4YSTA

Structure of copper nitrite reductase from geobacillus thermodenitrificans - 24.9 mgy
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
294
structure length
294
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
total genus 96
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ystA00
4N8UA 2BZ7A 2CJ3A 4F2FA 1IC0A 4KOBA 1CYXA 1ET8A 1NIEA 2BW4A 3EF4A 4P5SA 3FYEB 3ZDWA 5LDUA 4KO5A 3ZBMA 3DIVA 3ZIYA 3TA4D 4HHGA 3IN0A 3V9EA 1WA0X 2AANA 1NTDA 2YXWA 4E9YA 3TASA 3AW5A 3FU7A 1SDDA 2J5WA 4YSOA 2WSDA 2HXAA 3S8FB 1AIZA 4AI7A 3S3DB 1AZUA 2VMJA 2VW7A 4MFHA 1OF0A 1GW0A 1L9OA 4G7SB 2QPDB 1ILSA 4YSPA 5B1JC 4WTQA 4YSCA 2PPAA 4BWUA 3SQRA 1NIFA 3GXUB 5AFAA 2W88A 2IWKA 1N68A 4HCIA 3CDZA 3EH4B 5B7MA 3GYRA 1ZDQA 1KCBA 4BWWA 3ABKB 2BZCA 2NRDA 3PCYA 1OCZB 1RZPA 3WKQA 1E67A 2AFNA 2GIMA 1JVOA 1JZIA 4A67A 3GDCA 2Q5BA 4GP4B 3X1BA 5I26A 2PPEA 3QJSB 3S3BB 3T9WA 2XX0A 2DYRB 1AS7A 2UX7A 3PPSA 4Q89A 2DYSB 4DP4X 1KCWA 4YSRA 4E9WA 1CC3A 2CUAA 2X88A 4BDVA 2EILB 4AX3A 1OCRB 4YSUA 4G7RB 1W8EA 1PF3A 1IUZA 1TU2A 2HRGA 3FQ1A 4YSEA 1KDIA 1NICA 3NYKA 3FU7B 1SDDB 2QT6A 5I6KA 4A68A 2FQGA 1NINA 2UXTA 3RYMA 4YSQA 1E5YA 3TBBA 4DPBX 3SBQA 1JZFA 4YSAA 2P80A 5FC9A 4DP1X 2HX7A 3FPYA 1GS6X 3QJUB 5D4HA 1V54B 3NP4A 1AS6A 1GSKA 3OD3A 5IY5B 1PLBA 1AR1B 1AG0A 1XB8A 3CZUB 1ZIAA 3X1FA 1AZRA 2FJSA 4ENZA 3NJNA 1BQRA 5TK2A 3IE9A 4YVUA 4KNTA 4AKOA 2J55A 3PLYA 1YLBB 4X4KA 5I6MA 3NP3A 1SHXA 2YAHA 3EH5B 4JHVA 3UABA 2EIMB 2BWIA 1OOWA 3H56A 4L0PB 3S8GB 2IDUA 5ANHA 5E9NA 3HEIB 1WA2X 1V10A 3EH3B 3WG7B 1JOIA 4E9QA 4KNUA 4FA7B 1NWOA 7PAZA 2PCYA 1IKOP 4E9VA 4BXVA 1EZLA 2VSMB 1A8ZA 1GS8A 1PZCA 1GR7A 2PLTA 1AOZA 1PNCA 5EHFA 1JZGA 2XXFA 3FYIB 3T6ZA 2YAOA 4BDVB 2W8CA 3U25A 2YAEA 4AZUA 6PCYA 1SF3A 3IN2A 4W9ZA 4G70B 2IDTA 3FSZA 3H4HA 2OCCB 1AZNA 1E5ZA 1AS8A 1QNIA 2YAMA 4AKPA 2GI0A 2GSMB 2FT6A 5B7EA 1E65A 1ZDSA 8PAZA 2FQDA 1FWXA 1NPJA 3C75A 2FQEA 4DPAX 2XX1A 1DYZA 1ID2A 2EINB 3WIAA 3UADA 2IH9A 1TKWA 1L9TA 4GP8B 5B7FA 3S3CB 1J5CA 1TEFA 1IBYA 1A3ZA 2GBAA 5D4IA 2YAFA 1JXDA 3D12B 3UGEA 3JTBA 2GHZA 1SNRA 3AY2A 3T6WA 2I7OA 4YSSA 1MDAA 3G5WA 1ET7A 1M9WA 2EIKB 3X1EA 4F2EA 2YAQA 2GC4C 4A2FA 1FFTB 2JXMA 1GYCA 3FU8A 3OM3B 1TEGA 3JT2A 3HB3B 1XB6A 4KNSA 4A2GA 4DP9X 3NJMA 1OE3A 3AG2B 1BAWA 2VW6A 2RACA 1L9SA 1SF5A 1HAWA 1KYAA 1L9RA 1J9SA 2VN3A 1CUOA 4GP5B 2PCFA 1AQ8A 1A4AA 5B1JA 2H47C 1UATA 1ZPUA 3T71A 3N55A 4A2EA 1X9UA 1ILUA 1V55B 5I5JA 4CSZA 4HZ1A 2HX8A 2IWEA 4M4RB 1PLAA 3NJJA 2PPFA 4HCGA 4KO6A 1SFHA 3WNJA 2ZXWB 4RH4A 4DP2X 4W1TA 3SBRA 3KW8A 4GXFA 1CURA 2AZUA 4AKQA 3AG1B 2B3IA 3ASNB 1FA4A 1W6LA 3IEAA 1KBVA 1AZCA 2LLNA 3PAVA 3QJVB 2FTAA 1BQ5A 2UXVA 3EHBB 1HAUA 1OV8A 1PCSA 2VW4A 1SFDA 2EIJB 1NDTA 4PCYA 4YSTA 1KV7A 7PCYA 5TK4A 3OQRA 2X87A 2JFCA 1A65A 4CSPA 3AG4B 3WI9A 1ASQA 1WAEA 3ERXA 1ASPA 2HRHA 4P5RA 4DP6X 2PPDA 2FWLB 4WKXA 4DP8X 2BP0A 1ADWA 1ETJA 4BXSV 1W6WA 1OCCB 2I85A 5I6LA 1MZYA 4E9SA 2CALA 1NWPA 4YSDA 3FQ2A 1OCOB 2HLEB 2VM3A 4HHWA 2TSAA 2J56A 3CDZB 3OMAB 3WKPA 1KGYE 1OE1A 2YAPA 2ZONA 4NB7A 3TU6A 3NJFA 2IDFA 2DWTA 2J57A 3DKHA 3ABGA 4TXVB 2XV3A 4KO7A 1CYWA 2AZAA 2PP7A 1GY1A 1M56B 2JKWA 3X2QB 1OE2A 2YARA 2XVBA 1JERA 2VSKB 5B1KA 1RZQA 4UAHA 2XXGA 1AG6A 3CVDA 2WO3B 1I53A 1RCYA 2QPEB 3FSVA 4EF3A 4FAAB 3L45A 5I6PA 1ET5A 1T5KA 5B3SB 1AZBA 3NSCA 2XWZA 3QJQB 4NAJA 2XV2A 1GS7A 2DWSA 3FQYA 2E86A 2P80D 1NIAA 1BXUA 1WS7A 2XU9A 1PZBA 3UACA 1A4CA 3ABLB 3NJKA 3FSWA 2XUWA 3OMNB 2I7SA 2R7EA 2BP8A 2BP0B 2DV6A 1M57B 4F7KA 2B08A 4YVNA 4BWTA 2BW5A 2OJ1A 3MBWB 4G72B 3AG3B 3QJTB 2CCWA 5F7AA 2CAKA 2YXVA 6PAZA 3TBCA 2IDQA 1RKRA 3SBPA 4NERA 2BHFA 2HZHA 3NT0A 2QDVA 3IBOA 5I5IA 3CVBA 2Y1AA 3NJGA 2IDSA 4DP7X 4ZK8A 2GB2A 4A2DA 3QQXA 5I28A 2IH8A 2H5UA 3NSDA 5B1BB 1BYOA 3BVDB 2IAAC 3KW7A 2CBPA 5I6OA 1EHKB 3BQVA 5F7BA 3T6VA 9PCYA 5PCYA 1AANA 1BXVA 5I5MA 2PP9A 1DZ0A 2XLLA 3X1GA 4E9XA 1F56A 1JZJA 1BQKA 2Q9OA 4KO9A 2AVFA 3FPXA 1KBWA 3NSYA 4QKTA 4JHUA 1JZEA 3FU9A 1ZIBA 5I6NA 2VM4A 1VLXA 2BWDA 2TSBA 1L9PA 2R7EB 2BP8B 2PP8A 2BO0A 1BYPA 1J9QA 5PAZA 3T6XA 3FSAA 4GYBA 1MZZA 2ZWNA 4HALA 3ASOB 2YQBA 3ZX1A 1J9RA 4QLWA 1BEXA 5AKRA 1XB3A 3X1NA 1PZAA 4JKNA 1E30A 2GC7C 4YL4A 4E9RA 3H4FA 3NJHA 1PAZA 1NIDA 2OV0A 4DP5X 1WS8A 3MX0B 4DP0X 1NPNA 5D4JA 5B1AB 3OMIB 4UANA 4A2HA 1URIA 1QLEB 3V9CA 2MTAA 4DPCX 4GY4A 2XYBA 2HX9A 1SJMA 4HCFA 4HIPA 2Y69B 1NZRA 1R1CA 1ZV2A 3NSFA 3CVCA 2UXFA 3FS9A 1JZHA 2FT8A 2FQFA 4N4YB 5AZUA 1B3IA 2FNWA 4G7QB 4K9JA 4PAZA 2IWFA 1ASOA 3FT0A 1HFUA 1XMEB 4KOCA 4A66A 3QJRB 1MG3C 1PY0A 1AACA 5A7EA 1AAJA 1KDJA 1JXFA 2N0MA 2UXGA 2A3TA 4UF7C 3ABMB 2UX6A 2WO2B 1PNDA 1A4BA 2FT7A 2PPCA 1NIBA 2ZOOA 3DTUB 3UAAA 3UAEA 3AZUA 1QHQA 4G71B 1BXAA 4HAKA 1J9TA 1SHWA 1L9QA 3WNIA 2H3XC 1X9RA 1MG2C 3PAZA 2MRYA 1GY2A 1JXGA 3PXLA 3QPKA 4M3HA 2XV0A 1PLCA 1N70A 2DY2A 4BK5C 3CG8A 2QDWA 3NJLA 3N2JA 1IBZA 1PMYA 3NJIA 4E9TA 1J5DA 1JVLA 1WA1X 4Q8BA 3PAUA
chains in the Genus database with same CATH superfamily
