4YSTA

Structure of copper nitrite reductase from geobacillus thermodenitrificans - 24.9 mgy
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
294
structure length
294
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 96
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ystA00
2OCCB 2PPCA 1AZNA 4BK5C 2Q5BA 6PCYA 1PZAA 2Y69B 2YAEA 2YQBA 2FQFA 4DP7X 3EH4B 3EH3B 4QLWA 3WKQA 4A2DA 2WO2B 4YSUA 1EZLA 2I7SA 3N55A 2P80A 2VN3A 3ASNB 2PCYA 4HHGA 5EHFA 3FQ1A 1V55B 1L9QA 1OE3A 3QQXA 3PLYA 4BWTA 4E9YA 1RCYA 1E30A 1IBZA 3S3CB 3T6VA 2XX0A 3CG8A 2GHZA 6PAZA 1A4AA 1AAJA 2HRHA 4AZUA 1E65A 1J9SA 1XMEB 4BXVA 2H3XC 3UAAA 1N70A 2YARA 3X1BA 4X4KA 4G7SB 3ZX1A 4K9JA 3NT0A 2GB2A 4Q89A 3HB3B 3ABMB 2IDTA 3FYIB 2YAPA 2FQDA 2UXVA 1AR1B 3AZUA 4E9WA 4KO6A 1BQRA 5I5IA 4E9VA 2UX6A 3OMAB 3SBQA 2ZXWB 4MFHA 1HFUA 3WNJA 1WA1X 2WSDA 4PCYA 2IH9A 1RZPA 3ZIYA 2YAHA 3NJIA 3TA4D 3CVCA 4DP1X 1KCBA 1ZIAA 3QJVB 1PLBA 4A68A 3U25A 1SFDA 1JZFA 2GIMA 1ID2A 4YSOA 2W8CA 1XB8A 4YSAA 3EHBB 5FC9A 2J5WA 2HXAA 1MZZA 5ANHA 4UANA 1OCCB 1A3ZA 4HCFA 2BP8B 4YSCA 4M3HA 2ZOOA 3H4HA 1KDJA 3FSWA 1CC3A 1WS8A 4HALA 3N2JA 1SDDA 1E5ZA 3CVDA 4E9RA 4GY4A 2N0MA 1KV7A 2PPFA 3AG3B 1AS8A 4UAHA 5PAZA 3EH5B 3FU7A 4AKOA 2PPAA 3UACA 4DPAX 4GP4B 1J9RA 1ZIBA 4BXSV 1BAWA 1NIAA 5I26A 1BQ5A 3BVDB 2XX1A 3JT2A 3KW7A 3FU8A 5I5JA 1KCWA 2IWFA 1E5YA 4P5RA 4HHWA 5LDUA 1BYPA 4HCGA 2FTAA 4M4RB 2H47C 4P5SA 1AACA 3OQRA 1XB3A 2XV3A 4YSTA 3S3DB 1KBVA 4HAKA 2IAAC 2H5UA 3IN0A 2DY2A 1MZYA 4JHUA 5I5MA 2VW4A 3FQYA 3SBPA 2UXGA 2BP0B 3MBWB 1IBYA 4GP5B 1KYAA 3ABLB 2PLTA 3T9WA 1QLEB 2TSAA 1JXDA 5B1BB 2VSKB 1IC0A 2A3TA 2IDFA 1JVOA 3OD3A 1L9OA 2PCFA 3ZDWA 4AKPA 2FT8A 3S3BB 3G5WA 1NIFA 2EIKB 3OM3B 1JOIA 4HZ1A 4UF7C 5B3SB 1IKOP 1OE1A 2UXFA 1MDAA 5B1AB 1FA4A 3GYRA 2YAFA 5B1JC 1EHKB 5D4JA 2QT6A 1NTDA 4YSRA 1GW0A 2YXWA 3RYMA 3FS9A 3FSZA 1FWXA 2AFNA 1AS7A 2XU9A 3S8FB 2AZUA 4JHVA 4A2HA 1CUOA 4YSDA 4NERA 1YLBB 1AZUA 4E9SA 2YAMA 4A67A 3NP3A 1M57B 3SQRA 1WS7A 1R1CA 1SHWA 4A2EA 1OCZB 4E9XA 2I85A 1NIBA 3FSVA 3QJSB 1GS7A 3X1GA 2BWIA 2FNWA 1PAZA 3FPXA 1JZGA 3H4FA 1RKRA 4BWWA 4A2FA 1PZBA 2OV0A 1N68A 2R7EA 5I6MA 3ERXA 3WG7B 3AG2B 1ETJA 2DYRB 2QPDB 1ZV2A 2QDVA 1L9SA 1NPNA 7PCYA 1VLXA 5D4HA 3TBCA 4G71B 3WI9A 5I6KA 2BWDA 1L9TA 2Y1AA 4GP8B 5D4IA 2Q9OA 4KO9A 2X87A 3NSYA 1M9WA 2EIMB 5I6PA 3JTBA 3ABKB 5AFAA 2FJSA 2VW6A 1PLCA 2PP7A 1GY2A 3PPSA 3S8GB 4BWUA 2X88A 4JKNA 3H56A 2CAKA 1AIZA 1WA0X 3DKHA 4DP2X 3CZUB 3FQ2A 8PAZA 1SF5A 7PAZA 3DIVA 4F7KA 1NINA 5A7EA 4G7RB 2DWSA 4DP0X 2HX9A 2DYSB 4AI7A 1ILUA 4Q8BA 4AX3A 3V9CA 1ET8A 1AOZA 5IY5B 1NIDA 5AKRA 4ZK8A 2QDWA 1F56A 4KOBA 2DWTA 1SJMA 2EINB 3NSDA 5B1JA 3GDCA 3NJJA 1WA2X 2W88A 2ZWNA 2DV6A 2E86A 3NP4A 1J5DA 2BZCA 3CDZA 4KO5A 2B3IA 2J55A 1AANA 1ET5A 1PMYA 2EIJB 1BEXA 2HRGA 1UATA 3EF4A 1MG3C 2FWLB 4G72B 3FU9A 2JKWA 1MG2C 1BXUA 1PNCA 1B3IA 1JVLA 1NWPA 4F2EA 2HX7A 1TKWA 1TEFA 5F7BA 4GXFA 1BQKA 4WKXA 4AKQA 1W6LA 4EF3A 4FA7B 4YSQA 1JZIA 3IE9A 1M56B 2AZAA 1KBWA 2HX8A 3QJRB 3QJTB 1AZCA 1IUZA 2BW4A 2MTAA 3X2QB 1JZHA 3AW5A 2XXFA 1BXVA 5AZUA 1ADWA 1GS8A 1ZDSA 4E9QA 2MRYA 1OV8A 4NB7A 2XV2A 2PPDA 3MX0B 3AG4B 4HIPA 1AG6A 2RACA 4G70B 4KNTA 4YVUA 3NSCA 1NPJA 5TK2A 1DYZA 4BDVB 1KDIA 1AQ8A 4NAJA 3QJQB 1A4CA 1NDTA 2BP8A 3PCYA 5I6LA 1W8EA 1KGYE 3X1EA 4A2GA 4DP4X 5B7EA 1A4BA 2XYBA 5B1KA 4CSPA 1TU2A 2HLEB 1J9TA 3ZBMA 1SF3A 1PY0A 1T5KA 1V10A 3SBRA 2B08A 4QKTA 1OOWA 2BO0A 4DPBX 1I53A 2JFCA 3C75A 3UAEA 1JXFA 3T6WA 2VW7A 2CJ3A 3NJNA 4KO7A 1AZBA 2ZONA 1SFHA 9PCYA 1PCSA 2NRDA 1HAWA 2IDUA 1PZCA 3WNIA 2FT7A 1QHQA 3T71A 4DP5X 1X9RA 3QPKA 4RH4A 3IBOA 2XUWA 3IEAA 3NYKA 2YAOA 2AVFA 2PP8A 2XXGA 1J5CA 2TSBA 3PAUA 4GYBA 2VM4A 3NJLA 3ABGA 1NIEA 1PLAA 1X9UA 1QNIA 1ASPA 1BXAA 2HZHA 1SHXA 3FPYA 2VMJA 1CYXA 1XB6A 1JERA 3TBBA 3PXLA 2BW5A 2BP0A 3CDZB 4W9ZA 4L0PB 1ET7A 3BQVA 4A66A 1DZ0A 3UADA 1JZJA 2J56A 2YXVA 2GSMB 1NWOA 4KOCA 1A8ZA 2EILB 3NJFA 2UXTA 1PNDA 2BHFA 3NJHA 2AANA 2IDSA 1FFTB 2LLNA 4HCIA 5B7MA 3T6XA 1OCOB 4YSSA 2IWEA 2XVBA 3DTUB 2I7OA 3L45A 5TK4A 1W6WA 1PF3A 5E9NA 3ASOB 1AZRA 4DP8X 4TXVB 2R7EB 1CYWA 3QJUB 4WTQA 1L9RA 3FU7B 4PAZA 2VM3A 2J57A 2GC4C 4ENZA 4F2FA 3PAVA 2FQGA 3D12B 2XWZA 3NJGA 3X1FA 1ZDQA 1OE2A 1L9PA 3FSAA 2GBAA 4YSEA 3PAZA 3T6ZA 2QPEB 1AS6A 1WAEA 1GSKA 3OMIB 1GYCA 2PP9A 4DP9X 1OCRB 2IWKA 3AY2A 5I28A 1ILSA 4E9TA 3V9EA 3TASA 1SNRA 2XLLA 3TU6A 4BDVA 2FT6A 4YVNA 4G7QB 3NJMA 3WIAA 2GI0A 1TEGA 2CALA 4YSPA 3UABA 2XV0A 1GY1A 1OF0A 1GS6X 5PCYA 4N4YB 1JZEA 2IDQA 2CBPA 4KNUA 2CCWA 1URIA 5I6NA 1CURA 1SDDB 3X1NA 1V54B 3AG1B 3NJKA 1RZQA 2OJ1A 1BYOA 3GXUB 3FT0A 3NSFA 3OMNB 1ASQA 4N8UA 4CSZA 2PPEA 3CVBA 1ASOA 2VSMB 1AG0A 1NICA 1NZRA 2BZ7A 4DPCX 3FYEB 4DP6X 5I6OA 1A65A 5F7AA 2CUAA 3HEIB 1JXGA 1ZPUA 2FQEA 1HAUA 5B7FA 1J9QA 2GC7C 3WKPA 4FAAB 4W1TA 2IH8A 2JXMA 3KW8A 1E67A 1GR7A 2YAQA 2UX7A 4YL4A 3IN2A 2P80D 4KNSA 2WO3B 3UGEA
chains in the Genus database with same CATH superfamily
