4JO2H

Crystal structure of rabbit mab r56 fab in complex with v3 crown of hiv-1 consensus a gp120
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
210
structure length
204
Chain Sequence
QSLEESGGDLVQPGASLTLTCKASGFSFGNNYDMCWVRQAPGKGLEWIGCIETGSSDSAAYATWAKGRFTISKTSSTTVTLQMTSLTAADTATYFCARNFDLWGPGTLVIVSSGQPKAPSVFPLAPCSTVTLGCLVKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords monoclonal anti-HIV-1 gp120 V3 antibody R56 light chain
publication title Rabbit Anti-HIV-1 Monoclonal Antibodies Raised by Immunization Can Mimic the Antigen-Binding Modes of Antibodies Derived from HIV-1-Infected Humans.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 35
structure length 204
sequence length 210
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jo2H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jo2H01
2OJZH 2DQFB 2CR6A 5JW4R 1LO3H 3O4OB 3V4VH 3MUHL 1KIRB 1RZ8A 1UJ3B 1EGJL 3O6ML 3CLFH 5FK9A 2FEDC 3RUGE 5L0QB 4DEPB 1ZOXA 4MNGE 1W72A 2ZCKH 4G3YH 3VFWB 2A9NL 6FABL 3U9PL 2FWOA 3QQ4A 3GJFB 5DMIL 4RX4A 2D2OA 3QEQB 1NC2B 2X2YA 3KXFD 3RWHB 3MRJB 3KPLA 4ORGB 3THMH 1YEGH 3KYMA 3GI9L 4WTZA 5JW4Q 1UQSB 3LRSB 3VWKD 5JW5B 2EH8L 4JJ5A 4Y4KC 1RK1A 2ORBH 3H9SB 1S7UB 1SJVA 3U7WL 4UT6H 2NLJB 4RFEB 2R1WB 2ARJQ 1CFBA 4XP6H 4KVNL 4KZDL 3PNWA 5HPMB 3HNTH 3V7AG 4OZGA 2JCCE 4RGNB 3C5SA 3EO0A 3GK8H 1T0PB 4DZ8A 5TFSH 4TNVF 5BV7L 1DVFB 4HWEH 1EH9A 1RJLA 2V2TA 4ZO7A 1IGML 3MV7D 5CCKL 4L8DB 4PGDA 4W6YB 3EO1B 3CGTA 5JIIA 4NO3A 3ZT7A 4P5MB 4JPKH 3LH2L 3QDGA 5DJ6A 4NNXB 4JQVC 4NHUA 4HH8A 5D1XD 4QRUA 5KSBF 3OB0H 1H0DB 3QO0B 2NY5C 1ZLWK 5AYQA 1OSPH 1T7YA 5C70A 1U8KB 5DYOB 5J1SC 5HVGB 4PJIE 4K94H 5IMLA 3CZFB 3GGWA 2YRZA 1VFBA 1GGUA 3BEVA 1SY6A 4EBQL 1NBZA 5EOCJ 3L3GB 1QHOA 5GS0D 2J5LB 1F11A 5E08H 4EXPX 4MQ7B 2PW1B 4HZLA 3LSOA 4NM8L 5ALBL 3HUJF 2R2BB 4JR9H 4PJ5B 2DLTA 3NFNB 5J12C 5F7LB 5I15H 1PX3A 2WNGA 5K9OA 1X7QB 3I9GL 4IRJB 5E94A 1P4BH 4JFYA 2WQ8A 1D9KC 4J2XA 5F3HA 1KB5A 3QR2A 4GAGL 2AJ3B 4EDWH 3E3QE 1ZWIA 1JHLL 5DA4A 4PTUB 1KBGH 3BZEB 1MWAA 3L3KB 3VFUB 5DQJA 2WWKT 2R39A 2X9WA 1FNHA 4K3HA 1DUYA 2R29H 5IW6A 2JIXA 1F45A 3IJHA 5CKAA 4TUKH 5BOPA 1FGNH 5F89B 5IG7B 3QCTH 1CCZA 3PJSB 4M7ZC 1BZ9B 5K9KA 5CIPB 4N0CC 3MOAL 3JWOL 4R26L 3UTTE 5KSBB 4Z95L 4UNVA 1S9VA 3RU8L 1HINH 2CXKA 4RSVA 3SGJA 3OR6A 4OZIA 4V1DE 3KPQA 5JQ6L 3WO4B 2H2SD 2SEBA 3QEUB 3HE6C 2W38A 3IRPX 3QQ9D 2MCPH 1N0XH 1OTTD 1GZQA 4GRLD 2HFGH 1HILB 4O58L 1LGVA 1Q1JL 4RGMC 3KPSA 4L3CB 4MXWH 1RIUH 5GS1B 2BOCB 4YHIB 4GXVH 3HUJB 1E4XH 5TQ2H 3BYTA 5D2NB 2NMSA 4P4KB 5I1LB 3OJDB 5E9DE 3CFEA 5IFAH 3P73A 5DFWH 2DDQH 1RZ7H 5FYLH 4KJQC 2AGJL 5TDOB 1IGTA 1FN4A 3QUML 4XVJL 4Y4FD 3WV0A 5I2IA 3GKWL 2VN4A 2IANB 1GC1C 1WWBX 4QHLA 5I8EA 3MGOA 2DB8A 4X6FB 5D9SA 3ZHLA 1N6QL 4OIIL 4IRSA 5A16B 4F57H 2CD0A 1I1FA 2VXVL 4P57A 4WWKC 3LN9A 4HPYH 4OFIA 1YPZA 4KKAD 1UKSA 1UA6H 5DMKA 4QO1A 5FKAB 3O2WL 5CZXC 3BVNB 2YPVH 4PD4K 1F8TH 5JHLL 1UVQA 5EOCH 5I71C 1KLUA 2IG2H 4X8JA 5LAXB 3OV6A 1IC7H 4UNTA 1FO0A 4KTEH 1U36A 3IDXH 4G7YH 2NZ9D 3LMJL 3ILPA 5E8OB 2DIJA 1J05B 5HHQA 1IGYA 1T66C 5ERWB 5T33L 5HI4C 1CG9B 1H8OA 3GHBH 3C60B 5IWLC 4WTXA 4JRXA 1QFWL 4L1DA 1UXWA 5FA3A 5C07A 1F4HA 4X5WB 2VR9A 4BK5A 5DDHA 2QJDA 4G80B 4JZNA 2V7NA 5DURB 5FAAA 1MCWM 2ADIB 4U33A 1T1ZB 2G60L 4OV5A 3WN5C 1AQKH 3ALWA 2PTUA 5I0ZA 4S2SA 3HCVB 3S6CA 1XGYH 2PR4H 4X4ZA 3WKML 2IQAB 2RAMA 3RI5F 1LEKA 1M6OA 1J8HB 1KN4H 3ZDYF 1JWMB 1I1RA 5D6CA 1HYRC 5L7XL 4JO1L 3BI9X 4XNMB 4QGTA 3PWLB 2DQJL 2A77L 3OGCB 4F7EB 3LV3B 3NZHH 5L2KA 4HV8A 2AEPL 3NPSC 3AU1B 4Z7WF 4KGJA 3AREA 4XB7A 3OKDB 4XPAL 4P5KA 1HHHB 4WTZG 1X5HA 5KSAB 1DLHB 3VMNA 4G8FB 1BREA 5B39A 4DTGL 5EN2A 5IOPB 3L5XH 3WL9B 4IRZH 5ICXB 1BD2A 3P11L 3CFJA 2HJFB 1BJ1J 3IDIA 2AJXL 4ONGH 1CQYA 3HI6H 3LD8B 4X99B 5ID0B 4C59B 3NFSL 3TJHD 4UTAH 3O9WD 5IB3B 1BQHB 4P4RA 1I1AC 3T0DA 3B8YA 4LSVH 3UJTH 1LHZA 2Z8WC 3EOBB 3B5GA 1MHCA 1MH5B 3DV4A 3DYPA 2NXYC 3DUHA 4J8RB 4TQEL 3QNZB 1RQ5A 1KJVA 4WCYL 2ADFH 4OD1L 3QUZC 4WI8A 5KVFL 4D9LL 1TJIL 2VLME 3QJHA 1C1EL 5FGBA 4IMLA 4XWOD 3SQOL 1LDPH 1PFCA 4HPOL 1KNOA 1ZHBA 2OI9B 4X7EC 4HKXB 3ROOA 1EERB 4JM2A 3CVIH 4PBVC 4F9PA 4F15C 3STLA 3DO7A 1N4XH 5EO9A 3UROR 4GUPA 2K7QA 5FGRA 3V4PL 4TTGA 4F7CB 4Z7WB 4AEIL 2X1QA 4PJHE 1O7SA 3P4NB 4Q2ZA 4UILL 1OD9A 1JHTB 3F5WB 5KG9B 4LLAA 4S1DD 4AT6A 5CEYA 2L0DA 3S3SA 3HMXA 3JVGC 1V7NL 5HVHB 4JFFA 2ZNXA 3O6LL 4MJ5A 5DRWB 1CICC 2WWMC 1L7IH 4M7JH 5KJRH 3TZVD 1A4KB 1U8LA 3H42L 1MIMH 1NGPL 2O61B 5F9DC 3UTSA 1TIUA 4GH7B 1JPGA 4GAJH 2AK4B 1UWEL 2HTLC 1KB9J 4I2XB 1GZPA 1TJHH 1AY1H 3FT2B 4FTVB 4NO5A 1FAIL 3QUXA 4GBXC 1MF2H 1T80A 2BVTA 2R8SH 2W65B 4M4PA 1P69B 2FEEL 1REIA 3TBWA 3IVKA 4XI5D 4Z7UE 4Y0GA 3BDBA 1NGXA 4I0PC 3MODL 4JRYD 2Y23A 1H3UA 1G7LB 3D0VA 1XZ0A 1KIPB 3T0EC 4MVBD 1JYXA 1OAQH 4TVPL 5F21B 2VDPL 4KK6C 3PP3K 3R1GH 4LCCC 4OSUH 2XFXB 1BJ1H 1PYWA 3I3BA 4FQHA 3TH2T 1FYTB 3EKCA 4ZAKB 1OAZH 3FMGH 4KPHH 1M71B 4Q9QH 2AV7A 1XMWA 4ELMF 1BMGA 1UEYA 2ZUUA 4JZOB 1LO5A 1MQKH 1S7SA 2DQTH 3WUWG 1MJJB 5H2BB 1JRHL 3TO4A 4X4YB 4Z77A 4P46C 3TM6A 1NUNB 1DP0A 1K9TA 3U1SL 2VMFA 4ZUUB 1HQ4B 4X6DE 1OQOA 5CBEB 2YUZA 