3RGVD 4PLNC 2XG5A 3QUKA 3MBEB 1CYXA 1U41A 1BX2A 2BNRA 2Z7UA 5I15H 5EOTA 2DLHA 2ZWSA 1IX2A 3ZDWA 5ICYB 5LDUA 3DIVA 2BERA 1Q4NX 3GBNH 1ROCA 4DVRH 3B9VA 3MLVH 2EUVA 3IN0A 1CF1A 1KNOB 5C7XL 2DWDB 1OQOA 5SX5H 2NCEA 2VQ1A 1M1XA 2Q76A 1EEQA 2QGEA 4NUGH 4U6VH 4Z95L 4AG4H 5KSUB 5L88L 5D1QD 2OSWA 4UOW0 5MENB 4LCCA 3BIBX 2V3DA 5AZ2H 3OX8B 5BJTB 5T1MB 3OHXA 1HQ4A 4RISL 5JZ7D 3KGSA 5LHDA 4UQ9A 1H19A 3OR6B 4BFBD 2G2PA 2D03L 4DOHB 1IFGA 3CFUA 5JPNB 3QNYB 2ZAIA 4GRWH 4OD2B 4MYWB 3A0OA 1PW3A 1JFQL 3R06A 4IMKA 3VCLB 2VDRL 5L4IA 4L4TE 5ESQB 2WYIA 4K07A 1JYVA 2OJEA 3U36B 3BGAA 1UACH 2E9JA 4R84A 2XN9E 1E27A 1WPCA 3DJ9A 3IGAA 5D96C 2X05A 3GLDA 3VFGH 1UUSA 5MHSE 4Q6IB 2Q2EB 2XNAA 2AEPH 3SCMC 4QRQA 4X6EB 4O4YH 5FW8A 4YMPA 2Q5BA 2ED7A 4GP4B 4MAUL 3VJ6B 2XI9A 5I26A 3QHTC 3SKNB 4YHML 1S3KH 3T9WA 2NYZA 1Y1UA 2GUOA 2P24A 5IJVA 1RMFH 1A7NH 2EP6A 2UX7A 1F86A 1OM9A 3B5GA 2A9AA 2GTWA 4JO5A 4ODXB 4LCUA 5I1AA 1SQ2N 5ILTL 1G0DA 1AQKH 4MHHI 1JGUH 4RMWA 3W9EA 4N86A 3LZLA 2HN7A 3IDNA 4ORZC 2BNUB 1VFUA 1QSFA 3ZE0F 2BPBA 3OPUA 1E5YA 1B4LA 1NGPH 3CSFA 1RUAL 1UH4A 3X3GL 1U93B 2CRIA 1P5VA 5AVYB 3P0VL 4NDMB 1EXHA 3HC3L 5DC2A 4YSAA 1QSEA 2OCFD 1S9YB 1Z9LA 4H0LC 1V54B 4X5PA 5IY5B 5T3ZH 1FPTH 3LDBC 1L7IL 2LTQB 2VZTA 3DOHA 3GFUA 4FLQA 4IS6A 2UZXA 3VWJC 4ENZA 5LVEA 4GAJH 1B2WL 4I87A 4L1TA 1XGZA 4WENB 3ZHLA 4XWGL 5J1AB 4LF3A 2NQ3A 4QRFA 3LH2L 2ZXGA 2YPLD 4PRIA 5I6MA 2DMKA 2ATKB 2DM2A 4GSUA 5HVGB 5DQ9A 1FNEA 4KH9A 4TRPH 1KJ3L 3P9WB 3RFZB 5TH2A 3T65A 4OKVB 4Y88A 1JOIA 2H26B 4JFHE 4XAKE 3Q2VA 1B0WA 4F1SA 7PAZA 1HJCA 3AREC 3II2A 4HD5A 2VSMB 4MZ2A 4APQC 2IH3B 3A22A 3EBAA 4K5NA 4F8PA 1PNCA 2I26N 3QNZB 4EI6A 1JZGA 4JK0D 2YAOA 5IOKA 3TEWA 4FTDA 1DQDH 5C08B 3U25A 3QHFH 4ENEC 3WTWA 5LGJA 1BVOA 1CFMA 1AHWA 2RFXB 3BISA 1FI8C 3HI5L 7CGTA 2ZX6A 4BA0A 2EZ0C 2IEPA 1MPAH 1XGYH 4N9OB 3V5HB 1MCSA 5G5DB 5I23A 3GT6A 2Y0SA 5KYUA 5GRYA 4ZMZA 3B9EA 2VLJB 3ELQA 3SDXA 3U9PL 3RTQD 2HP4A 4WNQA 3I75B 3FH5A 4F33A 2DTSA 1NUNB 2LU7A 3M1BA 2CMRH 1TKWA 1TQCB 4S1DC 1ZJAA 3EFOA 3HI6H 5E00A 3VFMA 2BHUA 5JW5B 5HGDA 4MNQE 1JNLH 4MQXC 5D1ZA 4M93C 3VGFA 1WBXB 1IFHH 5J13C 3SYQA 2P49B 2EUWA 4OZHA 1LEIB 3S2AA 3GSQB 5E7FA 2L0DA 3BH8A 4IU3A 1IZKA 1KY7A 3OG4B 1M9WA 4QRBA 2YAQA 3RUGE 2FUQA 5IW1B 1RJYB 5D1XC 5IVZA 1QRND 1NOFA 4BUHA 1E2VA 1HL8A 1SVBA 4PRBB 2C4XA 4LLVB 1OE3A 1AR1C 5MERA 2XTLA 5G4OA 5ITBL 3T3PF 1HAWA 4XPFL 3F05A 3ESVF 1N18A 1J10A 4YZWA 1DVSA 4ZW5A 3KYKH 1A4AA 5LAXA 4LIQE 1G6RH 2JJTA 3LKRA 3KBPA 5E6SB 5FYLL 3WNKA 4AV5A 2FRGP 4GS7B 4JO2L 5I1GL 5J56B 5HY9A 5BVJA 4PJCE 3UPRA 1AGDA 1QEXA 4HYTB 3V7AE 2AS5M 4JY4A 4AE0A 2X6UA 5GGUB 3EAKA 3WJJC 3WIIL 2ZT9C 2AZUA 1RVFL 3BVUA 5BRQA 4KFMA 3KHOA 3ASNB 4AXWB 2ZKHH 3DRTA 3PDOA 3P2DA 1AD0B 1TOXA 2A6JB 4N2IA 2O5YH 4PJXA 4Y4FD 4YC2B 5I75B 4P9HH 4OGYH 1UCTA 4PJBA 4MJ6B 3ZZSA 4IRSD 4N24A 5I15L 3SPCA 1CBJA 4FG4A 1AD9A 2IGTA 2PTTA 3QRFM 2J7LA 3GBNL 3UTTA 1IE5A 4Y5XB 4LHUB 2MHAA 2O72A 5HGHA 3UC0L 2AQQA 2EIBA 1X4YA 4U6VL 2J5LB 4NUGL 3U7YH 3ERXA 1CD9B 3EH1A 3TA3B 1SHMA 5EO1A 2YMXH 1E8ZA 4QTHB 5EIVA 5AZ2L 2HFEA 3QEHA 1OPGH 4DN4H 1E9PA 1NJ9B 3F58H 2CG9X 2H6UA 4OFQA 3VFVA 1ZJBA 2WXGA 3T4YB 3UBXA 1S7WB 2M1KA 4O00A 4ZAKD 5HBBA 2F53E 3A47A 4QHUB 3HG1B 2J56A 4F3FB 1P0SE 5EEYA 1U3JA 3DUUA 4LCWB 4PY8J 3CHPA 4FKHA 3PXJA 3W11D 3AU1B 4KY1L 3O6FD 3PP4H 3AXLA 2Z0UA 4NZJA 2QLYA 1GH7A 2OMUA 2CU9A 3EKCA 1A6AB 1ZT1B 4HS8H 4X50A 4ABVA 3VFGL 2VDKB 5IW6A 3DX6A 2J8OA 4AQAB 3HB3C 5J6GB 3QEQE 1I3GL 3MLRH 5E8NA 2IQ9H 2VSKB 3QE5A 2AEPL 5B1KA 1GHFH 2W9DH 3GPEA 4O4YL 4R90L 3QEGH 3GGWA 4CGTA 2OZ4A 4M6OL 4ORGB 4LHUG 3RVWD 2XVLA 1S3KL 4KTDH 2EEFA 4KMLB 4PJGA 3VB8A 2AKRA 3MV8B 3RG1C 1A7NL 4X7CC 4PBDA 4OZGE 4CVZA 5T1LA 4EZJA 3TBWB 4F20A 3GRBA 4KDTA 1AQKL 4OGQC 5IB2B 2IXQA 3CC1A 4MLIA 3HNSH 3RVUD 4XNDA 4Z8FH 2C9PA 1OAXL 1LP9F 1PZBA 3T0EC 4JL2A 4YGVB 3V9FA 3MFGB 2VDNH 3L17A 1CL7H 3UYPB 4PVMA 3OB8A 4CKVX 3CX5K 3ARSA 3C6LD 5A2AA 1GL4B 1NEZA 4MYPA 4ABUA 4L4VB 1ZV5A 3M88A 4OM1H 3GHEL 1NBZA 4M6MH 1K8IA 4Z6AT 2BW5A 3LMJL 3CPUA 8FABA 5T3ZL 1BMGA 2D73A 1BLNB 1EEYB 3LIUA 3FRPA 5C0FB 5SX5K 4YWGH 2WZPD 4N90E 3HAEH 2WB1A 1MEXH 3FO2A 3TWCL 1P6WA 4LDEB 1KV3A 2VDMB 1WP6A 4NZTH 4GAJL 1RU9H 3PF2A 3V10A 4AL8C 1WISA 1AKJD 2DM7A 3FB5A 4MZRA 3QQXA 2NW3A 1IKNA 2BVYA 4TRPL 4M7LH 1MSPA 1RZKH 1A7OL 1BYOA 2PO6A 4JG1H 4BQBA 4JDEB 4JGJA 3SBWA 3LX9A 5FKAB 2Y1ZA 1KUMA 2H0EA 2VT0A 2X6AA 1S9XA 1M2VB 3LRLA 5D7JA 1FVDB 3BKCH 3L95A 3TVMD 3P4OB 4NNXA 4E9XA 1MCCA 4NZUL 4NNPH 4NN6B 1E4WH 5HHQA 3QHFL 4NIKB 4WSKA 3FPXA 1MLCA 2V7NA 1PIFA 1QA9B 4UTAH 2DIEA 1KJVA 2DMHA 3WTVA 1XGYL 4AYID 2DI7A 4WFED 3CBRA 5DWPA 2HUHA 1QUNB 1TQTA 4AUJA 5C0ND 5ISZE 2OTWB 2XWDA 3GTNA 1VFBA 2ITCB 3CFQA 3AT0A 4JS7A 2XCMC 1RQ5A 2IWGA 3CFKA 5TJWK 3FSAA 4NKIH 1MZZA 1VF5C 3HI6L 3MUZ1 2Y6SC 3JT0A 2DJUA 5DO2C 3L3IB 4W9IC 3VFRB 3SE9H 3HZMB 4XODA 4K8RH 1TJMA 5ICZA 1IFHL 1NCHA 1B0RB 3DX1A 3RDJA 3OKLB 2XWBB 3Q1SH 5E70A 2X2UA 4QRTB 2MPAH 3EGSA 5DXWA 3MUY1 3CZKA 4HV8B 4WK2B 1GPOH 4KTEH 4CGUB 4W9CC 3S3SA 4KITB 2HG5B 4C56A 2WUCL 5GS0D 1SJMA 2WYZA 4LMQI 4JVUA 4UIKL 4P46B 3CX5J 3PRZA 4CVUA 2Q6WB 3CVCA 4D9RE 3II1A 5LNEA 3EYVA 1EEUA 4FG6D 1KXTB 2X6CA 1DVFD 3IFOB 3KYKL 4LVHB 3N85H 4F15C 3QJRB 4XRCB 