4YSTA

Structure of copper nitrite reductase from geobacillus thermodenitrificans - 24.9 mgy
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
294
structure length
294
Chain Sequence
b'IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
total genus 96
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ystA00
2CCWA 5TK4A 2PP8A 1AG6A 3IN2A 3X1BA 2YAMA 1JZIA 1ZIAA 2P80A 5EHFA 1OCCB 2R7EB 2VMJA 3V9CA 4YSDA 1NWPA 3X1FA 1PF3A 3NSCA 4F2EA 3FU7B 3OMIB 1JVLA 3NJGA 2VW6A 2CAKA 3PAZA 2WO2B 3FPYA 3RYMA 1L9TA 5A7EA 1WS7A 1NIDA 4ENZA 2Y1AA 3WG7B 3QJVB 3X1NA 1PMYA 1NWOA 3UAAA 5B1AB 1SDDB 2AANA 1J9QA 1GY1A 5D4IA 1TEFA 3AG3B 2XV0A 2PPEA 3FSAA 1J9RA 2TSBA 2GBAA 1RZPA 2IWFA 2VM3A 2OV0A 3QJSB 2HX8A 5AZUA 1KYAA 4AZUA 1ILUA 4KNTA 1ID2A 3AG4B 1XB6A 2GIMA 2J57A 3AG2B 3ZBMA 3JT2A 3QJRB 3NJIA 1KV7A 2ZOOA 3SBPA 2UXFA 4QKTA 2Q5BA 7PCYA 1J9TA 1AR1B 3NJFA 1PZBA 2BP8B 1ZV2A 1ETJA 1NTDA 1ET8A 2IWEA 2YXVA 4GY4A 2DWSA 3X1EA 4K9JA 2BWIA 3ZDWA 3WNJA 1KDJA 1X9RA 3NJLA 1W6WA 3NJNA 4AI7A 1OV8A 4TXVB 1WAEA 3MBWB 1TKWA 3S3DB 4DP8X 1BXVA 3ABMB 1SNRA 1ASPA 5I26A 3H4HA 1CC3A 2FQDA 2GC4C 4G7RB 2VW7A 1NIBA 2UXGA 2CALA 5I6NA 1PAZA 2H3XC 1GSKA 4DP6X 4WTQA 3C75A 4NAJA 3OMNB 1KCWA 2UX6A 4E9YA 1BQRA 3G5WA 1WA1X 2IDQA 1M56B 1ET7A 4F2FA 1NIAA 1IUZA 2YAEA 2ZONA 1QLEB 1IC0A 3S8FB 3HB3B 3CVDA 1UATA 3S3BB 4DPCX 5D4JA 3OD3A 4RH4A 1PLAA 3IE9A 4BDVB 4E9XA 3PXLA 1GS8A 2XX0A 2BZ7A 4G7SB 2IH9A 4GP4B 1FFTB 2DYSB 2I85A 1V54B 5FC9A 4KO5A 2IWKA 3DIVA 2DWTA 3L45A 4YL4A 1F56A 1JERA 2W88A 4DPBX 3X2QB 1GW0A 2EILB 1XMEB 1EZLA 2QDVA 3FQYA 4M4RB 4KOCA 2PP7A 2XU9A 3QQXA 1AZNA 3PPSA 4YSOA 4YSAA 8PAZA 1PZCA 2VW4A 2B3IA 2EIKB 3MX0B 2JKWA 3QJTB 3NJJA 3IBOA 2AZAA 1JZEA 2PPAA 4DP4X 1JZHA 5B1BB 3WI9A 5I5JA 4YSQA 1OCZB 4BWTA 1BXAA 3FYIB 4N8UA 3PAVA 1DYZA 4AX3A 1BEXA 3AW5A 2HLEB 2BO0A 2GB2A 4KNUA 1GYCA 1JZJA 3UACA 2FT8A 2HRHA 4YSPA 2CBPA 3ZIYA 4GP8B 4QLWA 1M57B 2FNWA 4MFHA 4UANA 2EINB 2XV2A 4YSUA 3EH4B 4M3HA 1V55B 4GXFA 2N0MA 4Q89A 4G71B 2I7OA 1GS6X 2BP0A 2AZUA 3SQRA 1ZPUA 2EIJB 1CUOA 3V9EA 1L9PA 3GDCA 1X9UA 2YXWA 4F7KA 4PAZA 4PCYA 3ABKB 2OJ1A 5I5MA 4G70B 2PCYA 2JXMA 4HALA 2FQFA 4BWUA 4HZ1A 2QPEB 4KO6A 2B08A 4W1TA 2AVFA 4YVUA 1IKOP 1W6LA 5B1JC 1RKRA 1AANA 3IN0A 3T9WA 5B3SB 2PPCA 2W8CA 3FQ2A 4P5RA 2R7EA 2FT6A 1URIA 1KGYE 1A4AA 4GP5B 4A67A 3FU7A 4DP2X 1TU2A 1FWXA 1AQ8A 2XXGA 3CDZA 1JZGA 5E9NA 1SFHA 2XUWA 5AKRA 1A4BA 3SBQA 2I7SA 4YVNA 4A2FA 1J5DA 1SF3A 3CVCA 3T71A 1OE1A 3AZUA 5I6KA 2ZWNA 3FU8A 4HIPA 4N4YB 4A2EA 1AZRA 1CURA 2HXAA 3NP3A 1OCOB 1PLCA 4YSSA 1SDDA 1V10A 2YAQA 3N55A 4E9WA 4FA7B 5IY5B 4EF3A 2X88A 1E67A 2DY2A 3ABGA 1BQ5A 1OE3A 1AS7A 1N68A 1L9QA 1JXDA 4DP7X 2DYRB 5I6LA 1MZYA 2XX1A 1VLXA 1W8EA 5TK2A 1ZDQA 1OOWA 2WO3B 4DP0X 1BAWA 2YARA 1AG0A 4YSTA 3S8GB 3EH3B 5I5IA 3WNIA 3EHBB 5B1KA 2PLTA 2MTAA 2YAFA 2P80D 2XLLA 3QJUB 2YAPA 2HX7A 1AOZA 2BP8A 3AY2A 1T5KA 1NIFA 2VSMB 3ERXA 1KCBA 1ET5A 4CSZA 4UF7C 4JHVA 1AIZA 1NDTA 5B7FA 1SHXA 1AAJA 3NJMA 1NPNA 5PCYA 1QNIA 3U25A 1OCRB 4KO9A 3S3CB 4HHWA 3FT0A 1SHWA 1J5CA 4E9RA 1AZUA 5ANHA 2H5UA 3FSWA 4W9ZA 4Q8BA 3FQ1A 1A3ZA 2BW4A 3OQRA 4NERA 4AKOA 1L9RA 3OMAB 4WKXA 1IBYA 4AKPA 2YAOA 1KBWA 4DP9X 2H47C 3NP4A 4P5SA 2PP9A 4DP1X 1I53A 2PPDA 4A68A 2FWLB 3TA4D 1OF0A 2VN3A 3UADA 1SF5A 4KOBA 3UAEA 2TSAA 1JOIA 2AFNA 1OE2A 1XB8A 3HEIB 3GXUB 1MG2C 3T6ZA 4BXSV 4BDVA 4HCFA 2XWZA 4HCIA 3N2JA 5B7MA 2VM4A 1PY0A 4YSRA 4A2GA 2GHZA 4X4KA 4UAHA 4AKQA 1MZZA 2IDSA 2FQGA 3WKPA 1ILSA 1WS8A 3QPKA 4BWWA 3T6WA 1A4CA 1MG3C 1KBVA 4HAKA 3ASOB 3ABLB 3CDZB 3FS9A 1KDIA 1TEGA 4KNSA 1HAUA 1BYOA 3H56A 4HCGA 1BXUA 2GSMB 2X87A 3JTBA 5PAZA 3DKHA 1AZCA 4NB7A 4FAAB 1NPJA 1NZRA 1E5YA 2LLNA 5B7EA 3WKQA 2BWDA 3SBRA 1A65A 4KO7A 5I6OA 1ZIBA 4A2DA 3AG1B 5I6PA 1ASQA 2MRYA 4G7QB 1E30A 2IDFA 2IDUA 3D12B 4A66A 4BXVA 4E9TA 1PLBA 3OM3B 4A2HA 3NSYA 5I28A 2IAAC 3FYEB 1QHQA 3TASA 4JKNA 2UX7A 3KW8A 2OCCB 2J56A 2IDTA 5AFAA 2XVBA 3CG8A 1ASOA 1NICA 1SFDA 2BW5A 1NIEA 3NJHA 1JZFA 2DV6A 1PNDA 1IBZA 1NINA 1GY2A 3CVBA 3T6VA 2FQEA 2FTAA 2XXFA 3NSDA 3TBCA 4L0PB 3ZX1A 2BHFA 1AS8A 1PZAA 2CJ3A 3FSVA 1L9SA 1RCYA 2FJSA 5I6MA 3TBBA 2NRDA 4HHGA 2BZCA 2XYBA 4ZK8A 2HRGA 1GS7A 3DTUB 3PAUA 2YAHA 1DZ0A 2WSDA 2GC7C 4BK5C 3TU6A 2YQBA 5B1JA 5LDUA 1EHKB 9PCYA 3ASNB 3FU9A 3X1GA 2HX9A 7PAZA 3KW7A 2Y69B 2QT6A 6PAZA 3BQVA 1SJMA 2UXVA 1E5ZA 1E65A 2JFCA 1HFUA 1GR7A 1BYPA 1RZQA 1BQKA 2EIMB 2Q9OA 2XV3A 4JHUA 2J55A 3EH5B 4DPAX 2IH8A 2QDWA 5D4HA 3GYRA 2CUAA 3EF4A 3H4FA 1M9WA 3NJKA 3NYKA 6PCYA 3UGEA 3FSZA 3UABA 4DP5X 2RACA 2GI0A 3FPXA 3NSFA 4G72B 4YSEA 5F7AA 4E9VA 2QPDB 1PCSA 1AS6A 1HAWA 3IEAA 2E86A 1N70A 1ADWA 1A8ZA 2PCFA 3QJQB 1JXGA 1MDAA 1CYWA 1YLBB 4E9QA 1XB3A 4GYBA 2J5WA 5F7BA 2BP0B 1B3IA 1R1CA 3CZUB 3PCYA 4CSPA 1JXFA 2A3TA 1WA0X 1FA4A 3T6XA 1PNCA 4E9SA 1L9OA 2HZHA 1AACA 3WIAA 1J9SA 1ZDSA 3BVDB 4YSCA 2FT7A 1AZBA 2VSKB 2UXTA 1CYXA 1JVOA 3PLYA 1WA2X 2ZXWB 3NT0A 2PPFA
chains in the Genus database with same CATH superfamily
