4YSTA

Structure of copper nitrite reductase from geobacillus thermodenitrificans - 24.9 mgy
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
294
structure length
294
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
total genus 96
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ystA00
3WKQA 1AZRA 2JKWA 2ZXWB 2PP8A 3TASA 2GBAA 3S8FB 1ZDQA 3FYEB 4YSAA 4N4YB 2GSMB 1L9TA 4HCGA 1JVLA 2YAOA 4YSPA 1L9RA 3FSAA 2MRYA 5D4JA 1TEFA 2IAAC 3CDZB 1OE2A 4BXVA 2GC7C 4HHGA 2VM3A 4HALA 4KO5A 4QKTA 4AKOA 2IDUA 3NYKA 3EH3B 1EZLA 3NJLA 4DPBX 3WG7B 3X1EA 3WKPA 1SFDA 3FU8A 3ABKB 4YVNA 4YSCA 1M56B 1TKWA 5B7MA 2GC4C 2PPEA 3EH5B 4KNTA 3FQYA 3ABGA 1PZCA 1J5CA 1L9PA 1J9RA 1JXGA 3FU7B 2QDVA 1XB6A 5FC9A 1TU2A 1JZJA 2FT8A 2UXVA 1BYOA 1NWOA 1PZBA 1E5YA 3NSFA 3FU7A 2BP0A 1PCSA 1RKRA 1XMEB 1GS8A 2HRHA 2CJ3A 5IY5B 1AACA 1ASQA 1B3IA 4X4KA 1J5DA 2J55A 2FQDA 4JHVA 2IWEA 4ENZA 3OQRA 1CC3A 2FTAA 1FWXA 2HX9A 3ABMB 1MG2C 1N68A 1A4AA 4YSDA 3FYIB 4A2HA 4KNSA 3T6VA 1ASOA 1QNIA 1NWPA 1OE1A 3OMNB 3ZDWA 4GP4B 3FSWA 3U25A 3EHBB 2JXMA 1ETJA 4M3HA 2FQEA 2FT6A 5I5MA 4HIPA 4NAJA 1BXAA 1JXDA 4M4RB 2OV0A 3N55A 5D4IA 1ZPUA 4RH4A 4GYBA 4E9XA 3QJVB 2IDSA 1PAZA 2CALA 2XUWA 3QJUB 5B1KA 2WO2B 4HCIA 3OMAB 1WAEA 4AZUA 5B7EA 1AZBA 1NPNA 3IN2A 1A4CA 3T6XA 2FQFA 3MBWB 1OCOB 3AG3B 3OM3B 2TSAA 3SBRA 4AI7A 4G71B 2Q5BA 4PCYA 2OCCB 1N70A 2WO3B 2IWKA 1AOZA 1HFUA 4A2FA 1ZIBA 2R7EA 3NJKA 5I6MA 2GI0A 4DP1X 2BWDA 4DP4X 4HAKA 1V55B 5I6NA 4E9QA 2YAFA 1TEGA 2QPEB 3DIVA 4PAZA 3N2JA 2EIJB 5EHFA 3JT2A 1KGYE 2PPFA 4E9WA 4BWUA 4UAHA 5AFAA 1BEXA 2EIKB 2BW4A 1CUOA 2PPDA 4BDVB 3NSDA 3QJQB 1SHXA 3S8GB 1DZ0A 3ZBMA 1I53A 1PF3A 1NIFA 1KDIA 1YLBB 1SDDB 1AQ8A 1RZQA 2TSBA 2I7SA 2XV0A 2XV3A 1NZRA 2PPCA 1NDTA 2DY2A 1AAJA 2AVFA 2GB2A 4F7KA 1PMYA 3H56A 2Q9OA 2DYRB 2XYBA 2P80D 4GY4A 3NJFA 3QJSB 2UXFA 3QQXA 2N0MA 3T6ZA 3D12B 5TK2A 1KCWA 3HB3B 1GY1A 2XX0A 1BAWA 5I6LA 5TK4A 4P5RA 1AG0A 4A2GA 1AANA 1CURA 2A3TA 6PCYA 2IDTA 2HX7A 2OJ1A 4AKQA 4AKPA 1IBZA 3GYRA 1HAUA 1QHQA 2BP0B 2FJSA 2GHZA 5F7BA 3SQRA 4YSOA 4DPAX 3WI9A 1VLXA 2BW5A 1A3ZA 2ZOOA 2W88A 1JVOA 3DKHA 2XV2A 3FQ1A 3PAVA 7PCYA 1WA1X 4KO6A 2BWIA 9PCYA 2CUAA 1BYPA 4K9JA 1NIAA 3IBOA 5B7FA 4JHUA 1WA0X 1AR1B 3PPSA 3T6WA 2PPAA 3NP3A 5I28A 1AS6A 1BXUA 2IWFA 2MTAA 3GXUB 4G7SB 3UGEA 1MDAA 1JZIA 3CG8A 4HCFA 2YXWA 3RYMA 1A65A 3S3CB 1AZCA 4E9SA 1NPJA 2YAPA 3NJMA 1M57B 4Q8BA 2CBPA 3G5WA 1AZNA 1A4BA 1MG3C 3FS9A 1OCCB 1E30A 2HRGA 3KW7A 5B1BB 1PZAA 3UAEA 3AG1B 1AS8A 4G72B 4FAAB 1DYZA 1IBYA 1QLEB 4TXVB 1W6WA 3NJGA 3NSYA 3PAUA 3EH4B 3X1GA 4YSQA 4YSRA 2XWZA 1IKOP 3AG2B 5D4HA 2QPDB 4AX3A 1NICA 3X2QB 2YARA 3S3BB 3L45A 2JFCA 4KNUA 1HAWA 3CVBA 2CAKA 3WIAA 1PLBA 4BWWA 2P80A 2YAEA 2FQGA 3NT0A 1SHWA 3AG4B 4DP6X 2IH9A 3UACA 2R7EB 3X1FA 1KYAA 2DWSA 2BP8B 3QJTB 4CSPA 5B3SB 1FFTB 3ASOB 2AANA 3UADA 1RZPA 2BP8A 2EIMB 3BQVA 1GR7A 1SFHA 5PAZA 2FT7A 1CYWA 2J56A 3PLYA 1PLCA 4G7RB 3PXLA 2CCWA 2YXVA 1ZV2A 6PAZA 2VW7A 3ZIYA 3IEAA 2I7OA 2AFNA 1NINA 4DPCX 3WNJA 2IDQA 1XB3A 2PCYA 3TU6A 3EF4A 2HZHA 3X1BA 4DP2X 1NIDA 4G70B 3SBPA 5AKRA 1KBVA 4F2FA 1BQ5A 2DWTA 4DP0X 2XX1A 3NJNA 1JXFA 3NJJA 5B1JA 4YVUA 4HZ1A 5A7EA 1OF0A 2VN3A 1ID2A 4A67A 2UX6A 4NERA 4DP9X 1X9RA 4MFHA 1R1CA 1OV8A 4A66A 1F56A 1BXVA 3QPKA 1ILUA 2LLNA 5LDUA 2YQBA 1NIEA 2XU9A 3PAZA 2H47C 3ZX1A 4DP5X 1PY0A 3QJRB 2AZUA 3H4HA 8PAZA 1ASPA 1WS7A 1E5ZA 3FU9A 3FSZA 2VMJA 4CSZA 4BXSV 2J57A 4A2EA 1GW0A 1SF3A 1WS8A 3S3DB 5I5JA 3OD3A 2VSMB 4UANA 1BQKA 2UX7A 1JERA 2PCFA 2Y1AA 1GS6X 3BVDB 1V10A 4FA7B 7PAZA 2B3IA 4G7QB 2AZAA 4W1TA 2ZONA 1PLAA 3ERXA 1IC0A 4E9RA 3CDZA 3NSCA 2VM4A 1OOWA 2PLTA 1X9UA 1OCRB 5PCYA 3KW8A 1AZUA 2IH8A 3WNIA 2EILB 1OE3A 1J9TA 1JZEA 2W8CA 5I5IA 4GXFA 3FPXA 2H5UA 4KOBA 1A8ZA 1ADWA 4E9TA 3MX0B 4UF7C 2QT6A 1AIZA 3AY2A 1ZDSA 1SF5A 1CYXA 2IDFA 2J5WA 1GY2A 3NJIA 1ILSA 3FQ2A 3SBQA 1J9QA 3NJHA 1URIA 2H3XC 2DYSB 4ZK8A 4NB7A 3T71A 1JZGA 1MZYA 2YAHA 3IE9A 4N8UA 4YSUA 3UABA 5I6KA 2HXAA 2NRDA 1V54B 2VW4A 2E86A 2EINB 1OCZB 3HEIB 5I6OA 3FSVA 3ABLB 2PP9A 4KO7A 1W8EA 4E9VA 4W9ZA 4HHWA 4WKXA 2GIMA 5ANHA 4KO9A 2BO0A 2UXGA 1UATA 1GYCA 3IN0A 4EF3A 3TBCA 2DV6A 1L9QA 3X1NA 4A2DA 1PNDA 2BHFA 4YSTA 5B1JC 4YL4A 1RCYA 1FA4A 1ZIAA 3FPYA 2Y69B 1WA2X 4DP7X 3UAAA 1KDJA 1L9OA 2B08A 4GP5B 1E67A 4YSSA 2WSDA 2VSKB 2XXGA 3ASNB 2HX8A 3GDCA 4KOCA 3PCYA 4Q89A 1GSKA 5B1AB 4BK5C 3C75A 1ET8A 2YAMA 1J9SA 4QLWA 2UXTA 2QDWA 3OMIB 2FWLB 5I6PA 2BZCA 4P5SA 2RACA 2X88A 1KV7A 4F2EA 1EHKB 2YAQA 1SJMA 1ET7A 3AW5A 4DP8X 1BQRA 2PP7A 2VW6A 3V9EA 2XVBA 3JTBA 4YSEA 2FNWA 2BZ7A 5E9NA 1SNRA 2XLLA 2ZWNA 3DTUB 1PNCA 1JOIA 3V9CA 1JZHA 1M9WA 1JZFA 1KBWA 2XXFA 4JKNA 1KCBA 1T5KA 3FT0A 3CZUB 3H4FA 5AZUA 1W6LA 2I85A 4WTQA 4A68A 1E65A 1GS7A 3TA4D 3CVDA 4GP8B 3TBBA 1NIBA 3AZUA 2HLEB 4L0PB 1L9SA 3CVCA 4BDVA 1XB8A 1NTDA 1MZZA 5I26A 5F7AA 4E9YA 1IUZA 3NP4A 3T9WA 1AS7A 1AG6A 2X87A 4BWTA 1ET5A 1SDDA
chains in the Genus database with same CATH superfamily