3O3EA 2N0MA 2R9HD 1XF4B 1U8OA 3NESA 4Z7WB 1II4E 2WO2B 1CXHA 2BNQE 3ETTA 1ZVHA 4HK0B 4IKJA 2W92A 3D0LA 3DTUB 5F9WB 5F88A 2KMWA 4FQHB 3QYCA 3UDWA 1YNLH 5H4ZA 4ZG1A 3MGOB 3O3BB 3PWLB 4H0HB 1JZDC 2RHEA 4RDBA 3AZUA 4LL4A 4F7TB 3ZQXA 4NAMA 3O11B 5DFVC 2L04A 3MRMB 1ZHLB 3BZ5A 2FO4B 2ZKHL 3B9KA 3K4AA 5FOJA 3STLB 4AM0B 2O5YL 4XPHH 4P9HL 1AOHA 4OGYL 1HKLH 2HFGH 3Q1EA 5L7XL 1IGJA 2YGQA 1UVQB 2DY2A 1PZ5B 4JCMA 4L4TA 3I50L 4BELD 4Z7NF 5IB3A 1LE5B 3S96A 2NNAA 1TLMA 5DD6A 3NJIA 2P8LB 3WFBH 4PW9A 3GLAA 4QI3A 3JZYA 2BZ7A 2YMXL 2EDRA 4ZW3A 1OPGL 1IC1A 1NIEA 2AQNA 4FLSA 3F58L 3P9MB 4P23C 3QWNA 2GY7B 4OZIF 4AIZA 3JWNC 2J12B 1P7KA 2ALWA 4HT1L 4UM8B 2XFGB 4I0PB 1B6UA 1VEMA 2B3RA 2GT9B 4YAQB 4IOSD 4TF4A 3HC0B 4X0KA 3AUVA 5CP3H 3JYBA 3PP4L 4QF1A 4OD1H 3CZFA 3TGXA 2C7UB 3WFHA 1UD5A 4MFHA 4Y19E 4HS8L 2NLJB 3VXTA 3KJ4C 4WWKB 3C8DA 5G4MA 4ZUTA 2CNZA 4XMLL 3HCVA 4GI6A 1GRWA 1EANA 2EKSA 4QYOA 1AP2A 3CE1A 1WGOA 4D0CB 4EZLA 4YSCA 3MLRL 2IQ9L 1CD0A 1WZLA 1GHFL 2W9DL 3QEGL 2W88A 2VABA 3INUL 1I8AA 5HDLA 1H5BC 5DR5H 3UCRA 5KJRL 2NZ9D 4LSDA 2K8MA 4GPVA 4FNRA 3TIDA 3GYRA 3F12B 1FHGA 3KPMA 4X6CF 4XO4A 3GXTA 1UT2A 2NRDA 1TIUA 2NX5D 1E67A 1LGVA 1BW8A 2EECA 3IJHB 3P11H 2Z35B 4Z8FL 2P7TA 3H9SE 1J88A 4W9EC 3UAJD 3FFDA 3UJIH 2VDNL 3BXNA 3NK3A 2ZPKH 4G1MA 4BK8A 1XXDC 3BPCA 4AC4A 5C07E 5C6TL 3TURA 3ARFB 1NCWH 3BKML 2CO6B 2ENPA 4WV1A 3VFTA 3AS1A 5ITFA 1HEZB 4L1HA 2A1WH 4LAQL 4JFXA 5EO9A 3D09A 3PREA 4U1HA 1A6ZB 2YPKA 4ZUVB 4M7ZC 2EVJA 4YWGL 4IIQB 4P2QD 4ZX4A 4IHBA 4GKZA 3IJ8A 4NZTL 1QKZH 4TVPD 4L3AA 1J0HA 2O5ZH 1RU9L 2BXZA 1HILB 1FCCA 3KLKA 5JORB 4NZFA 1F11A 2P80A 4GQZA 3VTTA 5GS1B 3TEYA 3F64A 2NXYC 1IJ9A 4R0LB 1AS6A 4FQLL 4M7LL 4D9QD 4LLWB 4YNYB 4KV5E 1RZKL 3IMUA 4JG1L 5KSAD 3GEFA 4TULH 3QJZA 1XB8A 2ITEA 3N44B 4LDOB 4BIKA 5IEKB 1EXUB 1AZRA 4WK0B 2Y7OA 4FZ8L 3IMWA 3TEXA 1PEZA 5BUAA 2XKNA 1KYDA 1KG0B 3CCHA 1S7TB 4QRAA 1E4WL 3UZQA 5BV7H 1NUFA 2WZAA 4EEEA 4WNJA 3K4DA 1UA3A 4KNUA 2R0LH 1VKXB 1E4KC 2E74C 3DETC 4UTAL 1DBKL 2MQ3A 2JTDA 3SDCA 1EGJA 3EJCA 3C6SB 3MJWA 5DJAA 5CM1A 4PMEA 1JPFB 3RUGA 2GEEA 4RMRA 3C5JA 2K6WA 2ZKMX 1E3XA 5T1JA 4G8IA 1JHTB 4GUOA 2XN2A 4NO5B 4B7LA 4GLRI 4OR1A 3KYNB 4NKIL 4WUUA 4N6RA 2OQJA 1A9VA 2VLME 5DRXB 1TU2B 2XY1A 3ULUH 1R6VA 3ESNA 5SWQA 4H0IA 3SE9L 2WMPA 3LN9A 1G7IA 4WI0A 1D5RA 3Q1SL 4PJCA 4KKRA 3QG7H 2ZUVA 3ARDB 1GPOL 2PWGA 4JFQB 4KTEL 3FTWA 4OAWA 4GP8B 2HYMA 5T5FL 1FBIH 4N0FA 4BCZA 2XWCA 3ARBA 3S5ZA 1GCFA 5ID0A 2RB8A 4OF6A 5D4IA 1FSKB 3RRQA 2IALA 2B5IB 2P5ED 3NJXA 1WFJA 3CZJA 1ZT7A 3AY2A 5LN8A 4BSJA 5GGSY 3SQOH 2I32A 5JDJA 1EZUA 1KT2A 1WYJA 3MV7B 1DDHA 4YDKH 2N3JA 1T83A 4FFZL 1R3IH 4TQEH 1D5MB 2YEQA 4P5TA 5CWSB 4YOKA 3QJFB 4GG6E 1DEEA 1HHKA 5FHAH 3KGRA 1KZQA 5AVTB 5K1VA 1YNLL 3T1WA 1T89A 5INDA 1DQVA 3CXHK 4W9HC 3VG0H 3ZE0E 1LO2L 4GP5B 1XH1A 1FN4A 1SY6A 3EBHA 3DUSA 3ARGB 5KVFH 3QT2A 1FFRA 3JVGC 5I8OH 4XPHL 3VQ2C 2JIXA 1RZJL 3P4MA 1EUTA 2YEZA 2OLDA 1AO7B 1E50A 3FF8A 2HFGL 2OA9A 4UT9A 2VLRB 2XG5B 3QUKB 1N5AB 4NKQB 5HI5D 4HEPG 1BX2B 2BNRB 2Y1YA 5FS5A 1K9TA 1CURA 3WFBL 4TNEA 5GSVA 5B39A 4WEBL 1TO4A 1BZ9A 4FYQA 3IEAA 1AZCA 3BFQG 1D9KA 3QEQA 2VQ1B 1M1XB 2Q76B 2UXVA 1DLHB 5FFGA 1B9ZA 5E6YA 2PYFB 1BJ1J 3MKGA 5HI3D 5EU4A 5CD3B 5J6HA 3EFDL 3SE8L 2CHWA 1HQ4B 3OHXB 1A65A 1R19A 4I77L 1BQLH 4GRWB 5F0PB 2BHYA 4JM2D 4JDVB 4QKXB 1XEDA 3W0WE 5EIIB 2HKFH 3II3A 4CVXA 1HL9A 4OZGA 5IWLC 4KUZH 4OD1L 1UADC 2NY1C 1S7RA 1VRSA 4PJEF 3DX4A 4TQ8A 1G9HA 3ZUCA 1ZSDA 3R06B 3ZTEA 4AYFA 1DFBL 3BZ4A 1HOCA 2CALA 1CN4A 4Z7QF 1ORSA 2OJEB 5ALBH 2IADA 3GJFA 4XXCA 1OF2B 1X5LA 3OJMB 2UY7B 1ZY9A 1S7SA 1OE1A 4OF8A 4KMQA 3FQUA 3CN4A 5DR5L 4ZFGH 4NI6A 4IRZL 3L1EA 1QMUA 3D6GA 4I9WD 1X9LA 2XNAB 2P44B 1TFPA 3QQ9C 1PDKB 4LNVA 3NDZE 5KEZA 1SXAA 3UBHA 3QS3A 3SEPA 5GGTA 1GY1A 2ZXCA 1EMTH 3QEUA 2P24B 1LEGB 2CJUH 5D70H 1VERA 4NHCH 5IJVB 5JXEC 3U30B 3UP6A 4J3OH 1RZQA 2GTWB 3S5LA 5GGTH 4KKBD 1MH5B 4LCUB 3UJIL 5I1AB 2DOCA 5C86A 2CLVB 4JLRA 4F57L 2JWYA 1LQBC 1JDCA 3IDNB 4GQPH 3IRPX 5EIIG 3L3JA 3QZWB 3E9UA 1EFQA 2J4WL 2A1WL 1AZBA 2X0VA 3CXHJ 3N43F 3OKEB 3Q7JA 5DURB 5F1SA 2XV2A 1EQWA 3DJTA 1P5VB 1VCBC 4YPGA 1BXUA 1QSEB 2BSTA 2OMXB 3AXIA 3GSNL 4FCHA 3GI8H 3T3PE 3LCYA 4A7GF 3BIAX 1QKZL 1KOAA 5GSRA 1GYUA 4HPYH 4EO5A 2O5ZL 4OZFA 1F58H 3QZLA 3WMPA 2BSDA 3K1DA 4PJ7F 1UZ8A 4IS6B 1G9NL 4FMVA 2UZXB 2H0JA 1UM6L 3QPXH 4ZPTA 1JG9A 5KUKA 3A6BL 2WXPA 2CA4A 4LF3B 3BSZA 3CTTA 4JFEE 4POZC 1WFUA 4TULL 1YEJH 6PAZA 2DMGA 4G1EB 2GI7A 1CLZH 5HVHB 1FNEB 4TNFA 3ARYA 5D8JH 5IBLD 5TH2B 3T65B 1T04A 1ZWIA 1F6FB 1FZMB 2AXFA 2ZCZA 2DQCL 3R4DA 2J71A 3D4ZA 4WW2F 3QXWA 3ULVE 1BGXH 4ZRGA 1M71A 4CUCA 4PS3A 3KW7A 2R0LL 1Z66A 5F7BA 4FF9A 1JPTH 3WCYA 3UPAA 5CLZA 5LGJB 2XN0A 1AHWB 5ERWA 1INQA 3MXWL 4GB9A 5GZNC 2PXYC 4A6YL 4X6BA 3Q01A 1OOAA 1UKQA 1CFTA 1QQDA 4HKJB 3MRKA 4JHWH 4ZMWA 1PZSA 1CWVA 3ULUL 3A6CL 3QCTH 3VB9A 5FUCC 1WHOA 3MDJA 4WNQB 1UENA 1JXKA 4OLVL 1EAQA 1NC4A 1TKWB 1K5NA 5L6YH 4F9LA 3EFOB 5E00B 1RI8A 3VFMB 1J8HD 4UNTA 1S6NA 4LBEA 1ZE3H 2BNQA 3CFDA 2A83A 5D1ZB 3QDHA 3QIBA 2D7NA 3V8CA 4URTB 4D0BB 2WCSA 4V1DD 1FBIL 