5EH1A 1A22B 1EAPA 2VZSA 3WTTA 3SO5A 1XCQB 4MNHA 1N8ZA 5BXFB 5JPNB 4NC1E 5DVOA 4EDWL 1JGEA 4FFZH 4XPHH 3U6RB 3MV7E 5FM5M 1OQXA 5LKNA 1IT9L 3TO4C 4GIOA 2Z91B 2YZ8A 3N55A 2F1EA 4MXQC 1D5BB 2V8LA 4PV8B 1LO0L 3HRZA 2K70A 5DD3L 5BRQA 4OAWB 1SXCA 1Y07A 4GPVA 4JFYA 25C8H 2WLLA 5JHDD 3OJVC 3ELAT 3DX7A 3T6VA 3AJ7A 5AB1A 2QV4A 3C09B 2HTKD 4J4PC 4N1EA 3BT2L 2BP5M 2CRMA 2VZTA 5C92A 2ICWB 4MDJA 1Q9OA 1NCOA 2ZXGA 2H3XC 3JVFC 4XMWA 3ZRFC 5ALCL 5I24A 4URKA 4ANKA 1D2OA 3FDWA 3BD5A 5D70H 4OLXH 3WJLA 4ZAKC 4FTVA 2FQDA 4FFTA 2F53A 1CD1A 4HWZA 1K3ZA 2UX6A 3OMAB 5D7IB 3V4PA 5I76B 2F54E 2Z8WC 2VN7A 3MGAA 2NY7L 3I74A 1FFNB 5E6YA 4HA1A 1G9MH 4R4NC 1IGCH 1OCWL 1R3IL 1LO5B 3GZPA 3V10A 5JOPE 1RK7A 1BA9A 2OW6A 1GIGL 2LAGB 4I18C 4M93B 1GTNA 2UVEA 3NBNA 3L4WA 4R7LA 5JIDA 3FFCA 3U25A 4Z3GA 3TH2T 4N2CA 4YO0B 3RRQA 2X9ZA 1YQVH 3QZBA 2RQEA 3VX1A 5JW3L 3OX8A 4JG1H 3B9DA 2ITCA 4ZUSA 3V5DB 5B21A 2HPTA 3NCXA 5DZLA 5D8JH 1TR7A 4XCYA 4E41A 4XPFH 4UQDA 5BRPA 4XB3A 4ICXA 1AO7A 4NSKB 2WOBA 3FSWA 3MDJA 5D9SA 1RZIA 1XGTA 1MI5B 1H9DA 4EPSA 1KV7A 4F8QA 1IAOB 1KT2A 1DDTA 3BWAB 3MXVL 5F9AC 5C07D 3P40A 4DPAX 1ZIBA 3TTYA 1A6TB 2ZG1A 1EK3A 1DJXA 2GW5A 3PABB 4I3RL 2A9NL 4GXUM 1I1AA 4F37K 2R2EB 1DN2A 1MAKA 4X7FC 4K7PX 4DHLA 3C6SA 5FECB 2BIQA 1G7PA 1G9MC 1KG0A 1QNZL 3TT1H 4G6AD 4ZUWA 5IZ7A 2I32A 1VKXB 2VDKH 3LNHA 4Y2DB 1JZ8A 3ISRA 4AGPA 4DAGH 4F57H 4KK5C 1A7RH 5JIMA 4PTTB 2HKHH 3KHQA 5EBWA 1SJXA 3G08A 1UM5H 4LOFA 2FWUA 4HK0A 1IC0A 4XPAL 2J1XA 5IT2L 5B38G 4I0PB 3NEEA 2D3NA 1A0QL 2Y7MA 1ORQB 1S7UB 3Q8EA 4KH9A 1E6JL 4GBXA 4U3SB 3WXVH 5B3SB 1DANU 1JXJA 1BJ8A 3FO0L 3WHE1 4TTDC 5IKCB 4AMXA 2PYED 2J8UA 3LPWA 4FXTA 4LESA 4MS6A 3W0WD 3O3DA 5E23A 4FA6A 5C0EA 1HIMH 2IBZX 1KXVC 2O72A 3D2UD 4GQ9L 5D4JA 3WELA 4F58L 4F7TA 4TPRH 3GKWL 4XN1A 2MSPA 2VDRB 1FZKB 4KHXH 4JL2A 1J12A 1O7SA 2ZXAA 4XCNA 3GSOB 3VXMA 1EDQA 4EKXA 1C8PA 1S6NA 2V3FA 2XU9A 3O0RH 3U4EB 2Z31A 2H4EA 2MHAA 2YPVA 4R26H 4X4YA 3VGEA 5DVNA 3NZHH 1BD2D 4NERA 4AQ1B 4X98A 5E2TH 1A3RL 1BW8A 2VL5B 2DQCL 1QTPA 1BFSA 4WI0B 3QZWB 3BPLB 7TAAA 1G84A 3P3UA 5ADOL 2QQQA 3S37X 2FD6H 3LSOA 3TEZA 4EVNB 4C56B 3FMGH 2NY0C 3PIQA 4JR9L 1ACYL 2QQNL 2OULB 4UIKH 5CP7B 2ZJSL 4N90D 4QI3A 4D9QE 3H8NA 2R69H 3LNFA 3S3JA 2XN1A 1OK0A 2FIKA 5CLTA 3TBCA 1AGBB 1J9CT 3HN3A 1R3HB 3KVQA 4QRRB 1GYVA 1P7KB 1I8KB 4NCC2 3B1TA 4B7IA 5EZLB 1YMMA 1OF2B 3ABKB 3B4NA 3RE0A 4FGMA 4F7EA 4YUEL 4Y0GA 2ICWJ 2EVGA 3WY3A 1MCEA 1T21B 3L81A 4IDLA 2VZUA 4FXKC 4KDWA 5TDPB 4AK1A 2WLZA 4QHLB 5MEQA 2OP4L 2JK5A 2X38A 1JYVA 1OXYA 4FE9A 4ECNA 1Z5LA 2X88A 1FE8H 1FIGL 3QIBD 4Z7WA 3VI3B 4X4ME 1AIZA 2AK1L 1U3YA 2F53E 1JGVH 3HNTL 1NBZA 3KYOB 3PY9A 3C6LC 3CHPA 1RUKH 2M2DA 1NINA 3HUJF 1N6VA 3QUMH 4PGDA 3D4ZA 5CEXA 3QIBC 1TFHA 4MB3A 1MFBH 3TJHD 5J1AB 3VWJC 1SJEA 1CR9H 2APFA 2LU4A 5EA0L 4I0KA 1X5XA 1SJMA 3L3IB 1BIIA 3NSDA 4GEIA 4IJ3B 2PCFB 4UYPA 4XCCH 2XWTB 1DCLA 3VJ6B 2BFVH 3QEUB 4L4TE 4HU2A 4KO5A 3CDZA 4Z0XA 4I77L 1ET5A 4CGUB 3DSFL 4P57A 1PYWA 2WV3A 4XNQA 5SWSA 1TYEB 3ECWA 4I1NB 4KKLD 4KGLA 5C0RH 4FMKA 3VFTA 5LXVA 5IB5B 2Y2WA 4ZX5A 5KVFH 1UD5A 5KBKA 1H3XA 2J4WH 3WCYA 1FIEA 3FCSA 1A6AA 1BQKA 3E1ZA 3ECUA 4X5WB 3V7AG 6FABH 2VAAA 1VF5C 1E8ZA 4FDWA 5IW1B 3JWOH 1M56B 4KJWD 3UAJD 3NK3A 5TJWK 3CHQA 4MJHA 4XCFH 2W0FB 5F71A 1XBRA 1YPZA 5LGJA 1CVSC 1PL3A 3LDBC 5AW4B 3SE9H 3T2LA 4ZUUA 3EDDA 4YHKH 1GXEA 2B20A 2DEWX 2DQEL 2XKNB 1UFUA 1AHKA 4G6KL 3T65B 5I5RA 4PY7B 2Q86B 1ZVYA 1NAMB 4HIJB 4Y5XA 4KI5D 4JFTA 5K9JL 4PR5B 4H2AA 4JGMA 1A4CA 1ML0A 5IUSA 2XBZA 5E8OA 1MHPL 1H8LA 4IOIB 1JF5A 1NMAH 1IM3D 4LASH 3U0PA 3NFPB 3ZGHA 2ZUVA 2WAQA 1KEML 3N41F 4JEGB 1Y18B 2YPLA 4HS8H 2VLRE 4R26L 5K9QG 4N8VB 1MAMH 2HLEB 4MXWH 2NY3C 3IFOB 5DT1L 5IW3A 1F4YL 5I18L 1P7QD 4M93C 4Y5YC 1U58A 3B37A 3J7HA 5DJXA 3SKMA 4NKMA 4G83A 3PQYD 2VB5A 2WXMA 3U7WL 3FTVA 4JHWH 2NX5A 4JO8A 5SWZD 1AQHA 5BO1L 2EQDA 1P84J 1YJDH 2A6DB 1E42A 4P07A 1LNUA 4DESA 1EVTC 3ME0B 5LGJB 2E7BA 4XGZA 1MJJB 1YPZB 1PCSA 2MCPL 5TPWH 2EVIA 2I5YH 4G9DA 4MD5B 1QFUH 2BERA 3RVTD 1F6AA 4BZ2L 4JRYB 1X9RA 4M7LL 5E94B 4TQPA 3Q2WA 4AXWB 1DBBH 3C12A 4EBQL 3FCTB 2BOLA 2OZ4L 1Y0LA 1QW9A 2VCOA 5GRYA 5I8KL 4YMPA 4C54A 5KSBF 3VD0A 3JTSB 3NZ8B 3MJ8B 2J8UF 3NYKA 3L3OB 2YD0A 3OGCB 4GAAA 4N5EC 5GSRA 3PAUA 2FE0A 1I7UB 4TSCH 2E0PA 5F8QC 1X9UA 1P53A 3TBYB 1ASPA 1FC1A 1HH9A 5LGYA 2X3CA 1L5GB 4OCRL 5EDXA 3IXTB 3G6DH 4XMLL 4K8RL 4AIOA 3E8UH 4HH9A 3FUDA 4LSDA 4K15A 3P11H 3BQVA 5MI0B 4A66A 2NSQA 2XG4A 5T1KA 3WE6B 2O30A 4LQFL 3W5NA 5I1GL 3IJ7A 1C16B 2DJMA 3G7TA 5E8EA 2DQFA 4IKKA 2VMCA 5DD6B 2VXVH 2P52A 3O6LH 3T8XB 4NNPL 1TVBA 3N1FC 3B3BA 4MCYB 1E43A 4ENED 1AKPA 2MOQA 2YFOA 5CLWA 4Y5VB 3FCBA 2LU7A 3FCUB 1D5XB 3VA2C 2ZX8A 3ZE0E 2CNZA 1DBJL 4L4VB 2R4SL 4IK7A 2OAAA 2G30A 5LCVA 2GABA 3RL1A 1MHHA 5DRWB 3GK8H 4JZJB 3QRBA 4OCRH 2OMUB 3CH1A 3QRLA 1O9VA 1OO2A 2VKXA 2EXSA 1M7XA 5C2BL 3CIAA 3E6HB 2JJUA 1P2CA 3SE8H 1T04B 4MB5A 1F97A 2W38A 3WMQA 3UAJA 2Q3XA 5E6UB 4IHOA 5T5FA 3L16A 2AQ2A 4FC3E 4OCXL 1SXBA 1K8DA 3BVNB 2NY3D 5FYLH 3QE5A 5GGUA 2XNAB 3TASA 2VQTA 3P4NB 1VJSA 2QR0A 4KKZA 2NXYC 1YY8A 1OHZA 1IGFL 5H37H 1D9KA 5FV1L 3BD3A 4QXGL 3H9ZA 5CD3A 3EBIA 1AD0A 1NMBH 4X5LA 1SDDB 4WSGA 4OGQC 1M6OB 3GS4A 4UIMB 1V8HA 4R83A 4U6YB 1L7IL 4NGHH 