4HWBH 4JFDD 5IHUL 1S7TB 1CDUA 5FO9A 3VXSA 4LVOC 4OF0A 3G9VA 1RUAL 1DQML 1G9NC 4Y7MA 3ES6B 4M48H 2A6DB 5FOJA 5LCVL 3WJLA 5ESVB 2BMKB 1IZJA 4MB4A 5A2KH 3FQTB 3OKNB 2PYFB 2VXSH 4L8BB 4MJIA 3QXVA 1AD0A 1TFHA 3S35H 1G7PB 2V7HB 3V95A 4UMGA 5T3ZE 1LP9F 3WLWD 2CDFB 4WENB 4KHXH 4X8XA 3K46A 3MJGX 2OL3A 3CVHL 5CD5D 3MA9L 5KVEH 1SMAA 3O0RH 1A2YA 4G8EA 4JRWA 4F2MA 1F3JB 1KT2B 2VUOA 4HCRL 3MXWL 4EZMA 1TXKA 3CU7A 4OF7A 5KAQF 2AERT 4FFZH 5C0CA 3EYQD 7FABH 1INDH 2EIZB 3GSQB 2KQNA 5D1QC 4KRPB 3EOTH 3VA6A 3W81A 4EDXB 1UZ8B 5D7SL 1N59A 1NLDH 3CXHK 3JV0A 4I4WA 1GC1L 4UUJA 3W9EB 4KMLB 1VCAA 1PY9A 2CRZA 1A6TB 4HW6A 5T5FH 4U1JB 4HKBA 3BPOB 4Z7QE 5JPNB 2FYYB 4M1DL 4U7KA 4ELMB 2FHCA 4XBEL 4D0CB 1CK0H 4Y16C 2C3WA 4L3ED 5DLMH 4LQFL 1FNSH 4HWNA 4BSJA 1CFTA 3VFPA 5IVXF 2ATPA 1KIQB 5DRXA 2DQHH 3D3VA 2XWJB 5HVFB 2GSIB 1EO5A 4IDJL 4RAVA 4OM1H 2CDGA 2EXYC 4PJGA 1CFQB 2NY2B 3NACH 1N3NA 1IT9H 5JDSB 1HHJB 4U6XB 1LP9B 4KQ3H 3DTXA 1T03H 3ARZA 3KPOB 1QTYT 1FYHB 1PQZB 1YNTA 4ZFOB 15C8H 4FNLL 3BIKB 4B7LA 1T4KA 4NBYB 4DVBA 3VFTA 3TPUA 2QSCH 1JPFA 5ENWA 2WSKA 1G0XA 3T3ME 3U4BH 2ESVD 3L3IA 1VEOA 3GMQB 5B3NA 3T1FA 4YE4L 2DJSA 1QEWB 4AG4L 1NDMB 2FSEB 4UINL 5JOPD 2J7LA 3MNWB 3FRUB 3OZ9L 4NRZB 4R7NA 5BZWA 3LKOB 4M6OH 1AC0A 4LLVA 4FZEH 4MAUH 1QPPA 2HLAB 4K23L 2LU3A 2BNRE 5HHVL 4LSDA 2A74A 4C55A 5IB1B 5IVXB 3PV7A 5IEHB 2G5BB 2JELH 4G9FD 1AQDA 5DT1H 2X89D 4ZFZA 1HWGB 3G9AB 3IFOA 3ARWA 4P5TB 2FO1A 3WIIL 4XPTH 1AGFA 5E95B 3MBED 1MFAH 3UTQA 3BP5B 4D8PA 3OKLA 4XVUC 1ZLVK 4JFOA 3MRPA 2DTML 2JK5A 3VXQB 5KS9A 1ZT1B 3ARGA 1XT5A 4OLXL 1X5FA 2PTTB 4IIQA 1Z3GL 5GGVL 1EA9C 4WJ5B 1DZBA 1E6JH 2FIKA 3QIWD 3RVTC 3AY4A 3ME0A 4OJFL 4Z6AT 4PJ9D 4JB9H 5HHPA 5L8LB 1QSFB 1RMFL 4CAGA 4RISH 1S9KC 3PV6A 2XZQL 1FFRA 2P8MA 4JFHE 1SYSA 3UJJH 3OWEA 3QRGL 4LLQB 2VDNL 4JPWH 1PAMA 3MLSL 5C08E 1QQDA 4JZJC 1NGZB 2HFEB 4Q74A 2P5WA 5DC4B 2VLLA 4PPTA 2B0SL 3ILQD 5IEKA 2JB5L 3IGAA 3MV8A 2P7TB 4FFYL 4Z0XB 5GISH 4WEUD 1L7TL 2NW3A 2ARWA 3U2SB 2N1KA 1TZIA 3TO2B 1LO0L 3MNVA 1YY9C 4XH2B 2VRAA 3RVWC 1VA9A 3IDUA 2ZZUT 1A8JH 4KUCD 3RBGA 3C5ZB 5C9JA 2OP4H 1KTDA 3P0YH 2V5RA 4G42B 4N5UA 3H0TA 4G8IA 5F9OL 3RA7H 3ULUF 5IIEA 3HG1D 3QI9C 1K4CA 4M7LT 1RZ8B 4LHUD 4X4ME 3U0WH 1HSBA 5FK9B 4YDIL 4J1UA 4ZOBA 3TC9A 1U3HC 1W72B 2BY2A 3EUUA 4KI5F 4Q6YA 4MCYA 3F6LA 4YXKL 2FWOB 2X40A 3MRNA 3QQ4B 3AS2A 4FP8L 4H20H 4UBDD 4P2RD 3VI4E 5HHNA 4KDWA 3KPLB 1XIWA 1UCTA 3KYMB 2BNQA 3UTZA 3I50H 4JJ5B 3ZDZF 1EUUA 2YWZA 1RK1B 3QG6A 1RVFL 1IM3B 2GTZA 4LAQH 3HAEA 3O6KH 2UUDK 1ND0A 3RWJA 1IILE 3PNWB 3SDXE 1YDPA 2FHFA 3ZKMC 3MYZA 4OLYH 1HXYA 3UC0L 3C5SB 3EO0B 4JJHA 4DZ8B 1CD0A 4EQ3A 1F97A 4HS3A 1RJLB 2V2TB 2CKBH 3RIFF 3B9KD 4PGDB 2FO4A 1BX2A 3VXUD 4NO3B 3QDGB 3B2VH 5DJ6B 2LTQC 5GRZA 5AWNL 4NHUB 4ZOCA 4QRUB 4W4OA 4HUUA 5A2JH 4OZIF 1Q9LA 5C0BD 3Q6GH 4NYLA 4FXKA 1IAMA 5IMLB 4HMDA 3KJ6H 3GGWB 1VFBB 3BEVB 4MA1B 2WBWB 3VRLE 1NBZB 5IW3A 3O4LE 2BSRB 5DVKA 1F11B 3KPMA 4Q9RL 4HZLB 2E7LA 2A6IA 2JJWA 3LSOB 3PL6A 3PDGA 4LLYA 4WEBL 5KSUA 4BJLA 5K9OB 1OT1A 5E94B 1A7RH 1CGUA 3CC5A 3K2UL 4JFYB 5K59F 5I8CA 3AS0A 3MLTA 5F3HB 5CILL 1B0GA 3KLHC 4KH2A 3MMEA 4X6EA 1G9MC 1ZWIB 4YXLH 1MCRA 1MWAB 3SKJL 5JR1H 5DQJB 2JJUA 4GLRI 5SWZA 4JHAH 4NCDA 1GOGA 3GNML 1DUYB 1H8SA 5IW6B 2JIXB 3H9SE 5AZEH 3IJHB 1YPZF 3OPZH 5ISZA 1HOCA 4FS0A 3FN0L 3GBNH 5K9KB 4R2GD 2R9HD 4LSTL 1A6UL 5ELIA 2DLIA 1S9VB 4MHHI 4M9PA 4LCWA 1PBYA 1CFVL 3OR6B 3QWOA 4X7DC 4OZIB 3KPQB 3ZTJG 5GGTL 1DQQA 2SEBB 4TRPH 5FYJE 1FNEA 4TUJA 5AAMA 1GZQB 3WIHL 1K4DA 3QFJA 1ZLUK 1SY6H 4JO3L 3KPSB 4LIQE 3T4YA 1MI5D 3QIBC 3LDBB 3QIUA 2P46B 4I48A 5GZND 1U3ZA 1ZE3C 3CFEB 3P73B 5DMGD 3GHEL 4YDJA 4MX7A 3ORJA 2EDYA 1QBBA 1KB5H 3Q3GA 4WI7A 2VITA 1IGTB 1FN4B 2P49B 4CDGC 3B43A 2ZSVA 5SV3A 5LXGL 5I2IB 4MLSA 1IC4H 2V17H 4QHLB 5I8EB 1XF1A 1DUZA 3MGOB 4NFBA 5D9SB 4GG8A 4FRWA 4IRSB 1I1FB 1X4YA 3D0LA 2GY7B 2KPNA 4P57B 1EHXA 4BKLA 5IVOA 5J11C 1NBQA 1YPZB 4P9HC 5DMKB 2KDGA 1WIOA 4I13B 3ZYOA 1NCAL 5M94B 1I9JL 1GGBH 1UVQB 1F4WH 1KLUB 4X8JB 4OLUH 4XWGH 2VZ1A 3QUYD 1BFOA 1FO0B 3VFGH 3UO1L 2EEBA 1TTUA 5GJTH 2FJGA 3OAYK 3ILPB 3V6OA 5CGYC 2BFVH 5F7YC 4NBZB 1CLYL 5HHQB 3MC0A 1IGYB 5F1NA 5EU3A 5GIRA 5E56A 4YFEA 3FB6A 1JV5A 3E8UH 3O6FD 4JRXB 1R5IA 4Q97A 4XNXH 1UXWB 1EZVY 5FA3B 4YGVA 5C07B 4M6MH 4GRWH 3NTCH 5F44A 3SE3C 4RIRA 4A2MA 1JZ5A 3T08A 3MRQA 1WBXA 4JZNB 2V7NB 1A3RH 3LS4L 4D0DA 1OQXA 2BJMH 4OV5B 5IFJA 3V0WL 5DA0B 3KLSA 4WHTA 4LSSH 4I1NB 3NA4A 3MLPA 4S2SB 1OLZA 4Y5XC 5IBTL 5IQ7L 3DRTA 3N1PC 3SJVD 1E4XI 4GSDH 3WXVL 3SCMD 1LEKB 4AEHL 1M6OB 4M7KL 2IWGA 4PJEE 2E6JA 4PUBL 3HUJE 5D6CB 1AXTH 1HXMA 3WS6C 4JM2F 1CYGA 1QNZH 1BBDL 4E41D 1BZ7A 5L2KB 4ZFFA 4HV8B 5INDA 3W5MA 4HXAL 4HGWA 2DLFH 2C3XA 2X4SB 1JVKA 3AREB 3BZDA 5DJ8A 4P5KB 1UM6L 2BVUA 1Z2KA 5EU5A 2BY3A 1IGCH 5B39B 2R0ZH 2O5XL 1FO0H 5EN2B 1AO7E 1MRCH 2Y07H 5FHAH 1OGAD 4YIQA 3GUTA 1BD2B 1YEHL 3CFJB 1P5VA 2VOTA 2V6HA 3IDIB 5T5NG 4EVNA 5KW9H 3D39E 1X5ZA 1QOKA 3J7HA 1CDBA 3K81A 2OX5A 1F5WA 1YEIL 3IYLW 3MOBH 3QXDA 5CJQL 4P4RB 1YEFL 5FM5O 1VGEH 5GSRA 2W0LA 4FQ2H 2AJUL 4NQCA 5CHNA 5J0BA 2DQCL 3AMKA 4GMTH 1MHCB 5GJSH 3DV4B 3SO3C 2J6EH 1AGBA 2CK0L 3FQXA 