2CXKA

Crystal structure of the tig domain of human calmodulin-binding transcription activator 1 (camta1)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
87
Chain Sequence
SSGMVTDYSPEWSYPEGGVKVLITGPWQEASNNYSCLFDQISVPASLIQPGVLRCYCPAHDTGLVTLQVAFNNQIISNSVVFEYKSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords calmodulin binding transcription activator 1
publication title Crystal structure of the TIG domain of human calmodulin-binding transcription activator 1 (CAMTA1)
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 15
structure length 87
sequence length 87
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01833 TIG IPT/TIG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cxkA00
1I9IL 5ICYA 4M7ZB 1JGLL 2DBJA 3TVMA 1IAIH 1HWHB 3OXRB 4P5KB 4LARL 5I1LA 3DJ9A 1IFHH 4WI9A 2DWDB 1UVQB 3EZ8A 3T0VA 4NCC2 3RZCC 1M71B 3HR5A 4JRWA 3CVHB 3ZKXB 4U1IA 5E2VH 3BEVA 2YWZA 3GMOA 3WL9B 3SKOA 4X4ZA 3OXSA 4MA7H 3OQ3B 4U05A 1HQRB 3OX8A 1YEFL 3AUVA 4V1DE 5D7JB 1BIIB 2YWYA 3TA3A 5T3ZE 1FFPA 4MJ4A 1NGZA 4UINL 5DC4B 4C83B 1R5WB 4G6MH 1OCWL 5KSVB 5E5MA 1HHKA 1JV5A 4NGHH 3UZQA 4CRPA 3O8XC 2W65B 3HC3H 3O2DL 2OL3B 1UWEL 1A02N 3ZE0F 4WUUB 3BP6B 1ZVHA 4CMMA 2AJ3A 1LP9B 4Y2DC 4NO2B 1FLTX 1TLKA 5EZJB 1MOEA 1U8HB 4NN5B 5CCKH 3DROB 2RQ8A 3QZWB 3GKZA 3QDME 4APQB 5HI4D 1ERNA 4G6JH 2R0ZH 3PG2A 4LCYB 1JCKA 4P3CH 5CBEA 1N2RA 2Z35A 3WS3A 5F3BB 3N1MC 5TE7L 5ECJE 1ZHBA 1VSCA 1PLGL 5LBSL 2A9MH 4ODTL 3ZKQD 1MCNA 2NXYD 1T83C 1IILE 2MMXA 4Y16D 1KEMH 3S96B 4JLRB 4L3CB 1OAKL 3VGDA 4UQ2A 4NWUH 3SO3B 3MRQB 3RNQB 3PQYA 2W59A 3IDXH 5F7MC 2VLLA 1WV7T 2B39A 4J3OC 1JYWA 5BOPA 4C59B 5ISZA 3MRRB 5DJAA 1BEYH 1HSBA 1XF2B 3RWJA 4KZDL 3RDTC 1MHHA 5C0NC 4KK8C 4M6MH 5F9OL 1RURH 1KIQB 3FO9B 5F1IA 2WW8A 1MCPH 2JJTC 4G6FB 4BYHA 3JWOL 3ARBA 1UC6A 4QRRE 4ZQKB 5C3LD 1A3QA 2IAMA 4Z95H 5DUPH 4KFZC 3OXRA 2Z8SA 4NM8H 4P5KA 3MFGB 2DWDA 1UVQA 4GRLC 4ZUSB 3CDGB 1M71A 3CVHA 4DEPC 3EJYC 4XPHL 1NBYB 2Q6WB 1K3IA 1S9XB 1HQRA 3AREC 3OAUH 4YDIH 4I0PD 3ARQA 2R56H 5D7JA 1BIIA 2QBWA 3G08B 2J88L 4XRCB 4C83A 3BE1L 2GHWB 1R5WA 3D6GA 3VGGA 3EW3B 1HEZB 2IBGA 3HFMH 2OL3A 1I9IH 3RIAK 1JGLH 3EZJB 3SGKC 2Y6SC 4BSJA 1QG3A 4LARH 1LP9A 5IG7B 4RX4A 3CVIL 4NO2A 4G9FE 5EZJA 1JI2A 4TNWK 1U8HA 5IHLB 3KDMB 1UB5A 1F13A 3RGVD 2NX5D 3IJSB 1TZIB 3DROA 4YGAB 4PLOB 5EO9B 1BQHB 3QZWA 5CKAA 5BS0B 3MBEC 4APQA 1YEFH 3H9ZA 4LCYA 4F57L 1M05B 5F3BA 4UINH 1XGPB 4MS8D 5DJDB 1AGCB 2RR3A 1OCWH 4OQTA 3DO7B 1NC2D 1J1PL 2DQGL 4R0LB 2UUDH 4PJ9B 3O2DH 5GS2H 1UWEH 2EDRA 3LH2L 4OCYL 4WW2C 3S96A 1I1RA 4LLMA 4L3CA 3CDFA 3MRQA 1Z3GL 4K07A 5GS1C 3MV7E 2CSPA 3NIDF 5HDBF 5A2KH 1RK1B 2XTJC 1FAKT 2H1PL 1RY7B 4TOYL 5E1AB 3MRRA 3D3VB 4NZUL 5IBLD 4DTGL 1XF2A 2LVEA 1PQZB 3REVB 5CZXD 1G7QA 2CXKA 4WFFD 1KIQA 3FO9A 2ED8A 4JM2D 1CCZA 5D96C 5TE7H 5HHNB 1L6XA 1PLGH 5LBSH 1NUDA 4ODTH 4ZQKA 2P43B 1MF2L 4NC1E 1UKSA 5JUEL 5SWQA 4RBPK 4HFUL 4R6UA 1OAKH 2VUYA 4K9EC 4ZUSA 4AZ8A 3CDGA 1FYHB 5CJXC 1XF3B 4XP1H 2K7PA 1NBYA 1G7LB 1DANU 3WXVL 5K9KB 3PGDA 4KZDH 1EFQA 5F9OH 1HSAB 3G08A 4MNHB 4XRCA 1BZQK 2E6JA 3JWOH 1JZ5A 3QCUH 3U4EB 5IROC 2EC9T 5T1LD 3QDHA 4BSWB 4RAVA 1IVLA 1PG7L 2H2PC 3QQ9C 5IG7A 1NFDF 3MA7B 3GJFK 5IEHB 4Y1AB 4ZTPL 5ABDE 3KDMA 4XPHH 5HPMA 1FFOB 2NY1C 1ACYL 3QHTC 2HMIC 3IJSA 1TZIA 4ONHB 5EO9A 1BQHA 1HHIB 1XCTB 5DI8A 3RY6C 2ATKB 3KJ4C 1M05A 2J88H 3MCKB 2X5PA 3BE1H 5DJDA 1Y6MR 1AGCA 3DO7A 2R15A 4RGOL 2X1XR 4GOSA 4R0LA 4PJ9A 1ZHKB 2K9UA 1H8NA 4UIKL 4FQXD 5EU4B 2ADGA 2WBJD 1W8OA 4ZO8A 3F7PC 3EDEA 3FTGB 3CVIH 2XQBL 3C6LC 5FGCB 3SDAC 1RK1A 1T7XA 5E1AA 3AC0A 1AGFB 3D3VA 3X12B 3SHSA 1FJ1B 1PQZA 3DWTA 3REVA 4F57H 1E6JL 5CSBA 5HJ3A 3SDXF 3HUJF 4P2OB 5I6XB 2O5YL 1NAKL 5HHNA 5MENB 5ELIA 4Z6AT 2BXYA 1J1PH 2DQGH 1GHFL 1HI6B 5BQ7A 3LH2H 3BI9X 1M7XA 3QNYB 3QAZC 1G7JB 4OCYH 3SDYL 1ZGLB 4WHYH 2M1KA 5IVOA 3GJEB 1ZLWK 2BY2A 3MRKB 1BQUA 1XF3A 1Z3GH 5GRJL 4OD2B 2XNAB 2H1PH 4TOYH 1G7LA 1OVZA 4NZUH 5K9KA 4DTGH 5KN5B 4WDIB 1RUAL 5I75B 1HSAA 2NY6C 4MNHA 5CILL 4V1DD 1GAFL 5T3ZD 3S35X 5FECB 1UGNA 1MF2H 5I8OL 1U8PB 4PJBE 3U4EA 3LIZL 5JUEH 5D4QA 4BSWA 4P4KB 5L8LB 1BJ1H 4HFUH 1MRDL 3TBVB 3I3DA 3LQAL 1A9EB 2AQ3A 3MA7A 3P9WB 4TVPE 4Y1AA 3RU8L 5C9KA 5HYJE 5IEHA 4WW1B 2ZOKB 1EJ6A 1FFOA 3C8HA 3RKDD 1GGYA 4ONHA 3O6FB 1HHIA 3O4LA 3WXVH 5B39G 4KHTL 1GGBL 1U58A 1XCTA 3JVGA 3H9SB 2ATKA 3VWJC 1ZS8B 3MCKA 1RZJL 4LVHC 1R3JB 3VGAB 2C5DC 4KAQL 3NFNB 1WUNT 1UH3A 2CR3A 4QHLB 5EU4A 43CAA 1PG7H 4D94A 1T03L 5IT2L 1AE6L 5C08E 4WWID 4ZTPH 3F5WA 3MV9B 1NKRA 2IEPA 1ACYH 3VFPB 1AGFA 5CINL 4DN4L 2OXGA 1WTLA 3MLXL 5E6ID 4BKLB 3X12A 1FJ1A 1IAKB 1P7QD 3H9YA 4KGJA 4OGYL 5ENWA 1DVFC 4P2OA 2DRUA 5F1OB 5MENA 5JZ7D 4RGOH 1HI6A 2D9QB 4KTYA 4EQ3A 1NUNB 3QNYA 3BZEB 1G7JA 4UIKH 1ZGLA 1A0QL 4QRRD 3GJEA 4HCRL 5I1IL 3MRKA 2XQBH 2C7UB 3UZEA 4FFVC 4K7PX 2VOTA 4OD2A 4X9FA 2XNAA 3SKJH 1MFEL 2EDLA 3C9NB 2D7QA 3OKEB 3VA6A 3U4AA 5KN5A 4WDIA 1E6JH 2XICA 3TJHD 3VFGL 5K93A 2O5YH 2WANA 3AS1A 3GRWL 1NAKH 3WNOA 2DOCA 1GHFH 1ONQA 5TQ0L 1REIA 1OP5K 3SDYH 4P4KA 4AQ1B 1Y6NR 2F15A 4X98B 4OCSL 4U1KB 2CIIA 4V2CB 3D1MC 3TBVA 4X6CF 1ZT4B 1AO7D 4WW1A 4NDMA 5GRJH 1S5HB 