2CXKA

Crystal structure of the tig domain of human calmodulin-binding transcription activator 1 (camta1)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
87
Chain Sequence
SSGMVTDYSPEWSYPEGGVKVLITGPWQEASNNYSCLFDQISVPASLIQPGVLRCYCPAHDTGLVTLQVAFNNQIISNSVVFEYKSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords calmodulin binding transcription activator 1
publication title Crystal structure of the TIG domain of human calmodulin-binding transcription activator 1 (CAMTA1)
rcsb
source organism Homo sapiens
total genus 15
structure length 87
sequence length 87
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01833 TIG IPT/TIG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cxkA00
5AZ2H 3TYGH 1R24B 3QG7H 1KIRA 4X99B 3THMH 4OT1L 1K5NB 5FF6A 2UZIH 2Q8AL 1FPTL 5DHYB 2DQUL 3VXNB 1NSNH 4DEPC 2GQHA 4F58H 3FN0L 4YHLH 5JPMA 3H7BA 1NGPH 2AXGB 2AJZA 4LCYA 1HIML 1NCWL 1RZKH 2EDFA 3FT4B 1ZLWK 2JJTA 3PJSA 2GK2A 2ED9A 3VXMB 4JHZA 4Z7QF 3HZMB 3BP6A 2EDQA 5D2NC 1X5IA 3HMXL 3SDCC 1S9WA 1EO7A 5HI5C 5KSBF 3T8XA 2J4WL 3V6OE 1FNSL 2FX7L 4O02L 2CDFB 3BDXA 2FNBA 4AIZA 4X7EC 1F13A 2F8XC 2OBGA 3OAUL 1JGLL 1U8OB 2ICCA 3DVIA 2D4DA 1BBJB 4ISVA 3ARDD 1AR2A 2PW1A 4QOKD 5GGUA 1YYMH 4WI5A 3O2DH 4MNHA 3V5HA 3QCTH 4RAHA 2AJYL 2E7MA 3DARA 5E8DH 3BN3B 4D0DA 1XF4A 1OSZA 2GY7B 1NL0L 4JPIB 5T5NG 4HV8B 1RSFA 3BKJH 5EBMB 2A6DB 2W92A 2ZG3A 5CLWA 2AJUH 4APQC 2ICES 2FATH 3I6LD 1UM5H 2FYYB 5E94A 1V8HA 4I77L 4MXVE 5IFAL 1JNHA 1F4YL 1XH3A 1PKOA 1UWEH 4X8XA 3O2DA 1DUZA 2FD6H 4X80L 5I30L 3F7QA 4PRHA 4PJBB 5IVXE 4OLVL 1CBVL 2P5WE 4RGNC 4NNPL 5TQ0H 1K8DB 2XQBL 4DGVH 4Z7VA 3JTSA 1K2DA 5GS1B 3C2AH 3AREB 4QRQA 3G9VA 2BVQA 3TT1L 4F9LC 2NR6D 2XFXB 4DFHA 3C6LC 1PY9A 4MB4A 5EZIL 35C8H 3S35L 1WIPA 4KK8C 1YNTB 1DLFL 5E9DA 4HFUH 2Z31A 2EH8H 4D3CL 3HLAB 3MRCB 2MCG1 3WBDA 2VLMD 4ZXBA 5EA0H 2W9EL 4XVUC 4YDLB 4KJQD 2X42A 2F8VA 3MRDA 3O8XB 3WNLA 3PV7A 4OF3A 4P46A 4C4KT 3SE9H 3IF1B 3WHE0 1G7QA 5F1KC 5EOQL 3T0EE 1F3JB 3EOBB 4IRSD 3UXFA 1FVDA 1FBIL 1JHLH 2VOTA 4KTEL 5B3JE 5KVFH 1T83A 1JBJA 4MAYD 3NIGE 1OP5H 4XXCA 5C0AB 4GQPH 3SKOA 1UB6B 4NQCE 3B6SA 3BKYH 3M45A 4GRMB 4WFEE 1CFNA 1HHJB 1KYOJ 5IHBA 3K2UH 5ISZD 4FNLH 4UAOB 3PHOA 4NO5B 5I1GL 1J0IA 2JCCF 1RUQL 2HVKB 3L7FA 4NC2B 1I9RL 3RWEA 3S96A 3LKPB 4LBEB 4G8EB 5T3ZD 2WUCH 4P9ML 1HN1A 4BQBA 4FP8H 5FO7A 1CFSB 4OZGB 2EDJA 1GGCL 2ZPKH 1XT5A 4QHUB 5F1OB 3DVFA 5IKCA 4FABL 5GGRY 4F7EB 1QSEB 2VDRH 4L8SA 3DX6B 1IARB 2W9LA 1T0PB 2DBLL 2ITCA 5EUOF 3F6LA 1KBGH 3HUJE 2FO4A 3QQ9D 1TCRB 4DK3A 3GJEA 2HJLA 5E7FA 2YBRA 2OM5A 1SEQH 1CR9L 3CFCL 1NGWB 1BD2B 1CDUA 4PY8J 2XIDA 3H9SA 5EWIL 3V5DA 2I25N 4JFPA 1ETZA 3REWA 2FDBP 3QNZA 1F58L 4UV7H 3BZEA 4I5BA 5E4EC 1NFIB 3BPNB 4YHOH 1D5MA 2AP2A 2DL2A 4N8PA 5GS0C 4PRPB 2XY1A 2KBGA 2OZ4H 3NZ8B 1RU9H 1U8QB 2R56L 4X0KB 3UYRH 5I8CB 1T21A 3DHMA 2R0KH 2BJMH 4YK4C 4E42A 3LCYA 1KJVA 1IKFL 1UH3A 3GMOA 1I85C 1A4KB 3ZE1F 2WWMC 2WZPD 1FZKA 5TFSH 3QEQB 4POZD 4U33A 3RWHA 2I9LA 1YEDB 3S6CA 3E3QE 4UT6H 1F8TH 4HBCL 4BFIB 4N0YL 4BKLA 4MS8C 3MV7E 1UEYA 4DKFH 1X9QA 1TQCB 1S78C 2EDYA 4Z8FH 5KN5B 3L3GB 1U8HA 2NY6D 3QHZH 5L2JB 4K94H 4IDLA 3HPLB 3CVIL 3GRWH 5I8KL 1ZLUK 3WFDH 3QUYD 2ZNXA 4Q7DA 3MYJB 3FMGL 1E27A 2OTWB 4K2UH 2ZJSH 2B0SL 1KPUA 3QISA 3LKSA 1RUPL 1I8LA 2X4PB 1DQDL 4NQUA 3EYSL 5CIPH 5EN2B 5D9SB 2VXUL 4P2RE 4DEPB 1INQB 2JCCB 3S97C 3EJJX 5F9WC 1QFWI 4YFDB 2XTJB 4M5YL 3IDYC 1JV5A 1TZGH 2X4UB 4JPIA 4XVTL 1GYAA 4HS8H 2OP4H 1BOGB 3D9AH 3GRWA 3QIBA 5EBMA 4CVXB 2DWDA 3SDXB 4KKBC 1IQWH 3C60D 4O9HL 5D2NB 4NOBA 3SDCB 2FEEL 2X5PA 1MAML 1U8PB 4IOFC 3U0PA 4XVJH 1QQDB 1FLRL 4JHBA 5E0QA 4TOYH 4EDWL 4IRJD 5CIPA 1S7SB 5DFWH 4DAGH 4P4KD 3GJFK 2OMBA 1A3RL 5DMGD 1B0GB 2PXYD 4PB0H 3FQUA 3PL6A 4XNXH 1R3IL 3GSNB 2NXYC 4JM2F 3AREA 3QDJA 4OF0A 4K3JH 2VH5L 3OJMB 2XFXA 1F45A 3BESR 5J1SC 5FKAB 3JWDL 3KG5A 3NAAH 5FKPA 25C8L 1YNTA 2G5BB 3HC4L 4NRYB 4ZUVA 4BUHA 1PLGH 4JJ5B 5FGCE 4LVNB 4MJIE 4APQB 4KK6D 4PR5A 1D9KA 4KY1H 3O8XA 3RNKB 5I1KH 43C9B 4NWTH 4JN2B 4M7JL 1CIUA 5D7LE 1IGML 3CUPA 1Y18B 3CK0L 4ZTOH 1KSRA 1Z3GH 4NM8L 3EOBA 5I66A 2D7TH 1A0QL 4JFEE 1DBJH 1ZA6B 2PNDA 3BUTA 1VACA 3BRFA 1Q8MA 5A2FA 4HXBL 3E8UH 4S1SH 4F7PA 3GDBA 4LRNH 3BPOC 2NY7H 4QHMA 5MEQB 1XCQA 3C6LB 1I8MA 1BM3L 1E4XH 5C0AA 4HT1H 3W9DB 4LARH 4W68A 4JHWH 5JZ7D 4M1DH 1BF2A 5HYSG 4R0LB 2A2QT 5D71L 1A6WH 1NCBH 4OBRA 1GXEA 2COQA 2VDKL 1BMGA 3N1FC 2E9BA 4NO5A 3DO7B 4N0UE 3VXTB 3SDYL 1NBZB 4HUXA 3LKNB 1IAMA 4LBEA 4PJCA 5HYIA 3C5JA 2WQ8A 2R1XB 2FB4H 4GRWE 4XGZB 3KLAA 4XI5D 1SMAA 4OZGA 3DROB 4U6HA 3DI2B 5SWZD 3HC3L 3NTCH 3IYLW 4LSRH 4ENEC 5HGBB 3HNTL 4LLDB 5JHLH 4UOJA 5DWUH 1CE6A 1KCRL 3SOBL 4BUGA 1PX4A 2P42B 2XYCA 3LS5L 1E4WL 2ICWI 3UJIH 4LASH 4JY6B 1JL8A 4YGAB 1NGWA 3B5GA 1BD2A 4PRBA 2DQEH 4M7LH 3RTQC 3EOAB 5IESL 1JTOA 5FYJD 4UNUA 4MJ6B 1FE8H 4TTDC 1JVKA 1CDHA 3BN9C 4J4PC 4M8VA 4MD0A 4F7CA 3RUGF 3N50A 5FM5O 2Z8RA 3D39E 1KCLA 3FCTB 2QEJA 2F54E 5KSAA 4U1IB 5M7QA 4AG4H 4S0TD 1Y6NR 4OI9A 5T1LD 3LEVL 1U8QA 4JN1L 1RUKL 3QP3A 4X0KA 3MRQA 1G9NC 3U4EB 3MRLB 4H1LG 2HRLA 3S34H 2RR3A 1MHHB 3STLB 8FABB 1H15A 2EO1A 4YBQD 3L9RA 4U1LA 3GKZA 