4NKIH 3PL6D 3C09B 2EDRA 3HG3A 3J7HA 2PP8A 4JFUA 3I3BA 4TRPL 2GI7A 4JZJC 2BIIA 3LMJL 4KVNL 2DMCA 4M1DL 2LU3A 1RFDL 2VXVL 2WZ5A 2XIIA 3MKKA 5TE7L 1KTDB 4Z3JA 3V0JA 4F8OA 3QG6B 4EUPB 1AO7E 2O5XL 2QVTA 4DGIL 3QDMD 3BRFA 1YJDC 1I9JH 1OM9A 2ZWYA 3NCEB 5J56B 2C3VA 2NW2A 2WUBH 1OSPL 3NIFF 1J0IA 2JKRM 4JO3L 4MHHI 1RP8A 4PJEB 4I5BA 4Y9GA 1SDDB 1FCCA 4U1NA 1HINL 1RIUL 4C83B 1HT6A 4CDGC 2AANA 5GGRB 3W0WE 1UADC 1JD9A 4GKOA 1KIPA 5CCHE 1XGTA 1PD6A 3JTTA 1MVYA 3MZTA 3VRIB 1YPZA 3LZQA 2QZ5A 1DANT 5E1GA 1XTMA 3VRJA 1LP9B 1ES0B 1FYHB 3QR1A 3WKML 4F2MB 2B2XL 2WNKA 2MQ3A 4NHCL 2GITB 3O4LD 3EJZD 1U30A 1CXLA 1ANUA 5DHDA 3TNNB 3QXAA 3UCRA 1H5BB 5DUPL 1JN6B 4MCZA 1S7RB 1VADB 4FQQA 3QJFB 1KYOK 2DQUL 1B0WA 3O3AB 2L04A 3VFPB 3DX6A 3X3GL 5BS0E 1Z32X 1QFWI 3KYOB 2YXVA 1DBML 3MNZB 4LCYB 4RWHA 4OZGE 4F3FA 1W6WA 4AI7A 2KYIA 4Z1PA 3NZUA 3SE3C 5D1XC 3MBWB 2X1XR 4LLAA 2P8LB 3JTSA 3HLAA 5AAMC 4O4YH 5D1QA 2HRPH 3DROB 2E7DA 3ARDD 4XNMA 1UKTA 1CC3A 1X5KA 1I7RB 1NCDL 4OW6A 3L13A 5HHOA 4X4ME 2H32B 5IESH 4E41D 2D7QA 2XJLA 3F7QA 3HBQA 4HUKB 2FD6L 2YKLH 4JFDA 4NAJA 4N0RA 4NZTL 1FC2D 1QFUL 4ONFL 1I8AA 4JE4B 3TP4A 3G5WA 3NFSH 5DMKB 5JHDD 1A9BA 2APBA 5DI8B 4Z7OF 1XWVA 5I8EB 2MFNA 5T3XE 1UG9A 3TPKA 3Q8FA 1IEHA 1FVDA 2UY6A 3L3OC 3WHXA 5C0CA 3FH7A 5A6IA 3CVDA 3NK3A 5A2CA 1CFMA 4M6NH 3CMOL 4OGZA 5GISH 1NGQL 2OMNA 1RULH 4C56E 1CB4A 3CX2A 4WJ5A 1A4JA 5H37A 4TVPH 5HHQB 4JO5A 4K3JH 5GSVA 2VXQL 1CS6A 1U0QA 2IH9A 2WP3T 4L3FA 2XKNB 3DMMD 2X4TB 1Q0YL 2HH0H 2ITCA 1J5IA 4DQOL 1IC7H 5HYQB 1XGQB 2DDQL 3TBTA 4DN4H 5I71B 3F7KA 4B50A 1EZLA 1GGTA 4LEOB 5GRYA 3U2SB 4A6YA 5KN5B 2H4EA 4G6AC 1XF3A 2B15A 4GRWB 1EEUA 2VW4A 3L9RA 3UOAB 2JWYA 4AM0A 3MXWL 3P9LB 4JDTL 4PGCA 4RMUA 2A0LC 2EADA 4LVNC 4MNQB 3ZE1F 3GPEA 3ORJA 2EAEA 3GK8L 2XWJA 1QUNB 3IKCA 4J27A 2BFGA 1MFDL 4X5PA 2QVFB 1MHHA 1B6UA 4YSQA 1J5OL 2FEJA 1GGCL 4G8AC 2F15A 5DEGB 1HQRA 3DETD 1PYWA 3BFOA 3ARGB 3X17A 2AXGB 4FTVE 2E74C 1W72L 3QO1A 5AOLA 5CHNA 1BAFH 4JBSA 4B41A 1OAQH 1W2KT 3WSQH 3ILPB 2BIOA 2GY5A 5J0BA 1JPTH 4LKCB 1NKGA 2YA0A 4PWHA 3O81A 4GXFA 1CZ8L 3GJFB 3G6JA 4J23A 4KHXH 4QRTB 2BP0A 1J05B 1SXCA 3WS3B 4HCRA 3I2CL 1JPSH 4S0HA 1F4AA 3FONB 5D1QD 4XT1C 1XGPB 4PI0A 2UZIL 2FIKA 4JEGB 5HHOD 5I5MA 2NX5A 3FFDB 1S9XA 4EXKA 2X4PA 1UENA 4MXWH 2AEWA 3QYMA 2UYLB 4HSCX 5F1SA 1NCCH 2VL4A 2W81C 1TJIH 3O11A 3PS6A 3SCMC 2ZCLH 5D2LE 1KCKA 5HY9A 3QDJA 1SXZA 4UQ2A 1FH2A 2JQMA 5DA0B 3MLVL 1IGCH 1RUKH 2PABA 3FQ2A 2Q8BH 2NNAA 5DMGC 3P11L 3KCPA 1GMEA 3VXSB 4RWYH 4KJYA 1O6SB 2XKUA 3L9YA 1RIVH 3OKKA 2WGNB 5DQ9A 4UNUA 5CZVL 1H8NA 1SMOA 5AQ0A 4JN1L 3QUMB 3RY4A 1PKQA 2ZWNA 4FG2A 4Y5XC 2NY4B 5TQ0L 3NP3A 3LRSB 4FA7B 2HPOA 1KC5L 2WYZA 2QEJA 5IJDC 5JTWA 4QRFA 3MRIA 4N8VG 1B6DA 1U8PA 1E2VA 4G80B 2J7LA 1ZWIB 2LU5A 3OAZH 3WFEL 4AH2A 2HCZX 4YL9A 1NCAL 4DFHA 2ZAIA 4QHKJ 4WNQB 2PXYB 4P57A 1XH3A 2DQJL 4QOKB 1K4CA 4J7RA 1TTCA 3MCG1 4I88A 3REWB 3BIAX 1F4WH 3TBWB 4KUZH 1L0XA 2QR0A 1F4XH 1SRDA 5EZLA 4BH7B 4DZBB 5LAXA 2MWCA 3PABB 2HKHH 2O5NA 4YHLH 3U0TA 2DH3A 4NRXA 2Q86B 4U1HA 4YDIL 6FABL 4ZS6D 3D51A 2AV7B 5CCJA 2P42B 5DJ6A 5I8CB 4X6BB 4QRBA 1RURH 4PREB 4ZQKA 4W4OC 5GGTA 4F7EA 1A3LH 1QWNA 4NHUB 3U25A 2GFBA 4QEGA 3RTQA 2WVVA 3GLEA 4U33A 3A6OA 1ZVNA 5DK2B 2XQBL 5HHME 1BVZA 2NY3C 5HHPA 1ZSDA 4K5NA 4Q9RH 5DGRA 3DJ9A 1T4KA 1HDMB 1A1MA 4RMWA 4I3SH 1EMTH 2CGRH 1V3LA 2GHWB 3O2WH 4IQHA 4FABH 1QMUA 4MKTA 5HGBA 2B5IC 4AIOA 4UM8A 3SDAC 1DN2A 2WXKA 4NERA 1CXFA 1N5AB 2CDFB 1L9RA 4FQJL 3SQOH 3ZU8A 1FYTE 1MFNA 3WEAA 3SOBL 5ESQA 3EJYD 3QSKB 3GSXA 3M17A 4XC1L 3IETB 1EUTA 4ZSOE 3RGBA 4ZNEA 4MNGE 2GSGA 3BGMB 2ZKHH 2PN5A 5F7WC 4PJDF 3AY4A 3DVGB 3QXTA 3MJ7A 2X4QA 1UZGA 3GBEA 3T6ZA 5FW6A 1CFSA 4HCFA 1CIDA 1E3XA 1FFPA 5B7MA 2C3WA 2F53B 3K0YA 4JB9L 3GI8H 4Z7VF 3NPZB 4J8RB 1ZANH 4XB7A 4UINL 2NTFB 2ADGB 4DW2L 5IB3A 4X80L 1TLKA 5JDJA 2AQSA 2J6EL 4PH8A 3TTYA 5JMRA 1CT8B 1AI1H 3W9DB 3ABLB 5I9QB 3S88L 4P9HL 2X9ZA 4JG1L 2F9BT 4YDJB 1QI4A 4XVJH 5DFVD 1KEGL 2WLZA 2B20A 3QJZA 4JZNA 4WTXA 2GSMB 3SJVA 2DIJA 3S34L 1Q9LB 4XO4A 4YDLC 1JHKH 3QAZC 4CVZB 3VGAB 3II1A 1U8OA 4NM8L 3QEHA 5E8PB 4AUYA 4JFSA 1I1CA 5GHWL 2BMKB 1KSRA 5D2NA 4NNXA 4DO4A 1EEZA 3KBPA 3TIDB 1T0NA 3H85A 4XBEL 3SYPA 2EXWC 4L8BB 5J6HA 2J1XA 2EYTA 3K4DA 1HZHH 1WBZA 4U1KB 4M7JH 3OGOE 2UUDK 4KQ3H 1IAKA 2BNQB 5BUGA 4CNIB 4ZMYA 3Q3GB 4IS6A 4DEWA 2PR9A 4WDIA 2JELH 1KIQB 4TVUA 1A1NB 2AJSH 2ICES 3B2XA 1LO4L 4F58H 4ISVA 4FLSA 4X6DF 1OGAA 1XF5B 1PD0A 1SHMA 4JW3A 4G7YH 3D08A 3SDYH 3FSVA 1ED3B 2CM5A 4WIQA 3QHFH 5DZJA 2R59A 4DGWC 4Q97A 5K5YA 2ZPKH 3D4GA 4ZK8A 3UYPA 2R4RL 1FI8C 1VGEL 3LN4B 2P24B 2P47B 1OGTB 4ZYKA 2R69H 1LK3H 4OLEA 3QA3B 4X98B 4NUJB 3FUIA 4LEXL 3F6JA 4M62H 4ALAL 4PJCA 5B1JA 3G6AA 4FC3E 3BLKA 2IPUK 9PCYA 4ILDA 2DQHL 1KULA 4X83A 1MRFH 4PLJC 4OI8A 2EKSB 2FO8A 1DQKA 4ES8A 5IVXB 2HAZA 2JI1A 4CW1B 3F7RA 4Q56A 1F11B 3EIFA 1G9ML 5CGYD 5CZXC 4MZRA 3CLFL 4FFYL 5IMLB 5FCUL 1JNHB 1GR7A 3N6YA 1KB9J 1WFIA 2L7JA 5EEWA 1Z9SB 5ESVB 2X3AA 4UILH 3GMRA 5ITFB 1BCIA 1MJ8L 3ARYA 1PG7X 1XTLA 2F0CA 3FRPG 4Q9BA 3KH4A 3WY1A 3KPRB 2IH8A 5D4HA 3K2UL 2DQGH 2I07B 4JUSA 1MFCH 2CUAA 1F1DA 4N25A 2WAQA 3NYKA 2R9HC 3BWAA 1T3FA 4U6XA 1TEYA 2OI9B 3MODH 3VXOA 5IHHA 3RVWD 1NJ9A 