2P7TB 4G9FD 4HIHB 3EO0B 2NNAB 1KCRL 1S8DB 4DZBA 1RUAH 3H9SA 4EN3A 1G9NL 3ARUA 1ZS8A 1R3JA 3X3GL 5J4MA 2ZOLB 5CILH 1GAFH 4JDVA 1IM3B 3NFNA 2A74B 2ICEA 1H3WM 1S9YB 5I8OH 3LIZH 4JAMB 5C0BE 5F1NB 4QHLA 1KIUA 3K2UL 4WEBL 5LQBL 1BZ9B 5F7DB 1VGEL 3QXWA 1MRDH 4Y4FC 4WUKL 1F45A 3LQAH 3RU8H 2BSSB 3MV9A 2J12B 5B38G 5IMMB 3BP5B 2MQ3A 4ZPTB 4KKAC 1GCFA 3VFPA 1RUKL 2VJXA 3KYAA 2N7AA 4BKLA 4KHTH 1GGBH 3DX7B 3QUYC 1S7UB 4YE4L 4GUPB 1P69B 1RZJH 2GYSA 3PGCB 3HUJB 5C2UB 4KAQH 4IRJB 1RAMA 3QUMH 3ULUF 1KLFA 3EAKA 3L3HB 3MJ7B 2XKNB 1B88A 1T03H 4NN6C 1XH3B 5D6CB 5IT2H 5J1TC 5KW9L 2AJYL 1AE6H 2C7UA 4RAHA 3LRGA 1MI5E 2DAVA 2PXYA 3BZFB 4NHCL 1JGEB 3G6JB 3LKSB 2AXFB 5CINH 4DN4H 3C9NA 3MLXH 4QHKI 2ITCB 2OR7A 4LPCA 4OGYH 1P6AB 1RJYB 3S98A 1SBBA 4YXKL 3TBSB 4TRPL 2GTWB 1A0QH 3OHXB 1JUFB 1MHCB 1Z2KA 2YRZA 4HCRH 5I1IH 1ZT4A 2EIZB 4NSKB 5B4MC 2Q76B 5F9DC 3VFSB 4PLJD 4PRHB 1S5HA 4I3RL 2P7TA 1MFEH 3D39B 3EYFB 4UIMA 3EO0A 2J5LC 5FYJE 1G6VK 2NNAA 4P0DA 5F70A 5I17A 1S8DA 2FB4L 2I60L 1XR8B 4XC3L 2UWEA 3VFGH 4W4NA 2ZOLA 2VABB 3GRWH 1J7VR 4P5TC 2A74A 2PNDA 3C2SA 5TQ0H 2I5YL 3QUZA 1IQWL 1S9YA 1D5XB 4MQXD 4NP4L 1FBIL 2CDFA 1B90A 1B4JL 5SWSA 4N0FB 1BZ9A 5F7DA 4OCSH 4PGJA 4MX7B 3EOBA 1S9KC 1IC4L 5K9JL 4KUCD 2BSSA 1J10A 1H0DB 5IMMA 1WBZB 5BZWB 3BP5A 4WO4C 4F15B 3VD9A 4RNRB 1S9WB 3RVXC 1KCRH 1KJ2B 1F90L 1S7UA 3V6OC 4LVEA 1G9NH 3GI9L 4GUPA 5IIEB 3PGCA 1X5ZA 2ICWB 3X3GH 3T3MF 4YHOL 3HUJA 1U3HC 1S5IL 3EUUA 4P46C 3ARRA 5HI5C 2XTJE 3FQUB 4O51A 2B4CL 4X4ME 4Y5XB 4KDTA 3K2UH 3KNBB 3U36A 3MJ7A 4WEBH 5LQBH 1OGAB 2DIBA 1SVCP 1FL3B 2EXWC 1VGEH 2Y23A 1FCGA 4WUKH 2OXHA 3C5SB 4XVTL 2BJML 4WUUE 2MCPL 1VCAA 2QSVA 3IDYB 3BZFA 1RUKH 1LP9E 1JGEA 3G6JA 3LKSA 3VI4E 4OFYD 1G1YA 3TN0B 4LGPB 4Z8FL 4YE4H 4WEMB 1RJYA 2W9DL 5IMLA 4HUMB 1BQLL 4N68A 3TBSA 3CIQA 3IS1X 1FNLA 32C2B 2GTWA 5F6IB 1JUFA 2Z4QB 1MHCA 4BFIB 4XAWL 2G75B 1AP2B 1IEBA 2UY6A 2P46B 2AJYH 3WUWG 5KW9H 1ACZA 2EIZA 4NSKA 4X6CB 1J86A 2Q76A 3VFSA 2IPUK 4PRHA 4WFED 4TVPD 2QQLL 5HYJD 3IKCB 3BESR 4NHCH 4UI2A 1GRWA 4MVBD 4F7MB 2E6QA 1QRKA 3ARZA 3PDDA 4PTUB 2VABA 3OJ2C 4YXKH 3KR3L 4TRPH 1KB9K 2H3NB 2XA8L 4ZFOL 1D5XA 1RULL 4Z76B 1U2CA 4N0FA 4POZD 5E2UL 2D7TL 4MX7A 4YHYC 4JB9L 2BRRL 4OZGE 2H2SC 3RWFB 4NUJB 1WBZA 4PJCF 2IBZX 2GT9A 4H1LB 5BZWA 4I3RH 1NBQA 2IPKA 4LVNB 1V3KA 4L8DB 4RNRA 5C08D 1S9WA 2FB4H 5F7YC 3KPSB 3T4YB 5CLWA 5DJ8B 5INCB 2I60H 4PJGA 3VRIA 1ZVYA 4XC3H 2GFBB 5IIEA 2H45A 2ICWA 5I1KL 4XP9L 4I3SL 4JQXC 4F7EB 5IUSA 3C8KB 2VZUA 5GRVK 3FQUA 4LNRB 3RJQB 2I5YH 1IQWH 4PBVC 4Y5XA 1NAMB 4NP4H 4J1UB 1FBIH 1B4JH 1NMAL 1OGAA 1SQ2N 4RMSA 1F4HA 1FL3A 6CGTA 5D1QB 1IC4H 5K9JH 3GBNL 3C5SA 1ZA3B 3O0RL 3Q5OA 3VE0B 1TITA 1AQKL 3LSOB 3SE9H 4RISL 2W9EL 5GRZA 4BSVB 1F90H 3TN0A 2MHAB 4L3AA 1A9BB 5D9SB 3GI9H 1VACB 3MODL 4ZUUB 4YHOH 2EEBA 1S5IH 5BS0E 3RZCD 3NOIA 1CLZL 4C54A 3DSFL 4PJHF 2VDOL 2B4CH 32C2A 3UJJL 4XHJC 2Z4QA 3IDIB 5E2TL 4R9HA 4BFIA 1CI5A 1AP2A 1BBDL 1IGML 5TJWK 5SV3A 4XVTH 2BJMH 2WBKA 2MCPH 2VQ1B 4PG9B 3CFJB 4YC2C 3IKCA 4J3WA 3O8XD 1SJHB 4Z8FH 4F7MA 3N1QC 4IRSB 4D0CB 3CXDL 1KEGL 4PP1C 3UPRA 4BK4A 3OMZA 4OZHA 4PTUA 1A6VL 4ZXBB 3UTSA 3IDJA 2W9DH 3VD7A 1URLA 4OM0L 4BFBD 3PHOB 3DETC 1CBVL 2PETA 3O6ML 4Z7UF 3RX5A 4CNIB 1K85A 3GSVB 5C0BD 4XAWH 5F89B 1ADQL 1I7TB 3PE9A 1PZ5A 4MZ2A 3L3DB 3RWFA 4NUJA 4H1LA 3MGAA 2QQLH 1EBAA 1NQBA 4L8DA 3QIBB 2F58L 5FDYA 3T4YA 3KPSA 3WN5A 5DJ8A 5INCA 5D1ZD 4YWGL 4ENEC 2IWGA 2LAGB 4ORZC 3GGWB 1UM6L 2HLAB 1NMBH 2NY0D 4RRPG 4F7EA 1T2QL 3KR3H 3C8KA 2M2DA 4LNRA 3T0EC 2XA8H 4F80A 2NY3C 1RULH 3HPJB 4NZDA 2BVUA 4J1UA 3MRGA 4OLZL 3OF6D 3BPLC 2ADIB 3BKML 4L4TB 5E2UH 1Z6JT 2D7TH 5D1QA 4JB9H 2BRRH 2IH3B 1ZA3A 5C0ND 4KK8D 1JMXA 2YD3A 4YHKL 5C6TL 2Q7NA 4TNVF 1IRAY 3ZE0E 3ARXA 4R26L 4AIXA 3NH7L 3LSOA 5F7NC 3S3PA 2MHAA 1MI5D 2F5BL 3RTQB 1A9BA 3B9DA 2OMNA 5D9SA 1VACA 2I24N 4ZUUA 5I1KH 4XP9H 4I3SH 4OZIF 4F7TB 4HX1B 3GMNB 3EJYD 3P73B 2CKBB 3FT4A 4YX2L 1T66C 3Q3GA 1NMAH 3IDIA 3HN3A 3OR7B 3GBNH 5JW3L 3O0RH 5FGBC 5DURD 4MQTB 1YEIL 2VQ1A 1AQKH 4PG9A 5BRZD 3KPRE 4RISH 4FQ2L 2W9EH 1SJHA 2AK4E 3IYLW 5FGCE 4D0CA 1DE4B 3MODH 4IRSA 5GXBB 2Y6SD 4BZ1L 3H3BC 3FFDB 4S10A 4DGIL 2L0DA 2YKLL 2JTDA 3QWQB 4ZXBA 5DD6A 2IH1B 4K3GA 1R6VA 1CLZH 3PHOA 5GGSB 2GCYB 3QIWB 1UKQA 3DSFH 2VDOH 2NW3B 2VISB 3MRPB 4H20L 3UJJH 5C3TA 3K80A 2AEWA 3EOAA 5E2TH 5SV4A 4CNIA 3GSVA 5F89A 4UMGA 1NL0L 3MBED 3QT2A 1IGMH 5KVMC 5I8KL 1A2YB 1JF1B 3I6LE 3L3DA 4WHTB 3E6FB 2ZCHL 5F9WB 4LHQB 3KLHC 4GKOA 3HE7A 4JE4B 4PR5B 3ROLB 1W2KT 4PJDF 1BF8A 3CXDH 1KN2L 1KEGH 1RIVL 2HLAA 4NQVB 1A6VH 3L3KA 4ZSOE 3FHQA 4OM0H 5E03A 2ILLA 4IM8A 2X41A 3HPJA 3ISWA 1CBVH 1NCUA 1T4KB 1VFOA 5FYKU 2XTJD 2JIXB 3O6MH 4QEGA 3OPZL 3X17A 2ADIA 3MGTB 2ATPB 4OIIL 3B9KC 1ADQH 3ZMRA 2QL1A 3B6SB 2EICA 2IH3A 2VDKL 43C9B 1U8KB 3QULB 4NZJA 3W9EB 1T7WA 4MNGE 4MJIA 4WUUD 2F58H 4M4RA 3B83A 3RTQA 1I3UA 4YWGH 3PF2A 1KIPB 4MSWB 1UM6H 3CFBB 5L0QC 4W70A 1TDQA 2I9LB 2RAMA 1T2QH 4F7TA 3GMNA 4PJHB 3UTTB 2CKBA 2P45B 5M7QA 4OLZH 2R69L 2OI9B 3BKMH 3O2VL 5JA8B 1QUNA 3OR7A 5FO9B 5C6TH 4YHKH 4XWOC 4R26H 1QFUL 3NH7H 1KTLB 2BVYA 5C6PB 3QFDB 2F5BH 5B39B 1T7YA 3ECBB 2BY3A 4NQDB 3NIDE 