4JRYD 2XA8L 3CDCA 3RZCA 5KVDH 3HI6L 4DUWA 1YECH 4DKEH 1JYVA 4ONGL 4XHJD 1TJGL 1W72L 2YXMA 3H3PH 5F3BB 2VXSH 3BP4A 2IGFH 2LU7A 3UTZB 5DJAB 2XN9D 5E4EB 5FM5M 1NMBL 1NC4B 4KJWD 5ACMA 2EEDA 4NC1C 4JFXB 4HMDA 3CMOL 3OGCA 3SKJL 5CD3A 4M00A 5EC2A 3I02B 5DQDH 4UQ3A 3F12A 1RZ7H 4JO3L 3MRPA 2AK4B 5DFVD 1MRDH 2BFVH 4YWGH 3RVTD 3KDMB 3FB6A 4KFZC 3PGFH 2X4PA 2W1NA 3QDGD 3V4PH 2C1OB 1MHCB 3EYQD 3LN5B 3MACH 3PQYB 4V1DA 1INQA 3G6AB 3VGBA 4OZHE 1S5HB 3EO9L 3VFGH 4U31A 3VMPA 5J6HB 2X4UA 1IZKA 3GSNH 1G0XA 1E4KA 1N8ZB 4OCSL 4L4VB 4Y16D 1EUUA 3RVUD 5DI8B 4CVXA 4WTWA 2CO7B 1U91B 4OIIL 5EBGA 3DHJA 2BNRA 4PJ8C 4HK0A 3K80A 3FFDB 2Q8BH 3UPAA 1UM6L 4XP4H 1BP3B 4MDJA 12E8L 3WN5C 5MI0C 3VXOB 1B0GA 1X6LA 2P8MA 1RI8A 3REVB 3FQXB 2IALA 3NCFB 3GSNA 3LN4B 3DXAE 4G5ZH 5F9WB 3RUGB 5FOBB 4HC1H 1IM3B 3IDYB 2X4RB 5FKAA 1XMWA 2OS7A 2F53E 4FQLH 3ULUH 2OJZH 4NRYA 4GMSL 4WUUB 4JO2H 4JJ5A 3I6GA 2QSVA 4YO0A 3QG6A 1I1CA 1XGTA 4PJXE 5I1EH 2J88H 3O6LL 5CSZA 5T1KD 1BFOA 3LB6C 1DQQB 4APQA 4RSVA 1EIBA 4M48H 1SY6H 4JDTH 5CGMA 4KVCH 3X17A 4JN2A 4TSAL 1KEGH 3IJSA 3VRLE 4TPRL 2UWEA 4IHOA 4S1QL 1V3LA 4HC1A 5KVEH 4EXKA 1N5AA 1S5IH 2E8YA 1BJ1H 4KI1A 4OJFH 2BSTB 2NXYB 5BRZD 4BQ9A 2GSGA 3VFVA 1HOCB 4F9LA 1RULL 5JW3H 5MEQA 2P1YA 3FOMB 3OJDA 3B2UC 5FCUH 4K7PX 1D5IH 3UJTH 1J1PL 4QXUH 4L9LC 4EJ1C 5C0FA 3VD5A 4XBPB 5CSBA 5CEXB 4ZPTB 2I24N 2Y23A 4CVUA 3QJHB 1H8NA 1FFQA 2CUHA 3VXTA 3LKNA 3MRRB 5DEGB 4PJGF 1I1AC 5CGYD 4AEIH 1S7VA 1CXFA 2VQTA 3TZVD 4DN3L 4Q2ZA 1IM9B 2YZ1A 4FOMA 3DROA 1NLDL 4GG6E 1CZ8L 4WWKC 4JG0H 4PBVC 5HGBA 1FRGL 1U3ZA 1J1XL 3BPOB 2CIIB 3MCLL 5KS9F 4N8VB 5D5MB 1A7OH 4OLZL 3X3FH 1SBSH 4Q6IC 3EOAA 3WXVL 1MQKH 2FJHB 3HFMH 4LCCC 4YAQB 2FSEA 4LQFH 5E8EB 2ZUWA 2Q76B 4ZAKC 1HZHH 4TVSa 5LJYH 1I3RA 3DMMC 2DLFH 2NNAA 3QPXL 3OKDA 5DMIL 1DN0B 1TPXC 5B38A 4HMEA 4WI3A 2EC9T 2W60B 1RZ8A 3MRLA 4N90D 5GS0H 5AZEL 2WWKO 3BFOA 2HRPH 2YN5A 3L5XL 4P9HL 5LWYL 4BQCA 3UTSE 5C7XL 5CKGA 2JJSC 3Q0HA 4JO1L 5C09D 4QHNA 4HHAA 2VDQH 2YA0A 5MEOB 1XR9A 1WLHA 2CRYA 32C2B 3OPZL 3UAJD 2VLJD 4XBEL 1CF8H 1NDMB 5GGVL 3TN0C 5JUEL 4NQED 1DN2A 4WFGD 1QNZL 3RTQB 4Y2DC 5CBAB 1EFXB 5I76B 5DJAA 4M6NL 4KMTH 4XCCH 1WBYA 1A5FH 3GIZH 3G04B 3E2HC 4AENB 2GTZB 5FYKH 5MERA 4OCYH 4TUOA 4YUEL 4OZFA 1T89C 3O4LD 2X6MA 1N3NB 1TZIA 1QBML 1U8NB 1N0LA 3FO2A 1DL7H 4QWWC 3S4SB 2P5WA 4Z78B 1Y6KR 2B1AL 2W65B 1ZE3C 4DOHB 1P6AB 1OARL 3TC9A 3IFOA 1MHCA 5SV4A 4ODHH 4RMTA 3FAXA 3CFDB 1MI5D 1NCTA 4MAUL 5SWSB 2HFFA 4W4OC 3KHOA 3M8OL 4L8CA 4MA1C 2HFEB 3MBXH 3S35X 4ALAL 3D85B 1N8ZA 4Q97A 1UWGL 2JLLA 3GBLA 4KJPC 2OL3L 4FQCL 1RHHA 4BZ2L 3Q1SL 2NY3D 1ED3B 2MKLC 1CD9B 1UACH 3B8YA 4HPOL 1DQLL 3BHBB 4CN1A 4OFIA 2VR4A 3FFDA 4L1DA 3WFHA 4JFFD 1T80A 1QSZA 5HHOA 5KS9B 2Q86B 4GW5B 4IIQB 4NUGH 1NCAL 3VXOA 3GMPB 5BV7C 3REVA 1BREA 3LS4H 4WI8A 4Y19E 2IFFL 5FOBA 4X7TB 1IM3A 3BKCL 3CVHB 1CU4L 1JPSH 3PWNB 1NQBA 4S2SA 5B39A 5IEKB 3RA7H 1CFQA 4WUUA 4CU7A 1WFTA 3HS0A 1UXSA 3MLZL 4FQXC 1DQQA 1NMAL 4MX7A 4W4NA 3TNMB 15C8L 4PJ8B 5EU6A 3IAGC 3HR6A 1VPOL 4WFFD 3UTTD 3WN5B 4JAMB 5MI0B 4XAKE 3EYFA 1YEJL 5D72H 3G5ZA 4AYFA 1OAYH 3S5LB 3T3PF 2CKBB 1EEQA 1HHGB 5DYOB 3PIQA 4PGDB 1UWXH 1QLRB 1QR4A 2IPUG 1FG9C 4G8GE 5MHSE 4DVBB 1LQSR 1FAKT 4LCWB 1C7TA 2HT2C 4Z7QE 1NJ9B 2BERA 5EC1B 3UPCA 3L3JB 3MBED 5ILTH 4OKVB 4F37F 3ELAT 3MJ6A 1P7QD 5CEXA 1J88A 4P3DB 3P4NB 5KSBE 3ZKMC 3QJHA 4LHUG 1OM3L 3NABL 1J0KA 1QA9B 4R97C 5F7HA 4G7YH 2APTA 5DRZB 1DSFL 3QB7C 2OJEB 1YY8B 4OI8A 3C5ZA 1KNOB 1SVCP 4AT6A 2BXZA 5IFJA 1TZHA 1ZEAH 4KQ3H 1MLBB 1XF5B 1ND0B 4AL8L 4AM0A 2YUWA 5ELIA 4OD1L 1QSEE 3MJ8B 4FTVA 2FIKB 2I07B 1IBGL 3V4UL 1SEBB 1W0WA 3INUL 4TVPH 5D5MA 3MV7A 4L9LB 4NKIH 4JQXC 4MXWL 4D0BB 4I3SL 2H8PA 4YDKL 5DJ2B 2OTUA 2Q76A 5D6CA 2ENYA 5DLMH 5GJTL 1I1AB 3FFCD 3OAZK 4EBQH 3WIHL 1DN0A 3O11B 4NCDA 5IJVB 1T66D 4PRPE 5J12C 1NGYB 3RJDA 3VGEA 5IQ9B 1IEAA 3CSGA 4RZCA 2W60A 3UO1L 4CMHC 3QFDA 2B7DT 4WWKB 2Z35B 1GRWA 1KTLB 1KJ2L 4NO2B 3ZT5A 1AE6H 3OKOA 4LHQB 2QHRL 4NKQB 1G9NH 3KPTA 3ULVE 4WNQB 4G7VL 5MEOA 1NANI 4KRPD 4P2RA 3FB8B 4QYOB 1AGBA 5BS0A 3HHRB 3T0AA 1J11A 4Y4HA 5TH2B 1FAIL 1Z5LB 4QRPB 3RTQA 4Q6IB 1CFTB 4P3CL 1RUML 5H35B 5CBAA 3LRSA 3QI9C 4LCCB 2GSIA 4H26A 5F7DA 4BSWA 1EK3A 2DBJA 4EOWL 5I8OL 3DGGA 4NRZB 4ZAKB 1F11B 5L2KB 1YEKL 4ZPVB 3ARFC 4D0CB 3DMMB 4D94A 3EJZC 4F3FB 1TPXB 4DZ8B 4KZEL 3VXUA 4M4RA 1QRKA 4PJFF 2GJ6B 4MDIA 2LAAA 2HT4C 3KPMB 5FDWB 4UT9H 5C07D 4Z78A 2W65A 5D6DA 5I19L 1OQOA 3LEYH 5MP6H 2J8HA 1CL7L 5JOFB 5DK0B 4LVEA 5C8JA 1YMHB 3QQNA 3WFCL 4M7KL 1D6VH 3B5HA 5SWSA 1FNLA 5I1IH 1AD9B 5AZ2L 3TYGL 2CJUH 3QG7L 5C0BD 3TN0B 3THML 1ZS8B 3CXHJ 4Y2DB 2UZIL 5DSCB 4DWHA 2XTJE 5CHNB 3ROLB 1N6VA 1X5GA 1UKTA 4OLWH 3E2HB 4HWZB 3CVHH 4F58L 4YHLL 4LAQH 4MJIA 3RVXD 1QOKA 1NGPL 5E6ID 1ED3A 4K3HA 3IS1X 1CGSH 1T04A 3WDHA 2IADB 5DTFA 5EUOE 1T1XA 3SCMD 3MRJB 2L7JA 4GW5A 4HAFA 4N0FB 1XR8A 3IKCA 1JGUL 4EQ3A 2YPVH 1P84K 5J1AA 1KB5A 5EZJA 4Y4KB 1WEJH 3VW3L 3DX7B 1RIHH 1BFTA 2B2XL 4NCC2 4X7TA 2YSSB 3TH3T 2AKRA 1NBVH 2CKBH 1II4E 3PWNA 4MA1B 3CAFA 1JPGA 5HHQA 3GMQB 1NCNA 5C0CD 1YYML 3TJHC 1U0QA 3O2DL 3QCTL 2G75B 1S9YB 5M94B 5E8DL 2Y72A 2Q3AA 3C9NA 2YPLE 4PJ8A 