5CSBA 4QXVA 5GRUL 3FT0A 3MKGA 1PKQA 5FA3A 1U8MB 5TFSL 4DTGL 1MEXH 3FRUA 4MHHG 3KDMB 2VSMB 1HCYA 4IGBC 3QNZB 4TNGA 1K5NB 1I9RH 4JPWL 4KK9C 4QMEA 1FZKA 4TLKA 4I13B 1OPGH 2DQUL 2XWXA 3TYGL 4CC1A 3O6KH 3AY4A 4V1DA 2GHWB 3F64A 4ELMB 4H8UA 4JM2B 1U42A 4TNVK 2FX8L 2KUTA 1DSFH 4PJIE 3L3HB 4PP1C 4LDOB 2IOIA 2PPCA 1EJOH 3FAWA 5DC4B 4PJGF 2I27N 4W9LC 2QBWA 2EIDA 4DVRL 3FZUD 3D69A 4XP5H 3TWCH 1PKOA 4N0FB 4FQHB 12E8H 3THMH 1VZHA 4M43H 5DUJA 4N2KA 4IK6A 5EBWB 1DBAH 3JYBA 5AVVB 2WXNA 3VWJB 1DQIA 3FQ1A 3ZE1E 1FN4A 3HC0A 5CSZA 3CDYA 5D6DA 4OD1H 2GCYA 3CU7A 3F5WB 1XGQA 2DDQH 5D96C 3QQNA 3Q5OA 1KEGL 2BZDA 2V7NB 3GBDA 4PJ5A 2P5ED 3ZXAC 2G60L 1E65A 2COVD 1XMEB 1KTDA 5DO8A 4WEMB 1IQWL 1U2HA 3FC8A 3H9SE 3ESMA 4P48A 3EYQD 1A6TA 5KYNA 3FYIB 4P2RE 2O6FA 4LCWB 4AQAB 3DJRA 4UNUA 4MXWL 5DEFB 5DT1H 1KCKA 4RMUA 1TLKA 4LLYB 4JJOA 2A9MH 3FW6A 2CXKA 2K7PA 2Z31D 4G42A 4PJXA 4FABL 4FQ2L 1W91A 2DTSA 4QHKJ 5MHSE 4DGIH 4YDKL 3NJIA 4POZD 3UERA 3PL6B 5AD0B 2VGLM 3LDBB 5KAQG 1A7OH 1P7QA 3H6JA 4OT1L 2EE2A 4OD1L 3LKNA 4UTBL 5BPPA 5E4IA 5KYUB 5JA9A 4YDJA 1PLGH 1OT4A 3FFCB 1OTSC 2E4FA 1T4KA 5I19H 1TENA 5DDHB 3TVMC 1MZZA 4MA3B 4PGCA 4POYA 5LXGH 1WUZA 1XGQB 3QUMA 4XI5C 1HHHB 4PREB 2RB8A 2JI2A 4PYHA 1CL7L 3BP5B 3DVFA 5DUMH 4JMNA 1NKGA 5GRVL 3UO8B 5C0NC 3QO0A 1DZBA 4I77H 3AG3B 3SKUD 4HEPG 4OJEH 1DQMH 4PJDA 4P4KA 3U4KA 4AMKH 1BZ7A 1FZJB 1YPZF 2H1XA 4OD2B 3H3KA 2HFEA 2Q8BL 3K81A 4LCCC 4CILA 4WUUA 4H88H 3HBZA 1BYPA 4NQTA 4ELMA 2XOTA 3AAZB 5CKGA 5FDYA 1JZ7A 2DQFB 3B3IB 5HGBA 5L88H 3CCHA 4JFXA 5D7IE 5DLLA 1IIKA 4R0LC 3O11B 3UXFA 4NJAH 1KJVB 1T83A 4NKOA 1SM3L 1MRDL 4JCMA 2E56A 2ZX7A 1NEZA 3QNZA 1KYAA 5AWNH 5IVXE 3CUPA 4FTDA 3L3OC 4JDEB 4Z5RA 3QI9B 5B1BB 4JQXC 4J39A 5ESAB 3ZY7A 1JVOA 1RY7B 3DX8A 4PJ7A 4S1QL 3VXSB 3S3BB 3BUQA 3E8UL 4XNYL 1S7VA 4I3SH 3V4UH 1UH4A 3ECBA 5IW6A 3LZOA 2Q0ZX 1DQDH 2NT0A 2X4PA 2N7SA 3QEGL 1NSNL 2D9CA 2GITA 3RWIA 1RUPL 4L8SC 3IXAA 3UTPE 5EU7E 4Y88A 5I66A 4BH8A 5EEXA 4PVMA 4AJVA 2CO6B 2QZ5A 4H1LG 4OZIA 1LNUB 4K71B 2WMPB 2A6DA 1V5JA 2XA8L 2AS5M 5HSFA 4A2HA 1QI5A 4IHOB 1UOVA 2EXWC 5DRXB 4ANVA 3FJTA 4Z7QF 2EO9A 4I8DA 3LD8B 4IKJA 4W81A 4Y5VC 3T77B 5JR1L 1JHTA 3NCMA 3GLDA 3Q43A 1CDHA 1SHWA 3V2AR 5K9QI 4UILL 1KBGH 2JKXA 3T0BA 4E9XA 3EGXA 2H2SD 1GS7A 4OJFH 2OI9B 1XAKA 4ONHA 4X6DA 3V0JA 1TZGL 4JZJC 5C08E 5F6IB 1RKRA 4KUCF 1QTYT 1WFOA 2Y07L 4WEEA 4HUXA 4I88A 3UTPD 4EMZA 4ZMZA 1J8HD 1Q9LA 3X11B 2XWJA 2X28A 1ZTMA 1R5WA 1UFGA 3BX7C 1HI6B 1SHSA 1ZK9A 1A6ZA 4OIBA 1OLLA 2VC2H 1JJUA 3U7YL 1PQZB 2UY7B 3DHMA 3DXAB 3HR5A 4NQCB 1FNGA 1Q9LB 5SWSE 3CDGB 2Z92A 1FZMA 2OYMA 4IOSA 1YNKL 3WL9A 4ACPA 1B3JA 2X87A 4M29A 4UZUA 2EIMB 5B3JF 1CGUA 4J4PA 1SJHB 4P4RA 2VXQH 2BOBB 3D08A 1YECH 3T4YA 5CKAA 4HH9B 5FYJU 4LF3A 4BQBA 4RWHA 3IMWA 1CE1H 3BZEB 2BNRE 4LAQL 2IFGA 2OR9H 3FUEA 1T2JA 3F00A 4XZ4A 4YHMH 3ZO0A 1L4IA 1LJMA 5KTEL 1FFRA 4MMZC 3DV6A 3DIVA 1A3QA 3FOMA 4TV3A 2D7MA 3Q2LA 4QCIA 1HDMB 1KTCA 3G5XA 3KWWB 1UUNA 3PNWA 5HGAB 3V9CA 2YUVA 2WLIB 3A21A 4PLJC 2BVTA 1KCUH 4N2OA 1KPRB 1PFCA 2WXOA 1YEWA 1JGDB 1S7TA 5DYOB 2EINB 1MJJA 2NTFA 1KBBA 5F0MB 2N01B 3QARA 5HHXL 5C2BH 2F5BL 3DX8B 2NY1D 3Q0HA 4DGUA 3TT1L 3ZN6A 5DJ8B 3IETB 4OLWH 5J1AA 2B3IA 2QFRA 5IB2A 1BEXA 1LO4H 5LQBL 1BQHA 2O4EA 2ZOKB 3KPPB 5AOKA 3FT1A 3OZ9H 2YFNA 4NNYA 3V4PH 5DJCB 3RB5A 4E68A 4YZFE 2EDEA 5SX4I 1MG2C 4LSQL 2YC1A 2HJFA 2XQBH 5LBSL 3VAEA 2R9HC 2ISDA 5JW3H 4X0NA 5G4MA 5G2NA 1HH6B 3UJJL 3TIDA 4HS6B 1HXMA 3X13A 1CQKA 4PRIE 2DD8H 3L7FB 1F5WA 5D96B 1ZVHA 3ZKXC 4CJ1A 2HFEB 1G7LB 1HIML 4ZODA 3EZ8A 1ZT7A 6TAAA 3BFQG 4WRLA 3VXTA 3G04A 4HKXB 2JLPA 3M46A 4PG2A 4LLQB 2ZXQA 2FHBA 2QQLH 1N10A 3FRPG 4EN3D 2BSCA 1T66D 4Q6IB 4HUNB 3JWNH 1GMIA 1RPKA 4NAJA 5B22A 1VENA 3QUMB 5IW1A 4PGCB 2HH0L 4X7TA 3QCVL 4DP4X 1T4KB 5K5YA 3CHRA 1TU2A 2UZXB 2YD4A 3CN0A 2O5NA 2TRHA 2IV9A 4PGJA 1UZGA 3ARRA 3ENEA 4AUYA 1P7QB 3CNKA 2XN9E 5EUKA 1HINL 1BAFH 1K6QL 1CGTA 3RGVD 4OLXL 3K4AA 1GGYA 4LK4A 3UAEA 5JW5B 2R0KH 3UZQA 4Z0XB 4U6VL 5JA8B 1JD9A 1CDBA 4YDIH 4LHUG 3U2SB 4GUQA 2Y9RT 3TFBA 1AZBA 5I1KH 1MHPH 1U9KA 1MLBA 1KCLA 9PCYA 3V0EA 2R2HA 5GZNC 1NCHA 4LPUA 1KN2H 1HILB 2GJZB 2VLJB 4B9YA 2IAMB 4BZ2A 3O3DB 3T0ED 5C0EB 1F4YH 1X9QA 3IGAA 1UWGL 2F58L 3ES6B 2C1PB 3WDHA 1DJSA 4J12A 3GSQB 4MA7L 4PGDB 3BGMA 1SUHA 3OKDB 2O5ZH 3MUGB 1BEYH 2NY4D 4YQXH 1UYWL 5C08B 4I0PA 4M8VA 1QNIA 1BXAA 5C0CA 4D9LL 3EADA 5DI8A 5AYUL 1YUHB 4OF6A 4PUBL 5E56A 4AOFA 1EV2E 4EZMA 3K6SB 4Q0XL 5D2LE 1VPOL 1Z32X 1BOGA 3LY6A 3I75B 3KR3H 4QD2E 5B39A 1JK8A 1RP8A 5FGCB 5HVGB 3ESNA 4R0LB 4Q4EA 3QDMD 4YHML 1QMUA 1E6OL 1P7KA 1XSKA 4OCLC 4YDVA 2IPKA 5I8KH 3L3JA 1S4IA 1R33A 2AVGA 2FBJL 1AJ7L 1XCTB 1FAKT 2N1KA 3TO4A 4F8NA 2AGJL 1IKFL 3GNML 1V27A 2IWEA 5E9NA 1NCCL 2UZYB 4HEMA 1DANT 3QQ4B 4JB9H 4HXBH 1WBZB 1AZRA 4DP8X 4YXKH 1WTGT 4TXVB 5AVXB 3CZNA 1D5ZA 2YPKB 3D0LB 3FAXA 5D2NB 4S1RH 2D7TH 4XNDA 1RJZA 2J57A 4QHMA 3CXHK 4LGSB 4O2FA 1J87A 1Q94B 2MPVA 3GLEA 4WENB 2YEVB 4NSKA 3BWUF 3DLQR 3MUJA 1RZ7L 5DEZA 3AT8A 1ZDQA 3FK3A 4JFEE 4O5LL 3QQ3B 4Y89A 4E36A 1MNNA 4UUJA 1PDKA 1AS6A 3EOBA 1RI8A 4IU3B 