2CXKA

Crystal structure of the tig domain of human calmodulin-binding transcription activator 1 (camta1)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
87
Chain Sequence
SSGMVTDYSPEWSYPEGGVKVLITGPWQEASNNYSCLFDQISVPASLIQPGVLRCYCPAHDTGLVTLQVAFNNQIISNSVVFEYKSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords calmodulin binding transcription activator 1
publication title Crystal structure of the TIG domain of human calmodulin-binding transcription activator 1 (CAMTA1)
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 15
structure length 87
sequence length 87
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01833 TIG IPT/TIG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cxkA00
1T1ZA 2X2YA 3F12B 1LWRA 2DLFH 4PJCB 2DKUA 3KYMA 3JV6B 4PB0L 1XGRB 4JFPB 4XB7A 4JEGB 3ZTNH 3D2UD 1EGJA 3GBNL 2CKBL 4XPFL 3TIEA 1A1NB 1AD9A 2B20A 4XMPL 1SBSL 1BBDH 2XTJC 2ADIB 2XV6B 1OHQA 1YYLL 3W2DL 1E4XI 3BMVA 1MI5D 2KUTA 1VHPA 5INDA 1SM3H 3WKML 1ZVHA 1DBAH 3TNNA 4MJID 5MHSE 4G9FB 4F33A 4LCIH 3MV11 2CDEA 3QZWG 3DMMA 3ROLA 3BUYB 1D5IH 4GLRH 4OF6A 4KKAD 3GKWL 2XTJB 4UINH 1OP3H 3HFML 1JYNA 2IH1B 2EDYA 3VXUA 3FFDA 3K1KC 1FPTL 4OGAD 4Y1AB 4PJ9D 5FECB 3AXLA 4NT6A 5A3ID 1SEQH 4RMUA 2EE3A 3BGFC 3RPKA 3WFBL 2V9TA 5IEHA 3VFRA 3KPLB 1BZQK 1KPRA 4JY5L 3B2VH 3UC0L 4CN1A 2GI7A 5IMLB 1TNNA 4JANB 3U7AA 4AZ8A 1KF9B 4NQDD 5KN5A 4PJHA 1CFTA 3VXRA 3NCYP 4CN4A 4MA8L 4P4RA 3L7EA 5FYKH 2IH3A 1MFEL 1M7DB 1CXHA 3JTSB 4XXCC 4GG6F 1BVLB 3L5HA 2E9BA 2K7PA 3MRBB 4PRNB 4RAUB 4X6BB 4UDUB 3BGFB 1P6AB 2X9YA 1H5BC 1OQOA 2XFXB 2CDFA 4PUBL 2XXCB 5DJ8A 5T1LB 5JZ7C 5L2KE 4HZAA 3VDBA 1MOEA 5B4MC 3CXDL 4BZ2H 4WI2A 3UTTB 1WBZA 4OIIL 3HC3H 3O2DA 3BKCH 1TIUA 3ALXA 4PJIE 1A3QA 5DD0H 2XWTB 3FOLB 3MA9L 1BF2A 1PG7W 5CJBA 3ZE0E 1N2RB 4JFQA 2NLJA 4LARL 1FNFA 1H5BB 3U30C 4I3SL 3SKJL 3KGRA 4KDTA 4XCCH 1T3FB 4HWNA 4R6UA 3ZE2E 1CWVA 2NXYD 3K81A 3ZYJA 2UWEB 1RZIA 2XN9B 4LGRB 3WFHB 1BF8A 1L6XA 2EDXA 3BD4A 4PB9L 1ZLVK 3MRFB 1YJDC 1G9NL 2NY4C 4MQXD 1A6VL 1A5FL 4PRHA 1NMAH 3BP4A 4FQJL 3QQ9D 1BJ1J 1C12A 4QHNA 1RIVL 1ZMYA 1DVFA 1UM4L 2D7OA 3VRIA 2JCCF 4Q2ZB 4WUUA 1XF5B 1K3IA 2B4CH 3UPRB 3U30B 5GS0D 3CXHK 1IEBA 5JOFB 1FH5L 1KN2L 1E4XL 4EDXA 3MBEC 5D6CB 3QUZD 3KPPB 5EN2B 1IBGH 5GSRA 4ELMF 5K59E 1DQLH 2FIKB 2Y5EA 1RURH 1XIWB 2LAAA 4HXBL 2F53B 3H2WA 2NY4B 3B3IA 5DEZA 5GGVY 3DURA 3KR3H 4X9IA 1NMBH 3BZEA 2R1YA 3LD8C 3SCMA 1XGYL 1OTUC 3FB6A 4M3JA 2Y06L 3DVGB 4L29B 5HHQB 3MBEB 1D5BA 5ICYB 3HG1E 3IDGA 2J5LC 4J8RA 4RCAA 4J12A 5GISH 1DJSA 2NW2B 1DQQA 2H3NB 4A2LA 1G9ML 3SKMA 5HGDB 4KTDL 4EI6B 2OLDA 3LD8B 3PNWB 1ED3B 3U7YL 1FE8H 5I1LA 3BIKB 2VXQL 1B4RA 1Q94A 1VGKA 2J5LB 3DV6B 5D1QD 3PL6C 3CAFA 2BNQE 4MQTB 3SY0A 1S5HA 1BZ9A 2V9RA 3KPTA 4F7TB 2YPVH 5ACLA 1M4KA 3LKRB 2XWJB 1KG0A 2EIEA 3ZSTA 1IEAA 4I2XB 1PLGH 2VLKE 4OF3A 4JO1H 1MHHA 4MDJB 1BFTA 3G6JE 4PJAA 4D3CL 5KZCD 3WFCL 5KTEH 1RMFH 4JPKL 3R8QA 4NKQB 3KHOA 3HA0A 4U3HA 3DSNA 4D8PA 4OD3L 5CEZH 4JQIL 4P23D 4HUWA 3RWEB 43C9A 4F37K 2LV4A 3PL6B 4PYHA 2VE6B 5DLMH 2HFTA 4NO0A 2X6MA 1DSFH 4U3CA 4UOJA 1GRWA 3B8YA 2WQRA 5SWZE 2ZPKL 3KYMB 3ARZA 4WFHD 5DGQA 3FJTA 3FN9A 5HVFB 5BW7A 1ZLUH 3JWOC 2XT1B 3IDXH 1Q9KA 3DMMC 5I75C 3S9DB 2R0ZH 4WEBL 3TIEB 1C1EL 1AD9B 1QO3B 4EOWL 1L9MA 3OKKB 5HI4D 4GBXA 5INDB 3JWOH 3ALPA 4QRTA 1T6VN 5HDLA 2ORBL 4HUUA 5GRXG 3TNNB 3MRJA 3PDGA 5C0BE 1ORSA 3BJLA 2ID5A 1BPVA 3LMJH 2CDEB 3ROLB 3DMMB 5I75B 3QEQA 3EHBD 1CDIA 4G6MH 3EKCA 3FFDB 4HKXA 4UB0L 4IRSD 4ONFH 1OGTB 3K4DA 4FFWD 4OFYD 4WI5A 2HYMA 1INQA 3AXLB 4ORZC 4NT6B 1EH9A 2HT3C 1CDJA 4J23A 1OAZL 4HMEA 5FUOH 1QSED 4LIQL 5DRNA 5IEHB 4CUCA 3QRFM 2EYTB 2YS4A 3TBTA 1N0LA 3VFRB 3EZJB 1KPRB 5KVDH 2AK1L 3A6OA 5KN5B 4JR9L 1HWGB 1U2HA 4Z0BH 3D69A 4PJHB 5C7XH 1CFTB 3E6FA 3VXRB 1G1YA 4P4RB 2PW2A 3L7EB 4QOKE 5E8OA 4ZAKD 2IH3B 3CSYA 3EJYD 1CLZH 5IKCA 2QQLL 2VSDA 3OG4B 3T65A 4HIIB 1NCBL 2VDNL 4ZNEA 3V9FA 4AL8L 3E0GA 1WZKA 1RSFA 3EJZD 1UG9A 3LKPB 1QYGL 4KDTC 4PRID 4NM4H 2W07A 4BSVA 5E03A 4IIQA 3U1SL 3P30L 1J05A 2HTKD 3SE3A 4LNVA 2YKLH 3NACH 1WBZB 1R5VA 1OY3B 5ITBH 1UJTA 4DQOL 3OJDA 2FJGA 1QR1B 1DVFC 4GG6E 3VFTA 3AAZA 4YDKH 3MRKA 4O2FA 3GEWB 4JFQB 2NLJB 4PJCF 5L6YL 4FQCH 2NXZD 2DIAA 3ET9F 4RGOL 3I84A 4KPHH 1BQLH 1QFOA 1HNFA 2Q87A 3DUUA 3BKYH 4YHMH 3F6IA 1RZIB 4H88L 4R4FL 1KCVH 2IG2H 4OZFA 4Z5RA 1RZJC 1UM5H 1HH9B 1JHKL 4NFDA 4PJ5D 4YEFA 1KJ2A 5C8JA 2FGZA 4PRHB 3BP4B 1V5JA 5DJYA 1A9EB 3OXRA 5HYJD 4QHNB 2YA0A 4WHYH 3AREA 3AU1A 3UXFA 1AE6H 1DVFB 4Y16D 3VRIB 3O2WL 1AY1L 1KYOJ 1KB5A 1MHEA 1WF5A 4GLRI 4QXTA 4WUUB 3SCMC 1A6TB 1ZT1A 1IEBB 5TDOA 1E4KA 1NAML 3S35H 3MV9A 4EDXB 1RZJH 4M8QA 4U6TA 3UTSD 3VH8A 3IFPA 5GSRB 1CFVH 3TIDA 4WWKA 2I9TA 2NTFA 3B3IB 4HUKB 3DURB 3RTQD 3VXME 1S3KL 3MSPA 2GJ6A 1BIIA 3P3YA 3KXFA 1KGCE 4QLRA 3BZEB 2XACC 3D39A 3HKFA 4L1HA 2JCCE 3SCMB 1NAKH 2BXYA 4EBQH 4YXLL 3FB6B 2OXGA 4FTVD 2DBJA 1SQ2N 5DMGD 4I3RH 1KEGL 1ORQA 1D5BB 3IDGB 1UEMA 4J8RB 3BDYL 2N7AA 4ELME 2J4WH 1IAIL 1DQQB 15C8L 4I9WE 1RJYA 3TVMA 5BZWA 3SO3C 4H8WC 1Q72H 5CJ8A 1YEHH 3O2VH 3RWCB 4L8CA 5KS9A 5TDPA 4U1MA 2DRUA 2CUHA 2LTQC 3QO1A 4HT1H 2Y07L 1C8PA 1DL7L 5I1LB 