4NC2B 2R2EB 3PWNB 4GW4A 1L4IA 1HXMA 3DVNB 5FKAA 5IUSA 1OY3B 4P2RB 4JHAH 1JBJA 4JO4L 4RZCA 4CKQA 5D55A 1UZ8A 1UOVA 3SJVD 2DTML 1YC7A 2QSVA 2CHNA 5FUOL 3RFZB 2HZHA 3BAIA 3TJEH 5GGTL 3PNRB 5KSVB 4K0OA 1IFRA 1NBZA 2HFFA 4Z7QF 4HT1H 3BVDB 4KKNA 3QDGA 4O2EA 5D70L 2P8PA 1AR2A 3ZDZF 2UXTA 1CYXA 3K71A 4AUUA 4KJPD 3DSNB 4J12A 1FDLL 2FCBA 3KH3A 5EU6B 3QZWA 1LNUB 2YLKA 1OP9A 5J11B 3A3YB 1L6PA 5ANMB 4ODSH 4DCQB 5IGXH 5J1SC 3G5ZA 4KUCD 4JR9H 5CS7A 3QQ9C 1Q0XL 3X1FA 5C08B 1P4UA 3E38A 2HFGH 3WIHA 3VDBA 4PJGB 1IT9H 3EADA 4WNJA 1JV2A 3DYOA 2H0JA 4OD2A 1MNNA 4O02A 3C2SA 4O51B 1MKFA 3LNIA 4J4PA 1NIDA 5EUOF 4DKEL 2Y1AA 4J3OD 3RDTA 1HQ4B 4MDJA 3VD1A 3STLA 1MWAB 1IEBB 3KBHE 2C4XA 5SWZA 1NWOA 4QMEA 2AXFB 4FHJA 3MJ6A 3QPQC 3DV4A 1A9EA 1NAMA 2QHLA 2X44D 3SD2A 3PV7A 3PWVA 5I1KL 4O2CA 3FSAA 4FE9A 5CSZA 3BSZL 1S7VA 3KYKL 3SE9L 4E41E 1B3JA 4B53A 2V8MA 2VNCA 5IEKB 4HF5L 5INDA 5I73C 1IGTB 2WPGA 5JHDE 5C7XH 5IHZB 4YDVA 1HE7A 5C0AD 3RA7H 2X6CA 3ARTA 4WW1A 1HWHB 5AZEH 4NJ9H 3K91A 2H3NA 1DVFD 1TQBB 2EDJA 7PCYA 2PTUA 1J11A 1P9MA 3IF1A 3PXJA 4I1NB 2BP8B 4RISH 3X1EA 3V5DA 1HHGB 2Y1VA 2HUEA 5I17A 4K9JA 3NQIA 2BWIA 3MLRL 4Y9FA 5EEXA 3WNJA 4HOXA 5F6HI 5JUEH 2EDFA 2WTRB 3PFQA 4DKDC 5LN8A 1LEKA 1EAOA 1NLBL 4V1DA 1MFEL 4HIJA 3VFSA 2YMOA 1QABA 2ENQA 3ARWA 2YZ8A 3U0PB 5JIPA 3SPVA 3VTMA 1D9KA 2BOCB 4OJFH 3MRBA 1ORQB 5AW7B 2NCMA 3UBXB 3N3EA 4P46C 4AV0A 1LP9F 2GK2A 3HIZA 3L3JB 4LVHB 4NJAL 2RFXA 4QCIB 2PO6B 2G75B 2NMSA 4M03A 2GBTA 4PCSA 1ZTXH 1M56B 4YHMH 3PWLB 1N12A 5TDOB 3TA3C 4F2FA 2QADD 3WIIL 2IVFC 2CBOA 2QQLH 3QDGD 3QIWB 2LU4A 5I18H 3QFDA 2C8NA 5KYYA 1CO1A 1QLEB 1IM9D 2ZKMX 4R83A 2EZ0D 3BN9D 3EO0B 4HJTA 4F8QA 4MRBA 1NM9A 4KK6D 1HK6A 4W9LC 1KT2B 3IE9A 2G9HA 5KSAB 4BQ8A 4B9KC 1JYNA 5F7DB 2B9BA 4E9LA 5F70A 2FL5A 4L2LA 2DEYX 1CQYA 2HT3C 3LQZA 3IDMB 1AD0B 2DWTA 4YL4A 1BFVH 1JERA 3RUGE 2EILB 1MVUB 1JPGA 4AVKA 1MREL 1FFNA 1G7HB 2OXGA 1F3JB 5EU4B 2K9UA 3ESMA 3GTTA 5JOFA 4GRLB 3RDTD 2X3CA 2CDEA 2OSXA 4FG6D 4PJ7A 3MNMA 4PY8I 3V0VA 2AI0L 3HAEB 1TETH 2PTVA 4P59H 3QUKA 4BUGA 5L8LB 4EI5C 3D34A 3ZN6A 1JZEA 2PPAA 2VDMB 1XT5A 3BPCA 4FLRA 4LSQL 3MRJA 3QULB 3CSPA 4PV8A 1A3RL 2VR3A 3MRQB 4GUPB 4HC1L 4M48L 2QELA 5GGQH 1T1WB 1AKJB 3GHBL 4MAYC 1S9KC 1N5YH 3CD4A 1EEQA 1BOGA 1WCQA 2GBVA 4JN2A 2A6DB 4ZPTA 4PBVC 4X4ZA 1SJEB 1LTXA 3MJ9H 3CHRA 4XXWC 1G0XA 1JNLH 4ZO6A 2C7UB 1TYJA 2X1OA 4J2QA 3CZGA 5IB1B 4I2XB 4TPRL 2CO4A 4B7IA 3P4LA 3TZVB 4BUHA 3MUJA 3B3IB 4BGDA 5EA0L 4AC2A 2YFOA 1KTLA 3JV4A 3OKLB 4FYSA 5F7LB 1ZMYA 4GRWF 1V55B 4MTMA 4J6RH 1M7IB 4D9LH 5F6IB 2OR9H 1ACYH 1MPAL 5IQ7L 5I0ZA 2DLGA 1OAKH 4LCWA 4F7KA 1MCWM 1T89C 2F74B 3OLDA 4JCWA 4KDTA 4NQEB 4F20A 1L5GA 2H9GA 3ZGIA 2X1WL 7FABL 3GSNH 2VMCA 1GZHC 2Q1EA 2YSSB 1KXQA 4PJIB 3MLSL 4PU2A 3ARBB 5E0QA 4O02L 5JORB 4H0HB 2HVKB 3QDHA 3F65A 1RK0B 2W0KA 5AD0A 4JKWA 2BZDA 3IN0A 3CFKB 12E8L 2ZD0A 2VJ8A 3APDA 5KYUB 3LKQB 4P05A 1W0WA 5C0GA 4HMCA 2ODHA 3BYYA 4MD0B 4TUJB 4LLYA 2WSPA 3GB7B 5K39B 1BIIA 2VERA 4Y16B 3LS4H 1Q9OA 2JCCA 4ES9A 5JPMA 2X4NB 1CLVA 1Z3GL 3UO1L 4WCYH 4UMSA 1JZ2A 5LNDA 2O61A 1UB5A 3T71A 1VCBC 1D6VL 3GRGA 3WXWL 2CHZA 5HGAA 3UZEC 3TO2A 5KSBA 4MXVF 4YSSA 5H94B 1FORL 2IXQA 2R2HA 3V52L 2IAMB 4LP4A 1XL4A 2WC7A 2R15A 3CZJA 5EBWB 5EC1A 5K33A 4AV5A 5LNEA 3BEVA 1HKLL 3V0DA 1A6PA 1MZYA 1HHIB 2XX1A 1VLXA 2IAND 3FO9A 3P4MA 1COBA 3ZKND 3IU4L 1QFWM 1NM4A 4H25B 1OOWA 4NO3A 5DJYA 5E4EB 2CKBL 4QYAA 1YNLH 4LXFA 1LK2B 2EE2A 1RV6X 3H8NA 4TNVF 5AOKA 3MREA 1IMHC 4PTUA 3WTYA 4KRLB 1SYSA 4N2EA 3M86A 2YAPA 4Y2DA 1BD2B 4RNRB 4OAWB 1QA9B 4WEUD 1ET5A 3LIUA 1QUPA 1UD2A 2PYFB 3FQWA 4R96B 1SHXA 2AAAA 3UPRB 3S5YA 4EDWH 4G9FA 4H8PA 1MNUH 3Q8EA 5MP6H 1BLNA 2YWZA 3CZLA 1XQ4A 4LLVB 5CEZH 1M1XB 2AQRA 2D03H 3QHZL 4UM9A 4Y5YB 3WFZA 2NZ1A 3K6SA 1J5CA 1ZHKB 3FUDA 4M29A 4PY7B 4ZFOB 5MENA 2IV9A 2A74B 4NQCB 2R2BA 1ZV9A 3U1QA 3APMA 1KJVB 2UZXB 3KLAA 1GCYA 3BESR 2WWNA 1Q38A 1JPFA 4U6VL 1Y18B 4XVTL 4D0CA 4LCWD 3DYMA 1MI5A 3Q9QA 4WFHD 3HFMH 3UDWA 2YBGA 1WAAE 1DP0A 5D1ZC 4LSTH 4PJ9B 4XMTA 2VN3A 3AXLB 3PL6C 3QEGH 4LSPH 4W9DC 5CJXC 1NC4A 1Y07A 3K8MA 2V3DA 2A73B 4R0LB 5CP3A 1UEMA 1I1RA 4MJIA 4PI2A 4AT6A 4BXSV 4KZDL 4AXWB 1ZAGA 4WLCA 1GYUA 3Q6GL 3BGFB 1TJHH 2JB5L 2WNWA 5FO9A 3QPXL 1G7QA 4N9OB 2C9SA 3FMGH 1IC1A 4XPTH 2E7HA 2ZNXA 1TQWA 4ETQB 3FDWA 2VE6A 2JMRA 3GKWH 3C5ZB 4FG4A 5D71L 4HLEA 4ODTH 4OKVA 2AK1L 3ARPA 3RTLA 4QHLB 3DUUB 2YKKA 5LWYH 1EEYA 2CQVA 3HKZA 2V33A 1FL5A 1G7JB 1YEJH 2J73A 3DKHA 3OF6A 2FBJH 4PRIA 4U2ZA 1S7SA 4X4YA 2DH2A 4OLUH 5FHBH 1ULVA 1DBJL 4I85A 5FOBB 1FZMA 1LWRA 4ELMB 4BM7A 4M7KL 1ZK5A 4AY0A 1H6EA 3VGEA 5C07A 2W9LA 1VDGA 3L3GB 3DXAE 4I8DA 1RMFH 4XN5A 4U0RC 1F3RB 2VLKB 3EJTA 1G9NC 1CDYA 3L3KB 2CCLA 4L3EA 2WJ7A 1EZVY 1HTYA 2I9LB 2P28B 2DWXA 1KBKA 2WNGA 3HE6C 4G8EB 3BIKB 4JKNA 1YHPA 4GKNA 1OB1B 2UX7A 4Y2DD 5BRPA 2UV3A 3CHPA 1XX9C 4KXAA 2CH8A 1MRDH 3HNVL 3PWPA 4QO1B 2OMXB 4BD4A 5E4IA 3N1PC 4WJG3 2RCSL 1KGUA 1BZEA 4EO5A 5BJTB 3QORA 4NWTL 5J06A 4MA8L 3KPTA 4H4NA 1AGCA 3TBCA 3D5OF 3B3BA 3MCLH 3D52A 1RZ8B 3ARDC 3LVTA 4L0PB 1I1AB 3CMGA 2CJ3A 1DQDH 3F2LA 5SWSA 