1WWAX

Ngf binding domain of human trka receptor
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
105
structure length
105
Chain Sequence
b'VSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (NERVE GROWTH FACTOR RECEPTOR TRKA)
publication title Crystal structures of the neurotrophin-binding domain of TrkA, TrkB and TrkC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 11
structure length 105
sequence length 105
chains with identical sequence Y
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1999-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wwaX00
2PO6C 2M2DA 3U83A 5HYQB 1AQKL 1QKZL 1E6JL 3FN9A 1OGAB 3SDDD 5D7KD 4PRNA 4HZLA 3VXRB 4PUBH 2P44B 4I0CC 4UB0L 5TE6H 1AY1H 3UTQA 3FO9A 3CFCL 4G9FB 2P5WB 5HHOA 4I3RH 3IFOB 3C6SB 5DTFB 3KS0H 4XHJD 5EBLA 2BVQB 3VXMA 5C0CA 1A6UH 1V8HA 4AY0A 1CS6A 3MUJA 4JFFD 2EYTB 1FG2A 3I6GA 1NLDH 4L3EE 3T2OA 2NX5D 5ETUB 2IBBA 4ZAKC 4R4FL 4KI5C 1MCPH 4N5UA 3V6OC 5BXFB 4PREA 3GZKA 4QF1B 5F7EH 3LKRA 1X7QB 1Q38A 1QFWI 4LIQH 4XBPA 2LVCA 3MNZA 4G43A 3C60B 4I18B 3AREB 3EYSL 3ULSB 1K9TA 3EGSB 5DI8B 3MRKA 5JLZA 3U9UA 4Z77B 1FLTX 1QVOA 1Q9WB 5EO1B 2CD0A 4FFVD 4RAUA 3VFPA 5JNYB 3MRMB 1VPOL 1CFVH 4J4PD 3IDJA 3EFDL 1Q94A 1I9RH 1HZHL 4JO1L 3QFJE 4NNPH 4OLUL 5JDSB 4U1NB 1AH1A 1I3UA 1CGTA 3PGCB 4M4RA 4OFVA 1BEYL 1AQKH 1E6JH 3T2NL 4Z7VA 4Z9KB 1VKXB 5EUOE 3G6DL 1CFNB 1R3KB 3N9GL 4UB0H 5C08B 3ZKQD 4QNPF 2D0HA 3CFCH 3O8XC 4AT6A 4Y4FD 4TTDD 2IANB 3QNZA 3OG6B 1XGTB 1K5NB 3U36B 4KPHL 4OAWA 4YHYC 3IXAA 3VXRE 3MV8D 3U0TA 1TJIL 4L8SC 5C86A 4Y4HD 1FVEB 2X4QA 3F12B 2P5WE 3QWQB 4C4KT 1M7DB 2ERJB 1OPGL 2XFXA 5I8KH 3WN5A 5ID1A 3RJQB 3QUZC 4OFYD 3PNWB 2V9RA 5DK0A 1EHLL 1TDQA 4R4FH 5HGDB 1MHPL 3NIFF 3WFDL 4EI5B 1OD7A 5FYJD 1I7ZA 2X5PA 5EIQA 4JREC 1MCWW 1HHHB 4OZFH 3EYSH 5CJOL 3LKPA 3MXVH 3MV01 3VFSB 4YGVA 1GJIA 4NM8L 5KAQG 1U8LA 4EUPG 3VE0B 5E94A 4MX7A 2EEAA 1EJOL 5F6HI 