1F02I 2EDNA 1YEIL 5HYSG 1Q94B 1VGKB 3CFCL 1PG7L 3ARTA 1JTPA 5F1NA 3SY0B 4AT6B 1BZ9B 1QG3A 4LK4A 4HULB 5IT2H 1RZGA 5DUBA 3L3IB 3SO3B 4JO4L 1KG0B 1IEAB 4FG6D 1MHHB 5BW7C 4PJAB 2DLFL 2LTQB 5KG9A 1UH2A 4I0CC 3ZTNL 1JNLH 4D8PB 3FB5A 3MFGB 4HUWB 1UACH 43C9B 2KL6A 5F7WC 4OAWA 1T7ZA 1CR9L 5CP3A 4NO0B 2UWEF 3VFOA 2WWKO 1BBDL 4JRXE 4GBXC 1XF2A 3O0RH 4C83A 1JN6A 1B4JL 5SWQA 1SM3L 4M6OH 1NLBH 4M1GL 1Q9KB 5TF1L 5JNYA 5H35A 2RQ8A 1DBAL 1JWUB 4R96A 3QBTB 4WGVB 3RA7H 5F7NC 1J8HE 4URTB 4LCIL 1D5IL 5FUZL 5FUCE 2Q8AH 4XC1H 1BQUA 4GBXB 2Q3ZA 4Y4HA 1AXIB 4C57C 5DVNA 4QRTB 4FRWA 4KMTH 1HH6A 4HUUB 1U8OA 2IEPA 3UCRA 3MRJB 4JQXA 1X5GA 1ORSB 1SEQL 2MNUA 3RJDA 1KCSH 5EA0H 4X7DC 5HVWA 3QEQB 4LFHD 4KRPD 3B2VL 3CDFA 1IQWH 5A1AA 3T1FB 4HKXB 4KROC 1S7WA 3BPLC 3DIFB 1YZZA 5C2BH 1INQB 5HPOA 2HMIC 1GGYA 5FYKL 1T66C 2X4QA 4JFDD 3QDMD 3X3GL 5T1KD 1CT8A 4J4PA 5DRNB 3PP3K 4L9LA 3TBTB 5C0RH 1NKOA 1T1XA 4JFED 4XPGH 4IIQC 1U8IA 4Y5VA 3D69B 1PJ9A 3SE3C 4NC2B 3E6FB 3MLSH 2DI9A 3BN3B 4U1HA 4NN7C 2PW2B 5E8OB 1NUGA 4POUB 3CSYB 3WO4C 4D9LH 3CLEH 4KROB 2R2HA 2UY7A 5IKCB 4BSJA 4BZ2L 2O93L 3T65B 3HC3L 3T0WA 4MAUH 4RA0C 5KSBE 1MCWW 3BKCL 4TNVK 3HRZA 5DD0L 4ZMAT 2EDHA 2DKSA 2IALB 5DFVD 2P47B 5SX5K 1EBPA 1WSST 4BSVB 5E95B 4IIQB 4CRPA 1SEBA 1J05B 4XCCL 1JNHA 1FZMA 3FMGH 4NN7B 1R5VB 4W6YB 4CADA 2JIXD 3WO4B 3OJDB 1P9MC 4MXVF 1ND0B 3TT3H 5IMKA 1YN7A 1CQYA 5L88H 3AREC 2FJGB 5E9DD 3VFTB 3AAZB 3NFPA 3MRKB 1IM9A 4O2FB 2E7BA 3HPLA 4X4XA 4P4KD 3QCUL 1JRHH 1E4KC 3O8XC 3QCTH 4OZFH 5T3ZH 2B4CL 4M5ZH 3VJ6A 1KJ2H 1LDSA 2CIIA 4Z5RB 1JGDA 3E2HC 3DI2B 2AXFA 4HEME 5C9JA 4WWKC 1KJ2B 1FNLA 3ARDD 3G9VA 5C8JB 2B1HL 5DJYB 1IBGL 3WNOA 3OXRB 5EBLA 1FGNH 1MY7A 3QUYD 3WE6B 3AREB 1RURL 3AU1B 4D9QE 1OT2A 3SQBA 3MRPA 1KB5B 1AI1H 1HXYA 4QXTB 5F44A 1MCOH 3KR3L 4ISVA 3LKNA 3C5ZD 1ZT1B 3GSVA 4WU7A 5TDOB 2V17H 3O8XB 4PJCE 4XNYH 1NMBL 1QFWH 2B5IC 5HD8C 2ED8A 1CTOA 4M8QB 5ABDE 1QSFD 3VH8B 5MEOA 5EIVA 3IFPB 3E2HB 3VU2A 1TCRA 2IBBA 2A0LD 4WWKB 2I9TB 2NTFB 3GK8H 4DGVH 1E4WH 2ZOKA 3M8OH 3TVMC 3BI9X 4PRAA 1UXSA 2GJ6B 1BIIB 1CGYA 5GISL 3V6FA 3KXFB 3TP4A 1J1XL 3ISWA 1G0XA 5CJQH 4OCNC 1EUUA 3D39B 4XT1C 1YPZA 4CJ1A 1R3LB 4LPVA 4X5WB 1IAIM 2OI9C 2W92A 1Z9SA 1VFBA 3U4BH 2B5IB 1ORQB 1FE8L 1FV1A 1PVHA 2Y36L 1TQBC 4G9FE 2OTUA 4QTIH 3IVKB 4D0DB 2DLHA 4GS7C 1OAKH 1RJYB 4PJHF 4XTRD 3TVMB 5BZWB 5J8OA 2P8MA 4HWBA 4JN1H 2XTJE 3UDWA 3PP4H 5TDPB 4PJ8D 4G43A 4U1MB 1J18A 2YPVL 5FO7B 4H0HB 5D1ZA 2OI9B 3QO1B 3UTPE 1PLGL 4Y1AE 1OB1A 3DYMA 4JO1L 4XCEA 5KTEL 1RMFL 1TQBB 3EIFA 5F88A 2PUQT 3O4LD 5CEZL 4GS7B 3SKOA 3VFPB 1RZGB 5DUBB 3T0VA 3PE9A 5DLML 3O6KH 3MRDA 3HB3D 2FL5A 1DSFL 4I0PD 4MCZA 5E1HB 3RWFA 5KG9B 4MAYD 5FYKE 1KXVC 2E27H 4NZJA 1GHFH 1RZ8A 5CEYB 3WN5C 2Q8BH 1U8PA 3IDXL 5CP3H 2MCG1 1L6ZA 3OKNA 4NUJA 4OAWB 2E7CA 2R0ZL 1U3HC 1EMTL 2X9WA 4ZTPH 3VFOB 4WFED 1UGNA 4Y4HC 1XF2B 4XNZC 3UTTE 4C83B 4B7IA 1EUTA 1JN6B 4ZPTA 5SWQB 4H1LA 1OGAA 1F8TL 3JWOL 3IU4H 4JQXC 3MNZA 5IW6A 4OT1H 5JNYB 5H35B 2GYSA 4JRYA 2VXUH 4R96B 3WN5B 1MNUH 1ZAGA 4TTGA 3LMJL 1U3HB 4JPIB 3SEPA 2OR8A 4FQLH 5C0AE 4LLUB 3O6FA 4G6ML 4Y4HB 2UWEE 2XN9E 4U49A 1NFDA 4XNZB 3UX9B 1OPGL 3OHXA 1WICA 4ONFL 3CSPA 1U8OB 1I9RH 5I0ZA 4L9LC 4I77L 4WNQA 1KCRH 5FUOL 4Q7DA 3DV4B 5DO2C 2XQYG 1TVDA 3B5TA 4QRRA 4Y5VC 1CXKA 4LRIC 1YECH 1ZT4A 2EDEA 4JM2D 4KJQC 3RP1A 1T89A 1XGPA 4Y2DD 1QBAA 4Z7QF 1QRND 1AKJD 3C6LC 2FJHA 3QEGH 4Z0BL 1S7WB 5EH1A 5C7XL 2QEJA 4PFEA 5T3XD 1ZVYA 2UZIH 2X4QB 4XWGH 2F53E 5CKAA 1KIQA 1CT8B 5EOTA 4L9LB 4QRPD 1DR9A 1T1XB 5JIPA 3IJHA 4HIXH 3VG9C 4Y5VB 1PFCA 2OK0H 4NM4L 3V5HA 4QHLA 5EIQA 1PEWA 5TE7H 2R2HB 3NCEB 3ULVC 4PLOB 4Y2OA 3WEXA 1F42A 5ADPH 2YKLL 3NACL 5ITBL 4ZUVA 3PQYA 1NGXA 3UYOD 2PTUA 3N1QC 3TPUA 4JHAL 1QKZH 1T2QH 4F58H 2N4IA 3BKMH 4YDKL 2Z31A 4PRPD 4PJAF 5E2JA 3NFNA 4FQCL 3VG9B 1SEBB 4ZUUA 3TA3D 1JNHB 5DJXA 3ULVH 1FZMB 4M02A 1PQZB 2Q76A 2E3VA 4KPHL 4NSKA 1BQLL 4KQ4H 5E99H 3V0WH 4CADB 3BKYL 4YHML 2AI0H 1ACZA 5B39A 1KCVL 2IG2L 3KYNA 5IMKB 2VDQH 1OAQH 1UM5L 1YN7B 1TFHA 4M6MH 5GGRA 2HT2C 3MBXH 1XGTA 3VCLA 5I1KH 3HPLB 3JV5A 1S5IH 4CJ0A 5DDHA 5DVLA 4X4XB 1AE6L 4X9BA 3ULSA 2D9QB 3JWDC 1ZA3A 3MRQA 4I2XE 2VWEC 2ZNXA 3LZFH 2DM4A 3VJ6B 1NANI 2A77H 5DHVA 5FO9A 1JGDB 2AXFB 1F3JA 3BT2H 3S35L 1RZJL 3VRLF 4YHZH 3DX8A 4RISH 1CFVL 4DTGH 3MRPB 4EI5A 4X6FA 5CEZE 3JWDH 1XZ0A 5IWLA 3GB7A 4ISVB 1NDGA 3LKNB 4R9HA 2MQ3A 1SMAA 3GSVB 4WU7B 1NAKL 4EBQL 2EDWA 3P4MA 5E94A 1ZGLP 1QVOA 4H25A 2DYPA 5A16A 3EDJA 3K8LA 1TCRB 4I3RL 3THML 1GGUA 5GRVK 4EZMA 2AQ2A 2ZOKB 5FK9A 2GTZA 4U05A 4PRAB 1UXSB 4ETYA 3V6FB 2CRMA 2J4WL 2MPAH 4O58H 3UDWC 4YHYC 2M1KA 1W2KT 1YPZB 4XCNA 5D1ZC 2P42B 1Q72L 1NUDA 1YEHL 3O2VL 2YC1B 3W0WB 4KUCD 3CK0H 3CZFB 1VFBB 4LP4A 1FV1B 1AXTH 4HT1L 3V7MA 3VFUA 4L3EA 2OTUB 1GOFA 5GJTH 5DK2A 4HMDA 1MRFH 1I7RA 2P8MB 5B8CA 2AQ3A 1L0XA 4OF8A 1S7RA 4RGMC 4YHYB 5IT2L 4G43B 1JV5A 2HLAB 5D1ZB 5I17A 3ZO0A 2VDLH 1OB1B 2FEDC 1IGYA 4ZO8A 4XCEB 4YDJA 1JGVH 2AAVA 5TGBB 5F88B 1JNLL 4O2CA 3TBYA 4XMKH 4KK5D 4TVPD 1UACL 1JRHI 1EPFA 2Q86A 1MQKH 4CVXA 4RGMB 4PJHE 1W0YT 4HPOH 3MRDB 3VXRE 2FL5B 3TN0C 2PYEA 4MCZB 5C9KA 4ODUA 3ORJA 1CQKA 3RWFB 4X9HA 1WZ1H 