2K0RA 1SJXA 3R7RA 1JK9B 1V7NH 4IU3B 4J23A 5K69A 4HW6A 5AL8A 4ZXBD 1AXIB 4HZAA 3H4FA 2NDFA 4XHJC 2WQSA 2OV0A 4CSSA 5EC1A 1UXLA 4UTCA 2V0AA 3FDWA 5CIPA 1X6NA 5SWSE 3EJUA 3RL1A 3QZOA 5MERB 2C26A 4A2HA 1IIIA 2UYLB 3SQOL 3M1CA 1G6RB 2D7QA 4XVOA 3C6EA 2CRMA 4WJ5A 4YDKL 4PLKD 1JTTA 2JKIS 4ZFFA 4TQEL 1UB5A 3QXDA 4WHDA 3B5HA 1ZV2A 2YA2A 3LKRB 3NSFA 3O4LD 4FJ6A 3OC8A 3WKYA 2FT8A 4FXTA 1LP9E 5GISH 3DSFH 3IBEA 4HCRL 1K3IA 4IGBD 5BUGA 5BVJB 3G04A 1XH0A 1AGDB 3UPRB 2C8NA 3TBSA 4EI5A 3HBGA 4JY4B 1QI5A 1WAAA 4MA3A 5A7EA 5KVFL 3MCLL 4ZX5A 5I8OL 1O75A 5I6XB 3WS6A 3T0DA 3HE7D 4UMGA 1ZA6A 2Y3AA 4UF7C 2J25A 5GGRB 4ATWA 4UZUA 3BZEA 1NGWB 1ZK9A 4X9YA 1S5IL 3DRTB 3PDOB 4PJXB 3MRGA 1RULH 3C08H 4PJBB 1QHQA 2OTUA 2QZQA 4ODUA 1AD9B 2PTTB 3T09A 3DPBA 3LXAA 1R34A 1SHSA 2VXUH 5IHHA 1Y6MR 1U0QA 4EUPA 5HGHB 3O9WA 2FWUA 3BZFA 5TTRA 3TPUA 1T4KB 3MRJA 5CLXA 4NEHB 2EYTA 1LVEA 3AAZB 3DV6A 1I7UA 2HFEB 2WLMA 4YHPA 3DO7A 2X40A 5I16A 4QXUL 4JKKA 2DL9A 4IKLA 1A6VH 5I18L 3R1GH 4DCQA 2FJFA 2HKFL 1NCCH 4BD4A 2ZYSA 4C54A 4P5SA 3DUUB 4Z7VF 5HGBA 5E5UB 3H9SA 1A1OA 5GGVY 5GZOC 3V6BR 3F83A 5ALBL 3LPPA 5C07A 5DHMC 3L3GA 3ZT6A 3TN0C 3P9LA 3AW5A 2VR6A 1XO8A 2F8IA 3WIFB 3DX6B 1QLFA 1OVZA 3CZGA 1O6TA 4ZFGL 2HXAA 3S8FB 4AI7A 2EDXA 5E8NB 4LEOA 3SDAD 1T66C 5FCSH 1TTAA 3FZUC 5D2NE 1N4XH 3ZKMC 4KUCF 3E80A 4PJGB 2W65B 5D70L 2AKRB 2CJUL 3UMTA 4WTQA 3VI3E 2PPAA 3OGOE 4CVZB 5T1LB 5AFAA 5FO9A 2OAAA 4MJJA 1VEPA 2JCCF 3WD5H 2IXQB 2VDNB 2ADJA 3NCWA 4KGJA 2AJSH 4IYKA 5LGKA 1WD9A 1BA9A 1EZVY 3A67H 1DP0A 3CHOA 1BVNT 1JF5A 2WBJC 3NRFA 5FW7A 4YDVB 4F24A 1NEZB 4ATTA 3GI8L 3IU4H 1SN5A 5E6IC 1RK1A 1Z3GH 4OFYA 1K8IB 2BY0A 3HAEB 3X1BA 3D0VA 4NQUA 4HPYL 2WVTA 1X3DA 4RCAA 8FABB 4YBLC 2WINA 2VC2B 3FRPB 1F58L 4KRLB 4LL9A 3KPNB 3LAFA 4PLJC 3BWZA 5FWRA 3VXPA 3M45A 4J4PC 3KEDA 1JF1A 4Y7OC 5D5MF 3VDBA 3FO2B 2A6KA 2JF1A 5EBGA 1UH3A 3FOLA 4E9WA 3QPXL 5TFSH 4A37A 1LO5B 1XSJA 1KTLA 3TNNB 1HC1A 1YEJL 3ZL4H 4BZ1A 1IFRA 3BN9C 1MQ8A 5BZZA 3PQYE 2AJYH 2NSMA 3BP6A 4NNYA 2JKLA 2XIIA 2NR6C 1YMME 2ENYA 2PO6B 2BVPA 5F0MB 4PY7A 3RGHA 5FC9A 3HLAA 4CC4A 2V9TA 3KPRD 3IDYC 4RESB 1C8QA 1V8HA 2YUWA 3NP4A 4G6KH 1S9KC 1S9XB 5D7JB 3WELA 2ARJA 1BGXL 3L95B 1X4XA 2DH3A 2Z8VC 2K70A 1AG0A 4Z7NE 4PBWD 3MJ7A 2D9QB 1KEGH 4R96A 1JPTL 1QTPA 4XT1C 5HHQB 2GITB 4F7EB 4F58L 5FECA 1MLCB 1NEZG 3F6LA 4UDTB 4NQSA 2L7UA 3D69A 2KKQA 2E7LC 5IBUG 4E2OA 1KJVB 3BPOB 3AM8C 4YXKH 2BY2A 2YAHA 4NP4L 5GRVK 1XGPA 3S8GB 5FYKD 1QZ1A 3FRPG 1F2QA 3OAYH 2LW3A 5BRZE 4OZIE 3B6SA 4FA7B 4EQ2A 1VFBB 4MDJA 5D7KE 5JPNC 4E9VA 4H8UA 2HTKD 3CFKB 4KROD 5TDOB 3QXUA 5L6YL 1XSIA 2X44D 3W57A 3LKSA 1GR7A 4E42A 4IRJD 3IJEA 1ZEAL 5GS0L 4NWUH 3I84A 2VQUA 5I1JH 2VSCA 1E0OB 1B90A 4HA1A 4GG6A 2OL3H 5ICZB 3E3QC 3ALPA 5AAWC 2APFA 4AGPA 3ZGIA 3EGSB 4G6FD 4X9BA 4KJYA 3NOIA 3OL2A 1ID5I 4X42A 4C56B 3N6YA 3FTUA 3GS0A 2O5XH 1QTYT 1NPJA 3WGUB 3TZVC 1TQWA 3IXTB 1ADQL 1A6TA 1YECH 1CFSA 1MNUH 2Q2LA 4OCRL 4OB5L 2J8UF 3EYVB 5CZKA 4R8WH 4X6CE 4PI0A 1J5CA 4IOIB 1IBYA 3MRQA 2WN2A 2GKIA 1WBYA 3KWTA 4M61A 2Y23A 3DROA 4QRUA 3CPLA 2BJMH 4FADA 5J4MA 5E8EA 3DSFL 1KCVH 1U8OB 3MTRA 1SNRA 1WWBX 1ZMYA 4HBCH 4PJFF 4YR6A 5F88B 3BO8A 4P4KD 1FFTB 3AACA 4XNZB 2RCSH 3RY4A 4Z7UE 5T5NF 1DUZB 2XWXA 5FGCE 1KGCE 4W9DC 3W0WA 1CGWA 3GXMA 4K3DH 4QRRD 3S7GA 2EXYC 3B9KB 4AQ1A 1A4KA 1RULL 1SJEA 4PMFA 1J9SA 3C08L 2VN3A 1DLFL 5AAMA 3TBYA 4J3WA 4AGOA 3KVQA 2ESVD 2VXUL 5JR1H 3S96B 4FFVD 4OJFH 1CMOA 4NPKA 1CGUA 4KXZI 3I9GH 2ED8A 3C09C 3R8QA 1WJ3A 1QRKA 3RFZC 2FEDD 1T80A 2WCGA 4XNQB 4GSXA 5DU7A 4EN3A 3J2PA 3PGCA 5CCKH 5BQ7A 2VMCA 3R1GL 1BD2E 3QUHA 1IBFA 4OFPA 1EJ6A 4JUTA 2FH8A 1EEZB 4M29A 3WUWA 3WNPA 4CDGC 1RJLA 3MJ9H 3TWYA 2Z8RA 4NQDD 5DSCA 3BAXA 4I0KA 4MS8D 3IXAB 2NXZC 4FULA 4KK6D 4J8QA 1SFDA 4QF1B 4UNVA 2DI9A 2VTFA 3QZMA 2NUPB 4GLRH 3L16A 4G83A 3IJ7A 3Q2CA 2ADIB 4AJYV 3RWCA 4MDIA 1H9VA 2EKSB 4QYOB 3NUKA 1HH9A 1TQCC 2VABB 4FQ2L 5TPWH 1XXFC 3PYCA 1N4XL 1NWPA 3ZK0A 1DCLA 3ZL1A 1R3JA 3KPOA 3TIDB 3EO0A 4OIBA 2BY1A 3O8XC 4LVOC 2DJ4A 1D7BA 1NAMA 3VRIA 2PYED 3QZBA 3OKYA 2J57A 4CMMA 3ZDZB 2QPFA 3BH9B 4FGMA 5KJ4A 5D71L 1IGMH 2VLKB 1MFDL 3BXNB 3CX2A 1YAIA 1DEDA 3BPCB 2JKWA 3IJYA 3FFCE 4TVPL 3L7FB 1MCJA 3SKUD 3POHA 4TUOB 4M8UA 4U1LA 3VFTB 5ITFB 3IU4L 3NFPA 4FXGB 2GY5A 1MAMH 1S4IA 3LPGA 4JFXB 2WO3B 1KN2H 5EO9B 4D8OA 1RCYA 3WU1A 5E6UB 2YPKB 2YWYA 3MOBH 3IRZA 3OLIA 4Y5VB 4CC1A 4EF3A 2VJXA 4KZEL 5AB1A 2EJ1A 4GKZB 5I6PA 1MWAA 4MJ4A 5JHLH 2BP5M 4GS7C 3THMH 3QDJD 3HPLA 3FQTA 2ZF9A 1GJWA 2FX7L 1PY9A 5LG1A 1RH8A 1MWAH 4LPUA 4AY0A 3SGKA 4LKXA 1F11B 3ZL4L 5DRNB 3VGHA 2WKGA 2B9BA 2B1AH 5CSBA 2AJYL 3EGXA 3TLRA 4NHUA 4PWFA 1R3LA 1P5UB 2YXFA 3OMNB 1E2WA 3LRSA 2BP8A 2FX9L 3TC9A 1IAKB 2WB7A 3DURA 3U48A 2VXVH 2A9DA 3I6SA 2IIJA 4F7KA 3H55A 3OQ3B 4WTZA 1RFDH 1KTBA 2QHRH 4YK4B 4P5MA 4ALAC 4J3UA 5CEZH 2DLFL 2YZ8A 4FQ1L 3OKKA 4WI3A 3MN8A 5BV7B 4AGQA 2CHNA 3WYRA 5CSZA 1DE4A 3QIWA 1TMQA 2BVOA 2MCAA 4UT7H 5KBDA 3UZQB 1E90A 3BJLA 4L05A 4WY7L 5D1QE 5HHPA 5DZVA 3T8XA 2H32H 2J5LC 4L2YA 4PP1C 5DK0A 2DQUH 5JXAH 1E8YA 2G2RB 4KK8C 2IPUK 2CGZA 3TA3C 3NJGA 