1KJVB 4XPGH 4G8GA 1ADQL 1JTPA 5EPMA 1H5BA 1WFOA 3F65A 1LK3L 5EUOA 3QJHB 3FL7A 4U7SA 4IMLB 4LP4A 3ETBF 1OCWL 1RY7B 4NFDA 1KNOB 1ZHBB 3QDMD 3I84A 4JO2L 2F15A 1IQWL 3ROOB 4LHUG 2EC9T 3TN0C 4JM2B 4LVHB 3AC0A 4TTDC 3STLB 2HJLA 1TPXB 3DO7B 5EOTA 2W0FA 4HHAA 4GUPB 5E8PA 4LGSB 1WLHA 2HMID 3VD4A 4FXLA 4Q2ZB 2FX9L 4XNZB 5CJXC 4NCC2 4I18A 3IDJB 4ALAH 5F1KC 1C5CL 5SWSD 2MTPA 4Y19E 4AT6B 5CEYB 1J8HE 2DD8L 3HRZA 5DK0A 3RZCC 2VLJA 1RJCA 3DHMA 4JFFB 5DUBA 1MAMH 4ZS6C 1KCKA 3L5WA 4MJ5B 1PEWA 4Y4HC 2BK8A 4EIZC 5T1KB 1JGDA 4X9BA 4YUEH 4XBGA 2NY0D 4W4NA 5DJYA 1U8LB 1ZEAL 5EU6A 4JFXB 4YFDB 2P8LA 4TVPD 2B20A 3UTSB 3AB0B 4OT1L 1MCNA 1JPGB 4JKKA 1D9KD 4U0QB 1I7TA 1GZPB 1EHAA 5FEBA 2A9MH 4NO5B 3QUXB 2XZAL 5FM8A 3U7YH 4LP5A 1KULA 2YPLA 5L0QC 4H26A 3QDJD 4Y89A 3TBWB 4DEPC 4K94C 2WP3O 3IVKB 1DBKL 5IROA 4CJ0A 5ICYA 3UMTA 5DS8A 1NGXB 2H3NA 4JAMA 5FM5M 4R90L 4W68A 5ETUA 5EDXA 4N0CD 3D0VB 1XZ0B 1NCCH 4X0KA 4PJBA 4I9WD 5CJ8A 4ZYKA 1OTSD 2AAVA 5MP6H 3FO1A 1PYWB 3HE6D 3PG2A 4WFHE 1FHGA 4FQHB 5H37G 1FORH 1KJMB 1JYVA 1WBZA 1X44A 3M45A 4UAOC 2DMCA 4LQ1A 2VYRE 3MLYL 4EJ1C 4RGNC 2AV7B 4PJAE 1DVFC 4PLKD 1A6WH 3N1MC 1DEDA 1J1PH 2IH3A 3ZE0F 2BXYA 1LO5B 1S7SB 3E6FA 5I1JL 3TO4B 4Z77B 5JOEA 5GZOC 5ACZA 4NQEA 1C7TA 4L4VE 5E7BA 5AUMA 4M3JA 4KJQD 3BESR 4DGVH 3VXSB 5EA0H 3WFZA 2J8HA 1P4IH 3F58L 2P8PA 5DHVA 4PJGF 3SQBA 1EX0A 4OGZA 3D5OF 1T6WA 3P3YA 2DQEL 1K6QL 4LVNB 4MJIB 4ORZC 1AD0B 2N7AA 5IJKC 4K7PH 1FSKB 5I9QB 2I9LA 4OI7A 1G7IA 3FAWA 4OQTL 4M7LL 4IMKC 4YEFA 5A40E 3VXRD 2OL3B 4WWKD 3FO0L 3GJEA 4MXVF 1A2YB 4G8EB 2J5LC 5E8NA 3SDDA 5KOVC 4BSWA 4F2MB 5E6YA 1PKQB 1I85C 4FG6C 5C0CB 1FNLA 5D7KD 3GRWL 2YMXH 4IRJC 3HNSL 3T2QA 4ENED 2XN9A 4N8CH 1N59B 4YXHL 4C58B 5E2WL 4I4WB 4U3HA 1R3IL 4UUJB 4B0MM 2H26A 5GS2D 1BQUA 1QPXA 4HKBB 3PUCA 1HHGA 2DQIL 1OVZA 2NY6B 4OF6A 1CFTB 3VFPB 5I1KL 2ATPB 4OCWH 3ZT5A 5DRXB 4TYUA 1I9EA 4W81A 3D3VB 1SHMA 5FCUL 1C08A 1WZLA 4P2OD 2ICWA 3EAKA 4RAVB 2CDGB 3WFCH 4PJGB 1N8ZA 1N3NB 4NN7C 4A6YL 1NAKH 3WO4C 2AP2A 5KS9F 3VFVA 5FYJH 4JKPL 2EDNA 3ALXA 3P0VH 3OF6D 3DTXB 3DMMD 2Y1VA 2OL3H 1F6LL 1RZKL 3AUVA 3GSRB 1W2KT 1YNTB 5GGSA 4OTXL 5GS1C 4DVBB 3VFTB 1D5ZA 3K4ZA 3TPUB 1JPFB 5ENWB 5D2NC 1XF4A 1Z9MA 3OXSB 3TBSA 4P4KC 3X11A 1I9IH 2XZCL 3L3IB 2DQUH 3V7AE 3T1FB 3ARBC 5JIHA 5IB4A 5D1XA 3BUTA 3TA3D 1VPOH 1VACA 1Z9SA 3ELAT 2YD4A 3HB3C 5FFLA 1FZJA 1IEAA 3PHQA 4R7NB 2W1NA 5BZWB 1BAFL 4HG4K 3EO9L 3K0WA 4LLVB 3SDAD 2DM4A 1R24A 2YD8A 5D5ME 4HS8H 3PGCA 2XA8L 4U1NA 2CKNA 3WFEL 3RVUC 2A74B 4X7SH 2ZKHL 4UIMB 4DFHA 1FLRH 1AQDB 3B5HA 3BPLB 4R7DA 1KF9B 4XHQA 3IFNL 2HT4C 4ZFZB 5JHDA 5FM4A 4G6KH 4HJ0C 1AGFB 5DR5L 3WN5A 4L8SC 2FGWL 5FOBA 4WV1A 2GTWA 1QUNA 4NC0B 3UTQB 3QT2A 4D8PB 1SJHB 3OKLB 4ELME 5CP3H 4JFOB 3MRPB 3VFSA 2JK5B 4PRHB 5KS9B 3ARGB 2QLVB 4HBQA 5C6PB 4IIQB 4JLRA 4LCYA 5I16A 2FIKB 1QBLH 1JGUL 1A6VL 2RHEA 4LSRH 2OJZL 2V5MA 4BFIA 5HHPB 3PV6B 2X7LA 1TTFA 2P8MB 4WUUE 1SYSB 1N2RA 4XXCC 2QADB 2DI9A 3VGFA 3D2UD 4MD0A 1QQDB 1B3JA 1A3LH 2GW5A 2P5WB 2YHGA 1P7QA 1CICD 2WWMD 3ZLQC 1HI6A 1KYOK 1BQLH 2VLLB 4RA0C 5F9WB 5BS0A 1RIVL 5IEKB 1IKNC 2ZUTA 1F90H 1RFDL 3IGAB 5HHMD 4GRLA 5T5NF 3MV8B 1KTLA 2B4CL 5CLTA 2NW3B 2EE6A 1DQLH 1TZIB 2NX5D 4KDVA 1JZ3A 3MNVB 5F71A 4DAGL 2HKHH 2PW2A 2IFGA 1B2WH 3N50A 4FQQA 4GBXD 4FQIH 2UY6A 5C9JB 1KTDB 5KSAC 4LFHG 3H0TB 4G8IB 4KRLB 1T0MA 4LHQB 4BFBD 3FN9A 5TE6L 5IIEB 2NY1D 1K4CB 3ZHDA 1JUFA 3QUZA 3U0PA 1HSBB 4J1UB 2WLYA 3T4AA 5IVXE 4KDTA 3HC0A 4MCYB 2PYED 5CJBA 2DBJA 3MRNB 1G0DA 1FL6A 5CGTA 5EWIH 4E5XA 3T2NH 3LD8C 1E4WH 5HHNB 5IMMA 1XIWB 3U0TA 3LCYA 4OLVH 3UTZB 3RGVA 2VKWA 3WHXA 4NNYA 3UTTD 3QG6B 4P59H 4BH7A 2GTZB 4GS7C 4K94L 3HAEB 1F58H 1ND0B 3QQ3A 3RWJB 4V1DD 1CGSH 3V79C 3WEXA 1YDPB 5F88A 1HXYB 1JP5A 5JA8B 5D7IE 5D8JH 3GMNA 4NIKB 1PSKH 2AJVL 4HS3B 5ILTH 4BQ6A 1QLFA 1KXQE 2VB5A 3QA3A 3TH4T 5HXMA 3PDDA 2FO4B 1BX2B 2X4NA 4JG0L 5JIKA 3IAPA 1LK2A 3CPLA 5HGAA 1WIUA 4HUUB 2Q76A 3LEVH 3TNMB 4CJ1A 4GMSL 1Q9LB 3S36L 2A6JA 1BJ8A 4NYLB 4FXKB 4OCLC 2R29L 5HVHC 5IJVA 2L7JA 3TV3H 1KN2L 4I0PA 3NIDE 1KELL 4LIQL 4K3EH 1JNNL 3KPMB 1BOYA 4RCAA 2A6IB 3HN3A 4UT7H 4ZDHA 3WXWL 3TBYA 5F7MC 3PL6B 4LLYB 5KSUB 4JDVA 4X9GA 1MCLA 3OJ2C 2MQ0A 1ZKAA 3JWNC 4XPFL 3CC5B 2B2XL 3U9UA 5I8CB 3HAEH 3BUYA 1I8IA 3MA7A 3MLTB 1B0GB 1J0IA 4YK4B 4M6AA 3MMEB 4LSUH 4X6EB 1CT8A 4MXWL 3DXAE 5IFHH 1J88A 3RY5A 1FGVL 3G08A 2UZIH 4XB8A 1CDYA 3EJYD 4J3XA 3RHWF 5SWZB 1D6VL 2XRAL 4P46A 3WSQL 3L3JA 5IFAL 3MLRH 2G75A 3FZUD 1RZ7L 3JTTA 2EXYD 5FUCE 5ISZB 1HOCB 3GSOA 2J4WH 1HHIA 1WV7T 1S5IH 4QHMB 1LO4L 4S1SH 4BYHA 4NZRL 2DKMA 4K3JH 4ZAKC 3ARDD 3NABH 4UT9L 4LCWB 5IMKA 2ILLA 3QWOB 4RBPH 3DOSA 1V5JA 3RKPA 3SE8L 3FAXA 4QTIH 1DQQB 4NUGH 1FNEB 4TUJB 1Y6KR 3QRFM 1OAUL 4LPVA 4G9DA 4OF8A 1UA6L 1K4DB 1XCTA 2QQQA 1UWGL 4Z0BH 3QFJB 1FC1A 1MFBH 3T4YB 5EOCL 1OTUC 2DL9A 1ZTXH 1BJMA 2J1KA 1T83A 4AIOA 1U6AH 3QIUB 3IDXL 3VJ6A 4I48B 2EDQA 3K80A 5D1QA 2HAZA 4FQJL 1CGWA 3T8XA 3BP6A 1WCBA 4CKVX 4MMXC 1RD6A 4YDJB 1X5YA 1AR1D 3GMRA 3LIZH 4MX7B 3B9AA 4ZUVA 3WO3B 5F70A 4YHYC 5E6ID 3Q3GB 4KJPC 4N9OB 2VITB 5IT2H 1INEH 3QBTB 2IQ9L 4ODSH 4PRPA 3G5VA 2ZSVB 4ZTOH 4Y16A 4NN5C 3DARA 1DUZB 