3BT0A 4DEPB 3WJMA 5F7YC 2EO9A 2YD5A 4K7FA 3TBBA 5BOZG 2FK9A 5MEND 4XNXH 3RL1A 3RVUD 4FQ2L 4Y1TA 2WBJC 2CO7B 2Y7QA 4POYA 1SBSL 1UVQB 3OXRB 1ZGLM 1MI5D 1NDGA 1U92A 3SE4C 1RUPH 3AT9A 1RH8A 3OKNB 2XWCA 4FNTA 5CP7A 2F8VA 3KR3L 4B3EA 2G5UA 5AAWA 1IAIH 3SY0A 5L7XL 7PAZA 3AACA 5C3IA 1ADQA 1DQJB 2NY5C 5T1LA 3K7UA 6PAZA 3L3IA 4X99B 5T1DL 3TF4A 1AJ7L 2PCPB 4JHWL 3MLTA 3RVXC 4A39A 5F9WC 1NMBL 1DQQB 4P5TB 5I1HL 3P2DA 4YZFF 1UYWL 1E4KA 1WWBX 1NEZA 5CZKA 5LCVH 4HA1A 5KJ7E 2G9KA 4IU2B 1M9WA 1RZJH 1I8UA 4J3VA 4OZIE 3JWOH 1KYOJ 3MCKB 2HKAA 3FT4A 4PVMA 4EKXA 3BDBA 2ICWI 3LEYL 4AQ1A 3EGSA 5I16B 4UWQB 3QQNA 4N90E 3VFRA 5AVSB 4HWNA 1I7TA 3GM8A 4X2UA 1TT6A 5F88B 4NZRH 3JV6A 4R7XA 3FB6B 4IBSA 1MCEA 5D6CB 3ZZLA 3NCCB 5C86A 3GUFA 1RUAH 3QNYB 2EACA 3K6OA 3QK0A 4PRID 3MRHB 5GJTH 3P4NA 1E43A 5DMIL 4ZG1A 2V5YA 2IALB 4EZLA 1U58B 1DUYA 2FSDA 5IVXF 4MSWB 4IMKA 4XI5D 3RWIA 3U7WH 4IM8A 4AQOA 3H3BC 4RFOL 5F44A 3W2DL 3KXFE 5DD3H 2BY3A 2N7AA 4DAGL 5L0QC 1A0QH 2B9AA 3L5HA 4YHYC 2BY0A 5JOEA 2DMHA 4AK2A 2UVEA 3G6DH 4L3ED 3LZOA 3VI4A 3E6HA 3FCBA 3IN2A 4OQTA 5C0AE 1LHZA 3CDGA 3QNZA 1AIFB 1OSEA 2VMJA 4YSDA 1P7HL 1OHQA 4O2FA 3Q13A 1BZ9B 1H9VA 1VFOA 3AS3A 4ZD3L 1HS6A 3MUHL 4ANWA 3I75A 1QO3A 5D1QC 2AABL 1NBVL 3QJVB 1UD3A 2L3BA 1VFAA 1F42A 2FJUB 2NXZD 1W15A 1G84A 1MQKL 5SWSD 3ZQ9A 1BF5A 4L8DB 2O93L 4PV9A 4QRSA 5I82A 1MUJB 5C0RL 5HXMA 2CO6A 1TQVA 4XNDA 2A9CA 2EUXA 1U8LB 2BNRD 2QFRA 43C9A 4IU3B 4IIQA 3WNPA 3PRZA 2K70A 5HI4C 1RZFH 1FFOA 3OKOA 1J8HD 1U8QB 1GOHA 3BEWB 1HNFA 3MV8A 3MV9B 2ARJQ 3LIZL 1J1PL 1XB6A 1DLFH 3V4UL 2F68X 5E1IA 4HPYL 4DVBA 4ZMTA 5GGVY 5T1LD 1IC5L 1FNGA 2LFEA 2Y7SA 4AYDC 5J12C 3QDGE 4PJGF 2EXYD 2UXFA 1F18A 2NY7L 2GK0A 3MRFB 3SBPA 1U3ZA 3MLXH 3C6EA 1AR1B 2CLVA 2P26A 5J6GA 4K94H 1IBFA 2ITFA 2OTWB 1SMDA 4LFHG 2YBRB 3V5KA 1JUFA 3UO8B 1U3HC 1CF8H 2J5LC 1BM3H 2Z31B 1P6FA 1J7VR 3ZL1A 3Q2VA 5CLTA 4FQIL 1ZD6A 4QHNA 1FVCB 1OLZA 3ZTJH 5ACZA 1UFGA 1S9YA 4ODXB 3K5SA 4XN7A 1U8CA 2YUWA 4ZDHA 4HWEL 2F19H 1M3JA 5ETUA 1HNGA 4YAQA 5CU9A 5DD6B 5LGHH 5F1IA 5EEUA 1BQRA 1SDAB 2Q76A 2NXYB 3DPBA 4PQXA 4U6HA 4P48A 1DN0B 1UZ6F 2O5YH 4EIBA 4KX7A 3GJFK 1KLGA 3MLZH 4ZS6C 3QEQA 1H9DA 2GSIA 3HB3B 1T5XA 1RU9H 1UATA 4HS8H 3PDOB 1F4YH 5I1IL 1D2OA 1SEBB 4NNPL 4HDIA 1E4XH 1MCDA 3IJSA 3WY4A 4AEIL 1FNSL 1IGML 5ALBL 2X7LA 3IGUA 3DOSB 4OV5B 1NKOA 4APXA 4ZUUB 3B6SB 4PJHE 3UTTA 3QXDA 3BD3A 4XP9L 1BW8A 2OR7A 3A6BL 3P9MB 4NDMB 4K9EL 3BXNA 3DIVA 4L4VB 1BLIA 1JZDC 5H4YA 2OCJA 2PW2A 3FUNA 3RZCD 3VW3L 3CZFA 4HKBB 1T1XA 3TO4A 4X7TA 4KQ0A 4HW6A 3FC8A 2DL2A 2IQ9H 3D69B 2VDRL 2B3IA 1X3DA 4ZAKB 4BZ2L 3JWDL 2OL3L 1OZTG 1I3GH 3OX8B 4HGMA 4JFEE 3RGHA 3B1TA 3SYCA 3VVWA 2XPZA 2RQ8A 2W1NA 1Q9KA 1KN2L 1H15B 3MBED 5I76B 3EH1A 4Z8FH 3PIQA 4H20L 5AAPA 1F6FB 5E5LA 3IDNA 3UTZA 4EKJA 4DK5A 1IGJA 5IMMA 3LH2H 2IGFH 5IQLA 3MV8D 4KGJA 4N2HA 2BO0A 3LHPL 1VGKB 2R8SH 3C87A 4HGWB 4PCKA 4W9KC 3ZRCC 1WC7A 4PB0L 3ZIYA 1KJMB 1AOHA 2OPCA 2BSBA 3CX5K 3QCUH 4NUQA 4ALAC 4DESA 1R3LA 4OM0L 5K59E 2N0KA 3GMNA 4YSUA 1WSST 1YYLH 2O6EA 5DLLA 3C60A 3L3DA 1IM3B 1WEJL 4WUKL 1ZT4B 3QJHA 2I5YL 4JX0A 3V9EA 3QWOA 4H88L 4U1SA 3L08A 2J72A 4OQTL 2GTZA 1QFWH 3UZVB 2CNZA 1XD0A 2ZG2A 4LB8A 1FG2A 1S46A 3EF7A 4F37K 4JDZA 3O6LH 1JGIA 5IR1B 5EF0A 3HR5B 3V95A 2GJZB 2DJ4A 4XMKL 4ZTPH 4S11A 5GQBA 4R7DB 3H7BA 3QW9A 4XNZC 4PJ7E 3BP5A 4TUOA 2EDOA 4K8RH 3NJVA 4UNIA 3CQQA 4QJ3B 3I6GA 1RZKH 2EDKA 2IANE 3WNMA 3APCA 2CK0L 3O9WB 4MGXA 3SO5A 4KXDA 3HS9A 1A6VH 3D09A 3ZR6A 3KPOB 3W57A 3DBXA 4PRNA 3SODB 4WZ9A 5I66A 2VKWA 1I8MA 1WQVT 3O0RL 4OD3L 1HX0A 5FUCC 2A4EA 2N7BA 1BQSA 3ATEA 3CUPB 4Q0XL 1Y6NR 3HI5L 4KKBD 4YVNA 5BNXD 1HL5A 2FATH 1NUGA 3ULUH 3RTQC 4HV8B 1G7MA 4YNYA 3UTTD 1GIGH 1JZ6A 4G8GA 5E8DH 4N9GA 3GT6A 1GGIH 3R8QA 1V10A 5IY5B 1MCPH 3GPSA 3LRMA 2G4GA 4JRYA 4NC1C 4WI9A 2ZXCA 1R5VA 4GINA 4OZFH 4ZFFA 3B83A 1KN4L 4KK8C 3OTTA 1Z2KA 2P8MA 3WIFA 2OKMA 3WEXB 4YHPB 4JY6A 3B9AA 4PJIF 1IBHA 1O7SA 4XWGH 4RFEB 1JG9A 1KY6A 2GJ6A 4LOEA 5TGBB 2BVUA 5LBVA 2VM9A 5D7LD 4AVHA 1KB3A 2A83A 3VXPA 1G87A 1JGVL 4YE4L 2WVSA 3AY4C 3OKMB 2V2WA 1CFBA 3SZKC 4JANA 4ZTOL 4BFBD 4PR5B 3PUUA 3GRBA 1P5VB 5FGCE 1KCBA 4CSZA 2DLEA 3NSXA 1SOXA 2O5ZL 5DJ8B 2OZNA 4N86A 4LZKA 4BSVB 4GJTB 1R3IH 3SO3B 1ZHLA 1OCRB 4H26B 4OF6A 4GW5A 3RVWC 3V4VH 4UQ3A 3M07A 4G8FB 2BSSA 4GQQA 3K74B 1JCVA 2XTJE 2JH2A 4MJJA 1W0VA 4X8GA 3SDXB 3LCYA 4XAWL 5DEFA 3K80A 3OQRA 4JJ5B 5DJXB 4UDUB 2WIIB 5C0IB 2R56L 1OPGL 3GLDA 3QARA 4HXBL 2FEDC 5L88L 2Q10A 4PJXB 3IDYC 1KBWA 4XCNB 2H47C 5D2NC 1E40A 1C8QA 3BPNC 4KJPC 3B43A 1EO8L 3O6FD 4JM0A 1ZVYA 2FWLB 2ENYA 2MPAH 1O9ZA 3CH8A 4J2XA 1S9WA 3VFVA 3AM8A 1YMMB 4S1DD 2ERJB 1NCBH 1NH6A 4MJ6B 5FS5A 1ROWA 1TTGA 1C1EH 5IW1A 1QSED 3II3A 1PG7H 4XP4L 3BRGC 2VDLL 4A2GA 3E8UH 4UAHA 4QJ5B 2XIDA 1JK8B 4K3GA 3P73B 1R3HB 4KAQH 4QRRB 1FH5H 5D5ME 4FQLL 1A4CA 2Z65C 4PLKD 4G8GD 1AQMA 4OLYH 5JPNB 3R1GH 1KDIA 5IW6B 1KWKA 1BQUA 4X7DC 3VXUA 2N59A 2ADIB 4OGXH 3MRRA 4GFXA 1DJSA 2KC0A 3JTBA 4GBXC 5DRWA 1HWWA 2LLNA 4LCCC 2IADA 4LSRL 5DHVA 1CD1B 2J8UB 1ODUA 2ZCZA 4NN5C 1A7OH 4UT9A 1FNEB 1G6RA 4OU3A 2LVEA 1XCQA 