5I71B 3BX7C 1VPOH 5DO2C 5FYKE 4AM0A 2D7OA 1FNSL 3EFDH 4P9HC 1HZHH 1QQDA 4JO1H 3M45A 4G8EA 4KJYA 4OLUH 2XZZA 3QG6A 4TN9A 2ATKA 5C0DA 2UYLB 3CDFA 1BEYH 2LAGB 2Z93B 3RTQA 3T2NH 4U6VL 3LY6A 3ZMRA 5F3BA 1IEBB 1MVFA 3N9GH 2X4PB 1GGCL 4P2QB 5L8KB 1A1OB 2XY1A 5KVFL 1KELL 1MFEL 1S9XB 4WWKA 1ADQL 1DVFB 1MOEA 2DQIL 2X10A 5JW3L 3C5ZD 2EDWA 5J56B 4LHUD 2A6IB 3BRGC 2NTSP 3GGWA 4KPHH 5D1ZD 4JB9L 5C08E 1TJIH 3BPLC 3L3IA 4U05A 3NOIA 4PFEA 1XGRB 2R29L 5I73B 1OPGH 1NANI 4YDVA 3TWCL 4WRLA 2GTZB 2WIIB 3QULA 2YWZA 3G5YA 4N0FA 4XI5C 1EHLH 1MHPH 1E4KA 4NOBA 3WFDH 5DD1L 3KPLA 5GGVL 2VN7A 2GK2A 4G8FA 2NW3A 4EIZC 5FECA 1QD0A 1UACL 4M1CC 3KJ4B 5CJOH 5EU5B 4NRZB 4RZCB 4OZIA 4MAUL 5BMFL 2F58L 3GHEL 4NM8H 4XHQA 5HVHC 3ZLQC 2H8PB 3B2VL 3DJ9A 1EJOH 1Z0NA 1MVUA 5I1LA 5F44A 5J1SC 1ETZB 1FNSH 4M1GL 4MAYA 1QNZL 1KOAA 1ZLWH 1RD6A 3NA9L 5IMOA 5E2WL 1QYGL 4LSSL 4RFEA 2OI9B 1RHFA 4TUJB 2VDKL 5EU3A 3VJ6B 4ZPVA 1TFHA 2VLRB 4U6VH 4KKBC 4PYGA 2NY6D 5MENB 1GGCH 1FRGL 3C6LD 4U49A 3RNKA 5J89A 4F9LA 1KELH 5KVFH 1JK8B 4WFFE 1YC7A 2ZCLL 1MFEH 4WI3A 5T1KD 1ADQH 2DQIH 5JW3H 3F7YB 1J88A 1U8OA 5E6IB 5B4MD 3C8DA 1TVDA 3KPMA 4AENB 4UTBL 1BFTA 5TE4H 3TO4A 4JB9H 3E1F1 3GSWB 5IWLC 1U93A 3G08A 3OAYH 3QT2A 4BH8A 3ARBD 2R29H 1DEEA 5H37H 2C5DC 5DJZA 5DJYA 3TWCH 1YNTB 1R3JB 3W2DL 5AEAA 1FBIL 5HY9B 1KLFA 3MLXL 5DD1H 5GGVH 2Y72A 5DUPL 3MRRA 4CVUA 4C56B 3LRHA 3FOMA 3GMNA 1UACH 2VOTA 5DLML 2WINA 2BSED 5BMFH 2F58H 3GHEH 1B2WL 1ORSB 3SEPA 3B8YA 5B38A 3B2VH 4FG6D 1HSBB 5D1QA 4EXPX 1EX0A 2J5LC 1OGTB 3EO0B 3DSFL 4X6CB 4M1GH 1RZJL 2X9YA 2YXFA 1QNZH 1GAFH 3QIBB 4EDXA 3NA9H 1KACB 5E2WH 1QYGH 2ZOLA 4LSSH 5HI4D 1TVBB 2UVFA 5IEHA 4X6FB 1UGNA 1MNUL 4MNQB 2VDKH 5BS0B 1EVUA 5C6WH 4R2GD 2COQA 1FRGH 2QR0A 4U1LB 2PTVA 4BQ8A 4WNQB 2ZCLH 5E5MB 3ARGD 4PJGF 4QO1A 4NHUB 5LGJA 1D9KD 1ZT7A 4HWEL 2VLRE 4UTBH 3MNVA 1WUNT 3Q1SL 3DVNA 3VMPA 5MENE 2ARJB 4GW1B 5T3XD 4C57C 4QRRB 3WUWB 