1JGLL 1XFPA 1SEQL 1J5OH 12E8H 2FIRT 4GG8B 1CGVA 4QOKE 3D0LB 2YOCA 3ZDZE 3KXFE 2CO7B 4XBPA 4BKLB 3T04D 1BEYH 4KRPC 1YEDA 2QHLA 4R97B 3VWJC 1XF5A 1IM9D 1UFUA 3QG7L 1BFOB 2QKIA 1CD9B 2LQRA 3AGVA 3U83A 3ARQA 1NKOA 2DIBA 2FJGB 4DN4L 3BPOC 1ZT7A 5JLZA 2JJVA 2XV6B 2DAVA 4PLJD 5F1NB 5EU3B 2X1XR 3REWB 2FX8L 5CS7A 2GIYA 3PP4L 1P9MC 3FB6B 1JV5B 1CTNA 3HR5B 2AS5M 1R5IB 4WNQA 3AMLA 4YGVB 3UYRL 3MV7E 4Y8DC 3VI3F 3WFDL 3MRQB 4IOIA 1WBXB 4KQ4H 2VC2H 2VDML 4D0DB 1G9EA 5D72L 1C5DA 3QZWA 1CR9L 5I8KH 2N7BA 4WHTB 2NY2C 4XC1H 2FH8A 2F8VA 3I02A 3CNKA 5HDQL 1II4E 4RAUA 5EUOF 1EJOL 1ZGLA 3D48R 4NN6B 3RVWD 1RURH 4M43L 3QUKA 4LSVL 1HXMB 3V6ZA 5I1HL 4RMVA 1YEKL 2K1MA 5DO2C 4PY8J 1BZ7B 1CZ8L 3QI9D 4ZFFB 5INDB 2EDHA 3UAJD 4HGWB 5DJ8B 5K59E 4PRBA 2ADFL 4Q7DA 2VDQL 2Y4SA 3KHOA 5EU5B 5EU7C 3CMOL 5D1ZD 3IT8D 2O5ZH 3F7YB 1WWCA 2F58H 1JPSH 5F7NC 4MDIA 4YIQB 3GUTB 1JNLH 1C12A 1FVEA 4PJXE 3VGGA 4QRPA 4EVNB 3UTOA 4OLZL 2YPKA 1EMTH 4JFEE 1EDQA 5DFTA 3P9WB 3QXDB 4F58H 2P43B 4P5TC 5GSRB 32C2A 5CHNB 4NQCB 1A1NA 1H8NA 4XMPL 4NNPL 5D7JC 4K9EL 5L8JB 4JN2A 2W07A 1AGBB 3BE1L 3FQXB 4G8GB 1L7IL 1UCBH 5ID1A 2B1AH 5EPMB 5EUOB 2EE9A 2O5YH 4UV4H 4JRXE 5E8DL 1I1YA 1SM3L 1YN7A 4L3EA 5GRVK 3V2AR 1DBBL 4GAJL 4XZUA 5C07E 1B88A 5E2VL 2H1PH 1TJHL 4WI2A 3SGEH 5CSGA 4OFVA 5IBUG 1ACYH 1U8HA 2HJLB 4PJBF 4NZDA 5EOTB 2W0FB 4HHAB 2R8SL 5KVMC 5E8PB 2D7QA 4M5ZL 3LEYL 5TQ0H 2WQRA 4LKCA 2QHRH 3ARVA 1XCQA 4I18B 4P23D 5ITBL 1YC8A 2AK1L 1DLFH 3HRZB 3K2MC 5DK0B 3BWUC 2VLJB 4XP9L 3DYOA 2CDEA 5DUBB 2BSTA 3L5WB 1QBMH 1JGDB 3NIGE 4WW2C 3IS0X 4XBGB 3PXHA 5DJYB 5EU6B 4YR6A 1FE8H 1MOEA 2P8LB 3O3UN 1VFAA 3BH8A 3Q1SL 1H3XA 4LSPH 5BO1H 2ZSWA 1I7TB 5FGCE 4I3SL 1YEJL 4ELKA 4Q9QL 1RHHA 2VNCA 5ALCH 1JWUA 2NY7L 1AXIB 4G6ML 2YPLB 3PWNA 3BRFA 4GG6E 4H26B 3OAZH 5I66A 1NUFA 5JUEL 1J18A 1JCKA 5AEAA 1CFNA 4M93B 5ICYB 5DS8B 5FDYA 2VH5L 4HWBL 2H3NB 3D18A 1IKFH 4JAMB 2HTKD 5ETUB 3INUL 2D7MA 4M48L 2VTFA 2AKRA 1KPVA 4X0KB 2X89A 4PJBB 1A7PH 3M8OL 3DSFL 2IAMA 2W9DL 3AM8A 5I1IL 3EGSA 4MD4A 2VERN 4ZYKB 3MBEA 1OWRM 3FO1B 4IJ3C 3ARSA 1F6AA 4LLWA 3HI5H 4ZTPH 4NWUL 3EYUH 3O0RL 5C2BL 2DJUA 2GCYA 4HC1H 5IGXH 4NGHL 3I6GA 1GGTA 2IH3B 4MNHA 4F7MA 2WUCL 4ZO6A 3QIBD 3RTQD 3GMOA 3TT1L 3E6FB 5T1LD 4PJ9A 2AVGA 3KPRA 4KHTL 1RUQH 1Q8MA 3DGGA 4HUKB 1U41A 5ACZB 4S1RH 4U1MA 4NQEB 3UZVB 3MUJA 3NBNA 1A22B 2LABA 4ODUA 1NLDL 3FO9A 5AUMB 5J12B 1RHFA 2EDDA 1U92A 1DBJH 1NCBL 3BOVA 5CLWA 2P8PB 5DHVB 1OOAA 1FNGB 4ZXBD 2I60L 1YMMD 5E2UH 1JHKL 2Z9TA 5DJZA 5E5MA 3RAJL 4EN3D 4QRRA 4ZUTA 2XKUA 3CFDA 4O51A 1QSZA 3MLUH 4KI5C 2I9LB 1G7IB 1T7WA 2DQHL 5JIPA 1TJGL 2BNRD 4MA1C 3SPVA 3GJEB 2ICWJ 5E8NB 3HNVH 3SDDB 2FH6A 4XCNA 3V5DA 1YJDL 3MGTA 4BSWB 3K1DA 4OCYL 2UVEA 1KPUA 5DK3A 2H45A 3MLWL 3V6BR 4OZ4A 5DD6A 2XN9B 1DL7L 4MWFA 2KUTA 4Q6IC 1OT2A 3TCLA 4GRMA 3RNKA 1JNJA 2H26B 3L5IA 4APQA 1MUJA 5DJ2B 2R0KH 1HHGB 2BVQA 2EC8A 4RGMB 4GXUN 1C8PA 2NYYC 1CE1H 3NCEB 3FQUA 1D6EA 2F54A 3S3JA 1FNFA 4P9MH 4HFUL 1AC6A 4JFHD 5C08D 1C08B 4MA7H 4FA8A 2ICWB 3SHSA 1EHNA 4XC3H 4JN1H 2BXZA 1N8ZB 4Y2DA 1KCVL 5DI8A 4PJ7A 3SGJC 1YYLH 1T0NA 5C0AE 3VFVB 2ARJA 1JMZA 1MIEH 4HUVA 3GSNL 5GGSB 3B9KA 1N5YL 3N9GH 5B22A 1D5ZB 4K2UL 3LDBC 4RDQG 3E0GA 1XF4B 3REVA 5L8KB 3X11B 4O5LL 4PB0H 4JE4B 4MJIE 1KXVC 2VL4A 5I71B 2VQ1A 4Z76A 1VACB 1CLZL 5FGSA 1NL0H 1NCDL 2Z4QA 1FZJB 1IEAB 3PHQB 4ZFOL 1MAJA 2VLKE 3RIAK 4P2QE 3B2UC 5DGQA 3NFPA 4RISL 3SOBH 4TN9A 3W11C 1PKQE 4CVUA 1NC4A 1R24B 3QAZB 1FIGH 3K1KC 3PGCB 4U1NB 1SBSH 1GRWA 4JY5H 4AMKH 4JPWL 3JUYA 4R7DB 1LE5A 1ULVA 2ED7A 3FFCE 4XAWH 4XP5L 3ZYZA 5GSVA 5JHDB 4KTDH 3OR7A 3WN5B 4JHWH 5FOBB 3LQAH 2GTWB 1GAFL 5A3ID 4KKBC 3U79A 4BSVA 3UX9B 3VFSB 4ERSH 5CZVH 4YX2L 5E2TL 4NO0D 1IBGH 35C8H 2XWBA 3QNXA 3ZL4L 1U8OA 5BMFL 4JLRB 4LCYB 5I16B 5IHZA 4WY7H 4XCYA 3K4DA 5DHYA 4KV5E 3WS6A 1UWXH 3O8XC 2X4RA 3CD4A 5CUSL 4BFIB 2MQCA 1FVCA 2X7LB 4JFDE 4PJGE 5CBAA 4QXUH 1N2RB 2MNUA 5K33A 1SJXA 3QPQC 3VXTA 1MCSA 4MD0B 2HLFC 3NH7L 1BPVA 1CGTA 4Y4HD 4K55A 3TNNA 1P7QB 1HI6B 3MV11 5BS0B 4QLRA 3V6FA 1ITBB 1KTLB 3O4LD 5HI5C 3LS5L 3RVVC 5GS0H 4XVTL 1AGEA 5IBLD 2PW2B 3Q5YA 4LAQL 3CFCL 3HZYA 2HP4A 4FQQB 4PLOB 1YUHA 1DBAH 1T5XA 3PHSA 3G6DH 4IDLA 2ZUWA 4YBLB 1T0MB 1IC5H 3MJ9L 1DQJA 2EH7L 3DX7A 4H0IA 2NXYB 1R3LA 3QWQB 2HT2C 3H3PH 1CDCA 3T0XA 3QEGL 3K8MA 3DI2B 3QUZB 3U0PB 4YHNA 3RDTD 3QEQD 2YRLA 3T4AB 1RIHH 2QQKL 3HC3H 1CF8H 5C7XL 2XQYK 4EI5A 1NFKA 1S9WA 3HC0B 4XNQA 1FL6B 3TN0A 3KJ4B 3H9SD 4E5XB 2WBJA 2IADA 4R4FH 4F15B 5L6YL 3GI8H 1GPOL 5IMMB 3U0TB 1AI1H 1WF5A 2QSVA 3VW3H 2W0KA 5J6GA 4N5ED 3RGVB 5IB2A 5EZOL 3Q6GL 3WHXB 4NNYB 4AJ0A 5JMOC 4I3RH 4BH7B 5CJXA 4RGND 1T7ZA 1DVFD 1W72L 1MRDL 4PRHE 3QQ3B 3KR3H 5KS9E 1N7ML 4MS8C 3WEXB 5CGMA 2J88H 1FPTL 4HIXH 3UJIH 3ABZA 5F88B 1PG7X 3C08H 3EOAA 2BHZA 3GMNB 5TE7L 4OUUA 1MPAL 3F6IA 4X7FC 3KGRA 1SYVA 1BFTA 1HN1A 4JQXC 1QLFB 5DHXB 1MRFL 3WIFA 4F9PC 5B21A 3LEXB 3QA3B 4ODHH 3ET9F 4JGUA 3EJZC 1UGNA 1W8NA 3FOLA 3S3PA 3MZTA 4JFZH 4X98A 5D2LE 2X4NB 4X7TA 1R0AH 2P5WE 2ESVE 1LK2B 3CPLB 5DD3L 5HGAB 5CWSA 5HDLA 2F5AL 1EFQA 2Q76B 2KZ1B 2A6JB 3SJVA 4YHML 2V5YA 5IJVB 4K7PY 4XX1G 3SCMA 3WS3A 4I0PB 3OPZL 3EYOB 5IBUB 