1A1MB 1DE4A 3ZYIA 2CPCA 5HDBE 1GL4B 3DMMC 3FFDA 2H2PD 3IDGB 4X8JB 2IH1A 1UG9A 5GGSA 1K5NB 2GCYA 1X5KA 2PF6A 3QIWA 2VISA 4YX2H 4UAOC 3WKML 2HMID 1UQSB 4Z7UB 4HFWB 5D7SL 1HNFA 5JW3H 3HI1B 1JF1A 1KLGB 5K59F 4WHTA 1YEIH 2YPLB 2WWKO 3E6FA 1CFSB 4BQBA 5DD0L 3U7YL 2FX7L 1HK6A 4OIAA 4FQ2H 4FFZL 4QY8B 4HIIB 4DUVA 4PR5A 3ROLA 1RJLA 1S7WB 4BZ1H 1BWWA 4NQVA 4DGIH 2YKLH 4N1EA 3UBXG 5E0QA 1W72L 2C1PB 3HNVL 1R3LB 4H20H 4JO1L 1D9KD 3SDAD 1MEXL 2JIXA 3V6OE 4YO0B 1TZHB 3MGTA 4FHBD 2ATPA 5F71A 3QO1B 1NL0H 5HI3C 5FUCE 5JTWA 2XN9E 5I8KH 3B6SA 4LHUD 43C9A 4CDGC 3A6OA 3QULA 3W9EA 3ZO0A 3B5GA 2ZCHH 3O4OB 1WJ3A 1OWRM 4EI6B 3FL7A 5JOPE 4L8SC 1FZJB 1NFDE 1KIPA 4MSWA 4MHHG 4B7LA 1KN2H 3CFBA 1RIVH 4LLUB 2I9LA 1KT2B 4YXLL 4OZIB 4HDIA 4OD1L 3MBXL 4P2RB 1Q9WB 4PJHA 3UTTA 5C2BL 1SYVB 1S7TB 4NO0B 4Z7WF 5BS0D 3OPZH 2KPNA 1OY3B 4M93B 4OIIH 3BPOB 4JQIL 2WIMA 5FO9A 1FL5B 2VDKH 3MNVB 3G6AB 4PRPB 2CMRL 1KTLA 1CD0A 4OF7A 4NJAL 3QFDA 5B39A 1DR9A 3OAYK 4NQDA 2DQEL 1A1MA 2JJSA 3SCMD 1CL7H 2FYYB 4X8JA 2NPLX 1K5NA 3ZKMC 4NT6B 3L5XL 1A7NL 4YFEA 5IFJB 5DJCB 3SDXE 3HUJE 1UQSA 4ODUB 3TGXA 3MA9L 4HFWA 5FM8A 3O2VH 3OKYA 3SKNB 2EZ0C 4E5XA 4RMUA 1FFNA 1KLGA 2YPLA 1CFSA 4NM4L 5E9DB 5B38B 1UM5L 1QFUH 3QDAA 2APXA 3ARFC 5GRWA 1TPXC 12E8L 4QY8A 4HIIA 1XIWC 4HGMA 1D5ZB 4JZOB 4P9HC 1S7WA 4PJDB 4M1DL 5D2LA 3TH4T 1QVOB 2D3VA 3FJTA 1HQ4B 5KANG 3BPNB 4HGKC 5F1SA 2C1PA 1R3LA 3V52L 1K8IB 3WKMH 4R2GD 4YO0A 1BECA 2ENSA 2HFFB 1TZHA 3LDBB 1TQBB 5D7SH 3QO1A 3KGRA 4ZNEE 3IAPA 2CIKB 2X89A 3V6BR 5DD0H 3U7YH 1MSPA 2FX7H 4EI6A 1RHHB 4FFZH 3MRLB 3QEHB 5DEGB 4B0MM 1FZJA 4YQXL 1ZLUK 4NRZB 5E1HB 4KK9C 4ONGL 4LLUA 2O93L 1SMOA 3D39E 4XGZB 1JE6A 1KT2A 4RQQB 3I84A 2EEDA 1N5YL 4OZIA 1W72H 1EAJA 5EOCL 1UJTA 1Q9WA 4A6YL 1SYVA 4JO1H 4NO0A 3KPQB 4XP4L 2RGSA 1MEXH 3E3QC 4G6AD 3QXAB 4RMQA 4I0CC 3VI3F 1FL5A 3MNVA 1WEJL 3G6AA 4PRPA 2ORBL 3DGGB 3PWNB 1W8NA 3WO4B 3CLFL 2PW1B 4AIOA 5EOCJ 1JZ6A 3GJFH 4HD9A 2X1WL 4D8PB 1KG0A 1MY5A 3KPRD 4EI5D 4OCMC 5E8EB 3VMNA 1CQKA 1TNNA 5C0GB 1Y6KR 1LQSR 1S7RB 1ZT7B 2AK4D 2FYYA 1QR1A 3JTTB 4YXLH 4KY1H 5CZVL 1PKQE 1VB9A 3TIEB 4OD1H 2I25N 3MBXH 4N90E 5C2BH 3BJLA 2HAZA 5DJCA 5IFJA 5F7EL 4ODUA 3SDDC 1H15B 3AFLA 5E94B 4NZTL 4XNQB 3SKNA 4JQIH 4Z7OF 4WFHD 5E9DA 5B38A 2CMRH 1H3XA 1DUZB 5DQJB 1CXEA 4CGTA 3JZ7A 3T77B 4NJAH 4F7CB 1D5ZA 4JZOA 4XH2B 2QJDA 4UOW1 2DQEH 4PJDA 3V6ZB 1YNTB 1U3ZA 5C07A 3TZVB 5HGHB 3O3EB 1QVOA 2IAMC 4ETQA 3LEYL 4M7ZC 4A2LA 4Y4FD 1JGVL 4JGJA 5KZCB 3GNML 3PL6D 3L5XH 1A7NH 2HJFB 3MLYL 3B9EA 3T3PE 4KKAD 4NBXB 4QCIA 4S11A 5HHOA 2VDML 2V5TA 1C5DB 3ZKXC 2ESVE 3MA9H 4KRPB 5CLTA 1OB1B 3CAFA 3QUYD 3QWRD 2CIKA 4JGUA 3U48A 4BQ9A 3T0EE 4NM4H 3UJIL 5KSUB 1UM5H 5HHPB 3QP3A 1N8ZB 1ZLWH 1RHHA 5DEGA 12E8H 3MRLA 3QEHA 4U1LB 5CS7A 1YNKL 3I6KB 4X6CE 2GQHA 1TVDA 2VLRA 5EIVA 4M1DH 4HMDA 4XGZA 4RQQA 1LK2A 2NY7L 3S37X 3B5HA 4N9OB 3V52H 3KPQA 4Z7WB 1QLEL 5ITFB 2UV3A 3V4PL 5ESAB 3NA9L 3QXAA 4WHDA 5MP6L 3ARDD 3ME0A 3WUWB 3DGGA 3PWNA 5EPMB 4QRUB 1MFAL 1GOHA 1QZ1A 1KC5L 4R4FL 1EFXB 4APQC 2PW1A 1ULVA 1HIML 4I18B 3UAJD 1G9EA 5MHSE 4WVRA 4YQXH 4D8PA 2VXQL 4ZAKD 5D5MF 5E8EA 5C0GA 3BISA 1TTFA 4L9LB 4ONGH 5D1XB 4OQ1A 4DZ8B 1S7RA 1ZT7A 3NCMA 5CP3H 3JTTA 4LGRB 1N5YH 2C4FU 3QJFB 3TIEA 5B4MD 1KTDB 5EOCH 3JV6B 4A6YH 1S7VB 4XP4H 2VE6B 3QHFL 3JUZA 4K71C 5K9OB 1H15A 2VSCA 5E94A 4K3DL 2DIAA 4FFYL 4XNZB 4XNQA 1DBBL 4PGCB 1GIGL 2DYPA 3BGAA 1L7TL 3ULUE 1WEJH 2ORBH 1IEHA 3T65B 3SJVE 4ODXB 3CLFH 1G9MC 1DUZA 2F54B 3M8OL 5DQJA 4P5TD 4RGNB 3T77A 1JNLL 3W0WB 4F7CA 5IQ9A 4HAFA 1OHQA 1X5GA 1K4CB 3A0OA 4YZFF 4P23C 5L2KB 3MQIA 3R8BB 4IIQA 3V6ZA 1YNTA 3TZVA 5HGHA 4PRNB 1KPVB 5CZVH 4LLYB 2HLFC 4WV1B 1G1CA 2VWEC 1L9NA 2HJFA 4M7JL 1JWSB 4RWYL 5F7EH 1C5DA 3OSKA 4NZTH 3WNNA 3RVXD 2EKJA 1OB1A 2DLTA 3QG6A 3HCVB 4WU7B 5A2JH 3DPBA 4P4RB 2R0WL 5KSUA 5CUSL 1U3HD 1QLFB 2XN9D 3Q6FB 4HKBB 2NYYC 4P46D 1N8ZA 1EJOL 4U1LA 5LJYH 3I6KA 1H3GA 4KK6C 5JOPD 2VDRL 2EXWD 3LEYH 1JGVH 4LEOB 1NJ9B 3C5ZB 4PJXF 3GNMH 4KQ4L 3CUPB 3MLYH 3KXFB 3MLTB 4Z7WA 5ITFA 2X4OB 2VDMH 3TO4B 1JZ3A 2BVOA 5ESAA 4JJ5B 1OP5H 1KB5L 4PY8I 3WUWA 1OQOA 3H2WA 5EPMA 4KJQC 4QRUA 3WIHA 5IMOB 3UJIH 3BSZL 1EFXA 4JFFE 3N85L 4I18A 1IAII 3JBG7 3ORJA 4F33B 5F96L 4OD3L 1YNKH 3RWEB 5I71B 1K2DB 1IM9B 3ET9F 4L9LA 1KUMA 4R0LC 5D1XA 2NY7H 3QJFA 1QTYT 3U0PB 3VGFA 1KTDA 3JV6A 1S7VA 2VE6A 2P44B 1QLEH 5IV2B 4HQQL 5K9OA 3T3ME 4NNYB 3V4PH 25C8L 3EGSB 2EDNA 3WFZA 3NA9H 4PGCA 3RWDA 4G43B 5MP6H 4JREB 1MFAH 3T65A 3TM6A 1LE5B 1KC5H 4R4FH 3WO3B 1K3ZA 4N0CD 4L4TE 1HIMH 2AGJL 4K3JL 2F54A 1BX2B 3K3QA 3W0WA 5IM7B 3BKJH 1WICA 2VXQH 4QRQB 1K4CA 1EV2E 4WJ5B 3CFCL 4YHIB 2H41A 4PRNA 1KPVA 3D48R 3DX8B 4LNVA 2H2SD 4WV1A 4XPAL 1JWSA 3QHFH 1FG9C 3HTLX 4K3DH 4FFYH 1DEEB 1DBBH 1GIGH 2PR4L 1L7TH 3HCVA 4WU7A 2F19L 1T1XB 4P4RA 4JHWL 1EO8L 4YEEA 4HKBA 3Q6FA 4LFHD 3M8OH 2OJEB 4N1CA 1JNLH 1MCEA 4NQCD 4PV8B 3BEWB 1INDL 4HJ0C 1NSNL 4GS7B 3UCRA 3K8KA 1B6DA 4LEOA 1NJ9A 1KYOJ 4ZOEA 3F12B 3D39D 2AV1B 3CUPA 4M7JH 5BMFH 1H3VA 3MLTA 4RWYH 2X4OA 3NGBC 3QPQC 4JJ5A 5J3HC 1FSKB 4U1HB 4M61B 4MJ6B 2GJ6E 3WYRA 4X0KB 2HT4C 5IMOA 5K9QI 5EDXA 2R0WH 5CUSH 3JVGC 2J4WL 3T09A 1G6RB 