1H3PL 3MODH 2WBKA 4XX1G 2WBJC 4P4RA 1T0NB 4XH2B 4WGVB 5GSRA 4FFYH 1VFBA 2AJUL 3GMNB 3W9EB 2HLFD 4WU7B 3ME0A 3JV6B 5BV7B 1P4IH 4WW2A 3S5LA 1Q94B 5HDLA 1Q9KB 2CKBA 3T4AA 4TSCH 4LEOA 5DC0A 1GSMA 1FNHA 3N85H 5DD6B 2K3TA 4M62H 4Z7UF 1SYSA 4PGDA 4OB5H 1QLRA 1T22B 2FD6L 3K4ZA 3W11D 4LCWA 2FECI 4LNRA 4JRXB 1FC1A 5EO9A 4LCUA 1NJ9A 3C2AL 3L3JA 3QBTB 1L6XA 1U36A 1CDJA 1JCKA 4PJFB 1C08A 1CGWA 1YY9C 3AXLB 3TH4T 3UJJH 4YHIA 1WV7T 4EI5A 3CFEB 2P45B 35C8L 2BSRA 1QO3B 4HFUL 2NY2D 2EH8L 1K8IB 1YY8A 1KNOA 2P5EE 4YBHA 5JIHA 5EA0L 1XGQB 2N4IA 1XF5A 1ND0A 4KI5D 1QACA 3U36A 4KVNH 5I74C 3SE9L 2R8SH 4M1CD 5F9JB 4N0RA 3U9PH 1XGRB 5D1XC 4JQIL 5L8JB 1FVEB 4ZUTB 1X5JA 2FIKA 1KXTB 2IBBA 5D7KD 1JHLL 2RGSA 3ISWA 2I07A 2IBZX 3T1FB 1SEBA 5LCVH 1JHTB 4L9LA 4Z7OE 3BMWA 2IFGA 3VFNB 3BGFC 1TFHA 4N68A 2PYEB 2MQ0A 4HJJH 1BZ9B 2CUIA 5DJ2A 3A67H 1JYNA 4R97B 1KELH 4LFHG 1PAMA 4ZS7H 1JTPA 3VH8A 3BKYL 3FRUB 4KV5F 2H3NB 5T5FH 1I1AA 3UTQB 3X13B 4G8FB 3K2UL 4LP4A 4NFDA 4PREB 2VN4A 3CH8A 1FL3A 4PRNB 2IAMC 4WWKA 1RZIA 2X44D 1IQDA 5K9KA 4XCFL 1PEWA 5E2UL 1JF1A 5ALCH 3EIFA 4FP8L 3MFFB 1FYTD 4WNQA 4LLUB 2ZPKL 1OAXH 3D0VA 1OPGH 3FOLB 3L5HA 4M6OL 1SVZA 4F8TA 3IFPB 3J7HA 4NQXB 1D5BB 5EO0A 5DMYA 1C5DB 4KRNA 1KBGL 1DFBH 2ZUUA 4Q6IA 1KJMB 5H35A 2HN7B 2V7HB 1FHGA 4PJIF 1LEKB 3NH7H 4KDTC 2CRMA 4XNYH 1ACYL 1SEQL 3H3BC 4YR6B 3RGVD 2VABB 1QR1A 1FORL 1YQVH 3HZKB 3DMMA 3HI1B 5C0NC 5HHMB 1QLEL 4L4TE 3HE6D 5J12B 4UV7L 2BY2A 3CMGA 4CMHB 4M3JA 1CWVA 1VENA 3QO0A 4YHOL 1BQSA 2GJ6A 4RIRA 4OIBA 5EU3B 1BFVH 4XZUB 2OZ4L 5FDWA 1W0VA 1RU9L 2JJSA 2VC2H 2ZUXA 3UYRL 1R3KB 3BO8B 1TVHB 3QFJD 4UQ2B 5JOFA 1EEYB 2R0KL 5JOPD 4NO0B 1A6TB 1Z0MA 5SX4H 3STZA 2F53A 2KZ1B 1ZS8A 4Y2DA 4ETYA 2EYTB 1UFUA 5TFSL 1F6AA 2WQRA 4L4VE 1F8TL 3ZE0E 4X6DF 3WUWB 4JG1H 4X6CF 4FFVD 3U1SH 4DKFL 2EIDA 2NXZC 1A7NL 5DHXB 2IADA 4LVHC 4Z8FL 4PTUB 5I8EA 1T89A 4MD5A 1CLYH 4EUPB 1KFAH 4G3YH 1AC6A 1FG2A 4DN4H 2Y06L 4IRSB 5DXWA 1JN6A 1FNEA 2Y5TB 3WFDL 3ARBA 1DJSA 2LV4A 3D87B 5HDQL 3D6GA 1LEIB 2ZJSL 1CGUA 1QLFB 4IOIB 4XPHH 1N4XH 4GBXD 4TQEH 2FJGB 4XMLH 3JUYA 2NTFB 3UTOA 1A6VH 5DMKB 5EOCH 1A9BB 1DVFD 3FT2B 3QRGH 4GAJH 1T3FB 2HG5B 1TZGL 2ZG2A 3CFJA 4XAWL 1B0RB 4HS8L 3KNBA 1U6AL 3D9AL 5HJ3A 5KW9L 2LTQC 3MV11 4GG6A 1CXKA 1IQWL 3W9EA 2RCSL 2DOCA 5ICZB 4PRDB 4HJGA 3H9YA 3GJFH 3LKOB 2HKFH 1QRNB 5F72S 3C09C 3BW9B 4HMCA 4PJIB 1B2WH 4DAGL 3MOQA 1T22A 1FFNB 2D0FA 3QDME 2AVGA 3QUZC 3S36H 5CINH 4KJYA 3KPRE 4H0HB 4LKCA 4XNXL 3GIVB 3KJ6H 1ZANH 4R4BB 1VADA 2CQVA 2NX5E 4L8BB 1I7TB 4DUXA 2VL4A 5IB3B 4K3JL 1GGUA 5D1QA 3AROA 4FQXA 4R7DB 4LIQH 4OFPA 5DJXB 3NAAL 3D69A 3ARGD 4CU8A 2WBJB 3GJFA 3K8KA 5FM8A 3F58H 1H8OA 1FL5A 1XGQA 4DZBA 2IPKA 1PEZA 4OGAD 5I1KL 4FXKB 4NWTL 1ORSA 5BMFH 2MNUA 4ZFOB 4Z76B 1XGRA 4MVBD 3TLRA 1CGXA 4ZTOL 2BMKB 5D70H 1E28A 4O58L 2D7TL 2XKSA 3TCLB 4HZLA 2GCYB 3KXFD 5IK3B 4JQVC 3E8UL 3VFNA 4NQSB 4S1SL 4GLRH 3T08A 1NAMB 4LVOC 2YD6A 1WIOA 1E4XL 3SDAD 4LSSH 4PD4K 4HT1L 4ZYKA 5I1AB 4MA3A 3HTLX 4J23A 2IG2L 4M1DL 4QF1B 1BJ8A 5K59E 1C16A 2OXGA 3X13A 1J5OL 2BX5A 3AMKA 4UT7L 3GSUB 2W07A 1AP2B 3K81A 3MLUH 2DM4A 5I74B 3UEZA 1MAJA 2D9CA 4DQOH 5C6PB 1QEWB 4Z18A 3O2VH 4TULH 2FB4L 4QRRB 4I4WB 5D1XB 5CZXC 2L7UA 4LSPH 3OKLB 1EEUA 2WIIB 3S37L 1XGUB 2AEQH 5LAXA 3CSYB 2R2HA 3FOLA 1AKJB 3L6FA 3NTCL 3RVVD 5DUBB 4LSRL 4P2OD 5JO5A 1HHHB 5JHLL 5DWUL 4HJ0D 3BGFB 4JQXA 5BW7C 2BSED 1KJMA 5FA4A 4I2XB 3UPRB 4JFYB 3LQAC 1VDGA 3MUJA 3UJIL 3QUXA 4LASL 1T4KA 3HZKA 2EDXA 5BO1H 3C60B 2DQEL 3ZKNC 3NIDF 4M7LL 4WENB 3DECA 3MGTA 2NYYC 1FE8L 4NQDB 4F33B 2IAMB 2KPNA 3K2MC 3WV0A 2BNQB 5A2LH 1J8HB 3ARZA 2NZ9D 4N8CL 3RL1B 2B4CC 1PZ5B 4AG4L 1OL0A 5C70A 4X9HA 3ARPA 4H20H 1RZGA 4JGMA 4PLOB 3C5SA 4O5LH 1RJLB 4HIXH 4EN3C 1P2CB 4Y19A 1EEYA 1AI1L 3S34L 3HG1A 3Q6FB 3NMEA 5HGAA 4KKLD 2FRGP 1TJHH 1WFUA 4MLSA 1I9IH 1ZHKA 1INEL 3QI9A 5D7IB 4ZNCD 5HD8C 3BAEH 4YGVA 3VWJA 4PJGE 3HPJB 3RWJA 4PGCB 5KVDL 4NKOA 3VGAC 4DKEL 1RJZA 3ARFA 2IANB 3SJVE 3D5OF 5FYLH 2QJDA 3TH2T 3KYOB 3GGWB 1NC2B 3AS1A 1WTGT 2VXSL 2IGFL 3MCG1 4ELKA 3DV4A 4PTUA 4WO4C 1RY7B 4OGYH 4U6VL 3IGAB 4Y5YC 4IDJH 3MREB 4PY8I 4Z6AT 5KS9E 3GSWB 4ZG1A 5DQJB 4Y4FD 3WFBL 1KPVB 5DQDL 4RWYL 2Y5TA 2ZUSA 1OT2A 2GT9A 3QIUB 2J1KA 1RZ7L 4ODXB 2BFVL 4S1RH 1I7ZB 1PQZA 4G8GA 4X9BA 2HTKC 2QL1A 4I8DA 3PGFL 1IGJB 3V4PL 3JV4A 5SWQA 1QBAA 5KSBA 3ARQA 5C0GB 3MV8B 3VFGL 3MA7B 3FT2A 2JE8A 2HG5A 2M2DA 2XA3A 3M17B 3GSNL 1CT8B 4JPVL 1XCTA 2NXZB 4LVHB 1B0RA 2VLRA 5BVPH 1MIML 2VO5A 5HGDB 1MCDA 5ICZA 3NFSH 3LKOA 4JJHA 2AK1H 4A2LA 4K9EL 4F7TA 3EOTH 4XP4L 1ONQA 4FFWC 1LO5B 4U49A 1BQHA 2MJWA 2F5BL 2C3GA 5A16B 3GIVA 3O6FD 1O0VA 1ZT1A 1GGIL 1I7TA 4G5ZL 3MLYH 6FABH 4TUJB 4HC1L 3BH9A 5D7JC 4KRMB 3MRMB 4R7DA 3MRNA 1AO7E 1QSFB 2OJZL 4J6RH 2WBJA 5C6TH 1H5BC 5IF0B 5CKAA 3DRTB 3B9KA 2LTQB 1I8IB 1CDIA 1IZJA 3GBNH 5E5RB 1ZKAA 2C3XA 2VDMH 3BEWB 2CMRH 3MJGX 4M48L 1SY6L 3C09B 4JDTL 5DD5L 4KVCL 1KEGL 1EEZB 4PRHD 4UDUB 4C83A 4GKOA 1JZ3A 5KZCD 3QUZB 4WU5A 5KVEL 3WS3B 2HJFB 1S5IL 1WZLA 2V5TA 2D7OA 1ZHLB 5JDSA 5INDA 5JW3L 4IOSD 2XNAB 4TYUA 3GKWL 4GRLD 4LHUD 5BVJA 5E9DD 4U1MA 5F71A 4FQ2L 2D7PA 1D5IL 5SX5H 4QXUL 3IXTB 4FS0A 