1FJ1B 5C0RH 4IRJD 4S1QL 3AB0C 4ZDHB 3ULUL 3TBYB 4OLWH 3RWCA 4BZYA 3OB0K 4G9FE 1IGJA 4JDVB 4JDTH 3X3GL 1FRGL 4OCRH 1MCFA 2VDRL 3QUXC 4TRPL 3GEWB 4UI2A 5DUPL 4DW2L 3OMZA 3U9UB 1BECA 4JM4H 3BUYB 5K9QI 1I8IB 3MA7B 3ALPA 3L9RA 1L0QA 3GJFK 3S5LG 2R2EA 1CT8B 1OPGL 4NKOA 4U05A 2ICCA 4YWGH 1DBMH 3G08B 4LDOB 3KPTA 2HWZH 3QXUA 4P46B 4M5YH 3L3JB 3SKNA 2G75B 3JTTB 4YBQC 4O02H 1UKTA 4QYOA 3RP1A 1D5IH 4OD3L 3GSOB 5HHOE 1HHIB 1W0WA 3DJ9A 3MCLL 3CX5K 2H8PA 4NKIH 2XI9A 1IC4L 4KJWD 25C8H 1MWAL 5IJKA 5IMKB 5HGHA 3CSGA 3ZKXC 5MENA 4EUPH 1MHEB 4IMKA 1A7NL 1U58A 4BZ1H 1Q94A 3CDYA 3IJSA 4G9DB 2R0WH 2Q7YA 4XTRD 1XCTB 1QFUL 4P4KD 2A2QT 4R3SA 4KMTL 3ZE2E 1F4WL 4PREA 2HRPH 2XXCB 2R56L 3VJ6B 5I1DA 3HB3D 3VGHA 5D1QB 2DLGA 3T8XB 5E5UB 3BP6B 1WCBB 4LBEA 4OI8A 3T65A 1U2HA 4XPBL 5SWSA 4N9GA 1A14L 2CO6B 3GMRB 4LVNC 3HG1E 5F9AC 4ZUVB 1VEMA 2K9UA 2YC1A 4PRPB 1FSKC 5I9QC 3A6BH 1ZANL 3T2OA 3LQMA 4Y16B 3O41A 2VE6A 4D9QD 2HKFH 4M8VA 2MCG1 4PGJA 2HT4D 1NMAH 1EBAA 3BKYH 5E4EB 3R8BB 5TE4H 3DUSA 3C6LC 2X1WL 3MACH 1QLEL 1CN4A 4KKLC 1YEDB 5F7DA 1XF5B 4GSDL 4TNVK 2QKIB 5CZKA 3C60D 1KC5H 5CJ5A 3NAAH 4JREC 4F7PA 5IESL 4I5BA 3NCCB 1ZT7B 4JVPA 2BDNH 2IPTL 4JO4L 3TJEH 2OR8A 3V4UL 2NY6C 1MHPL 1MY7A 3QULA 4WNQB 3UPRA 5JXAH 4OCXH 1NGQL 5F7FA 2XQYG 1WISA 5F6HJ 4K7FA 5IMOA 4E42A 2R0ZL 1FO0L 3VXUE 3WLBA 4IOIB 3ARBA 4PIRF 1D5XA 1I7RA 1BLNA 1C5DB 1MLCA 3QZWB 3NCYS 5HYSG 2AEQH 4XCCL 2X5PA 4ZPTA 2VUYA 1J8HD 5EOQH 1TQCC 1IGIH 5C0BE 3I02B 2BVOA 2FECI 4M62L 1XGUA 4RAUB 1ZGLB 3QFJE 2EECA 3M17A 1J0JA 2AJYL 3OJMB 4KROB 1EAJA 3A67H 2XYCA 4ONFL 3MOBL 1V3JA 4WGVB 5DQDL 1T2QH 1MJ7H 5LWYH 3V6ZB 4MA3A 4HCRA 1JMXA 4ODVH 5GJSL 2W9LA 4JY6A 3EDEA 3ZSSA 2F53A 4BFEA 4PRBB 3G6JA 4L8SA 4Z8FH 1HNFA 2FBJH 5F3BA 5H8DA 5L88L 3VGDA 1DEEA 3IDMA 1RU9L 4MDIB 2RFXA 3VXRA 5TPWL 4RZCA 4MA8L 5DWUH 1T6VN 4OUOA 1C12B 4YFLF 1FVEB 4OM0H 3SBWC 4U31A 4ZFGH 5HD8C 4WUKH 4QRPB 4NWTH 4Z7VE 4MHHG 3WFBH 3O3DA 2Y6SD 2YPKB 4HT1H 4C56A 4D9RD 4E9LA 1DN0A 1UH4A 4ALAL 3BPLC 1HIMH 1D5BA 3UXFA 3QHFH 4AYFA 4XXCA 3WNNA 1A1NB 3OAUL 4WFHD 2ZUSA 2EC9U 2NY4B 4JN2B 1B0WA 5TF0A 3P4MA 4WO4A 5ID1B 2MJWA 3ARGC 1IKNA 4IIQC 3ULVF 1I1YB 1YN7B 4XZUB 4TOYH 4Z5RA 2E5EA 3PWPA 4TSCH 1EHLH 1NEUA 4LNRA 2X4QA 4X80L 1MI5E 1LD9A 1OW0C 4XMKH 4DCQA 1CDHA 5AZ2L 4QRTA 5DC9B 1VEPA 4LKCB 5HYJE 3JUZA 1XCQB 5SX5H 1EK3A 5F1IA 1V3LA 5F93C 5C8JA 1TETL 3HE7C 4DKEH 5LBSH 2F19H 3DMMA 5C0GA 3V52H 2CDEB 1A6PA 1NBYA 2AK4D 1ZLSH 5DVOA 4YR6B 4NZTH 3DRQA 4F37F 1VFAB 2QQLH 5E4IA 3BH8B 4JGMA 5C0EA 2ZSWB 5FECA 2VDOL 2Y25A 5J9PA 5AAWA 1ZHKA 3I6KA 4ELKB 4HMCA 4LEXL 3HMXL 1RHHB 3TA3A 1JWUB 1A6WL 3DHJA 1J1PL 5K93A 3RUGA 3IU4H 3A6CL 3PWNB 5CEZE 1RZIA 4OQ1A 5JQHC 4HBCH 5I66B 3IXAA 4QF1A 4DQOL 1A1MA 5DD0L 1JPTL 1CFNB 5DUML 3GB7A 3D18B 4XCFH 3P77A 4J4PC 4YHZL 1J12A 1P4IL 2FLBT 1RZFL 3A0OA 4NM4L 3SE9H 4PRNA 4NQCE 2CRYA 5T1DL 1P4LA 2AKRB 1KPVB 4JPVH 3O2VH 4KK8D 4NP4H 1QYGH 2EDEA 1FYTD 5CSBA 4QHNA 4CGTA 4DGYH 1MNUL 2IAMB 3EGSB 4MD4B 3WFHA 3HI1A 3MBEB 2Z31C 4QY8A 2VXTH 5C92A 5LGKA 1F6AB 4LLWB 1GGCL 4U3XA 3BXNA 1TCRA 3BDYH 1J8KA 2JCCA 3RI5K 3GO1H 3SGEI 2GCYB 3VDCA 1KV3A 2P5EB 3F62A 3MTRA 3U36A 3KYKH 3I6GB 3K74B 2E8YA 2ITCA 1OTUD 4MNHB 4XMLH 4PGBA 4F7MB 3GMOB 4RRPA 3I3EA 2A0LC 4PJ9B 2XKSA 3KPRB 5DSCA 3DGGB 3AVEA 1JPST 4LASL 3QHTC 4RMUA 3C9NA 1MCIA 3IU3A 4ODUB 3FO9B 3EZJB 4RFOH 4E41E 3JWDH 3SE4A 4MZ3A 4OAWA 4KJPD 1U92B 4QGYA 3D2UA 1AH1A 3L3OA 4WFED 4PJ7F 4PJIA 3D25B 1KCUH 4O2FA 4NO2A 2PO6A 3P30H 5DJZB 4LSQH 5E5MB 4MQXC 4QRRB 4ZUTB 3CFDB 4O51B 1OGAE 1LILA 3QXTA 5EU6E 4MQSB 4WI6A 4HFWA 3MRLA 3SPVB 1L9MA 2ZPKL 4QTHA 5CINH 3RJDA 4HXBL 4B50A 3SDCC 2OK0L 4XCNB 3V5DB 2FATH 3MGTB 2E7LC 5GGQH 2YD1A 4CW1A 2DM7A 1HYSC 1OAYL 3PL6C 4NJAL 3WFCL 4HAFA 1KPUB 4KY1H 3QCVL 2DS4A 3DX9A 2YXFA 3D9AH 3T77A 1NCTA 3NCBB 2ZUXA 2YPLE 4YO0A 4ZUWA 1NAML 4M3KB 1TMCB 5BW7C 4KC3B 5DD6B 4MWFB 1G7QA 1JF6A 2R69L 4KTYA 4YK4C 3MO1A 3NCJH 4JEGB 3TCLB 4GRMB 3RNKB 5TGBA 4APQB 5ACLA 2FB4H 1MUJB 2BVQB 4OKVA 3BAEL 4WU5A 5EH1A 2DQGL 3FQUB 1D6EB 2F54B 1MEXH 4L9LA 4NZUH 1YY8A 4PRAA 4ODTH 1K3ZA 3WNKA 4WUUD 3DVNA 3DUUB 1P53A 2LE9A 2NY2D 3UTTA 4DK6A 2Y7QA 1S8DA 2ADJA 5L9DL 2GJ6A 1ZXQA 2GAZA 1MFEL 4V1DA 2Z92A 5IHLB 2NR6C 2UWEF 1EGJH 3O6MH 4Y2DB 5DI8B 2I5YL 4PJ7B 4CMHC 1CXIA 1T0NB 2ARJB 2JE8A 3U9PH 2X70B 1KGCE 5A2FA 4Z78A 5DMIH 4HUVB 4NQEE 1TDQA 4NQSA 3ARXA 3B9KB 4G6KL 2NY3D 3GI9H 4FQLL 4TVPE 5E9DA 2X4PB 3REVB 5FO7A 3DI3B 3UZEA 3U7WH 4WW1A 5CSZA 3VWJA 3NZ8A 3B9DA 3VA2C 2VQ1B 4KVNH 4Z76B 4KZDH 5FV2A 2Z4QB 2QTEA 3W5NA 5HBBA 3QDJE 2ZCHL 5BV7H 3IAGC 1NBVH 3NFPB 1I3UA 1NC4B 4WFGE 3RWIA 1HE7A 4CNIA 4MNQA 2E8ZA 4L5FL 5CCKH 1K5NA 2CLVA 1VGKA 1Q9OA 1IAII 2Z8RA 5IKCA 3DLQR 1LE5B 3LH2H 3MBXH 5GSVB 3VD5A 1FDLL 2HRLA 1NQBA 3OR7B 3L1OH 5AYUH 2FL5A 2DYPA 4M1CC 1H3TA 4BSVB 5DMYA 5GGTA 4MXQC 3V6OC 4TSAL 2XWBB 3QNXB 1YN6A 4WI3A 1QSFD 3P9MA 1U8OB 4PJFA 5IHZB 4XCYB 5DHYB 4EBQH 2HVKA 1ZLUH 3RKDC 4KGLA 5DQ9A 5BXFA 2X4RB 2MOVA 3EFFA 2C4XA 4NM8H 5ALBH 1N5AA 1ZVSB 4WI9A 4JFQA 2EDJA 5CBAB 1ZGLP 3I9GH 5DJDA 3L5JA 1OM3L 1A7QL 4AEFA 1WEJL 2WIMA 3ARDA 1RJZA 1IVLA 3KVQA 4GAGH 3TNNB 1HH6A 1J1XL 3QCUL 3MNZA 4QT5A 