2XT1B 4F33A 4C56B 1EJOH 1JL8A 1K6QL 4NWTL 3RWEA 4W6WB 1MCHA 4E0RB 1K2DA 1IM9A 4YHZL 4PJCE 4XHJD 5I15L 4PRIB 2VDRH 4TUKL 3Q5YA 3U0PA 4HS6B 4KQ4H 1FLRL 5IV2A 4NNYA 3KHOA 3EGSA 5GRVL 4G43A 1W0YT 1KB5H 3RWHB 3GK8L 3BSZH 1J8HB 4YFDB 3N85H 3R4DA 1CGTA 1BX2A 3BN9D 5F96H 1QOKA 5IM7A 4OD3H 4M4PA 3GSUB 3MOAL 4QRQA 3T2QA 2N7BA 2X1OA 4WJ5A 2VZ3A 3MOBL 4P5MB 1DLFL 5CGTA 4RRPA 1IGFL 3DX8A 3O3BB 3VFMA 5F3HB 1CICB 2NY4B 4EDWL 4HQQH 4FP8L 3Q5TA 1CE6B 2F5AL 1DEEA 5TF1L 3F7YB 4KMLB 1ZTXL 4DVBB 4ENED 4K8RD 5DHVB 3G04A 3WHE0 2ESVD 2IC2A 3VG0L 1T1XA 2DJUA 3MZTA 5EUOB 4K3JH 2HT3D 2OJEA 1BFSA 3T0ED 4YK4C 3CFEB 2NY3D 4PV8A 5C0CE 1FVDB 3CFCH 3CDCA 4N5UA 4PJ8B 2AVGA 2GY7B 1WFNA 4UNTA 2EDHA 3F12A 2YZ1A 3FQWA 3O6KL 4OT1L 2AV1A 4XPAH 1ITBB 1F6LL 1YMHB 3BT2L 2Y5EA 1X7QB 2PR4H 4U1HA 4M61A 1R5IB 4MJ6A 4X0KA 2F19H 1PSKL 4JHWH 1EO8H 1OT2A 4Z7UE 4EN3C 4OLYL 1QSED 5JXEA 1G6RA 5JHDA 4C56A 3E3QE 3EYQC 3QQ3A 1T66D 4G8GB 3V9FA 1INDH 4GKSB 4XNXL 1JYVA 1NSNH 4QOKE 1F58L 3VRLE 2CDGA 4HS6A 1WIPA 3PWLB 4NJ9L 1MHPL 2PYEE 3RWHA 3M17B 4NRXB 2J6EA 2B8OT 4NKIL 2C3WA 1J8HA 3GO1L 3N1FC 2J4WH 3I9GL 1I7ZB 1K6QH 1R3HB 5CEYB 3SJVD 4NWTH 2Y36L 3GSUA 1SJVA 1AKJB 5C0AA 3IRPX 4YHZH 5I15H 2WWMC 4P5MA 5DD5L 2CUHA 1A6ZB 4TUKH 3UBXB 3DLQR 1SMAA 3CJJA 3H9HB 3O3BA 4JR9L 1AC0A 1OP9A 5F3HA 5A2IH 1FLRH 3BW9B 4LIQE 1CE6A 1QD0A 5IGXH 3JWDC 1X5IA 2PXYC 3F7YA 4DVBA 1FNHA 2V2WB 4P2RE 5DHVA 4D3CL 3MX0A 5EUOA 4FRWA 3CCHA 5HDLA 3CFEA 3MOAH 1FVDA 4LLAA 2Z31C 3MOBH 3B9KD 4BJLA 1DLFH 1F11B 2FLBT 2NTSP 1IGFH 1JK8B 3ALWA 1A8JH 1HHJB 5D7KE 1YMHA 4EDWH 2VLJE 4FP8H 4WGVB 2F5AH 1X7QA 3MNWB 5TF1H 2LVCA 1ZTXH 3RY5A 3VG0H 4Z7VE 4Q7DA 2DQJL 5HVWA 1CGVA 4JVWA 2X7LB 1EX0A 5L8KB 5C0EB 5IB1B 1NLDL 4HUWB 5GZNC 4JFFD 5DHXB 3ILPB 1A6PA 5F7WC 3S36L 1FG2B 1WFOA 3QUZC 4GKSA 1BREA 4AM0B 3GSOB 4JFQB 4MB3A 4L3EA 1N7ML 2BCKB 5HYQB 4OT1H 3O6KH 3ARSA 4XWOD 3DYPA 4PJDE 1FO0B 3IVKB 4DN3L 3BT2H 5IHZB 2ZSVB 4U0RB 1KLUA 3PWLA 3FRUB 3KG5A 4JPIA 3K2MC 5E95B 1IT9L 3GI8L 3M17A 4NRXA 4XPBL 3DMMD 1BMGA 1PSKH 4B7IA 4FMKA 2HFEB 1F8TL 4UILL 3AU1B 5TDOB 1I7ZA 5CEYA 3TYFA 2YA1A 5FA4B 1AKJA 5JLZB 1YNLH 2CD0A 4X9IA 1R24B 2Y06L 4XI5C 5DVNA 2YK1L 4XNXH 1B0RB 1A6ZA 1QKZL 1F58H 3UBXA 5JQ6L 4X6BB 4R3SB 4ACPA 1I1YB 4KTDL 2J3SA 2H9GB 4D9RE 4BH8B 3WKNA 4W68A 2J8OA 1XGYL 4NJ9H 4ODWB 1CLYH 5SWZD 1FC2D 1MHPH 2V2WA 4KJWD 4ZOBA 3W82A 1N5AB 3PDGA 3T2PA 1QFWL 4NKIH 3VFTA 3GO1H 5T3XL 3MREB 3X11B 3I9GH 2Z0BA 3MLRL 5I73B 2IBBA 4XVUC 2JJWA 3DVIA 4ERSL 2Y36H 1VPOL 1UH4A 2AEIT 5F88B 1VGKB 2R29L 5DD5H 3MNZB 1J0YA 1F11A 5HI3D 3T1WA 2P5WE 4KPHL 1KCVL 1XGQA 1JK8A 4JM2F 2XKUA 1HHJA 3NZ8B 5EULV 4H0IA 2GY5A 4NYLB 1FDLL 4O5LL 1EZVX 3EO9L 3TYGH 3MNWA 5D7LA 3DRTB 4Q2ZA 4D3CH 3WLWC 3QR2A 1N0XH 4FQIL 2DLIA 2X7LA 2GJ6D 5C0EA 5CEZE 1B0WA 1E28B 4HUWA 2NXZD 5J8OA 3MROB 2DQCL 3ILPA 5TF0A 5K59E 4NRYB 1F4YL 2W92A 4ZO9A 1FG2A 4AM0A 2VC2L 3GSOA 4JFQA 4FQCL 2BCKA 5HYQA 4WGWB 4MD4A 3Q1SL 1FO0A 3IVKA 3DHJA 3JSSA 4ZOCA 5HHME 3ZT5A 3RWCB 5IHZA 2ZSVA 3DGCR 3FRUA 2CR6A 4S0TD 1U3JA 2HN7B 4F15C 2P4AB 4ZOAA 3R0NA 4TTGA 3HPLB 2CLRB 4EUPH 4IHOB 2NR6C 2DQJH 2HFEA 1OTSC 2ADJB 3AU1A 5TDOA 3HAEB 5C1MB 1NLDH 4N8VG 3ZKMD 4M9OA 4WFGE 2WK2A 5JLZA 2G5BB 5H94B 3D69B 3S36H 3AM8C 1B0RA 1F97A 2FL5B 5H37G 4JFHE 1N7MH 4X6BA 4R3SA 2JJVA 4OB5L 1JIBA 1I1YA 4ZS6C 1PKOA 3W5MA 1YEKL 2H9GA 4DN3H 2NXYB 4Y16B 1IT9H 1XIWD 4ODWA 1FYTD 1EEYB 3IDYC 1T1YB 4XPBH 4XAKE 4Z7WE 2EECA 3U30B 3WFCL 5FDWB 3TN0C 1F8TH 4UILH 2HWZL 3MREA 3X11A 5I18L 5C0DB 3MUGB 3O9WA 2FDBP 5F88A 3O2DA 4GAJL 4LLWB 2YK1H 1VGKA 3E8UL 2R1XB 3F7RA 1QKZH 4HPOL 5C0CD 3MNZA 5JQ6H 5F6IC 5JORB 4FQPA 2FIRT 3NZ8A 4RAUB 1RMFL 4KTDH 4NYLA 3BQUC 2P1YA 4HF5L 1AQDB 1QHPA 4LCCB 3FFCE 4D9LL 4JY6A 4J4PA 5IF0A 2OTUA 1XGYH 5HYSG 2CRIA 4ELMF 3BUYB 2VITA 3DRTA 3ZHLA 2W38A 1QFWH 2IMMA 4KK9D 3MJ9L 1VADB 5HPOA 5T3XH 3QDGB 3MLRH 5HHQB 2F8OA 1E28A 3VRJB 4DOHE 5C86A 4ERSH 3MROA 1VPOH 3VA2C 4NRYA 3B5TA 3FOLA 4NOFA 4P9HL 4I0PB 4UV7L 4RFOL 1P84J 2R29H 3P4NB 5CEXB 2UVFA 5FOJA 4RGNE 3W0WE 4KPHH 1KCVH 4UBDD 5A1AA 5L2KE 1EHAA 4QOKD 4RA3A 1GVIA 3RWCA 4CDHA 1ZV5A 1FDLH 5DXWA 4O5LH 3EO9H 5H37H 1GC1C 3IXTB 4M3JA 5ITBL 5EO1B 3HPLA 3W2DL 2VZSA 4KVCL 2CLRA 4H0HB 4IHOA 4FQIH 3WN5C 1BD2E 2PYED 2I26N 3HAEA 3UTQA 1HH9B 3OJVC 3RGVB 4AY0A 2NX5B 4BH7B 2DQCH 2BVPB 2G5BA 4QHNB 4HUVB 3D69A 1F4YH 3SKMB 3SDDD 1YY8B 3HMXA 2VC2H 4NQXB 2FL5A 3FOMB 4FQCH 4ZODA 5EOQL 2AABL 1N59B 3Q1SH 4KZEL 5D1QC 4AMKL 1NC2B 2VLME 2GITB 3X14B 3LPFA 2JKXA 4Z78B 4KRLB 4Y16A 3MLWL 4O9HL 1DQQB 3KXFE 4JEGB 4PD4J 1AJ7L 3VWKC 4AG4L 3VI3E 5C0DA 1G84A 1I7RB 3MUGA 2Y5TB 2D7OA 5EZOH 3BRFA 4LLWA 1GGUA 2ENYA 3TH2T 4EIZC 4OB5H 3STLB 5EUKB 1Z5LB 4BZYA 4RAUA 4JM2B 2EDTA 3WE6A 1YEKH 4KJYB 5EOTB 1UM4L 3KLSA 4LCCA 4XP6L 2P8PB 4GKZB 5D7KD 5GGRB 2X4QA 4PUBL 2GK2A 1NUFA 4HUKB 3SBWC 3BUYA 4YBLB 5HYFA 2VLJD 4LOUC 1T7VA 1EUTA 1VADA 4RFNB 3WFCH 4NKOB 5DFTA 2HWZH 5HHQA 3VRJA 3I85A 5I18H 1AGBB 4ZXBC 4Z7OE 1FZKB 3NCBB 3AMLA 4O2FB 3BIAX 2P49B 4GAJH 2G60L 4I0PA 3E8UH 3P4NA 4HPOH 4GW5B 5CEXA 2VZVA 2BRQA 4YHLL 3OAYH 1EGJA 1RMFH 4OV5B 3OKDA 4HF5H 1Z9SA 3L3OB 4D9LH 5AD0B 2C9AA 3QWOB 5ANME 3IXTA 3CVHL 