2Z8RA 3O0RL 5CGMA 5EZOH 4YXKH 2UZYB 4LEOA 1RZ8B 2E8ZA 4DZ8A 4M6OL 1GCFA 1NLBL 1CDCA 1QPPA 1U8PB 3RIFF 1MCKA 3OKNB 4NUJB 2ZCKH 3PWVA 5HY9A 1P84J 3QDJB 2Y72A 3WLWC 4XBEH 2NY5H 3TCLA 3O6FC 5BV7C 3VXSD 4X83A 4H1LH 1QFWI 1FYTA 4ODTH 5DJ6A 2Q8AL 3HN3A 4PRDA 3TN0B 3QEUA 4XC1L 2HT4D 4H1LB 1OGAB 3DETC 5IW6B 3NN8A 4KMTL 4JRYB 2COQA 4QO1A 4L8BA 3B9EA 2NQCA 3EGSB 5EA0L 2C1PA 3QO0A 5IROA 1T89C 2IANA 3HTLX 4MA1C 3SGKA 4UBDC 3O6FB 5BV7B 4JHZA 1IQWL 4RAVA 1NFDB 4JVWA 3OHXB 5HGAA 5C2BL 4PRHE 5IVOA 4Z8FH 4WNQB 5HHOA 3CLFH 3Q0HA 1MCNA 1FFRA 4WUUE 4QRRB 5C0RL 1KTDA 2DDQH 1MWAA 4NJAH 4OUUA 1ZT4B 4WI8A 1XGPB 2ILLA 4XPGL 2PXYD 4MA1B 3D1MC 4Y4FD 5I6XC 3NCCB 3MLSL 4Q74A 3LPFA 3TZVD 1JNNH 4D9LL 3CLEL 4U1IA 3REVA 2JE8A 1KIQB 2QQQA 5EOTB 3S3PA 4XAKE 2YMXH 4MAUL 3T04D 2Z31C 4RRPG 2EZ0C 2W59A 3IJHB 2EDLA 4XP1H 1D5ZA 3V5HB 4QYOA 4TSAH 4QHLB 3HHRB 4C55A 2H45A 2WBKA 5I6XB 3RY6C 1JE6A 3WEXB 1AQKH 2X89A 3FMGL 4Z7QE 3GMOA 2X4PA 4ZUVB 3PQYB 4LHUA 2E9WA 2ZUTA 3TJHC 3QUKA 4GRWB 5J1AB 3TPUB 2P44B 4WEUD 3TT3L 5L88L 3TF7C 1KJMA 3GHEH 2VXTL 3GSNA 5HGBA 2Z31B 3NFNB 3AUVA 5JIIA 1JRHL 4ZUUB 3I50H 3QCTL 5DJXB 5TF0A 1CDBA 3V4PH 2Q76B 3UZEA 4JGUA 4NSKB 5T3ZL 1ROWA 4M5ZL 1T22A 2CDGA 4OCLC 3QT2A 3C09B 2EDJA 5B39B 3KYNB 3P0VH 5E8EA 2FHFA 2ZSWA 5GGRB 1XGTB 3SGJA 3VCLB 3QG6A 3RNKA 1FGNL 5IWLC 5DDHB 1RHHA 1A7QH 4GKOA 4M1CD 4G7VH 1O7VA 4ENED 4LPYA 4Y8DC 4YDVA 1AI1L 3ULSB 3MLTA 3RU8H 1ZA3B 2WLZA 4HSQA 4PJDA 2EICA 1RHFA 1MCOL 2EXWD 1MCDA 1F2QA 4FA8A 2LU7A 4PJAE 2V17L 5DHVB 5FO9B 3D0VB 4XNYL 1QFWL 1XAUA 2BSTA 4HLJA 2V2XB 1T5XA 5AUMA 2OM5A 3DX8B 1RUMH 3WSQH 1A7NH 4RFOH 4U1GC 3TO4D 3B83A 2W0PA 1X5KA 3GK8L 1NGWA 1E4WL 3M8OL 4X6FB 4DGVL 3RHWF 3C6SA 1XZ0B 2BNRA 2H41A 3OMZA 3GB7B 5LBSL 1NDGB 2UYLA 5CAYB 5CJQL 5A43C 3MRMA 3L3KA 2NY3C 3P4MB 5E94B 3GMNA 1QVOB 2ZSVA 4H25B 2DYPB 5A16B 2HFGH 5BVPH 5CBAA 1B0GA 4RZCA 3U4BL 5MHSD 2BY1A 2C9AA 2AJ3A 3ZKMD 5FK9B 3VRLE 4U1GB 5F93C 4WGWB 5B8CC 3T4YA 4LSSH 1OAKL 4M6AA 4ORGA 4GRLC 4PGZA 1YEFH 5CJOH 5TE6H 4XCNB 1TZHA 2DQHL 3K74B 3EDEA 4JN1L 4PGDA 5JQ6H 3PP4L 4AQOA 1KV3A 2NY3B 4NQEA 3EYOA 1WZLA 3VFUB 4L3EB 4PV9A 1CD9B 2BVEA 2F58H 1BHGA 3QH3A 5DK2B 2GHWB 3QEQE 1T20A 1I7RB 4MYWB 3EAKA 5B8CB 5BJTA 1S7RB 3ABZA 2P5EA 3KJ6H 3B2UC 1JV5B 4NNXB 1ITBB 5I17B 5HTSA 3O6KL 5I1HH 2CLZA 3IT8D 4YDJB 5FGCB 2YN5A 4O2CB 4KK9D 3STLA 1GHFL 5E5UB 3TBYB 4L5FH 2Q8BL 3QHZH 4FXGA 1DBBH 2WSKA 3NIFE 5L2KD 2Q86B 1R0AH 4JRWA 4CVXB 4ZTPL 3ULVF 2PYEB 3AROA 1SJVA 4O51A 1AGDA 3P11H 4K7FA 5E6IA 4QWWD 3ZKXC 3CFIC 4AG4H 4BQ9A 3VI4F 2GK0A 4LEOB 5C0FA 4ZNEE 4DZ8B 3BN9D 2D31A 5DHXB 1QLEL 3IU4L 1D5XA 1X6LA 2F15A 4IOFD 5I2IA 1BVKA 3QIBD 4OT1L 2I26N 3PWVB 5HY9B 3N85H 3AC0A 1TVBB 2VXUL 3KWWA 5IROC 3NVQA 1MNUL 3IF1B 3TM6A 3WIHA 5IM7A 3SGKC 2L7UA 3TCLB 2LVEA 5EWIH 4AENB 1FYTB 4FQLL 5DJ6B 3TYGH 4ZOAA 4CVZA 3ZKXB 5CZVH 3MLPA 4A2MA 1CGTA 3NN8B 3FO9A 4Z95H 4LSVH 1I9RL 1KCRL 1DUZB 1A7OH 1QBMH 3WL9A 2C1PB 3QO0B 1UA6H 2XYCA 2IANB 3MCLH 1YECL 4I1NB 4RAVB 1Q0YH 4D0BB 4P3CH 3V0VA 5HGAB 3QEGL 5EORL 2AXGA 2J2ZA 3KLAA 1A22B 2UZIL 4XWGL 1CLCA 1QD0A 3L5JA 4CDHA 5HHOB 1MWAH 1YPZF 1R3JB 5HYEA 2WMPA 1KTDB 1MWAB 4IMLA 1I8LA 4HIXL 3LQAC 2HFFA 3EOBB 5FYJU 2OK0L 1OTTC 3HG1D 5ACZA 3PGCA 5TE7L 2C7UA 3FOMA 4U1IB 4QHMA 3REVB 3WXWH 4J3OC 4XXDA 1U8MA 3DUHA 2ARJA 5ADPL 3TFKD 2ZUWA 1DTUA 2V9QA 2GJ6E 1AC0A 1YMMA 1UB6A 5GGVH 3KXFE 3LIZH 1QKZL 1T2QL 2WUCH 4K8RD 3D39E 5AG8A 3BKML 3LQAH 1D5ZB 4QYOB 2YRZA 1WT5C 2X44D 3BD5A 1UCBH 3ULVL 3TT1H 3GMOB 2X4PB 2VL5A 4KQ4L 5E99L 2WAHA 4LHUB 2AI0L 3ARGA 3GSNH 2YK1H 3QUKB 2BNQD 3SGJC 2VDQL 4CMHC 4M6ML 1KJMB 5LJYH 3MBXL 3GSNB 5HGBB 1NSNL 4MA3A 5I1KL 1S5IL 2VLKD 2DF3A 3VW3H 1R3IH 1C5CL 4W6XB 1LHZA 4ZTOH 1T22B 2CDGB 2N7BA 2A77L 5E8EB 4GW4A 2ZSWB 3QNXA 3BT2L 1P4BH 5J3HD 2XICA 3FQUA 3QG6B 1QFWM 2ZG3A 3PP3H 4RISL 3RNKB 4DTGL 1OTSC 1I9JH 3T0EA 1RHHB 4CMHB 1AR1C 3K4AA 1KN4H 1IC4H 3MLTB 1F3DJ 3WNMA 4PJDB 4WCYH 4KY1H 5SWZD 3OPZH 5FGBA 3ZYIA 1OAYH 3ALWA 3FAWA 1U58A 1Q9OA 1AH1A 1BM3L 4DKEL 4E0RA 5EU7C 2BSTB 2ZKHH 5ETUA 5F3BA 1T5XB 2DJUA 4WHYG 5I9QC 1YEEH 1RIUH 4BZYA 2Y23A 1NGWB 5CMAA 2YHGA 2VN7A 4MNQE 5SX5H 5T33H 1KB9J 4JZJA 2UYLB 4OKVA 1NFDF 4OFPA 4ACPA 3MJ6A 2D7NA 2P46B 5JORA 1I7TA 4BFEA 3MRMB 3L3KB 1NH6A 4AEEA 3GMNB 2ZSVB 5LGKA 3CMOH 3CK0L 5CBAB 1IGCH 1B0GB 2DI8A 4RZCB 1E27A 4WVRA 1AXTL 5C0BD 2AJ3B 1GC1C 1FZJA 1BX2A 3DGCR 3FT2A 4FFZH 3S37X 4RFNC 5I9QB 5SWSA 3T2PA 5MENB 1A6AA 3T4YB 4F37F 1DN0A 5GJTL 5DQJA 4ORGB 1D9KA 1MRFL 1E6OH 1TZHB 3I9GH 5ICXA 4PGDB 5J0BA 3WV0A 4N1CA 4KVCH 1BOGA 1B0WA 1XMWA 3BH9B 4WIQA 4O02H 3KS0J 4NDMA 4C58B 3B5HA 3EYOB 4K9EC 2VDLL 4G5ZH 5KSVA 4PV9B 1YEGH 1JPFA 5FDYA 5D1XD 5GSVA 1JGVL 4RFNB 1T20B 2Z91A 5BJTB 3F62A 4XMKL 3UPCA 2P5EB 4L4VA 1LO4L 4GMTH 4QOKD 1MQKL 4LPUA 4LSTH 2DL9A 1TLKA 4HPOL 1TJIH 4P5KA 4K9EH 3WNLA 4GRWF 1DBMH 4KI5C 3D3VA 2CLZB 2KZWA 1WZ1L 3IJYA 5CHNA 1U95B 3NCJH 5EOCH 5EZOL 4YXKL 3N1FC 3ZHLA 3STLB 2VLRE 4LVOC 1ETZA 5DYOA 2ZCKL 2F54A 5INCA 2IC2A 4YFDB 3NFSH 4LLYA 3SO5A 4DUWA 4NWTH 3OKLA 4XBEL 2E6QA 4L4TA 1ZGLB 2NY5L 1AGDB 4K7FB 2Z8WC 5BRZA 5E6IB 3IKKA 4ODTL 1P6FA 4YH6A 3QXTA 4PGBB 4UILL 5D93C 2YEZA 