4D3CL 1JHLH 3V6FB 1E4WL 3TVMA 1DSFH 4NN6C 3CDFA 3FB5A 1T7VA 3C5ZD 3F7RA 3F12B 4W6XB 1JN6A 4PG2C 5JOFA 2OTUA 1AGEB 1OY3B 4POZD 3HZYB 1E28A 1Q72L 5LGHH 1YUHB 1T5XB 5HHXL 5D7KE 5D7JA 3MOAH 1Q38A 4R26H 1DQJB 4Z95H 3DX7B 2DOCA 1R3LB 4CVXA 3RU8H 3LB6D 2BHYA 1PSKL 1NDGA 5E6IA 1CIUA 5E0QA 5JQ6H 4RX4D 3DXAD 4YHNB 5JA9A 4RQQA 5EZIL 5EIIA 1S78C 3RX8A 4EI5B 1S9WB 4O58H 2I9TA 4XNQB 1Q1JH 4X5XA 4FHBD 4KVCL 1AKJD 3CMGA 3TN0B 1X5AA 2V2WA 2ICWI 1S7XA 3AXLA 2WBJB 3F8UB 2IADB 4RRPG 5I18L 4LOUD 1JTTA 5JXED 3GMLA 3S36X 2PETA 4ZSOE 5J6GB 5IB2B 1TQBC 2AGJH 3TV3L 4LCIH 5BVPL 3OKYA 5JZ7D 2LVCA 5HI3C 3KG5A 1CGXA 3W0WA 3QUMH 1H5BC 2F8OA 4XVJH 2IJ0C 3EOAB 3ARFD 4OUUB 3VG0L 3OX8A 2CKBA 4EIGB 4OIIH 1F4AA 2Z8VC 5K9JL 4WW2A 3QDGD 4DZBA 1SYVB 3WIFB 5I8OH 4M6NL 2VXVH 4YQXL 3ULUD 1MCPL 4TULH 3FOLB 4X98B 3RRQA 1FCGA 2FBOJ 3O2WH 4GW5A 4QNPE 5I1GL 5JHLH 3G5XA 3K3QA 5KSVA 4I18C 5CWSB 1NFDE 2OYPA 1ZS8A 2UZIL 5J56B 4HK3J 1K8IA 3LMJH 5DC0A 4OZFA 1XF3A 3CZJA 5J3HC 3SJVB 4BQBA 1NPUA 3MLRL 3WS3B 4LEOA 5T33H 1E27B 3W82A 4QOKD 3VRIA 3NIFF 5DJAA 4GOSA 1P6FA 3RWCB 2VZSA 1S5HA 1IGJB 4PJCA 4PYHA 4IHOA 3QB7C 4BELD 2F9BT 3JV4A 1IRAY 2D03L 4Z7UA 4UAOB 3L9RB 2VIRA 1X6LA 3B9EA 2R2EB 3WKMH 5IROC 5I1EL 2FECL 3TCXA 2BNUA 4M93C 1U0QA 4NKOB 4H5SA 2GYSA 2XKNA 1YC7A 5L7XH 4JO1H 2WZPD 2DQJH 3L5HA 2A77H 4QHKI 3SKNB 1MJUL 2AEPH 4FQCL 4LLUA 5JDJA 4QYOB 3LIZL 4XPAH 2VDLH 4J3TA 4ODXA 1WWAX 1W0WB 2IBBA 5BRZA 4L8CA 1INEL 2EDFA 2PCPA 4QWWD 2H8PB 4L1HA 3T2PA 3JBG7 1F4XL 4DTGH 2GQHA 5HGHB 3KPSD 5FYKH 1CFSA 3BGMA 5MENB 3TIEA 3CLEH 3NCMA 2ID5A 1U58B 1Q94B 5HHME 2F8XC 3FQRA 3IJSB 2Q7YB 2AJXH 4CL7A 3BHBA 4FN0A 1UB5A 2D7NA 1QVOA 2DICA 2NX5E 4X6DA 2OZ4A 4R3SB 4KK9C 2FX7L 2VZOA 3NFSH 4PREB 3CK0L 3VRJA 3PGDA 5I1DB 4MD5A 1GVIA 3F7VA 1JFQL 1CXKA 4LBEB 4XRCA 2WM0A 3ISWA 3T65B 3RWDA 4OFDA 4P23A 4TQEH 5SWSB 3B2UD 4N9GB 1OAKL 5EZLA 4WCYH 3W11D 4LLMA 4OD1H 4Q6IA 5KVFH 3EOYG 4D9LH 2IALA 1TJIH 2YC1B 4IRSD 2KKQA 3WD5L 1SBBA 1C1EH 1YNKL 1MVUA 3SQOH 4HPOH 5EO1A 5B4MD 8CGTA 1KIUA 4DVRL 3O41B 2VE6B 3T0EE 3SKUD 3MRGA 2PYEE 2PXYD 2VN7A 3ZTNL 3SDDC 1S7WA 3O11A 4JFED 3U46A 5BCAA 3QFDA 2XTJC 3BKJL 5ANMA 4PY7A 3V4PH 3DUSB 4AEIH 3NA9L 3HPJA 2C3GA 4OGAD 5KAQG 4M03A 4UILH 4XHJD 3UDWC 5F7DB 3G6JF 2K7PA 4ZS7L 2VR4A 1RURL 3CFBA 4KJYA 4NN7B 1TZGL 4HWZA 2FLRT 4JRXD 2Y5EA 2ATKB 3UBXG 5ADOL 4I5BB 3MRRA 5C07D 3RIFK 3O6LH 2IPKA 1FCCA 4JHBA 1VESA 2Y06H 2YBRA 1JWSA 4L4TE 3H42H 1NGPH 3QULB 2X41A 4Z18A 3UPRB 5GGSY 3ARTA 3QPQD 4JQIL 2HLFD 1UWEH 2ERJB 2O5ZL 4K7FB 5TF1L 4E42B 5IMOB 2Y36L 5F1SA 1UH3A 3WLBB 3ARBB 1I7RB 1BLNB 1MLCB 2WLZA 4ZPTB 1X5KA 4CN1A 4JG1L 3OL2A 3RVVD 4MJ4A 2BVOB 4OGYL 4LL9A 1XGUB 4RMWA 2D9QB 4NQVA 2AJSL 3M17B 3MLXL 1OF2A 4G6JL 3RTQA 2Z93A 5L2KD 5GRJL 5JW4N 3MODH 2D31A 3ARED 3BKCH 4MA3B 4LDEB 3EDFA 4MZ2A 4TVPH 2IC2A 4H8WC 1JL8A 2VDPH 2DWDA 3MLVL 5HDBF 2HT2D 2F53B 3WUZA 1GGYA 2JB6A 5D1XC 3G6JB 1MFDL 4L8SB 4PRPE 4ZXBA 2MFNA 5F3BB 1AJ7L 4EN3A 1HCVA 1DEEB 3IDMB 2CUMA 2RFXB 3VXRB 4RZCB 2BNRA 3QAZC 5GS0C 3O8XA 1TVDA 1QSEA 1QSVA 3O3DB 1XR8A 4C56B 2EICA 3C2SA 1DN0B 1D5BB 3IAQA 1RZJL 3OTTA 1RUAH 1DQMH 5LCVH 4K8RL 3ZE1E 2J6EA 1P84J 2DLEA 2XQBL 3RUGF 4ZOAA 4WV1C 5GXBB 5CEZL 1QBML 4WHDA 4ZO9A 4GKOA 3P4MB 2MPAL 4WO4B 1EFXA 4JM2D 1FVDA 1GGIL 1DQDL 1FE8L 3CVHH 3U48A 3MA9H 3T3PF 2D7TH 2OJEA 1DR9A 1HSAA 4KZEL 3LKNA 4Z5RB 4KAQL 1T20A 1LVEA 3PWPB 4J3UA 3IF1A 4YHKL 5I73C 3D69A 4HCRH 4LNRB 4LPXA 3MXWH 5ALCL 2X4QB 1H3PL 3S4SA 1LD9B 1T89A 4DCQB 4NT6A 1U8QA 1LO2L 1W8OA 4QRTB 5FDWA 4X6CE 1KCRL 2AXGA 3QHZL 1GC1H 3B3IA 5F1IB 2JCCF 5C8JB 5T1KD 2H2SC 1CU4L 4UIKL 3BPCA 3FOMA 4YDKL 3QQ9C 1VSCA 1OTTC 3DMMB 5C0GB 4XBEH 4GRLC 2UY7A 1NBYB 4H1LA 1T2JA 4PG9A 5AG8A 3MROA 4LQFH 2X4OA 1JBJA 1F4YL 5C9KA 1BVLA 3QUXD 4TSBL 3DRQB 2J8OA 5C0EB 1KEML 1LDSA 4NQDE 4ZTPL 1J0ZA 5FECB 2AXJA 4IDJH 5J9PB 4FQPA 4YBLC 1ZHKB 3I6KB 3GSXA 1K2DA 4YZFE 4GS7B 4X4MA 1BGXH 3RUGB 2VDKH 2LAAA 4B53A 4PJIF 4OCSL 1F3RB 4XNYL 1RZIB 4Y4FC 3IXAB 5E00A 2C7UA 2YKLH 4QF1B 3N1QC 4U1LA 1A1MB 4S1RL 4AL8L 4KDTC 5EC2A 4YBQD 3IFLL 4JQXA 2X9YA 3KJ4C 3P77B 3LN5A 1XH3A 2JLLA 4PRNB 4KKAC 1P4LB 5CMAA 1KCLA 2VKXA 1I9RH 1FAKT 3RGVC 4QHNB 2W9EL 2FD6L 1T22A 4YE4H 2OS7A 3WFHB 3HI1B 1IJ9A 3MLUL 3GMMA 4QY8B 4AG4H 3SDXA 4CDHA 3BXNB 1TCRB 4UINH 4N0UA 2GK2A 2JCCB 5C0AD 2NZ9C 3OZ9H 5B3JE 1GXEA 3TO4D 3I2CL 3U36B 2ITCB 4K23H 2W60A 2VZ3A 5DZNA 4PGBB 4X9HA 5KVDL 4LAJH 4ZD3L 1QACA 3EHBD 5HHVH 5DSCB 1RJYB 3RWGA 1UACH 3C9NB 3IU3B 1IAIL 4XPHL 2NY5L 4MJID 4OAWB 1FZMB 3D2UB 4EOWH 2F74A 4LPCA 2ZOLA 3L3OB 2VLKD 2DTMH 2YN3A 4O2FB 4PJIB 4NO2B 5J8OA 2PO6B 3QXWA 4OLXH 3QISA 4P2QD 1Z3GH 5GGVH 2YK1L 2QSQA 1FZOA 1WAAE 5JTWA 4LMQE 4HKJA 4HFWB 3MRLB 4OJFH 4BFGA 3X17A 5C0CD 4GXUM 4QTHB 3BN3B 1QR1A 1RUKH 4DKFL 5CAYB 4CUCA 1TCMA 1RMFH 5IP4A 3SKMA 3FFCD 4CW1B 3H3KA 1QFHA 1KIRA 1XGTA 4I8DA 3DX9B 5LGJA 3QRGH 3T77B 2VDNH 3GSWA 1E4JA 3MLSH 4YO0B 4ZUWB 4LPWA 1MFCL 2J8UE 1GOFA 2YD3A 2NY6D 1G7QB 3KLDA 2IMNA 3RDTA 3MO1B 3PGFH 3PQYE 2JB5H 2I25N 3MLZL 1L7TH 3DGCR 4R8WL 1Z5LA 3D3VD 3U30B 3WHE1 4OKVB 1JZ4A 1LO0H 4WU5B 4CADB 4PB0L 4PRAB 4L9LB 1YY8B 4CU8A 1N64L 3MRBA 3EYFA 3TJHC 3ZHKA 3KAAA 