5E8DL 1IL1A 2AAVA 4HUKB 3AY2A 2W65A 3QGVA 1O7DC 1ZT4B 2VQ4A 3G9VA 3VYPA 2JIXB 3BUPA 1G7IB 2Y5QA 4OGAD 3HHSB 4X6CA 3CFUA 1WJ3A 4KMTL 5ITBH 3QUXB 3SDYL 3VGDA 4CVXB 5AAWA 3GC3A 4G9FA 1OF0A 1PU0A 3KVDD 1UKQA 2FJHB 5IV2A 1FCGA 2Y36H 4F7CB 1BM3H 4PJHE 3IPFA 4M1GH 3EDJA 4LGPB 1G1CA 5F88B 1JNHB 3GBMH 1I7TA 5HYSA 2BK8A 3HZVB 5AAMA 5EC1B 2F53B 1UD3A 4HWZB 5GS0D 4WV1A 2YMOA 1FRGH 1G7HA 3E6FA 1R19A 2WPGA 1OWRM 4AGQA 1CXLA 1KPVA 2VWEE 2CU9A 1PG7L 3E9TA 4R7DB 4OGZA 4QJ4B 3W2DL 4FAAB 3KCPA 1SJVA 5MERB 4ZUWB 2JB5H 3VG9C 2X6MA 3MLWL 4GBXC 4GQQA 1HYRC 2YAQA 1S9VB 4Y9GA 3P2BA 4CMMA 2R29L 5EZIH 2BCMA 4OV5A 3F2LA 2ZUTA 2E7DA 1XF4B 3O2VH 4Q6YA 4MMZB 4P2QB 4OIFA 3UOAB 4A2DA 1FYTD 4MB1A 1KT2B 3M1OA 3MRKB 1OSEA 1WFIA 3QT2A 4JDTL 2QGDA 2XG4B 4EUPH 3O3BB 1GGBH 1MI5A 2FH8A 4ZFQA 2P80A 2ZKWA 4ODHH 1E2ZA 4XVSH 4QRBA 2D4DA 4JRFA 3C60C 1L9QA 1YEJL 3BZFA 1E28B 4E5XA 5DD1L 4F91B 2ZAIA 3H3PH 3SGJA 3MZGB 3CZLA 1KN4L 3B5GA 2BSSB 5E00B 5DWUL 5I8EB 3PHSA 2VJXA 3CFBB 4M02A 4QDGA 5C0FB 4K7FB 3ULUF 4TUKL 4NKIH 3KPSB 2SEBA 2MOVA 5IFJA 1R47A 3ARYA 2R15A 4JUSA 2GB2A 4FG2A 3ZL1A 1ZTXE 4C56D 2NY5L 3THML 4Z8FL 3W81A 1UGKA 1TCRA 2WC7A 4X9HA 4OZFA 3MPCA 1PW3A 1A7NL 3OPUA 3FRPB 3O4LA 4JS7A 3NGBC 5CEZH 1BLNA 4R2GC 1FFNA 4Y2OA 2FBJH 2IH9A 2YRZA 2WXHA 3D3VB 5F7NC 5D7IA 3V4PB 2MIZA 3QHZH 2H45A 2LQRA 4WW2F 1T1XA 1OAJA 5E9DE 1PZ5B 4Z7UF 4EUPG 4JKPH 2BLFA 5C0GB 4DVBB 2CXGA 3VFRA 2H7WA 2R4RL 2HKAA 2HRPH 2XC8A 5D2LB 1P69B 3NABL 3QH3A 3RGBA 3VMNA 5KZCD 5T1DH 4QRQB 1JXKA 3HOGA 4FKHA 1OVZA 2A6JA 2EABA 4JFUA 3BN9C 1L0YA 1BZ9A 5FGSA 1A3ZA 1M6UA 5IBUB 1RUKL 2OMVB 4BZ1L 4Z7VE 1A3RH 1OSYA 4L1DA 3KG5A 4HKBA 4BFIB 4J28A 3NTCH 2W9EH 5D93C 5SV3A 4DGIL 4PY7A 1F3JB 1MH5A 1P5VA 1V7NH 2B1AH 3AQZA 5E2WH 3QUHA 3GRGA 1AS8A 1J5OH 3CJJA 2AXHA 5IQ7L 4AKOA 1BCIA 2OTUA 1FGVH 3WIHH 4GP4B 1QI3A 4XPFL 5C0BA 5C0GA 2RTTA 5CHNB 3O3AB 2DQDH 3WYRA 2XA3A 5A3IC 5CN2A 2IQ9H 3EJSA 1C08B 3F8UB 2YMXL 1VFUA 1VCAA 3MI6A 1T3FA 1EGJL 3WNLA 2C8NA 4P2RB 2FTAA 2E7MA 1QYGH 1XB3A 4LNVA 2QHRL 4X8JB 3DOIA 2AJ3A 1JV5A 1D2PA 4RFEB 2D7PA 5DJ6A 1TCMA 2IO5A 3ZTJH 4MQ7A 1MJUH 4U3CA 4DSYA 5IQLA 3D7PA 4Y4KA 3U9UB 1ZEAH 4G6JH 4L37A 3MJ9A 4HULB 4KZDH 3KYAA 1CLVA 3OBAA 3SDDD 5HYSG 2TSAA 3PUCA 1P5UA 2P28B 5JHDE 1KYUA 2VO8A 3VCLB 3VFSA 2GG1A 2HFTA 2XN9D 4XWOD 2ZYSA 2PR4H 2AP2A 3EJQA 3VFMB 3AS3A 4Y19B 1U3JA 3BZFB 4IRZH 4LLAA 2IOOA 4D9QD 3CVHA 1OE1A 2A99A 3LZFH 3GYRA 4YDLC 1T22A 1QOKA 1XH0A 2XWDA 3NN8B 3FULA 5B1JC 1EHKB 2VDKB 3A6BH 3VTAA 4W9DC 4GXVL 5F7UA 4Q14A 2OTUB 5T3XL 4HOXA 2A4CA 4MMZA 4BFJA 1KNOA 1SOKA 1CT8A 3V6FB 2DAVA 1HQ4B 2H0JA 3HAEG 4HJ0D 2HTLD 4AYBA 3KWVA 3SE3A 1JPEA 3LCYA 2X09A 5G5DA 1CXHA 1CFSB 2YAMA 3ARFC 4WFHD 1GA2A 3WFDL 1MEXL 1QQDA 2JI3A 2J1YA 1FVDA 3WY1A 1QVOB 1R1CA 5MERA 1EUTA 3IVKA 3T0EB 2OMTA 5D2NC 1XD0A 4R7DA 3C87A 4NQCD 3ARSA 1X5AA 4RDQF 2ZUUA 5CN1A 3A4EA 4K7PL 3BLKA 4X6CF 1AGBA 3KS0J 3ZJAA 3NRQA 5TQ2H 1JAEA 4WY7H 2VXSH 1YO4A 3GBNL 4KRPB 1T1XB 2K9FB 1ETJA 4WF7A 4R3SA 4HK3N 5AB2A 3EAKA 7PCYA 1E40A 1ZGLM 4EVNA 2EE0A 2CD0A 5FHBL 1UM4L 2A1WL 2HJLB 5B38A 3MR9A 5DQ9B 2E59A 1OAYL 5C07E 3IDNB 5EG6C 5E1GA 3CVHL 4Z7NE 2FCBA 4XXDB 3VRLE 3OC8A 3VACA 1FCCA 2HYMA 5C7ZA 3RVXC 3RWEB 2V0AA 4RGNB 5AOIA 2BVOA 4G8FA 3MLPA 2ZF8A 2IPTL 5DA0B 3D9AL 1KLFA 1OWWA 3ZSSA 4NN5C 3T2NL 1IB5A 1V05A 4YLQT 3QQ3A 3BAYA 4EI5A 4U1SA 4S1QH 4BZ1H 3QZMA 4E5XB 4N0YL 4L4VD 1OAQL 4XNUH 3KPRD 2B8OT 2DIAA 1F4WH 1YNKH 2JWYA 5AVSB 1G0XA 1UZ6E 2NXZB 3IJEB 4GG8B 4JM0A 5DZPA 1PGRB 3HG1E 4RNRA 4QHMB 4DK3A 2BSTA 4XZUB 3H3BC 1R3JA 2OJEA 3MNZB 3QZLA 3IF1B 4LEOA 4MVBC 4AVIA 4UTBA 1NC4D 3BIKB 5JHLL 1F56A 4KXAA 3UBGA 1DQLL 1CDGA 4GBXB 4M62H 4DKTA 1DHKA 3OLEA 3V0AC 5L4MA 1KCSH 2PWHA 4TOYL 1MFCL 2DV6A 3UIZA 5DEGA 3SD5A 3HI6H 3U1PA 4LKXA 5G4NA 4QOKA 1UEMA 1WK0A 4XVTH 2AI0H 3FB6B 4N68A 4D0DA 3M1BB 2WUBH 3TBTA 4NOBA 3ZDYB 4PJ8C 1T83C 1A9VA 1FL5B 4XB8A 3BKML 3SDDA 1CDYA 4FQ1H 4N86A 3V0IA 1G7QB 2BCKA 3ILPA 3OHXB 4FZEH 5G4OA 4FI6A 5EOTA 3TIEB 2CSPA 4ZPVA 4ZQKA 5DI8B 1X9LA 3FFDA 2DH3A 2H1PL 4PLKD 5FK9B 3ECVA 4UOW1 5EUOA 3QRGH 3MUGA 2FWOA 5G55A 4P9HL 3NH7H 4JFZL 1Y6MR 3T0EE 5C9JA 1J0JA 1DQJA 3IF1A 2BSTB 4XZUA 1NDGB 1JK9A 1T1ZA 4KNTA 3V79C 3GHPA 3BUBA 4JHWL 4P5TD 3G5VB 3MV11 5D4QA 4U1KB 3AXLB 2VXQL 3CFKA 3ESOA 2K3TA 2G5BA 4K73A 2EUVA 3O6FA 4RAVB 3FF8A 5KSVA 1AYRA 4NI3A 3TVMA 5B7EA 4HG4J 2YSSA 5KANI 4KKBD 4CSPA 1HZKA 2OMNA 2PMZA 3IDMB 3HC3L 5C0ND 3SBRA 3PJNA 1NCGA 3PXHA 2R4RH 1OOWA 4KQ0A 5AAWC 3IRCA 3LPGA 2PTTB 4U33A 1LO5A 1IGML 2O26U 2HJLA 1SVZA 1KCRL 5I76A 1P0SE 3HG4A 1I9JH 4Z3FA 2VDMB 1YN7B 4B50A 3LZRA 1JGLL 4FTVB 4MQXC 4GUOA 1TJHL 5KSAD 1FAIL 4JFPB 4MJJA 1RUPH 2Q10A 5BV7L 3BDBA 1WFJA 4L3EE 2YOCA 1UB5A 4RH4A 5IM7A 1YNLL 3DETD 1UVQA 1CFQA 1E5AA 5ICYA 2GSGA 1VEMA 2FGZA 1NBYA 1M71B 1PZSA 3QVAA 1TG8A 1NANH 4TKWA 4ABQA 5FCUH 4JPVH 2NT1A 4ZAKD 1ZE3H 3SDXF 3KLKA 5C08A 2Z91A 4YX2L 4BFEA 2YC1B 3KLHD 2FJGA 4G7VH 4HP5A 4G8GB 2QHLA 1XL6A 2XYCA 4QYOB 4XMPL 4N0YH 4TVPH 2OL3B 2ZOKA 2KMWA 1E4HA 5FOJA 3HC2A 4FABH 4ORZC 1EHXA 3FTGB 2OTWA 5IBTH 3QHFH 4PJAB 2IAMA 4OZGA 3SJVE 4PS4L 