1QBAA 5T1LB 5EO1A 2CXGA 3HE7C 3V4UL 1U9KA 3MJ9H 2MKWA 4KUZL 1EH9A 3QIUD 1HH9A 3L3JB 3RGVA 3DBXB 2NX5A 4JFXB 4BH7A 2BVPA 4QHNA 3QRFM 4HUVA 3SKMA 4P9HH 3R1GL 4UV7H 1YY8A 4RFOH 3TIDB 1OP3K 1VDGA 4N0UB 3FOMA 1T5XB 1I8LA 1UCBL 1N59A 3SY0B 1LE9B 4Y88A 1NC2A 3X14A 4R96B 1NCNA 4Z78A 1NC4D 4FQXB 5ITBH 2WBJB 1WWBX 2VDNL 3W2DH 1DQQA 4P23D 4GBXD 4KVCH 5DJYB 4Z0XB 2PCPB 1Z0MA 4WRLA 2JF1A 3RHWK 5FCUL 1MIEL 2HLFD 3BJ91 2KL6A 1I7RA 3V0WL 2Y5TA 3RIFF 4OQTL 1NCDL 3L95B 1ZLUH 5EOQH 5EUKA 1Z5LA 1X5HA 4JM2A 2DL2A 5D5ME 3RQ3A 4KZEH 1C1EL 4PRIE 3L5WA 5EOTA 2P5WD 2H32H 2NYYD 3DV4B 5JHLL 3LD8C 4GKZA 2BK8A 2DQDL 5GGRA 2FATL 3MLWH 4O9HH 4ELMB 3D25B 1JP5A 1QHOA 1Z9OA 4KK6D 3HE6C 1AJ7H 1FVEB 4NKOA 1G9ML 4AG4H 4S2SB 1ZHNB 5HGBB 2C3HA 1YUHB 2YUZA 1FZKA 2ERJC 5HSFA 4G8IB 4O2FA 1JWUA 1CXIA 2ZKHL 3WFHB 3VFVB 4UB0L 1J8HE 5CEZD 5JIIA 1JHTB 4FFWC 4N9GB 5DSCB 1P9MA 3S88L 4HK3J 4KJQD 5DA0B 4OV5A 2FHBA 1UM4H 3QZWG 3L3OA 4GLRH 5AD0A 4XP6H 3QWOA 5T1LA 4PUBH 3TCLB 2BY0A 2ARWA 5HHMD 1RZ8B 1ZLVK 1KBGL 2QSTA 3KLAB 1M7DA 3MUJA 3VXMD 2PN5A 5IOPB 5KAQG 3E6HB 3L3JA 5D93B 4WWKC 3ZE2F 4EXKA 3DBXA 2A0LD 4JFXA 2VN4A 3BDYL 4MJ5B 2G60H 4F9PA 4HUXB 4N0UA 4WFGD 1T5XA 3GM8A 4DKEL 4YHLH 4YDJA 1H5BC 3FCTB 3SY0A 4CL7A 1LE9A 4JFHD 3Q6GL 1I9EA 4PBXA 4YH6A 3CX5J 4R96A 3CVHH 1O7SA 4FQXA 3BOVA 2WBJA 4PJXE 1UWXK 1I3GL 4OTXL 4JO2L 5DJYA 2HRLA 3V4UH 4KUCF 1T20B 4DFIA 1NFKA 3OG6B 4KUZH 4XAKD 4PLNC 5DEFB 1YA5A 3G5VB 5EU5B 4JZNB 5E6IB 3R1GH 2OLDA 1P7QB 5B8CB 4N5EC 3L95A 1OTTC 4FXKB 3IDUA 3UYRL 3WEXB 1UCBH 4G8GE 5CJBA 5FUZL 5TE6L 1CG9B 1J9CT 3DV4A 2VQTA 2MTPA 3BHBB 5DK2B 4JVUA 4KXZH 3D25A 3FFCD 2VDNH 4QRRB 4ELMA 2FHCA 2NZ9D 3VW3L 4LHUG 1FVEA 4OCNC 4KGLA 4P2QD 4AIZB 4S2SA 4XMKL 2UYLB 1U92B 1MIEH 5FCUH 5B21A 4KHXL 1YUHA 3V0WH 3VD5A 5DZOA 3WFHA 4KVNL 4OQTH 1J88A 1JHTA 1NCDH 4N9GA 5DA4A 5DSCA 1FP5A 2P47B 1D3CA 5J3HD 2EKSB 3NMEA 2HT4D 4V1DA 1U93B 4FQLL 3FN0L 1C1EH 4D2NA 5JHLH 1BQHG 1F02I 3GSNA 2DQDH 1OD7A 2FATH 3BUTA 2AEPL 3JV4A 1FC1A 2YR3A 3X3FL 3PP3K 1RZ8A 4O00A 1CGXA 5TPWL 5KG9A 5IOPA 1AO7B 1G9MH 3E6HA 2Y07L 2FO4B 1BD2D 5H2BB 5GSVB 4EDXB 2HP4A 2ZKHH 2I27N 4HKXB 4UB0H 4HUXA 2A6JB 5FM4A 1QSFD 3S88H 3FCTA 4JQVA 2NTFB 1FE8L 2V7NB 2X4TB 1RUQL 4C55A 1YPZE 4U3HA 1T0MB 5DWUL 3O4OC 2VLMD 4G5ZL 1CDGA 3C2AL 5D6DA 2ZP0T 1KBGH 3C5ZD 1BFTA 1J0ZA 1PX4A 2F53E 3P2TA 4U0QB 3GRWA 5DEFA 3U4BL 3BDYH 3G5VA 2QSCL 5E6IA 2CO7B 2XY1A 1YYML 1P7QA 3LEVL 4QYOA 5B8CA 3CSYB 4DKEH 2DI8A 4FXKA 3W5NA 4POUB 3WEXA 3S34L 1HDMB 2AJSL 4M93C 1CG9A 3Q6GH 3DRQB 3BHBA 2WBWB 1KJVB 4TVSa 2HRPL 4QRRA 1I3GH 3V95A 1CFVL 4JO2H 1BVZA 4OTXH 3LS5L 3UTPE 5FYKL 1MCSA 2BSTB 4AIZA 4NNPL 2M26A 2EDDA 1U92A 3KPPA 5GS0C 4LMQI 1CVRA 3DUUB 4LLVB 3L5HA 2AW2A 4OLWL 3U7WL 2EKSA 4UUJB 5ERWB 3JXAA 3UYRH 4HLZH 3VFOB 1U93A 5FUZH 5TE6H 4KH2A 4XVSL 1LO3L 1UEMA 1Q8MA 1JTTA 2EXYC 4YAQB 1MCJA 3SE4A 2HT2C 3VW3H 3MRNB 2AQ2A 4LRIA 1AO7A 4MDJA 3HZMB 1CDIA 4XMKH 2FO4A 5E2WL 4G9FA 4KHXH 1WWWX 5GSVA 2YD2A 2XPGB 4Z7QF 4KVNH 4HKXA 5ADPL 3E2HC 2A6JA 1HWGB 1EA9C 5D2NC 4KK5D 4LPWA 1Z9MA 5L9DL 1C16B 1KN4L 2E7CA 1TQBC 4KKBC 1S7QB 3FN0H 2V7NA 2X4TA 3ES6B 2IAND 4Z18A 4L4VE 4XB7A 5DFVD 4NCDA 1T0MA 2AEPH 3X3FH 1YC8A 2WWMD 5TPWH 5IWLC 4JJHA 2DL9A 4UU9B 1DBJH 2Y07H 3BKCL 4ZUTA 5CJQL 1RZIB 5I74B 2QADC 2B2XL 5T5NF 1ZA6B 4Y89A 1E4WL 4IRZL 1HDMA 1FE8H 1DN0B 4YIQB 4AEFA 1RUQH 3DRQA 5DWUH 3WO4C 4OCLC 1KJVA 1HCFX 4GFTB 1SY6A 2DICA 2EDXA 3FO2B 4G5ZH 2EEAA 3C2AH 1ZE3C 1CIDA 2Z31D 4GXVL 4MLSA 2A77L 2CJUL 4X7EC 2MSPA 2BFVL 2BSTA 2JB6A 3A6BL 5TH2B 2VERN 3U4BH 1ROWA 4NO3B 1J5OL 3DUUA 3NACL 4JKMA 5M94B 1A6UL 1EBPA 4TTDD 4ZFOB 4LLVA 1YYMH 3LEVH 1M4KA 4R90L 4Q6IB 4PPTA 5DJXB 5ERWA 4UDTA 5KVDL 1C12B 3S34H 3VFOA 5J12B 3H8NA 3GSWB 4KI1A 2COQA 5IVXE 1KULA 4G9DB 4MD5B 3SGEH 1CGUA 2FIKA 3F6LA 1WCBB 2HRPH 2R39A 3JWDL 1FRGL 5C7XL 1CFVH 3L9RB 3VDAA 2QQKL 5FYKH 1B9ZA 3HZMA 3LOWA 4NNPH 4IIQC 3SPVB 5KVEL 5HYJB 1GOGA 4P49A 2XPGA 3PWJB 1OARL 3FO0L 4MJ2A 4OLWH 3U7WH 1C16A 1E4KA 2PTVA 1BFVL 3ES6A 3VFRB 4JY4B 4XVSH 5E8NB 1LO3H 5EU7C 3WSQL 5IVNA 4PJ8D 1G0DA 2X09A 3UPAA 4XI5D 4TNWF 3U9PL 4U7MA 4UU9A 3GMMB 5EBMB 2LU3A 1IC7L 3KWWB 4YXHL 5E2WH 1RZIA 1GYAA 1C7SA 1IAOB 1U36A 2FEDC 5ADPH 1BP3B 1CK0L 3QDGE 4WW2F 4QTIL 3D2UD 3ULVC 4ZFGL 5L9DH 4JRYE 5LVEA 1KN4H 2IADB 2YPKB 4PJIF 1DN0A 4YIQA 3HB3C 4NQSB 4CN4A 1RI8A 2VLKE 4G8GD 4LVOC 3SDCC 4PJEF 1E4XL 4XVUD 3VMOA 2W0PA 5BW7A 3FO2A 4WI6A 3ZTJG 4I18C 1A4KB 3V7AE 2P8MB 4HMCA 5TH2A 3BKCH 2IALB 4L9LC 5CJQH 4ZFZA 4LP4A 1O7VA 2ZUUA 4NO3A 5DUML 1DBKH 2B2XH 4DGVL 4PV9B 4OFYA 1DQJB 1H3PL 3VXOB 1T21B 4Q6IA 5DJXA 1G7MB 1E4WH 2R23B 4IRZH 3LB6C 4G80B 1FZMB 1R5VB 4DKAA 3GSWA 3V0VB 3WLWD 4C58B 3B8YA 3RZCB 3ILQC 4G9DA 2H6PB 1I1CA 4TSBL 4FNLL 3U79A 1CU4L 1OF2A 1WCBA 3W81A 3WCYA 2HH0H 3LPGA 2A6KB 3PIQB 1CGYA 1LWRA 4GXVH 4TUOA 2A77H 1UFUA 1YN7B 1WCQA 2CJUH 5J89A 3A6BH 1C5BL 4I77L 4Q74A 3SPVA 2LE9A 4OUOA 2JE8A 5HYJA 1J5OH 3NACH 2Q20A 4XZUB 3PWJA 1A6UH 5EA0L 1A7OL 3O8XB 5IFHL 5I8CB 4R90H 4Q58C 2DQFB 4KJPC 3G5YB 4FOMA 1OTSD 3VFRA 4JY4A 5E8NA 2M8XA 3VXNB 2FZ3B 4MAUL 3MV8E 3P40A 3JWDH 5DO2C 5C7XH 3MO1B 5C0BB 1JPGB 3CDYA 2QQKH 1QACA 2FR4B 