3DVFA 4F7CB 4KRPC 5C07D 4H0HB 1FZJA 4Z7WF 2VZVA 2ESVD 3LEXB 3W2DH 4IS6B 1YN7B 2EXYD 1FBIH 1UH4A 1K2DB 3MLXH 4XXDA 1P6AB 3BN3B 5DUPH 1XIWA 5JORA 4WW2A 3UZEA 4U1MB 2YA2A 1UFUA 4P4KA 5DJAB 3S88L 2N7AA 4AQ1B 4X7TA 2V5RA 1FNGB 3L3HB 2JB6B 1JN6A 1B2WH 4PJBA 2O5YL 4NQCB 1R5IB 3I75A 2QTEA 4C56E 4ZDHB 2YSSB 1Q9LA 1KTLA 1Y6NR 4LPXA 5I76B 2UZIL 1FYTB 5CGYC 4IOIB 2PXYC 3DSFH 3RL1A 1RJYA 1RZJH 1YEGL 2IADB 3AY4C 4Y2DC 4M5YL 5CCKL 4XCNB 5D7LA 3EJZC 3PWPE 4D9RE 2Z35B 3CFBB 3CMOL 1XEDA 2FYYA 32C2A 4BSWB 1MNUH 4KK6C 4E42B 4CKVX 1S7SB 4XXCC 2R23B 3ARXA 4K7PY 4X6CE 5GS1C 3VFNB 1L4IA 3FT4B 5F3HB 4IRZH 1QLRA 3V52L 1U8PB 4EI5C 3F7RA 4TRPL 5IJVA 5L2JB 4IEFB 2BNRD 1FO0L 4HWEH 4OF8A 4PB9H 2JIXA 3Q1SH 2AK4B 4KDTA 2PCPB 5AZEL 4F9PC 2BVOB 3BQUD 2LTQB 2CK2A 3ULUD 1CFTB 1UZ6F 3KS0J 3HR5A 3BMVA 3V6BR 4LKCB 3HC4L 1P9MA 4XPAL 4HG4J 1NPUA 5CMAB 1VADB 1TCRB 1MIML 4QRRE 5CJXA 1BD2A 1QSVA 4XRCA 1ZAGA 3W5MA 2NY4D 1I1AB 3RGVC 4CVXB 2RB8A 3S88H 1P5UA 2JK5A 1JGDA 1J1OH 3T0AA 1IGML 1RSFA 43CAB 3VG0L 4IBLT 3CH8A 4R4BB 4YHKL 5JW4R 3QJHA 2L4OA 2QLVB 2A9NL 2ILLA 3U46A 3RKDC 2O5YH 2AJYL 1YEHL 3KYMA 1J12A 2VE6A 1HYRC 2A0LC 4NO3B 2UZIH 1RUQL 5JW4N 1D5MA 3MRFB 1G0DA 4BQ6A 1N2RA 1YEGH 1L0YA 4M9OA 4X7CC 1JPFA 4M5YH 4PGCA 5CCKH 1VFMA 2OTUA 2R1YA 3HB3C 3MRCB 4NQCE 1A6TA 4HS6B 4HKXB 5A16A 4L8CA 4OGYL 3CMOH 5C71A 3M17A 3KPOA 1FYTE 1PG7X 3JV6A 5E2JA 3P9MB 2CK0L 4QRTA 5L2KD 1QP1A 4P5TB 4XP5L 3V52H 1F42A 4NN5B 1KCUL 2YN5A 4TRPH 5DHYA 1XZ0A 3L7FB 3CIQA 4JR9L 3VMNA 1FO0H 3T3MF 3B9KA 1ZHNB 4LCWA 3L5JA 5ICZA 5ICXB 5AZEH 2VUOA 4NO5A 5EUKB 4E5XA 4RQQB 3X12A 5GPRA 3QDMA 3HC4H 4XPAH 1NCUA 3P4OB 4EIGB 4F2MA 1MIMH 5DRNB 5IW6B 4J8RB 3PE9A 2A6KB 2DBJA 1X5HA 2Y5EA 4WW2F 1BQHG 1E4XI 5IBLD 1IGMH 5IFHL 5ISZD 4KHTH 3VG0H 2VLLB 3DROB 1M1SA 4YHKH 1BZ7A 4MJIA 1NEZB 2A9NH 3MRLA 1U3JA 2GJZA 3D85B 2L7UA 2AJYH 4XNZC 1YEHH 4EDWL 2CKBB 3P0VL 1LDPL 2UY7A 1MCEA 1FL3B 1BFSA 