4Y19A 1TQSA 4Z7NF 3HE6A 5AW5B 1IVTA 2ARJQ 2R7EB 4IBVA 2CKBA 4OVUA 1FL6A 5I23A 2F15A 3NIGB 4HD5A 2R29H 3ZE2B 3VFOB 2ROYA 4ENZA 1DBML 3NVQA 4F2FA 4XPGL 2FJUB 5FYLE 1YHPA 3VYOA 1T1WB 4YC2B 3GUTB 4WK0B 4FFZA 4B53A 4QHNB 4LFHG 1DJYA 5JYMA 5DO2D 1UEYA 3FBQA 3P02A 1Z2KA 4WWKD 3L13A 5EOCH 1TU2B 2UZXA 3GNMH 4NM8L 2QPEB 5EU3A 1OANA 1LK3H 1AGDA 2WBJD 2D03L 1K2DB 5DHVH 3U6XA 4Z7VA 2XLLA 1A1MB 3QNYA 5E5MA 5IHUH 5CHNA 5JHDA 5DS8A 3LNDA 2A4EA 5AW1B 3ZDYE 1OPGL 1QD0A 2F58H 3TZVB 1RHHA 4ZFGH 4XN9A 1W72A 5I6NA 3L6FA 2QTEA 5C0JB 4H7VA 3NJKA 4NQVA 2CIKA 3V7AE 1WHOA 4J3OC 4CSZA 2V9QA 3HLAB 2VDQL 4PJEA 3X11A 3ASWA 1WAAE 2DJ4A 3FYEB 1J8HA 4KRNA 1LP9B 4PWEA 1IX2A 4ONHB 1RIHH 3BLBA 4GT0A 1NLBH 3EGXB 5HI4C 5DJCA 5HHOD 3WEXA 1K8IB 1OGAA 4B97A 3KPPA 3AQYA 1TQBC 2KERA 4LCUB 3F7YA 4N2DA 4PRIA 3RIAF 3K91A 5HVWA 3D51A 4G80A 1C5CH 4XOAA 3TC9A 5DRXA 3ZK0A 3SBWA 2BSED 3RVUD 1IKFH 5DJ8A 2AV7B 3IJSB 3SHSA 4Y2OB 3CZJA 2Y69B 2FQFA 5I66B 5IFHH 3VMPA 4DN3H 3INOA 3MXWH 2YLKA 3REVA 2YKKA 5CJQL 1D7FA 4D0CA 5ID1A 1ICTA 4PJGB 5DTFA 4EUPB 3VXME 3QULA 4AM0Q 4DNLA 1CB4A 2Q76B 3NESA 1MN4A 4GUPA 4N3TA 2RALA 5IOKA 4UT9H 2Q6WB 2WZ5A 3DX6B 3QQXA 2HUEA 1IO4C 5L8KB 1DBJH 4JQIH 1WIUA 3IGKA 3KWUA 4QRSA 3N6YA 4ZBJA 3KR3L 2NZ9D 3FT4B 1M2OA 5LNDA 4PJ8D 4Y4HA 3GT6A 3PV7A 1A4JB 3SGKC 3CUPB 1KJ2B 4QTIH 3JYCA 3RWGA 3SCMA 3QAQA 2IGTA 1I1YB 2DYPA 1I3RB 2GJ6A 1KJVA 2BOBA 3T0WA 5DFVD 3U83A 5I1AA 1BP3B 1U8HB 1I3UA 4KKPA 4PB0L 4TULH 4XN5A 4AQOA 2VC2L 2R0WH 4E9VA 4EE2A 2HVBA 4P5KA 4ZUVA 1SXZA 4A7GA 2OMYB 3F04A 4KTGA 3FFOA 3I6GA 2OJZL 5EU6E 5HHOB 5EO0A 1UJTA 3SPIA 1A7BA 3DX4A 3QNFA 4FADA 3OZ9L 1ZAGA 2ATAA 1BVNP 2EKSB 5KYYA 3OC5A 1BQSA 4HUXB 1IJ9A 4MQXD 2GIMA 5D7JD 4S1SH 1AI1H 1IM3B 3GIZH 1AKJD 3DTDA 3FB7B 4LVNC 4G8GE 3LEXB 4R90L 1CXIA 2YD9A 3NUKA 4MJ6A 4OQTL 1QBLL 3F7QA 5ANHA 3SE9L 2WCPA 4DW2L 1WIOA 5KTEH 3GMRB 5FO7A 1HHHA 4HIXH 2WQWA 3T77A 4NUQA 2JNZA 3QDJE 3Q1SH 5KJ7E 5DDHA 3MV01 1VPOH 2PN5A 3HZVA 5F9DC 3PWLB 3TA3D 1Q4NX 2W60A 3P0YH 3WIIL 3CFIC 4X9GA 2CM6A 4F7CA 4X6DE 3R7QA 1WCBA 1YYLH 4IRSB 1BVOA 5I1HH 5TQ0L 4LP8A 2DLFL 3AGWA 1MJ7H 1TSRA 4F33B 2I60H 2WTOA 2B0SL 3EO0B 3MROB 4M9OA 3K2MC 5CUSH 1EJOL 3BWZA 1HNGA 3MRJB 4ZDHB 3GEFA 4MA8L 5EU5A 3N91A 4I3GA 2QSCL 5H8DA 1RZGB 1GZHA 5DHVB 4DKAA 3MSPA 1DJIA 4BRVA 4XAKD 4PJ7B 3GI8H 2NY6C 3KE0A 3U4BL 3UTTB 3WFBH 2O61A 15C8H 2K45A 4Z5RB 5DJ2B 4HWBH 4NN7B 1INDH 2UXGA 2HTLC 2ZKYA 4FZ8H 2AJUH 1XH3A 3ABLB 3ZIMA 1RJZB 4CSTA 1XH1A 4LVOC 1LQBC 4UM9B 5GS0L 1M05B 4AENB 5I8CB 1A1NA 2VTFA 3JQOB 2GCYB 3NJXA 3QDMB 4PIBA 1IIIA 3KLQA 4F15C 5IVXA 2B3RA 4L8CB 1T5XA 1CGXA 2IDCA 3DECA 2PYEB 4MAYD 4L18A 4XNMA 3QA3B 3BUDA 4TSCL 1WUNT 1MF2L 4HEPA 5HHNB 1CLOH 1JD7A 1GW0A 4ZW8A 4NQDB 1I4FA 3FSZA 2FYVA 3CPLB 4M4PA 3EYUH 3U7AA 1I8AA 2F5AL 4W6YB 2Y5TA 1AZUA 3GMOB 4NRXA 4GKLA 4XCEB 1YUHA 4PREA 4V1DB 2OSWA 4XBGB 2WB7A 3EYFB 4MA3A 1LXMA 4JRYD 5D71L 1BWMA 1U91B 3IU3A 4CC4C 4N2LA 4XPGH 4NENB 3H4FA 2AJXH 3DPDA 4ZRGA 2C1PA 4YC2C 1RK0A 1N68A 2FYYB 2C9AA 3DGGB 1QUNA 1CFBA 1VACA 2GUYA 2JI1A 3HA0A 3AVEA 3VGGA 2DQJL 1NCBH 1ZVNA 4HFWA 2CRZA 1EDYA 5BRZA 5ANME 4Z23A 3S97C 3QEQD 1VLXA 4O2CB 3HFMH 2GSIA 2PCXA 1L9TA 2DQ6A 1JSYA 2HA1A 4WVRA 2XZZA 3D0VB 1JTTA 1CLYH 1MCSA 1EEQA 3TEWA 5E4EB 4YIQB 1KCUL 3U36A 3CK0L 3ZW3A 2JKIS 5JORA 3ZDXB 5DQDL 2BNQB 3H9SB 1G7JA 3IM1A 4M1CC 1JWMA 5JUEL 2E74C 3ZUCA 4PJ5B 4K3JH 5FYJD 1KB5A 3H56A 3JV0A 4MJID 1CBVH 1DVQA 1RUQL 1T04A 4OSUH 2Z7ZA 5GGVL 3MC0A 5D1XD 4ZMXA 1T2XA 3S4SG 3ZR6A 1RVFL 5A7EA 1EIBA 2VQ1B 4AEIH 5F7FA 2QQNH 4UIKL 5CJXA 5MENE 5K33A 1A66A 1AZZC 2VLRA 3M86A 5CINL 3B5HA 4K5MA 4RMBA 3QAZB 1CG9B 1TQBB 2NMSA 2OYKA 4ESKA 1MCFA 3GRWA 1UWEL 1X4ZA 4ODXB 3X13B 4P9HC 1TVBB 2JTDA 4GAJH 3BRGC 2O1AA 4HC1L 2WWNA 3R7RA 4JDZB 3WNKA 1OD9A 2AABH 2XWCA 1YC7A 5AOJA 4CVUA 4GINA 5TF1H 3UJIH 1ORSA 3MCYA 4P05A 5GRWA 2V9RA 5KBLA 1HX0A 1U8MA 4DEPB 2APVA 4WHYG 2VDML 3HFFA 4WKZB 3Q5TA 5EF0A 1EWHA 1TJXA 1DBKL 5EORL 3ULUE 4QXTB 1ADQA 3WUZA 1XF5A 2MRYA 4YPGA 2YRPA 1OSZB 2QV2A 2F1AA 2ZX9A 2BX5A 3ZE0F 3B43A 3I9PA 1JRHH 3K72A 1D9KB 3APFA 1UWEH 3PS6A 4G70B 3PAYA 1KFGA 1FGNL 3AREB 3ARGC 3QHTC 2B39A 4YVUA 4NHUA 3AWGA 3LPOA 4FQ1L 2X4UB 1SGKA 1NGWA 1T0OA 5J6GB 2XNAA 4FN0A 2BP8A 5FYKL 1XSIA 1H8SA 2YUWA 3CGTA 4X6BA 5FUZH 4FF9A 2RA1A 1NGZB 3KL0A 4FQQB 4XVJH 1P2CB 3HNVH 2PETA 3VXMD 2R0LL 1TQVA 3I85A 1SJHA 2OL3L 4P4RB 2QKSA 3GXFA 2X6UA 3IWUA 2DIEA 4ZX6A 1HU8A 2P4AB 3KNBB 4YGAB 3KPQB 4YDKH 2XWEA 4LVNB 1FZMB 4FXGC 1XTLA 1Q0XH 1JFHA 3ILEA 4JX0A 5BVPL 4YGVB 1UJ3C 1P1ZB 1HI6A 1PZCA 2PUQT 1W15A 4ZFFA 2YUXA 2EE9A 1UM6L 2FX9L 2MH4A 3BHBB 5DD6A 4AMWA 1DVFB 1BM7A 4IRSC 4KKLC 4JFDE 3EOAB 2PF6A 2QADB 3VFVA 3JV5A 1TVHB 3OKKB 4DGYL 4GRLD 1MIEL 4LRNH 4GYBA 4U1NA 3WE6A 2ADIA 3I6KA 2LGNA 1UH3A 5EU6A 3LKPB 4E2OA 2DI9A 2DW5A 4JK0D 4KHTH 2DWEA 2Y1ZA 1KELH 3F62A 3GMMA 4P5TB 5L2KE 4KNQA 4RVBA 1ET7A 3EYUL 2WMPA 1NC2B 2DIJA 2FECI 1DZ0A 2F8OA 1FYTA 3VFTB 3PP4H 1BMGA 2VDKL 3VXSD 5CCGE 4QHPA 2YXVA 4ZFZB 1NUGA 3RWFA 4JG0L 4U6HB 4UNTA 1SY6H 5D7JB 7CGTA 2BY2A 2UXTA 2H2SC 2YJLA 3AU1A 3SIKA 1G9NC 2WNKA 1T66C 