3ECBA 3QIWC 4AIXA 4ODUA 1C12A 4EZMA 5GRZA 5JHDB 4DVRH 4P46D 1GZPB 3DV6B 5ANME 3UYOD 1WC7A 2YMXH 3NOIA 2VR9A 4PJDB 1QPPA 1AXTL 2Q6WA 5DJCB 1VESA 3PABA 4KDVA 3SPVB 5IOPB 3QQ3B 4Q9RH 4QEGA 4JPWH 1WZKA 5ABDE 5ICXB 2Y7QB 1JWUB 2LFGA 5DUBA 4JG0L 3BI9X 1FV1A 1U3HA 4G80A 2P8LB 1MVFA 3EBAA 4RQQA 1MLCA 5F9OH 5CJ5A 1T1YB 1VKXA 3ZHDA 3TEUA 4NRXB 3UPRA 4QRPE 5I1JH 4N8VG 4MQ7B 3HB3D 5C86A 1A7OL 3MV9E 3HMWL 5IHZB 3I9GL 3X3FL 1SBSL 4F2MB 3T3PE 1BZ7A 1IRAY 3KWWB 1MFBL 1MQKL 3HFML 5EUOA 1EA9C 4NQDA 1G6VK 5HYJB 3ZSSA 1CICA 2BNQA 1HZHL 1J8HA 3F7PC 3P9LB 3RL1A 2EICA 2GI7A 2DLFL 3DUSB 1YZZA 2R15A 3BWAB 3QCVH 4PJHB 3OX8A 5E5MB 5GGSY 4M4PA 1RJLA 4PJ5A 2X9YA 4JB9H 1OT1A 2C3HA 5GS0L 1FO0B 3TYFB 4QCIA 1I3GH 2HRPL 5L8LB 2X1XR 3RWFB 4XMKL 1KYOK 1OGTA 2ENSA 2ICEA 1KN2L 3L3IB 2VDQL 3HPJA 4KDTA 4PGCA 4JKKA 1VFAA 4ERSH 4GUPB 4MNQD 5FK9B 3U6RA 3H9SD 4K3EH 2EE3A 1MAKA 1CF8L 1MOEA 5K9OA 4LPCA 1HINH 1JHKL 4PLNC 2GIYA 4KMTL 4XCCL 4U1HA 3GIZL 1DUYA 2E8ZA 2H32H 1LE5A 2ORBH 4HBQA 5FYKL 3QXDA 1ZHNB 1FSKC 3LHPH 4PV9B 3LPWA 1BEYL 2WLZA 5JA9A 1KPVA 3PGCA 3NPZB 4HWBH 3W0WD 1A1OB 1U2CA 2EYRB 2R69L 4EN3B 3GUTA 2R23B 1PD6A 4JO4H 4ODXA 4GXUN 1HNFA 4KK9D 1I7ZA 3K74B 3S4SG 5E56A 1HYSD 1EO8H 1DL7L 5F9DC 5HYFA 3HE7A 4PG2C 3MMEB 1I1RA 2VZTA 3I6KA 1K85A 3VGAB 4PB9H 5L8KB 6CGTA 3MA7A 2H32A 4QLRA 4WEBH 2ARJB 4ZQKA 1C5CL 1G7IB 3VXMD 4CW1B 3PHQB 4Y5YB 2RIKA 5GGSB 4L3EE 3RDTC 4RAVB 3HCVB 1KG0A 5FOJA 2EDNA 3V9FA 1TETH 5DR5L 2ZKHL 4X9FA 1PY4A 3WL9B 1LO5A 5CJXC 3MLRH 2IQAB 4HEME 3D2UA 4ZS6D 2N56A 4LEXH 1F42A 3MRFA 5GIRB 3MRBB 4L3AA 4PLJD 4ZNEE 2HH0L 2P48B 1ORQA 1JPSL 1FZMB 4OFYD 2CK0L 3U46A 5T5NF 2YD4A 3RA7L 1FL6A 4FQQB 3RVWD 5IVOA 2PTTB 3RI5F 4YEFA 5BCAA 4JM2A 3MOBH 3V8CA 4KK5D 5AUMB 1T03H 3QUMA 4W6WB 2AQ1A 1LO2H 5BQ7A 3DTXA 3HC0B 4XCEA 5ETUA 5D72L 3RHWK 3QUZA 3S5LG 2W0LA 2HJFA 3ARED 1OAYL 3QDJD 3MR9B 4KTDH 3D18B 2DM3A 5HHPA 3KJ4C 3TBWB 2HVJB 1U8MA 4NQEB 2P43B 5D7JB 3CD4A 1RMFL 5BZWB 2A6IA 3KPNB 2XQYG 2A6JB 3FT3B 4YHMH 4HPYH 4HXAL 4S0SD 1P4LB 5ILTL 3IXTA 1H5BB 4L4TA 1HQRB 5CP7B 1I4FB 4EKXA 3BQUC 2VXQL 5F89A 3L5IA 3QH3B 3O8XD 3VGGA 1MCWW 1MCBA 5HI4D 1QFUH 5D8JH 1AY1L 3QA3A 4G7YL 2ED8A 4PJDA 2BHYA 5GGTH 1NEZB 5GHWH 4PGJA 5F7LB 5DJCA 2RJMA 5CEZH 2VLKA 5IOPA 1S7XA 5J3HD 1ZEAL 1X4XA 4KQ3L 3VXPA 4D9RD 2AQ3A 1NGQL 4LSUH 3EDDA 2P8LA 4QOKE 4X6EB 5FXCH 5FO8B 1MCPL 1LO0L 4E41B 1LVEA 4ZSOB 4NRXA 5C0AD 3U9UB 4KKAD 1WBXA 3LPFA 5D2LE 4LFHD 3BJLA 2Y07H 1WWCA 1DQML 1JPTL 4TVPL 3CIQA 1EXUA 1CD0A 1Q0XH 4NYLA 1G6RA 2A74B 2UY7A 4HS3B 4BH7A 4F2MA 3OAZH 3EHBC 4ELMF 1D3CA 5CSGA 1C5BH 2MPAH 2YD5A 5GISL 4UIMB 4HLJA 4U6XA 1UZ8B 4Z7UE 4JFFB 3I6LE 3VH8G 3W39B 4TUKH 1S7TA 5DLML 4GW1B 4NPYA 4EBQL 5JW5A 1MJ8H 3DUSA 3L5WB 4LF3B 4YFLF 5E99L 3EFDH 4YBLB 2B4CH 2SEBB 3PWUB 4MJ5B 3IDNA 2CR3A 3MNWB 4M5ZH 1AE6L 5BW7A 4KHXH 4JY4B 4CAGA 5C0EB 4E0RB 4BFGA 3GEWB 1OGAA 1VFUA 3HI5H 4HIJB 5ACZA 1BD2D 2ILLA 1G9MC 2G9HB 1RAMA 4LGPB 5JNYA 4TNWF 3WNNA 5DRNB 1FGVL 3KPOA 3VFRB 2VLME 5HYQB 1GHFH 4RWHA 4WTZA 1CGTA 1F97A 5BOPA 3U4BH 1IGTB 3DRQB 4JFDB 5CGTA 2DIBA 3A0OA 3UTTB 1JZ7A 4LGRB 4NM4H 4OCXH 4W6YB 3K1KC 1A1OA 2GFBB 4RAUB 4JDVB 4UU9A 2BC4B 4DGIH 2EXWD 3DVNB 3BIKA 5ERWA 3QDMA 3KLHC 3QEQD 2AJXH 5IR1B 4UT9L 3RZCD 3MMEA 3KPRA 4X4XA 3P0VH 4X8JB 2CXGA 3LEYL 4KV5E 1V3JA 2NX5A 5I1CH 1CD1B 4KZDH 3L1OH 1D6VL 5I1IL 4LOUC 2X4TB 5GRVK 1JNLH 3N9GH 3IDMB 5ISZE 5ITFB 3ZL4L 4WO4A 3PP3H 3SGDI 3CVHL 3T3ME 3T0BA 4HIIB 4LAQL 5T3ZE 1FSKB 5JW4Q 3QRFM 3HCVA 1CGSL 2C26A 3GFUA 3FZUC 3QDAA 1J18A 1A1MA 2JJUA 5I2IA 3LEXB 3ET9F 3EAKA 2A6KB 2ZCLH 1U9KA 3WKMH 2VAJA 1OP3H 2JB6B 2YK1L 5DJ6B 4ELMB 3H7LA 2YPVL 3MRBA 7FABL 4JKPH 2XTJD 4P2QB 3U2SB 1WEJL 3P4OA 3P4MB 1RIHL 2PYFA 4L29A 5I1LB 1FGNH 1NBVL 2CKBL 4PRIA 2VXVH 3VG0L 1U93B 5AG9A 5C0DB 4XTRC 4LSTH 4P59L 1BIIB 4HEPG 1YN6B 3EUUA 1S9XB 3DPBA 1IC1A 3SDCD 4FQIH 1JGDB 3RDTB 4QKXB 5HI5D 2X4NB 1FFPB 1MCCA 2F5AH 4M8QA 4Q9CA 3JV0A 3PUCA 4FXGB 2I60L 3GHBL 3MODL 2D7MA 5E8NB 4U7MA 2QQLH 1ZVYA 5FCSH 1MREH 4WHYH 2CXKA 3HC0A 3S37X 3BVNB 1Y6MR 4HUMB 1FLTX 4KRPB 2GKIA 3NPSC 1JI2A 3V5KA 1P4IL 2VLLB 2D0HA 4X6DE 3WHXB 2XKNB 2CD0A 4TSCL 2FEEI 4X6CE 1SMOA 1KLFA 4M7ZC 2HVJA 3N85L 4X4ME 4TRPH 4FMFA 4OB5L 3KPSB 2APFA 3OJ2C 1TQBC 5HHVL 1HH9B 4P48A 5D7JA 5BZWA 5IB2B 5IFHH 1A6AB 4YXKH 2A6JA 3FT3A 4NNYB 5J13C 1VGEH 4PRAB 1GCFA 1P4LA 5GPRA 1T1ZB 4JDZB 1H5BA 2VZUA 1I4FA 4APQD 3UJJL 3U48A 1ZLSH 3AVEA 4AY0A 3SKUD 4KJQC 1D7FA 3T0DA 3G6DL 1N64H 1WBZB 3MUY1 2J6EL 4I3GA 1X4YA 3NA9H 4X9IA 3TBSB 2HFGH 3BPLB 2EKSA 5DVOA 4RGND 4P23A 3CFBB 3B9VA 5ESQB 4KVNL 5DURB 4B53A 2R8SL 3KJ4B 5FO8A 5KG9B 2GTWA 2AJSH 3C6LD 1M6OA 3U9PL 4ZSOA 1FFOB 4R26H 3TT3L 2X2YA 4KK8D 4U7KA 4HAGA 4J1UB 4LLVA 4AH2A 3SJVA 5LGJB 5LCVL 3BIBX 5E1HB 4JZOA 1FZOB 1FVCA 2E7BA 3QXUA 2A0LC 4XNMB 2A74A 4XVUD 4YFLI 3QIWA 3R8BB 4HS3A 3X3GL 2CIKA 1B9ZA 3BQUB 1MQ8A 4HJJL 4FQ1H 5FAAA 1KTDB 1UZ8A 3A67L 5IUSA 5EBWA 4ZS7L 2EDWA 5T5FL 4FHBD 1FJ1A 2O5ZH 4LF3A 5IIEA 2CDGB 1NFKA 4EI6A 3HNVH 3O3AA 3PWUA 5EFIA 1GGTA 3ZYJA 4OSUH 1T5WB 2BRQA 3MLTB 5ALCL 2RFXA 5DVLA 3VFMB 4U05A 4E0RA 5C0EA 4G42A 1OPGL 1KLGB 1HEZB 4OUUA 4Y89A 3BRDA 1B6UA 5INCB 