4TOYL 4A2DA 4TSCL 4F92B 3LPFA 2I60L 3VXQB 4HS6B 4E68A 3S2AA 4TNFA 1JFQL 1SJXA 1I8KB 3CDCA 3QG6A 1NCTA 4A2HA 4EUPA 1G9EA 2VZ1A 1HKFA 1YA5A 1ZEAH 4XMVA 2MCPL 4UU9A 4OQ1A 1O7DE 3G08A 4C58B 4L3CB 3GSNB 1KEML 1KGXA 3ESOA 3GI9H 4ZFGH 4PN6A 4PJEA 1CD8A 2HMIC 4MASA 1QI5A 4YHKL 5J3HD 4GI8A 5GGRA 5CCKH 2A4CA 3K81A 3KWVA 4HUXB 4BV1A 1JYVA 3NZ8B 4DVRL 3ARQA 3WYRA 2CGZA 5TFSL 3CWGA 4M5TA 1HIMH 2LE9A 4ZMZA 3NIFE 1FE8H 4ELMF 4FLOA 4N0YH 4LLDA 3PQYE 2KLRA 2NYZA 1NQBA 3NAAL 4I0CC 3TNNA 1H5BA 2X09A 4R8WL 1JNNL 3FT9A 2YUVA 4ONHB 1GL4B 4JG0L 3O3AA 2JKTM 3OAYK 2HLFC 5EV7A 1ZVHA 2Z8VC 3W0WB 4U1JA 1OAYL 5KW9L 3H9SB 2K1MA 3O8XB 4HQQH 4LCYA 4M6OL 1BQHA 3AWGA 4JFHD 4GH7B 1E65A 4I9WE 3A6CH 4OVVA 3KJ6H 2P8LA 2VH5L 3MXVL 3EH5B 1I3RB 1NKRA 3AXHA 3X3FL 1JZ5A 4L3EE 5FR3A 4M7LL 25C8L 5C2BL 3H4FA 4MHHG 4I77L 1U93B 3FSZA 4D0BA 4IGBB 3FPXA 2GVYA 4LARL 4IRSC 1U8JA 2C1OA 4E9VA 2CDGB 4IBQA 1MFUA 3WLBB 4J4PC 4OFQA 5C0ND 3BDYH 3GZKA 5DMKA 3RDTC 4OSUL 1U2YA 1BJ1J 2XN1A 1JXGA 2NLJA 2E0PA 2OMWB 3NACL 3MRMA 5I8EA 5AZ2L 3VXUD 4GW1B 3LY6A 4XP1H 3ESUF 2M1KA 4IBVA 3IYLW 4X9HA 2VTFA 1ONQA 3CAFA 5GS0H 1AGFB 2MHAB 5F89A 5EZOH 4QXVA 4Z78A 4XHJC 3GSUA 2IH3A 3MNVB 4FP8H 4QJ4B 2L4OA 3O45B 2XZAH 3PHSA 1CL7L 4NCC1 3QUZB 3WHE1 1FBIH 4Z7OE 2BNRE 5GS3A 1WA2X 2AK4A 2ZXWB 3L9BA 4ZXBB 2PPFA 3CVHH 4XVOA 3T0EA 4RRPM 1P7QB 1J8HE 4NGHH 4WI5A 5GRUH 5EIIA 4N2CA 4GI6A 1V8HA 2P80A 4YR6B 3VWKA 1ZLUH 1P9MC 1I9IH 1BZQK 3KLHD 4OY9A 4Z7WA 5D7IE 3PPEA 2FO4A 3GS4A 5AW3B 4LEOA 3VRLF 4LL1A 3WN5B 5KN5A 4XCFL 2C4FU 2FWSA 5C8JB 3SPCA 5KVEH 5DQJA 4C56B 3EFDL 1BZ8A 2EH7H 3P9LA 5FM4A 4MNQA 2G2PA 1D9KC 4D8PA 1D7FA 2AJZB 4PWKA 2YA1A 4RQQB 1ZT1A 1P1VA 3VA6A 5K9JH 2P46B 2R0ZH 3WFHB 2YK1L 3N85H 3AG3B 4HVBA 3LRLA 5T3ZL 5DD1H 2F1BA 1ZVSA 3O3BB 1VPOL 4ONOA 5IM7B 4ZNCD 4WEMB 2BHUA 4FXKB 3QJSB 3ZE1E 1UXMA 2X4RA 1C5DA 4UB0L 4JPKL 3QFGA 3TYGH 3L5XH 4KI1A 1U8KB 4XP6L 4LKCA 4UUJB 1Q1PA 2ZOOA 2Y6SD 4IDJH 3DX1A 1IGYA 5FKPB 1LILA 2QKIA 5E2UH 5EWIH 4Q6IB 2P7TB 3RHWK 4AEFA 4XPAH 1UT1A 2H2SC 4XPGH 1KB5H 3WS3A 2DWSA 4ABVA 3MLUH 4RAUA 1ZLSL 1MJJA 5HJ3B 3ZT5A 3OB0H 5EEYA 1R47A 4KTEH 1YO4A 3FHQA 5E8OB 4NOFA 5CJ8A 3SDDB 5F7UA 1R33A 5EH1A 2UYLA 4GSUA 3H4HA 2UXGA 3WY3A 1PAZA 5IF0B 3S4SA 1JV5A 4QXGL 3D30A 1EVTC 1S3KH 5H8DA 3GFUA 4XP5H 1WA1X 4NN6C 4YWGH 3FHEA 4J3UA 1XBDA 3UXFA 2A77L 1YNTB 2VQ1A 4P04A 4XTRC 3WD5H 4BQ6A 5K9KA 2G0KA 4OCSH 4UQCA 1S78D 5FA3B 5HHNA 3IDXH 1AMXA 1VACB 2WLMA 35C8H 3MRPB 4XCEA 3JZYA 3AREB 4DKFH 3WO4C 5KVGE 3T0ED 2QSCL 3MJGX 4DPCX 1AHWB 3I9AA 3QR2A 1TIUA 4QHMA 3VWKD 3EG9A 1J8RA 4LL4A 1TCMA 1UACH 1SUJA 1Z5LA 3CHSA 4JQIH 1CFTB 1HOCB 4F33B 1B0GB 2XWBB 5F1OB 2R0WH 3NFNA 3BI9X 5EPMA 4HWBL 3FQYA 2PP7A 1JHLH 4WNQA 3RWCB 3QQXA 4MNQD 1CFQB 3PPSA 4BK5A 8PAZA 4KDTC 2YQ3A 4OLWL 1C16B 1SY6L 4O9HL 2ZAGA 1J1XH 2KHAA 5E56A 1FRGH 4WKZB 3FOMB 3BYTA 3PABA 4JCLA 1YEIH 3NA9H 2Q86A 2R4SL 2XOTA 3EJQA 4ZJ9A 4YFLF 2QVIA 4BZ1H 1M2OA 1CN4A 4YO0B 4Z7UA 2EH8H 2Q8AH 1KENL 5I8CA 5C0BB 4X6BA 3N42F 1FZJA 4ZMVA 3N91A 4LDLB 3KPSB 1BXAA 2VZUA 2NNFA 1NGPL 3FYIB 1YJDH 2FX8H 1C12A 1DYZA 4TYUA 1F97A 1QWUA 1IC4H 2BJML 2X2YA 5LUMA 3CQFA 1HDMA 1UB6B 3E3QE 3F12B 3ZHKA 1G94A 4NENA 4YS4A 4FG0A 3VH8G 3VGDA 1YECL 3F7PC 4WO4B 1E8WA 1KELL 2P3YA 3EH4B 2IG2H 1MFAH 3F5WB 4C4UA 4Q9CA 3OXSA 5ABDE 1R0AH 1TENA 4MXQC 3IETA 4JGUA 1X9UA 3I3EA 3QE5A 3VSUA 3DUSA 2DQDH 1K8IB 1KY7A 3ABKB 4K2UH 4NWUH 3WTTA 2RGSA 1IO4C 1MH5A 4G6JL 4HSQA 2BOLA 1I7UB 1IQDA 4WFFE 2B4CL 4KO6A 1CGTA 1KFAL 3BE1H 2AVFA 4XBPB 4YVUA 3AB0B 2C3XA 3B2DC 1GRWA 1VZHA 4L5FE 1XF2B 1PL3A 5H4ZA 2UZPA 4HX1A 1FYTB 3VXSD 1EUUA 1T22A 2M8XA 5D7LE 5AVVB 1MFBH 4PJDE 1RJYA 5DMYA 4A67A 1VF5C 1THCA 2ATKA 4HKXB 1CT8A 3FU7A 4PRHB 3SPGA 1CI3M 3T8XB 5EOCH 5EO9A 2EKJA 3I9IA 5B22A 2PTTA 1IJNA 1PZSA 4YDJA 3FTSA 3N1GC 4WI3A 5L8JB 4Z7VE 5E08H 3MLYL 4LAJH 1JHTB 2CIIA 4AL8C 4XOCA 1Q9LA 4K23H 3TESA 4Y4KB 4GAJH 4ATTA 3HBGA 3VFNB 1IGIL 5F21B 4LGPB 2G4EA 2HTLD 2YAQA 1JTTA 4BGLA 1VAHA 2YPKA 4PJ6A 4NUGL 3RVUC 4B9ZA 2KERA 2PXYD 2E27L 1D7CA 3BQUB 3TIDA 5BXFB 3CVIH 4YDKL 2W0FB 3OC8A 1UJ3A 4KWUA 2YD0A 5IREA 3FO2A 2YPLB 1WV7T 3ETBJ 4PB9H 1X5FA 4U1MB 4DFIA 5C0EA 2EDDA 1WZLA 3ZY7A 3Q3GA 3G5YA 3S8GB 3EH3B 2MQ0A 2D73A 1TOXA 2DEWX 1A1NA 4JO1H 4G59C 3NK4A 4H8VA 1XF5A 2ZWZA 3AY2A 3OKEB 2QQNL 4G5ZL 3BPLC 1XSKA 2H45A 1RZGA 2N1KA 1HYSC 4KRPB 3TIEB 4XN8A 1CU4L 2ZXBA 2DEXX 2R0KL 3QZPA 3W37A 3VD4A 1QSEE 2WINB 3AQZA 3LN4A 2P24A 3KHQA 5FB8A 3MOAH 4X6DE 4KKRA 1B0RB 5DZNA 3INUL 3HC4L 3UG5A 2CHXA 5DURB 2EDEA 4N0FB 1M7UA 5DD0H 2FB4L 1F8TL 1RXLA 2BW4A 4LP8A 3SPHA 2WQUA 4WWKA 4Z0BH 3I84A 3LDBC 1WZKA 3MRKA 4AENB 3BISA 4XBMA 2OMYB 4WKXA 1WFMA 4AGMA 3II2A 3LZNA 1GTNA 2WVTA 4H8UA 3OGCB 4MLIA 1KZYA 3EYUL 3V6FA 1I53A 2PPDA 3S36L 1E9QB 2ZYRA 1YQVH 4HIHB 4P5MB 4PJBB 4XMUA 5DWUL 2ICEB 4AV4A 5SWQB 5CJBA 4LPTA 3HEIB 1NCGA 1OCWH 2VDPH 4BDVA 4KPHL 1H3WM 2HUHA 4JFQB 1SLUA 2XVGA 4XNUL 3HRZA 4Q9QH 3QXVA 2EDLA 4QT5B 3SOTA 1TVHA 4D9RD 1PTZA 4JY5H 1CGVA 3QORC 3SDXF 2YMXL 1AYOA 3WV0A 4E0RB 1DQTA 4ODWA 4XVSL 3ABZA 1SOKA 3HG2A 1G0DA 1R3JB 3GWJA 4F7PB 1KBVA 3Q0HA 