1RUQH 1FFPA 3OV6A 4U31A 3VD7A 5GGSB 1N3NA 3HKFA 3UJIH 2BVPA 3IKKA 1MHEA 3FQUA 2PW2B 4PJ8B 2LV4A 1J8HB 4APQA 1F6AA 5E9DB 1M6OB 1N6UA 5T1LB 2CK0H 3EOYG 1G7LA 3RPIA 4TSCL 4M3KB 4WHYG 1BIIB 1PW3A 3DUSB 4XCYA 1NMCC 4XP5H 2XWTB 1RZIA 1KCUH 4NFBA 4YR6A 4BFBD 5I0ZA 4JR9H 3EOAB 3S37X 3VGAC 4X99B 2OQJB 2EYRA 3JWOL 5SWQB 2WW8A 4MXVF 4W4OA 4UAOB 1I8KB 4XP1L 5EFIA 1AKJA 2I07A 1LEGA 1U92B 3NCJL 3EJYD 1C7TA 2AJZA 2R2HB 5E99L 3CZFB 4HIIA 2FJFB 2Q20A 3SJVD 3VG9C 3ARSA 5IHZB 4MCYB 4XPHL 4WEMB 3REWB 2AVGA 1P4IL 3EAKA 4LHUG 2UUDH 4PP2B 1BJ8A 1QBAA 1E27A 4OD2A 5C2BL 5EC1B 5EOCL 3SDCD 5IFHH 1ZK9A 1WAAF 4YPGB 4WV1B 5GGTL 2X4OB 4JZNB 4ZFFB 2FIRT 4HBQA 1JMXA 2HLAB 2YWYA 2NY5C 3QEUA 5CGTA 2NX5E 2VLME 1QR1B 2NZ9D 4IMLA 4Z7OE 5I0DA 5C0FA 4EDWH 1GHFH 4XNQB 3P0VH 1LDPH 5J7CC 4NC1E 1BJMA 5E8PA 1DZBA 5DJ2A 4JQVC 2XXMB 3FCTA 1UA6L 4J7RA 3ES6B 3W0WD 1QSFD 3AS2A 4G3YL 4NBYB 4KUCD 3OKNB 3CXDL 4O2CA 1U8NB 4TSCH 2Q87A 3V95A 1IM3A 2ARWA 3U7YL 3E3QE 3GJEB 4F7PA 5ESAB 2JF1A 1NEUA 4G8GD 3BHBB 1J8HE 1UXSA 4AL8L 1G7HA 1PX4A 3JWOH 2M26A 3FB5A 4PJIA 3GO1L 2YZ8A 5KSAB 1DLHB 1JPGB 4WTWA 4XP1H 4G6AC 1Q9KB 3EOBA 2YUVA 1IAIL 1BWWA 3NCJH 5E99H 2AXFA 2QADC 3HTLX 2CIKB 4KRNA 1II4E 3H7BB 5HVGB 4X5WA 4NC2B 4P23C 2VYRE 4XPHH 1EJ6A 4W6YB 1P4IH 1GGUA 5GJTL 3MV8E 1U9KA 1BX2A 5C2BH 5HI3C 5EOCH 4ZPTB 4OZGE 3H0TB 5GGTH 2G75A 5C0BD 5J6GA 2ED8A 2Y5TB 2P8MA 1EDQA 2G5RA 4X9HA 3TN0A 5HPOA 3ULVL 2MQCA 4N5EC 5EO0B 1MHHA 4JG0L 4DCQB 2W60A 1MQ8A 2DKUA 1IC4L 5IESL 1D6EB 4PRPA 4BKLA 4H5SB 2Y6SC 3RWJB 1PGRB 2IPUK 1UA6H 3OXSB 4PLOB 1NGPH 4M6OH 1C16A 5CILL 4M00A 4G3YH 4RAVB 1MUJB 4OFKA 4LNRB 2I5YL 2V9TA 3CXDH 4YEEA 3U2SA 3K0WA 1KT2B 2BVEA 4NQEA 1QA9A 2HJFB 2IAMD 1OWWA 2MNUA 3U7YH 1KIQB 2OM5A 5IMLB 2ZG2A 3LEYL 4AL8H 4PY8I 5MERA 1LMKA 2BNUA 4IHOA 4NN6B 3VXUD 3ALPA 1G7PA 3KPNA 3CCHA 4KVCL 4XNMA 3GO1H 5D7SL 5F7DA 2DIBA 1JGVL 4GAYB 1XGPB 5FHBL 5GGTA 4EN3C 1RJCA 4OUUA 