3ARUA 2OK0L 4ODWB 3VFRA 1IGYA 4LNVA 1KCKA 2UYLB 3NH7L 4XNYL 2B39A 4UMGA 1ZT7A 1KXVC 2EE6A 1YQVL 4IM8A 4U1JB 1JWSA 4YX2H 1LK2B 4OLEA 3RWGA 4ZD3H 3GK8H 1BLNB 4RAUA 3QQ4A 3LY6A 4JDVA 4UILH 1TTFA 1LO3H 1OCWH 5EZLB 4PJAF 1MEXH 5C9KA 3LSOB 4HLZH 1S7UA 4P5MB 1MJJA 2CLVA 2VC2L 3VXRB 3H42H 1WITA 1EGJH 3FO1A 5FV2A 5BOZG 1CD1A 1QYGH 2C9AA 3GSQB 4DTGH 5HPMA 5DRWB 3TVMC 2X4TA 4G6JH 5IG7A 4JY5H 4WJ5A 2KQNA 1NC4D 4M7LT 2NY6C 5GS0D 2B5IC 5C9JB 4XCNB 4ZFFB 4XT1C 1AQKL 4JG1L 2AXFB 4XNQA 1KCVH 3OR6B 3U1SL 2W91A 4HUNB 1R3JB 2XWJB 1KEML 5EU5B 3QUYC 2AK4D 3EYUH 3IETB 5DUPH 5I75B 4EUPG 5SWZE 1KN4L 1CLYL 5EB9A 2FHCA 4MHHG 2WWMD 1KFAL 2ZSWB 1EGJA 4G3YL 2A6KA 1ITCA 2DYPB 4DN4L 3B2VH 3O3EA 2G60L 3F65A 3OKMB 5C08B 2V2WB 4PG2A 1RJYB 3PQYD 1OTUD 4RFOL 1K4DB 3U0WH 4G6KH 2C4XA 2FGZA 4P2QA 2P7TB 4QNPF 5FYKD 2EDTA 2CR6A 5BV7L 1S78D 3WS6C 1ZAGA 4M43L 5FYJE 4TQEL 4PP2B 1MCFA 1HI6B 4KWUA 1A6VL 2D3VA 3ZO0A 1EBPA 5EOCL 3AAZA 4GAJL 2HTLC 3QRGL 5IBLC 2X4NA 1IT9H 4A2MA 3D25A 4HIHA 4URTB 5CZVL 5HHOD 2WMPA 3RPIA 4ZO9A 1NGXB 1MH5B 1SJHB 5C2BH 2Q7YB 1J86A 5J9PA 1OB1B 2NY1C 1T20A 3V79C 2DTMH 4JLRA 4CADA 1S7RB 1T1WB 2W38A 2HKFL 2IQ9H 2YRZA 4JRYE 3NACH 1B2WL 4EVNB 2FO1A 4NKMB 43CAB 2V5YA 2OMNA 3DSFH 3V4VL 5IB2A 1CDCA 3S36L 1A6AA 1F3DH 1NDGB 1RK1B 2GUOB 1O7SA 4I0PA 4NNYA 4WUUD 5CINL 1RIUH 2XN9E 3KJ6L 4HKXB 1ZANL 4JDZA 4KKBD 4IMLA 4QHLA 3HE6B 5EU6D 4OD2B 4AEHL 1LMKA 4HKJB 4NNXB 2YD7A 3GB7A 4YXLH 2E7HA 1MCHA 4DKAA 4OFDA 5LXGL 2ESVB 4RNRB 4X6BB 1EJOH 3LAFA 1G7MB 3KYAA 4HF5L 3CFBA 3SE8L 3NBNA 2GJZA 5CJQH 3QFJB 2NXYD 5EO1B 3S88L 3NPSB 5B8CC 1A1NA 3QDGE 2YD8A 1A2YA 9CGTA 5BMFL 1IKNC 4M7ZB 5KG9A 5CFHA 2BZDA 3QO1B 4M1GH 3KAAA 3QWOA 1FFOA 1TQBB 2Z4QA 1N6QH 1CK0L 4WCYH 4MNGA 3L3HB 5D70L 5FECB 5F7EH 5K9JL 3VI4F 3MJ9H 3DURB 2EKJA 5J13B 1MWAH 3TO4A 2X4OA 4WV1C 1FZOA 1WISA 4XNMA 3IVKB 4H88L 3CXDL 2EIEA 1IGIH 3BQUA 1HQ4B 3RL2A 1HCVA 2PUQT 4LSSL 5ADPH 2MSPA 5DJZB 1M7DB 5HYJE 4HFWB 3O2WH 5EU7C 3V6BR 5A1AA 3OR7B 5HHXH 2CDGA 4ZO6A 2RHEA 2UY6A 2Z8WC 4P5TC 3MUHL 3NCJL 1DEEA 4WGWB 3MJ9A 5EPMA 4DQOL 4GSDH 2EYSB 2ZOLB 3P3YA 4LKXB 3MLTA 5F70A 4TULL 1MWAA 4FTVD 4F57L 2AEQL 1XGYL 5L7XH 2P24B 2H26B 1KLGA 1BVLA 1R5WB 4CMMA 4TNWK 1UVQB 5INCA 1RHFA 4TNVF 3KPQA 1I75A 4Q58C 2UYLA 1KC5H 1G9MH 1MHPH 3G6JF 2HKHH 1IAKB 1JRHI 4L3EA 3VRIA 1QBLH 2H1PH 4NDMA 1KB9J 4PJEF 1LK2A 3VCLB 2ADIB 4MSWB 4ENED 4OCWL 3BEVB 3TA3A 2LABA 2JK5B 4TVPD 1NFDF 5BRZE 4PGBA 1H3WM 1FIGH 5JA8B 3P11H 3LSOA 4H20L 3E6FB 3F7YB 4P5MA 4JFOB 4O5LL 3VXRA 1AIFB 1IGFH 5BS0D 1IE5A 2UZYB 4XHJC 3GI9H 1Q9OB 3RTQD 2QQQA 3WJLC 3QCUL 1EFXD 4HX1B 4TTDD 2YUZA 2R1WA 5GGQH 1U58A 3BN9D 4J4PD 3O45A 2Z31C 4WHTB 1I9IL 3DIFA 1R6VA 3BAEL 4ZDHB 4HUWA 4ZXBC 5EOTB 3LKRA 4ZFFA 4HCRH 2XZCL 1L7TH 4HGMA 5EUKA 4A6YB 2AXFA 4L9DA 3VXUD 2J5LB 1DDHA 2XWJA 2Z8VC 1JZ5A 5HDOA 3HRZB 3IETA 4OV6F 3CDYA 1WZ1H 3O3DB 1YPZB 4MYWB 2WV3A 1WGOA 2ZSWA 3RWDA 4IDJL 4OCLC 4NZTL 1H9VA 3MCKA 1IAOB 3OKMA 5T3ZL 4WUKL 2X7LB 5SWSD 3KXFB 3PWJA 4U1KB 4K3DH 3SGJA 3OAYK 4QXGL 4S1RL 3KGRA 3D3VB 4HCRA 3D85D 1IC4H 1LD9A 5GRWA 4QGYA 4PJ7E 4UV4L 5IQ7H 2MKWA 3AGVA 1OVZA 2B5IB 1HI6A 4S1DC 1KLUB 3RY6C 4O2CB 3OHXB 3O0RH 3QPQD 3ROOB 4U3XA 4ZOBA 1CTOA 1VGKA 1WWAX 3G5YB 4OTXL 1MH5A 4N90E 4OGZA 1ZT4B 5BVPL 2BCKA 3PDOB 3NFSL 3WFEH 3CXHK 4L8SC 3ARDA 4OGXH 1J10A 4QOKA 5C09E 2AK1L 4NJAH 4XMPH 5EORH 3M1BA 4TSBH 3MRGB 3EOTL 43CAA 2VLJE 3RQ3A 3BH8B 2VIRB 3DX9A 5L6YL 4O2FA 5D2LA 4B7LA 2APVA 4NQEE 4WFGE 5I16B 3ZYIA 4ZFOL 1RK1A 2GUOA 4PJEB 5AD0B 4HKXA 1PSKH 1S8DA 3QXAB 1EO5A 3MGOB 5FHBH 5AAMA 6FABL 5J6GA 2VL5A 4PJ8D 1G84A 2CSPA 2YS4A 4LLQA 4PS4H 4U2YA 3X12A 4J6RL 3C8HA 1RV6X 3O4LE 2VDPL 4QGTA 4JFQB 1NAML 4RNRA 4GMTH 4GKZA 1BQUA 1ZTXH 2NY1B 1G7MA 2K1MA 3GBNL 4MJ2A 4ACPA 4ODSH 2CMRL 4R7NB 3C2SA 3FB5A 1NGZA 3V0WH 3CJJA 1MI5E 3R06B 2NW3B 2JIXB 4LCWD 1DE4B 3F7VB 4KKCC 5IB4A 2R2BA 5TDNA 5LVEA 2AW2A 3L3HA 5ESVA 4QRSB 3FO0H 1EPFA 4EDXB 1P1ZB 3OKKB 3PXHA 4CNIA 3DURA 5MENA 1XF3B 1JPST 5TE6H 3O3BB 4Z7VF 1MCIA 1UA6H 4HH9B 3LB6D 2QSTA 1HQ4A 2ITDB 4P5KA 5CILL 4X5WA 1J05B 3IAPA 1OAUH 4YXHH 4JFFE 3HZYB 5TDOB 3OR7A 2W0KA 3EKCA 2XT1B 5TQ2H 1EAPA 3V6ZA 5B8CB 4L5FH 2FX9H 1Q9WA 1KIRB 4JKMA 4L1HA 2V5MA 4YHKH 5FF6B 3U82B 2OSLB 2ZOLA 4KU1A 3B2UD 4LKXA 4Q9RL 1YJDC 5DEFA 3MZGB 4MAYA 2FLBT 1DEDA 2H26A 1M1SA 3GBMH 5JPMB 3H7BB 1J0JA 4WV1B 2VZVA 3V7AG 5F9OL 2M1KA 4IEFB 5DGQA 5ISZA 4LCYB 2I9TB 4J3OC 3PJSB 3QIBC 1LDPH 2B1HH 4G6AC 1I1AD 2C3VB 3BDBA 2BK8A 1FCCA 3NCYP 1RK0A 4YHNA 1S9WB 3FO9A 4WWKD 4WFFE 3UTTE 4P5TB 2DJ4A 4UOW1 3BEVA 3CZJA 5FA3A 1GVIA 4YHPA 4YNYA 4ISVB 4OCMC 3SE3C 2PW1B 3PL6C 3QCVL 3F7YA 3MYZA 1AIFA 3V5HB 4NIKB 1PG7W 5DD0H 1MFEH 4QTHA 1RPQA 1I3GL 3AU1B 4D0DB 1Q9OA 1EHLH 1XF4B 1OSZB 2FZ3A 2NCMA 1YA5A 5D1ZC 4ZAKD 4MGXA 5L2KD 5F96H 4Y8DC 3DMMD 4KMLB 3BGMB 4MCZB 4JZJA 1IL1B 4WI6A 5H2BA 3V0VB 1D9KC 1HINL 2V9QA 1A7RH 5E94B 3VFSA 4Q9QH 5GRYA 1JNHB 1IC7L 2GJ6D 1XH3B 3RX7A 3LQZA 2WP3O 1YPZA 2XZQH 1DUZB 1AJ7H 2ORBL 2A1WH 3LHPL 4Z7VB 1IAOA 4HWBL 4G6FB 4ZFZA 2L4OA 1JWMA 3RU8L 2BVQB 4X4MA 3IJHA 4JR9H 1B4JH 4JO4L 2X4SB 3TN0D 4ELME 1QSVA 3EYVA 4Y2DD 3TVMA 5GXBB 1KTRL 3UYPA 1MELA 5E9DB 4LDOB 