3RFZA 5IHWA 3ASOB 1NFDA 1DEEB 1TEGA 3VGFA 5KSVA 1WBXB 5IVNA 2E4FA 3MKGA 4PJXF 4MA1B 3QCTL 3D39E 2ZG1A 3WKQA 3RFRA 4M8RA 1LNUA 3T2QA 4ORGB 2Q6WB 4JPVL 1MAKA 1S7QA 1TTAA 4EEEA 1RPKA 3KYNB 2R83A 2NY0B 4K9EC 4DCQA 2IDFA 3M1OA 5EU7E 1ZXQA 2VRAA 3L3HB 4LSSH 5C08A 3TPUA 4Z7QE 1BGXL 3ZDZE 2CUMA 3OSVA 3IDIB 4NQDE 2VLRB 3IMTA 3MO1A 4PYGA 4KX8A 1E4KC 2J56A 4JFHE 2IDTA 4AJWA 4CN1A 3HUJA 3GNML 3Q6FB 3V0WH 2G60L 1ASOA 1H19A 4KI5C 1IEBA 4PRAA 4D0DA 3QRLA 3WOVA 4RGMC 4AQ1C 1ZLWH 1FSKB 1KCVL 5T3ZE 4NPYA 1UM4H 2AW2A 2J8UF 5DZAA 5EUOE 1QOKA 3SYAA 2NRDA 4IOSA 5IEKA 2NZ9D 2WNXA 3LKSA 5B39G 1IGTA 5E9AA 2YQGA 2ICCA 4JPWH 4AGNA 4ZZKA 3BT2H 2D4FA 4AIZB 4FS0A 1B4JH 4TLKA 4IMKC 1CGYA 3FU9A 2VZOA 2AHIA 5LG1A 1BECA 4AGQA 4XE5B 4KMTH 4RBPH 2Y69B 4OZFB 2HKFH 3KPRD 3GC3A 1T1YB 2E7BA 1TNMA 5CJOH 2NY2B 1Q4NX 1X5IA 5IHLB 3UEQA 5F96L 4ZI8A 1KTRL 4K3EL 5AYTA 2XBTA 3F7LA 1BIHA 2LW3A 2Q0ZX 3I6KB 5IIEB 4KQ4L 1NANI 1PCSA 2E59A 2B0SL 1AGDB 1FVEA 4LLMB 4DWHA 4HWZA 4I48B 4BFKA 5ENWA 1G1OA 5A7BA 4POUB 1CBVH 5LXVA 1WWAX 1U2CA 3WUZA 4JMXA 2DJSA 4AIEA 2VLJE 4H2CA 5B38G 1BBDL 3GUTA 2YUZA 2DI7A 2NUTB 2BSRA 1L9OA 1LP9E 3MFFB 1S7UB 3BUPA 4F2ME 3V4VB 3ZT7A 5HD8D 3EO0A 4OT1L 1Q1JH 2FJFA 4Z3TA 3QUYC 1HHJB 1XF1A 3CPLA 3LPWA 1KT2A 5IG7B 1X4YA 3T09A 3NCJH 5DK0B 5EBLB 3DHJA 1TFHA 1IE4A 2ZUVA 4M43L 5C08D 4X9GA 2QV2A 4NQQA 5E6RB 4LNVA 3IDMA 1AD0A 2CRZA 4MS8D 4KH2A 1QTYT 1Z9NA 2ZCHL 3FAXA 4H0LC 4HH9B 5EHFA 3V7AG 4ABQA 5CM1A 1CR9H 2AQTA 3WAJA 4AMKL 2A1WL 5B8CA 1YEEL 1J10A 1D5BA 4XN9A 4L8SA 5KBLA 2GIXA 1G4RA 2VW6A 1M7DA 4G6KL 1JMZA 1L7IL 2F8OA 1XAUA 5DJZA 4N8VA 1KLFA 3U46B 2AXHA 2JIXB 4N2OA 3PP4H 2C1PB 3EFOA 3PNWB 1ZLVK 1HHKB 1JGUH 1R4XA 1NBYB 2OAAA 2OR8A 3D25B 4JZOB 5D4IA 4IOSD 4PD4J 1L6XA 2ZTBA 5HI5C 4HJ0C 4WEBL 4UNVA 4G9DB 5FA4B 2K9FB 3CFBA 3P2BA 2MEJB 2AKRA 3ARUA 5HJGA 2LTQC 3FB7B 5IB5B 4KZEH 4WW2B 2FGWH 3BWUF 1WG3A 1E9PB 4Z3IA 2E3VA 1ZGLB 4YXKL 2XACC 1YYMH 4OD1H 2GIMA 4QDGA 1R24B 1HZLA 4NT6A 3CFTA 2NW3A 2H0FA 1INQA 2CO1A 1XXFC 3VSQA 2XXMB 3P3TA 1UWGL 2Q5BA 3JYCA 5M94B 3IGAB 3V4PH 1J86A 1BXXA 4KKBC 5DJDB 1QKZL 2OMZB 1JCKA 1EJ8A 1KIRB 1ZHNB 5AYUL 3D2UA 2E6QA 4A63A 4JRXB 5CBAB 5IKCB 3GMQB 2AEPH 5DO2C 3UIYA 4HFUH 5CKAA 3HPLB 5F7FA 2YSSA 1DANU 4GRWE 5D7JB 2GC4C 2WQSA 3TO4C 2PO6D 2C9PA 1GGBH 2VW7A 2VABB 4WWNA 2AEIT 4UNTA 2CIKA 3ZL2A 3C75A 4C4KT 4OR1A 2W07A 1XCTA 3H54A 1MWAL 4HS3B 3QIWD 1OLLA 1QNZL 3KWWB 1R5WB 5DA4A 3HZYB 4MD0A 4P4KB 3GB7A 1N59B 1AP2A 4JQXA 5EBMA 3CSYA 3DOIA 2WXJA 3QB7C 5B3JF 1BWMA 2IFFH 1CGSL 3UBXI 4P23B 3AMKA 3VFTB 1WFOA 5KSAD 2X4UA 2BIHA 3HG1A 2XQYG 5KG9A 4PJ5A 1DBBH 2ZWSA 3HI6L 4AG4H 3X14B 3LKOB 3OD3A 1WFJA 3D07A 1W9XA 1E8YA 4HK3N 3LRKA 4MJ4A 1XBRA 4IKKA 1KJ2H 1S5HB 2I85A 2LVCA 4HK0A 1DSWA 4GRLD 3BCFA 3C5JB 4FA6A 1S7WA 1F13A 3X2QB 2CBMA 1AQKH 1HHIA 3C60C 1LQBC 1H3XA 4PW4A 4R4BB 1AFVH 3M1BB 4L37A 4MXVE 3FUEA 3LD8C 4MQXD 2LT9A 4H25A 4FXGA 4YSAA 2F5AH 4AQ8A 2JK5B 3N40F 4NIYE 5ADOL 2EIKB 3K8LA 1LK2A 1BQLH 1YNTF 2FUTA 3MRGB 4M93C 4GPVA 2NDGA 4X9IA 1AKJD 2AZAA 3ARXA 4N24A 4RNRA 4UAOB 4OAWA 5EOTB 3PGFH 4OLVH 2YUXA 1T03L 1HCFX 4RGNC 1A25A 4QUOA 5DWPA 2BVQA 4RAVA 1UQSB 2X6VA 2Q3ZA 4XRCB 4GG6A 3VXSE 5DRXB 3O0LA 5FUCE 1ZS8A 5ICXA 1JZJA 3LYRA 1N2RB 2E7LA 4PY7A 1QLEL 2HRHA 3HC0A 5IQOA 2VXSL 5L4JA 4TQIA 2COVD 1KJVA 4A1RA 1DL7L 2NY1B 2ADFH 4LVOB 4UANA 4WI4A 1AY1H 4NFBA 3V6BR 3EYQD 3LEVL 2JKXA 3MJ8A 4M3HA 1EJFA 3RX5A 1OWWA 2CA4A 3CXDH 3CVHB 4HJGA 1JJUA 4X6CE 4KXZH 4FQPA 1E0OB 1D6EA 4KROB 2XWRA 2R23B 3UPAA 2WVUA 4QOKE 2Y07H 3FN0L 3HCVA 4LO9A 5D4QA 1XVSA 1N26A 4R3SA 1CE1H 1PX4A 3RWGA 3W56A 1CDUA 1JP5A 3VJ6A 1AANA 4Y16D 2VDML 3FRPA 4BCZA 5D6DC 3CFDB 3VQLA 5DS8B 1P2CB 4MQ7B 2R7EA 5JHLH 4ETQA 1RLWA 3C5ZA 4M6MH 5MERB 5BUPA 4RRPG 3RL2A 1EHXA 3DV6A 3LH9A 3MC0A 4K3DL 4LF3A 3BZ4B 1PGRB 4QHLA 2XUWA 3SBQA 4IOFC 4HUVA 3R18A 2IAMD 2CK2A 2MOGA 4DGYL 4A2FA 3BKMH 4UTBA 5AVQB 1QHOA 3BZDA 4A2EA 4RA3A 1YY8A 1RUQH 4UCFA 4ELMA 3QWRA 4ADGA 4W6WB 4BKLA 3NEXA 3T4AB 2AGJH 4Y5VB 3L3GA 2FYVA 3TVMB 4X6EB 2L7QA 4M5ZL 2CXGA 4Q7DA 3VWJC 1MY5A 2BWQA 3X12B 1CICB 3DIFA 4WF7A 5JOPE 5TD4A 1KTBA 3H0TB 5DHYB 4Q14A 2CD0A 3DO7B 4WHYG 2XPGB 1IAOA 2ESVE 3DJRA 3QIBB 3HNTL 1BD2D 1L3NA 1TZHA 2YARA 1KXVA 4FFWC 3GRWA 4FN0A 3EOAB 5A16A 2OMXA 2G2RA 1I9JL 3NESA 3QUXA 1VKXB 2QZQA 3BP4B 2NUPA 3QJUB 1E50A 4QHUA 2WUBL 2XJKA 4NUMA 4CN6A 3OL2A 2F53E 3ARRA 3LKRB 3ERXA 4NYLB 2X9WA 3GXMA 5E6IB 3ZRSA 2VDKH 4LRNH 1SOQA 4ANUA 3WUWG 4JM2A 5B7FA 2P5EB 3MRDB 5I75B 4G3YL 1FZKB 1UOKA 4PP1C 1GJUA 4NQCD 4PTTB 4OFKA 2X40A 2Z7YA 1A5FH 4HHWA 3PV6A 2IGTA 4ZMQA 5C0NC 3WKYA 3ROLB 3UGXA 4TQ8A 3OXRA 4RDBA 3DO3A 4TVPD 2MQCA 4G2AA 5DUBA 2Y06H 5I0VA 4D94A 3KEHA 5ISZB 1N64H 5EN2B 4UTAA 1JK9B 3RU8H 5CWSA 5HJBA 2B59A 2EIZB 4PJ9D 3W39B 4X99A 3C8HA 4OGYH 3D4CA 4HP5A 4YH6A 4HUUB 1F0LA 2FEEI 3PWJB 3ARZA 3MV7B 4P5TA 4PRPA 3P3RA 4EBQH 1BVOA 1EDQA 1NFIA 2DQIL 2VKXA 1CLYL 4OF3A 4QF1B 3U6XA 2R27A 3J27A 4FXLA 2RA1A 3Q5OA 3ES6B 2BVPA 3IDJA 4M5YH 5TQ2H 2ZOLB 2BNQE 1OE2A 4CUCA 1QVOB 2WWOA 3EJJX 4UIKH 2QSQA 1E8ZA 2J88H 4O4YL 3RVTD 2HRPL 3VAEA 3C5ZD 4AMWA 