1IZJA 4ZO6A 5KG9A 5HTSA 4YBLC 4R96A 1UB5A 1IAIH 5BV7L 2G9HB 4Z5RA 4YHNA 3CU1A 2YPLB 3O9WB 1T80A 2C4FU 2OL3A 3LV3B 3OKYA 4FN0A 3SCMB 5DD3L 1NCCL 4S1DC 1AFVL 1WT5C 5GJTH 1I3VA 2CDFB 1AI1L 2F54B 1X5ZA 3P4LA 3PHSA 1YYLL 4BZ1L 5IT2L 4HV8B 3PGDB 1F3JA 3LSOB 1R3LB 4D0BB 5CEYB 1ZWIA 2ARJQ 1ZHBA 3MRBB 4BK5A 3MYZA 3ULVH 4NN5C 2PW1B 3VFUA 4JG0H 2VLKB 3E6HA 4MJ6A 4U1SA 3LS5L 1BREA 3PP3H 4EI6A 1IC4H 3NABL 2BSTA 3VI4E 5EZOH 3RVTD 4URTB 3G5XA 1BVKA 3QRFM 5F1NB 3BW9A 1B0GA 5CILH 3V79C 5D7JA 4GAJL 2I5YH 4UT6L 2J8UB 2FCBA 3TPUA 1H5BB 3CFDB 4TOYL 4F3FA 1KLGB 3HI5L 3UTSA 4JY5L 1FL6B 3MLZL 3NGBC 1T5XA 1A9EA 3BEWB 4LARL 4OSUH 1CFQA 3O4OB 1FAIL 3CNKA 3RVUC 1V3MA 3HI1A 3LEYH 4W70A 2QQQA 5JHDA 2DRUA 1AP2A 4KVCH 3GMLA 1KB5A 1MREL 2R2CA 1QSEA 2ICES 5D7SH 4PJIF 1JGVH 5FHBH 1S7RB 4K8RD 43C9A 3H3PL 4ZO8A 1P84K 2AXGB 1IBGL 2R1XA 5ANMA 1TQBB 5BV7H 4OCLC 4NKOB 1YEIL 3X3FL 4QKXB 1NGZA 5E6YA 4PJ9A 3BMWA 3R0NA 5KJRL 5DD3H 3NPSC 1HHJA 1NCCH 3MNWA 1AFVH 4CDHA 5I75C 5C0EA 5F9OL 2HA1A 3SKUD 4MD5A 1YYLH 3VWKB 5IF0B 4BZ1H 5IT2H 2YPLE 4FQQB 3KYNA 2PO6A 1JRHL 3VFWA 5B3NA 1IGFL 3QIWC 1F02I 3V6ZA 3SKMB 4HIHA 1GPOL 3B83A 1U91A 2CMRL 2F54E 5JO5B 3LS5H 1T83A 2R39A 3NABH 3LMJL 5JR1L 5F97E 4HUVB 3QUXB 3MLYL 1WCBA 5JIIA 1X6LA 1KBGL 3PIQB 3EO1A 3K4ZA 3L5HA 3S35X 2HKHL 2LU3A 2VLKE 5E08L 2P5EA 4JQXC 1MFCL 4GAJH 3ROLA 4UT6H 3MXWL 5E95B 4F15B 4TOYH 3IGAB 3HI5H 4JY5H 3M1BB 2DYPA 2K1MA 4LARH 4X5XA 4ZAKA 1FAIH 3TZVD 3V0AC 3G6JA 4PTTA 2PN5A 1IEHA 1Z6JT 2A83B 3TH4T 3V6OA 1YMHA 5CIPB 3UYRL 5C0JB 1SBSL 1MREH 4M5ZL 1WFNA 5CEZL 3F7VB 3S6CA 5IFJB 5BQ7A 3H3PH 4F33B 1IBGH 1IGCL 2BOBB 1AJ7L 2HTLC 4QOKA 5GGQL 1YEIH 4Q6IC 5FKPB 1JMZA 3CH1A 4PV9B 3LD8B 4Q9RL 2WBJD 2E9JA 5KJRH 3UP1A 4CVZB 2CIIA 1JWUA 3QQ9C 5F9OH 4UDUB 5DWUL 5CBEB 1T3FB 5IB3A 4Q9CA 1JRHH 2C7UA 1IGFH 3E6FB 4CN6A 5EBMB 3DRQB 1GPOH 3T2PA 2CMRH 3O8XA 3LMJH 4PJ5D 5JR1H 4BM7A 4IIQB 1UQSA 4NPYA 5E5UB 