYB 1VGKB 3N1QC 3G08B 3QHTC 1FC2D 3GIZL 3N1MC 1I1CA 2EDLA 4NUGL 2BJML 2H41A 5JIHA 3NCJH 5J56B 5JW3L 4OCLC 5KW9L 3VD3A 4ZO6A 1BFOA 3WXWH 1NBVH 3QIBD 4U1IB 1TQBB 2QQKH 3ARQA 2PTTB 2H9GA 3Q48A 1FDLL 4RFEB 4Z7OE 2BRQA 4ZUUB 3U6RA 1FFPB 4WEMB 1RZ8B 1J9CT 2BOBB 3VWJC 5CUSL 2C3VB 4ODWA 3U9PH 2ADFL 5DHVH 15C8L 5GIRA 4YHML 1EVTC 1A7BA 1OWWA 2NMSA 1H3WM 2Q8BH 3TZVD 4HF5L 1H3GA 2XZQL 4ZS6C 4FRWA 4NZJA 1NQBA 1W72B 1BVLB 5D2LE 1IKFH 3PWPE 5ITBL 5DFVD 3LKSA 4MDIB 1BOGB 2NTFB 4ZUSB 1L6ZA 4H0GA 4PPTA 4XCFL 4WWKC 4PS4H 3GSVA 3HR5B 4PREB 1U8KA 3P73A 2PR4H 3RIAF 3IB4A 4OLZH 4AT6A 2JJTC 4LRNL 4S1DC 2FX8L 5BS0E 2WINA 3DX9B 4N5UA 4DKDC 5F1IA 1LO5A 1LD9A 1A21A 4OQ1A 3GUTA 5HI3D 2D03L 3I02B 4OZFH 3REVA 4HK3J 1BWWA 1JZ6A 4I3RL 1YEHL 3V6FA 5DK2B 4NNYA 5I18L 4JJ5B 2AV1B 2ATKA 1AO7A 5BRZA 4TSCL 4G6KL 2VR9A 3ULVH 2VLRE 3GSOB 2R2BA 4AEHL 3SJVE 3S37L 3G5VA 4ODTL 1HXYA 1LNUA 3B9VA 5IBTH 2B39A 1J5OL 4D8PA 1I8LA 1T0NB 1WWBX 5B38G 3JV4B 5BMFH 1JN6A 4XWGH 4Q2ZB 3DRQA 3P11H 3BP4B 3NOIA 4DKEL 4M6OH 3H2WA 4I0PA 3MJGX 5HBBA 1U8HA 4XGZA 4HIXH 3O3BB 4LU5H 3H9HB 4GRLA 1MCOL 4PJ8B 3VXRB 3DIFA 3IDXH 4Z7VE 2H6PB 4M93B 5HGDB 2F54A 2HTKC 4BQBA 2VQUA 1E6JL 4F9LC 1EX0A 4AEIL 1A64A 4AQOA 1FJ1A 1UKTA 4NJ9L 3CFIC 4GW4A 3IJHA 4LKCB 1I7TA 5K9OB 4P4KA 4M5YH 5A40E 4P2OD 3PWJA 1B0GB 1N6QL 4KQ3H 5D1XC 5DFWH 3KS0J 4YO0A 3JUZA 4E42A 3DETC 3FO9A 4JLRB 1X5IA 2BVTA 2EH7H 3NBNA 3V4VL 1WBZB 4D0BA 1CR9H 3NCFB 3MCG1 4OLWH 3WN5C 4N0YL 2ADGB 1M7DA 2WBWB 1MHPH 2JKXA 4HBCH 1OGTA 4DOHE 5F6HJ 3I6KA 5B8CA 4JRXA 3OMZA 3EDDA 5EOQL 1WBXA 5E2JA 1SVCP 5DD6B 4F57L 1FHGA 3NABH 3WJLA 3QCTH 5JNYA 2FX9L 3OTTA 4JPVH 1RJZB 1PQZA 3DTXA 4RIRB 1MFDL 5E56A 1AD0A 4UIMA 2R0WL 3FKUS 4PJDA 1S7WA 1BVKB 3SE4A 1IM3A 2Y72A 2B4CC 3C08L 2JJVA 5EUOE 5FYJH 4AENA 1GC1H 3D39E 4KH2A 4Q9BA 3DMMD 3BKML 5IMLB 3VGHA 