1GJWA 3NCFB 3DWTA 4OCRH 1P7KA 5IESL 3EYFB 5F88A 1JNJA 4YZFE 4Y19A 2AV1A 4JZJB 1QEXA 3ROOB 2YKLL 3HZVB 5D6CA 3VD9A 5CEYA 3IAGC 5CGMA 3BUQA 2PWFA 1PKOA 1WFUA 3NFSL 3NZSA 3P3SA 1V7NH 3ZE0E 3DJSA 4OZIB 4U3SA 3MGOA 2AQPA 4YX2H 1T2QL 5HYJA 3BVWA 4Z77A 2BK8A 3SSGA 2X87A 2NOYA 2BIQA 4WAFA 1FN4B 4NQSB 2ADYA 2ALAA 2FEEL 4ZFOL 2OW7A 1E8XA 1N67A 2A5UA 2ROXA 1YY9D 3QC5X 4M6NL 3V8OA 5GISL 4XGZB 1RULL 4PJBF 5GJSH 5B38B 4MA7L 2M83A 4WTZG 2R1WB 4TVPL 3D12B 3F7YA 5IVXE 5J5EA 5BQDA 4N8CL 5LBSH 3V5HB 4IOIB 4R2GC 2NR6A 5DJ2A 1IKNA 1DQIA 4Y0GA 1A6TB 3EO9L 3KWTA 4L3AA 4DN4L 4L1SA 1QHQA 2K78A 4CMMB 3KPRE 3MVSA 2G3NA 3KXFB 2LOEA 3L95B 2DJMA 1OB0A 2LHAA 1NICA 3UTQB 2YGPA 1SOSA 4JM2D 2GUYA 4MQSB 5BV7L 3HE7C 1C8PA 4K7PH 2YD9A 3S37L 1IBZA 4XNBA 5GGSY 4M1DH 2VXVH 3P0YH 5TE7H 3UTSE 4O00A 5IMKA 2K8MA 2O5XH 3BW9B 2ZJSL 4DGIH 1BZDA 4P2RE 5D1XB 4IU3A 4ACPA 3VQ2C 1ZA3A 2Q3AA 3GIZL 4AQEA 2X2JA 3FRUB 1OSPH 2C3GA 1T7WA 3FCSB 1S9VB 4JPIA 4JO3H 4HJIA 4ZZFA 4B9GA 3HG5A 1BAFL 3K1KC 1OP3K 1RIUH 3WSQL 5MEOA 4P5TD 1D5MB 2F7IA 4AEEA 2F7RA 3MFGB 5D93C 5EU6E 1JPTL 1PZDA 1R6VA 1GSMA 1EFXB 3BQVA 2YBRA 3VG0H 3T0EC 2JFCA 2C34A 3FQNA 5ANME 2X05A 4KHXL 4NHCH 1YNKH 3VWKC 2J55A 1JPSL 2Z4QB 3ZZQA 5KANI 3L3OB 2WW8A 4PJGE 4ZMAT 4W6YB 1CXKA 1Z9OA 3AAZA 2OYKA 1ZY9A 4S1RH 4CN4A 4X9FA 2WOBA 5E94A 1UH4A 2GI0A 2HJLA 2Y9RT 2XDHA 3BZFB 1WITA 3EUUA 4MXWL 2BCKA 2N56A 2P45B 3FT2B 3IJ8A 1NCCL 4ZRGA 5HI3D 5TE6H 5E8EA 3WEOA 5KS9A 4TNWK 6CGTA 2NYYD 3D18B 3RNKA 1DBMH 3CDFA 2ZCLL 2WXHA 1M6OB 2PCFA 5DSCB 1QLRA 4E9QA 1CYWA 1MRCL 4GYBA 2A6KB 3L17A 1RUKL 2Q8BL 3D0VB 2QPSA 3KPQB 1EQWA 2A3TA 3G9AB 4IRZA 2Z0BA 2ZOKA 1FA4A 4WU5B 4RWYL 3CN4A 3PDOA 3ZKXC 3IJ9A 4XAKD 4G1EA 4ZBJA 5DR5H 3LSOB 4YSCA 1MLBA 5HDOA 5JR1L 2FT7A 1AZBA 4LVNB 3PWUB 2NNCA 3QUZC 2XWTB 4ONFH 1MLCB 2FLRT 1ZJAA 4N6RA 5IQMA 2A7BA 2FX7H 2NR6D 3P9MA 1UUNA 4BSJA 4UTAL 3OR7B 1BVKA 1FO0A 1KYDA 4GG8B 4DUXA 5G4NA 2WXIA 2QKIC 3DX7B 1ESOA 3V9CA 4N3TA 4EN3A 1PF3A 1CVSC 2AJXL 3EJRA 4GSRA 3IXTB 1JVLA 1XZWA 1HHHA 1KGCE 4M9OA 2NPLX 3TJHD 2A6IA 3QNXA 2OYMA 4APQA 2WQ8A 5H2BB 1NGQH 1RZ7H 3V10A 4KZ0A 4Q2ZA 4PJFB 1F58H 1WS7A 3QI9A 2XYCA 1XFPA 1ERNA 2YRPA 1FAIH 1OVZA 2VXQH 3GTNA 4PJ8A 4PJHB 4LGRB 4QRPE 3MLWL 3OHMB 4KUZL 3D3VB 1Q0YH 4OUUA 4JJHA 3CNKA 1XSIA 1X9LA 2VDNL 1GY1A 4MMYA 1F90L 4YHLL 5IROD 4H2AA 3LZPA 3MV9D 3INOA 1N0LA 1HI6B 2YMTA 1RURL 3V6OA 1VGKA 1TCRA 4PVBA 1KYAA 4JFEB 3MXWH 4GMTL 3ZDXE 1TTRA 1KWGA 1PIGA 1AR1D 4FX5A 3SCMB 4OF5A 4HOMA 3RB5A 4AMXA 2TRHA 3GK8H 5A3ID 1I7ZB 1UD8A 3UG3A 4I3SL 3JWNE 1EMTL 2YR3A 4YLBA 3FT1A 1MFDH 1OP4A 4X6FB 1J9TA 2Z31D 5FK9A 1J5OH 2WN2A 3HZ3A 4L9LC 1IM3A 2YS4A 3HC3H 4YPGA 3SKNB 1I8LA 4JFYA 4OTXL 3SQOL 4WV1A 3RWEB 1A7PL 4OJEH 3PHOB 2HTLC 3IFOB 4TULH 1KF9B 1W72H 1U36A 2B1HH 2X4OB 1WAEA 4H1LG 4QY8B 5E00B 5JW3L 5DMJB 3GXPA 5IR1A 4H0GA 4GUQA 1UHVA 3KD4A 3AGVA 4Y5XB 2FQDA 3B9DA 2VR8A 3W5MA 3WLWD 4G7RB 2NXYD 3NEOA 5ICYA 5DHEA 5I6NA 4GQZA 2D9QB 2H3XC 1H6UA 4HIQA 1ZKAA 1FV1B 1XAKA 5C0JB 1CZ8H 4WW2F 3ASWA 2IH1A 3OMNB 3ZTNH 5JXEA 3I2CH 4BSWB 3PHQB 3FHAA 4ANVA 4OZHA 3KPOA 2LAGB 3U48A 1DLHB 1TUPA 2UZIH 3HB3D 1TZIB 2BSTA 4KV5F 2VQ4A 2VISB 2SEBB 2RTTA 3RVVD 2WKGA 3US1A 3FQXA 4B9YA 1SXSA 2V9UA 4W81A 1AI1L 2PYEA 4ZW6A 3RG1C 4F7TB 3BKJL 3REVA 3U4BL 3VXRB 3MLPA 4L4VD 3UJTL 4XVJL 1NCOA 3MLVH 2MKLC 2VIRB 1LD9B 4I2XE 2BS9A 3D7PA 3UEZA 2D3LA 5HDBE 1JHKL 2V5MA 4GP4B 2DYSB 4JFPA 4PW3A 3P11H 5G5DA 3WEXA 4YHPA 5GGSA 1KTCA 4E5XB 2BNUB 4APQD 2WXPA 2ZCKL 2NQDA 5FYJD 4NI6A 3K3QA 2P1YA 1U95B 3QI9D 2I32A 2NY3B 5TGBA 4NQEE 2BFVH 4PJ8D 2M2DA 3LZFH 1KPVA 5TQ0H 3MX0B 2XFXB 1Q8MA 1EXUB 1KC5H 4KK5C 2B5IB 3JWOC 4PJIE 2J1KA 3SDAB 2OJEB 4FQ1L 3FTGB 2ITEA 2XN0A 2VLLB 3U9WA 4L2YA 2EDXA 3V79C 5ID1A 3L7FB 4F58L 2AJSL 2J3SA 5DJ8A 1G5GA 1NCAH 3O3UN 4BWTA 5IB4A 4XMXA 4AJYV 4P2QA 3MMEA 3SY6A 3WMPA 3U36B 1OAZH 1T7ZA 4G7YL 4NBZB 3SDYL 1URLA 3C6LC 2ZUSA 4W70A 2WOYA 4LPWA 3LV3A 4JDEB 4OCYL 1BBJB 1CFNB 5D7EA 1EXHA 3D87B 1H6TA 3QC6X 1HH9A 1J8KA 3KLLA 4YSPA 5DGQA 4JJOA 4XZUB 1IM3D 4QLWA 2Y23A 2DM4A 3WUWB 4WENB 1TO5A 4YDIH 2R69L 4N2DA 2WLLB 3JQOB 5DJXA 3ZGHA 2YD3A 5AW5B 43CAB 4X9BA 2Z9TA 5AALA 2V7HB 4A7QA 3HTLX 2LGNA 1MRFL 3I3DA 4WI0B 5EC2A 3L5WA 5INCA 1ZPUA 2EIJB 3B5HA 1E27A 1FO0L 3LJ3A 2A99A 1WJ3A 3BAKA 5EEVA 1UJ3C 3OV6A 3O3EB 3QRBA 2ZUYA 4LOUD 1J18A 5CLYA 4ZUWB 1IBGH 4IHOA 2K4WA 4RFNC 3QYCA 3S5LG 2WGXA 4YDLB 2Y3AA 3QAZB 4OCLC 5JXED 4MJ6A 1IFHH 4XR8C 1MFCL 5FYJL 4QAMB 4LIQH 2UWEE 4BHUA 4FQJH 5H37H 3BH9B 1KTJA 1L3WA 4NFDA 3SOBH 3MODL 4DK3A 1TVBB 1BD2E 3P73A 4XC1H 1R3HA 1AQDB 3T3MB 1WZ1H 5G4MA 3VFMB 4TNGA 2PYED 3VI3A 5ILTH 1I1FA 1OP5H 3Q44A 1B2WH 2ILLA 3N06B 4A6YH 3BO8A 3AXIA 1OPOA 3OZ9H 4WUUA 4UV7L 1Y0LB 3FO1B 3TJEL 4BFIB 3VMPA 4L1DA 2CKNA 4PIRF 1CLZL 1KG0A 4AZ8B 4NQCE 3W1ZA 2QPFA 4D9QD 4G42A 4HT1L 5F0MB 1WPCA 4DW2H 2ZT9C 2NZ9C 3TBVA 2X88A 4XBGA 2W9EH 1HEZB 4TVPE 4UV4L 4WWKC 3V4PB 4GS7C 3L1GA 3ZYJA 2VN4A 4ACTA 1I8KA 5JMOC 3S88H 3QGVA 4M61B 4FFZA 2EIEA 4JG1H 4ODSL 3KCWA 3MSPA 4Y4FA 5IGXL 4PRBB 3VFWA 4ZO8A 1KEGH 4JR9L 4WSGA 1ZDQA 1XF4B 2Y5QA 1TYEB 1ZJBA 1S7XA 1C08A 