5DMJB 2ZNWA 1TMCB 1KCSL 3KWWA 5KVEH 1AHWC 4ZS6D 4OZGF 4IOIB 1AGEB 2CKNA 2D2OA 1IAIM 5C08A 1IAOA 1FNAA 2F53D 1OARH 1KJMB 4U1SB 5IB5B 1PYWB 3FO0H 5SX5K 1FZOB 1CD9B 5EU3B 2NY0B 2YPKA 4NQSA 1BFVH 4CVXB 2VXVL 1I8KB 4HWBL 1QFPA 3D85D 3K1KC 3T2NL 5GIRB 4Y19E 3WSQH 1A4KA 2Y72A 3U9PH 4GRMB 1T2JA 1ZAGA 2EE6A 2P8MA 5I71C 1DZBA 1MAKA 5ACMA 2IALA 1IC7H 4LFHG 4YXHH 3UTPD 5FB8B 3QFJD 3BQUD 5J11B 2P8LB 1KENL 1DQJA 4U4BA 1J0HA 3VXOA 1CK0H 3UO1L 1HHGB 3QJHB 4QTIH 1G7MA 4ZFGH 3UYOD 4G80A 2AJZB 1FZMA 1ADQA 4OUUB 1R5VA 4M7LT 4HS3B 3RZCA 4AJ0A 1AR1C 5HGDB 2H6PA 2ICWJ 1E4XH 4HZAA 2A6KA 3PIQA 3UTSD 3KYNB 4Y4HC 1YN7A 5DURB 3VXSB 4NC0B 2LABA 4KRMB 5BRZB 4XZUA 3PWVB 4DGVH 3O8XA 5MEOB 1H3PH 5I8CA 5DQ9B 4U6HB 1VEPA 1Y0LB 1QPXA 4CADB 3QHZL 3HHRB 3J8F7 3G5YA 4Y4KD 5TDNB 4L1DA 3VXNA 4TSBH 4FNLH 1CU4H 4XCYB 2FZ3A 2ZUXA 3ARGC 4CJ0A 3MO1A 2R2BB 4L4VD 5C0BA 3MBEB 4KMQA 3O6LL 2GKIA 2FR4A 2I07B 4JZJC 4HHAB 4I77H 3DHMA 4IOIA 4GS7C 1AGEA 3L3IB 4FXLA 5EA0H 1A7OH 5IFHH 2GSIB 5C09E 4U1SA 5D1ZA 1PYWA 1FZOA 3MUHL 4WW2B 4NBZB 4KU1A 4K7FB 1X5FA 4PJIB 4HUUB 1FSKC 4CVXA 4EBQL 3VWKD 1I8KA 5GS1B 1DQML 3NABL 5GIRA 1GC1L 2VDPL 4QRTB 2XTJB 3OF6A 4MAUH 5I1DB 4XPGL 3UJTL 5JXEC 3WDHA 2FNBA 4GRMA 5IB2B 3T8XB 1WC7B 1Q0XL 1KCSH 4HIJA 5FB8A 2KUTA 2JJTA 1UJ3B 5D96B 3GBLA 5KS9E 4QWWC 1FNEB 4FQQB 3HLAB 2O26U 5FK9B 1MI5A 3M07A 1HHGA 5BXFB 3DXAE 1I85A 3QJHA 1CDCA 4MAYC 2AAVA 1MCFA 3U0TB 4OUUA 1F5WA 5FIEA 1FHGA 4HS3A 2VXVH 2DI7A 4HWBH 5HGDA 3T2NH 1A5FL 4S1RL 4LKXB 2K7QA 3KYNA 4XB8A 3G9VA 5IK3B 4D0BB 4AQOA 3RRQA 2FJGA 4XCCL 1U91B 1KF9B 5BRZA 3FQNB 3PWPD 3BIBX 3PWVA 3B2UC 5MEPB 1KENH 3GMRA 2W91A 3UO1H 3MRCB 5DQ9A 4U6HA 1RJZB 1Y0LA 4CADA 1VFAB 1DSFL 1HINL 4GAYA 4H1LG 5EN2B 4XP1L 3UC0L 1MJJB 2XKSA 5TDNA 3AY4A 4XCYA 3LEXB 2R2BA 1D5MB 1H3TA 1P4LB 2YMXL 1AIFB 2YHGA 3NCYP 2I07A 3KJ4B 2FX8L 1AXTL 4HHAA 4Z77B 3QCUL 4OZGB 2Q1EA 4RGMC 1NCWL 2NY2C 3L3IA 1IMHC 2GSIA 1WF5A 2AERT 4NFBA 2A6DB 4WW2A 5F1KC 4MJID 3QHZH 2QLVB 4K7FA 4ZDHB 4GW1B 3QDGD 3WL9A 3QCTL 4H8WC 5DC0A 1BLNB 2GW5A 4HUUA 4NFDA 3IRZA 4JRYD 2YBRB 5GS1A 1D9KB 3SDAB 1JYXA 4QRTA 4PY7B 5I1DA 2QEJA 4X4MA 2VLKD 3O6LH 1X4ZA 5IB2A 3T8XA 4YDLC 4LHUB 1WC7A 3WFBL 5KSVA 3MSPA 3MCLL 1YN6B 4JHBA 4S1DC 1UJ3A 2W65A 4QLRA 1FNEA 4FQQA 3BP6A 3HLAA 4WUUA 1VFUA 5FK9A 1AO7E 5BXFA 3VG9C 3U0TA 4PJ7F 2ARJQ 2PO6D 2X4RB 3HE6D 3UPCA 4EBQH 1DQMH 1CXKA 3NABH 4AL8L 1GC1H 2VDPH 1YECL 1IAMA 4LKXA 3DI2B 4H1LH 4XPGH 3UJTH 4PIRF 1T89C 3SQBA 5IK3A 4FFWD 3RVTD 3IS0X 4D0BA 1Q0XH 4RDQF 1M7IB 3V5KB 1U91A 2XY2A 5MEPA 3LQMA 3A67L 3MRCA 4JLRA 3TPKA 1RJZA 2CKBL 4YGVB 3SCMB 1U8IB 3RNQA 1VFAA 2HKHL 4Y2OA 5EN2A 1MJJA 1T5WB 4IDJL 2NCMA 1J11A 1A5FH 3DSNA 4WWKD 3LEXA 2DTMH 4S1RH 1UKTA 5J1SC 1P4LA 3RY6A 4M48L 1AIFA 1XZ0B 5A2FA 1A22B 1OM3L 3MV8D 4MA1B 3MV11 1JRHL 1OSPL 4LVHB 4XCCH 1GXEA 4K3EH 3WBDA 1O0VA 1K9TA 4OZGA 4W6XB 1KGCE 5A3IC 3DVNB 5FV2A 4X9HA 2WAHA 1LGVA 2A6DA 3MLUL 4BQ6A 1DSFH 1HINH 4ZDHA 4GW1A 2BX5A 3UC0H 2YD7A 1BLNA 1XF4B 2Q6WA 1S9XA 1IL1B 1D9KA 3SDAA 4PREB 4R2GB 4PY7A 1TTUA 3K81A 1EMTL 3BWAB 3HRZB 3BFOA 2YMXH 2BNQE 3VXQB 4Y19D 4LHUA 2FX8H 1AXTH 4N5ED 1OTTD 1Q9KB 1YDPB 1J05B 1YN6A 1HEZA 2UZXB 4ALAL 1NCWH 2YD5A 3F6IA 5DLML 1NBZB 1XF5B 1A6TB 4M1CC 3ZE2E 4U0RC 2X4RA 2E9BA 3QCTH 4I2XB 1BOYA 2W9LA 3VXRD 1WAAF 4OI9A 5BS0A 5E99L 4V2BA 2EIEA 1XGPA 4MWFB 2YUVA 1PG7X 3P4MB 3WFBH 4U1NB 1M7IA 2E9JA 3EBAA 3V5KA 5AG8A 3MCLH 1JNHB 5GRYA 5GZOC 5C92A 2APVA 3U83A 5KTEH 4LF3B 3KPRB 1HN1A 4EI5B 1JPFB 3NA4A 4YGVA 3SCMA 4ETYA 5L2JB 2AK4B 5E8DL 4NHUB 5KOVC 1F00I 1OP3H 1YC7A 3MGOB 3SKJL 3PJSB 4WTZA 2WQ8A 4AL8H 1YECH 2MCG1 2X4SB 2WINB 1NUGA 2DM4A 5I73C 2B20A 4YLQT 5TDPB 1XZ0A 3TCXA 3FQXB 4IEFB 3O9WC 4EXPX 4RWHA 2HVKB 4HH8A 3SKUD 1LD9B 3DVNA 5HVHB 1WZMA 3A67H 4MGXA 2BOBB 2CKBH 5ALCH 1VERA 2EDYA 4J4PC 2HKHH 5C09D 35C8L 4Y4FB 4UZGA 1I9RL 2E27L 3PL6B 4IDJH 5CSGA 4ZSOB 1IL1A 3EYUL 4PREA 3LZFL 1BOGB 1N6QL 3BWAA 3HRZA 4OLVL 3CFDB 5GSRB 4M48H 3VXQA 1OM3H 3QUYB 4M62L 4XBPB 1JRHH 1OSPH 1Q9KA 5A16B 3IB4A 2EH8L 3AS3A 2J7LA 4M5YL 4MNGB 3LKOB 1XF5A 1A6TA 4FTVE 4WFEE 3MLUH 3UTZB 1DCLA 4NN6B 3DXAD 4I2XA 1SYSB 1OAXL 4NBYB 3QYCA 1WFUA 2VR4A 4IOFC 5GS0D 4HC1A 1EMTH 4LPTA 1DP0A 1DL7L 2AJUL 4JN2B 3ARDB 3P4MA 3FB6B 4U1NA 5I9QC 2DM7A 2OQJB 3QUML 3BYYA 1JNHA 1ZHKA 1ZLVH 3GMPB 4ALAH 4HKZB 2DDQL 2JK5B 4JFOB 5DLMH 3JV5A 4ZAKB 3KPRA 4EI5A 1JPFA 3ZL4L 2FO1A 3FTGA 1Q9LB 2EXYD 5L2JA 2AK4A 2HT2D 4W6YB 4E41E 1P4BL 2VR5A 3C87A 5T1KD 3PJSA 2EO9A 5DRXB 3UTOA 3MACH 2DMBA 3C5JB 5C07D 3U30C 1CDHA 2X4SA 1HE7A 5E99H 2J5LB 2LTQB 5JDJA 4K2UL 5TDPA 2YD1A 3FQXA 4LCUB 2VMFA 4G8FB 3RGHA 1UWXH 3O3DB 5GS0L 2HVKA 3I6GB 4P5TB 1JPTL 2F74B 1LD9A 3RVWD 2GTZB 5F72S 5EH1A 1I1AC 1BJ8A 5E8DH 4Y4FA 1MVFA 1KCLA 4YHML 4L1HA 3PL6A 3RKPA 2AS5M 4ZSOA 4WO4B 3SGJA 5DJ6B 4LMQE 1BOGA 3CFDA 3T3PF 5GSRA 3QWRA 4XBPA 5FECA 5A16A 4I0PC 1U3HB 2XN9B 2VAAB 1U8PA 4P46B 1MLBB 2ZUQC 4MNGA 3LKOA 3FAXA 2A6IB 3CLEL 1A9EA 1NFDB 3UTZA 1CGSL 1WK0A 2C3VB 2ZOKA 35C8H 4TQEL 4Z7QE 4CJ1A 3GKWL 1H3UA 1SYSA 3WUZA 1I9RH 2E27H 4KI5C 2B1HL 3O6FA 4XX1E 1FVCB 3EYUH 4RMTA 4UQ3B 3LZFH 1N6QH 3QI9C 4LSSL 4PTTB 4OLVH 4JN2A 5JO5B 4ZPVB 4M62H 