5I5IA 4BFKA 3RKDC 2R1YA 3GS4A 2VR5A 4NWTL 5E9DB 4YXKL 5TE6H 5DJAB 4EOWL 1DJHA 2A74A 3C5JB 3NSDA 4DO5A 1AC0A 4ZTPH 4G8IB 5CZVH 2CBPA 5SX4I 5I6OA 5SWSA 3EG9B 4RNRB 4WUUB 4N6RB 3EO9H 2HWZH 2SODB 3IKCA 5I1DB 1YEKH 2IAND 2WXIA 3IF1B 1T21A 2X53A 4PJEE 4NWUL 5SWQB 5I1JL 1F56A 4NO0A 2WMPB 3SKMB 3GPSA 1G7IB 2OL3L 5DC4B 1SN0A 5A3ID 4LT7A 5DHYB 4LOUC 3MLTA 2AMUA 4OM0H 1I82A 4XN9A 1ZIBA 1XWVA 5E95B 2Y06L 1QASA 3Q2NA 4OAWB 5IEHA 3L5IA 5ADPH 1NM4A 2O5XL 4N0FB 3ARBB 4WU5A 4PHXA 4PV1C 5JOEA 4DGVL 1YECL 4DKFH 3CHRA 1MNUL 1KBPA 4G9DB 2J1WA 2IALB 2NZIA 1I8LC 1ZT7B 4X5LA 1JD9A 3TTSA 4IBSA 5DHVH 5LAPA 2XWRA 3IFPB 4Z5RA 5ESVA 2GJJA 2BJML 4WRLA 1KT2B 2GHWB 1DDHB 1Z5HA 2H6OA 1FJ1B 2D3JA 4HJUA 2VAAA 1CFVH 4DP0X 4HBCL 3LZPA 2NPLX 3LVEA 4X98A 1HHKB 3Q8AA 5CGYC 3V0HA 3QUZC 5INDB 4P3DB 1DSYA 2C9SA 2P5PA 4GKSB 4XOAA 1FN4B 3D52A 4ZBJA 3TIEA 1BOGA 3DUSB 4K3DL 1UD4A 4FQQA 4JFZH 5JA9A 5E2VH 4ECNA 1L3NA 4AZ8A 2JIXB 2FNWA 4N2MA 3P4MB 1DSFH 2YEZB 1HEJC 4Y4HC 5I1IH 3T0AA 3V7AG 2YPLE 1D3CA 1L7TH 1BDYA 3MLYH 3OAYK 4OJFL 1Z7JA 5DA4A 3FK3A 3I9GL 3ETBF 2XZAH 4OCWH 3QW9A 1BZ9B 2CXGA 1KBGH 3H8NA 3QEQB 4P3CL 4X7DC 3TESA 3QDGD 4JM2F 4GSRA 3ZIMA 1IEHA 3FBQA 2NNXA 5EU4B 5J6HB 1YPZF 2XQYK 4H1LA 5D2NA 5TF0A 2VDOB 4CADB 3MJ9L 4JRYD 3SKJL 3VI3A 2EYSA 1U8IB 1EFXD 1P2CA 3SPIA 2FLMA 4X9GA 4ZNEA 4OZGB 5DJYA 1J5HA 1S7RB 2JNZA 2V2XA 2EEDA 4XN7A 1N59B 3IPEA 4OZ4A 3U1PA 4AYFB 3U46A 3PU7A 3WFCL 5I74B 1ORSB 1BFTA 1DBJH 2I5YL 2DQIH 2HPOA 1TR7A 3FUDA 2C1OA 1J87A 1S7SB 2VYRE 2WUBL 3MRNA 4K9EC 1GXEA 3FQUB 2LVEA 5TPWL 3B34A 1FV1B 3B37A 5IJKC 4KKZA 4KQ4L 4AJVA 4IJ3B 4JHBA 4OUOA 5B39G 4XN1A 1IEAB 4HF5H 4XNMB 4Z18A 2WZ0A 4I88A 3BMVA 5FGSA 2FSEA 4KHXH 2ZAHA 4Z23A 3QEUB 3WHXA 4KK9D 4DN3L 3QUXB 2HTLD 3S5LB 3OGCA 3EOAA 4XNYH 4NCC2 3I9PA 3T4AB 2VDPB 1QRNE 2ARJQ 2ATPB 2X4QA 3OZKA 4U3HA 3SQBA 3PQYA 4YSPA 1NAKH 4X7FC 1YMMA 3U7WH 2ITDA 2QQKH 3G6DL 4IMLA 1F3DH 1RIUL 3FAWA 3QSKB 3BOVA 2ED9A 1KLUA 3L3JB 2A4EA 2G2NA 1MAML 5DUBA 1DQKA 3J07A 3QUYB 5I30H 4Z3FA 4YPGB 1O6SA 3MOBL 2BSTB 2FEEI 4R26L 1GKEA 4LSTL 1CDYA 1S3RA 5I73C 3K46A 15C8H 3N0PB 5A2FA 3KDMA 2AFNA 2J3SA 1UZ8B 3GKWH 4YDNA 1ZA3B 3FT9A 4Y9EA 1F41A 3DRQA 4ZPTB 3U9WA 2B1AL 1NSNL 1LXMA 1CDIA 3O3UN 3V0WH 3AU0A 2FGWH 5DWUH 1D5XA 1UWGL 1U3HD 2FBOJ 1UUNA 3MKKA 5BRZA 4OZIA 2N7BA 3L9RA 1LO4H 5IB4A 4J3OG 3MRFA 4UB0H 2HAZA 3MRDA 2QHRL 3BGFB 1VZHA 2VERN 3C2AH 3FO9B 1ZWIB 5CEZL 1IUZA 3G9AB 3S5LG 2Q86A 4X80H 2AXFB 1XTMA 4HPOL 3KPTA 5I6KA 4A68A 3KE0A 3GO1H 4X8GA 3RYMA 2X6BA 5EDXA 3FQ4A 3E6FB 5JXAL 1NUDA 1M71B 1H15A 2C9AA 5B8CB 1QEWB 5DUJA 5A16A 1WVZA 2EH7L 4E0RA 1U92B 1BQHA 3GSOA 5ERWB 1INQB 5SV4A 3NCFB 4RRPA 4PJIE 1MRCH 2DKUA 4X6BB 1CS6A 3LB6D 4AK2A 1QQDB 4OZFG 3WJLC 2N0KA 1QW8A 2HWZL 2VKWA 1YEKL 1OGAB 1T20B 2J55A 1TLKA 3NP3A 1NC4B 3M86A 4Z7VE 1OOWA 4L0PB 3RY6C 4GBXA 5KYXA 2NT0A 4LBEB 4WWKC 4M8VA 3HR5A 4OCMC 5D72L 3HKFA 1SJVA 4OM0L 3CFDB 3HZVA 3DMMB 2WANA 4YXHL 3OZ9L 3QIBB 3VVWA 2ZCLH 5ADPL 8CGTA 5H35A 1RLBA 2PR4H 5DJDA 1AOZA 4Z7UA 5F0LB 1RUKH 1KLFB 1U30A 3MRBA 2FBJL 3O45B 2YJLA 3RX5A 4HC1L 3ETBJ 5IR1A 2O4EA 3CLFL 5CIPB 3RL1B 5IQOA 4DJMA 4MA8L 2I25N 4XTRC 4DK5A 2OCCB 4FYSA 3C9NA 4WJ5B 4IBLT 5CUSH 4H8PA 2WYTA 3ZY7A 1D7DA 5TE4L 2JCCE 4ZFFB 3OXRB 3UOAB 4C58B 1UB5B 3QXDB 2FQEA 5ECJE 3ZT7A 4FLHA 3ARFC 3AGWA 4HUXA 4OGAD 4P0DA 1CICA 3K0YA 1UB6B 3KR3H 1ES0A 1JN6A 3P30H 4CDHA 1CXFA 3O3DA 35C8H 4HIIA 4J1UB 2CUIA 1UH2A 2WBWB 1BD2A 4PJ8A 1Z32X 3NA4A 3D3VA 4OJCA 3WGVB 4EI5B 3K5RA 3TV8A 3GIZH 3K8MA 3EYSH 2YAFA 2WOYA 3P73A 5E2VL 3WN6A 1JGDA 2BIPA 4IIQC 2X89A 2I27N 2ARWA 1ZA6B 1DSFL 4N2DA 3OSKA 4XXWC 3JTSA 4YSSA 3BZEB 5I1IL 3DC0A 4RZKA 3MRGB 2XFXA 1L7TL 2GC4C 4OF5A 3MLYL 3N50A 2OTUB 1M9SA 2WKLA 2XVKA 4ODUB 5GS1C 1HE7A 2FGZA 3DPBB 3HE6C 4OCWL 4R0LC 3BDBA 3VQLA 1ZHBA 4EUPB 3AVEA 1HHJA 1L9SA 2X4PA 5JNYA 5KYNA 4CU6A 1KBGL 4MXQD 4QDGA 1HJBC 3FC8A 1QAWA 3FCTB 3MRJB 5IK3B 2G4EA 2EYTB 4RAHA 2F7IA 4I13B 4HOZA 1JV5A 4LLQB 4FP8H 3DV6B 1I7UB 4YHPB 2G5UA 5D1XA 1ICTA 4PTUB 3C60D 5FIEA 3V4UL 3DO7B 4PP2A 3VYOA 2UY6B 3VRJB 1X9UA 4DCQB 2FJFB 2IH1B 3SY0A 2ADFL 2XG4A 4LLYA 3ZTJH 4ZUSA 1HSBA 2GCYA 4J27A 5ESAA 3WNJA 2EE0A 1CBVH 2EQDA 3MC0A 4W1TA 1MCWM 5HGBB 2NY4B 3DHJA 3CZEA 3H9HB 3LZOA 2D4FA 2QVTA 3WAKA 4AQ8A 5JIQA 1A1OB 4AKQA 2ZD0A 3ZZLA 2IBZY 1F5WA 1DBJL 5K1JA 5C07B 2YD1A 3FFCA 5E08H 3L3GB 2FO8A 1MJJB 2GFBA 4QXGL 2VXQA 4UAOB 1QLFB 2ODHA 3FN0H 5B22A 2M83A 2ZP0T 3LHPH 4B0MM 1B4JH 1JS4A 2A77H 2JFCA 5HJBA 4P57A 1LE9A 3BT2L 1WAEA 2CIKA 2DQEH 4KHXL 4W9LC 4EUPG 3ZGHA 3A4DA 4GMSH 3ARDC 2EIZB 4FFZA 4AUYA 2H6PA 1T5XA 2NY5C 4YSDA 3L8QA 5CEYB 1NAKL 1Z9SB 3TJHC 3RGVA 2QQKL 4YQXL 3WEBA 1ZLUH 5E8OA 1ZS8B 2PCFB 1PEWA 1GGCH 2XZQL 5I30L 2YA1A 1AMXA 4HUVA 2J8UE 1N8OE 1RK1B 2OFQA 4PWHA 3WY3A 4KO7A 1JGLH 4R6UA 2SEBB 4KVNH 2BS71 3MZGB 3RWHA 15C8L 3TO4D 5D1QA 1SLWA 1IV8A 1JF1B 2A6KB 3GSWA 3FOLB 1AG6A 2VZVA 2WWKT 4MKTA 3VD7A 4Z1PA 4KKAD 2FGWL 5DWUL 4LQFH 4FERA 3KYOA 5TQ2L 4P49A 2XWJA 2XWTA 4UB0L 1BOYA 2WQWA 5FUZL 5CKAA 4B60A 2E86A 2BVPB 3ZKXC 1MJ8H 4XE5B 5HDOA 2G5RA 4PJEA 4YDZA 1NEPA 4KXZH 2RH0A 