3MRGB 4HK3J 3S4SB 2IDSA 1FFTB 2H0PA 5FKAB 5EZOH 3QEUA 3EGDB 3ECBB 2DBJA 2XVBA 4Q2ZA 3ISYA 1N0LB 3C60D 4LO9A 3WAJA 2ZAHA 4M03A 1NCNA 2BNQE 2VDQB 1I8IB 3L3GA 2YKLL 3ME0A 4HUVA 1X5ZA 2HVJA 2IBBA 4K94L 1N64H 3HS9A 5I9QB 2C3VA 2VM3A 4P99A 3VSUA 2GC4C 4XAWH 1WWWX 1ZLUH 3VVVA 1NEZB 4KFZC 3QUYB 1LE9A 2XN0A 3DYPA 3HMWH 2XWZA 3A6CH 3U0WH 4P4KC 4CBPA 4LLUB 4RQQB 5J6SA 2PXYD 5EUOE 1YN6B 3GM0A 2Z35A 2NDGA 2DM3A 1X7SA 4GS7B 4ODVL 3VXRD 1YQVL 4UM8A 1QWNA 1VFBB 4KKAD 3U46B 2JB6B 2QMJA 3NFPA 1JPFA 4NUMA 3RBGA 2P44B 2ZT9C 1TNNA 1USZA 3WN5B 4E9TA 3FUMA 1RJLB 3FQ4A 1RSFA 3HNSH 4OLUH 4A2LA 4XNZB 3QC6X 5DFAA 2FT6A 3GSNB 2CDEB 3P4OB 3PDOA 5JLZA 2BP3A 3C8DA 4L3ED 4OQ1A 2VLJD 4U7KA 4KZCA 5GQBA 3RUGF 4B9ZA 4TQHA 4QRRA 1KMGA 3GHEH 3WD5H 4XP9H 3MQIA 2MKLC 4ZW7A 2B1OA 1TETL 4X80H 4ZUUB 3QO0B 1FNLA 1S3KH 2BRQA 2NCMA 3EBGA 3AG1B 3PP3K 4LEBA 4PLOB 3VDCA 1D5MB 2DKMA 3LEVH 3QUKB 3NSFA 3W0WE 1XGYL 1FV1A 4NT6A 4HOMA 3CFTA 4G8EA 4HETA 2NY7H 5BUPA 1F90H 5F44A 3BEWB 3P3TA 5AVQB 3RZCC 4AGMA 4MHHI 4PJFB 5KYUA 2IWGA 3UEZA 1NEUA 4HGMA 4E0RA 2X6CA 4GMSL 5ACMA 2GC7C 5E4EC 3KYMB 4FRWA 1T0MB 4WLCA 2VN5A 3QZWA 2GIXA 1KXQE 4G7YH 5GGSA 4F8OA 3KLAA 3PL6D 1GR7A 4DERA 4MAZA 3TP4A 1AI1L 1UZ8B 3GIZL 4OFYA 3T3ME 5BW7C 2R29A 2APXA 3STZA 3QHFL 4GRWH 4QT5A 3WEAA 3SE6A 3BUIA 5LDSA 4MYPA 5ITFB 3NIDE 1F4XH 3D5OF 3L3IA 3EJYC 4J8QA 2HP4A 1O5PA 1BZEA 3LVEA 2V3DA 2WCGA 4M7JH 3B2DC 2GUOA 3QDJB 3W82A 3ZDZE 1R0AL 3ZT6A 1RLWA 2ICEB 1F3RB 1KJ3H 2R9HD 3GJFH 1RH8A 1U4FA 3PG2A 4U3SA 2NY1C 2KPWA 4AVJA 4XNAA 3MRDB 5K59F 3FUIA 2XX0A 4Z7WB 1VZGA 4NBYB 1P6WA 4JVPA 1J8KA 2LU5A 3AS2A 3GLAA 2D9QB 5FYLL 1Q0EA 5DZAA 3Q1EA 3VWJD 3OR6B 1HCZA 2AV1A 2HRPL 5CEYA 3E8VA 3OG6B 2NX5E 5F3HA 3D09A 4JFED 2IDTA 2WTRB 4LHJB 2HT4C 3GMNA 3PP4L 3BGFB 3HB3D 4E9WA 3FHQA 1GAFL 2Y72A 4J6RL 1CU4H 1G7PB 5FXCH 1OAUH 3V95A 3LHPL 5J12B 4OZIF 3MUUA 4AVHA 2CJUH 2OXGA 2R2EA 1KIUA 1RZPA 4MXVE 2GBUA 3L3HA 4OH2A 5IBLC 3CTTA 1ZLVH 3PABA 4CJ0A 5BVJB 2OCJA 2JELH 3CVCA 3B7UX 4G11A 4ZYKB 3U1SL 2W59A 2EE6A 3HG1D 4CN6A 2EDRA 4GG6E 2XQYA 3V5KA 1IE4A 1D9KC 1GKEA 2ZKXA 2JCCA 3B9VA 4JKWA 4PJHF 2VMEA 4UV4L 5IBUG 4AY0A 4F7MA 1K5NA 1QLRB 3DPBB 3O4LD 3LH2L 1OT1A 3APNA 3RQ3A 4TLUA 3LQZB 3ATAA 3ZKMC 4RMTA 2HUHA 4LIQE 4ZMWA 4UTAL 1PKQB 4HGWA 4K3DL 3U9WA 3V5DA 1J8RA 1ZLWH 4XVUD 3CFEB 1PY9A 3CC1A 1NGXB 3MJWA 3OJMB 5T1DL 1SDDA 1DSWA 5K9KB 1AY1H 3R4DA 4K3GA 3TN0B 4F7PB 4P2YA 3ARXA 3GSVA 4ONFH 4KVNH 1LO3H 4RMQA 4UDUB 5HYIA 4YN3A 1T5WB 2VISB 4FOMA 4XR8C 5I26A 2UUDH 3V5HB 2QR0B 5GS0C 2TRYA 1WFTA 2DI7A 3WE1A 4DO5A 2Z7YA 2HSIA 5GGUB 4IRZL 4QEGA 5LWYH 2W5PA 1X5YA 4OLZH 5CU9A 4F24A 3OQRA 4YSTA 5TPWL 3SPGA 3QWRA 5FOBB 4K2UH 1LDSA 3FQUB 3ARDC 3MV7B 4OUOA 2OLDA 3BP6A 1DVFC 4O51B 3BP4B 2QADC 1N4XL 4QKXB 1IBHA 2HFFB 2J88L 3OF6D 1XF2B 3QUKA 4K3HA 3V52H 2GJ6E 4YHIA 4OTXH 1NGYA 2FT8A 3RWDB 4AZ8A 5HYEA 1SDAB 5L4IA 2LLGA 1CFNA 1XAUA 3D4GA 1MDAA 1D5BA 1FA4A 2A74A 3L1OL 5C6WH 5E8DH 2BIOA 2EYRA 4HWBL 5F7LB 4IIQB 4G6FD 5D7JC 4JJHA 3CVIH 1L3WA 5FS5A 2P5WA 1B4LA 5HDBB 5CGTA 2EO1A 2YD5A 3EOTH 3VXNB 1RZIB 4A7UA 3S5ZA 4N1HB 3FSOA 2H32B 2IOMA 4BHUI 3MV8A 2Z35B 4AE0A 2Q2EB 1WYJA 5DMJB 4IRZA 1Q0XL 4LLUA 3TBYA 4OCWH 5HGDB 4F27A 5E9DB 1E27B 3HB3C 4L8DA 1U95B 1MCBA 1PAZA 3MJ8A 3BD4A 3QUYC 3B7TA 1BHGA 3II3A 2F7RA 3TNNB 4PJ7E 5I75B 4ONOA 1MIML 5IK3B 2KQNA 1H8NA 4MSWB 4NZJA 1S9WB 3EZJB 3PQYE 5CP3A 1TTRA 2LVEA 3CSTA 2QDVA 2XZQL 3F05A 3LKQB 5DUPL 3NIFE 4MSWA 3KM1A 4MDIA 3OKEA 1XGUA 3ZR5A 2DQIL 3WI9A 3QYCA 4N5ED 3BMWA 3PWPB 4BA0A 2Y1AA 1Q72L 5I1JL 4LPYA 1AQDB 2X70A 3QCVH 3BSZL 3MLXL 1XD1A 1OTTC 4S1SL 3RWFB 3B2XA 2X42A 3QUZC 3ZTEA 3JTBA 5H35A 3KBHE 5DZVA 4DKEL 2OA9A 4N6RA 2Y23A 1FFOA 1GY2A 2ICWA 5CD5C 3IFNL 1RPUA 3TZVD 4LSTH 4MJIB 5HGHA 4JY5L 1YPZE 3BAJA 1BJ1J 3AWEA 1KGXA 3VXOA 2E46A 4Q74A 4FG0A 5IIEB 4YHLL 2P5WB 3O4LE 3QG6B 5IQ9A 1CK0L 3N0PB 3GKWH 4FFZL 4Y5XB 1W8OA 4HIJA 3WFHB 2NW3A 4IJTA 2XTJE 4OAWA 1FVCB 1G6VK 3ARDA 4P2OC 3RZCB 1AZVA 4W6WB 1AXSB 3O0RL 1I9RL 5EIIG 2XKNA 4BK5A 2GK0A 3LPFA 3S5YA 1X5HA 1CICA 5L9DL 4R97C 1BMWA 4KOBA 4LU5H 3DUUA 4NAQA 4BINA 1HNFA 1EAPB 4PTUA 3RTQA 1AFVH 5BV7H 2VZ3A 3ARUA 4X5WA 3LHPH 1Z5YD 2Z93B 5DJYB 4P3WA 4B9KC 4GAGL 5IB5A 1YDPA 3FU9A 1AIFB 4RZCB 2JKWA 3SYOA 1BXUA 2B16A 4NO3B 5FFOA 1LL1A 4HIEA 5I2IA 1TKWA 2EVHA 3QIBA 3S35X 4MJ5B 5EEUA 1NM9A 1EGJH 3JTTB 2FGWL 3CXHJ 5D1ZI 2O6DA 1JIBA 1AZCA 3VJ6A 4U1GB 1GTFA 1LP9E 1KZQA 4L4VE 2OYLA 3MV9A 4ELDA 1T5WA 2VISA 4JFHE 1G43A 4PB9L 3WKYA 2WJ5A 4OM0L 3CN4A 4XWOC 3NOIA 1WD8A 4GSQA 3S35H 1MVYA 3TNMA 1BM3L 2WKOF 2Y0SA 1MREH 3BDYH 2IADA 5FGBA 2G4GA 2GQHA 5IWLC 5I16A 1MPAH 1YSOA 3FFCE 5T5FH 4ES9A 4KBPA 5E9DA 2LTQC 2DQHL 2X4OB 1JPTL 2VDQH 1Z66A 3BSGA 4Q9CA 3VSQA 3D1MC 2QSCH 4ANWA 1IC4H 4D8PA 5JDSB 1F0LA 2BC4A 3MZTA 4U7SA 1QLRA 4WAFA 1VGKA 2EUWA 3TT3L 3DI3B 4TMPA 4NIKB 4BGLA 5TFSH 2HT4D 1Q9WB 4G9FE 1TZ8A 5T3XH 4ODWA 4IIQA 4JO2L 5JIIA 2XBTA 4FA8A 2IAMD 4FNLL 4AEEA 5D1QD 1I8KA 2QQKH 5F96H 3ZMNA 1A25A 1QA9B 2MMXA 2H26B 5JYLA 3QPQC 1MJUL 3BRFA 1QO3B 2JMRA 1LK3L 4K8RH 2M83A 4BKSC 1RIUL 5HHXH 2EIZA 3VFUA 3MA9L 