2Z31B 2I5YH 4XP1H 2WWKT 4ZXBB 4C56B 1CL7I 1KLUA 4PB9L 4O2CA 4MQSB 4NKDA 3MRDB 4HIEA 3FFCE 3PE9A 4P46B 3ROOA 4WEBL 5EOCJ 5IMKA 5HGGS 3QUYA 1ES0A 1ZXQA 3G5YA 2CLZA 3EDFA 4QWWD 5JMOC 1ITBB 1FVDB 2LQRA 2FH8A 1MFDH 2HMIC 5LBSH 5C0RH 5H8DA 3N0PB 1IC5H 1TETL 1NUGA 2J2ZA 3MNZB 3TM6A 2DWEA 4TN9A 1WSST 3WS6A 3MRHA 1A3LH 2JKXA 1NLBL 4LMQI 3B6SB 4KJPD 3SQOL 4K55A 1CFNB 4J8RB 3DJ9A 2NY4C 1OHQA 1CCZA 3PHOB 5C6WH 3OB0K 4OLUH 2NZIA 5BZDA 1LHZA 3L7FB 3S96B 3RWEB 1GPOL 5EIQA 5KSAC 3CZFA 5FO7B 3WUZA 4IRJA 4GOSA 3O81A 3MOBL 5IKCB 3SGEH 1T03L 1RIVH 1EBAA 5C07E 2PXYA 2X09A 4L8SB 4R7NA 2ITCB 2GEEA 2FO4B 1T2JA 1LO2L 3GJEB 5IT2H 5KOMC 2HJLB 1R5VB 1KT2B 4O51B 2YBRB 4O4YL 3IAQA 2X9XA 4JRXD 5C0BE 2KH2B 3OKKA 5E00B 4KTDL 3KS0J 1Q9LA 3V5DB 3MLXH 4JFPB 1ETZB 3REWB 3QNZB 4HH9A 3BZEB 4I5BB 4FQXD 1IJ9A 4JHAH 1C1EH 4MXQC 3QWRD 3AS0A 4ZFGH 3SN6N 4YHML 1J05A 4HPYL 2E27H 4WHDA 1R0AH 4MB5A 5IW1B 3QEUB 3NFPA 1T21B 4WHYG 3CDFA 4E42B 1KJVB 3GMOB 4NUJB 5D8JL 1NEZG 1TJIH 1IKNA 1FZKB 5GGTL 3HZVB 2OSLA 5CEZL 3TPKA 3RWHB 2I9LB 2VWEE 3T0XA 1OLLA 2HT2D 4GXVH 4LSUL 4PJ9C 5B21A 2IH1A 3VA2C 4BKLB 2YEZA 4WV1A 5C0CE 5EZOL 2PYED 4HWEL 3ZKMD 5HVFB 1E4KC 4U6TA 2I9TA 4TNVK 1U8HB 3CLEH 4LSQH 5T3XH 3WIIL 1DBBL 1FO0L 1OAQL 4U1GB 5C1MB 2Y07L 2C3VA 2NY0C 3RKPA 4LL9A 4ORZC 3LQAL 4OIAA 2PO6C 5JQ6H 1C5BL 1E27B 4P5TA 3BP5A 1KPUB 2YC1B 3IU3A 4TUKL 4Y5XA 2AQ2A 3LKSB 1F6LL 4XC3H 1OTSC 4PJCF 4XPTH 1MJ8L 5ADOL 4XWOC 2F19H 2VZSA 4OZGF 2D2OA 2B4CL 2IC2A 5TDPB 3WD5H 3AU1A 1JV5B 2XV6B 4Y5VA 4M5ZL 2AJ3A 3VG9B 3QIBB 3BZDA 2DWDB 1YEGH 1Z9LA 3BGMA 4MCZA 3UC0H 1IL1A 1JFQL 5H94A 5HHMD 2JJWA 2N1KA 3V0VA 4BFBD 5JPNA 5T1LA 3U0PB 1JYXA 3DVGA 3MLPA 2I27N 1HXMA 1OTTC 3ZDXF 1GHFL 5CIPB 3GSXB 5EIIA 4KI5E 3ULSB 1HHKA 3PWPB 4PGEB 2VQ1B 2R9HC 5IMMA 3FQUB 3GSOA 1ADQA 5DC4B 4D8PA 2YUVA 3PL6B 3AS3A 1CG9A 4OCXL 1LDSA 4FQHA 4I13B 1D5ZA 3HG1D 3ULUC 4KQ4H 3QDJB 4NO0D 1XZ0A 5D7KE 4DGIL 2X4SA 3JXAA 4AMKL 1CFVH 2MTPA 3WJLA 1DZBA 5B22A 3N1GC 3WSQL 3QI9D 2AJXL 2CLRB 1U92A 5FKPB 1DANU 1T7VA 3S36X 4ZUVB 3P0VL 1V7NH 4NZUH 1MRFH 4P49A 5D1ZB 3H9ZA 4F7MB 5IMLA 1SBBA 5J06A 5M95B 4Q0XH 5I1CL 3OL2A 1YUHA 2DI8A 3EJZD 4C56A 2CRIA 4KZDL 2XWBA 3L1OL 4RGMC 5E6IC 3MC0A 2FBJH 2FGWH 4PR5B 1D9KB 3SEPA 1JNLL 3BIAX 4XC1H 5TJWK 1JZ2A 2FJFA 3CUPB 5BXFB 5I66B 5DT1H 2Q8AH 3MJ7A 3ILPB 3NCYS 4P0DA 3LKQB 1I9JL 1DP0A 4G9FA 2DQUH 3QJFB 1HKLH 1FYTE 3QDGA 2V6HA 5I18L 1VACB 4HLZG 1V5JA 4DCQA 4F7PB 3MNVB 2D31A 4QHMB 3MNZA 5CCKL 1XCQB 2VZ1A 4N1EA 5D96C 4E5XB 4JFHD 1F02I 1I8MB 5FYLD 1NCWH 4DJMA 4RGOH 5DHVH 2EE9A 5CJ8A 3B8SA 3EDJA 4Y16A 3RWCA 2VDNH 4J8RA 4JKPL 5IMOB 1AR1C 4Z0BH 3RY6A 5I0DA 4NHUB 2E6PA 4E9LA 3GSRA 4HUXB 3VI3F 1FNFA 2VXVL 4PJAE 2DM2A 2FX7H 4PJCB 3C5JB 5I1DB 5DQ9A 1PW3A 3MPCA 3UMTA 3KLAB 4V2BA 3EO0A 3NCBB 2QSQA 2FR4B 4AEFA 3V6OC 1MUJA 4U6HB 1IGCL 1HH6A 4FQIL 2BVTA 1LO4H 1QRND 2F5AL 3SDXF 1CGYA 1JNNH 5DHVA 5L0QC 1CE6B 2AJYH 3QFJE 5F7WC 4HUVA 1G7JA 5JOPE 3SGKA 1R5VA 2QQLL 1KT2A 4O51A 1VHPA 1MREL 1DBMH 1EH9A 1HYRC 2ED7A 4Y1AB 2IPUK 3PXJA 3TJHD 5IW6A 1P5VA 5E00A 4PRBB 1DQJA 1HDMB 1MJ7H 3ZKXB 3E6HA 5F8QC 5T1KA 4N0CC 4MD0B 4F7CB 3TNNB 5J4MA 5IFAH 2G2RA 2WBJD 5KSAB 4YXKL 3O6MH 2GAZA 1Z9OA 5I30H 4NBZB 5IW1A 1CBVH 3QEUA 3MRQB 4NNPH 2XQBH 1GH7A 4R2GB 4NZJA 3RNQB 5KJRH 4NUJA 1N64L 2EIZA 4QNPE 4UNVA 4PGZA 1H15B 2H2SC 4JM4H 3CC5A 3L9RB 3HZVA 3D1MC 5HY9A 5KSUA 4U1LB 2J8UE 5EZIH 2HFGL 3S35H 3RZCB 1G9EA 5CWSA 2UWEF 2LAGB 3FHAA 2ZCHH 3ORJA 2VMFA 4I3RH 4N1HB 3R1GH 3BP4B 1YY9D 1YJDH 4ESKA 5DD1L 2AJSL 3TBTB 3ULUF 4R26L 4QTIL 2DMKA 1RZJC 4R4NC 4Z5RA 3OGCB 3B9AA 5CD3B 5EC2B 4OZIB 4ZTPH 1PG7H 4UQ3B 3EFFB 3F12B 1P69B 3MRPB 3T0EC 2DQCL 4KTEH 3R8QA 4FQ1L 1QVOA 2YC1A 4CDGC 3FQNA 3FB6B 4QRRD 1E4XI 5D1XD 1K6QL 4FQPA 1WVZA 1AKJD 2O5ZL 3U0TA 1NUFA 4BJLA 1QG3A 5IWLA 4V1DB 2BOCA 4PJ9B 5TDPA 3HNVL 2CO6B 1H3UA 5HDBE 4C58B 1OP5K 5I1GH 4PJ7A 5J7CC 1I9RH 3ALXA 3ZT6A 4XP6H 2XRAH 2BNUB 2NY0B 4PLKD 5IBTL 2BNRB 2WUBH 4HK0B 4NQDD 1F00I 1Y0LB 2IAMD 5E8OA 5HYEA 4X7SH 2BNQD 1J8HD 4MWFA 3GSXA 4XB7A 3ULSA 4MDJB 3PWPA 4WFHD 4PGEA 2VQ1A 2DQDH 2P8MB 1YC8A 3C6SB 4PJ5D 3VI4E 1SYVA 2IALB 3SE3A 1FH5H 1OWWA 4YX2L 5C09A 2MHAA 4ZD3L 2UZXB 5DVMA 3T2NH 4UILL 1ZOXA 2O5XH 2VLJA 5EWIH 1EHXA 3KXFE 1F58H 2CLRA 4HGKC 2PCPA 3WLBA 1U8IB 1WFOA 5D1ZA 4F7MA 3BISA 3H42L 2GITB 3I6GB 2UVFA 4YO0B 3QG6B 1XGTB 2IAND 5DJ0A 1QYGL 5CMAA 5CSZB 1NC2D 1YMMA 5C0ND 1BFOB 2ZWLT 4G6JL 3B43A 3BDYH 5GZOC 3BXNA 4JGUA 4JY5L 1IKFH 3IJSB 1UGNA 3C5ZC 2QR0A 1RZFH 4KGLA 2UWEB 4KHTH 5BXFA 4IHOB 4Q9BA 3ILPA 1KCVL 4RGNB 1IEHA 3LKQA 1N5AB 3QIUD 3JWOL 3QJFA 3EYUL 5DUPL 2GSGB 3VFVB 2RBLA 4Z95H 3MNVA 5T33H 3ZTJG 1T5XA 4E5XA 3OJDB 3E3QC 4WEUD 3G6JE 3WLWC 4GBXC 1LWRA 2PTUA 5C0FB 3V52H 3P73A 3EZJB 3MV8D 5IMOA 4PJEE 3CVIH 4RGMB 3ARWA 4NHUA 5ITBH 2NXZD 1A7PL 4S10A 3FMGH 1PKQE 2DKMA 5I1DA 1NFDE 2AXJA 1S7VB 2FR4A 4Q2ZB 5TPWH 2HJKA 2CPCA 4P57B 1IT9L 1ZVSA 5GJSL 1U42A 2D7NA 4XWGH 1IVLA 2DMBA 5C2BL 4X6FA 1Z9MA 1BZQK 1EERB 2ADFH 2DTML 2FBOJ 4Y1AA 1X5KA 3QEHB 3MROA 4KROC 1OW0C 3WO3B 4Y4HC 2IQ9L 5GS2H 3F5WA 2QTEA 3NACL 1HDMA 3MRIB 3NCCB 3L3KA 2FSEB 4QHKI 1GGBH 1HILA 2VKWA 3TNNA 1QSFD 3NIGF 