3DVNB 3GIZH 3UTTB 4NUJA 4N0YL 2Y7QB 4HLZH 5F9OH 1S8DB 4RFNB 4PS4L 1BFVL 2ADJB 2GJ6B 2GAZB 4V1DB 2Z92B 2P5EE 4LRNL 4YFLI 4YHYB 3RBSA 4MJ6A 4N0FA 4YDIH 5GHWL 4LMQI 1MCOH 1Q0YL 5SX4H 4JY5L 4Z7NE 1KCSH 3KPRE 5FCSH 4PJFF 4YXKH 5CEXA 3RNQA 4NN5B 1QRNA 4Z78B 3MRIA 4NQSB 3ZMRA 2XXMB 1MCKA 4GW4A 4KTDL 5F7UA 2BRRL 4JHWL 3C6LA 5E5RB 3BQUA 1T83C 1QD0A 3TIDA 1QRKA 5E9DB 4V2BA 1NMBL 5FO7B 4DK3A 1J1OL 3LY6A 5CSZB 3VWJB 3NZ8B 5EIVA 3EFDL 4S1DC 1T1WA 5DRZA 1BWMA 2QQNH 1AHWA 3HZKA 3UC0H 4OB5L 1CVSC 1W0VA 4NOBA 4WI4A 5IV2A 1FFQA 2A1WL 4FQ1L 3MSPA 4DN3L 4H8WL 6CGTA 3TZVC 3RWIB 1T2XA 4CNIB 4MNQB 1B9ZA 4CU7A 5E4EC 3VH8A 1K5NB 2CLVB 1VGKB 1Q9OB 1HKLL 5IKCB 1JNHA 2CLRA 4PB9L 4OI9A 3C6SB 5LJYH 1V8HA 4HJJL 5AWNH 4O9HL 4PRHD 2RCSL 4XX1E 3SDYL 1CD1A 1MHHA 2B1HL 5CP3A 5F7EL 2Q8AL 2E27L 2DYPB 4O2EA 2NW2A 5B39G 4XI5C 3MRKA 3F7QA 1U8IA 1WSST 1YN6B 3P9MB 3GDBA 4PJFB 4HIHB 5DTFA 5IVZA 3MV9E 2HVKB 4PRDA 3CXDL 4Q9RH 5DQ9B 5BXFB 1A02N 2QADD 5I1CL 3EFFB 1PG7H 4MVBC 1N5AB 4WEBH 3DURA 4BH8A 4JFQB 2P5WD 1KJ2A 5DJDB 4RGOL 4BZ2H 3K2UH 1KENL 2R0LL 4G43A 1G6VK 3QNYA 3O2DA 4YC2B 1HILA 3ARDB 3MV8D 1NLBL 1RJZB 5CILH 3S98A 3OKKA 3UBXB 1YMME 1HH6B 4PFEA 4PTTA 3MNZB 4QT5B 1QFWM 4PJEA 5F1OB 3TVMB 4KROC 3SKJH 3FB5B 3PHOA 3SBWA 1QR4A 3PE9A 1Y0LA 5IW1A 1WIPA 4Q9BA 4WW2F 3GNMH 2YN5A 1JN6B 3E2HB 2OTUB 5D96B 3KS0J 5CJOH 1U8MA 4X5LA 1E28B 3JSSA 3FN0H 2OTWB 1ZMYA 2COQA 4K3DL 4DOHE 1UADC 5D7JB 4LSTH 1A6UH 2C1OA 4PJ8D 4WFFD 1AO7A 1ORQA 3H2WA 5AG9A 3HA0A 1CFVH 5E6IB 1NDGB 1JIBA 3S37X 1ZT4A 1BZQK 4FMFA 1FL3A 5FUOL 3WLWC 2M26A 5GGTH 4WWID 2OXGA 4RQQB 4HSQA 5EIIB 1XIWD 5CD5C 3WIHH 5FUZL 1HHKA 3D39A 1GHFL 2I9TB 4G6FB 4H0HB 4X5XB 3LKRA 4JO3H 2V2WB 4U6VH 1S7XB 3AXLB 1RUPL 3DX6A 5HHOD 3EYQC 3D85A 1OW0A 3GMLB 4PJCF 4OBRA 2UWEE 3V5KA 1DANT 2NY4C 1ONQA 2M8XA 4Z7UF 3HE7A 1T5WA 1ZHLA 3W0WB 1TZHA 4OZGF 2A0LD 5I30L 1I4FA 5D71L 5LXGH 2H32A 4M00A 5HGGS 1BVZA 1N6VA 1RULL 3OX8B 2CKBB 3LZFH 4JDTL 4WW2B 4DZBB 4FFVD 2YA1A 4JKMA 4PV9A 1SVCP 2A73A 1DJSA 2VLRE 4TPRL 2R4SL 1NCAH 4UNUA 1T1YA 1I9JH 4FFWD 4GW5B 5D70L 4AQOA 1R3KA 2UV3A 3S88H 3G5XB 4Y19A 5KSVB 5DRNA 3SO5A 1J8HA 3UO1H 1ZS8B 5HY9A 1K8IB 2HH0L 2MHAA 1VFUA 4AZ8A 4OZFB 1CLYH 5C0DA 2FZ3A 3RVXC 4LEOB 7CGTA 3PL6D 3T0BA 4NPYA 5C09A 3GKZA 3VRIB 4X6DF 2E6PA 4J4PA 1RZGA 3ESVF 4PV8A 5DJAB 3BEWA 4N68A 3JWDC 1Q9KA 2XOTA 3GSUA 3W2DL 3WNPA 25C8L 1X3DA 4PJCB 3TYGL 1NCWL 3WDIA 4Y5YA 4N1EA 4IHOB 3C2AH 2Z31A 4IJ3B 3V0WH 2OMBA 2BRQA 3JV4B 3KS0H 2WAHA 1G6RL 4Z7UB 5IBTH 2CXGA 5IQ7H 2Q8BL 4C54A 2VIRB 4OZGB 3ULVC 3WXVH 1J0HA 2BNUB 2YUVA 4M7KH 3P4OA 4H5SB 2XKNB 4PUBH 1C5BH 5ISZD 4Y1AA 1IAIM 4JDZA 5ABDE 1BBDH 5FIEA 1KUMA 4LLUB 4H25A 4LCWD 3HZVA 4OFYA 2IAMC 3AM8C 4U0RC 4ODXB 3MBEC 5BRZB 4L8CB 4RWHA 2PCPB 2NNAA 2PF6A 4YHLL 2O5XH 3QPXL 4PJAA 3VDBA 3QFJD 3BGMB 1OP3H 3TIEB 4OZFH 1DFBL 3RX5A 5TE4L 1YEHH 4L3AA 3FQRB 3QIUD 4PJ9C 3BHBB 4JVWA 1UB5B 4ZQKA 1Q0XL 1QVOB 4KUZL 3SDCA 3UTPE 4L4VA 4X6DB 1HZHL 1S9YA 4GRWF 4MYWB 1G9NL 3JZ7A 1YEIH 5D7LA 1B4JL 5CJQH 1YEFH 2H41A 3PGDB 3VRJB 2AJUH 2DQCH 1KC5L 4DFIA 4MD5B 3F7VB 4RBPK 2CGRH 5BW7A 3BSZL 4Q0XL 2Q3AA 4XRCB 2CIIA 2D0FA 3RWDB 4P23B 2CK0H 1KB5B 5EZLB 4LLMB 4Q6IB 1ADQH 4PP2A 5TJWK 1LK3H 3ILQC 2IALB 3BD4A 3SGKC 4UB0H 1MVUB 3QEQE 5EO1B 1OCWH 4O4YL 4JO2H 2P48B 1IQWH 3MRGB 5KZCD 5J7CC 2GSGA 2ZOKA 1S7WB 3O11B 3U46B 3QFDB 3T3MF 4OGXH 5ANMB 1M05A 1BF8A 4PY7B 4UQ3A 5LG1A 3FJTA 1XF2A 4WIQA 3HPJB 3DBXA 2FX9H 1FV1A 4MXQD 4S10A 4RGNE 5E1AA 1FL5A 3CFBB 2GHWB 4KJYB 4QXGL 4HWZB 2DD8H 2NTSP 5BV7C 5CD3A 4WRLA 2Q1EA 5HPOA 1KIPA 4APQC 2FCBA 1A4JA 4PGZA 3MRRB 1QFPA 2EE3A 4MAYA 2IPKB 4UBDC 3SGDH 5HYFA 3CUPA 2YD2A 2YBRB 1JWSB 1ZEAH 1PZUB 2Y72A 2W92A 3G04A 4GRWB 2OZ4H 3EYVA 4OT1H 1U95A 2WWKO 1MELA 2R4RL 4KWUA 3Q5TA 1EEQA 1OAXL 5HYJD 1NH6A 2XZAH 1PVHA 3NCYP 3R8QA 3LVEA 4Y2DC 5T3ZH 3OKEA 1NANH 4ZFGL 5I19L 1EAPA 4FQXD 4NQVB 2Y5TA 1OF2B 1YQVL 1J10A 3NIFE 1GJIA 4OD2A 4PJ5E 2D31B 1D5MA 5B8CA 3B9KC 3EYSL 4R90H 5K9QG 3ES6A 2EZ0D 1IAOA 4OIAA 1I1CA 1S7QA 3MCG1 2DWDB 1A5FH 2UVFA 3W39A 3X12A 4K8RD 2CDFA 3VE0A 2JB6B 4G7VL 2H2PD 1NSNL 5DFVD 4ZXBB 5CEZD 1S78D 3HLAA 1NFIA 4GQPH 3ARPA 4EN3B 3MLYH 4IS6A 2CJUL 3RHWK 4HMEA 1AE6L 1V7ML 5D5MA 4D94A 1R5WA 2BNRB 5I1JH 1G1CA 3O8XB 5HYQA 1QSEB 2JJTA 2XNAA 4NQCD 2CMRL 2VXQL 1XR8B 4IOFD 1WZ1L 4MQTB 4J12A 2YD7A 5DDHB 5KSBE 4P99A 4G8GD 1IFHL 3TT3L 1D7FA 3F58H 1MJ8L 3ZO0A 1OP9A 2DQEH 1K6QH 3T0AA 1WBYA 2FR4A 1KOAA 1ZLSL 1GIGL 5F72S 1EFXB 1FVDB 4OQTH 4M7LH 3S97C 5GRVL 4K3GA 3GSNA 3FO0H 1BM3L 2OJEB 2W0PA 3VI4F 3U4AA 4OFKA 1HSAB 2GSIA 4PG2A 3L3HA 3S96A 5D2NE 3LKNB 4GQ9L 9CGTA 1T20B 3IF1B 3D69B 3PF2A 4HUMB 2ENSA 4WUUA 4XVSL 4PYGA 3IU4L 3R0MA 4XP4H 3S4SB 4LF3A 4XNUL 3GRWH 4R2GC 4NT6B 2FEDD 4F7TA 3HNSH 1U8QB 3RX7A 4J6RL 4HBCL 2XPGA 3ZDXF 5J3HD 5FDWB 2VLJD 4HF5L 4YXHH 3SDXF 5E2WH 2AXGB 3VFRA 3HAEG 2IANE 1PQZA 3TEUA 1G7HA 3BPCB 5EU6D 3FOMB 4BA8A 2DQIH 1EJ6A 3LHPL 2M1KA 3MROB 3BX7C 2ZUQC 4Y4KD 1CLOL 1S3KH 4D9QE 5I1KH 3ULSA 4HUXA 2X4OB 5C6TH 1A9EA 1BVLB 5DZLA 4PRIA 5E70A 4RMTA 3G6JE 5GZNC 5FCUH 2YPLD 1UM4L 3WKNA 1EO8L 4OF3A 5IQ9A 5DMGC 3GSXB 1K2DB 3VMOA 2YR3A 5A43C 4A6YH 5EULV 3VFMA 5HYIA 