4X5XA 3IAQA 1RAMA 4PJCB 3GTTA 3L5XH 3S9DB 3VXUA 5C0RL 4ZOCA 3DROA 3MLYL 3F7VB 4GRLC 1KULA 1EHNA 3VD5A 4XVJL 2J25A 2QPFA 5LBGA 1TFPA 3QG7L 4K7PH 1YEIH 4ZSOB 4WQOA 4M5YL 2BVYA 1X3DA 1F4AA 2L8AA 2VDOH 4LDLB 4WWKA 5KUKA 3FQUA 1KCSL 4TOYH 2YAOA 1QBMH 1KXVA 1M2VB 5FOBA 5DWUH 5F6HJ 4WI0A 2HFGL 3UTOA 4MJ4A 3Q3GB 1JWMB 4X98B 4M5TA 1J5OL 1FFQA 3ZMEA 4HU8A 3ZUNC 1JCKA 2BW5A 3EFOB 2VXUL 5ICZB 3CQQA 2CR3A 3KBFA 3PQYA 3RLSA 1P7BA 4OD3L 1IAIM 3QS2A 1UT2A 5CJXC 1A6PA 1QKZH 3WFDH 1GOHA 4KOCA 2AK4A 2BWQA 3F84A 1XCWA 4O2EA 1OARL 4XNXH 2LE9A 1ETA1 2BNQD 4KVPA 3WNMA 4HS8L 3CFEA 1OAXH 4W9EC 4CVZA 5T1MB 1TZOA 2A2QT 4DO6A 2EEBA 1D7BA 4RGNE 4RAUB 4PV1C 4UCFA 1U8LB 4ZO7A 3ROLB 2ZWLT 2ORBL 4NZTH 2CLRA 4F7MB 3I9AA 5SWQB 1IGFH 2N7AA 3TO4D 1GL4B 1LEKB 2UYLA 3VXQA 4OV6F 4DGWC 2CK2A 2J4WL 2PO6B 5E7FA 3VDBA 2DQIH 4IIQC 2GIYA 5J4MA 1T2QL 4RFNC 1TZHB 3FSAA 4Z8FH 1CDJA 4BE6A 2CLZA 4QHUB 3UTQB 2YRLA 4Z76A 2P8PB 1KIUB 1GYCA 2OXGB 4L1SA 1ZA6A 4LMQE 1ETZB 3B8YA 8FABB 1F11B 1J0KA 1WFUA 2WCSA 2XG5B 4MX7B 3VRIA 2VRAA 3EG9A 4UQ3B 2CALA 2CBOA 3GK8L 4AIZA 3P77B 1U8QB 1W0WA 3CDCA 1NCTA 1U8CB 1RJLA 3L4UA 3WY4A 1CURA 1T5XB 3ULUH 2B59A 2BY3A 4XP6L 1XGTB 1V54B 1I8UA 2HAZA 1RZQA 1S2EA 5A43C 1B4TA 1FBIL 2FAUA 3DX2A 4QLRA 1NCAL 2CG9X 3NSJA 4PJEF 2CGYA 3BXNB 2VXVL 1ZA3B 2AQRA 4FQ2H 4FNRA 3DHJA 5CJOL 5CF3A 2V5YA 3QUZB 1P84K 2C7UA 4P3DA 5I1EL 1OALA 2B4CC 3LRSA 2EDLA 1E6JH 4F2ME 4N25A 1E67A 3HAEA 4Y4FA 1TJIH 3FQTB 4G1MA 3VXPB 3BH8A 4PJ9A 1ZHKB 3L5WA 4PRPD 3TBSA 1Z7JA 4IRJB 4ODBD 3STZB 5HHVL 4M1DH 5C0CE 2HMID 4UV7H 3WKNA 1RUAH 3FTSA 5DSCB 3VD2A 3LH8A 4FZEL 1GOGA 4ABWA 4L2YA 5CGMA 3TO2A 3CZFB 1YEGL 1CL7H 3HE7A 2BIHA 2M26A 5C0IA 3SDXB 2DTML 5E1AB 4D0BB 3UC2A 2FNBA 2N1TE 2A6IA 1FO0B 2P47B 4LOEA 3RTQD 4ENEC 4G8EB 4R4FL 1LM8V 3BKYL 3AT9A 2ZPKH 5KBDA 2NY5H 4N2EA 3N5AA 3S3CB 1BF5A 3U82B 2G2RB 5IMLB 3BQUC 1JP5A 3KLSA 4FCAA 4BXVA 2FD6L 4YS4A 3AADB 1UXLA 4G1EA 2FR4A 2EKSA 3ARED 4U1MB 3P73B 1KXQA 1HHGB 4I2XB 3E0GA 3MJ7A 2C9QA 3U6RA 1LD9A 1QKZL 1U4EA 3PXJA 2R83A 4PW3A 3O2VL 4JN2B 5JPNA 2ZXWB 4NBZB 1YEDB 3WN5A 1TMQA 1SQ2N 4LASL 4XPTH 2F61A 4ZUVB 2JB6A 3NABH 2ITDA 4GKZA 5E4AA 5AVWB 5SWZA 1X5FA 2IXQB 2EADA 2R69A 4U1GC 5EC2A 5ETUB 3O2DA 1UKTA 4CBZA 4HLZH 3SPJA 4JB9L 1KCBA 1ZIAA 4TPRL 4D94A 1ES0B 2KZBA 3RWGB 3SCMB 2X6AA 3QUYA 4TN9A 1QRNB 3UDWA 1HKFA 1H3GA 2E9WA 4BHUA 1BDYA 5AW3B 1JWUB 1QACA 4JFZH 2AK4E 2Y06L 4FMVA 1EEZA 4LMQI 5HJGA 2OMWA 2YEZA 2AXFA 1G5GA 4HDIB 1G6RB 4NHUB 3DDFA 1G94A 1NLDH 2QELA 4PJGA 2V2WB 4LSUH 1KC5L 3K72B 1HQRB 2PPFA 3P4MB 5KSAC 3S88H 1ROWA 2CRIA 2P5EA 5D7JA 1HHIA 2MQCA 4Z18A 2H6UA 3CMOH 4YZWA 1JFQL 1J9RA 3JVGC 4GKOA 5T1KD 5CM1A 1BGXH 4FNLH 5KS9F 1MY5A 1U8OA 5EWIL 3MACL 5ITBL 1FYTB 2W0LA 3BFOA 2D8KA 4DOHE 2XX1A 1TZIB 4P9MH 2IWFA 2Q7YB 4RGOH 5KOVC 2DWEB 2NQCA 1IFRA 1YEHH 3VM7A 1KTJA 1H5BB 3RDTA 1XGZA 2JJSA 2YBRB 4K7PY 1KBVA 3A4FA 4NDMB 3IN0A 2ZX6A 1EBAA 3I50H 3N85L 2DY2A 4RMSA 4JHUA 5I5MA 4AE1A 1ZRUA 2OSLA 2X7LA 3ZDZF 5JHBA 2E7CA 4GP5B 3GJFK 2B9BA 4GSUA 4GRWE 2EJ1A 3FH5A 1CIUA 5C0AA 5FR3A 1Z0MA 4GG6B 2R1WA 4F93B 3L7EB 2APWA 3FN0L 5D5MB 4R4BA 3L9YA 3KBPA 2ZG3A 1W72B 2C9RA 2K6ZA 2NX5D 5F1NA 2KPNA 3T3MF 4HX1B 1J0HA 1FNEA 4HXAH 4X0KA 1J8HE 4LSSH 3RVWC 4IBWA 2KHAA 5KVGH 1ZS8A 5T1LA 5LAXA 4YFLF 4H26A 4EI5D 2X4NA 3L17A 4PRPE 2DLIA 3P4MA 4P4KD 1HOCA 1MCKA 5GGRB 5I30H 3U48A 1S7XB 2VR8A 4HSQA 1K3IA 5JXEC 5D72H 3V9FA 4E9SA 4FP8L 4FQXD 1HK6A 3SQRA 4N0CC 3UBFA 4ONGH 1R5IA 4MNQE 4APQB 2H9GA 4I85A 3FO9B 1G4RA 4J5VA 2X4UA 1DEEA 3MA9H 1T1WA 3BPOB 4ZO8A 4YHYC 3GUTA 4RFOL 2J1WA 3VD3A 1HNYA 1S7RA 3PFQA 5JMRA 1N3NA 1U92A 2ZWSA 4HLEA 2N59A 1DJZA 1F6LL 1F1GA 1G1YA 3NJVA 3L1GA 2R7EA 1J5IA 2IQAB 3SSGA 2DPKA 2QGBA 5KBMA 4ZTOH 5LBVA 3G6JA 2OSYA 4LRIA 4RMRA 4WKZA 4GUCA 3ORJA 2ATPB 2B5IB 5FGCE 4OZGB 1QUNB 1VACB 3UGXA 3UJJH 2AQPA 1U21A 2JQAA 4K94H 2C5DC 3IU4L 2XN9B 4HCRH 2Q9OA 2B0SH 5J9PA 2XVKA 1NCBL 3G9AB 2FO4B 3O9WB 2GEQA 2IPUG 4OD3H 3LMJH 1Z9SB 5K9JH 3ESVF 4PJHA 3PGFH 3IDIB 2ZUSA 3WEOA 5DHXB 2Y5EA 2VDPH 3MRLA 3OKNB 1UURA 1CO1A 4KX8A 3F7KA 1MCIA 1WBXB 4ODXA 3PWNA 2X3BA 4Z78B 2CAKA 3C8KA 1QSVA 2VLJE 1NBYB 1ZSHA 2F53D 1SY6L 1F6FB 1MCLA 4KITB 1UVQB 3S6CA 3QJHB 2HX9A 1PIGA 2M8XA 2H8PA 3O41B 3S2AA 4Q8BA 3GJEA 1DSYA 4M43L 4D0BA 4H8VA 4PS7A 2A6KB 5BO1H 2XETA 4AK2A 3C5JA 3GBEA 1CFMA 5I1IH 4W93A 3WLWD 1YN7A 5EU6D 2CM5A 3DJ9A 4NQSB 5DSCA 2W88A 4HCRL 4PWGA 4AENA 4A2MA 1OP4A 4ETQA 5I8CA 4IM8A 4WNQA 3MRCA 3NPZB 1HYSC 2CCLA 3MRHA 5IF0A 5KVEE 1D6VH 1JN6A 3L95B 1G0DA 3EW3B 5GXBB 3K2IA 1I3GL 5DGQA 2FWLB 4MCZA 3N44F 5I6XC 1MIEH 1PNCA 1JVLA 4WWPA 1MAML 4TL4A 1NWPA 4PJGE 5C0AD 5F7BA 1RURH 2FZ3B 1AQMA 4NO2B 1W6LA 1J1XH 4RAVA 3DOSA 4MZRA 4JFOA 1PCXA 1H9VA 5CGBA 1E9QB 4J2QA 5EN2B 3OV6A 3FN9A 1LILA 4HFWB 4BGDA 3L4VA 3B7SA 2O93L 3KYKL 5I1GH 1EEUA 2QVTA 3W9DB 1T1ZB 2H0EA 2FYYA 5JMOC 3ARTA 4NI6A 1J11A 3AG4B 1MFNA 1GGCH 5IB4B 1PEWA 3KPMA 4OF3A 1CDCA 2ZP8A 4IBSA 1VADB 3O6FC 1NDTA 5SWZE 4JCWA 3BEVA 2EH8H 2XFXB 1ZA6B 1WC7A 1JRHL 1EZVY 1JUFA 4XMKL 5DD0L 5ANMB 2VDNB 1XF3B 4LB8A 4WWID 1FGNH 2Q2LA 5EOCL 5HHOE 1J9TA 