2VZOA 4XWOC 4KTEL 1H8OA 4MMZA 1KN2H 2ORBL 1ZDQA 2JV6A 3OG4B 1AGCA 4I77L 4XGZB 5C07B 2C5DC 3TT3H 2IAAC 4HIXL 5FYJD 1OM3H 4ZAKB 5AYUH 3BP7A 5IFHL 3IJ7A 5C8JB 3H7LA 3WLWC 4DPBX 4KX9A 4WV1C 1U8MB 4PJHE 3S88L 2K70A 1P7KA 1SFDA 2UV3A 3RWCA 1HVXA 1U4FA 4NQXA 5IG7A 1LL1A 5JLZA 1TU2B 4MGXA 2E47A 1WBZA 4ISVA 3V0DA 2VQ1B 5DMYA 1EZVX 1JL8A 1HDMB 3CLEH 1QHPA 4YOKA 2ZOTA 3LHPL 2X70A 1QFUH 1SXBA 3MRHB 5IJBC 5J6HA 4PMFA 2B8OT 1BBJA 2VXVH 4KBPA 1S9XA 2BY3A 3CK0H 3FRPG 2CJ3A 3UBXG 3OGCA 5T5FH 2XWJA 4OI9A 3RVTC 2WSPA 1MQKH 4LFHD 2VMCA 2GI7A 4AIEA 3PHSA 5FYKE 5D1XA 4JPKL 1UGKA 4ETQB 2VLJA 4HUWB 2GTWA 4YEFA 1HKLH 4FJZA 1N68A 5HYQA 1K4CA 4PJAE 1QNIA 4XP9L 5DK2B 4HBCL 2AJYL 1TFPA 3U0PB 2HMID 2WBWB 3FSWA 3EFOA 2NY4B 2APWA 4TQHA 2JXMA 1S7QA 4YJZL 2HFGH 2Q20A 2ID5A 3KVDD 4XPAL 2YPLB 4AMXA 2Z92B 1MLCB 3BO8B 1HL8A 2HT3D 1FO0L 1S9YA 2FBOJ 4HAGA 4X4ZA 3F7KA 2BZDA 5DRWB 5G2NA 3VYPA 3GLEA 4IDJH 5IOKA 3NGBB 1SXAA 2A83A 5LGJB 5E8OB 4ZW7A 3RUGE 1GC1C 4UINH 4JE0A 4MLSA 1MCPL 2OCJA 2RQ8A 4XO9A 3L4UA 3ZR6A 1DVSA 1FSKC 1T6WA 2IFGA 5F44A 4GXVH 1SJHA 2FSDA 3LS4L 4PD4K 4JBSA 4G11A 1DJYA 1R5WA 1SEBA 4XCFL 4MCNA 2V17H 5IJKC 1N70A 2QVMA 3EW3B 5I1EH 3CBJB 3BUBA 5FYJE 1ZHKA 4IRSA 2OMYB 2A73B 4TV3A 3DTXA 1E28B 1UVQA 2WD0A 5TF1L 4IOIB 4X98B 1EERB 4K94L 4P99A 2JELH 4TVPH 5D2NA 5EHFA 2Y06L 3JVGC 2AJUL 4J3BA 2XWEA 3EDKA 2KPNA 5C6WH 5DS1A 4GG6B 2PKDA 5E2VH 1ROCA 3CVHL 25C8H 4OV5B 4XB8A 4N1CA 5JHLL 1D6VH 3L7EB 4J3OG 4LL1A 4X6CB 3OF6A 4N5UA 4NQDE 4XP6L 3DJSA 1RURH 1GPOL 5L2KA 1CDJA 2A4EA 3WIHA 5I1KL 2ESVB 2DJSA 5DD6B 4ADIA 5AW7B 5DS8B 3ROOB 1Q4NX 3CH1B 5JA9A 1EANA 1XGZA 5E8PA 3R1GH 5C86A 2EUVA 4RDQG 5CKGA 3SKOB 4XPGL 1ACYL 3FT2B 1JF1B 4NFCA 5D2LB 4AENA 5IB2B 3NABH 4LCWD 4WFED 2Q9OA 2HYMA 2VAJA 3D1MC 4K3DL 3R8QA 3RPBA 2EXWC 2XYBA 1DVFA 3EBHA 2K6ZA 4N2MA 2UXFA 3M17B 2NZ9C 3E80A 2YPVH 3FFCA 4WIQA 1AGFB 1HCVA 2Q8AH 3VRIA 4QHKJ 4QT5B 1TKWB 2ZD0A 4OZGF 3OV6A 2Z93B 4UILL 3H0TB 4G6JH 5EA0L 3ES6A 4Z7NB 1J86A 3D25B 3U46A 3BN3B 3AT8A 4WSKA 3LPWA 2A3TA 4L9DA 4GMSH 1BBDH 2DQTH 4WW2A 3HW7A 4PB9L 3FRPB 3UBXB 2WOBA 1P4BL 1GOGA 2E0PA 4IRZH 5IB1A 2IDCA 4N26A 4NN7C 1CE6B 5DZVA 4PWEA 1ETB1 4HGWB 4KTDL 5E6SB 3RNKB 1K3ZA 2J8UE 3WKML 2BW5A 5BRPA 4V1DE 2W88A 1B4TA 2CJTA 4G3YH 3DKHA 3PAVA 4TQIA 4Y8DC 1OALA 2DLGA 5HHVL 5IESH 2BWIA 4BKTC 4L9LC 3DURA 3I9GL 4MJ6B 2ZCZA 4KJPD 4HG4J 4GOSA 4ONHB 2B1HL 1AR1B 1MPAH 2PCPA 2N0KA 3NP3A 1JI2A 5GZOC 3TJPA 3LIZL 1Q9KB 2LT9A 2ZNWA 4Y9EA 2DQHL 1G9MC 2FX8H 5CIPH 5DMIH 1IIIA 4HH8A 5C6TL 3BLPX 1LO5A 1UWGL 4WWID 2WOYA 4RQQA 5B38G 2W0KA 3QORC 1XR8A 1YQ2A 5IB3B 2WUCH 1WEJL 4X7TA 1U8JA 4PW4A 1FE8L 4R97B 3ZDZF 5DRXA 4ZQKB 3I6SA 3S7GA 5HHNB 1F6FB 4U7SA 2EDOA 4S1RH 1DUYB 4NQCD 4FTDA 4JFZH 3WV0A 4HBQA 4NQTA 4PJDB 3ZL2A 1QSFA 3CFJB 1FAKT 4EBQL 3BFWA 4NO0B 2V5SA 2W95A 2Z4TA 2VLRA 1J88A 2KZKA 4Y4HC 5AW9B 2VXSH 3S3BB 3ZKNC 4HWBA 3QCTH 1YJDL 3GFUA 4UV7H 2GYSA 5T1KB 5IKCB 2H0PA 5BVJB 4HUCA 4M7LH 5HHMD 1XXFC 4LCWE 5AB0A 4WFEE 4HWZB 1AZVA 1B0GA 4KQ4L 2VXQH 5BV7B 4G8GB 2J73A 1S4IA 2H1PL 4QI3A 3FUDA 2J7LA 4PJIB 3HNVH 1HEZB 1EHLH 5E5UB 4UB0L 3BPCA 3K6SB 5DZJA 5TH2A 2Z0UA 3HR5B 3VSVA 1AO7D 2H6PA 2CCWA 2IQAB 3DI2B 1KXHA 5JHDD 2JWYA 4IBVA 3MOAH 1EAOA 3REVB 1EAPA 4OZHE 3MRMA 3WXWL 3RGVA 5JPNA 4I4WB 3OJVC 1ZWIB 4HWEL 2R27A 2ZOLA 4R7NA 1HT6A 1CDGA 5CCGE 1YEJL 1WO2A 2YRPA 3RAJL 3VGDA 1YY8A 4MXWH 3ZW3A 3MHZA 1AKPA 4UUJA 1CDYA 3CC5A 2VDKL 3NJJA 2I07A 2VN3A 2IBZY 2WZAA 3EAKA 1ERNA 2K45A 4OZFG 4WF7A 5ES4B 4N2FA 1FG2B 3RU8L 3A4FA 2A6JB 1ZSDA 1ZS8B 4MBRA 2ZYSA 2AK4A 3A0OA 1ILUA 4K23H 2DWEB 1EMTH 2PYEB 4Y4KD 2DI9A 1SN2A 3C08H 4I0PC 4M7KL 3RX9A 4DTGH 2CHZA 4EZKA 1GIGH 4FJYA 4OZIE 4JFDB 4YS4A 1G9ML 2FK9A 1T5WB 1MI5B 2VMJA 4JFFA 4NQCE 4P46B 2L7QA 1MJUH 1SVBA 2X6VA 2J57A 5JOEA 1X5IA 3HC3L 1FORL 2UX7A 1MVUA 2CPUA 5C1MB 1E4WH 4EI6A 5CCJA 1HQRA 4FYQA 1IC0A 4HOZA 1BFOA 2CDFB 1NBZB 2ZF8A 3NFNA 3CXDH 4LDLB 1BQUA 1PY4A 4M8UA 4IIQB 1UADC 5HHME 3RWHA 2IEPA 4P2QE 5F88A 3SE9H 3SGEI 5ABZA 2WSKA 3TZVA 3S37X 5B38B 2NR6D 2I5YH 1OSPL 1XH2A 4XN1A 1LQBC 4IQHA 2BCMA 1XZ0B 3W11D 2VR8A 4ZMAT 3BZFA 3DYMA 4OIIH 3FDWA 3IGLA 2F61A 1XSOA 1ILSA 2XYCA 1F3JA 4J7RA 4XTRD 5B3JE 2CA4A 1MZYA 3LZOA 4YSUA 1AO7E 3PAYA 1A9BB 1BOGA 2PTVA 4BHUI 3VTTA 5I6OA 4LPXA 3D69B 1IFHL 4KK6C 3FOLB 2AEPH 3CFBB 2PP9A 3QZBA 1U8HB 1G7IB 1W72B 3R7RA 2FIRT 3G5VA 4WJKB 2H1LM 2OL3H 1RK0B 2AJSH 1EVUA 1R5IB 4DO4A 4MD5A 1I1YA 3JV4A 5E7FA 3TBCA 3H2PA 5EOCJ 5F7KC 1T22B 4W6XB 5IV2A 3NRQA 1GOFA 4CC4C 1WAAE 5DFTA 4U6XA 1IX2A 2YD7A 3KHOA 5LBSH 4UNUA 3KPPA 1LD9A 3Q1SH 5TE7H 3V0GA 4L8SB 2VYRE 4TLKA 4G5ZL 1WZ1H 1JGDB 1JPTL 2VSKB 5JUEH 2HX8A 1XBDA 4YWGL 1CFSB 1Q1JH 4XMVA 4YHLL 3QYMA 2BOCA 5DEJA 4GW4B 5DRNA 4POZC 3RX8A 2VERA 3I3EA 1H5BA 4G6KH 3DYOA 3OAUL 4MX7B 3ZDXB 5I0DA 4XPTH 3BDBA 3EADA 2V4LA 3AW5A 4EVNB 1KV3A 4DP8X 4S0TD 1P1ZB 5HI3D 3T3MB 4CILA 2CLRB 1MNNA 2OQJB 1RIUL 3Q7JA 5D1XD 4M43L 2VLJD 5DF0A 4ZUTA 3Q5YA 4RGNE 1PYWA 4WK0B 3GSUA 2FX7H 1RSFA 5CR1A 2J88L 2A9MH 3JWOH 4LPTA 4OZFB 4WCYL 4J6IA 1SXNA 4UAOC 3H9SA 5JIIA 4AQEB 5DJ0B 2UYLA 4J4PC 4YHKH 4WZ9A 5IM7A 2OR7A 3M8OL 2APFA 2CKBA 3S37L 5I1AA 1NCAL 1RK1B 5MERB 5CU9A 2JKSA 5EH1A 5FYKH 1MHHA 3QEHA 2WXHA 1A6VL 1JHLH 2D9QB 4A68A 