1I3RB 2NNAB 3OKDB 3P0GB 4LGSB 4RA3A 4YIQB 5B38B 4HUUB 5F7YC 1RZ8B 3LH2H 3VDAA 3RNQA 3C8KA 4PP1C 1AGFB 5D6DC 4QHNB 4HHAB 1EJOL 1DBKH 1XR9B 3QUZD 2Z8SA 5CJQL 1JPFA 2VSDA 2EZ0C 4C55A 1I1YA 1WTLA 1P7QA 5FB8A 1QKZL 2H41A 3TBTA 1WBYB 1QFOA 2AEIT 1N6QL 4WCYL 2DQFA 5F7EL 3MJ9L 3EYOA 4NT6A 1I7UA 1IGMH 2Y6SC 5MERB 3CK0H 1MWAL 1JIBA 4OZIA 4NM8H 4TUOB 5JHDD 1RURL 1A0QH 4PPTA 4OZFB 4X83A 1BBDL 2D03H 3B9EA 3EFFA 5FM4A 1TZIB 4YK4B 3WEXA 5ADPL 2HT3C 3A6BH 3FO2B 4HS6A 3VFUA 2P5WB 5JW4N 3VJ6A 3O2WL 3IFOB 5HHXL 2GK0B 4MA8H 5F6IC 3SDDC 3PP4L 4ETQB 4LP5A 2MWCA 1WIUA 3E1F1 4PJ9A 5FUOH 5AEAA 2HFFB 3LIZH 2VDKH 1F5WA 4V2CB 1UG9A 4L8CB 4GSDL 4RDQF 3SDYH 3GHEL 2AABH 3FQRA 3VXSA 1RHHB 2BNUA 1VEMA 3FRPA 5C0IA 1QBBA 1L7IH 2YKLL 5LKNA 5F88A 5D5MF 5CEZD 5HYJD 4BSVA 1Y0LA 3WFHB 2PO6A 5CUSH 3OMZA 3T0EB 5HHOB 3HNTH 5F3HA 1KC5L 1MHPL 1G9ML 1F4AA 3VFPA 3A6CL 3CX5K 1QBLL 5CZXD 2R0ZL 5IVZB 3C6SA 4WW2C 4PRHE 3ZE2E 1YNLL 3LS5H 5C71A 3K7UA 3IJYA 4YDIH 4Z7VE 4OZ4A 3SE4A 5IESH 2BDNH 2DQTH 3EGSA 4KMQA 3PV6A 4NQCB 4S2SB 4X98A 5B39B 2OLDA 3MRKA 2AERT 3K4DA 1U8IA 1CFQB 1U3JA 2GITA 1IGFL 5E9DE 2HP4A 3HS0B 1UXSB 2L0DA 3ZKND 3GI9L 4JN1H 4K3GA 1G1YA 2PW2A 4EI5C 4MX7B 1AFVL 1LNUB 2NYYD 2DD8H 5EU6B 1EMTH 3GM8A 3RIAF 3BRGC 3B3IA 1NBYA 5DJDA 5CBEA 1L7TL 3EYFB 4KXZI 2X89A 3G5ZB 1RFDH 5C07A 4EN3D 2BVYA 4MD4A 3FQTB 4MMXC 1WZ1L 4KUZH 3PIQB 1ZLVK 1I3UA 2D9QB 3KYMA 1MCRA 2RQ8A 3MOAL 2FLRT 5HD8D 5K9QG 1NMBH 3P30L 5E70A 1BQLL 4U1NA 2V2XA 3TIEB 5F7MC 4R96A 4K3DL 3OKYA 3DWTA 4LRIA 5E6IA 1IC4L 1I7RA 4JO3H 4Z7WA 3ZDYE 3N1MC 5IQ7L 1UJTA 3C5ZB 3QXVA 3SCMA 2PN5A 4AT6B 5IFJB 1TZHB 3O0RL 4P57A 1FCGA 2V2TB 3WHE1 4AM0B 1TLKA 3NGBC 2WBWB 1OSPH 4JFZL 1T2QH 3CH1B 2HTKD 1JRHL 4FTVB 5AWNH 4HKZA 1W0WB 3WFEL 3QEHA 3MV7B 4OGXL 3OV6A 1LP9E 5C0CA 4OIIH 4XMPL 1MCSA 3MRIA 2H8PB 5EORL 4NP4L 3J8F7 4MNQE 3H9SE 2OTUB 4L4JA 1A3QA 5D6CB 1PFCA 3BE1H 1M71A 2R4RL 4YIQA 5DJYA 1PSKL 1IEAB 3V6OA 4RZCB 4HUUA 5FHBL 3QFDB 4HQQH 5CJOL 5E08L 3KYNB 3CDGA 4BSJA 2BSSB 3W0WE 1SJVA 3OKOB 1X3DA 1YEFH 2LVCA 1AGFA 3EDKA 3GSVA 4FFWD 4OZFH 1CN4A 3TIDA 4BFEA 4GMTL 1ZTXL 3CSBA 4P2RB 1LE9A 2LE9A 5J1TC 1AGBB 4J3SA 5BS0B 4KROB 4W70A 4Y4HB 3O6LH 1XGPA 4WW2F 3V0WL 2FEDC 4YDJA 5D7JD 3LRSB 2GSIB 3O6KL 4H26B 5F7DB 4BSWB 3OG6B 4JRWA 3DGGB 4X7CC 4NQVA 2O93L 2KKQA 3EZ8A 2HA1A 4KUCD 4OFKA 3U4AA 3VXME 5TE6L 5KAQG 4HULB 1UA6L 5I17A 3VXUB 1RVFH 1RZJH 2R39A 4MDIB 2ARWA 3NFNB 5IVXA 1OAUL 3UTPD 4K7FB 4YXHL 3ARBC 4OCRH 4NGHH 2GK0A 4M93C 2ZG1A 3TJEL 5C8JB 4ETQA 5TQ2L 3CFIC 5AYQA 4L5FL 2FX9L 1E6JL 5HYSA 4E41D 4YHKL 2X1WL 2HLAA 4WDIB 4IJ3C 5FGCB 4M03A 3T4YB 1CLOL 4MJIB 2QV2A 4XX1E 1Q0YH 4DN3H 1K9TA 1T04B 1NLDH 5JW4R 3DBXA 5DTFB 3P77B 3TV3H 5D7LB 1T1XB 1N59A 4NZRL 3B4NA 2B1HL 3EJYC 3N1QC 3T0EA 5GRUH 1FRGH 1P7KB 5EBLA 3B5TA 1XR8B 3IKCB 5IVZA 1JI1A 3MCLH 1FYTA 2P47B 4K23H 4PJBE 3IS0X 1ZA3A 5J1AB 1KB5B 3Q3GA 5EZJB 4A6YL 1UADC 3QDJE 2AKRB 5F7KC 4K8RC 2HWZL 4R6UA 3T65B 4NQCA 3BPCA 1JPGB 5HHQB 2JB5L 4OF6A 2BVEA 3SO5A 1KENL 3OF6A 4I0KA 4R9HA 3QPXH 5DD0L 1MFEL 5DMIH 4N0UB 5D1QC 1EHLL 4XB8A 1LNUA 3C9NB 5AZEH 4P4RB 4NFBA 3L5XH 1UJ3C 5HI3C 4L3CB 5GSRB 4JFDD 1CXHA 1VFBB 4JO1H 5L88H 4UTAH 2G5RA 3V2AR 4GO6B 4WW2B 3SKNA 3T4AB 3OPZH 3L3OA 4LEOB 3S7GA 3FQTA 3HUJA 4Q9QL 4D9RE 4XBEH 1SYSB 5GGVH 1H3TA 2XZQL 1AJ7L 2NY5C 4NHCL 1A6ZA 1BIHA 3JTTA 4LNRB 2ZNWA 5EO9B 2CDEB 4LCUB 4RBPK 3EOYG 2KL6A 5C0AE 3TIEA 2V7NA 1TVDA 1C08B 4JR9L 1B4JL 4WHCA 4YHIB 4XBGA 4YUEH 4EI5B 3W2DL 1QUNA 2XTLA 1CGVA 2BSRB 2YRPA 2F54B 5DDHB 2DAVA 1BX2A 4F9PA 4XP1L 4BQ8A 3OKNA 1OARH 4OZGE 4U3HA 3U36B 1D6EA 2GHWB 2V2TA 2XPGA 1NKOA 3GO1H 3RY5A 2J8UA 1X6NA 3CH1A 3M8OH 3DO3A 3TBVA 1FNAA 1MFDL 2YR3A 4ZS6C 5C0RL 3UROR 4GBXA 4ZOEA 2OL3H 1IC5L 3DETC 1IAIM 4P2QD 5FUCE 3ZTNH 3U83A 3OKEB 5TGBB 1BD2E 4JGJA 2NLJB 1DVFA 3ZDXE 2P8PA 4HPOH 1A3LL 2AEPH 3F7RA 2IWGA 1AC0A 3QUXC 3RZWA 3VH8B 1PX3A 1UKQA 3RDTD 3TGXA 3BSZH 1FL3B 3WIFA 1G7HA 4OLUL 1KJ3H 1CS6A 1RZIB 4PFEA 1IQDB 5K9KB 3KYNA 3GMMA 3I3BA 2BSSA 3NGBB 1JF1B 3IDJB 4JPKH 4Z0XB 2OL3A 4D9QD 5C2UB 4Z9KB 2I26N 3D0VB 2X1PA 4OZHB 3QEQE 1MFAL 4I1NB 5IM7B 1RIVL 5EO0B 4GG6F 1A14L 1OW0A 3QEGL 5FDYA 3PDDA 1FNGA 3KPSD 3QHFL 1U41A 2E9IA 2DQIH 3VWJC 4NN7C 1QR1B 4UI2A 4NBXB 4J2XA 1TCMA 3ARGA 3UBXA 5A40E 3MXWH 1LEGA 3MLXL 4HW6A 3FJTA 4N9GA 3QO0B 4JHAL 2H2PC 4RIRB 1KCSH 2YWZA 4ZFGL 3NFNA 2DLTA 3TPUA 5I15H 4KKNA 3UCRA 1MFNA 1W0VB 4K7FA 3PWVA 1CDGA 3QNXA 1TITA 3H9HB 1R0AL 1UCBL 3DXAB 5DO2C 5TF0A 5ACLA 3X14A 4BH8A 1TVBA 2WSKA 1JK8A 1F90L 5DURD 1KXQE 3H2WA 3JSSA 2OCFD 3STZB 2F53B 1TJIL 2JCCE 4YE4H 3QZWB 1BJMA 3VI3E 1KB5H 1UQSA 5DZNA 2O61A 4WDIA 1F6AB 1ZLWH 1T7YA 4PJXB 5LGKA 1NSNL 3LRGA 1DSFH 3T4YA 3SKMA 1MF2H 2C5DC 5DRXA 3E0GA 3BQUD 3SDXE 1U8JB 1RZKL 5D2NE 5I8EB 4MD5B 3P77A 5T3XL 5D7LA 1CVSC 3X11B 2EXYC 4BZYA 3BP7A 1FG2B 2O5YH 1P7KA 4OD1H 4JFEA 4CBPA 1JN6B 4CVZB 1FNEB 2X1OA 4GRWH 1MVUB 3ARBB 3R0MA 5EU4A 4M93B 4ZUUA 3NIFF 3SDDA 3OZ9H 5T1MA 4P2OA 3QUKA 3G6JA 4XC3L 3T65A 4YDKH 3I3DA 2YD2A 3ARRA 1J1OH 4CJ1A 4IJ3B 5FO9A 3CPLA 1JUFA 2F19L 3PNWA 4IRZH 5GJTH 4B41A 3T04D 1NH6A 3IDIA 4ZUSA 1OF2A 4N0UA 3WD5L 3V6FA 3ALWA 4DK6A 3EHBD 5TE7H 