2RIKA 2ZSWB 5GHWH 2BSCA 3AWEA 1TQCC 4RMVA 4BEIA 2XLLA 5A2BA 4UZSA 4HUXA 3HRZC 2VDOL 1AO7A 2P4AB 2ZX6A 4HCRH 3FUJA 3PHAA 1K2DB 3NJMA 4ZUTA 4TQEH 4KY1L 2J21A 3N43F 4PM1A 5FYLD 3VXNA 4Y1AB 4L29A 3CN1A 5CIPB 5SX5H 4E9RA 3PGCB 4JFFE 5DC2A 4ONHA 2ALWA 2BC4B 3FSWA 4H0IA 1YAZA 3T2OA 3W0WA 4N26A 3RA7L 3MRCA 3MYZA 1ZT7B 1YEGH 3R06B 5HD8C 1KJ2B 4IBZA 3A47A 2W0PA 3D06A 5FECB 2G3MA 2I9TA 4MMZA 3E2HC 2WQVA 4WY7H 1YMMD 4Y88A 5AEAA 5EUKB 3PQYB 2R4RH 4GO6B 5C3TA 1VGEH 2VLKE 4OB5H 1BF2A 3WJLC 4A68A 4HJ1A 2E9WA 4A7SA 1SF5A 4KOBA 5B4MC 3C9NB 5JLZB 4ALAH 2JXMB 4PUBH 1NUNB 2FJGA 4U1GC 4W9JC 1XB8A 3MGAA 4N5EC 5DQDL 4CKVX 2DQHH 1JE6A 5BS0A 4WWPA 2CDGA 5BRZB 1GYVA 4ELDA 4QRRD 3ARFA 2PETA 3NFPA 3OBAA 3DIDA 4RLDA 5FDWB 5GRJH 5LAPA 3CLFH 4NUPA 4OZGA 1O5DT 3I02A 4YEFA 2YD1A 1GZPB 4R6UA 5J13C 3LX9A 5IJVB 1LM8V 4M4RA 2HPTA 1YN7A 1MJ8H 1TVDA 1NDMB 4QRAA 3AS0A 1MW1A 4L4TB 1E28B 2HVJB 1BX2B 1AGFA 5L2KB 4X4MA 3HHSB 1TKWB 2QQLL 1PLGH 3IXAB 3CSGA 3L6FA 4FAAB 5I18L 2W65A 4RMTA 4MNHA 1HSAA 3PAYA 3K46A 4HUWA 4Y9CA 3QG7L 5FYLL 2CBTA 3WNOA 1RK1B 4RIRA 5KVFH 4YIQB 1NBCA 2CJUL 4Y4FD 1XR9B 4JO4H 4F80A 2IDUA 1UWYA 2BVOB 3WE6B 3TEYA 1LE9B 1PDKA 3QS2A 1WBYA 2J2ZB 5GGTH 4F7CA 1BFVL 4I4WA 3VFOA 5I73B 5IB2A 4N8PA 3GMPB 1X4ZA 1N18A 1VRSA 3TBYA 4C56A 3OAUH 2BSEA 5KYXA 1U2HA 4LCUA 2Y2WA 4AYBA 4DZ8A 4PSPA 2AJZA 2BS8A 3LZRA 1AO7D 1XEUA 3FU5A 1TETL 3QZBA 1L0YA 1MEXH 1F4HA 2K7PA 3DDGA 2DV6A 3IDUA 3QO0A 4LPUA 4P59L 5ICZB 2VR5A 4B9CA 3LTVA 2FTAA 3NTCH 5D7IB 3SEPA 1Q9WB 5J6SA 1RCYA 3LKPA 5JXAL 2IBZY 1J8SA 1YDPA 3HZMA 4NLAA 5CMAA 5C09E 4JRWA 5IM7A 5GGQL 4NFCA 1H3GA 3IK2A 1N5YL 2XYBA 2VGLM 3DTUB 4PP2B 2WQAA 3B2VL 3RGVA 3W0WD 4DKEH 2YZ1A 2JLPA 3GF8A 3UG4A 3H9SD 4LU5H 3T3PB 3ZMRA 2EDBA 1LEGA 3O8XD 4P46B 3ULUC 2DM7A 3GD1C 3VX0A 2A9AA 2AF2A 3OKDA 3K8KA 4OF0A 5TH2B 1AH1A 4UT6A 5FKPA 2HX9A 5IEHB 4AYMC 3KW7A 5AVRB 4JKPH 5JW5B 1HZKA 5ADPH 2QT6A 3KYKH 1SN5A 2GJJA 3VXME 5HJ3A 4XC3H 4PBXA 3TA3B 5CEXB 4GOSA 4FTVA 4J6RL 2HSIA 4D9LL 4IGBD 1K4DB 4HF5H 2OR9L 3A4EA 4RSVA 2G30A 5E8OA 3KL3A 4LFHD 3U2JA 5BQ7B 4FFZL 5B8CC 2HG0A 3VG9C 1YUHA 3MJWA 4L8SC 1B2YA 2GABA 4DP5X 2OXHA 1CJYA 3KNBB 5IOPB 3CCHB 4MD5A 1J12A 3IMSA 4JO8A 2KMWA 1QR1B 1KPUA 4GEJA 3OSKA 4DKAA 1CD0A 4MQXC 5FO8B 1Z0MA 2OJZL 1N70A 5I0DA 5LLIC 3T0WA 3B8SA 4Y2NA 4YHNB 2VDKB 1NLBH 3EW3B 3L4TA 3IJ7A 2BLFA 1NMAL 4NRZA 4NZUL 3D4ZA 5HDRA 1WK0A 2E6PA 4N0CC 1HSBA 4XVUD 5D2LA 1A14H 4G8IB 1MCIA 4WCYL 3CC5B 3MV9E 4EI5B 1FHGA 1UXLA 3B7UX 4PYHA 5FEBA 5F1KC 2KPNA 3AU1B 1ORSA 4I1PA 3RIFF 4FNQA 1S7TA 1XMWA 2NY6D 3CFEB 2OA9A 5DJ0B 3V0EA 1GOFA 3N9GL 4J3OH 4MAYB 2OTUB 3LVEA 3WIIH 4C56D 4R7NA 4KVCH 2BSED 4M1CD 3T08A 1PQZA 4ZFQA 4YBLC 3RWCA 4F2EA 4W68A 1NOAA 5DYOA 4Q4EA 1WE5A 2N01B 1MCNA 4OCXH 5ERWB 3ZO9A 2DIAA 3G5VB 2D9CA 4LMQI 2OX5A 3L1OL 1INDL 4XO3A 4JY4A 4QYOA 3RJDA 1KYFA 2KQNA 2FGZA 4ANXA 1D5ZA 5F8RC 1YNLL 3UAAA 1PJWA 1XXDC 3G5XB 4YO0A 3PU7A 1M71B 2JE8A 1MREH 3TS8A 3IJEA 4HMDA 4DGVH 2GBAA 5HDWA 1V3JA 3I9PA 3K4AA 3T4YB 4XN4A 2V2TB 2DBLH 3AUVA 4JQXC 3GXNA 1NGYA 2J25A 3NIDB 2AI0H 3F12A 2CBQA 3O6ML 3QWQB 4EDWL 1MNUL 1JF1A 1N8ZB 4KDWA 2VL5A 4NKMA 4CC0A 1NLDL 3IRZA 4WO4A 1GYAA 2ADJB 4WK2B 3QXWA 4LBEB 4YQXH 3BLPX 3LEXA 3TN0A 3GHBH 5F9JB 3EYSH 4FOMA 4PJFF 3VB8A 1QRNB 4ODHH 4L4VE 1KDJA 3NJLA 1A8JH 4GAAA 4PJHF 5CBEA 3WS6C 4TXVB 4JRLA 3WAKA 3QIUC 2Y2YA 3K2IA 5HDQL 1I7UA 1MCLA 4LSTL 1D3CA 5DTFA 1OTUC 1YRKA 2QVMA 4XBPA 4LSPL 5AVTB 2CALA 4FXGC 5EA0H 1UA7A 5TTRA 4AQ8C 5F3BB 1XF2A 3FQRB 1FYTA 5DS1A 2W92A 4G43B 5FX3A 5D96C 3RDJA 4ZSOA 1MPAH 5CILL 1NL0H 1PZ2A 1XIWA 5E5MB 2OBGA 4MNGA 1CE6B 1LWJA 3UP6A 3DRQB 2Z92A 2Q20A 3S5LB 4LQFH 2F54B 3WIHH 2L8AA 4HEME 4A7TA 2CPCA 3ECBA 4QI3A 4Q4IA 1NC2A 4PS8A 1JHTA 3QQ4A 4ODTL 4O02H 4GAFB 1P4LA 4F1SA 5K1VA 4I0PA 1ZHBB 2HT4C 3IJYB 4XX5A 5LWYL 5D4JA 1AE6H 1WWWX 4N0UB 12E8H 1LO0L 1YEJL 2KKQA 2KH2B 1XH1A 4LHJB 3IFPB 1Z7JA 32C2B 4LPCA 5HVHC 2WXRA 4OLUL 5KYWB 5FHBL 1NAMH 4ERSL 2EC9U 3M1CA 2W0FA 1YQ2A 3DX8A 3L45A 1D5XA 1AGEB 4ONGH 1XGUA 3LXUX 3OG4B 5CD3B 5DFAA 1A6ZA 3C12A 1RMFL 3M7OA 5C71A 5FO7B 4OLXH 3WL9B 5CUSH 4CVXA 4G7VL 3WEBA 3EXLA 1IAII 3FTVA 3DGGB 2HT2D 2GTWA 1FORH 4JCMA 1YEHH 2JKWA 3V52H 4UOQA 2V3FA 1MCRA 4J5VA 4OCWH 4DUVA 1F6AB 5BV7C 3HPJB 1MRDL 1HKLH 4D2NA 3AGWA 3STZA 4HIEB 4MD4B 2XBDA 4L05A 5D1ZB 3RVTC 3MGTA 3CFJA 3MCLL 3GJEB 4HPHA 2V3EA 2HWZL 3IU4H 3W5NA 3PL6B 1DQDL 1C9SA 4CADB 4XODA 1FLRH 1B0RA 4A55A 4WO4D 4QXTB 4WSKA 5GS0C 2Z6FA 2JKIS 4XNXL 4QTFA 4MJ5B 4OFIA 1E5BA 1MJUL 3WNKA 3OB0K 2OQJA 3A5VA 1MHCA 3QDMB 5HHMD 1RUPL 4IBWA 3BOVA 4CU8A 1OF2B 3W9EB 3SQRA 1ETZB 4CGTA 1PFOA 2J44A 1FJ1A 1UGNA 1NEUA 4G6ML 2RAMA 2JKLA 4JVUA 4FHBD 1DJHA 1YY9C 1JXJA 3S7GA 1YN6B 1G6VK 1FYTD 4M4PA 1T2XA 2QPEB 2B08A 5LCVL 4W1TA 3IMWA 5DRNA 4JFQA 1UM6L 4U6VH 1RZJL 3K6DA 1KXVC 4OIIL 2ZUTA 1E7VA 1BFTA 3ZRFC 3QUXC 1L7TH 2X9XA 2YD7A 3O4LB 2W8CA 3V6ZA 5F3HB 4E0RA 1A4AA 5AUMB 5FPIA 4XPBH 4U0RB 2DQEH 1M05A 3I85A 4HEPG 1R3JA 3TFKC 3W11C 4DP2X 4NZRL 4Y4KD 1AQ8A 1ZTXE 3HE6B 4I0PD 4JM2C 5AKSA 3NABL 1P5UA 1I8IA 1WFNA 4R4NC 5L9DH 1G1CA 3QJXA 2EIDA 3NGBC