1IC7H 5C0FB 4BA8A 2D31B 1D5XB 2DM7A 1W72A 5I2IB 1BVKB 4LVOB 3A6CH 5GS2D 5IM7B 1QPXA 4Z7VA 3OR7A 3QQ4A 2NY2D 1I8KB 3RVVC 1Q1JH 5ERWA 3WFDH 2GSIA 4CVZB 3ULVE 4Q9RH 4RMSA 4BQ6A 5D93B 5I1CH 2NZIA 1IGMH 3IFNH 4HXAH 5FDWB 3VI4E 4Z8FL 1G7QA 4DAGH 1NC4D 2AKRA 4F80A 1WFTA 3CLFL 3O9WD 1I8LC 3ULUC 3ARFA 4UU9A 2RB8A 2DDQL 2XA3A 4NJAL 2NR6C 1CD8A 2LE9A 5EU3A 5ANMA 4GMSH 4BK4A 1R3KA 1IZJA 3NZ8A 3KLAB 4XHJC 3OR6A 2BMKA 4NRZA 4JFYA 1JNNL 4MVBD 3VXMD 4MXQC 2ICCA 3VWKD 1KGCD 3BZDA 4HUXA 2YMXL 4HPYH 4LF3A 3ULUH 2Z35A 3V5KA 5IFHH 1JZ7A 3TLRA 1CXIA 4HW6A 3VFWA 3KPQA 2HFFB 1I9IH 1AO7A 2VWEE 4XP1L 4TSAL 1FFQA 1ES0A 1MSPA 1RUPH 1WFUA 4WFGE 5ACZB 3G5YA 3PGCB 3FOMB 2C7UB 5K9KA 2BHYA 4HGKC 4QHMB 3ARGC 4XXDB 3QG7H 1AQKL 2ARJB 4ZOCA 2WP3T 2G75A 4ONOA 2H6PA 2DQJH 1CDHA 4I9WD 1UB6B 1H15A 3L3DA 3LN4B 3B9VA 5F8QC 1YPZE 1QQDA 2GTWA 3CVIH 4LMQE 3SKNA 4POZC 3W0WE 4N0YH 4Y4KA 3LEVH 4WI4A 1NFIB 3I50L 4LLVA 2HTLC 2IBGA 3V4PL 4OLWH 2VL5B 3MYJA 3D0LA 5F8RC 1GZPA 3ARGB 1P7KB 3P0VL 5HI3D 3ZYZA 2MJWA 4K94C 3HUJA 3T0EC 3KVQA 4GW5A 4UNVA 3DXAA 4MA3B 2CQVA 3MYZA 1A7QL 5FGBC 4G7VL 3RU8L 1T2XA 2XQYK 4GW4B 3QNXB 1BIHA 5L9DH 4K94H 3FQUB 4ODXA 4A6YB 2AEPH 3MC0A 3SE9H 4LHQB 1RUML 1I4FB 4RGNC 2HRPH 4RFOL 3T0EB 4JZJC 4XWOC 3FRPG 4OZFG 1ZEAH 4JRXD 3BZ4A 4N5ED 5DVOA 1U58B 1MIMH 2C3HA 5JW4N 1Q9OB 2XG5A 4E0RB 5CD5C 5HSFA 5ETUB 5F3BB 3UP1A 5I1AA 3STZA 2HFGL 5BVPL 1P53A 4OM1H 3BEVA 1J8HD 4AIXA 5CMAB 2VABA 3QDJE 3B5GA 3N50A 4RGNB 4TTDC 4JZJB 1EVTC 2W0FB 4OKVB 1VA9A 2GQHA 4LSSL 1IRAY 3BP5A 4P9HC 5JORB 1I7TB 2VDPH 1YEFL 5CJOL 5TE6L 4JY6A 3FN0L 4H0IA 3P4NA 3MJGX 2BFVH 5JQ6L 4MJIA 2FR4A 3RPIB 1E27B 4BZ1H 5EPMB 1FZJB 1BX2B 2OL3H 3FT2B 4JRYE 3QZWB 3LKQA 5SWSB 1QBLH 1A6AB 5CGYC 2F58L 5DD5H 1DN0B 3UBXI 5DQJB 2O5ZH 3WLBA 2LU3A 4CL7A 5ICXB 1RU9H 1BOGB 3KJ6L 1NFDE 2OQJB 4TRPH 4NDMB 3VFVA 1WZMA 5JO5A 4GG8A 1BWWA 5KSVB 2WBJD 5I1HL 1JPFB 1JYVA 5GSVB 2YPLA 1CZ8H 2QHRH 3IYLW 4PD4K 1DN2A 4NQDA 1N7MH 2XKUA 2Z91B 4QRRE 2GEEA 4L5FL 4WUKH 3QHZL 2ARWA 1DBBL 4L4VB 1A6ZB 3T8XA 4HK0A 3H3PH 1R0AL 2HG5A 2EDRA 3QQNA 5IV2A 3U2SA 4PREA 1I1YA 4P5KB 4RDQF 1F4WH 3P11L 5CLTA 3IJYB 3MOBH 5CHNB 4AG4L 1S7VA 5ESQA 1G7IB 1CS6A 4HJ0C 1ETZB 5DYOB 2NW3A 3T0XA 2F54B 2P8LB 2VZ3A 3N85L 2H2SC 1LD9A 1MRCH 4GO6B 3OKLB 5F7LB 4L4TB 4R2GD 3EO9H 1KFAH 5BRZB 5EWIL 3D18B 4M4RA 5C71A 1W72H 3NMEA 3TYGL 3MRNA 1J9CT 3PQYE 2YEZB 5CZVL 4GRWE 1W72B 2DIJA 4DJMA 4GJTB 4PJDF 4Z95L 4LSVL 4WFHE 2QADD 4Z7NF 2DJ4A 2WWMD 5IBLC 5AD0A 1QBML 4Z7VB 3OR7B 3QQ4B 1JF1A 2O61B 4PGJA 1N5AB 2PTTB 1AC6A 2VR9A 3BOVA 3MCLL 5ERWB 1ACYH 2MQCA 2E7HA 2GSIB 1P4LA 5HYFA 1Q0YL 3N9GH 4P3CL 1LILA 3SE8H 4D9QD 3S88H 4K3DH 5IVXB 4BUHA 1EJOH 1G7QB 2OBGA 4TNVF 4ZO7A 3V6OA 2AKRB 5I19H 1MWAL 2HKHH 4PJ7A 1CL7H 3SDXA 2C4FU 3W39A 3FB8A 4NM8L 2H26A 2MKWA 3MODH 1JI2A 2F8VA 5EU3B 5ANMB 3MRCA 5D5MA 1HNGA 1R3KB 3NZ8B 1GOHA 5SX4I 2A9NH 2BMKB 3OR6B 4NRZB 1JFQH 4JFYB 1IT9H 2G5RA 3WXWL 1QLRA 2AXHA 2VTFA 4PLKD 5AG9A 2XY2A 4HUXB 4UT7H 4F3FA 4LF3B 1EAPA 2Z35B 5F21B 3V5KB 4OTXH 2GSGA 3ETBF 3LIZL 4G8GA 5GGVL 4ETQB 3VFWB 3KPSA 3KPQB 3SDDC 4Y4KC 4JO3H 3U46B 3LQAL 1AO7B 1V3KA 1FNEA 1ES0B 3G5YB 5K9KB 3BGAA 1UCBL 4U2ZA 1V7NH 3TT1L 4G9FD 2R0WH 2E6PA 3CX5J 3SDCA 5E5RB 1H0DA 3GSNL 2YK1L 4C4KT 1F11A 1H15B 3L3DB 3QXWA 2XTJD 5E24E 3RDTA 1QQDB 2GTWB 2UY6A 4RAHA 4M7LH 3SKNB 5LVEA 3UTPD 4ZOEA 4Y1AD 3SDDB 4Y4KB 3VW3L 3QB7C 5C0EA 4M3KB 5HYSA 1R3IL 5J4MA 1MCLA 3QYCA 4JPWH 3NPSC 3MYJB 2HWZH 3D0LB 4N0CC 5B3JF 1UVQA 1GZPB 2VZOA 4D94A 4AQ1B 4OFIA 5IQ9A 1QZ1A 1P4BL 4GW5B 4U6HA 3DXAB 3RUGA 4FFVC 1I9JL 2KKQA 3CDCA 3O3EA 5FB8A 1U42A 1KN4L 1IC4L 1OL0A 4NRYB 4P46A 4MLSA 4JQVC 5GQBA 4KI5F 4WCYL 4OGXH 4KY1L 3OPZL 1OAYL 2DD8H 5FYKD 1OP3K 4QRQA 3HI1A 2ICWA 5EU4A 3NPSB 2H1PH 4ODXB 2APWA 2ZKHL 4MNHA 4WI6A 5KSAC 3OKDA 1F45A 4HS3A 1YEEL 3L3GA 1NPUA 1RIUL 2W9LA 5T1LD 2OJEA 3ESUF 5T33L 5JDSA 1B88A 1PY9A 3UTTD 4XPTH 4PPTA 4YGAB 4Q6IC 5DEGA 1IJ9A 3EO0B 5I1AB 3CMOL 3STZB 3JWNC 1IGCL 2FDBP 3BEVB 4KDWA 5KSAB 5CUSH 2ZCHH 4FFZL 2VABB 1OD9A 2NNAA 4LVNC 2CIKA 3WXVH 2FGWL 4HV8A 3VG0H 5JZ7D 5C0AD 1FYTE 4ZFOL 2CKBA 2XN9D 1E6OL 3ARVA 3I9GL 4JY6B 5DA4A 3FO0H 3P4NB 3VXPA 4NZUH 2X09A 4KVCL 5E2VH 4YE4H 3AS3A 4O02L 1UADC 3LKQB 2AJYH 2FX9L 2W0LA 4G5ZL 4KVNH 5ILTL 5IHUH 3S37H 3UO1H 1YEGL 5IB4A 3OJMB 3VMNA 2GITA 1IGTA 3ULUF 4MNGA 3IFLH 3CCHA 3LRGA 4LVNB 4WTZG 3WLBB 2IANE 3CJJA 3WDIA 5FO8A 3H42H 1F4XH 1NUFA 3GSQA 4GMTL 2HN7A 1QSEA 3VFVB 5JO5B 4LSTL 3GUTA 4GG8B 5IFAH 1TJIL 2F53D 2NY4D 2YPLB 4L9DA 2HRLA 5HHOE 1FP5A 1XCTA 4EUPH 3NCJL 4NQDB 4JFXA 5C0IB 1SYVB 1JVKA 3T8XB 2VRAA 4HK0B 2VLME 3NFSL 2HG5B 3MBED 3H9SE 5IV2B 4PREB 1I1YB 4NWTL 4DVRL 1KJ3H 1S7VB 1RIHH 5ESQB 1AFVH 1BJ8A 3NA9H 3MQIA 3CC5A 1BQHG 2NW3B 2O5XH 4HUVA 3EYUH 1I75A 3A6CL 1OTUD 4UTBH 5DD3H 4AK1A 1R5WA 4CVWA 4IOSD 4EQ3A 2X70B 3K2MC 5T1DH 1Q1JL 3QWRA 1X7QA 3MRNB 2DB8A 4Q9RL 3BYTA 1L7TH 3V6OC 1DDHA 5I1CL 4NP4H 1IGML 3IFNL 4HXAL 5AD0B 4DAGL 4BJLA 3UEZA 1JF1B 3ARUA 4OV5B 3QUML 5DZOA 3VFNA 2NY0C 1UM6L 3LB6C 3KPRA 5HYJA 1AXSB 1CVSC 3ZLQC 4GMSL 1CU4H 1GSMA 1QUNA 2C3WA 3EYFA 2AV1A 3PL6D 3G5XA 2NPLX 2CH8A 5CEZD 3FQXA 3RI5K 1EHLH 4PJ7B 3SDXB 