1Z3RA 3WELA 1L6ZA 4Z7UE 1VSCA 3F7VB 5ACMA 2H0JA 4Y5VA 5MEQA 1VDGA 4ATWA 2OJZL 4FEIA 1A7OL 2UVFA 4WDIA 2Y7MA 3RY4A 2LFGA 4AUJA 4XOCA 1NFDA 4LPUA 1FO0B 1R3JB 3MNZB 3FCBA 1D3CA 2WBKA 2BPBA 1AZRA 3T04D 2J44A 4AVHA 1DUZB 2NTFB 3NZSA 4H25A 3SKNB 5I6XB 2NY2C 1RIVH 5D4QA 3QB7C 2YZ1A 3SCMD 4GG8B 2CIIB 4AKOA 5F8RC 2DQ6A 3F12B 4CN6A 1EZLA 3P0YH 5DJYB 4YL9A 2RIKA 3Q05A 3LQAH 1IGCH 4HIIB 1QLFB 2Y23A 1QD0A 3DUSA 2VR6A 1IT9H 2IOOA 1GZQB 2WLIA 5F7UA 3ZHLA 2E8ZA 1BZEA 1UWXH 4U7MA 5F9DC 5HI5D 4ZODA 2C9XA 4LRNL 3CDYA 2DM7A 2VQ4A 4GJTB 3BDYL 2FR4B 1G6RL 5FC9A 1TETL 1UEMA 2GTZA 4M8QA 5FYJH 1PZBA 3BKYL 4FG0A 4XI5D 5E95B 1XMEB 1YN6B 3GUFA 3OF6D 1ZJAA 3S3PA 2FGZA 5L2KD 4HX1A 3CFIC 3NCWA 5CLZA 3OKNA 4YBQD 2EDBA 4M6NH 3D0AA 2NMSA 1DQTA 3NCBB 2JJSC 5E1IA 5DUML 4AXWB 1IAII 3CVHB 1VFBA 2P8MA 3CFEA 3DVIA 3IDMA 3QNZA 1A4AA 5D1XE 2JE8A 1QKZH 3FYIB 2DLEA 4LCUA 2VLJE 3CSTA 4UQ9A 4N2CA 2ZG1A 2ZOKB 2EE3A 3GI8H 2XWXA 4MAYC 3VI4B 3ZDWA 4ZT1A 4JGUA 4ZJ9A 3T4AA 2ISDA 3EHBB 1GZPB 3FFCD 5A3IC 3GS4A 5SWQB 3WO3B 4LVHC 5BUGA 5EO1B 4P9HL 2W65B 3CBKB 3TT1H 4PVLA 1CGTA 4G6AD 1RP9A 5CD5C 1QR1B 2V7NB 2V8LA 2FB4H 4BSVB 5DMGC 4ONGH 3T0BA 4IHOB 1XV8A 4X6DB 3FJTA 3SOBL 3UTOA 2CALA 1CZ8H 2VR5A 3C60C 3P9LB 3RDTB 1VEPA 4FE9A 1YEDA 3GSRA 1DQDL 4FNTA 3QG6B 3ZMEA 3J2PA 4H1LH 4PJ8B 4MVBC 3T65A 2EH7L 3EOBA 3RTQC 3MRFB 3DHJA 2IXQB 4L29A 1UT2A 4PJFB 3V5HB 5GSRB 2VZ3A 4PJEA 2JH2A 1I8KB 3ZKXB 3MXWH 5JXAH 2NYYC 4P5TB 2YK1H 3PQYD 1AOZA 5ESQA 4IGBC 3QUYA 1MCIA 3CSGA 3H9ZA 3T0DA 5LKNA 2BDNL 1LE9A 3RDJA 3MV9B 1V55B 3NIDE 2ZG2A 2X6BA 3KPRB 1EBPA 1GGIL 2AQ2A 2ZX9A 2QPEB 3MUGA 5JNYB 3TWYA 2P8LA 3DIVA 3PL6A 2E9WA 4RMBA 3JT2A 4NM8H 2PPFA 1NGZA 1B4JL 4GFTB 3ZZQA 5D2NE 5BQ7B 2Y6TE 2O30A 3RLSA 1TFHA 3S34L 4BRJA 3S35H 3VE0A 2F5BH 4QWWD 1BQSA 1IGTA 3QEUA 2NY6D 4A7UA 5DJDB 3GDBA 1QSFD 1SDDB 2HG5B 5IFAH 4GT0A 5AOZA 5L2KE 3PV6A 4QXGH 2FO1A 5FGBC 1T1WB 5A6IA 1F02I 5AYUL 5I8OH 3WY2A 4XNYH 3DRTA 4QRSB 5DJCB 4Q9QH 3IAQA 3BAEH 3UGUA 3CFQA 3NCXA 1QBBA 4ZUVB 4L0YA 3EUUA 4PEEA 3D39B 3GPSA 1RH8A 3B2VH 1KB3A 4LKXB 4ANWA 2Z91B 5DU7A 4I9XA 3CFMA 3OPZL 4RMTA 4YDKH 3ESMA 3PJSB 1E0OB 1KJMB 5H4ZA 2ADGB 1S6NA 3NVQA 5GGSY 3ILQD 2VC2H 4MHHG 3HB3B 3CLEL 1QLEH 3FFCE 2EIEA 3G08B 1DQJB 4E5XA 1V27A 5EBGA 5FKAB 4P49A 1VFUA 3OR7A 2DI7A 3UTQA 2X4TA 1LO0H 3VD1A 2IDTA 1JGLH 3TA3C 1A4KB 1JWUB 5LQBH 1IBZA 2FJSA 2VLKA 4QRUA 5GS0C 1GXEA 3T08A 3P30H 1MQKL 5B8CA 2B16A 3D4GA 1MFUA 1T4KB 4P2OB 1HHHA 2LE9A 1OGTB 3E38A 5I17A 3FQ1A 3EJQA 4LARH 3OKDB 5AAMA 4BH8A 3MR9B 3FN9A 2TAAA 3MO1B 1OK8A 1S7XA 4KAQL 5ETUA 4OFDA 1VAHA 4AV4A 1EA9C 2HFGL 2ICWB 1U8NB 5CCKL 4X9GA 1DBJL 3WHXA 5C0NC 2CRIA 1OSEA 3P3YA 2DKUA 4PCSA 3RYMA 3IMRA 5LGHH 4NYLA 1WFMA 2VOTA 4K8RD 3FUIA 4L4VB 2L04A 4X9FA 1MUJA 2OTUB 4AVKA 3AXIA 3PWVB 2ED8A 2VDKB 2AK4D 4IDJL 2DEYX 2QSQA 2XTJC 5AKVA 3I50H 5JHMA 1FFOA 3C6LD 1MCFA 2CDGA 4UINL 2DRUA 3M88A 2JKJA 3NSYA 1PZ5A 5EWIL 5FK9B 5BJTB 3MRLB 1A02N 1MDTA 4LSTH 5I23A 4JFFD 5FOBB 3UEQA 3AG2B 4K9EL 4U1GB 2G5UA 1KJ2L 1XMWA 2WBXA 2V17L 3GMQB 3KDPB 4Z7WF 4TUOB 1QSFE 3MRJA 3QQDA 4HV8A 1HINH 5I1EL 2VLRE 1FF5A 1GH7A 2J43A 3TBYA 3V7MA 4PJBA 4C56A 1H6FA 4IBUA 1OAQH 4FTVB 4ZMOA 1U8PB 4QNPE 1NLDL 2DTSA 1DSFH 5C0DA 4QOKD 4P23C 1FJ1A 2IH9A 3ARGC 1JPGB 2JELL 3Q9PA 4PJXF 4Z7IA 3I74A 4UT6H 3TZVD 4FG6C 3QHZH 1W0VB 4FMKA 4EAEA 5JZ7C 5FUOL 4FQ2H 5KSUB 2Z31C 3AJ7A 5E2VL 3VWJA 1J7VR 4FZ8H 4PJ9B 4NQSB 25C8L 4QYOB 2DMBA 1XGRA 1RL1A 2H32A 4ZPTB 1D6VL 2ZTBA 1JGEA 1GR7A 1SFHA 2Y2WA 2YBRA 4LOFA 1EAJA 1CYWA 3PLYA 1BJ8A 4OT1H 2BOBA 2F15A 3ZIYA 5JXEA 5DEFB 1SJXA 1ODUA 1TTRA 2WAHA 2LLLA 4HQQH 3MODH 1JG9A 4OM0H 2ALWA 5AB9A 3TU6A 3R1GL 3TN0C 4NZDA 3PGDA 3V6ZA 2V33A 3HG4A 1WWCA 3Q3GA 1N0XH 3ZUCA 3Q5OA 4GBXC 4LDEB 1T0MA 2QZQA 4CJ0A 1JXFA 1W8OA 2BVPB 5D8JL 2YPVL 4BFIA 3GLZA 3VXSD 1SY6H 3ZE1E 1EJ6A 5GS0L 2Z64C 1EWHA 3EBAA 3CZGA 4G6JL 2OXGA 5BW7A 4Q2ZB 3S96A 2LU5A 4JN2B 3ZDYE 4A66A 1S9WA 3PY9A 1MRDL 2HVKA 4GMSL 1BBDL 3GMOB 5DEGA 1NDMB 2NXYC 5LDUA 1XCQA 2AK4E 4G7YH 4IRZL 4KY1H 3RBGA 1HH9B 3MROB 2VDNL 4WO4A 1AJ7H 2Y6SD 4YDLB 2XKNB 4DF9A 4L2LA 5EUKA 1WS7A 3DWTA 2XZQL 4PG9A 5HDQH 2EDLA 4PV8A 2WZ0A 3G6JF 4XCNA 2K1MA 3LXBA 4P48A 5B21A 3FTGA 3KWVA 2ZWKA 5J57B 2R2BB 5AVRB 3JWNC 4ZOCA 4JFFE 5JW4Q 1O7VA 5GSVA 2A74A 3MRPA 4UANA 3ZRSA 3MJ7B 5MEOA 1JERA 2Y1AA 3A47A 1MPAL 3WJLA 4LSVL 4OAWA 5CEZD 2FX8L 5E8EB 5DMIL 1M6UA 1BQHG 4ICXA 3PDOB 2ADYA 3RJDA 2BLFA 3FK3A 3K6OA 1AZUA 4O02L 2IH8A 4LCCB 3UZEC 2MKLC 1WSST 3A21A 2Z34A 3H9SD 5J3HC 5KVDE 2WUCL 3ISYA 4R83A 4PTUB 1S8DB 3IKCA 3QXWA 3NJXA 3VFSB 2X1WL 4XC3H 5A7BA 1KJVB 1EGJL 5CMAB 4S1RL 4BFKA 1RUPH 3ESOA 3KYMB 3NA4A 4JFZL 3RG1C 4Z18A 2BIPA 2OCFD 3N9GL 4X8XA 3NJHA 1ZA3B 4M48L 2H3XC 2O6EA 3L3HB 3GSOB 5IQ7L 2QL1A 2XN9D 2HLFC 5IHUL 3QEGH 2WWKO 5AOMA 3RFZC 1CGWA 3QCTL 1M6OA 5CN3A 4XE5B 5I75B 4UV7L 1HYSD 3ABLB 3IF1A 4U1IB 1NMAL 5KN5B 3IJYB 1XF1A 1NMCC 1QI4A 4YXKH 1J0JA 2V5MA 3WFDH 1MY5A 4M7LL 5ACZA 3KVQA 1G7MB 1GYCA 2BSDA 3C09C 4KJYB 4O2FB 1ROWA 2K4WA 2VXQL 1WGOA 2JQAA 3U36B 5CM1A 1T66D 3HNVL 1EHLL 2Y36H 1FDLL 3FU5A 4FNPA 3HZYB 4X5XA 