3CV5A 2J43A 3GO1L 4GXVH 2HPTA 1JGEA 3D87B 4EVNA 3WHE0 5AKVA 2BSCA 2ZKWA 3PXHA 5FYKL 3TT1H 1ORQA 3MJ7B 2ITFA 3EJYD 4JFDD 2EIEA 3NCEB 1OALA 4CJ0A 1UXSB 1AR2A 2FDBP 3KD4A 4NQSB 3D69B 3SE6A 4LCCC 4WWPA 4LCVA 2E8YA 1PX8A 4FI6A 2DJSA 3OHXC 5TGBA 4X7TA 1W0VA 3BQUD 1OTTC 2AABL 4GSQA 5CP7A 4IRZA 3MNVA 3B6SB 1S5HB 1JHKH 5K39B 2UZYA 3HJEA 4S1SH 3NIGE 1OTUC 1GVIA 1BJMA 4QXVA 4IMKC 3DYMA 3QYMA 3LKSB 4NQTA 2WLKA 4E42B 2OL3B 4YFLI 3IJEB 5B1BB 4QHPA 2BIIA 4GG6B 2G60H 3NGBB 1ZPLA 3ESUF 2HJFA 3EADA 3ZE0B 2ICEA 4WWNA 2PR4L 3B9AA 3C2SA 4ZS6C 3V0IA 1RUKL 4XB8A 3VXMA 4AL8H 4OLYH 4PCSA 1FIGH 2ZOLB 1E5CA 1E9OB 3D4YA 4J6RL 1KBWA 2NX5E 2WYHA 2HMIC 1XF5B 4B50A 4K23H 3GSNA 1CPUA 1NBVL 3STBA 1CFSB 4KHTL 2YPLA 4XC1H 4POYA 1LMIA 5EF0A 1G7LA 3CK0L 3LQAL 1IM3D 5A7BA 5IHLB 3IGKA 3GMLB 4NUJA 1R3KB 3MRQB 2MCMA 1WBYB 4NKDA 2X3CA 4M61B 3DROB 4FXKA 3CFNA 1BYPA 4KXBA 2JJWA 4LMQE 1X5ZA 3PABA 3KR3L 5E8EB 4ONHB 3P30L 1XGTA 4HALA 1H6FA 4IBQA 35C8L 5FDYA 2X12A 3HZYB 4HIXL 2IGFL 4YR6B 2VLLB 4P2QE 3BO8B 1LDSA 3DX0A 1PZUB 4TVPE 2ZICA 3NJHA 1NFDF 3EF7A 4YHKL 1Y07A 1WS8A 3W0WB 2P4AB 3CDFA 1OAQH 4AQ1B 1W80A 1A4KB 1RP9A 2XXCB 5LXGL 1U4EA 5EN2B 2NSQA 4X99B 4DQOH 5GZND 4D9QE 4XZUA 4LARH 1I9EA 3P0GB 1LWJA 3RTQA 4YBQD 4PAZA 5JOPD 5HVHC 1TETH 3LSOA 1ASOA 3LPOA 1XMEB 5FGBA 3US0A 1FZOB 1JXFA 5I19H 4GW4A 3P4NA 3DX7A 1BZ7A 2A3TA 3ABZA 4S0TD 4BSWA 4LDCA 2Y5TA 3PGCB 1P7QB 5BQ7B 3LXBA 2EDDA 3ABMB 2IPTH 1P4BH 3WUWB 2D2CC 1UQSA 2WXJA 4HS6A 4MXVF 4X5RA 2P5WD 3R0NA 4U1MA 1RJLB 3HMXA 1GW6A 5DSCB 5JR1L 4MB1A 2E27H 4FA6A 1K4CA 5IESH 4LVEA 5HVFB 2PW2A 2CDEB 1ODAA 1AHWC 4M9PA 1QRNA 3H7LA 4XBGA 4Z7AA 4PGEB 5I8EB 1GZHA 1MG2C 3RDTC 5I1LB 3UCQA 3RWCB 3FN0L 4M5SA 3DI2B 3K6IA 3LHPL 3MA9H 4FFTA 5ABAA 4G80A 2A77L 3ZQWA 2QR0A 1YYLH 3IGUA 3DVGA 1PS3A 2DQEL 3B83A 4QD2E 3DSNA 5IF0A 4PJ5D 1A7RL 1R3JB 3KPOB 5IUSA 5FO2A 5DUMH 5D1ZC 4DAGH 5I71B 2YJQA 1KCSH 1V3MA 4RFEA 4FNTA 1NAMB 3VRIB 5IVNA 5GIRA 1AJ7H 4CMMB 4M62L 2F1AA 2YXWA 3K80A 2CD0A 4FFYL 2P5EE 2EVHA 1SDDA 4XO8A 4Y4FA 3WUWG 4IRSA 1GGCL 4YFEA 2O6EA 2ZUWA 3G5VA 4HQQH 2VXSH 2H7WA 5FPIA 3UTQA 4JCWA 3NFPB 1TZHA 5KBPA 3DIFA 1BZDA 1JGLL 4KVNL 1C08A 4FYTA 5EEWA 1G7MA 2MJWA 2CHDA 3JWNH 4JO4L 1NLBL 2JJTC 3SQRA 1MWAB 2GK2A 3HPLB 3FQTB 1JPST 3SJVD 4FQPA 2DJMA 2XPGA 4LQFL 3QQDA 4HCIA 3HLKA 3U1SH 4LKXB 4U2YA 4AE1A 4PJIA 4JG5A 2VQTA 4ZAKA 3T77A 1ZDQA 4PTTB 1X9QA 5H4YA 3V6ZB 3EGXB 3OAZH 2WLZA 4JFWA 1UD8A 3O6FA 1TF4A 1T2JA 2R29H 1SBSH 3LRSB 3QDMD 1MJ8L 3DURB 1Q1PA 4PN6A 4LVNB 1YEWA 2F8VA 4GXVL 3T2OA 1BG9A 2AK1H 4Z7VA 4KRMB 4P5MB 2DH2A 1M53A 3PHAA 3U0PA 4KRPB 4IK7A 1WUNT 1DE4B 3QIWB 2BVOB 5CSZB 4NQCD 4ZTEA 4P2OD 4QRPD 2EVIA 1QVOA 3SYPA 4LASH 3T8XB 5DK0B 1OWRM 2CR0A 4YSUA 1W8EA 5J12B 2W59A 4MCYA 2GABA 1MHCA 3S35H 2R1YB 2IV8A 2O30A 3SDYH 3O41A 3WO3B 4ZT1A 3PWPB 4QWWD 1OL0A 2A74B 1L9NA 3S9DB 4GO6B 1FNGA 3WLWD 5JQ6L 3WIHH 1YPZE 1JHKL 3AS0A 3SSGA 2FD6H 5C9JB 3L4XA 5SWSB 2JVUA 3OKDA 1E9QA 1EHNA 3VI4A 4WW1A 5ACMA 1X7QA 3L4ZA 3TO2A 3IKCB 2RIKA 4G9FB 4KQ0A 2GQHA 1T21B 1O6VA 1IRAY 1EO5A 3C8KB 3BVTA 4NO0B 3QQ4B 1XH2A 1NGZA 2FJSA 5AOZA 2Z31D 5F89B 2G60L 4MDRA 4PJ6A 1KPVA 3TT3H 3HOGA 5DQDH 5HHXH 4CW1A 4I9WE 4L5FH 1MHEA 4WTZG 4UINH 4HIEA 2WZPA 4AL8L 1FIGL 4XVJL 5IEHB 2IDUA 4U1IB 2DQFA 1N3NA 1B0GB 3EH3B 3R19A 3GQFA 4K23L 4BA8A 5AG8A 1FQ9C 5DHVB 3GMOA 3BN3B 4NOFA 5AUMA 1AKJA 5SWZE 3N91A 1OZUA 3OC5A 4X4ZA 2PLTA 2V5TA 2MPVA 2WXLA 3FT1A 3VDCA 3NTCH 2UVEA 4KDTC 5K33A 3FUEA 3U6XS 2UUDK 2X4RB 2EYRA 4MMYA 2RBLA 2VAAB 4AEEA 1KIRA 3MBXH 3IWVA 1Q9OA 1GKOA 2D3VA 4X98B 3TVMA 3MBED 4G70B 3H4HA 1YDPB 4JFVA 2K7QA 5E6RB 4AKPA 1EPFA 3WXWH 3RVXC 1KLGB 1NCNA 3TIEB 1BOGB 3DPDA 1K4DA 4FQQB 4X7EC 4LLUA 4PRPB 5AB2A 1CYGA 1F45A 2QFRA 3IU3A 4MA1C 4PJAF 4MD0A 4OJAA 3LEYH 4P99A 3RFRA 3V5KA 4LARL 4AV0A 2B59A 4K4KA 4V2CB 3TM6A 4NGHH 3UYOD 4AUUA 2J88H 4XVUC 2XICA 4MKMA 3CC5B 5FHBL 1TETL 1IKNC 4HWBH 5D7IF 5T33L 2V9QA 2NY3C 1MCIA 2PO6C 3HRZA 4MTMA 3INOA 3VD4A 1TSRA 5I19L 1IGYB 3SBWC 1GYCA 3VXOA 5KANG 2NY6B 3JT2A 3ECBA 2IPTL 1X5XA 5D2NB 5E8DL 5D7JC 4K5MA 2RACA 3RJOA 4DIXA 3VI3B 2EYSB 2YUZA 1JE6A 4Y8AA 2WOBA 2E27L 5FYJD 1BZOA 3BRGC 4JFTA 5CLWA 4JHAH 1I9RL 2V2XB 1COBA 3MU3A 3MRLA 5GGQH 3DO3A 4XMXA 1PIGA 3U46B 3J7HA 3CDGA 1QATA 3GSRB 1YYCA 4OCYH 4GJTB 4YDMA 5HPOA 1R5WA 1DVFA 3MA9L 4CILA 2PPFA 1MQKH 2N59A 4HCGA 1SFHA 2C1OB 4G5ZL 1T7XA 3MRNB 4GXFA 1J8HE 1IJNA 1WH0A 2N1KA 5F9OH 1BIIA 4AMKH 5CF3A 2BY3A 3JVGA 5I9QC 1MOEA 1RUPH 4K8RC 1GGIH 4KI5D 4PD4K 4WFFD 2JLPA 2EUXA 2NT1A 1K2DB 5DUML 2EDNA 4Q97A 4BZ2A 2NUTB 3D07A 4V1DE 4DAGL 1PCSA 2FSEB 2MQGA 5DD3H 3N42F 3WHXB 2Z4QA 4YSTA 5JQHC 1AJ7L 2W91A 4O9HH 3U4BL 3ARUA 3EOAB 2XBDA 3EIFA 1ASQA 1MRFH 3LKQB 4P5RA 3ULAB 4AEHH 1PY4A 2X4QB 2OI9C 3SQBB 1HCZA 2BP3A 2FWLB 3ZKQD 1YMMB 2ITDB 2VXSL 4IMLB 4F7PA 4I3GA 1FVEA 4YS4A 1IT9L 3MCKB 4BQ9A 1DBBL 2H45A 3U0WL 1HINL 5L0QB 1I8KA 3D33A 1F4YL 1PZDA 3H54A 3MLSL 3DHUA 4NT6A 4E9SA 1HEHC 2HLEB 3P77A 3FCBA 4GINA 1O6SB 3O4LE 2ADGA 3OMAB 4LLDB 3HHRB 3WKPA 2ZUSA 3O2VH 1KGYE 1REIA 3ZR6A 3M17A 3NJFA 3BAEH 1OEZW 4LSPH 3KDMB 2QPUA 4NQXB 