3W39B 5F9OH 4HPYL 3ULUL 5IFHL 2H26B 4G7YH 4Z7NE 2FZ3B 2KDGA 3WD5H 2JB5H 2OSLB 3MRCB 5D5MB 1I9IL 3GSRA 2GKIA 2NY0B 1RUPL 4ZO6A 5C86A 1CCZA 3SDCC 1QLRB 3QG7L 2WINA 2DQJL 4JDTH 3SGDH 3RDTC 4FTVA 2GSGB 4G8GB 3V52H 1EEZA 5HPMB 3KPSB 5F1SA 3QDGA 4JDVB 3CVIL 4U0QB 4N0YL 3LEVL 5EU7E 2CRZA 5CZXC 1GOGA 1RUKH 4E41A 4U3XA 5MENE 3SDCB 1H0DB 2CJUH 3N06B 4C56A 1I7UA 2R39A 1F11B 3BQUC 4TUJA 1PEZA 1TJHH 2V5YA 3RDTB 1MHPH 4P46C 3BW9A 1X6NA 3AVEA 3HAEA 1MFNA 3UAJC 5C0EB 3BDBA 5HYSB 4N1EA 4C54A 4LPWA 1T1WA 3QSKB 4GKNA 1JGUH 1UVQB 4G6KH 1WV7T 4PJGA 5BS0B 5IQ9B 5L9DL 4K94L 5IOPA 4U6HB 1KJVA 1NGQH 2AEPL 3SE9L 3RUGB 1J88A 3BQUB 3GIZH 2HRPL 3O3EB 5FB8B 2AK4B 3AB0C 2P5EE 3VXRD 4P46B 4ZO9A 1ZEAL 4B50A 1M7XA 3IDJA 1HI6A 1KLFA 4JZNA 1MIML 2HT3D 3HI1B 4XX1G 2ICWB 5EU4B 5F9AC 4MNHB 1WFOA 3OKDB 3EDFA 4FQXA 4HS3B 5F9WC 5HYIA 5C0JA 4Z7VF 4OM1L 3WMSA 3L3GB 5D2LA 5B3JE 2XI9A 1HHGA 3R1GH 2PO6A 1FNSH 1CL7I 1MLCB 3A0OA 5JHDA 1IC1A 3MV8A 5E56A 4B53A 2I9LA 3AB0B 5CJ5A 2YSSB 4NZDA 2BRRH 4YWGH 4HIEB 2VDPL 1NQBA 5IVXF 4KI5E 4S1DC 2PN5A 2BFVL 3ZKSD 1CBVH 3FZUC 5GGSY 1Z9MA 1CFSA 25C8H 4BZ1L 2OL3L 4NQTA 2NNAB 4BQCA 5F9WB 5JR1H 1K4DA 3VMOA 1QBLL 2CIKB 3DX6A 5EUOA 5DD5L 4HV8B 4OD2A 1IQDA 4APQA 2O5ZL 1MCPH 4QNPF 2CKBB 2OTWA 4PBVC 3VXPB 3DGGA 1RU9L 3W9DB 5DR5H 4M8VA 4Z0XA 4PRHD 2EIZB 4TRPL 3PXHA 1DVFD 3RX7A 5IB4B 2GITB 3RL1A 1IGTB 4TYUA 1CZ8L 4WUUD 4MNGB 4X6DA 1N7ML 1B2WH 5D7IA 3L3JA 2VLLA 3QWOB 4WUKL 2AJZA 3GSQB 4JFDA 2HN7B 1QSEB 3H3PL 2QSQA 4NC0B 3HFMH 3GUTB 3MLRL 3EJZC 2DMBA 1F4WL 2NZ9C 1AHWA 4XAKD 1FPTH 3MOBL 1XCTB 5EIIA 3KYAA 5GRVL 3X12A 2HTKC 4NIKB 3SCMD 2BY2A 3A67H 3ULUE 2I25N 3VFMA 2Y4SA 4S1RH 5I71C 3D6GA 3H9ZA 3EO9L 1KFAL 1IAMA 3EFFA 3T0DA 3GMPA 2NY7H 4LLAA 1MFEH 2YR3A 1CXEA 2P48B 3CC5B 5I0DA 3GGWA 4PJBA 3MMEA 4HUVB 1ZSDA 3T4AA 1TQCC 4X4MA 1W0VA 3Q1SH 2GJZA 2YN3A 1R5WB 1Q9WA 4P3WA 1ACYL 1X7QB 4UAOC 5E9DA 5I71B 3CSGA 4I4WB 4KXZI 1I85C 3N9GL 2Y6SC 3Q2CA 1JIBA 4JJHA 1B3JA 3SE8L 1DDHB 3S88L 3AMKA 1GVIA 4TVSa 3ZE1F 4K3DL 1EJOL 3QI9A 4K07A 5I19L 1TQCB 2HKHL 1CL7L 5HYQA 4YNYA 2XTLA 2DIBA 3MODL 4MQSB 3VFNB 1KIRA 3KPRB 2AJXH 3S5LG 4UAOB 4W6WB 2ENYA 5D70H 4U1KB 2AV1B 3G5XB 1XR8A 2A9NL 2CRIA 1JFQL 4PR5A 2PETA 4UDTA 1XR9A 3FQXB 1IT9L 5D71H 2AJUH 3C5ZA 3T0EE 3C60D 2M26A 4KK6C 4NO0D 3MREA 1WTLA 4UT7L 4KKCC 4R4BA 4UI2A 2X5PA 1QSFA 1QACA 3AS2A 4OTXL 5CP7A 4JO3L 2ICEA 2AV7A 5GXBB 1QEWB 1TENA 3GSRB 3WHE0 5IGXH 3HZMA 4BFBD 1NEZG 3WFEH 2NY1C 2E5EA 1V7NL 3I6LE 1NAMA 5DVKA 2WINB 2R0WL 3LS5H 4FTVB 1U8KB 1EEZB 3FO1A 3F7YB 1HQ4A 4GBXD 2VN4A 3U83A 3QDGB 1RJLA 5FM4A 2DQEH 3RRQA 4M7LL 1WAAA 4LVEA 1G9MC 2LVCA 1WIUA 1XGYH 3KLHC 1HE7A 5J12C 5FGSA 4E41B 1IILE 2HWZL 3G5VA 4LP5A 5SWSE 3EYSH 2NY1B 3QEQD 3UBXG 5AYQA 4C56B 4TUJB 4OFDA 4KFZC 3HAEH 5HHVH 3MGOA 4NOFA 1VFUA 3BW9B 2V7NA 3MLXL 3QJHA 3QIWA 4X5XA 4U31A 3N1PC 1NL0H 4UUJA 3L9RA 4RWYH 4OGXL 1T1WB 4GKNB 5MEQB 1MUJA 2DD8L 3O4LA 5E2WH 4FQXC 3BSZH 5J12B 5E6ZA 4PJGB 3LPWA 2H1PL 5IOPB 2KBGA 1KJVB 2PO6C 1BFSA 4HJGA 3GMLA 2IAMA 4MB3A 1S7TA 4U6VH 4EN3C 4L4VE 2N1KA 1B0RA 5SV3A 4GXUM 1O0VA 4KROD 4P2OA 4HS8H 3IDJB 2R1WA 1HI6B 4XPTL 3WHE1 4JZNB 2HMID 1T66D 4F2MA 3GKZA 4FQXB 4PBXA 4DKFH 1HHGB 5H2BA 2PO6B 2MFNA 5CUSL 3GJFK 2ZCHL 4M9OA 4APQC 4EN3B 5JHDB 2QSVA 2RBLA 3MV8B 3WXVL 2I9LB 3VG0L 4DUVA 1C7TA 4DKAA 5C3TA 2V5SA 4KKLC 5E7FA 1NGPH 4PLJC 4UV7H 3FO0L 4NZUL 5FOBA 5E2VL 3C8DA 3H7LA 4PJ7F 3SDXF 1FIEA 5FCUH 3F7RA 5J13C 2WK2A 3PWJA 4KVNL 3IDMA 1QRKA 3CFKB 1FG9C 4P48A 3S37L 1QSZA 5IHUL 3DX6B 2E6JA 5EUOB 1H3TA 3IFLL 4OD2B 4Z7VE 1IQDB 3OF6D 5D5MF 4APQB 1LDPH 2OTWB 3U0PA 2AEQH 4U2YA 3H42L 1F4XL 2VISA 3DGGB 4Y88A 4MA7L 5D7LA 5E70A 4Z0XB 4WO4A 1AHWC 2QJDA 4KRNA 7CGTA 1YEJH 3R0MA 4P9MH 3ARED 4ZS6D 4G6AC 5IFAL 2Y25A 5MERA 4OB5H 5IVXE 4B0MM 4LAJH 3OXSA 4NKOA 5J13B 4X6DB 1T4KA 4NN5C 3O8XD 4FHBD 4IM8A 2F5BH 5D7IB 4YK4C 2VLLB 5DXWA 3W11C 5ANME 4G6FD 4QNPE 4WWKD 3SDYH 1AHWB 5F7UA 3GMRA 2GJ6D 4RRPA 2R2CA 1KJ3L 5E1AB 5EIIB 1G7PA 3E8UH 3KXFD 3X12B 3STBA 1AFVL 1JMZA 1S7XA 3D39D 4OKDA 1F4YH 3K8KA 3NA9L 4ZDHA 1ODAA 3CDGA 4NN5B 2O5XL 1A6PA 5C0CA 1S9VA 4LSDA 3WDHA 4YK4B 3EYUL 1AO7E 1GGBH 4LL9A 5HD8D 3VFMB 4F7EA 1EA9C 3P4OA 4LGPB 4UTBL 5DD3L 4JR9H 3MUY1 1WWBX 3EFFB 2EIDA 5T1DL 1J0ZA 1SMOA 3RUGF 3P4LA 5DURB 1BGXH 3TVMD 4PRPA 2QQLH 1FJ1A 1TJGL 3QI9C 3GGWB 3Q6GH 4OZGA 5EO1A 3MMEB 3MUHL 1ZSDB 1MAKA 1QHOA 3TA3A 4NP4L 1KTRL 1W0VB 7FABH 4YFLF 2GJZB 5IVNA 5FIEA 32C2A 3NAAH 1Q9WB 3PUCA 1NC2A 1FNHA 4YDLC 4YZFE 1KBGH 4X7SH 3LQMA 3UMTA 2CXGA 5KAQG 1CU4L 1GAFH 5GS0L 2P43B 3BHBA 3DXAE 2Y7QA 1KTKE 2J6EH 2ZNWA 3IJSA 3QI9B 1EHLL 3W81A 5DJ0B 1PGRB 3P9WB 4YNYB 4NCC1 5F9OL 5HYQB 5J56B 4WRLA 3F7QA 4UQ3A 1KUMA 4G7YL 5DFTA 3IAGC 2P4AB 1KIRB 3WD5L 5EOCJ 2JB5L 2EDFA 5DEFB 1YEDA 4YDLB 3LN5A 1T21A 3M07A 4X7FC 4R4FH 1XR8B 1BP3B 4PR5B 4UDTB 1XR9B 1VCAA 4MNQD 4TUOB 1YA5A 3MREB 3O3AA 1NUNB 1EEUA 1IKFH 3U79A 4JDTL 4R4BB 3ZMRA 3ZE1E 3FFCE 3V52L 4Z76A 5CP7B 4KTYA 4O2EA 1RPQA 2ICEB 2AV7B 4MD4A 2R9HC 3MXWH 2DQUH 3HZMB 1BD2A 1RUKL 1SBBA 1NAMB 1QHPA 4ZPVA 1A14H 1U3HD 2CJUL 3CIQA 3FO1B 3QIWC 4HX1A 3MACH 1HQ4B 1TJHL 4YQXH 4Y4HD 1BJMA 1S3KH 4PJEA 1MHPL 