4X9BA 5FECA 5T8IA 4BQ6A 1G7JA 1OP4A 3HG1B 3MLWH 4JKPH 5IZ7A 2Q6WA 3KPQA 4RNRA 4AC4A 2HH0L 3ELQA 3NIGB 3PCYA 2DYPA 3MOAL 4J1UA 5D6CB 3U2IA 1ET8A 1OL0A 1M2OA 1U91B 2UZPA 3AREA 3DOIA 5DURB 4F9LA 4XBPA 5D7JA 1ZE3C 1RMFH 4P5KA 3UL4A 4K73A 5AKTA 3ZSSA 3C5SB 2BRRL 2VR7A 5HY9B 4BZ2A 1H8NA 2H0EA 2UY6A 5F1IA 4U6HA 4DOHB 4OGAD 4UIKH 1G6RB 4BCZA 5AW8B 4E42A 3QUXC 5IB5A 5JR1L 3VFGL 4YSEA 1NGYA 2KQNA 3BSZL 4MD0B 3R06A 3ARXA 4NNPL 5A2FA 1DEEB 1ZMYA 4GI6A 4IJTA 4R7DA 4X6BA 5D71H 5E9NA 5LDSA 5KBMA 5E6IA 3UOAB 4ODSL 3F5WB 3WHE1 1JZHA 4TNEA 4PTTA 1GCYA 4N68A 3H9SE 1EMTL 4Z3HA 1E43A 5TDNA 1YHPA 4PYGA 3C08L 4LBEA 4DTGL 4EUPA 2VMFA 3L6FA 4YK4C 4GXUM 5E9DB 4UQDA 3VX1A 3NA9H 5H8DA 3CVDA 1S7SB 1MJUL 3AZUA 3VD4A 4L0PB 1NJ9B 3WY3A 3QUHA 3WYRA 3LKSB 3BPOB 4HC1A 1O5DT 4BFNA 5E08H 3LNIA 4OBSA 4YUEL 4G43B 3NP4A 1E4WL 3VXQA 5DZPA 2E7LC 1M2VB 1FC1A 3MBEA 2P7TA 4BWTA 3TEZA 5H4YA 5I9QC 3EBGA 4ZBJA 1B2WH 2X38A 3VI3B 4HK3J 1NFDE 1QW8A 4PRHA 3BX7C 3CXDL 4LO9A 4YSAA 1BQHB 4W9KC 2QMKA 1CXKA 3EJUA 3SE9L 3EFFB 3KWXA 3TJHD 1FVEB 3G5YA 4LLQA 2I5YL 4BYHA 3AQDA 2X1OA 4JFED 3BP5B 3QUYD 4U1JA 1FCCA 4OY9A 3BWUC 1R3IH 4G9FB 3CN2A 3GWJA 4OZ4A 4XMTA 1AGDA 1LE5B 2PO6C 4JZOB 1A0QH 4OIIL 5AVUB 1ZJBA 3X11B 3NCCB 4AEIH 2ZF9A 4LAJH 1LDSA 3MLSH 1M1XA 3HKFA 4KNTA 1Q0YH 3I6GB 3QDAA 4NLHA 3W37A 5F9WC 5GRVK 4FL4B 4AQAB 4ZFGH 1PSKH 4RZCA 1XB6A 4DK3A 3O2VH 4OFVA 3VRJB 3O8XA 4DGIH 1VENA 1MCSA 4NQVA 4AQ1A 1KGCE 1XZWA 4FYRA 4MAZA 3BQUC 3MJ6A 5EU6D 2AEPL 4DEPC 4GH7B 5DVNA 1GS8A 4JM2F 2XWTB 3OSKA 4KKAD 2OL3L 2AJSL 1XVSA 2WWKT 4JHBA 4R5VA 2HKFL 2R4RL 1NSNH 1BZ7B 2ICEB 5DJ6B 4ENZA 3RZCA 5C0BA 3PHOB 3B5GA 4H20H 4DK5A 3CH8A 3QFDA 2AABL 1B6DA 1IKFH 4FLRA 4FD0A 1ZA6B 3KLHD 5LBSL 1JP5A 1KXTA 1IAIM 1I9IH 3OMNB 3Q1SL 5TE7L 5KOMC 1WZ1L 1JNNH 5DTFB 3MFFB 4B95C 3ARBB 3P1VA 1BVLA 3F65A 3W9EB 5I5MA 1CO1A 5C0GB 4HIPA 2B9AA 3QNXB 5T33H 2HN7B 2RA1A 5CP3A 5I0ZA 1N8OE 2WO4A 3OG6B 4Y2DB 4MDIA 1HHIA 5D4IA 3T3PB 1UT9A 3JQOB 3SGDI 1ANUA 4APQD 1OK0A 2Q7NA 4BCXA 5I76A 4RMVA 2LTQC 1L9MA 5DSCB 1J8HD 2VLKD 4NKMB 4BFGA 3QZWG 4AZUA 3QFJB 4O2EA 1FFPB 5IEKA 3TNNA 3CFKA 1BFTA 2ZKXA 4H8UA 1FH2A 4OF0A 5DFVC 2ZT9C 2YD2A 2FX7L 3U1SH 1ED3A 4HSQA 2A9ML 3JWOL 1DR9A 1MFCH 3GPEA 4HJ1A 4FNRA 3GMPB 4YHKL 2XJLA 4EDWH 5JPMA 2LU3A 4I48A 2ADIA 2X05A 4I18A 1Z0NA 2OI9B 4PJEE 4ATTA 2NZIA 4LVHB 3ZYZA 5IMLB 3MPCA 5T3ZE 2WN3A 5I66B 5FYKL 4YDMA 3LH2H 1JHLL 4JREB 4UDTA 2OSLA 1Z66A 3DHUA 4JO2H 4E9QA 5E4IA 1TEGA 1H6UA 3D3VD 4PAZA 3N1FC 2HJKB 4X5RA 2LU4A 4UAHA 3E8UH 1Y6KR 4HZAA 1M7IA 5D5MF 3KYNB 1J87A 3WEOA 1Y0LA 3IJHB 2W59A 3GSXB 4KK5C 4BKLA 4BBWA 1U30A 1YG9A 1DZ0A 2EUXA 3T0EB 4XMLH 3MGAA 2I9TA 3MCKB 3D9AH 2K3HA 1R3HB 3FHEA 1RIVL 1RPUA 4G9DB 2XV3A 2YD8A 3MCYA 3SSGA 4RWHA 3CIAA 3DGCR 4Z95H 1VF5C 2GJ6B 4LLDB 3CDCA 4IGBB 4UOW1 3P0YL 4D3CH 2GY7B 4GIOA 3DUUA 4Y4FB 1IGCL 1ZXKA 3MUUA 1KJ2B 5DO8A 1MFDH 3CLWA 4DGUA 2W60B 3S3JA 2CO3A 2E3VA 2O5YH 4BK5A 1A7RH 1D2PA 5KSAD 3ZRFC 5CP7A 2LVCA 4FYSA 5I6LA 3IXAA 5IK3A 2FZ3A 4P5RA 1JZ3A 3VWJD 3CZLA 5DZAA 4HWBH 4NDMA 1TVHB 4AG4H 2ZSVA 4RSYA 1I75A 4YHYC 2R51A 2ODIA 1DQQA 3O3AB 1QWHA 3SQRA 4M6NL 4IU3A 1VLXA 5CLTA 1Q8MA 2BS8A 2VLKE 5DD3H 2ZOOA 2ZP0T 2J21A 1P9MC 3X12A 4KX7A 1KB9J 1QKZL 2P8PA 5E00B 4OKVB 4E41A 7PCYA 4YE4H 3BMVA 1MWAH 5BXFA 9PCYA 1KGUA 2NY1D 3GI8L 1QO3A 4K9JA 5I16A 4U3HA 1A7NH 4JHUA 1FLRL 2X4QA 4XNUH 5CZXC 5KVEE 4GFXA 1KG0A 1OAYH 4P2RA 4UMSA 1KNOA 1VFMA 4YXLH 2UZXB 3SQBA 3TF7C 4YLBA 3ZU8A 5IBTH 3F84A 2HSIA 5ABDE 2C4XA 1P5VA 1MDAA 3TT1L 2YWZA 2OA9A 4W70A 1KLUA 4HP5A 2HLAB 3WKNA 4V11A 2FB4L 5AVYB 5EC1B 3W3BA 1I8IB 2E9GA 2HRGA 3MV8A 4IMLB 3GSVA 3HS0B 1CZ8L 2BK8A 3L48A 4FQHA 5TGBA 3U48A 1SN0A 1UGNA 3PWUB 4WO4D 1UZGA 3QIUB 3LQMA 1KPRB 1BX2B 1QTPA 3QZWB 4N9OB 3X1GA 4QTFA 4YFLF 5B3NA 4YSRA 2NSXA 3CSYA 5I1JL 5KW9L 1E4XL 1EFXD 4H13C 1ML0A 2GITB 3TVMC 4Z3JA 2NNFA 2XSKA 4K8RH 1E3XA 5EDSA 2VDNB 2CJUL 1YEKL 1YY9C 3MXWL 4MBOA 3C6SB 2YK1L 1JPSL 4TLTA 2PXYD 4NNXB 5FW7A 3BE1H 3CZSA 2GBTA 1P53A 5FM4A 1YUHA 2CAKA 4OLWL 1PLBA 4Q9RH 2AV1A 3IGFA 4C56E 2P3YA 4PJBE 2I9LB 1E5AA 3P02A 3CHPA 4RBPH 2FWOA 1G7HA 5IVXF 1ODAA 2Z6FA 4M9PA 3MRNB 2R7EB 4K5OA 5CJXA 4HLEA 3BKMH 3ROLA 5CIPB 4M00A 1DE4A 4LQFH 4C83A 4IOSA 4NPKA 2BP8A 2EIMB 1QBLH 1AHMA 2F5BL 4KZ0A 4O02B 2V5YA 4R2GB 1TZOA 4F7EB 4N6QA 2WVSA 1FYTA 3BFOA 5IFAL 4RX4A 1A47A 3FC8A 5KVGE 3QZMA 4J12A 1NCCL 4Z7VB 2X0WA 3P54A 4W4OA 5DUPH 5KVDH 4LHUA 2R39A 5DQJB 3AY4A 1UA6H 4Q9QL 5AAWC 2IANA 3BAEL 4W6YB 2A9BA 1JRHH 3ZKSD 3ZOAA 4GRMA 4D8OA 3ENEA 2O6PA 4LVOC 3WS6A 3IVKB 2WQ8A 3Q0HA 1K8DA 1R75A 4G70B 5AKRA 3B2VL 2NW3B 2X4NA 2CBMA 4D9LH 3HZVB 2BVEA 5IROC 3T8VA 4YDKL 5C0RH 1I1RA 5KYYB 4CVZB 3SDDA 1RZJH 3TIDA 2VC2L 1QLEL 3UZVB 1W0WB 1HHKA 4GO6B 4NERA 3SDCC 5K9QG 1OV8A 4KXBA 4PJCF 4B50A 1MCOH 1OAKL 2FL5A 3BXNB 5F93C 2WUBH 1R5VA 4WKZB 5HD8D 3TURA 1OWWA 4BA0A 5LQBL 2DMCA 1NCUA 3OBAA 3DJRA 3KYAA 1NIEA 2V7HB 3C5ZA 4TQ8A 4MA3B 1DJZA 3P30L 4TUKL 5LBGA 4H2CA 2XC8A 2D7QA 3NFPA 3ARDA 3DOHA 5T1MB 2GSIA 2WLYA 2XFXB 4KMQA 4AYMC 2AJ3A 3EYFB 3VRLF 1CWVA 2HJFA 35C8L 4DH2A 3C8KA 2QVFB 4K3EH 