3WO4C 25C8H 3P4LA 3MOAH 1BHGA 4FXLA 3U1SL 2BLFA 1T0NA 3UDWC 3DRQB 3I3EA 3HN3A 4IIZA 3FT3A 1U58A 4XNZC 5KSBE 4ZX6A 1QPXA 1TJXA 2YQ2A 4IOSA 2WXFA 4EI0A 1D5XB 5D96B 2E9WA 2YARA 2LU4A 2BVTA 4PB9H 4OZIB 1TFHA 3L9RB 2C9VA 3QO1A 5IB4B 3MRFB 1GIGH 3QXVA 3QBTB 5A40E 4BH8A 3UJTH 1C16A 2AK1L 4K7PY 3CFBA 4MAYD 2FECL 4F8TA 4YUEH 4XNUH 4IW4C 3HR6A 3KS0H 1FO0H 3LQZA 2X4TA 1Z0MA 2H2SD 4LASL 2Z1KA 1U36A 2DWSA 1H15B 4PSRA 2H2PD 5IKCA 3BWAA 4JQIH 1LEKA 3QA3A 3LNFA 3QZPA 4FE9A 2Z6FA 1A64A 2ZYIA 5A16B 4E0RB 2EACA 4ICXA 3GSOB 1G7PA 3MZTA 5DFWH 2BSRB 2WPGA 5H2BA 3WIHL 4QXTA 2NX5A 1QUPA 3FONA 2FD6L 5F3HA 2X2HA 4JGNA 4NJ9H 1FRGL 2V17L 1CTMA 3WN5A 3T1FA 5TF1H 2F5AH 1IM9D 3UAJA 5B3NA 4MRBA 2WP3T 4PD4J 4S1RL 2A9MH 3L4VA 4PWGA 4GBXB 4U6XA 5KYXB 3HZ3A 4MCNA 4GFTB 2X41A 3FQRA 3K71B 3GMQA 3HR5B 5DQDL 5HHXL 4N90D 3TT3L 5JLZA 1HQRA 4QHLA 3HBPA 2DN7A 1O7DE 3HZVB 4AVIA 4DP7X 3M6DA 1I3RA 4UINL 4P2QA 4PGDB 1SUJA 5D9SB 4WGKA 5H35B 2H5UA 1HYRC 4EIZC 3BVDB 4Z7UB 3WNMA 3SY6A 2FWSA 4MNHB 4GAGH 3MRBB 5IMLA 5LCVH 4K5PA 3T6VA 3B2UC 2VJ8A 4HJGB 5F1OB 3HC2A 3AREB 3QCVH 2VZ3A 4LSSH 2XETA 3NTCL 5AVXB 2Z34A 1HDMA 1YQ2A 3CSYA 1A6WH 5KSAA 3OAZK 5EWIH 1BQHG 2EEBA 3HG4A 5GRJH 1P7HL 4RRPG 2M26A 3DVFA 1ZLDA 3MBXL 3MLPA 3EO1A 3S37H 2FEEL 4JKPH 3CFEA 3CWGA 5EUOB 4IJTA 3K6SA 4WV1C 1ES0B 1JN6B 2QKSA 3VFUA 3O3DB 4RLDA 4HIIB 4R4FH 1ZHKA 1JK8B 4PJ8B 3D3VB 1F8TH 3NABH 1E3FA 1WF5A 3P73B 1L5GB 1JGDB 1VZIA 2CK0H 3BUIA 4IOFC 4GYBA 5B38B 3GBMH 4NRZA 2R2HB 4H5SA 1HVXA 1AGFA 2QGDA 1PZAA 3NQIA 4NGHL 4Y9CA 2F68X 3EJTA 1XVSA 2J88L 5DVMA 1KTKE 3CN2A 3QHZH 2BSED 2XXMB 4M9OA 1NBQA 4HWBL 5D7SH 1MIMH 2J73A 3R7QA 1ZHBB 5J13B 1E5UI 3N3EA 2X4PB 3KPRE 5JNYB 2YPVL 4QLRA 4HCFA 1AXSA 4YK4C 1JV5B 1YN7A 3IS0X 3EYUL 4GW5A 2Z92B 5D1XB 4HEME 5BV7C 1ZLEA 3NFNA 4PP2B 5AZUA 3MRIA 4K2UH 4WI8A 2MQCA 4PGCA 3SY0B 1X5MA 4M7JH 1PLGH 4LLYB 2BS8A 2GCYB 4ZUSB 3CFMA 4TSBL 3RNQB 4M8QA 5FYKE 3SDCC 4PJHE 2C4FT 2CUMA 2ZUUA 2P5EA 5F7HA 5JYLA 1S78D 4OCYL 3H3KA 4XWOD 3AQDA 1MQKL 3WXVL 1A9BA 3QPQC 4KRNA 5DZNA 1FG2A 1QSVA 1FYHB 1QLRA 3EYQC 5F9OL 1JHLH 2CLRA 2EE9A 4HVBA 1RUPL 1DBAL 3ILQD 5TD4A 1BAFH 1GGIL 3QAZC 4X4MA 3NCJH 4M43H 1MREH 1ZLSH 2VITA 2XQBH 1I1FA 3QWRA 1G1KA 3PAZA 4P57B 1LM8V 3MROA 5DD5H 1JXGA 1DVZA 2XYCA 5HI4D 1WFMA 4Q74A 3RWJA 4UTBA 3AY4A 5DD3L 1VDGA 3I2CH 3CG8A 2WKOF 1IO4C 4O9HL 1IBZA 5EU5A 1W91A 1KC5H 3AS3A 3W81A 1CFBA 3ZYJA 5DEGA 2YLKA 2YOCA 3I02A 1J5DA 1JVLA 2H6PB 3IKKA 1MRFL 1HT6A 1T5XB 4AEHL 2GJ6A 3UC2A 2X9YA 4OLWH 4WHYH 3ARBC 4BCYA 2CKBA 5DT1H 3RGVB 2ZUYA 5EPMB 4GAYB 3ZTJG 5E8OB 1T5WA 3G6JA 3WTXA 5EO0A 2X09A 4HHGA 3EDDA 4HJSA 3FL7A 5TQ0H 4HIHA 1SYVA 5F7MC 5DDHA 4B7IA 3TASA 5I1CH 3FU7A 3L81A 1AQMA 3RWHB 4A7QA 2DQJH 2MCG1 1T83C 3U0TA 4P5TC 1CFQA 25C8L 4BFJA 3MOAL 4DUXA 2ID5A 5GZOA 3ZDXF 3GSWB 1TEYA 1L9OA 4HUCA 2FIKA 4JM2A 1X5HA 4YDIH 1OZTG 3JWDH 3LYRA 5AALA 2QTEA 3KYOB 3W37A 4Y19D 5HYSB 2ZCHH 4PB9L 2XWTB 1FGNH 1WAPA 2P47B 4XP1H 5TDPB 2CBMA 3BESR 4APXA 3RIFF 1A7QH 1Q9KB 3UJTL 3RPIB 3B7RL 1YNKH 2ESVE 2Z91A 1NKOA 4G43A 1KJ2L 3CDZA 1M7IA 2W0LA 4HJTA 4YUEL 4EVNB 1FO0L 3F04A 2DM3A 4JJ5A 5EBWA 2R56H 1KTCA 3P1VA 1ORQB 4JQIL 4XPGH 5CD5D 4A67A 2NCMA 1WV7T 3VFOB 2EDWA 1AMYA 1D9KC 4OIIH 4ELKA 3QJXA 5E1GA 3VGEA 3ZO9A 5K9QI 1TTCA 4A38A 1CO1A 4NJ9L 2G75A 1KCWA 2CUAA 1W0VB 5CP7B 3WFEL 1IC5L 2X9XA 4MB3A 1C7SA 2F5AL 4U0RB 4MXVE 2UZYB 4S2SA 4JN2A 4HUUA 2O6CA 3ROOA 2JKTM 3V4VA 2A9ML 4YSQA 4I4WB 3B7TA 4FC3E 4WO4D 4P46D 2MSPA 5I74C 3TTYA 2VWEE 1EAPA 1MCWW 4XXCC 1FIEA 2KHAA 4DGYH 2PTUA 3HNVH 2HJFB 3OD3A 3V55A 5LBVA 4EXKA 3VXMB 2D4DA 3CZUB 5IOPA 2CCVA 4GAGL 5DFAA 5LCVL 4IJ3C 3S88H 4AQEB 1UHVA 5LBSL 2X4SA 2PYEE 1MCFA 9CGTA 2UWEA 3RWIA 1CE6A 3E1ZA 2FIRT 1PFCA 2ZCKL 2ZF8A 5EWIL 5GRJL 3RIFK 1C5DA 1SZNA 4H13C 5AVRB 3FFOA 3UX9B 4PRDA 1E5AA 1JXJA 3HS9A 1VZGA 1OQXA 5F21B 4XCEA 1XSKA 1MI5E 3HZKA 1TZAA 3BC9A 1UCBL 2VH5H 4FXKB 4JKPL 4TLUA 5IREA 4C4KT 4L8CA 4K3GA 1A8ZA 3IMRA 4RSYA 1XGTB 3FTSA 2Y72A 4TTDC 3FUNA 1CDCA 5FLUA 1QBBA 1BM3H 3VU2A 1SOQA 1F8TL 3NABL 4MS6A 4PEEA 4IEFB 3QDJE 4NCC1 1L0YA 4X4XA 4K3JH 5ENWA 5HDBB 3W9DB 5IGXH 4POUB 4ZOBA 4DUVA 2MWCA 4HGWA 5JMOC 3KPSD 4AQOA 5IVXE 5D7SL 1MIML 3BAYA 1K6QH 3HBZA 3NIFF 1DYZA 4NN5C 2IPKA 3FHQA 3RTQB 2Y6TE 4I0PD 4HH8A 1NFIA 1Z9OA 3LSOB 4PHZA 1J8HA 3PDDA 2H9GB 3MRHA 4GW4B 3P4NB 1BZ7B 1DN0A 1OB1A 2R2BA 2Y5TB 3I85A 4K2UL 3UGEA 4BSWB 5I0VA 5KVGH 1N6VA 4N2KA 1NCUA 4M7JL 1PLGL 4HS6B 2DYPB 4V1DA 4XOCA 4IBWA 1GGBL 4PH8A 4U1MB 1KCLA 3DX3A 3BUPA 1CFNA 3X1EA 1PD6A 1RUMH 5JHBA 4ZXBA 2WLNA 1XAKA 4U6HA 2PW2B 4OF3A 3HA0A 3MX0A 3OXSA 3EBIA 3KDPB 3S36H 2IFGA 5HYFA 4XBGB 3GMPA 5E7BA 2OXHB 2H4EA 4MMXA 1Z2KA 4NBZB 4RX4D 3CU7A 1JSYA 5E5MA 3REVA 2AC0A 4QGYA 1L9MA 3GHBL 2IANE 1SN2A 1JHLL 1KBBA 1Q94B 4NI3A 1BAFL 1ZLSL 4G80B 4M43L 3BH4A 3O4LA 1AGCA 4YFLF 2QR0B 3NCCB 4F9LC 3DVGB 4IGBA 2MCPH 4GIAA 4GKNA 4JMNA 5IF0B 4PJDE 1HYSC 3SBRA 2CGRH 2HLAA 3QIBC 3NN8A 4QY8A 3VXSD 1OM3L 4RFEB 4AGNA 5KSBA 5GIRB 4OLWL 4J5VA 3WE6A 5DT1L 3Q6GH 1WCBA 4I85A 1ZTXH 5B4MD 4L3FA 3GBEA 4HBQA 4RFOH 4Y4FB 1QD0A 4QCIA 2ZSWA 3ARWA 1NGQL 