3H0TA 5FV2A 3E1F1 4M93C 1A0QH 1CF8H 4OD1L 4MMXC 1ZV5A 3D9AH 2NCMA 3LS4H 3MGTA 2VQ1A 2VC2H 3G5VB 1JGUL 4G6KL 2IAMC 4RWHA 4PP1D 4D2NA 3MGOB 1VSCA 1NGQL 4XB8A 4YIQA 1WLHA 1IM3A 1DLHA 3QJHB 3QIWB 3GIZL 4X5XB 4P2OC 3BISA 5AEAA 1Y6MR 4UUJB 4GQ9H 3QFJB 5E00A 3L9RB 3VRJA 4M93B 2AERT 1K3ZA 4XVTH 4IMKA 3KPOA 1MUJB 1NBQA 3BWAA 2YPLE 3PGDA 2VYRE 5JW3H 2VLRD 2AEWA 3K2UH 5DO2D 1KPVA 4NNPH 4HJGB 3GMLB 4Q9BA 2IAMB 2DL2A 5D8JL 1S7TB 3R1GL 4KJQD 1FNSL 1G6VK 1B0RB 3C6LD 4P2OB 4N0UB 4O4YL 2ITCA 2R1WB 5MI0C 4P2RA 3WNPA 2ZUVA 2BRRL 4Z7WA 4YWGL 1QFUH 3TPKA 4F9PA 4F2MB 1I3UA 1CBVL 4M43H 5HHNA 3LKSA 3GSXA 3L6FA 5H2BB 1WC7A 25C8L 3MRIA 3VXSA 2JTDA 4JG0H 5EU6B 3S8WA 5JR1L 4L4JA 4P2QB 4MB5A 1N6QH 1CR9H 1MCPL 4WO4C 4U7SA 3ULVD 5MI0B 3FQWA 2DQCH 4ZUSA 1X4ZA 5FOBB 1V3MA 5DR5L 2VITB 5F7DB 1B4JH 4M1GH 5TF1H 2A74A 3X17A 3R06A 1AP2B 3U0PB 1B2WL 3UJJH 5D7LB 5FUZH 2NYYC 4WO4B 2HJLA 4WI9A 1EDQA 2HT2D 1I7ZB 1LP9A 5MERB 3IXTA 2EIBA 1RZKH 2BVQA 2XZZA 5EZLB 2VUYA 3DX7A 3OXSB 4NKOB 3J7HA 3V6OE 5T3XH 3I3BA 2CLVA 5ID1B 3DYPA 4BFIA 3MA7A 3D25A 4OZ4A 2DN7A 3TZVA 3GSOA 4WFGD 3A67L 1J0IA 4JFOA 5D5ME 4Z7UA 1W0WA 4S1RL 1N64L 4HDIA 3QPXH 2F74A 4WEMB 3DVNA 1JF6A 3GMRB 3GIVA 4WI7A 1BREA 3RIAK 5IB1B 2NY7L 1S7XB 4NHUB 5E6YA 5F3HA 4KHTH 5DK0A 4ZDHB 1DQTA 3X3GH 4G8GE 4GAFB 1R24A 3W0WD 3KPSE 5C0CB 1Q8MA 1S9VB 1E0OB 3Q1SL 4F7EB 5BOZG 3P4OB 4OBSA 4PJGF 5FA3A 3QXUA 4J3SA 4P3DA 5IBUG 1XGUA 1NJ9A 3ILPA 3D85A 4PRPB 2R2EA 5K33A 4ELKA 1QLFB 1FJ1B 4OZGB 5EO1B 4X9FA 4XGZA 2WIIA 5D72H 2EH7H 1VFMA 4GW1A 5D1ZD 5T5NG 3MOAH 1DANU 4P2YA 32C2B 1G6RA 4XVJH 2D2OA 1JYXA 3PDOB 4B7LA 1NC2B 4JFFE 2YD1A 2XIDA 2AJXL 5EC2A 1E6JH 2B4CC 5BS0E 1ZLSH 2QSTA 5D70L 3BHBB 2Y7QB 1HINH 1JGLH 3RY4A 3RUGE 3UTQA 3IJSB 3QIUA 5D71L 1XIWC 2AJUL 1MAJA 2AK4E 3HMXA 5F1IA 1UKQA 4LEXH 3QCUH 3VGAC 4M6NH 2FEDD 5K9QI 4HHAA 4OIAA 1YEDB 2BSSA 3W9EA 2VAAA 1T21B 3LN5B 5DTFA 2APFA 2QL1A 5EUOF 2MMXA 1ZHLB 5IGXL 1NFKA 3QDJD 2ZCLH 3WFEL 1J1OH 2B1HH 3O3AB 2A38A 3LS5L 1MHCA 4GAGH 2RFXB 3RWIA 4JAMA 3GZKA 4Z76B 3TN0D 2MSPA 4O2EB 1DE4A 1RZFH 3PABA 3MZGB 4MD4B 1LEKB 1BFVH 3QFDB 2DQEL 3VGAB 4JRYD 2VQUA 3RGHA 4X6DF 1BD2B 3B9KA 1HKLL 3U4AA 5D7IF 2EH8H 4OFKA 4ZPVB 2VUOA 4KJWC 3M17A 3SE4C 3EYSL 4K3EH 3WLWD 2ZG1A 4X7CC 5I15H 3O6FD 1DEDA 5GGTA 5C0NC 5HHVL 3H0TB 1J1XH 2X1OA 2YD9A 1PSKH 4P0DA 4QEGA 4IMKC 1NL0L 1A3RL 3MGTB 3BO8A 4LAQH 4RWYL 2W9DH 2VQ1B 1U36A 1BLNA 3VDAA 5E2WL 2UV3A 2Y36H 2HP4A 3BSZL 5D96C 5DS8A 2V5MA 1PX3A 2I24N 4QRRD 1YMHA 1EJ6A 4LLWA 1ERNA 4YIQB 1SJEB 1IM3B 1DLHB 4U6VL 3GI9H 4UBDD 1T04A 1JYWA 2RAMA 2YBRA 5E00B 1EO5A 3VRJB 5E8DH 3HZYA 4HS8L 1MPAH 4TVPH 4AIZA 4F9PC 3KPOB 3BWAB 5LKNA 3PGDB 5EBMA 4OCYH 4N8PA 2IPKA 1FLTX 1KPVB 5GRWA 3IU3A 1X5LA 4TNWF 5D96B 2WWKT 3RL2A 3VDCA 4X7TA 2VZSA 4DKFL 1A1MA 3HZVA 2ZUUA 3TBSA 2EXYD 4PJIA 3ZKQD 5E8NA 1Z0NA 2ITCB 3WJLA 1WBYA 2DM3A 4P2RB 1P5VA 3IDNA 3PQYD 1TDQA 4S11A 4Z7WB 1J10A 1T1ZB 2ADFH 3FKUS 3QIBA 4ODHH 1NGPL 3MLUH 3RY5A 4UV7L 5HHNB 2D0FA 3LKSB 1S9XA 2FX7H 1GGCL 2Z31D 3GSXB 3H8NA 2EZ0D 3L6FB 5FCUL 4AM0A 1WC7B 3VXSB 4KRMB 3KNBA 1J0KA 1TITA 1B6UA 1EMTH 4OF7A 3C9NA 1LDPL 2J8OA 3FQWB 2AEQL 1MFAH 1DQMH 4ZUSB 2Q7NA 4D9RE 3QPQC 2DI7A 4K3GA 3TJHD 5IR1A 1YEJL 5D7JA 4P9ML 3EO1A 1XEDA 1F8TH 4OB5L 4L1DA 2A74B 3WJJA 1KIUA 3R06B 4NBZB 2W91A 3BX7C 4PG9A 4OLYL 4IRZH 4WW1A 2F5BL 4F33B 3VXTA 4WFFE 1IAKA 3EUUA 3RVWC 1L9NA 3OWEA 5EO9A 2HJLB 3KPRE 3L95A 3L3OA 4J3XA 1LP9B 3VXUB 1F4HA 3IXTB 3SDYL 4MDIA 1OPGH 2BVQB 3DTXA 1IEHA 3T3MF 3DX7B 2YZ8A 3E8UL 4I77H 2Y5TA 3D25B 1WAAF 1F4YL 1MY5A 4OZ4B 2I60H 2EKSA 3GSOB 4ZXBA 3GJFA 2OTPA 2DYPD 4JFOB 1T0PB 1W0WB 1HYRC 1GGBL 1RZ7H 4HDIB 2F74B 4AY0A 3DVNB 4EUPG 5BZDA 3GIVB 3ARSA 3RZWA 2VDRH 3OKOA 2DTSA 1BGXL 5F3HB 5DK0B 1P2CA 1TNMA 2ESVA 5IMMA 5HI5C 1FAIH 3UROR 3Q6GL 4MMZC 3LQZA 1R24B 1IC5H 2YOCA 3QDGE 1UQSA 2J1KA 2BJMH 2WANA 7FABL 1G7JA 1NGYA 2CDFB 3NAAL 5FA3B 1KELH 1NBYA 4P3DB 5DJ8B 3RKDC 4E41E 3FTGA 1NJ9B 1KBGL 4X7SL 3D85B 2R2EB 1U93A 2CRYA 4C56E 3QIUC 1GAFL 4XGZB 2WIIB 2CO6B 4GRLD 1G6RH 2J6EL 4R4ND 4JHAH 4GW1B 2CGRH 5LQBL 1PKOA 1G6RB 4XHQA 1YC7A 4JJ5A 3C8KA 2F8OA 4RIRA 2UUDK 4B41A 3ARBA 5EC2B 1YNKH 2XXMB 1LVEA 4HLZG 3FRPA 3HMXH 3UTQB 4PTUA 3QIUB 4Y5YA 3CFEA 3T2QA 1OCWH 4ZYKA 3B2UD 3MRGA 1IKFL 1N8ZA 1C12B 1PAMA 1HYSC 5F1IB 4LASH 4HHAB 2ICES 2BSSB 3W9EB 2VAAB 5DTFB 3MXWL 5FGRA 3B9KC 2DQUL 1JZ6A 4TQEH 3KYKH 3OAYK 3HE6A 3LV3A 2DOCA 1LEIA 4UNTA 3RVTC 1A14L 5JHDE 1MHCB 3MV8E 1FYTD 3RWIB 4JAMB 2RJMA 1EHNA 1DE4B 2H2PC 3MACL 4YQXL 4HBCH 3PABB 5C0BA 4AMKH 1A0QL 1CF8L 2R1YB 1JPGA 2VJXA 1ZT7A 1VADA 3D9AL 2HVJA 3LS4L 5A40E 2E7LA 4FFYH 3B9KB 3THMH 2VLJA 2VC2L 3M17B 3C87A 1FVDA 5GGTH 1FLRH 2IAND 5HBBA 5EUOE 4OLUH 3QRGH 4P49A 5GGSA 4Q58C 2Z0BA 1Z9OA 2D7TH 4GQ9L 3SKMB 3BO8B 5HHMB 4XVTL 4X80H 5HHOD 1BLNB 5JW3L 1A4JA 3FHAA 4HFWA 4BH8A 4X6DE 1HDMA 4LLWB 3K2UL 4NNPL 4RMRA 5J6GA 5D7IE 2X7LA 4QWWC 2VLMD 3WJLC 1T04B 3H9SD 4DFIA 1X4YA 3GNMH 2K3TA 2YBRB 1S5HB 1P69B 2BY0A 3HZYB 4JG1H 3QIBC 4AIZB 4MJ6A 3GI8H 4OZGF 3OSKA 1U3JA 5FAAA 5FYLH 5EBMB 3OKEA 5ICZA 1QFUL 2DAVA 1WFNA 2Z4QA 1I1RA 2IPKB 2A6DA 4FQQA 3INUH 3IU3B 4R3SA 1QSVA 2A73A 4M43L 3RWDA 