1VIWA 5KVGE 1B6UA 4M9PA 5BQ7B 5ERWA 2MQ3A 2B08A 3C9NB 4WTWA 3FUNA 4FFYH 4PJDE 3HE6D 3UL4A 5J9PB 3WGVB 3TBTB 3C75A 4AEHL 4Q9QL 4Y4HC 2OX5B 4TUJB 1ZLSL 5J1TC 4LL1A 3BKJH 2CJ3A 3TJPA 4AGLA 2YOAA 1CTOA 4LAJH 3K8KA 1HC1A 25C8L 2X3AA 5FUOH 5L88L 3QBTB 4CVZB 3MUHL 4V2CB 1KIQA 2WXJA 2FT7A 3Q06A 5AZEL 3TGXA 4EOWL 4QHKI 1I3RA 2TAAA 2WQUA 5KSUB 1E9OA 1XR9A 1CS6A 4UV4H 1WBYA 4U1LA 1AGCA 1QAWA 4NRYB 3RVWD 4BCXA 2L4OA 5JW4R 4TM9A 3HKFA 1HZHL 4PRDA 4H8PA 1X4YA 4HXBL 2CKBL 3WLBA 4UQ9A 4NQED 2Z9TA 1KGJA 4Y9FA 3PXLA 2BVOB 4G8FB 3QEHA 3UTZB 3ULUL 2WXQA 1GGIH 1INEL 1W8NA 4G3YL 4E42B 3MRPA 3SQOL 2DF3A 3RY6A 2MJWA 4NQSA 1NAKL 3S37L 1O7VA 3CXDL 1ZS8B 2F0CA 1WCBB 1WF5A 4N2FA 4RGND 1U3HB 4K3JL 1TJHH 5HPOA 2D7QA 2IG2H 2Q8AL 2I7OA 2XZQH 1A7NH 3MYZA 3KPRA 4YOKA 1MCCA 1REIA 3GMLB 5EORH 3RDTC 4AYFB 1OOAA 1YMMD 43C9A 2YS4A 2HG0A 2PTUA 4X9FA 4HJ1A 3FU7B 3S96A 2XTJD 1PLGL 2J6EH 3EFDL 1QA9A 4HEME 2WVVB 1WP6A 3D12B 1J8HB 4XVTL 3ZDXF 5IHHA 3EDFA 4W4NA 1N5AA 2DM7A 3HFML 3MOQA 1BQLL 1IGJA 4KRPD 2LR4A 1I7ZA 4N9OB 1QQDB 4R7NA 3UZEA 2GBAA 2EIEA 5DVPA 2W92A 3NCYS 2QLVB 4NQXA 5HYQA 4ODHL 4XVSL 4NUGL 1QSZA 4FG6C 2RCSL 4EZJA 5CGYC 3PHQB 4YK4C 1ZLVK 5FGRA 4KHXL 3GWJA 1BF2A 2X4OA 4ZPTA 3RG1C 3LIZH 4YHYB 1XXFC 3G6JB 1GZPB 1U8OB 3B9EA 5JHDB 4YSPA 5ESQA 1T22B 3NN8A 3QORA 2IQAA 5I1LA 1GY1A 3DHUA 4Z7QE 5DD5H 3ILQD 2X4RB 2IDQA 1T0PB 5ABZA 5LB1A 1A4JA 2X5PA 4TSAH 3TWCL 5D71H 4CL7A 1M1SA 1RHFA 2PW2B 3NCJL 4QRFA 3SE3C 4JO1H 5CCKH 1EEZB 5L7XH 5BO0D 1H6EA 1I3VA 4EJ1C 4CGTA 4HWUA 4MNGE 5IHZA 4RESB 3Q8CA 4L37B 1KGCE 2BZ7A 4MJ5A 5MHSD 5DD0H 3DX9A 5F3FA 3MOBH 2CUAA 2ZWYA 2AJ3B 1FL6B 2WP3O 1YDPB 4Q97A 4IEFA 4YEEA 4A6YA 5T1LB 5LXGL 3N42F 4UINH 5DVKA 1NOFA 3JWDL 3S2CA 3MRBB 1FNEB 5EC2B 1UQSA 1K72A 1IGMH 4I3RH 4BUQA 4G80B 1CE6A 2YWYA 4H25A 3D07A 3L7EA 1B0RB 4UQ2B 4ANUA 2CJSA 2OL3A 3JV4A 4X99B 3TBVA 1LO3L 5DJ0A 1A14H 4DT2A 4WFED 5FUOL 3PGCB 1CICB 5F0LB 1B0RA 4UQ2A 3W0WA 2AJSL 1BEYL 4L1HA 3VWKA 1PD0A 3U4BH 3D6GA 5K39A 1Z5HA 2HPOA 3NIFF 3ASNB 2DWYA 2BSEA 1OGPA 2NCEA 3IJHB 4R4ND 3VYNA 4UT6A 4RIRB 1NFIA 4F1SA 5JPMC 5L0QB 2QKIA 2JLLA 3HLAA 3IGUA 4L4TA 2OM5A 2OMVA 4A6YB 2PW1B 1M71A 4PJ7F 4WGKA 4XPAH 1J9SA 3FUHA 1FO0A 1P4BH 1RHHB 2Q7YA 3GJFB 3INUH 1IZJA 1FFOB 3D39E 1G9ML 2VDLH 3T1WA 1GJWA 2EH8L 5JHLA 2VO5A 5DUML 5E1AA 5IHZB 3SKOA 4LE8A 2YAPA 4HV8B 3Q8AA 3O45A 4Z7OF 4FI7A 1C1EH 2Y4SA 2X70B 2YPLE 2ZXEB 3NFSH 4BBWA 1K2DA 4JFDB 5AKVA 5EU3B 4KQ4L 1BJ1H 2ZD0A 1KPUA 4X50A 1IFGA 4H1LB 1VRSA 1XCXA 5J6HA 2YXFA 3MLTA 3B9AA 3LZNA 1TJMA 4IU2B 4U31A 4CU6A 4ELME 1BJMA 1I7RA 3QJVB 4ZS7L 3UBHA 1KSRA 3BVVA 4KH2A 4A68A 2OTPA 4NKQB 4NM4H 3KPSA 2F8XC 2Z7WA 2ENQA 1U95A 4HT1H 4BQ8A 4EI6B 4GB9A 4EOWH 5JXEA 4KAQL 3CFBA 2CKBB 4F8TA 2BSSA 3AQDA 3BH9B 3MOAL 2RQ8A 2OZNA 3O6FB 4LARL 4PSRA 3HE6B 1FL3B 4M3HA 2WXRA 4UT7H 1IGJB 4NC2B 4PPTA 4PI2A 3D18A 3KDPB 3MV8B 4OF0A 3UPCA 2PWGA 4AJWA 2IXQA 5ETUA 4U4IA 4HJIA 2WVVA 2B59B 5B4MD 3LXUX 1V3MA 4ZSOE 5PAZA 2KQMA 3BT0A 3FU7A 1A47A 3P2TA 4JN2A 1EFQA 5IOPB 3JV6A 4GNKB 5EZJB 4FQXB 5JHAA 3ZHNA 4O9HL 4YLBA 3SOBL 2EYTA 4J3SA 5CBAA 2YGPA 4RFOH 4HJGA 1IAMA 5HVHC 2WIIA 1DE4B 4LSRH 1HTYA 1E5YA 1LO4L 4L9LB 4UTCA 5EOTB 5BS0E 2GY5A 1GC1L 2K8MA 4NM4L 1KWGA 4NQEA 4QRPB 1DFXA 2VLLA 2CCVA 2IAAC 5AW9B 2FIRT 4C58B 1C8QA 3O6ML 1CXKA 3MRPB 4OU3A 1YJDL 2ZICA 5A6LA 5ALCH 3FQYA 2F9BT 2P48B 3M1BA 5E2JA 2HRLA 1MRFL 4N2NA 5FHAH 1X6LA 2Y6SD 3SDXA 5EC1A 1A2YB 2P49B 2DQUH 5ECGA 1L9OA 3TO2B 3U0TB 2XN2A 3WJMA 5C8JB 3FT2A 1IVLA 4AW4A 3VW3H 2CKNA 3TYFA 5CLXA 4O02A 1AKJA 5KBNC 4AYEC 5J57B 2FJHA 5IV2B 1KEMH 2CHNA 5C6PB 4EI0A 5B1AB 1QFHA 4CVXA 3I50L 3U7YH 3IMRA 4LU5L 4XMPH 2X2UA 1UD2A 4EDWH 3HNSL 3IRPX 2NY2B 4G59C 3H3PL 4DZBA 2V7HA 5F1IA 4KV5E 3TN0D 1U3HC 1NGXA 1Z9NA 2OX5A 4TUJA 1WZ1L 5DD3H 1OW0A 3W9EB 4NWUH 4POZC 3IMBA 4IDJL 4WFHE 4A67A 2RMNA 4DETA 5IJBC 4XC1H 3K74B 1JI1A 1XIWC 1N5YH 4K23H 3AROA 2UWEA 4L3CB 4YHZH 3VQ1C 2ADFL 1Q8MA 4FS0A 2WKLA 4RETB 3CZKA 5GJSL 2PXYB 2DJUA 3DPBA 5J13C 1Q94A 4HWEH 2AEWA 4X6CE 4WWKB 1OQOA 4EZKA 1NDGA 1P4LB 1Q1JL 2DKUA 2F7QA 5DRNB 5C0AE 4DQAA 1DQJB 2C4FT 2VUKA 1OIOA 3UGUA 4G8AC 4WIQA 1LE5A 2YKLH 5I6MA 5DK3A 2EKJA 1CTNA 3GGWA 1IEHA 3DNKA 1BGXL 1Z9LA 4BSWB 5CU5A 2ROXA 1UOWA 3TONA 3QZPA 2JF1A 2C3XA 5D72L 2K9UA 2IEPA 3QG7H 1KCRH 5IQNA 2GJ6D 4YK4B 4PWKA 3L3JB 4R96B 5FAAA 4QY8A 4WTXA 1TQCB 3RAJH 3W9DA 4LRIC 5FB8B 32C2B 1YMME 5I6PA 1NGQH 4MA1B 3DMMA 2VW6A 2X89A 3QISA 5DJZA 2DMKA 2RGSA 3OR6A 3TWYA 1T03H 3VXQB 4JFOB 1D7CA 5ELIA 1T89A 1LE5B 1CFSA 1GH7A 3DRQA 4HUCA 3WN6A 1KTLB 4HW6A 2Z3FA 2FZ3A 2CLRB 3B2MA 3QYMA 2BC4B 4MASA 2X44D 1WA0X 3DKHA 2BHZA 4RAUA 5MENA 1CT8B 2DWXA 2YD2A 3V0WL 3V6FA 4M6OH 1SF5A 1X5JA 2NNCA 4WEUD 3HE7C 4G7RB 5E8NA 2YGQA 4HIHA 3FU6A 4YNYB 4RRPG 4LEOB 3ES6A 3ZSTA 2X4TA 1R24A 2F68X 3ULVD 4TUOA 3EFDH 4GRMA 2KLSA 4KPHL 2WWMD 4FQCH 4V1DE 4NN6C 4P23B 4P9ML 5A2JH 5CZKA 1AGFB 3ZE1B 1CVRA 4FFYL 1YEHL 3NJJA 4Y4FC 1G1KA 4IGBD 5CFHA 2H1PH 4PEEA 1HE8A 4EIGB 4TVUA 3VCLA 3VFSB 3CFDA 1AANA 1BZQK 5A3ID 4PB9H 4KRLB 4F9PC 4XMVA 3RWEA 1LMKA 3KLAB 5I2IB 5CZVH 4EN3C 4HYTB 1PZ3A