3C08H 4FG6C 3CFJB 3VFOA 1PKQA 3PG2A 4GG8B 1NFDA 3KNBB 4OAWA 3ZE1E 5HJ3B 3BKJL 1CXIA 3VGFA 4L3CA 4O2EA 3B9KC 1YEGL 4GG6B 3UC0L 5IW3A 1XF2A 3MTRA 2UWEE 4BQ6A 2VR5A 2FATL 4HJGB 2BXYA 1UM5L 2ZSVA 1M7IB 4RGNE 3RWIA 1UH2A 2NMSA 1GC1C 3ULVC 3DX8B 1UWEL 3T1WA 1FAIH 4P3CH 5L9DH 4QT5A 3VXRD 5TQ0L 4DGVL 4KJYB 2CDEA 5I8OH 4LKCB 4MCYA 2NTSP 2VITA 3EO1A 2VDOH 1YDPA 1VADB 1YEKH 3QULB 4IS6B 4KQ4L 3CCHB 5IEHA 3DYMA 5D1QB 4FQXB 3D39A 1F4XH 3D69B 1KB9K 3QXWA 2F54A 4UDTA 5DDHA 1UXWA 1V7NL 1MRFL 1A7QH 3GJFB 1UJ3B 4U0RC 1MCNA 3QWQB 4J12A 1FL5B 4DZBB 2IPKB 1X7QA 1NEUA 2FBJL 2FGWL 1IAIH 4Y4FA 5JORA 1ORSB 5SX4I 5CP3H 4KPHH 5F93C 3UTSB 1WCBA 4P2CG 2ADJA 2DYPD 3KLHD 2ZZUT 3LOWA 1CLZH 1E28B 1XIWC 5C08D 5DT1L 1HE7A 1U3HC 4HZLB 3DUUB 1HKLL 1DTUA 4KDWA 3PWLA 2OXHA 5I71C 5KVFL 3VFTB 2XTJC 5CD5C 4YEEA 3OKEA 5TGBA 4ZMAT 2M26A 4LOUD 4GAYA 5GS3A 2NLJA 2LVEA 4RGOL 4ZYKB 1KOAA 4MA3B 1G0DA 4MZ2A 2Y4SA 1YYLH 2UUDK 1C16B 4YPGB 2VDNL 2VE6A 5CP3A 2H9GB 4FNLL 3ZZ1A 4Z0BL 1JGUH 3BUYA 5LGHH 1ERNA 1L0QA 3FZUD 1CICC 2RAMA 3VW3H 3IDJA 2WUCL 2B2XH 2WNGA 4Z0XA 4QXTA 1TTGA 5LAXB 1FYHB 1AGCA 2R2HB 2F8OA 2FIRT 3L6FB 4OZHA 1LO4L 4R3SA 5IM7A 4YZFF 1JNNL 2VDRL 4XNZC 5JO5B 1W8OA 3TFKC 1QHOA 4ONFH 3O6FA 4UTBH 1ZWIA 5FA4B 3S3PA 4OQTH 5F21B 1DBML 1H3PH 3L7EA 1Z6JT 4XTRD 3QUXB 4PG9A 1T4KB 4Y2OA 5HSFA 1J12A 2D7QA 1DQTA 3L5JA 4PY7A 4K9EC 2XQYK 4LVNC 3MGTB 3DUHA 4Y88A 1MJ7L 2A9NH 4OF5A 1KIQA 4GQ9H 1CDBA 3WXWH 3O6ML 2AK4E 2ESVD 2DN7A 1RZGB 4MMZC 3C5SB 3H9HA 3DXAA 4Y19B 2BJML 1KGCD 3HG1B 2EC9U 4OQTA 5HGAB 5KJRL 2IH3A 3K4AA 4JM4L 3PQYE 5FYJU 3HE7C 3QZWA 1ZHKB 3QI9B 5E2WH 4YGVB 3MUGB 4GRLA 3VWJB 2RB8A 3FQWA 3LDBC 4LHUA 5FYKE 3RWJB 4X4YA 4NN7B 5MEND 3ULVF 4NKOB 4PJXA 1WT5C 4UT6L 1U95A 2ZCHL 1MFCH 1RJZB 1U8KA 3ARFB 1DCLA 1O7VA 4R0LC 3TP4A 4I3RL 1A9EA 3R1GL 2BRRH 4XXDA 1YJDL 3BYTA 4YHYC 1U8JA 3MGAA 3WKNA 4ELKB 2XXMB 1CI5A 1CTNA 3DV4B 1ZLUH 4OLXH 3QHZL 3X11A 4K94L 1K4CA 5HHOE 5GZNC 4JQIH 3CFKB 4UNTA 5B4MC 4ZTPL 1PG7L 2VYRE 4CVZA 3GRWL 1MRCH 1MVUA 1F2QA 2GT9B 5ESAB 1UKSA 4GLRI 4K2UL 1PQZB 1SQ2N 4G8GB 1FDLH 2BY3A 1FZJA 3RUGE 3JV4B 5SWQB 2C3WA 2KUTA 5KSBB 3QNYA 4K8RH 2VDLH 2A0LD 4WUUE 3PGDB 2X05A 1OWRM 3N06B 3VFWA 1XCTB 4FMKA 5I1HH 1MNUH 4GG8A 2VLRB 2OP4L 3H3KA 4XCFH 5IB5B 5EU6E 4XP6L 3FRPG 5E2UH 2XKUA 2XRAL 3NN8B 4JM2C 1REIA 1HCFX 2WUBL 4M6OH 4XVJL 3D0LA 3OJVC 1QFWM 1M7IA 4X7SL 3JZ7A 4TOYL 2YA2A 3DX8A 4F7TB 1ONQB 1BQHB 4N5EC 2FX8H 3L3DB 2DQDL 3VD3A 4JE4B 4PB0L 1ACYH 1FH5L 1LP9A 4UIKH 1FORH 4F37K 3QULA 4M02A 1ZT1B 3T2NL 2R0WH 4IS6A 2NY5H 2QSCH 3CCHA 2O5XL 4MNQA 3BH9B 1MHEA 1QLEH 5IJKC 4QRUA 3MRNB 2N7AA 1H3XA 2DLIA 1R3HA 3LMJH 2VRAA 1PLGL 1UJ3A 1E4JA 4GAFB 3B9KB 5D7IF 4MHHI 1ODAA 4KY1L 3BDYL 3W0WA 2C1PA 1EFQA 3UTSA 5JTWA 5GQBA 4BK5A 1RZFL 1ZV5A 1R24A 4KHTL 4X99A 4C83B 4CVWA 1Z3GL 3K46A 1K5NA 2YRLA 1ZSDB 3GI8H 2Y9RT 4WU5B 3W82A 2WK2A 1EAJA 5HTSA 1DBJL 5DHYA 3DUUA 4FTVE 3VXNA 1OTUC 3SY0B 3VFTA 4Z95L 4LRNL 5INDB 5D5ME 5JDSB 2NY7L 3IFNH 3TVMD 2AXGA 5ICYB 3D3VD 5T33L 5BVJB 3NCEB 1A7NH 1R3LB 4M6AA 4U1MB 2OZ4A 3FT4A 2EIBA 4PIRF 5E03A 4LARL 4JHWL 4AIOA 1QFHA 3ECBB 3V52L 3VXMA 5F1SA 3TWCH 4YPGA 4U0RB 2Y06H 1A6WL 1NCBL 3HZMA 4ODUB 1C12B 2H9GA 5GGRB 1T6VN 2H45A 5F1NB 5ITBL 4KC3B 5A2IH 1WC7B 5HDQH 2Q6WB 2CDFA 3PABB 5B3NA 2VAAB 1U8OA 5TPWL 1BF8A 1GOGA 1XIWB 4TVPE 1BBJA 2DQJH 1FV1B 1U3HB 4G80B 3O9WC 2VUYA 4RQQB 1MLCB 5I71B 3WO4C 1VKXB 4XWGL 5BS0E 4HV8A 4XAWH 1U6AH 2ADFL 4OFYA 2A6DA 5KW9H 1BZ7B 2RCSH 2HTLD 3WCYA 4Z7OF 4H8WC 5IBLD 5EUOB 4ONOA 1GGBL 3Q6GH 4MJ4A 1CICB 3VXUE 2FYYA 2Y5EA 3RRQA 2NW2B 2EDLA 5B38G 5IP4A 2NY1D 3OX8B 4PJBA 4PJ5B 1K8DA 4DOHE 3LH2L 5GS1A 4QCIB 2Y36H 4XNZB 3S3JA 1OGTB 2ICEB 5SWSE 1HWGB 2JIXD 2ICWB 5FGSA 3MUGA 1V3MA 1DBKL 3DNKA 1VFAB 1YECL 3P9MB 3U6RB 1J87A 3HLAA 4OFVA 3H3PL 3MRCA 5K9OB 2M8XA 4NC1E 2YPLB 1GIGH 4X7FC 1B88A 5JIPA 4U1HB 3IF1A 1A21A 1DUYB 1LE5B 3QR2A 3QXDB 4YFEA 3LQMA 4WVRA 3CFKA 1F3JA 3PGCB 4O58H 4OZFG 3G9AB 3GUTB 5ESAA 2D03L 2VQUA 1MRDL 5H37H 4CJ0A 1J0YA 1SM3H 1FN4B 4YWGL 4XPBH 3A6BL 3HE7B 4PJDF 3I6KB 1J0HA 3LDBB 4MA8L 1UB6A 3MACL 4JVWA 2IG2H 4GRMA 1YN7B 5D93C 5HVHC 5FUOL 3SO3C 1HHJA 2BP3A 2IPTH 4G6MH 3LIZL 3PGDA 4U2ZA 1J5OH 2H32B 3NZHH 1QFWH 4UT7H 4YHYB 3CLFH 4ZQKB 2HVKA 5IB5A 2AABL 1QD0A 3LKPA 4G8EA 2P5EB 5DS8B 3NN8A 3NVQA 1CFSA 3ZE0F 5J11C 3S37H 1KG0B 1L7IL 4FQJH 1U2HA 3MLVH 4QHUA 5E24E 4P5TD 4F7EA 2Q8BL 5CUSL 1QSEA 2BVUA 3DX6A 1N5YH 2Z9TA 1EZVY 1TCRA 4N9OB 3D2UB 3L3DA 2OR9H 4HKBB 1GC1H 3ULVH 3MRFB 5T3XD 4LCWE 1PJ9A 2YXFA 4YDIL 3RJQB 1QFPA 4PJHF 1OD9A 3U7YH 4HK3J 1ORQB 5KBNC 2BDNL 2DQTL 1T7WA 4OV5B 1AXIB 5B39G 4FQLL 3IB4A 1M05B 1NFIA 3ULUL 1VCAA 3U46B 2ARJQ 1FL6B 4N8CH 4JO2L 4PRPA 5I1EL 1WF5A 4JM2B 2J88L 3NZ8A 4ODBD 3QUMB 5DA0B 5A2KH 5I8CA 2DD8L 4UBDC 1AI1H 1EMTL 3OTTA 5BQ7B 3DTXB 3S9DB 2VXTH 1A4KA 5C3TA 1ZLVH 4P23C 4XCEB 1ZSDA 5ETUB 4OBSA 4CL7A 1INEH 3QEQA 1RFDL 4G6FD 1YEDA 4J7RA 4OJFL 5HHPB 2Z91B 1JF5A 4BFIA 3SY0A 4KUZL 1U8MB 3CSPA 5ICYA 5FCUL 2Z31D 1R3LA 2A6IB 1S7QB 5KN5A 3L3GA 3UJTL 4U6VH 5L2JA 4ZXBD 4M61B 1CFBA 4L4TB 4C56D 3ILQC 4RMRA 1YQ2A 3HPLA 5F89B 5GGRA 4HDIB 5F1NA 4RWYH 3QPQC 1MY7A 3QA3B 3MYJA 4KGJA