3ARDA 3FB6A 2BVEA 2OQJA 3D9AL 3PP3H 2EH8H 3GMPA 2XFXB 4BZ2L 4HKZA 4UTBL 3P77B 4M5YH 5L6YL 4MS8C 3ZT7A 4ZAKA 1ZT1B 1Q9LA 2NW2B 1OAXH 3LMJL 1SEBB 4YHPB 5DRXA 2FEEL 4UNUA 3C5JA 4JDTL 5IP4A 1IAKA 4JPKL 3X13B 3MJGX 1DL7H 2AJUH 4X6FB 3K1DA 3SDXB 4LCUA 4LCWE 4G8FA 3LRSB 2EDQA 3I6GA 3ZKSD 4P5TA 3BZEA 2DDQH 2F74A 2HTLC 1LO5B 4JKPL 2VAJA 1TCRB 1BFOB 3ZL4H 3CFKB 2GTZA 1KGCD 3FRPA 5I1AB 1VEMA 4UTAL 2E7LC 3UDWA 1WITA 2X6MA 3UXFA 1DN2A 4YHYB 5KSAC 1P4BH 3V5DB 4J4PD 5CGYC 2KH2B 2VRAA 1A7QL 3OKEA 5DJ6A 4RFNC 3GDBA 3T1FB 4IJ3C 2FEDD 3C8DA 4K2UH 2EC9U 3EDKA 3V6OA 3IT8D 1AGDB 5DQDL 5E6ZA 1U3HA 2BNQD 2XN9A 1AD0B 4ZUWB 2VAAA 5GS0H 1BJMA 3EHBD 4P46A 2BSED 3QQNA 4X7TB 1MLBA 3HB3D 4LBEB 1JPTH 1P9MC 4NQCB 3VXSE 4X98A 3SDCD 4U1KA 5BRZE 4OZFB 3VJ6B 1UACL 1TVBB 1NFDA 2GAZB 2R0KL 5FF6B 4LPXA 2C3VA 1ZEAL 2Z93B 3GFUA 4YHMH 1TQCC 2YPVL 5SX4H 3GUTB 4HIHA 2RFXB 1FVCA 5FA3B 3FB5B 2DN7A 4UQ3A 1MAJA 4PTTA 2HJLB 3GB7B 1P2CB 1CFBA 4ZPVA 1FGNL 2VIRB 1YMME 3T04D 3HZKB 1A7RL 2CRYA 1IM3A 4GAFB 3FB8B 3QH3B 3CSPA 1UZ8B 1D6VL 5KSBF 1LO4L 5D7IF 3MRDB 4JAMA 2XFXA 4TN9A 5F1NA 4TSCL 1GGTA 1B2WL 1JNNL 1QFWI 1X3DA 1ZT1A 1A7PL 3V4VL 1PEWA 2GI7A 3CLEH 2NW2A 3FMGL 3ULVL 2ZG1A 1CGSH 1P7KB 3W11D 4TQEH 4WTWA 5F93C 4NQEE 3GKWH 4FQXC 4ZPTA 2WBJC 2XZZA 1PZUB 1SEBA 2B1HH 1DQLL 3RWIB 3SE9L 2D7PA 1CZ8L 1N0LA 1JZ4A 4YC2B 2EDEA 1PKQB 3DX7A 1ND0B 4LSSH 3X13A 3MRJB 4PJIE 4X6FA 5FYJU 3SDXA 4E42B 3MFFB 5E8PB 4IRJA 3LRSA 4PJEE 3D9AH 4M5ZL 1BVLB 2KKQA 3KPMB 4BZ2H 5J13C 3CXHJ 4UTBH 2YD4A 3L3HA 1LO5A 2AEQH 2XKNA 3REWB 5L6YH 1TCRA 2WUBL 1BFOA 2C26A 1XH3A 5D6CA 4BELD 1P4IL 5B3JF 4LSTL 3LV3B 4U3XA 5DO2D 4X9GA 2XRAL 5L8JB 3WIFB 3V5DA 1LO2L 2QR0B 1C5CL 3LMJH 5BV7C 2F8VA 4Q9QL 2AXFA 5HYIA 4Z5RB 4JDTH 2ITCA 1KSRA 4HLJA 2E9WA 4QXWA 1YEHL 4JPKH 4OCXL 5IMKB 1AGDA 2KQMA 2ESVB 2GSGB 4ZNEA 1AD0A 4ZUWA 4JQXA 4X7TA 1KYOK 3EYVB 4GKNB 3T0EB 5J9PB 4JKPH 3OHXA 2NY3B 4NQCA 3S4SG 4OZFA 5EBLB 4UTAH 1TVBA 5FF6A 2GAZA 2Z93A 4FTVD 5I2IB 3EYFA 4NN7C 3D39A 3GUTA 1A7QH 2BHYA 5E7FA 1B0GB 2FWOB 2X10A 1XR8A 3R8QA 2HJLA 3GB7A 5D93C 1P2CA 1NMBL 3RKDC 2V9TA 2VIRA 3HZKA 5DQDH 1FORL 4JFYB 3FB8A 1D6EB 3NFSH 1UZ8A 3ZE1F 1U8OB 4LLQB 1QSEB 3MRDA 3OKNB 1PEZA 3IU3B 3HG1B 4Q9RL 1MCQA 1AR1D 1I8IB 3B9AA 1CFTB 1P1ZB 4CN6A 1UACH 4DFHA 5I76B 2R0KH 1H0DA 1ZEAH 3HMWL 3OV6A 4Y4HD 4PJ5E 2R9HC 1IGTB 3GZKA 2YPVH 4JO3L 2NY5L 3CK0L 5FO7B 3RWIA 4E41D 2DQTL 1CT8B 1KJ2A 1PKQA 1ND0A 5IQ7L 2LV4A 3VXPB 3MRJA 4OZ4B 1DBML 1BBJB 1FGNH 3MFFA 3MLVL 1A7RH 4JCLA 2HA1A 4X4XB 3TBWB 2RBLA 1D6VH 1BVLA 1LO4H 5B8CC 3BGFB 3KPMA 4AENB 3WNMA 3KNBA 2V5SA 3SJVB 2D4DA 1JNNH 1B2WH 4TSCH 3REWA 1HHHB 4HKJB 1A7PH 3V4VH 1VESA 5JZ7C 3LV3A 3ARGD 3FMGH 3ULVH 5FOBB 3WIFA 2JCCE 1RZKC 4ODVL 4EUPB 1DQLH 1PW3A 3WD5L 4Z5RA 1CZ8H 2H26B 5LG1A 3WIHH 3AVEA 4FZ8L 4MQSB 5IMKA 3CU1A 4GQPH 3QBTB 2ESVA 1U2HA 2GSGA 1CQYA 1CVSC 1MUJB 4MZ3A 3QNXB 4DJMA 1HOCB 4M5ZH 4EZMA 1HILB 5T5FL 3BD4A 2BVQB 3EYVA 4GKNA 3T0EA 3TJHC 3DV6B 2WUBH 2G75A 1P4IH 4LSTH 1CFNB 2DKMA 2XRAH 2DI9A 4X6CA 3B9KB 1LO2H 5I2IA 1C5CH 3P9MB 3P11L 2V2XB 4Q9QH 5C9JB 3TPUB 2W0FB 4G3YH 1B0GA 1I8MB 2FWOA 1YEHH 1EZVY 3GSQB 4QWWD 3VCLB 4OCXH 3HI5L 3WNKA 1PBYA 1CDJA 4MAYD 5T1DL 4JFYA 4Y2DD 5L0QB 1U8NB 1KPRB 1D6EA 3V79C 1U8OA 2H3NA 3G5ZB 4LLQA 5KSBB 4Z76A 3OKNA 5D7IB 4U1MB 3IU3A 5FHAL 1LVEA 4JFFB 1I8IA 4HGWB 2VNCA 1CFTA 2GK0B 1F4XL 1MWAB 1P1ZA 3KJ6L 1P53A 5I76A 1NLBL 1IGTA 5FO7A 1FH5L 1QEWB 3VRLF 1CT8A 5KOMC 4OFVA 2D0FA 3B2UD 1NPUA 2GFBA 3VXPA 4OZ4A 1BBJA 4I1NB 1MLCB 1FORH 3LHPL 3DMMB 4GLRI 4X4XA 5CKGA 1C7TA 4LDLB 5F9JB 5MI0C 1QYGL 4MDIB 4LCWD 1NAMA 4AENA 1YY9C 4Q9RH 2Q3AA 3SJVA 1HHHA 4HKJA 1JI1A 3MYZA 4YUEL 2ZUVA 5EZLB 3VE0A 3RDTD 3ARWA 5FOBA 3HMWH 3ZYJA 3NZHL 5H35B 4JO3H 5SX5H 2NY5H 3CK0H 3OB0K 2FBJL 4NC1C 3VFWB 5EBGA 4BSVA 2H26A 1AI1L 2DQTH 5IQ7H 2NY2D 1XEDA 2E9IA 4I2XE 5FYLD 1WVZA 1DBMH 4GRWH 4F2MB 5SWZB 4ZD3L 3MLVH 4GRLD 4XXCA 3QNXA 3CH8A 1HOCA 1HILA 5GGSY 5GPRA 2XG5A 2EYTB 3SQOL 5ADOL 3DV6A 1J0IA 1NGPL 3ARED 5CHNB 5E70A 1XCQB 1CFNA 2X40A 3VXSD 3IXAB 3B9KA 1CDYA 4F37K 4R4NC 1JHKL 2QHLA 3CFJA 3P9MA 4ODVH 2A9NL 1QRNE 3D87B 3WD5H 2V2XA 4JDZB 1UA6L 5DK3A 3TPUA 3JTSB 4WEUD 2W0FA 1I8MA 3GSQA 4L3ED 3VCLA 4L8SB 4FZ8H 4PLJC 2R2EB 5E8OB 1U8NA 1KPRA 1FIGL 1CWVA 3QA3B 3G5ZA 5T5FH 2GJ6B 5KSBA 1YMMD 5JPMB 4GG6F 5D7IA 4U1MA 1T04B 4Z7VF 2NXZB 5FYLL 4JFFA 4WFHE 2CLVB 4HGWA 4JRXD 2LQRA 2GK0A 1I7TA 1MWAA 3U1SL 4PJCB 1MQKL 4H8WL 4S1SL 4R7DB 3ZDZF 2FD6L 3P11H 3TFKC 3QIBA 4NQED 1MCOL 3RL2B 2PUQT 3MMEB 3GGWA 3HI5H 1DQDL 1XGRB 4WI3A 3T4AB 5I74C 1MLCA 4QO1A 5T1DH 3DMMA 3CC5B 3ZLQC 4U49A 4LP5A 5F9JA 2H8PB 2FSEB 4MDIA 5GGVL 4RZCB 2BNRE 4MD0B 1RPQA 5FHAH 4L4TA 4JFDE 1F4XH 5EZLA 2X4PB 3KJ6H 5TGBB 1WZ1L 1XF1A 1VEOA 1NLBH 3MRHB 1XFPA 4HG4J 5H35A 4PY8J 1WFTA 1FH5H 2PTTB 4IMKC 4OCWL 3VFWA 1MNUL 5CD3B 4CVZB 4PJ7E 3ARFB 4WI8A 1YEDB 5GGTA 5A3ID 1S9VB 1XIWB 4F2MA 5SWZA 1CL7L 1FYTB 3MOQA 4JFZL 5IR1B 3LHPH 3BRDA 5EU6D 4HX1A 1JBJA 4Y5VC 1MPAL 4XCEB 3P73A 1QYGH 5D7LD 3IKKA 5L88L 2EYTA 2OP4H 4HT1L 3KHQA 3I50L 5CHNA 3FB7B 1J0KA 4YUEH 4U3CA 1XCQA 3OTTA 5C0CB 3IXAA 2HKFL 2V6HA 2XQYK 3NZHH 5INDB 3OXSB 2DS4A 4JDZA 