5GXBB 3PG2A 4R26H 4H40A 4RAVB 3CDGB 2E7DA 3F00A 3U30C 2DLFH 5ITFA 4GO8A 4FLSA 4BCYA 2C4FU 5EPMA 1KBBA 5HGAB 3KW8A 4KDWA 1U3HD 4RMUA 1JZEA 4BFEA 4DERA 1MFEH 2WCGA 5F96H 1U8OA 2KLTA 1U8MA 2YD6A 4S1DC 4OF7A 2DQJH 3NUKA 3MX0B 4U1LA 4UF7C 4W68A 3ZE2B 3MXVH 3SB3A 2QSCH 1OP5H 3PFUA 4I13B 5BZDB 1CYXA 3CX5J 3V8CA 2VQ1A 5HDBB 4HS3B 1MIEL 1HDMA 1ZANH 4LSTL 5CEZH 2Q76B 4JKKA 4ZK8A 3KZ8A 4HT1L 2HXAA 3U0TB 2EINB 3OKKB 4JB9H 5DT1L 4XVUD 1ETA1 3LKPB 2B39A 3IGAB 1OAQL 2CKBH 3AADB 3EBIA 4W9ZA 5KSBB 3NACH 2CNYA 1DSFL 1YNLH 2HUHA 3HMXA 4WEBH 1MLBA 1F4XH 1U8IB 4HUWA 3V0WH 4ETQA 2ZUQB 1EXUA 2DV6A 1XD1A 2J1XA 4GSXA 4JPQA 4YHOH 4A55A 4Z5RA 4UT6L 4QY8A 4A2DA 5DK2A 2BHFA 3QHZL 3QUZB 3WDIA 4FQ2L 3HTLX 4FZ8L 3KXFA 4R0LA 1A9EB 3U1QA 5F1NB 4FFVC 5DMKA 4C4BA 4I1RA 4YSSA 3UIZA 2MIZA 2Z92A 1MLCA 3BO8A 4WWKB 1BM3H 3OC8A 2Y07H 2WLLB 1IILE 1VADA 5AW5B 4HQQL 4XNBA 5DRWA 4OM0L 1A22B 1RZKC 1U95B 3F7PC 2GFBB 2AV7B 1Z5YD 2BIMA 3LEXB 5LGJA 5E8OA 1CFQB 4WW1B 4XN5A 2BXYA 3WFEH 1N0XL 3H3BC 3H42L 3MRKB 1NMCB 4F2EA 4S10A 2V2TB 1BMGA 3AS2A 1T0PB 2WLHA 3T5WA 1X5LA 1CICB 3RZCD 1T3FB 2XVBA 4R84A 3BUYA 3FU3A 1SY6L 5EZIH 2OTPA 3C8HA 1U92B 4Y19B 4I9WD 2W9DH 3K8KA 1NGWA 4NC2B 4ZMPA 1FNGA 5AVVB 3VWKA 3WIFB 2OL3B 3F8UB 4Z3TA 4JRYD 5I1IH 5E6YA 3EJJX 2A73A 1E28A 1KBWA 3LRSA 4HJJH 2X1XR 2R1XA 5DD1L 3SKJH 1QZ1A 4G7YL 4LNRB 3Q1EA 4X98A 5I0YA 1CFNB 3NSJA 1AJ7L 4WUKH 1NCWH 4WTQA 2A4CA 4ZUSA 4N86A 1AXIB 3SDAB 3DK0A 1YDPB 2Y5TB 4DFHA 4GG6A 5DHYA 1LEGA 3T2PA 5E2UH 4HF5H 3LIUA 2MWCA 4X6CA 1IEBA 3BAXA 2HTLC 1HEHC 2ZXGA 3Q6GH 1FZKB 4LFHG 4MAUL 4N87A 2ESVA 4RFEA 4PV9B 5MENB 1A64A 3I2CH 3V0HA 5DS8A 2ZSWA 5AD0B 3MN8A 3THMH 1ZVSB 3C9NA 3CHOA 5IWLA 3FSAA 1LM8V 2V37A 4PRHE 3NN8A 5D2LA 5FUZH 2AMGA 3VXUB 4YDJB 5IB2A 1K2DB 3N44B 1DJWA 2IDUA 3HUJB 5F3HB 3BOVA 3EH3B 4NBXB 1KOAA 1OPOA 4XC3L 2PF6A 3M17A 4BKSC 1RUPL 1AGFA 1UD3A 2FGWH 4QT5A 1TKWA 2NQDA 4RSVA 3W0WB 3QC6X 2FHFA 1OPGH 2AXJA 3EH5B 4JK0D 3BT2H 5I0VA 5DGQA 3RTLA 5EDXA 3MNDA 3LPOA 3QEGL 4ZOEA 3ZYJA 4OD2B 1JXKA 2YZ8A 1OVZA 1NANI 3FTXA 1MW0A 5T3ZH 4YXKL 4HGWA 4JQVC 1RV6X 3WFDL 1XGUB 2OK0H 1T04B 4PJAB 2VN4A 2VMDA 1YO4A 2YQ2A 4LVEA 5J9PA 4HUVB 4DKDC 4K3JL 2VDRL 1I85C 2VERN 2C4FT 3WGVB 5IHHA 5EOCH 5DJ8B 1RLWA 4ZMWA 4MJ6A 2WMPB 5C0BE 2WWOA 1BHGA 2GBVA 3HJEA 5FFOA 3VYNA 2EXYC 5F8QC 3NCYP 4I9WE 4CVUA 3TJEH 5L88H 4MMYB 1Q9KA 4FYTA 1LLAA 2IH1B 4FN0A 2RMNA 4JKPL 3ZTCC 1ETJA 2VZUA 3IETB 2CIKA 4OCXH 2FJHB 2EYRB 2NY7L 3OPUA 3RUGB 5IB3A 2BFGA 1KTLB 1C08A 4TTGA 4D0DB 3LZFH 3BQUB 5IGXH 3B8SA 4ZQKA 1AKJA 1CFBA 2E27H 4PY8I 2VSDA 5DZNA 2WW8A 5HHNA 2V9RA 1DUYA 5SWZA 2V8MA 3IDIB 1TIUA 4TSBL 4PJDA 1G5AA 3CFJA 4UIKL 4NO0A 3BESR 3HHSA 3PE9A 1S3KH 3UC0H 1TJIL 4K5MA 5D71L 5J13C 4UDUA 3BCDA 3SO3B 5T1KA 5T3XD 1EEZB 5C0EB 2VGLM 5IKCA 2Z4QB 4X8CA 1CIUA 2ZP8A 1UCBH 4P2RD 4Q56A 2HP4A 4FRWA 4CBZA 2D0HA 4HWZA 3EXJA 4UNIA 3R18A 3NH7H 1QPKA 5CJOH 4G8GA 4JANB 3BEWB 2YA0A 3NA9L 3RIAK 5IJVB 3K91A 4XX1E 1CB4A 2ERJC 3OMZA 2JVUA 3WLBB 1ESOA 2WXFA 3K6SA 5DI8A 4BWUA 4YC2B 3MV8D 1WG3A 1PW3A 4NFDA 5FV2A 5E08L 4HUUB 3VQMA 3GRWA 3HR5A 5KVEH 3TBSA 3EYSH 1M71B 2IQAA 43C9A 1JZ8A 1PAMA 5LNGA 1B2WL 4LP4A 3REVA 5C3LD 3RVUD 1FIGH 4OD3H 5EO0B 2GSGB 2CRYA 3L4YA 1ZWIA 2I7SA 4NI3A 4N6RB 3AQYA 4PGCB 4HUMB 1AAJA 3HMWL 3EDFA 1UURA 4GUPA 4IRJC 5JQHC 4ODUA 2N1TE 3MYJA 5AALA 3SN6N 4NWTH 4LEXL 4M6OH 1R3IL 2X0VA 1M7DB 1QA9B 2G60H 1A0QL 3ZLQC 4ONFH 4AEIL 2ZWSA 1CD8A 4U1HB 4ANVA 1Q0YL 5GS1B 1FG2A 1IBFA 2A6JA 4AJWA 1ZS8A 4F33B 1PSKL 4CL7A 3O2VL 1XFPA 3QQ4B 1N6QL 3TBVB 2OMTA 4DGIL 1K3IA 2XWBB 1AG0A 4CKVX 4IOSD 4D0BB 2J8UB 1YNTB 3EJPA 5E23A 4PGDA 3QCVH 1MHEA 4FXKC 4ADGA 1X5AA 1FYTD 4JFDA 4PW9A 1OAJA 3WNLA 2WYIA 1NSNL 4HJ0D 1UOWA 4H20L 5AUMB 5IT2L 4LHUD 1IC4H 2EDWA 1CFVL 1KENH 3U6RB 2AKRB 3U7WH 2AXGB 3LQZB 4JDZB 2VE6B 43CAB 1PZ3A 1I9IL 4GKNB 2CUAA 1F11A 4OZHF 3SE8L 4E41E 2CDFA 1JNNL 3VFTA 1NBZA 1GRWA 2V3DA 3SDDD 1DP0A 1FRGL 4Y5XC 3J7HA 4NJ9H 4IIQA 2ZWLT 2AQPA 1FN4B 2MTAA 3DECA 4P2RE 3ESNA 4ZO9A 4YPGA 3AU1B 2EO9A 4KPHL 4MKTA 2P48B 4X5WB 4JMNA 4JW3A 4KRNA 1TYEB 5IMMB 1A4BA 4XVTL 1E6JL 1N26A 5BUAA 4DK6A 4YHYB 3K81A 5EBMB 4HAFA 3EO0B 3Q6FA 4FAAB 2VC2B 1HL4A 1QLEB 3KGTA 3MV8E 4TXVB 3Q8FA 4XXWA 3HZKB 1KIRA 3FU6A 1NBCA 2B7DT 2CUMA 3ARDD 3ETBF 4YSQA 3D0VB 2YBGA 3N5AA 3BH9B 3FB5A 2QVKA 4GEJA 3H2QA 3FQNB 5JW4N 1AE6H 1MFCL 3FOLA 1UD2A 1U8HA 1G7IA 4JRXA 1ETZA 4LCWB 4NPYA 2IGFH 4DCQB 4EDWL 3SYOA 4OZIF 1RK0A 1T20B 1MJJA 4J6RH 2B0SH 2IQ9L 1S5IH 2FBJH 4IKJA 2RAMA 3LH2L 1T22A 1BIHA 2MKWA 2V0AA 1L7TL 4JO2L 1SHWA 4W9LC 2IOIA 3GXTA 2GW5A 1KYAA 1P69B 5ALCH 3HJ0A 5EEWA 1CQKA 3AC0A 1WT5C 3F7QA 3E8UL 1OP3H 4FQ1H 2J5LB 4AGLA 1KLFB 3WTXA 1T7VA 2VLME 4U0RB 4URKA 2XQYG 3QIWD 1IEHA 1NCDL 2R69A 3GB7B 4XMLL 3QWOB 4G7RB 3K1DA 4GW4A 6PAZA 3JTTB 3TBTA 2XBDA 4P57B 2BNRA 2VM9A 1BVNP 1RP8A 3WNJA 1XB3A 2D03L 1PGRB 4M93C 2OXHA 2YR3A 5F0JB 3DTDA 1JCKA 4EVNA 3ARQA 1MAML 2NW2A 4XXCA 1P1ZA 1BMWA 2CLRA 3BH8B 4L5FH 4FG2A 5LNEA 3V6OC 2KPWA 2NNCA 2IANE 2OQJA 4F2FA 4F57H 2KT6A 4IEFB 2O5YL 1C12A 2Q2EB 3G6AB 5B1JA 2YD9A 5IFJA 1A7RL 1VEOA 3ZXAC 