1NCDH 1FL6A 3RL2B 4MLIA 2ITDA 3LDBC 3DVFA 4X7TB 1A1MB 5F89A 2X4TA 3DX9A 4WTXA 4Y19A 1DFBH 4JG0L 4LIQE 4KMLB 4NQCA 8CGTA 4PJIB 4FXKA 3RVUC 5E8NB 3GRWA 4DK3A 1WBYB 4HQQH 4AYFA 1OTTD 1KEML 3BWUC 4OQ1A 1L7IH 1N6QL 1I1AA 3IDNB 4GT7A 3QIBB 5EULV 5D7JC 2DQCL 1UEYA 35C8H 1ZHKA 3P0GB 1RK0A 4KJPC 1S9XB 3WJJC 4AM0B 5C0GA 4F57H 3HCVA 3RGVA 3RVXC 4FABH 4X4ME 5IF0A 1KIPA 1CICA 1NBZA 3LDBB 3T3PF 3KNBB 4EVNA 1HZHH 2W9EH 1RAMA 2VDKH 3BAEL 3C9NB 1MCHA 4F8TA 5F9JA 1CGSH 3UJJL 4H20H 2FD6L 2R23A 2A83A 3EYQC 4MWFA 4M1DH 5IR1B 3T09A 2BHZA 3K80A 5D7JB 1NANH 3EO1B 2DTMH 2BNUA 4S0TD 1RZKL 1IAOA 1Q9LA 3LH2H 4YUEH 2ICWJ 5DSCA 5T3XL 5GIRA 4ZXBC 4WW1B 4JHWH 3VXTB 2OP4H 3R0NA 2ZUQC 3L95B 3F5WA 3L3OB 4GOSA 2XG4A 4XNQA 3QPXL 1UWGH 2AQ1A 4KUCF 3DTXB 4MDIB 1OTSD 1V7MH 3NIDF 1AR1D 3WS3A 3HPJA 2BZDA 1D6EA 2Y5TB 3GJFH 1EVUA 4PG2A 4KHTL 1KOAA 3QHFL 2B0SH 2XZQH 2YXFA 5IB3A 2EKSB 4ZXBB 3GJFB 5F7EH 4QF1A 3JUZA 1AR2A 3IRPX 2ZUQB 5ADOH 4MD0A 3DRQA 5D7KE 4NQVA 5BZDB 2B8OT 5MEND 4YEEA 2G9HA 1YNTA 3R4DA 1BBJA 3BYYA 3RI5F 1P2CB 2ESVB 5IMMB 1UYWH 3T3ME 5KOVC 1XGQA 1AD0A 1MFBH 4YR6A 1URLA 5D72L 2EH7L 1UQSB 3LOWA 1PX4A 1WCQA 1F6LL 2AEIT 5F6IC 5HVGB 1WAAE 3MOAL 4OGZA 1NGYB 4XVJL 3ARBC 4HGMA 4YX2L 1NBYB 5JXEA 4HKJA 3FTGB 2X10A 1U93B 1E6JL 1ZLSL 3MV7A 2P5ED 2X41A 3LN9A 1HINL 1JGLL 4G42A 3VXQA 4RQQA 4Z7WF 1INEH 2VXTH 1MJ7L 3QFJE 4J1UA 1U8LA 1F3RB 4JJ5B 4K23H 3C8KB 1MCIA 1BEYL 3OX8A 4KDVA 3V7AG 5CD3A 2X05A 4LEXL 4TN9A 5F6IB 4RIRB 4M6NL 3ARBB 2WLYA 3IXAA 1MREH 4M4PA 1FAKT 2QTEA 4F7MA 3DUUB 5JW4M 3HE6C 4OLZH 1I3GH 2K7QA 4OZFB 5I74C 3BH8A 1UKTA 4PTUB 4J3VA 5KANI 4OUOA 2ZCLL 1J1OL 3J8F7 4QXUH 3CFEB 1ZA6A 3MRGB 1N8ZB 5JW4Q 3E6HA 5FKPA 1HHHA 1RVFH 4N0UE 4GAGL 5A2IH 3NGBC 1WGOA 1MHEB 4KI5D 1RZFL 3VGGA 1CFQA 1BFVL 1JWMA 3S97C 2E7LC 1O5DT 5AAWA 3ZZ1A 4FQ2H 3MV9B 3O11A 3CFJA 1LEIB 3HE6B 5H37H 5I74B 1Y0LA 2EH8L 5EU6E 3TIDB 2X1WL 4K3EL 5EU5A 3LRHA 2BX5A 4P2QE 5JPMA 2F9BT 5I15L 3OKYA 5LBSH 5C0BB 1LP9F 3NGBB 2YUZA 2Q1EA 1PSKL 4OCSH 1JPGB 4LVHC 1ZT7B 4N8CH 1VADB 1NKRA 3F65A 2HVJB 4OM0H 5EBWA 4LAQL 2W9DL 4XNXH 2VLJB 4WTZA 3BRFA 2R4SH 2YA1A 4ZODA 4HZLA 1FVDB 1DANT 4XNMA 1NCWH 5GGSB 4Q6YA 1N26A 3RVVD 4U6XA 3GI9L 5D7LE 2DQHH 4MJ2A 3MUGA 5E8DL 1OF2A 4TVPL 4L8CB 1MPAL 5KS9B 3SDAA 3BRGC 4LVHB 5ENWA 2ERJC 1A4JB 3HAEG 4HFWB 1M1SA 3C5SA 4OCYL 1HDMB 5A2JH 3RFZC 3GO1H 2BHUA 2EYSA 4U4BA 5J6GB 2UVEA 3ULUD 2X7LB 1N3NA 4MD5A 3SHSA 2NR6D 1TTFA 5C92A 5F1NB 2XKNA 1I1AC 5KSBA 4FZEH 3HE7A 1DZBA 4XHJD 4DKDC 3BPNC 4MZ2A 3OKEB 4MXQD 2ADFL 2Z4QB 4ODHL 2A6DB 3MLUL 1FL3A 4FQQB 1BQHA 4XCYA 4R3SB 3RGVC 2A73B 2ERJB 3RWDB 1CICC 1FL6B 4OV6F 4DW2H 2FX7L 2ITDB 2VKXA 3WIFA 2GK2A 5F89B 3GRWH 2X4TB 3DX9B 4Y19B 5C0CE 1IGIH 3OV6A 1VENA 4NQCB 3FB5B 5SV4A 4BK5A 4FXKB 1I1AB 1BECA 4M7JH 1MFAL 1DQML 1YQVH 3BPNB 1ZHKB 1RK0B 3R8BB 5C0GB 5GZNC 3HCVB 4KKNA 1NBVH 3RGVB 5IF0B 1KIPB 1CICB 1QLEH 1NBZB 3BVNA 4EVNB 4POZD 4TULH 4Y5XA 4HWZA 1SHMA 4IRZL 2VOTA 2HTLD 2A83B 4MWFB 3X11A 1LO0H 3T0ED 4G80A 5DMIH 1IAOB 3G6AA 4PG2C 5I8KH 1HH6B 4GKSA 4X8XA 2J8HA 4J4PC 5DSCB 4R90H 3TV3H 5GIRB 5MEPA 3SOBL 2BXZA 4XPBH 5K9QG 5BQ7A 4LFHG 2A6JA 2I60L 3T3PE 3F5WB 4F9LA 1RZ7L 3ZSSA 3I6LD 5BCAA 5EORH 3ZDXF 3WS3B 3HPJB 4O5LL 2VDRL 1D6EB 2JB6A 1FAIL 1IC5L 2OMBA 2C5DC 5CD5D 4G9FA 2BJML 3V0AC 5JXEC 3DRQB 1U8IB 5L0QB 4NQVB 5SWSD 1BD2E 1N5YH 3GMQA 1KELL 5KJRH 2G9HB 4U1HB 5F7YC 1CXFA 5LCVH 2IH1A 4ODWA 1BBJB 3TYFA 4LDEB 5CWSA 2YUXA 1MEXL 1V8HA 3FN3A 1XGQB 1AD0B 1F90L 4YR6B 5DC4B 3NIDE 3UJTH 1G6RL 3HRZB 2CGRL 3PHQA 4K7PY 3GHBH 2BCKA 2R4RH 5M95B 3PWUA 4G6JH 3PWPA 2WQ8A 4NKDA 3MLZH 4DVBA 4JANA 5C07A 5C2UB 5CGYD 2FLBT 3BD3A 1YNKL 2CUMA 1EV2E 2RGSA 3MV7B 4PJIF 3HMXL 4L4VD 4D0CA 4G42B 2VZVA 3VXQB 3JTSA 4RQQB 3OZ9H 1HXMA 1OCWL 3ARXA 1IM9B 3NFPB 1NSNH 5DHYA 4KI1A 4X6BA 4UDUA 3OX8B 1MJJA 5CD3B 4LASL 3RWHA 3IXAB 4XP5H 2XFXA 1C5CH 3SKUD 4X6CA 3DSFH 5T1LA 4F7MB 3L5XH 1QTYT 2CIIB 2HVKA 2QLVB 2F54D 3BH8B 5C9JB 5C09A 4TQEL 3KYKL 1DBJH 1X3DA 4IS6A 1FG2A 4HCRA 1ZA6B 3E6HB 5EBLB 1HHHB 4JKLA 5FKPB 4MXVE 1HXYB 4P2RE 4Z7WE 2FBJH 4HBCL 2IGFH 1CFQB 4ZS7H 1EAJA 1JWMB 1N2RA 4GQPH 4UIKH 4AMKL 1H5BA 4HH9A 1BM3H 3RNQA 2K1MA 4DKEH 3OG6B 4HJ0D 3O11B 5C0AA 3CFJB 1JPST 4FFYL 5MEOB 3ZHKA 1DCLA 1Y0LB 4RX4D 2UWEA 1JI1A 3G5ZA 5GGTL 5EU5B 1FLRL 1IL1A 3O3BA 4OLUL 3QRGL 1UFUA 5JPMB 1VKXA 1P4IH 1EERB 5HDQL 3EJJX 4DUXA 3SDAC 2D7TL 3CH8A 1J11A 4Q2ZA 4PD4J 2IFFH 3PXJA 5EBWB 5JMRA 1NCCH 5F96H 4YHLH 3CFBA 4R7NA 3LAFA 4OCWL 4X80L 4WHCA 3SGEI 4HZLB 5MP6H 5IBLD 4HEPG 1B6DA 5D6CA 5HGGS 4XNMB 3F8UB 3D87B 1UB5A 5EN2A 2FIKA 4U6XB 1FDLH 3JTTA 2F53A 4AJ0A 3HE7C 3GNML 5FYKU 1J12A 4ZQKA 4N8VG 3U7WL 1OF2B 4JG1L 1LP9E 3SDAB 3VXUE 5ENWB 3GI8L 1P7QA 3KYOA 5FYLL 2EE6A 3UTZA 4Z18A 4R2GC 2EYSB 3INUL 1N3NB 3MBEA 1NCDL 5ICYA 4MD5B 1AO7D 1OVZA 3O6MH 2E8YA 4HF5H 2XKNB 1DFBL 1K9TA 4CBPA 5KSBB 4X9GA 1ULVA 1LO4H 2R15A 3HE7B 4HQQL 2DQIL 5DT1H 3SKOB 5JW4R 1L7IL 3PF2A 1BAFH 4KV5F 2NY5C 1QFHA 1FL3B 4N9OB 1BQHB 4XCYB 5GGRY 35C8L 3SJVA 3WIFB 1MJ8H 4QKXB 4F57L 4R2GB 4Y5XC 4FXLA 3SDDD 4Y4KD 4FABL 4HWEH 2XPGA 2OZ4L 2Q6WA 1S9YA 3IFOA 1HZHL 3DV6A 5F7FA 2W9EL 2VDKL 5FM8A 3RHWK 5E4EC 