1L7IL 2FBJH 1AI1H 3JTSA 1FFPB 2OMBA 4L8SA 4NNXB 4H0GA 1DANT 2R2EA 4X7FC 4OF3A 4IOSD 3RP1A 3QQ9D 4LLDB 4ZD3H 3ZYOA 5E8OA 3W9DB 4M1CD 1S7SB 3QA3A 2NW3A 2GJ6A 5JPMA 3MRPA 3MPCA 3MRBB 1T04A 1RUPL 2NY1D 4OF8A 2MKLC 2ZUTA 5A40E 3SQOH 3GHEL 3ZSSA 5ADOH 3OB8A 2CLVA 1NGPH 2H32B 1SVZA 3B4NA 3FAWA 1A2YA 3BAEL 3QXTA 1JHKH 4NKMB 4PJCA 4LDEB 2A9NH 1AXSB 4R7DA 2XYCA 4POZC 4QOKB 1UA6H 4X7SH 3IFNL 2X4UB 4PJ5D 3D18B 3RL2A 1N2RB 3MMEA 3QUXC 1QLRB 2VYRE 3WS3B 1UWGL 1NMCC 1XGRA 4HEPG 3T4AA 1MCCA 3CC5A 3U2SB 1FIGH 2E3VA 3C6LD 2PYEB 5I1EL 2H8PA 2FSEA 4RZCA 1T4KA 4MD0A 5AEAA 5FYLH 4M1GL 3UZVB 1FO0L 3T0WA 2X4PA 3SDDB 1U8KA 3MRHA 5IB3B 3U1SH 4GT7A 1MQKH 4H8WH 4JM4L 4S1SH 1JVKA 3O9WD 5ISZB 2FD6H 3MJ9A 1IC5L 2PTTA 4TSAL 1N3NB 2XZCL 1MCOH 4CVZA 1RFDL 3TLRA 1YEDA 2IFGA 1S9VA 5F1IB 1XIWA 1DQDH 1ZSDB 1FYTA 4OLEA 5JIKA 5IR1A 1WAAE 4KY1L 4X83A 1INEL 2OZ4A 4EJ1C 4J8RB 1ED3B 4XCEA 3QNZB 5GGVH 2FBOJ 2D0HA 1A3LL 1CXFA 4QRSB 3FB7A 2QHRL 1CS6A 3S8WA 1WZ1H 5C0CA 2NY6D 3C60C 1MFCL 5INDA 1TJGL 1TETL 4LSPL 4OCWH 4UOJA 1MNUH 4NZRL 5HGAB 5K9QG 1PY9A 3ECBA 4P2CG 4NNXA 2OTWB 2VDLL 3IDGA 2VLJB 4LLDA 4JFZH 3W9DA 1WWCA 1P84K 1S7SA 4J12A 4GH7B 1MPAH 1PD6A 1WT5A 1RD6A 3MRBA 4GG6B 5L88H 4Z7VB 1P5VA 3T0BA 4AT6B 4HT1H 4Z7UA 4PLKC 3I50H 4IOFD 2H32A 4XBGB 1UZ6E 3G6DL 2HG5B 3HI1A 3VWJD 2V2TB 2HKFH 5I30L 4ZS7L 1UB5B 4NKMA 1MY7A 1AXSA 3K74B 4QOKA 1L7IH 4DK6A 2OS7A 2B5IC 2X4UA 4KROC 3D18A 4AEHL 3MXWL 4XNYL 1IC1A 1QLRA 3S3SA 4KKLC 15C8L 4M00A 5GRXG 3TVMC 3C09B 3U2SA 4B5EA 3SGEI 2Y7QB 4BUHA 1DJSA 2PYEA 5D1ZC 2YD9A 3O2WL 1RUPH 3QIUB 4QNPF 4RA0C 4LLMB 3GHEH 4GSDL 2NY0C 2P24B 3QEQD 4K71B 4JFEE 4X99B 3SDDA 2R4RL 3C08L 5J6GB 4YFLI 3BAEH 5IB3A 1E27B 1DVFD 5AAWA 1CE1L 4WIQA 4NQCE 4RBPH 3TA3C 1SM3L 2ZWLT 4PD4K 1N3NA 3T0DA 3IFNH 4YFLF 1G7QB 3MZGB 5CJ8A 3U9UB 1UWGH 1NC4B 1ZSDA 4W4OA 3VXUE 4P23B 4GBXB 1U42A 5J11C 3OAZK 1JPSL 1I1AD 4J8RA 1ED3A 5I1EH 4P2RA 4FFVD 1I85C 1UEYA 3HMXL 3QNZA 1S7TA 5FHBL 3ZDXF 5SWQB 4PGZA 4QRSA 4M1GH 1FQ9C 1FO0H 2XXCB 3BZ4B 4NQUA 3CU7A 4LSQL 4M3KB 4JM4H 2WZPD 3WLBB 1RIUL 2BNUB 1IC5H 4TSAH 3PGDB 2L7JA 2XZCH 2P5WB 5CIPH 1RFDH 5HGAA 1QRND 1BQSA 3VXTB 1U8LB 1RZFL 2ZG2A 4OCRL 2OTWA 4NO5B 2VLJA 3MLSL 1I75A 5JA9A 1INEH 4OLXL 4NT6A 1YJDC 4GG6A 2MFNA 2VZTA 4KI5D 4RAVB 4WHCA 4HIXL 4Z7VA 4AT6A 4MB5A 1A3LH 4XBGA 2QHRH 5BVPL 2HG5A 3QI9D 1GGCL 2V2TA 1MFCH 1OQXA 3AY4C 5HPMB 4ONFL 1TJGH 3HAEG 1TETH 4LSPH 5DI8B 2B1AL 4NZRH 1FAIL 1NDMB 3ARBC 3ZT6A 2X9YA 4PFEA 1NCAL 2WM0A 3U7AA 5HHMB 3IF1B 2VDLH 2YN3A 2RB8A 4OF6A 1HQ4A 2Y7QA 3VXMB 5FO8B 1K8IA 1BZ7B 3QIUA 2ADGB 4OBRA 5GGQL 2HFFA 2YXFA 2P24A 3MXVL 1EGJL 3P0YL 2BNRD 4X99A 3G6DH 5J6GA 2ZCLL 5I30H 4ZS7H 1F3DJ 1E27A 2D9CA 4JFDD 4N0RA 5CZKA 5D7JC 4DK3A 1RJCA 3LKRB 1VHPA 3LVEA 1E6OL 4QRPE 3OKKB 4AEHH 4NRZA 3MXWH 3PP4L 3BMWA 4XNYH 5HJ3B 3RBGA 3AMKA 2HTLD 3U9UA 4LPVA 2C1OB 1NC4A 15C8H 3FONB 1UJ3C 4P23A 3WHXB 4GBXA 4J3UA 4EIGB 3D5OF 3NN8B 5BQ7B 2MPAL 1RQ5A 3O2WH 4OBSA 5KSAD 5CGYD 4GSDH 4CUCA 4M6NL 3S4SB 6FABL 4O4YL 4HXBL 1B6UA 2R4RH 3BZ4A 3C08H 4NN5C 1QSEE 5K33A 3HG1E 1MFDL 4L5FL 5FGSA 1CE1H 3ZKNC 3INUL 4F9LA 2WSKA 4OFKA 3WLBA 4KDVA 2BNUA 1SM3H 1EK3A 1ZK9A 5EWIL 3CSGA 5LKNA 2P5WA 3BKJL 4MMZC 1C8PA 3VXTA 1U8LA 1BJ1J 4FABL 3HAEH 4NO5A 5F7LB 3FFCB 1YYLL 5IBUB 3RNKB 4WHYG 8FABB 3LPWA 4I8DA 1JPSH 1OSZB 3HMXH 4P2QB 5FHBH 3WFDL 3V7AG 3SO3C 2VR9A 3KPNB 4U33A 3BDBA 3ARTA 5GJSL 1MFNA 2Q86B 4DOHB 3NGBB 4LSQH 1ORSB 1F4AA 1JGDB 1IZJA 1T6VN 1NGXB 3RWGB 3O4LB 1RIUH 4ODHL 1BF2A 1U58B 1GGIL 4MCZB 5BOZG 2UWEF 4XH2A 1NDMA 1TVHB 1RZFH 4O02L 4OCRH 5EO0B 1X6NA 3IF1A 3O3EA 1MREL 3MLSH 2CUMA 4OLXH 4Y7MA 1QR4A 1E4XI 3VXMA 3QCVL 5FO8A 5BMFL 1BZ7A 4WO4D 4JHAL 4HIXH 43CAB 1BD2B 5BVPH 1L0QA 1MCDA 3CX5K 3F5WB 3LKQB 1GGCH 1D9KC 5DD3L 4ONFH 3RVUC 5DGRA 5FCSH 5HHPA 1QSFB 3CFIC 3LKRA 5HI5D 4R7NB 2B1AH 3DIFB 1FAIH 3TC9A 4DW2L 3OKKA 3TEUA 2RJMA 2SEBB 2Y4SA 5ENWB 3NPSB 1NCAH 2C1OA 3FONA 1F3DH 3WHXA 3H7BB 4LQ1A 1YQ2A 2EDWA 2APTA 2AQ1A 3NN8A 3EFDL 3RI5F 3QDJE 2IMNA 4YPGB 5GGQH 5IKCB 5BJTB 2VXUL 3MC0A 1H9VA 3Q2CA 3FQRB 3S35L 3MXVH 1EDQA 3S4SA 4ZFFB 3P0GB 1EGJH 1IKNA 3P0YH 1PG7W 3AGVA 1ZANL 2ZCLH 5KSBE 5D7IE 3SO5A 2QQQA 3KVQA 1U8QB 3G6JF 2WQRA 5CGMA 4M8VA 5DTFB 2CK2A 1E6OH 3N0PB 5IEKB 1J87A 4YEFA 4MXVF 3PP4H 4YK4B 1G7IB 4PJ9C 1D5IL 3FFCA 3RNKA 4DZ8A 8FABA 5MERB 5T3XE 1ONQB 5IFAL 4XBEL 1OSZA 2MPAH 1SHMA 4P2QA 1CLOL 3TJEL 2DB8A 3SCMC 3KPNA 2D4FA 5C0IB 2CIIB 4M6NH 5F9AC 1QSVA 6FABH 2Q86A 4O4YH 4F7PB 4HXBH 1ORSA 1MFDH 4L5FH 4NDMB 3INUH 1JGDA 4ODXA 2FGWL 1NGXA 3PXJA 3RWGA 5BV7L 4MNQE 5F7HA 5B3JE 4QT5B 5EWIH 4DZBB 4MCZA 4EN3B 4MA1C 5L2KA 1TVHA 1U8JB 3QDMD 4FABH 5EO0A 3KYKL 1YYLH 4JDVB 5GISL 1MH5B 5ANMB 3V8OA 2ICEB 3WDIA 1HKFA 4LLYA 2EDOA 2A73B 5ID0B 3WFDH 3CX2A 2R9HD 5SWZE 3KS0J 1G7PB 1BD2A 5GJSH 1T1ZB 5T3ZL 1P7HL 3DVFA 3LKQA 2ICWI 3GSNL 4Q9BA 4R2GC 4JFED 1QLFA 1QSFA 4ODHH 4R7NA 3DIFA 1GGIH 4J6RL 4PJGF 2IANB 4NCC1 2SEBA 4K7PL 4O02H 4DGYL 2X1PA 3LS4L 1MREH 4GAGL 3TBTB 1YPZF 5IBTL 3H7BA 5FKAB 3C5ZA 4JGMA 4AEIL 3VXUD 3QCVH 4YPGA 3KXFA 4JHAH 1KTKE 5IKCA 5BJTA 1RV6X 3TO4A 3FQRA 1N26A 4ZFFA 1T22B 3MUY1 2APWA 3ZE1E 2FGZA 3B3IB 2EYRB 1JJUA