5IUCA 4QLRA 1O5PA 2JB5H 4OZFA 4P3CH 1GGUA 5KVFE 5D72H 5EORH 2YJLA 4FXGC 4D0CB 1WC7B 1X9RA 2OR9L 5HGDB 2DBLL 3KXFD 2NY4D 4HWBL 4HKJB 3LEVH 3RGBA 1X9QA 4JO4H 3PV7A 4NQCB 3UFIA 2J6WA 1KYOJ 3O2WL 1WAAF 1TTBA 1QG3A 3F7VA 2JJTA 1PZSA 1KLGB 1WWBX 4KDTC 2K9FB 4RESB 3FONB 4XO8A 5DD3L 3SKUD 3FSZA 3P3SA 4S0HA 2R9HC 1NFAA 4HYTB 3DXAA 1G7QB 4DN3L 2WINA 1N9PA 4YE4L 1MWAL 2B14A 3GK8L 4H0LC 3RFRA 4UU9B 4C47A 1EZSA 1FBIL 1FO0A 1R3JA 4WHDA 1A7NL 3UPCA 1RY7B 4XNUL 2NTFA 3GBNH 1KBPA 1VA9A 1OAYL 1QASA 4Z7NF 5HJDA 3GIVB 2X4OA 1OGAA 3F83A 3Q44A 5IBTL 3FQ4A 3CZKA 3MJGX 4PJ7F 2PABA 5G4NA 4WGWB 2PLTA 4LRIC 1X9UA 2C9QA 4GG8A 5EOTA 3SDCB 1ES0B 2CIIA 2A9AA 4ZMLA 4D94A 1FLTX 3VWKD 3F12A 4W9IC 2QR0B 4HS6B 4KU1A 5DJYA 3ALWA 3ZVVA 1OO2A 2WNXA 3SQOH 3B37A 2YN3A 3K7UA 3P3RA 1QLFA 5E4OA 4KUCF 3SODB 1AMYA 5H94B 3F6IA 5F9JA 5JHDB 5JIKA 2GHWB 3DGGA 4YDVA 4BZ2H 3NEEA 2FCBA 4JRFA 2VH5H 2X42A 4HW6A 2FR4A 3SGEH 4JM2C 5D9SB 1JF5A 1BFVH 1GHFH 2YAHA 1IL1B 3IE9A 1DVTA 4K8RL 1V54B 4CSTA 1YN6A 3EKCA 4OH2A 1QRNB 1TR7A 4PLNC 4FNUA 3CNKA 1NGPH 4HJTA 1SDYA 4F7PB 5HI4C 1TSHA 1KTRL 3CCHB 3GM0A 1HSBB 3U30B 4Q9RL 2DQFB 4AXWA 3CVHA 5JIDA 4PUBH 4EF3A 5JHLA 4EUPH 2R56H 1AQKH 2NX5B 2G2RB 5MP6H 1Z9LA 3X1NA 1XTLA 1KY6A 4LQFL 1TQBC 3CPUA 1ZHBA 4HC1H 4Y4KB 1GZPA 4YGVA 5DFWH 1KDJA 4ABVA 3CHQA 1QBLL 5SWQA 1D7CA 5F7WC 1NC4D 2B08A 3KXFE 3IXTA 4LOVA 5EO1A 4OFKA 1RULH 2XXGA 2WXRA 1UM6L 4U1MB 3DX0A 3RRQA 1H0DB 2EVHA 2V7NA 1HI6A 3HRZC 3LB6D 4HIHA 5TE4H 1D7BA 1K8IB 1J9SA 5DUPL 4IHOA 1AI1H 1QFWL 3BRGC 1BPVA 5C2UB 2BC4A 2K6WA 1JRHL 4D9QE 2M26A 4AYGA 3UC2A 3PWLA 3HOGA 2F58H 1OW0C 2P28B 4Z1PA 3AS1A 4JVUA 2BCKB 5C0RL 3IGKA 4PJ8A 1QWUA 1WD9A 4EE2A 3B9KD 3MRFA 4JHAH 3V5HA 1RZJL 2PR9A 1DJHA 3DROB 1YPZF 5A2JH 4HPOL 1PD6A 1U8CB 2ZXQA 3QI9D 4PY8J 2Y1VA 4LLYB 3L4VA 5HHPB 1I8KA 1NCBL 1I3RA 3FTVA 1MCOL 4Z7UB 5AB2A 2WUBL 4FA6A 1HILB 4ADJA 2RB8A 4L1SA 3MV9A 1AYOA 3KPRA 4Z7OB 5JNYA 5D7KD 2MPVA 4IOFD 1F1DA 3QCUH 4WI8A 3N41B 5HVGB 1V5JA 4MCYB 4HUKB 2K7QA 3LIZA 1AKJD 2CMRL 2QKIC 2GQHA 3FH7A 4X5QA 2L4OA 2XWCA 4K3EL 2WP3O 5SWZD 3ZZLA 4GG6E 4YAQB 2HFTA 3EO9H 4R26L 1DVZA 4X6CE 2HG5A 1SDDA 2WN2A 3BKCH 5C7XL 2WIMA 3WKQA 2D4DA 3NPZB 3HHMA 2ESVE 5IJKA 4NM4H 3FYEB 5J4MA 2PWGA 3O41A 4QRSA 5DJCA 2G2PA 4KGJA 2WXPA 1MFEL 5CP3H 5ALBL 3RQ3A 1P7KB 3KGRA 4MMXC 1MCNA 3EJSA 1G87A 4NQXB 4ZUVA 5IG7B 2DQJL 3WJMB 4DVRH 4LKXA 5D2LE 2JCWA 3MXVL 5DO2C 4EN3D 4B7IA 2QSCL 5BO1H 1E4HA 2EC9T 4JRWA 3PJSA 1WIOA 1F1GA 2WCPA 5A6LA 3W39A 5HDRA 3OSVA 4G8GD 3HZMA 3QH3B 1MCJA 1ZANL 2EYTA 5CEZL 5JTWA 1A8JH 1DQJA 4ZFQA 1EQWA 1GAFH 4PHZA 5FKAA 4NT6B 2XQBH 2FATH 3H7BA 3MGTB 4PJ5B 2JJWA 1NGQH 5DDHA 5FWQA 2X2HA 3A22A 5GS3A 2WIIA 4Z7NE 2FT8A 1A4KA 5JORA 1JWUA 4JB9L 5IBUG 3NIDF 3N04A 1HWHB 3L2NA 4PRIA 1PCSA 1WZAA 2CKBL 4M29A 1B3IA 4EDXB 1YNLL 1T4KA 2GTWB 2VLJB 4U6YA 4WEBL 1F4XL 1UOKA 3V0WL 2Y7QA 2EDYA 4KWUA 1K4CB 4YHOL 3O6FB 5FO7B 1LNUB 5KG9B 1FWXA 3DUHA 4WFGE 2N56A 2Q10A 3MR9A 4JFQB 3MO1A 3EFOB 2JXMB 2EDNA 3FB8A 2RTTA 2ICWA 1U8NA 2DOCA 2G30A 5LB1A 2NSMA 3VA2C 1C5DB 2CA3A 5FLVA 1BM3L 1KCLA 3BVUA 1E9QA 2Y07L 2QHRL 4LNVA 1IAIH 4C58B 2D3NA 2OTUA 4HCRL 1N4XL 1J11A 2A83B 1TQVA 2OV0A 1IVTA 4X2UA 2DS4A 3K2UH 4U05A 3LS5H 3WFEL 3ZT7A 5FV1L 5FK9A 4EI5D 3MRLA 1SJHB 1MVFA 2VZ1A 4GQRA 5DC9B 1U41A 3DARA 2WBJC 5FOBA 5SWZE 4M9OA 1CCZA 5EZIL 1T0NA 1WZLA 2JNZA 3GMQA 3T6XA 3FAWA 4I89A 3SCMB 4PJDE 2EABA 4I5BA 4L9LA 4FQCL 5KANI 4UZUA 1P4LA 2RBLA 5FS5A 1JHKH 1UVQB 5DZ9A 1S7VA 4FTVA 2J1WA 3MLPA 1U8PA 3SKJL 1UWEL 1DHKA 3ZE0E 5L7XH 4FZEH 4WUKL 4QHUA 1JPGA 3QORA 4IM8A 3ARFC 1BREA 1W0VA 3O9WC 4GUCA 4G8GE 1PFOA 2VDQH 4QYOA 1U3ZA 3GTTA 1XTMA 4ZPTA 1RERA 1HXMB 4OCWL 3L5WA 2BERA 1UH2A 3KLSA 5DFAA 5DEFA 2EIDA 5F7EL 2JKNA 3PGCA 3I2CL 5E6RB 4AM0A 3GXFA 4M5TA 4EIUA 5E8NA 3AXHA 5AZ2H 1EXGA 1KC5H 1IQDB 2O6FA 3KEDA 2WP3T 3BEVA 4TPRH 4Z7QF 5E8PB 3THML 3FUFA 3NCFB 2YMTA 2OBGA 4AENB 3BPLC 2MOVA 4OGYL 3VFOB 4JRXD 1JTOA 5I73B 2AVFA 2ZZUT 1NFKA 3GUTB 1A4JB 2IAMC 3FFCB 2BVPA 4L1DA 5D93B 1BAFH 3D4ZA 5EEXA 4WU7B 4F9PC 1R0AH 5IBLC 3BT2L 4JN2A 2IF7A 3D12B 4GXUN 2VR4A 1H3GA 1OB1A 4JFYA 4WW2B 5J7CC 1CT8B 1KF9B 4A1RA 1OTTC 1X5MA 1UM4H 4EOWL 5IBUB 3FCTA 1HH9A 3MROA 4QRAA 2XKNA 2XPZA 1XCXA 2BP0B 2K78A 1YEEH 4YSOA 2BNRD 3WNNA 4JFDE 5EOCL 4UTAA 3DURB 3I9IA 3PP3H 4EUPB 4Q6IC 4XCCL 5FGCE 2ITDA 4ZW8A 3PQYB 1UKSA 1LO3H 4KNQA 5L88L 4KO6A 2JQZA 2QGDA 3TJEL 3AUWB 3ZGHA 1UKQA 3B7TA 1IC7H 2Y9RT 3VD7A 1A1MB 1HS6A 3PDOA 3V4VH 3CQQA 4OCXL 2D9CA 4RQQB 4UV4L 4LCCA 1GYUA 4F37K 3AS0A 3GXUB 1A3QA 2AEQH 2EE9A 4X7TB 1JWSB 1U8JB 4ZXBD 3HNTL 1C8QA 4PTUA 5DRXB 3HE7C 3LZFL 5GRUL 5DHVB 5IGXL 2CBPA 3DO3A 3F3HA 4QTHA 4XWGL 2E27L 1PKQB 1KJVA 3ULVF 3ZE1F 5G4MA 2WGXA 3KW7A 2NY6B 4PLOB 5J11C 3ZMRA 4S11A 2XZAL 5FM8A 1ZA3A 1SXCA 3L3HA 3L95B 4XCEA 1G1CA 2ADJB 1BEYH 3L5IA 5KVFH 2WWMD 5ENWA 3UC0L 1ZD6A 2NOYA 3DXAD 2NXZD 3Q8AA 4JPSA 5A2BA 1GGCL 3QISA 4L48A 3DRQB 2MCMA 3VACA 1UCBL 2AQRA 2AK1H 4JDEB 4LGPB 4Y5XB 1G7MA 1OGAD 1X9LA 4PU2A 5DR5H 4KJYA 5EU5B 4E68A 2ZICA 3NH7L 5TF0A 3X3FH 5CJOL 2F8IA 1MWAB 2MTPA 1N59A 1I9JH 1V7NH 1UZ6E 