3G5VB 3OHMB 1KV7A 3KS0J 5TQ0L 5CZXC 1J0ZA 3UTQB 4RMBA 2WWMC 5I1CL 4PW3A 3DIFB 3QR1A 3UP1A 2M2DA 3KVDD 3MGTB 4K5OA 1KB5L 3WFDL 1G7MB 4HPHA 5FDWA 3FU0A 2JJUA 3DDGA 1S9VB 3LIZA 3OB0H 1FNSH 4NQEA 1T1WA 1N7MH 1FDLL 3GXFA 1SJHB 3D25A 3N1MC 4NM8L 1U3NA 2D3NA 2VB5A 4YDIL 4A7UA 3B4NA 3QQDB 3KJ4B 2LABA 2TSAA 3QI9C 4PJIB 2YZ1A 2ZCHL 4ZAKB 3T77B 3VXQA 1FGNL 2YAPA 1UWEH 3OF6D 4UV7L 3WS6C 1R17A 2DBJA 3O6FB 4Z3IA 1YNKL 1O9VA 4XVSL 3I9IA 1TTFA 5FR3A 43C9A 4QO1A 2P8PB 4FG2A 2YFOA 5B3JF 3K74B 4WFGD 2JCWA 4PJAE 1JRHH 5KOVC 5C6PB 4Z7VB 2AZAA 2R56L 1L4IA 1FC1A 3IPBA 1CK0H 5ELIA 1DVUA 2K6YA 3QDGE 3O9WC 4UAHA 5EZJA 1UKSA 2X2YA 1TVBA 1KXQE 3NEEA 3SDAA 3ZMEA 3M8OH 2D0FA 3AC0A 4HSQA 4OIIL 5D7IE 3FSVA 1KEMH 2YK1H 4MCYB 4HJIA 2F9BT 2H3NA 4JRYE 3JWNG 2ZXQA 3O41B 1M7DB 2JKXA 2W94A 4GI8A 4KJWD 1MCOL 1JDDA 2OP4H 1YY9C 1IILE 1W0WB 2JQZA 3FQYA 1OP4A 2NTFA 4ONGL 3LS4H 3TFKD 1HH6A 1A6UH 4JZOA 3OKDB 4XN2A 5E2JA 1E9QB 4TQHA 3VI4B 5IQNA 4WW1B 5IIEA 3TO2B 2NY4C 1HSAB 4ETQA 5DJXA 1ZOXA 1YNTA 3C87A 3GXDA 4P06A 2WWKO 4DGYL 2B4CC 1U91B 1WIPA 5E0FA 4FFWD 4KTYA 4G72B 5DZLA 3ZMNA 4UAOC 4CW1B 2NXYB 3CZNA 5DYFA 4C8XA 2DLIA 1MHEB 1M6UA 4D94A 2C3VB 1X7SA 3T3MF 4HIEB 1RKRA 2W0PA 1N6UA 3MV7D 4OJEH 5FYLD 5ANME 3SBPA 1NFKA 2DQFB 4JFED 1N3NB 4NUQA 3RBSA 4UOW1 4U6TA 3D06A 4NQVA 1IL1A 4AT6B 3GMOB 5AUMB 3RVVD 4Y0GA 1AKJB 1HHHA 1TCMA 2GEQA 2X4NB 1WEJH 3IGFA 4PB0H 1MFBH 2PABA 2Y7NA 2IAAC 5GGVH 4ALAH 5CLTA 1BF5A 5AOJA 3ARGD 3VXRB 3SPHA 2VH5L 1RPKA 1GTNA 1OGSA 2GAZB 2CBTA 4Q58C 2EYRB 1FH2A 3KPRA 3BDYH 4XH2A 1T1XA 5H94A 1KIRB 1AO7D 2PP9A 1Q9OB 2AXGB 2VLRD 3TVMB 1MN4A 1U8JA 4CU8A 2Z0BA 4HEMA 5I5RA 3HC4H 1MHHA 3FU3A 1NANI 1KELL 3IDXL 4KO9A 4MBOA 3W39A 2Y7SA 4FJYA 4UBDD 2O5NA 1OCWH 2RD0A 4DGWC 4L8SA 4Z77A 4BCXA 4O51A 4J8RB 2LLLA 2D7TL 5AB9A 1WTGT 3HS0A 3V5KB 1FL5B 5BMFH 2W95A 4PJHA 4QRSB 1K6QL 4NKMA 4Q4IA 4PV9B 5C71A 3LRGA 2E46A 3VFPA 1VACA 3K72A 4TPRH 3UAFA 2Y2WA 3FOMA 3O6MH 3HRZB 4JKNA 4PIBA 2AJ3B 3IB4A 1E30A 1ANUA 3IDGA 2XBZA 1HI6A 3LN5A 5KVGL 5EORH 1NCDH 4TLKA 5D1ZI 3L5XH 5E2TH 1NPNA 2AQTA 4JBSA 3IAGC 1I8LA 2OX5A 2W60A 3V9CA 2G3MA 1W72A 3NIDB 1RUML 4QIRA 3ZE2E 4M5YH 3K4ZA 3U4EA 4AOFA 4OSUL 4FNLH 3IS1X 3X11A 1RZ7L 1JZ5A 1R1CA 2KYIA 5KOMC 3MRLB 1JFHA 2BZDA 4ZMPA 3H2WA 1O5DT 4Z78A 4S11A 1J5IA 3CDGB 2F8XC 4M1CD 5KYYA 3OKMB 1BWMA 3A4EA 3Q5YA 3RX8A 5CEXB 3L4TA 5CGBA 1MW3A 3F2LA 1VFMA 2FHFA 3I6GB 4OLZH 3UTSD 4X5XA 1WFTA 5JPMA 1XBRA 4CL7A 2MCPL 4JPSA 4OQTA 3E6HB 3GSXA 4QOKD 4P4KA 2CGRL 5IM7B 4UIMA 3RL2A 3MLUH 3NGBC 5DURD 2VDMH 4J6IA 4GQ9L 1XCWA 4OQTH 5T3ZD 3PGFH 4PR5A 1R75A 3Q6GL 4QRRA 1SVCP 4LOVA 3BHBA 3QUMA 1MCEA 1GY2A 2NNCA 2XRAH 1XD0A 3QUMH 1Z5YD 2ESVA 2HT3D 1E3ZA 1XEUA 2VKXA 3CH1B 1I8KB 1F3RB 2B77A 2R1WA 4ODWB 2XTSA 3GS7A 3GM0A 2A0LD 3ETSA 5JOFB 1E8WA 2ADGB 1FNSL 5KSVB 3EW3B 5KS9B 4KJQC 3PWNB 2NY1B 5I1EH 1HX0A 2O26U 1S7UA 1DZBA 1ND0A 5TE7H 1TJHL 1MKFA 3V9EA 1MXDA 1EJOH 1UM5L 1ZSHA 3MNDA 2OYLA 3KGUA 4DTGH 3FT3B 1U58B 2LAGB 4NQDA 3VWKD 3F00A 3ILPA 2JKRM 3ARZA 2WGNB 1NDMB 1CGVA 3A5VA 5INCB 4E41B 1NEUA 1YEEH 3NIGB 1TQUA 5EZLA 5BXFA 1Q0YH 2YGOA 3D18A 4K9EH 5EF3A 1C16B 1YEDA 2F8OA 3CFBB 1E7VA 5AAMC 2OXGB 1CK0L 1UD2A 4AH2A 5CSGA 5HD8C 2WTPA 5JDSA 2FUTA 2X4TB 3HI1B 3M8OL 5IKCB 4MWFB 1LEKB 2YK1L 4LCYB 3HMWH 3O2DH 3OPZL 5F1IA 1WC7B 2CRYA 2AAAA 3M7OA 4EN3C 1BVLA 2QBWA 1G7PB 2WSPA 1UJ3A 1NCIA 3IDUA 4H26A 4P4RB 3IDIB 4GXUM 4QXTB 3LS4L 1QYGH 2I24N 5F3HB 2PYEA 4ZDHB 1A6UL 1ROWA 5D1ZD 1CL7I 4OGZA 2E9BA 2VXTL 3T1FB 1KIQA 5J6SA 2W07A 4FQCH 4MD5A 2Z4TA 3MACL 1AS7A 3L48A 5CGMA 4JZJA 2CDFA 4U6XB 3HJ0A 2EILB 1YQVH 3FUJA 4MNGA 3D50A 2Y36H 3GMQB 4L4JA 5JLZB 4U1SA 2XZCH 1HQRB 1FVCB 1OIOA 4FFYA 4F7CA 3GTTA 5CJOH 1OLZA 3QG6B 5GJTL 1KENL 5L2JA 1TQVA 1EHXA 1TDQA 3QDJA 4P5KA 1ZLVH 1LWRA 4ZW8A 2IOOA 5IMLB 4JO1H 3C5SB 1PCXA 4HKXA 5CLYA 5D4HA 2BFVH 4NFCA 3RJQB 2AK4B 1WEJL 3HRPA 5GGVL 4ALAL 1QNZL 3DBXB 5IVXA 3L7EB 5FXCH 2YGPA 1DJGA 3DO4A 5I2IA 2F19H 3QRGH 3MR9B 3WNOA 2XHNA 3LRKA 1BQRA 3BRFA 4KX9A 5HYJD 3CUPB 2HG0A 1HNYA 3BCFA 2PXYB 2EIMB 1OP3H 3K6SB 5AKTA 3HNTL 3VFUB 3OAUH 1MY5A 1ZHKB 5JIKA 4U1GC 5DVNA 4E9QA 4GKLA 5C09B 2XKSA 1PAMA 3ULVC 3KPPA 4NRZB 2VOTA 1GZPA 4IHOB 2GVYA 1WFOA 1L3WA 1EAOA 4H5SB 5F7YC 1AGFB 5EHFA 1UGNA 3FYIB 1LO0H 5FWQA 1M4KA 2EDMA 3UTZB 3V8OA 1B88A 5HHVH 3SGKC 3ZDXE 2W8CA 2D2OA 4LCIH 3AQXA 1JUFA 1G7HA 3F7PC 3T2QA 2MOQA 2OMNA 5DJ2A 2VDKL 1A6PA 2H0PA 1XZWA 2IANA 2EE6A 4M4RA 4R7NA 1E5ZA 4ZMOA 2WO4A 2WCPA 5EORL 1E65A 4LVNC 1DHKA 4GW5B 4Y16D 5I8KL 1INEH 4ICWA 3UADA 2IH9A 4JR9H 4JFDE 4PJDA 4WJG3 3TCLA 3QIWC 4M5YL 4FNLL 4PGCB 4PS7A 4NP9A 4WU7A 3Q2WA 3GB7A 5J12C 1RUQH 3OJDB 4L3CA 2LOEA 3ZDYE 4Y5YA 1M3JA 4TUUA 4BINA 2A74C 4OKDA 1MDAA 1I1CA 1B9KA 5E2UH 3T04D 1YMHA 3B2VL 3KLDA 4YHZH 2WLLB 3FQNA 1XH3A 5JO5A 4FA8A 4UTBH 1A9BB 4YDLB 4OLZL 4A2GA 5BS0A 1GZQB 3BD5A 1PX4A 3V0EA 5DS8B 4D9LL 1N0LA 1YN6A 5CJXA 2DS4A 2VITB 1I1FB 5DLMH 1PZ2A 1A3RH 1KCRL 3MROB 5A2KH 2LGNA 4N20A 1S7XA 3MLUL 3RWJB 2VDML 1W8OA 4S1QL 3SGEH 3DA0A 5GHWH 5DEJA 3REWB 1YO4A 3PGFL 4KQ3L 4W6XB 1D6EA 1HZKA 1EAJA 3I02B 4Q56A 5AB0A