4EN3B 5FA4B 3O45A 1Y0LB 3QIBC 1YYLL 4YGAB 1RVFL 4U1LA 1E4XH 3OAUH 1IC7L 4LSQL 1J1XH 4GAGH 5E2UL 4D0CB 1JGLH 4X6BB 3VXRD 5IEHB 5I1LA 2HRLA 3RP1A 3OG4B 1ZMYA 4ZD3L 3IJYB 1FORL 1MCNA 4PV8A 1XF5A 2BMKA 4GRWE 3FQNB 4OCRH 3NAAL 1KIQB 2ITCA 2IFGA 3Q3GB 1FP5A 1R3KA 3TZVC 5KSAC 3TO2A 1JF1A 4WWKA 1OF2B 5D70H 4PB0H 5CP3H 5KVGH 3KYMB 8FABB 2J8HA 1QRNB 2R0ZH 2X1QA 4PG2C 4PR5A 2HT4C 2YD5A 5DFVC 1NDMA 3ZKND 5DMYA 3IDGB 3F7PC 5BW7C 3WE6B 1W72H 5KTEL 3QUXA 1QSVA 5FXCH 2DQUL 3OKNB 4GQ9H 4PJXE 5ESVA 1YPZE 1XGYL 4YC2B 5DXWA 3C6SB 4PUBL 2GW5A 5JA8B 3NIDE 2IMMA 4WV1B 3DLQR 4JY6A 3SBWA 3BP5B 1ED3B 4KTEH 2IAMB 3HS0B 1CICB 4E41D 2DM4A 2HLAB 1KJ3H 5TE7H 4Y4KB 1PZ5B 2DD8H 1F6AA 3TBYA 1E28B 1T0MA 3DGCR 2NZIA 2VL5B 5I1EH 1EA9C 4PY8J 4OF3A 5FO7A 4HS6B 1MIEH 1NEZB 4B0MM 5DURB 1EBAA 1RU9H 1LILA 4QY8B 1BBJA 4XP6L 3RDTA 4ISVA 3FT4B 3VXQB 3GGWA 4LVNB 1OAZH 4M43L 1LO4L 1YN6A 5ITFB 4P5KB 5E8DL 1GAFH 1X3DA 2G75A 4JFFB 4JFQA 1EUTA 1DSFH 4EDXA 4WO4A 2I07B 4HWBL 4F7PB 5ABDE 1JI1A 3MGTB 3NN8B 4X6CA 1MCSA 5CJBA 3QDJA 1BQUA 5GS1C 4FQCL 4O02L 4XI5C 1BZ7B 4YHNA 4NKMA 1MCQA 4MHHI 4JY4A 3QEUA 1MHCB 4LL9A 2HG5B 3QXWA 3EGSB 4LDLB 1J0HA 4P23B 2FL5B 1ORSA 3O2VL 2W0LA 3RZCC 3MRKB 2F58L 3IDJB 1QRND 3O3DA 4JREC 3HNVL 1T22A 5DRWB 2Q6WA 4GOSA 5FV1L 2IPUK 5J11C 1FYTB 4LHUB 4PRPD 5I8OL 3WIHL 4P2OC 2R9HD 1H0DB 5GJSL 4AMKH 3HZYB 1QR1B 4NQSA 3B43A 3NH7H 5I66A 3LPFA 5T5FH 3KPLA 3VFTB 4X5XA 5DT1H 2NYYD 5TGBA 4JHZA 4Y4KD 4DZ8A 3VFVA 5D5ME 3JXAA 3ZTJH 3B3IB 2NR6D 5EO0B 3ARUA 2C4FT 2Z4QB 4DGYL 1CK0L 3QPQD 3QNXA 1INQA 1MQKH 3C60D 1SQ2N 4HFUL 1G7MA 4KJYB 5F89B 1B4RA 5F1OB 1XZ0A 1ZLWH 1VDGA 1ES0A 2PXYD 4L8CB 5JLZA 2COQA 3MNWB 2D31A 5D71L 4PB9L 3P77A 3MNZB 5HHMB 3E3QE 4HV8A 1MJ8L 3KPPA 5GS0L 2IH1A 3DMMC 4JFFD 5I9QC 4XPBL 3NA9L 4ODVH 1KPVB 1IGML 4JFEA 5TFSL 1T04A 4BSWB 3MOAL 1SJEA