1E8ZA 3DX4A 4HH9B 3RIFK 3DO4A 3BPCB 4OLEA 4CSPA 5IQNA 5FFLA 5TH2B 3N40F 2FEDC 3QDJB 1R24B 3JSSA 4PJGF 2B5IC 3PJLA 3WNKA 2NY5C 1G0YR 3BQVA 5IVNA 1N10A 4GINA 5PAZA 4FQXC 5CEXA 4XPFL 1EAPB 2J56A 2B2XH 3MRMB 3TCLB 5D7IF 1U91A 1VHPA 3L5HA 3G3LA 4R7NB 2ZOLB 2I7OA 3WO4C 3GJFA 1NGXA 4Z7AA 3B5HA 3ZKQD 2FSEB 5BRZA 3CC5B 4NWTL 5EC2B 1LJMA 3QK0A 3ZDXE 3S97C 4M6OL 4B60A 4PWFA 2I07B 1G6RA 1S7WB 2DWTA 4ONFL 1K6QH 3HG0A 3ZTNL 5FW6A 4CC4A 3U0WH 5K9KA 3WLWD 1HE8A 5BS0A 4ZMNA 1OT2A 2OW6A 5HJ3A 4GKZA 2WHVA 1Q72H 2X3AA 3C8DA 1N67A 4NWUH 3HG3A 3C6LB 3B9VA 3BP4B 3EYQC 5M95B 3QCVL 1RQ5A 5GISH 5F7MC 4HK3N 2G0KA 4G1MB 3SZ6A 1FP5A 1IAOB 1FV1B 1MJ7H 2B77A 2H47C 2UWEF 4JFFB 4AMWA 1TCRB 2W81C 1S7SA 1TZ8A 1NJ9A 5AW3B 1TTFA 1IC4L 1NM9A 3LKSA 1KENL 1XL4A 1DBAH 5LAPA 3U7WL 3KJ4C 1A3LL 3F58L 2KYIA 3HS8A 3L4ZA 4G43A 2NCMA 1IKNC 3RVTD 4K55A 3RVWC 2FYYB 3FHAA 1M2VA 3DXAE 1UT1A 1V3KA 1BQKA 3TNMB 3VI3A 3TEUA 1I9RL 3GGWA 3LQAC 3NFNB 2HWZH 4QOKB 5CN2A 5AW0B 8CGTA 3ERXA 3VA6A 4NJ9L 2VL5B 4HEPG 4MNHA 2EKSB 2V3EA 3GTVA 5F88B 3TZVB 3WN5C 1OGAE 3FF8A 3CHRA 3NZHH 4Y16C 2EILB 5A40E 3BP5A 3BD5A 2FD6H 1PZ2A 2D7PA 3BZFB 1ADQL 4O51B 4G9FA 4E9TA 5EZPA 2ENQA 2VSCA 4JZOA 2R2HB 1JXJA 2QT6A 2HJLA 3QPQC 1F3JB 4GQQA 3AY2A 3KPRD 4U6VL 3I6GA 3MRGA 1BOGB 3MLYL 4DZ8A 1E3ZA 1DTUA 3KH3A 2HVBA 4OF3A 3VRJA 1U58B 3PREA 3B7YA 5INCB 3V0VB 1AE6L 2F7QA 3G5VB 2IPTH 2M1KA 2OW7A 3KEHA 1BDYA 4MJJA 5AL8A 2CHWA 1I1YB 4RMQA 5HP5A 2B0SL 1QZNA 5GGQH 1W8EA 1S5IL 2FBJL 3PWJB 4Z3EA 1NCGA 4LE8A 5DJ6A 3VXSB 5ANHA 2AGJH 5IV2B 4KO9A 4K5LA 4U6XB 3WUZA 4I0KA 4HLZH 1A9VA 2ZUSA 4OJEH 4PBDA 3MNVB 5ALCL 4LVNB 3GZKA 4FLHA 4UQ3A 5CILH 1L5GA 1LD9B 4NZUH 4FQ1L 1RCYA 3GHEL 1A66A 4TVUA 5DTFA 3MFFA 3ARBA 1L3WA 2G5RA 5KYXB 5C0GA 1E4XI 2E5EA 1ZS2A 1P5UB 5HVWA 4RMSA 5HDLA 1OT1A 1H5BB 4C4UA 1DVQA 3WU1A 5I0XA 1UOLA 1T21B 4XP4L 2UXTA 3I85A 4YMPA 1DBBH 4H88H 2FWLB 4PRID 4RRPA 2ETWA 4NKMA 4L5FL 1JD7A 3FO1B 2NY0C 3QFJA 3SE6A 4F57L 3QRGH 2CM5A 1QBMH 4ZUTB 1D7DA 5FO2A 3QIBC 2ZKYA 2EVGA 2EH8H 2JB5L 2KC0A 3BAKA 3H9SB 3QDGA 4P3CL 5EIIG 1DN2A 3GMPA 5D72L 2UYLB 5EORL 2EXWD 2CKBB 2CXKA 3DTUB 1CLVA 1YNKL 4G8FB 3UMNA 3E2HC 3QAZC 1LEIB 5HHOA 2W9LA 2NZ9D 3ZT5A 4BM7A 4NXSA 5BNXD 4JO4L 4NUGH 1MHHB 1WVZA 1VERA 3QEHB 5I66A 1QYGL 3EYUH 1DVXA 3CSPA 4XP1H 4G8IB 1I3UA 4Y5VB 2XN9B 3DX3A 3MV9E 1KN4L 1CXLA 3KPRE 2Z8SA 4WDIB 3QXDB 3ZHKA 4AJYV 3C60A 1NIBA 3KYNA 3NK4A 3D50A 3GSXA 2ZWYA 1WFIA 1NFDB 1XB8A 3L5XH 1CN4A 2H0FA 4HZLA 2E7BA 4QYAA 2XPYA 3LJ3A 2GAZA 4GW1B 1TJGL 1IFRA 4XNXH 3T0EA 2DMKA 5C2BH 3RTQA 3MCKA 3HI6H 3RWDB 1JZ5A 3UTPD 3WTSA 4NP9A 3VXPB 3EJZC 4N4YB 2GJ6A 4ODBD 2VZSA 3OZKA 4IGBA 3JV0A 4HALA 4QKTA 4MA7L 4XC1H 2DM2A 3SQOL 1D5MA 4V2CB 4JJOA 5E0FA 2E6PA 1KJ2A 3EDEA 3UDWC 1BQLL 4D7PA 2W60A 4D7BA 4F3FA 3QORD 4K15A 4E5XG 4YSCA 4N25A 5B7MA 3I9AA 4JO3H 4LB8A 2GTZB 4M8QB 3SJVA 4NZRL 1BFVL 1JXGA 1I8UA 1AY1H 5IF0B 1C5CH 2YSSA 3WUWG 2UXVA 1J8KA 1EEUA 1NGPL 1T0OA 5H37H 2RJMA 1M4KA 1BWMA 1FI8C 1DBKH 3OKNB 2W80C 4OTXH 5J12B 1O9ZA 3O3AA 3QXTA 4TNGA 5IY5B 4PRIE 4Y4HD 5FGBA 4AV5A 5INDB 3ZKND 1VFBB 2P8MB 3A4DA 3NQIA 1A6ZA 3ZMNA 3U6XA 5E4EC 4F15B 2R0KH 3NOIA 1OAXL 2R56L 4OKVA 1AQKL 4MB5A 3P11H 3VG9B 5MP6L 4JG0H 2ZCLL 4WVRA 1A7PH 5E5MB 1KYDA 1J0IA 2IBZX 5GGVY 4HC1L 4K3HA 4K3GA 1YEGH 4J3OH 1R3KA 4B9IA 1RULL 5DQ9A 4KHTH 4QD2E 5FF6B 3GM8A 2HLAA 2XA8H 5TE4L 5EC1A 4ZS7H 1AI1L 3HG2A 3TA3A 1IBGH 3WAKA 4IMLA 3HS0A 2F1BA 3MREA 4NRYA 4IK7A 4RH4A 4XRCA 1OXYA 3GSRB 3QJVB 3QIUA 4JKLA 5IEHA 2OMBA 1KPRA 2F58L 1I82A 3QZWA 3T65B 3OMAB 1GL4B 1TZHB 2PW1A 4ODTH 4L29B 2O5XH 3C5XA 4JHAL 4P2CG 3GMRB 4PSRA 2FQFA 2GITA 4FERA 4WU5A 3FTWA 4PJEB 3SGDH 5CJ5A 3IRPX 5EIIB 1HNYA 4JFEB 4AI7A 2F7OA 1SRDA 3LV3A 3QUYB 2HPOA 3DBSA 2X7LB 3KAAA 4M1DH 3QXUA 1OQOA 1HNFA 3V5KA 1UH3A 2I9LA 4MJ5A 1HFUA 4M6AA 4FTVE 1W80A 2FDBP 2P8LB 3L3OC 2R7EA 3MRNA 3QCUL 4FEMA 4Y2NA 2JI2A 3OB0K 4HAKA 1NGZB 3CQFA 1CFTA 4GMTH 4IU2A 2CUHA 4YN3A 2CNZA 1LK3L 1A7BA 3BVWA 5KBPA 5EU6B 1IFGA 5CFHA 2EIJB 3AMKA 4I0PD 1IGTB 3QEUB 4O02A 1FL5B 4F7EA 4PY7A 4UNVA 3NSDA 5AWNL 2G0LA 4H0IA 4XXDB 4Z7VA 3BN9C 5EF2A 4KY2A 4RFOH 3DRTB 1EGJA 4E2OA 4LPYA 3MJ8A 4R7VA 3VVVA 1BCIA 1A1OB 1NEZB 4DVRL 3JV6B 1JYXA 2V2WB 2NW3A 1S3RA 5ERWA 2KBGA 5BO1L 3ARGA 3O3EB 3TTYA 3TEWA 1CVSC 5DEZA 3ARFB 2WNKA 1RZ7H 3D2TA 3GT6A 2O1AA 4XMPH 5HJGA 5AZEH 2Z31A 3FO9A 3OR7B 3T6ZA 3U7YH 4WGKA 2X4TB 2FATL 4APQB 1B0RA 1NGQL 2X0UA 4N2HA 1PG7H 5I30H 4PCTA 3QQ9C 3BAWA 4XAWL 1J8HB 2VLKB 3WUWB 5I15H 3LVEA 5GQBA 5B8CB 2Y1YA 4AYFA 3LMJL 5KS9A 2BSTB 1HHHB 3N50A 5EZOH 1PPIA 4ZMZA 4EN2A 5I17B 2XFXA 3BPLB 4YH6A 4LHJB 4XBMA 4GBXA 4BH8B 4HIJA 4KTEH 5BRZD 3T8MA 5ETUB 3I75A 4GRWH 1TQSA 2IAMB 3QRFM 4I77H 5TFSL 3UTTA 4RAVA 3CDGA 3CXHK 4QJ4B 3KBHE 1R47A 4BZYA 1FZOA 3AGVA 3GBEA 3N42B 2R69H 5BS0D 3D3VB 1LGVA 5CKAA 3EO1A 4RGNC 3S88H 4H8WL 1MCHA 3RB7A 4DWHA 4JEGB 3D07A 4NCDA 1XSJA 3BSZA 2CDGB 4Q9CA 1CTOA 4A37A 3LS5L 5CGMA 1OLLA 4Z3GA 3EH1A 1CQYA 2R8SH 3HI5H 1N7MH 4HS3A 1EHXA 4N2EA 4POZD 4YO0B 3NQKA 1CLCA 1W6WA 4XMUA 3EH4B 4RZKA 3MRJB 2J2ZB 5B4MC 4HV8B 2XWZA 1IKOP 4OZFH 3OKKA 