1CGSL 3CX5K 1FO0A 4H20L 3QP3A 1VEPA 2MCPH 4M1DL 3DXAD 1F13A 4ZPTB 2FH8A 4UILH 2DTML 1LK3H 3MNZB 4UTAH 3IKCA 4UV4H 3MR9A 4Y5XB 3LH2L 4YUEL 4XP9H 4HWZB 4JHWL 1OW0A 3S5LA 4F9LC 2OP4L 3RWEA 5CBEA 3X11B 4N0CD 4XVUC 1B9ZA 4ZSOA 4YHKH 3TBWA 5EBGA 3S6CA 5E4EB 2BY3A 4LDLB 5IW1A 2YWZA 4G80B 2VNCA 1UWGL 1TMCB 3G6AB 4FFVD 3LHPH 1V7ML 4GKSB 4JKPH 4N0RA 4XCFH 4QXWA 3FFCD 4H26A 5MEPB 4KKBC 2B0SL 2XZQL 5BQ7B 2A6JB 2FIRT 5F7EL 2IQ9H 3WUWG 1NEZA 4AH2A 4X5LA 1T5WA 5KSAD 3Q48A 3DRTA 1QO3A 5ADOL 4K8RL 3DUSA 2FJHB 3K4ZA 3OKKA 1SY6H 1GJIA 5AWNH 4U0RC 3F58H 3GSWA 2JB6B 3IDUA 1UYWL 1MFBL 4DN3H 4KK8C 4GH7B 4LPXA 1JPTH 3UTOA 5KS9F 4HAFA 1CG9A 3H6JA 1KACB 3CD4A 4PP2A 1KPUA 1SVCP 1CGWA 1UWEH 3MROA 3GMQB 3LSOA 3UBXA 4JKMA 4ODWB 3RQ3A 1PY4A 3C09C 3BPCA 2BVOA 1YEKH 3DBXA 5AZEH 3TYFB 1E28A 1GPOH 5CWSB 4IBLT 1OGTA 4S2SA 4OGYH 1YNLH 1Z3GH 4XP4H 5H94A 1NGXB 3ZDXE 4U0RB 1FN4A 3PHQB 4M7ZC 2BCKB 1INEL 3PWUB 2EYTA 3O3UN 3PWPB 3TCXA 5DZNA 4NKDB 2YPLD 5BMFH 5HHME 4K23L 4DVBB 1P1ZA 1JL8A 1SVZA 5C07B 4PY7A 5GHWH 3IAPA 1MREL 3U9PH 1D3CA 3QDHA 5C08A 5DRWA 1JNJA 2IPUG 4O00A 4OLZL 1I3GL 5LXGH 4D0CB 3GBLA 3QR2A 2ADJA 1EZVY 4QXUL 4HIIA 1Y6NR 1HXMB 4EI5C 3X13A 5DHYB 3DHJA 1U91A 2EEDA 2QR0A 1RVFL 3HZKA 1MJJB 1OWWA 4M7ZB 4WDIA 3RWHB 4YHNA 3LKPA 3MRQB 5E5MA 4ZUTA 5GRYA 1MVFA 4X6CB 1K8IA 5FYLE 4HCRH 2HVKB 1IZKA 1F3JB 5BOPA 3QXVA 5C09B 4FQ2L 4IS6B 5IBTH 1FG2B 2RIKA 3ZKND 3V8CA 3WS6A 12E8H 5GZOC 2WV3A 1JMXA 4EI5B 1QR1A 1D5MA 3DI3B 4NNYA 4QHUA 4PBWD 3IETA 4HH9B 1I8MA 1F5WA 3DO3A 4OCSL 3RNQB 1L0QA 4N8CL 4OM0L 5C0AB 1KCLA 4XNXL 2R4SL 3G5ZB 2DLTA 1IL1B 1HH9A 1O7SA 3KG5A 3O3BB 2GTZB 1NCWL 4LCWA 4MSWA 2MKLC 1VKXB 1A9EA 2CLRA 1LE5A 4NZRL 2UUDH 2GJJA 3FN0H 3S36X 1A6TA 4J3UA 3CFBB 4R7NB 4ZFOA 1S9KC 2CK2A 2Q20A 1JZ8A 1N4XH 4LQ1A 1YJDH 3GO1L 1QFPA 1UB5B 4MQ7A 5JPNA 4IRJA 1YYMH 2X1QA 4OLXH 4KHXH 4YHOH 3JTTB 4BQBA 2JELH 4X98A 2NY0D 3LB6D 2V7HA 2DBLH 1U3ZA 2YPKA 4LSRH 4CMMA 1PBYA 4ZQKB 2SEBA 4FZEL 4UOW0 3PG2A 3OTTA 1P7QB 4OSUH 3KYOB 1HCVA 1FORL 3UTZB 4G8GD 3VWJA 1IGYB 3VD9A 3KPSD 3OAYH 4XNUH 2B39A 5DD1H 4DW2L 5JOPE 5CLWA 1GIGH 1VACA 3V6ZA 3GRWL 4GAJH 1A02N 1IGIL 4P5TA 2W38A 2D4DA 3NH7H 1FZKA 4ODBD 4X6EA 1ZHNA 3SDCD 5EO0A 2OR9L 1L0YA 2NY6C 3BZFA 4M7JL 1JUFA 1YQVL 3RWCA 4ODUB 3W82A 3S4SG 2QKIA 2ESVE 4NCDA 3RDTD 3SJVB 3HI5H 4B5EA 1NBVL 2XPGB 1ZKAA 1OW0C 2Q6WB 1S9YB 4XZUA 3IFOB 4JFFD 4TULL 1FO0H 5EOQH 2VXSH 1J87A 1WUNT 1WWWX 4AT6A 5CZXD 1OAUH 4PJXA 3BEWA 4FQIH 1FO0B 5BS0D 2A9ML 1A64A 1HHKA 3L3IA 3DJ9A 1EBAA 1LO0L 4PRDB 4EDWH 2NY6B 3RIAF 3BQUD 3QEUB 1EHAA 2AK4D 2CO7B 4KV5E 1BFOA 4MZ3A 3TGXA 4P46D 2NX5A 5DMIL 1ZHBA 3IKCB 5I8KL 3MR9B 1NDMA 4E42A 3QULA 4L8BB 4R90L 3TV3L 3UAJD 3C08H 3F6LA 4JFHE 5JXAH 3S5LB 4XPBL 4UOW1 5DQDH 5CBEB 4ZSOB 3TBWB 1A4KA 3MFFA 2YUVA 3C60A 3T08A 2FO1A 5IW1B 4JGMA 5KANG 5L8JB 3QUMA 5F1KC 4PS4H 5T3ZE 1EGJH 4KUZH 5EB9A 3GMMA 1H9VA 4H26B 1XT5A 1RY7B 4L3CA 4Z77A 1U8HA 1JWUA 4R26H 3QXDA 4NM8H 3UJIH 1NEZB 4OUUB 4AH2B 2HLFC 1T5WB 3DRTB 3DUSB 1PD6A 3MV9E 1N5YL 5KJRL 5LCVL 5HGHA 2A6KA 3MJ7A 3VD3A 3GSWB 4UT9H 3MRRA 3UJTL 5JW5A 1CG9B 3GHBL 4S1DD 2R4RL 4DOHB 4PP2B 3FZUD 1KPUB 4G6JL 3MROB 3LSOB 3UBXB 3IGAA 5I18H 3MLZL 2VLJE 3T1FA 4MS8C 3BPCB 2BVOB 3DBXB 1V05A 1R3HA 1E28B 5FHBH 4V1DA 4S2SB 3DIFA 4DEPC 5KSBF 5H94B 1JHLH 5CEXA 1JCKA 5CCKH 1FN4B 3QUXA 5DJ2A 4KC3B 1IAII 3OZ9L 4LCYA 1P5UA 3GM0A 1P1ZB 5KS9E 1FL5A 1C5BH 4PY7B 4KQ3H 4XP5L 3P9LA 2R29H 5C08B 2D03H 5DRWB 4EEEA 3DSFL 1C16A 1F3DH 3L5XL 2QBWA 3WS6C 2ADJB 1DBJL 4DEPB 3X13B 1U91B 2MHAA 2W1NA 2QR0B 3DPBA 3HZKB 5FKAA 1CFNA 4WDIB 3PWLA 4YDVB 2P24A 2IALA 2VZ1A 2NZ9D 4ZUTB 4YHNB 5E5MB 5IB2A 2FBJL 2IGFL 4ZS7L 3CX2A 4U1LA 4UIKL 5ISZA 1K8IB 3ZT7A 2J7LA 5IHBA 2YD4A 3O2DH 3T77A 4Y19E 2VZTA 5AUMB 1JGEA 1EFXA 1QBBA 4ODVH 4NQCE 3NZHL 3LKOA 4Y89A 1ND0A 2MWCA 3QWRD 1D5MB 2BNRB 3C6SB 4NNYB 4QHUB 4D9RD 3U48A 4TOYH 1P4IL 3OB8A 1H3PH 3IETB 5I1IH 4RBPH 2W60A 1Y6KR 4Y8AA 4ONHA 1I8MB 4GRMA 2IFFL 3OF6A 1NCCL 4U7MA 5F96L 4YHLL 4F7PA 5I73C 4IRJC 5MP6L 1S78C 4S0SD 4WFFD 4N90E 4LCWB 4MSWB 3BXNA 1P9MA 3KS0H 3K8MA 2C3XA 3A6BL 3KPRD 2OL3A 3HNTH 1FDLL 1IARB 2FGWH 5IK3A 3WE6A 2P49B 2CLRB 3WFZA 1LE5B 3OKMA 5CFHA 4QHKJ 2Y6SD 3DARA 3MNWA 1MCRA 1AQDA 2FEEI 2V5TA 2BSRA 4ZFOB 1NGZA 3VWJC 3O8XA 4NQEB 4YBQC 5DJZA 2FX9H 5SX4H 3VGEA 5ILTH 4MQ7B 5JPNB 5I73B 2AW2A 4IRJB 4ALAL 3QH3B 4P5TC 4X98B 4LLQA 2P1YA 3O6ML 4HF5L 5D4QA 1LO2H 2V7HB 4O9HH 2X1XR 2YPKB 4CMMB 4Q9CA 4YHPA 1KULA 1KLGA 2SEBB 4E9LA 4WHDA 1JP5A 1IKNA 5DT1L 5E6IC 1R3LA 4X5WA 1BAFL 4WY7H 4KK6D 3VWJB 1S8DA 3ZDZF 4KKCD 3QDGD 2O26U 3O45A 1HIMH 1MJ8L 1VACB 3V6ZB 4BM7A 1X5JA 2OJZH 3HNSH 4MGXA 4P5TB 1EX0A 1H3WM 5FYJH 4HWEL 3IVKA 4FXGB 4D0DA 4E41D 1J0YA 2WBWB 1FZKB 4X6EB 2V2WA 1ZHNB 2NY1D 5EO0B 3BZFB 4C56D 1JUFB 5DJDA 4O51B 5L7XH 2MCPL 1PZ5A 2QKIB 4DVRH 5FO7A 3AMLA 3NA4A 2GK0B 1WVZA 1UWXK 5IESL 3B9DA 5A2FA 1LK3L 4UTAL 2X1PA 1OARH 4XZUB 4UV4L 2FWOA 3KWWB 4XP9L 4K7PX 4X6CF 3MNVA 4M5YH 3KLHD 1F6FB 4PJXB 3BEWB 4H8WH 3C60C 2APBA 1I1FA 3VFPA 1HHKB 1MCEA 3P9MA 4YXHH 5IUSA 4YHKL 2B2XH 5IJVA 4XI5C 3BJ91 4L8SA 3MV7E 1AIFA 1WITA 1BFOB 2JJSA 2NX5B 1X5HA 1ZHBB 3FO9B 3LHPL 1NDMB