4JKPH 3CFKA 5E00B 2C7UB 4U1LB 2IBZX 1UM5L 1ZHNA 3VRLF 4EI5C 1QFOA 1RZKH 4LFHD 4XCEA 5EC2B 4C56E 4WHYH 4F9LA 3CX2A 2RB8A 4OTXH 2WBJC 4UV7L 3LN5B 1XH3B 3BWAA 1CDJA 5EO9B 5CMAB 3VFOA 3TBTA 2B39A 1T22B 5MEQA 1UYWL 2NQCA 3OAZK 2PTTA 3LN4A 3GMMB 4S11A 3QUYC 3ULVL 3SDXB 1YYMH 4GFTB 2ADGA 2XY1A 4N0UB 5D7IA 4HC1A 4OKDA 1CDIA 3S34L 5KTEL 2N4IA 5BJTA 3VD9A 1OL0A 1BAFH 2YRPA 3EO9H 1KGCD 2FATL 3N85L 3NGBB 1AR2A 4NQED 4H1LH 4Y2OA 2AEIT 2NPLX 2XA8H 3O6FC 5EO0A 3HR6A 3WFEH 4LLQA 5HDBE 1I8LA 1AFVL 2DQDL 4NHCL 2ZKHH 3RWGB 4G5ZL 4CN6A 2C4FT 4HUNB 5EORH 1NGWA 3NCJL 5DR5H 1NMCB 2FGWH 2VWEC 2F74B 3PWVA 2ZOLB 2V9QA 3HPLA 5GRUH 3ZYIA 3FT4A 4HK0A 1Z0NA 3SDDD 1VFMA 3CIQA 1DN2A 4U6YA 3SCMC 4EKXA 1FZOB 4ODTL 4WFGD 1JGUH 1A6VH 2D7PA 4HKJB 5E2JA 3RL1A 3CX5J 3SKOA 2C1PA 3N0PB 1QR1B 4YAQA 1A7OL 2NXZB 3SKMB 2XN9D 4D9RE 5EB9A 1XGTB 3ECBA 5LGJB 2WUBL 4U3CA 2P1YA 2WMPA 3GSWB 1KEGL 1R3HA 1G9ML 4E0RA 2IFFL 2XWTA 4UOJA 1BOGA 2J12B 3DXAA 1FFNA 3RDTB 3ZKXB 3T3PE 3ZDYE 1RIVH 1RFDH 2ICES 5ADPH 2B4CH 3KYAA 1CBVL 1Z5LB 2OMNA 1AKJA 4AEEA 2HG5A 4Z7WE 1OARH 4GLRH 3FTGA 1IM3A 2VXUL 1XGRA 4DAGH 4ETQA 5F96L 3MRBB 3EYFB 3R06A 5JXEA 2DF3A 3VXMA 2E7MA 2EDLA 1EXUA 5FO9B 4NUJB 2YA2A 5T3XL 5KBNC 5L2JA 5TE6H 1NBVL 1I3GL 2DMBA 2X9XA 4MJ6B 2FHBA 4LARL 1U8NA 4N0FB 4U1SA 4DGIL 3AROA 1EEZA 1ZA6A 4YBHA 2AW2A 2PNDA 2F5BL 3ARFA 5CEXB 3RNQB 1QRNB 1ETZA 1FBIL 3OKOA 4R0LC 3SEPA 3MRIB 2AK4E 1MREL 3MBXL 5CZXD 4I2XE 2Q6WA 4GW4B 4FTVE 4I77L 5GRXG 3L1OL 3C6LB 3MXVL 3BQUB 5AYUL 1H9VA 2UYLA 1MCHA 3TIDB 2HMIC 5EBLA 3UDWA 1TVHA 3FN3A 2EDWA 1T66D 4B5EA 5KVGH 2JF1A 5HI4D 1T1WB 5DRZB 4HEME 2BSRA 3GJFH 1AHWB 3HZKB 4JREB 4ESKA 1YNLL 2D9CA 4PJEF 1E4KA 1W0VB 5IV2B 1OP5H 2AJVH 4P9HL 4QOKA 2HFFA 2VQUA 3KXFA 2NY0C 5JHDD 1OD7A 3VH8B 1JNHB 2CLRB 3VWKA 4JG0H 5C86A 1FYTE 5LQBL 4CRPA 3GMPA 1DSFL 1CD1B 5DD5L 1MHHB 3HFML 2D0GA 4GMSH 1TQCB 2ZJSH 4O2EB 2ZNWA 3S36H 4NFCA 4UDUA 4JKLA 2NW2B 3MRKB 4UTBL 4HIJA 1BBJA 1U8IB 1MFNA 4NDMA 1KN2H 1G0YR 1KJ3L 3MRFA 4N90E 5DTFB 5IVZB 1KELH 4LIQH 5LGHL 5DZOA 1WWWX 4PRDB 1JNNH 3MV7A 1ZVHA 1T4KB 3OBAA 4NJ9L 3WXWH 4EXKA 2ERJC 4XP1H 3DURB 4TNWF 4BH8B 2GJ6E 2OR9H 4MLIA 1ZGLM 4HQQL 4I3GA 5SX4I 1OTSC 1P7QD 4FZ8L 1KJ2B 4XPFH 4YPGA 4O00A 4G43B 5BS0D 2B2XH 2G5RA 3QNYB 2E9BA 5ICZA 4U7MA 3OKKB 1KLGA 2LU4A 4WFEE 3R4DA 2Q86A 5DD1L 1WJ3A 2AQ2A 1UWXK 5F7WC 3X3FL 3HMWL 4PLKC 4PTTB 4PJEB 4WGWB 1FGVH 3PHOB 1I1AD 3BKML 1VENA 1FH5H 1Y0LB 1D6VH 2DWEA 2XRAH 5IW1B 3WSQH 2C3VA 1HDMA 1M7IA 3BRGC 1U8MB 4U1HA 2NXYD 2LAGB 1G7MA 4LCIL 1JGVH 3IFOB 4S0TD 1AIFA 5C6WH 3QUZD 1EVUA 3G5YA 1LO4H 2ZCLL 4NZRH 2C1OB 3WUWA 4NBXB 1AO7B 1ORQB 4UT9H 3KNBA 1ZT4B 3O45A 1FL3B 3SE8H 5I8OL 3E1F1 4PJXA 4MNQE 5ESAA 4TULL 1OAUH 4JCMA 2VSCA 1HHKB 2PXYA 3D39B 1UWGH 3B6SA 3RGVD 3LKRB 2BSSA 4JFEA 1LO3L 5CIPH 3V4VL 3DX6B 2BVEA 3D85B 4FQJH 3CLFL 3CAFA 3RWEA 4ENEC 3LAFA 5BVJA 1KJ2H 2FGZA 4R4NC 3V5KB 5MHSE 1ES0A 2ZCKL 4G3YL 1LP9E 1ONQB 3O2DH 3PABA 5C71A 2MWCA 1U8JA 2X10A 4ZNEA 4PJFE 3HE7B 2APVA 4WO4C 1T5WB 1ZHLB 1TZHB 2IQ9H 2XTLA 4MJ2A 5JW3H 1I4FB 3THML 4HIEA 5F97E 1YEGL 1U91A 2H32B 1F3DJ 1JGLH 1SEQH 2HTLD 2Q87A 2EYRA 2ORBL 4UT6L 3G6AA 4WVRA 3OB8A 4PV9B 1TTGA 4XP6L 1FZKA 1I3RA 2A73B 4J3SA 5E6ZA 5EU7E 4NKMA 4P2OC 5INCA 3HNTL 1T1YB 3GK8L 5TFSL 1R3KB 4DJMA 1QA9A 3QG7H 4Y19B 1TVBA 1JF1A 4HWEL 5DRNB 4I0PD 4HEPG 1W0YT 5HY9B 4PJAF 2MHAB 2OXHA 4Y4FA 1A0QH 4DN4H 1CQKA 2EKSA 3BISA 3DMMC 5C0DB 5GGVY 2FZ3B 3T0ED 3K8KA 3IDGA 2GEEA 4RWYH 1VKXA 2FX8H 2X4SA 3PP4H 4JPKL 4NPYB 5DEZA 1PLGH 4KK6D 5C09B 2J2ZA 2VDLL 2ZP0T 2VABA 1RZGB 4NRYA 4PV8B 3UYRH 1YA5A 3WFDH 1IQDA 3BEWB 2BNQB 1Q9KB 3GSUB 1OSPL 1BIHA 3IRZA 2VDMH 4Y5YB 5FYKL 5D72H 3CLEL 1CR9H 2Z31B 2CRMA 3TA3C 4GKNA 4GG6A 5I75C 1XGQA 3MOQA 3I85A 5HDQH 5E08L 1JGEA 2XG5A 5C0JA 1EJOH 4P46D 3SDAC 1RK0A 2H32H 4JR9L 1QSFE 3P4OB 2DM2A 4L4TD 2ZUYA 4M43H 5I15L 1I7UA 4Y1AB 5I1HH 2RQ8A 1YEKH 4JDZB 3WMSA 5EG6C 1P4BL 3DV6A 3QXAA 3BPNB 5MEPA 1CZ8H 2P4AB 3BP7A 5D6DA 3UBXI 3WCYA 2ICEA 4H25B 3HZVB 2VDQH 4EDWL 3LPGA 1WITA 3CMOH 3BW9A 3W0WE 2NNAB 3G5ZA 1KBGL 5HSFA 1H3WM 4QCIA 4EUPA 4PJAB 3JV5A 2CK2A 2R15A 2PKDA 4Y88A 1L4IA 3KWWA 4TUKL 1FGNL 4YHOH 3QCTL 4OLZH 3SDCB 4ZQKB 5D1QD 4L4VB 1S9YB 5HTSA 2WP3T 3JXAA 3IDJA 3MRCA 2RR3A 5D7LB 3KHQA 1HINL 2B5IB 3SE4C 2DKSA 1F3DH 5D93B 4XMPH 2KH2B 4NNPH 2V5TA 2X1OA 4K9EH 4PRPD 4JHZA 2MCPL 1N0XL 4RMQA 2CIIB 3B9VA 2VZUA 2HFGL 5C3TA 3BE1H 1KSRA 4Y16D 1MLBA 5T1KA 2PO6C 2DKUA 2Y06L 4PP2B 4WTWA 4JFXA 1RIUL 2V2XA 3H9YA 5E8DH 4GXVL 1SM3H 3DO3A 1E4XL 5TQ2L 1DBBH 2I26N 4FMKA 5E2VH 2GSGB 2ZOKB 3WE6A 4P3CH 2DDQL 4PJCE 1G84A 3O9WA 4CN4A 5FYLL 1M05B 3C09C 2MMXA 4UQ3B 4M5ZH 1XF2B 5C2UB 2VL5A 2Q7NA 3LEYH 1TNMA 3DBXB 5HDOA 1FV1B 2LVEA 2P24A 2NY1C 4OZGE 5E1AB 5ITBH 1FL5B 4CMHB 3E3QC 2NTFA 1H3GA 2AK1H 3BKCL 2AABH 4F57L 5CD3B 3MFGB 4XP9H 5IR1A 5D5MF 1QHPA 1A4JB 4HPYL 3U30C 4JY4A 4MAYB 2OSLA 3D1MC 5JW4M 5FV1L 2HVJA 3CUPB 1T04A 3DROA 2YPVL 4C57C 4L9LC 3QDGE 1F8TL 2IG2L 3G04B 3EYVB 1U95B 3IKKA 3Q1SH 1IC7L 5BRZE 1I7ZA 3H9HA 4KTEL 1KJMA 3ULUE 4G7YL 5LVEA 1VFOA 4I3SH 1YEJH 4RFNC 3MYJA 5MI0B 1EUTA 2NY7H 1AGCA 4KI5E 4KROD 3E6HA 5C0AA 4G6MH 5J1AA 3GHBL 4BQCA