5CUSL 1F4WL 5D4HA 4F2MA 2YEQA 4I7ZC 4JGNA 1HWGB 1J48A 2VZVA 3IGAA 3PJNA 5EN2B 5TE6L 2DH2A 1U8IA 5J0BA 1U4EA 3WIAA 5L7XL 2EDKA 2I25N 5MHSD 2GBUA 3UZEA 2Y22A 3ML9A 5KSAB 4F20A 4P4KC 2CXGA 4J4PD 4MMZC 2AJYH 5C9KA 2LQRA 2IGLA 3PWNA 3QUZA 4FQQA 3VWJB 3PNRB 4OI7A 1OTUC 2DWSA 1FC2D 2VDQL 1XGRB 4TL5A 1A9EA 1JGEB 2YBRB 3B34A 1P7QA 1OHQA 2WM0A 1TPXB 2CGRH 1D5XA 5T3XL 2BOBB 1RUAL 4WWKA 2OMUA 3DMMC 4A7GA 2CBOA 4YR6B 3RFZA 1PIFA 1G9NC 1KC5L 1U95A 3FF7A 2GFBA 3NIGE 4HIEB 1IAMA 2AV7A 3V6ZB 3LEXA 4PH8A 3UBGA 4J3UA 3W5NA 4TKWA 3IU4L 5DVMA 5SX5K 4I2XB 3P40A 4BD4A 2NY1B 4ALAC 3MRKA 3DIFB 5K9JH 3ARVA 3EF4A 4X80H 2WY3B 4RGMC 4TQPA 4U1SB 3RIAF 3LS4H 2ZPKL 2NY2D 4N1EA 5BRQA 1NIDA 5BRZE 3SE4C 1BAFL 2EXSA 4NKIH 3EOAA 5F7FA 1IZKA 3TIEB 4Y19A 4DOHE 1R0AL 2OXGB 2YA1A 3S96B 5E51A 4DETA 3RNQA 3WIFA 5FM5M 5GZNA 2HVKB 2MEJB 1K4DB 3VFUB 4XN2A 1T1YA 3GD1C 5BS0E 2B5IB 1XCQB 2CR0A 5TF1H 4LNRA 3ARBD 4K94H 4EUPG 1EO8H 3GEFA 1NMBL 5EUKB 1F3RB 4BK4A 2JJUA 2Y06H 3APNA 3VTAA 1JNJA 2AJUH 4PV8B 1EFXB 4ZX6A 1QATA 3FTGB 4XHJC 1YDPA 2Y5TA 4Q97A 3BUQA 1E5ZA 3PXJA 2A74B 3MRPB 1FFQA 4JJHA 4L4TD 1AHWB 5JHLH 1TQUA 5MEOB 2F7IA 1GCFA 4XP6H 5DC4B 2PXYB 4KQ3L 1LO3L 2C3XA 5I1KH 1FZKA 4OAWB 3ARUA 5MENA 4JY6A 3ILDA 1IC7L 4G8EA 4IKNA 5ECGA 1SQMA 3MUHL 3V4VL 5KAQG 2EEFA 4GI9A 3VI3E 2WJ7A 3WTYA 2NNAA 3QDGD 1S9VA 1ACYH 2AEQL 4W81A 3VXUA 4B97A 4YDJA 1K2DA 4K3DH 5MHSE 3IKCB 1G0XA 3HUJA 4L8DA 2SEBB 2L0DA 5F3HA 5HHOD 3RVXC 5A3ID 4DNLA 4GXFA 3P4OB 2BNUA 2MQ0A 4ZTEA 1NKRA 3W0WA 4G9FE 4UILH 2CO6A 1XSKA 3B5TA 3L08A 5EA0H 5CD5D 4IRSC 4Y0GA 2YUZA 1GYVA 5DMGD 3FQ2A 1M6OB 2WGNB 2Z7UA 3BPNC 1U2HA 3C60D 4PB9H 1JZGA 1NQBA 4DIXA 5D2NC 5HI5C 3ATEA 1FZJB 5KYWB 2VW4A 4KTDH 2ARJB 3AABA 1UG9A 1XGUA 1T04A 3RTQD 2AK1L 3WFBL 5DR5L 4HUVA 1XIWC 2YRBA 5CGBA 4XI5C 1IIKA 2EO7A 3WN5B 1Z3GL 5HHVH 4NP4H 5DJ8A 2F1AA 2FNBA 2NYYD 2WMPA 4LLVA 1MCWM 4IGBD 4OZGA 4DAGL 3LKNA 3GNML 1PNDA 1C7SA 4MMYA 1GC1H 2DQHH 2FX9L 2PO6A 4YSTA 1G7JB 5HYFA 3O81A 2IH1A 5CR8A 5C0AA 1WA2X 3KPQB 4RNRB 3A4AA 5C6TH 4L1TA 2TRYA 3L9RB 2FJHA 4J1UB 1A6PA 1UWGH 1HCZA 3EFDH 3BGFB 2RCSH 3ASNB 4GIPD 1WEJH 4XBPB 1DVFC 3SJVD 3QARA 1KTLA 3BQUA 5B1AB 2P4AB 3C75A 3B7UX 2YAMA 2O6DA 4BQ9A 3T3PE 5K59F 3DJZA 3M1OA 1EBAA 4AVJA 3IDIA 2UY6B 5F1IB 4U6HB 4G7VL 4GRLC 2YQGA 3FQWA 2DI8A 2YC1A 3R06B 5D1QC 4YZFE 5DD5L 2MCAA 4X6BB 4BE6A 2VW6A 3QFJE 3BWSA 3L1OH 1U3HB 3WBDA 4BJLA 1N18A 1EEZA 3L8QA 1OWRM 3OGOE 4AGNA 3QWRA 4B9CA 4DKEH 3QDGE 1CXEA 1Q72L 1JPEA 5TDNB 4NWUL 3NCJH 2G4EA 3OC5A 3L4WA 5F9OL 3V0EA 1J8RA 4LBEB 4JDVA 1GTNA 2CGYA 3V2AR 5HHOE 4KQ4H 2JF1A 2VNCA 1U3JA 3L6FB 3UBFA 5A2AA 3EOTH 1D7FA 3ZTDC 4A6YA 4JANA 2GJRA 3BEWA 5IJVA 2YD0A 3B8YA 1OB0A 5KJ4A 4N8PA 5AZUA 4UB0H 3WLBA 2E46A 2KL6A 3TA3D 5J6GB 2GJZA 3O4LB 3TBBA 4HUUA 3VXQB 4AUUA 2APXA 2W07A 5GS0D 1M71A 1OM9A 1V3JA 2XY1A 3U82B 3VU2A 4JFHD 2HWZL 3FH5A 5EO0A 1ET5A 3BUIA 5GJTL 1TYJA 5DJ2A 3T0EE 2XN2A 2ZXWB 4N6RA 4FCAA 2AXHA 3UTZB 3VXOB 3S8FB 4LLQB 5A43C 5FLUA 3NZHL 3OAZK 2AQ3A 2IC2A 2MOGA 2VDKH 3DPBB 1O9WA 3PRZA 2FD6L 4EIZC 4OZ4B 4A39A 5T5NF 2GJ6E 2BIOA 1AGDB 2V3FA 4LP8A 5C0ND 4KZDH 1QA9A 2DIJA 1SHSA 4JY4B 4QCIA 3WKPA 3A23A 2A0LC 1M56B 4RZCB 1J1PH 4NQVB 4AQ1B 2IADA 2GUOB 2XWBA 2D2OA 3I9PA 4NQUA 3SJVE 4M5YL 1MEXH 2IPTL 4QPEA 5D96C 2CGZA 3UAJC 2F8OA 4OFYA 1QABA 1D9KC 3PYCA 1MCQA 1G9MH 2KERA 2M8XA 1KFAH 3RZCB 3S36X 1XGQB 3PNWB 1GW6A 5T1LD 3QFDB 3ASWA 1QSZA 1J1OH 1FORH 3DLQR 5B22A 2IV8A 5CZKA 2AKRA 5ECJE 2AXGA 4M7ZB 1SYSB 2IWEA 4UQIM 3IRCA 4JRYB 5CILL 5GPRA 3BWAB 2VE6A 1NANH 1WLHA 4NC0B 4ZUWB 4NZUL 4GKNA 2EDFA 3RGVC 5JPNC 1U8KA 1AQHA 4P23D 2XRAH 1BVLB 1YMHA 4LP5A 3ARGD 3V79C 2XG5B 1S9KC 4FG6D 4N28A 4GUQA 5JZ7D 3ULVC 1OSPH 2Y0SA 2Z31D 2EDHA 3AU1A 3BAIA 3LEYH 4JFWA 4PGBA 4CU6A 4LPCA 4X5WA 4MXVF 3NFSL 5IMMA 1GTFA 2IGTA 2LW3A 3IFNH 4M4RB 4GS7B 4QHLA 2F54A 5EBMA 3ZIMA 1DBBL 4H88L 1G0DA 1IEAB 3EO0A 1AGEB 3QHTC 4O2EB 1IAKB 5CF3A 4IK6A 1QBML 3CFUA 3CFKB 1G5GA 1D6EB 1SOXA 4KKLC 5B1KA 5F7HA 4HCIA 1R6VA 1P9MA 4PWKA 4PGEA 2EH8L 3TN0D 3FO2A 4JFHE 4TYUA 1IFHH 3IDYC 1R3LA 1CTMA 1RHHB 4GBXD 5JPMB 4EJ1C 3SYAA 2ADIB 4I18B 2P5ED 3UTTD 1LDPL 5CBAA 2XZCL 4PG2A 4OLXL 1R19A 4G1EA 3W5MA 3S5YA 4XP1L 2OSLB 4I87A 1KCUL 3QAQA 2K3TA 3HBZA 1I8LC 4Q9BA 1IBHA 3NJKA 1QFWI 2GI0A 1QNZL 2CO7A 1XF3A 1BVKB 1CF8L 1M7IB 2NXYD 4G5ZH 1KTBA 4KK8C 1KLFA 3M1BB 4B9JA 4BKLB 4UTAH 3N2JA 2F74A 2XV6B 3ESVF 4YWGH 3L5XL 4JFOB 1ZY9A 3D05A 1SXSA 3GB7A 3LX9A 4XNXL 5AL0A 4FLQA 4AW4A 4BDVB 1S7RB 4FNQA 2E56A 4LHUG 4P57A 4S1QH 3TVMA 1SZNA 5HBBA 1CL7I 3OAUH 1K5WA 3QFGA 3S36L 2PWHA 2K6YA 4Z7VE 2ZE0A 3MV11 4FGMA 2N4IA 2ED7A 2DJ4A 4R4BA 3RL2A 3GI9L 4U7KA 4UIMA 4XC1L 1RIUH 3QXAB 4KMLB 3VNZA 2C3GA 2X1QA 4IEFA 1VCAA 3G6AA 5C08B 1CU4H 4MKMA 3ZR5A 3BC9A 1ULVA 2EECA 5CP7B 3VFPA 1VJSA 2DD8H 4JO3L 2B59B 2N7SA 2P5WD 2ZXAA 3IXAB 2FZ3B 5GRWA 5IK3B 4F1ZA 3WTUA 4D0CA 1WC7A 3JWDC 3STBA 1NCAH 1SBBA 1AY1L 2JKIS 4FMFA 3KLAA 4U6TA 1BAWA 2Y2YA 4ZMVA 1P7QD 1S5HB 1NCIA 1A6VH 4A2GA 3GINA 1DBKL 1CURA 4B0MB 1DQQB 1PDKA 3MACH 4UT6A 4HVBA 6PCYA 2HLFD 1KLGA 4ZMYA 4WHTA 3FONA 2OJZH 3BLBA