1DUZA 1KBGH 2EZ0C 2HKHH 2FO4B 1VHPA 1G6RL 4L8SA 5JPNB 3VFGL 5E08H 1HQ4B 1UXWB 3QEGL 1MFCH 1HQRB 1I7UA 2H32B 3MXWH 3VFVA 4N8VA 1KG0B 1U8JB 2Z31C 4ZUVB 3MBED 3RL2A 3QUZA 2YR3A 4NKMB 1CN4A 4XP9L 1CGWA 3L7EA 2ED7A 4FFWC 3FTGA 1CT8A 5DF0A 4NUJB 3L3GB 3UYRH 4G5ZL 5HGAA 1DQJB 1SBSH 4ZMAT 4G80A 4H1LG 2X4TA 4HEPG 4M5ZH 1G9MC 3H9SA 5CEZH 5LGHL 5M7QA 4ODXB 1ZTXL 5AUMB 5L88L 4N1EA 4NCC2 4L9LC 1IGCH 3KPRB 5JIKA 1AJ7H 5GGQH 3WBDA 1KTKE 3FO2A 3ULVF 4LKXA 5HDBF 1QFUL 4Q9RH 2BNRE 3SE4C 1NC4A 3IJYB 5GIRB 5F88B 1H15A 1U8QA 3FONB 5DWUH 4D0DA 4OV5A 2CJUL 3ULUE 3QFDB 1AD9A 1REIA 1IAOB 2ZUVA 5IR1B 3CFKB 5L0QC 1F13A 2NR6D 2W65B 4UMGA 5F9JA 4RBPH 2BVUA 4MXQD 4X83A 3BVNA 4LHJB 2DQFA 1LO3L 4X8JB 3QIUD 1S9YB 4HUXB 3MV11 5B8CB 1G6RH 3VFGH 1ZLUH 3QEGH 1BM3L 3CJJA 5IKCB 1KCSL 4JKWA 4AMKL 3WFCL 1KIRA 3O2VL 1A22B 5JXAL 1N59A 3HC0B 3OR7B 1VFBA 4XP9H 1EAPB 2EE9A 4U1JB 3K81A 1I85C 1IAKB 2BCKA 5CSZB 3AS0A 4KI5F 3ZKXB 4G5ZH 5FYKL 1GGTA 3PWLA 5FA3A 3GUTB 3GSUB 5LGHH 5J13B 3QPQD 1ZTXH 5L88H 1KPRA 2ZG1A 2D31A 4QHMA 2I9TB 4ZXBB 5CJ5A 3BP7B 2RAMA 1QFUH 2H26A 2DQUL 1P2CA 1JPST 5IHUL 4LMQE 3KXFB 2EE2A 1JZ2A 4NBZB 3SDXF 3KPRE 4GRWH 4F7TB 2CJUH 3UCRA 1G6RA 4WFHE 3VXOA 1CE6B 4AIOA 3LHPL 2HFFA 1WWCA 5EH1A 3O4OC 2X1XR 2NY3C 3PWJA 2AI0L 3HE6D 1TZIB 3GSQA 4PRDA 2GJ6B 2I26N 1LO3H 3TBSA 4PRHD 5D96C 3MOBL 4PLJC 1BJ1H 3L3DB 3OJ2C 5INCA 5F7HA 5IWLA 1JYWA 4XZUA 1BM3H 1KCSH 5FGRA 4ZUSA 3WFCH 1I75A 3O2VH 3O11B 3BI9X 1PQZB 2A2QT 2WV3A 4QTIL 1WFTA 1PYWB 4HH9B 4NZJA 3NN8B 5JXAH 4DOHB 1JGLH 2HJLA 1XGQB 4H25A 1FFNA 4JZJC 4X0KB 5BO1L 2FH8A 5IVXF 3L95B 1E28B 3QWOB 5I66B 4LLUB 3PWUA 3V4PL 5FYKH 4TVPL 5HYQA 4L29B 1QRNB 1OGAA 1GC1L 5HGBB 1OF2A 3V0VB 4FQHA 2CLRA 2ZUYA 1H3XA 3HZYB 4G9FA 4QHUA 4IOFC 5DR5L 4PJXB 1P7QA 3MREA 5HHVL 5D9SB 2DQUH 1P1ZB 4HSQA 1ONQA 3QEHA 3TJHC 5IHUH 5KSBF 3JV5A 1IM9B 5JW4M 3T04D 5E0QA 5AAMA 3A6OA 4IRSC 2GW5A 3LHPH 1NBZB 2H3NB 1CICB 5DEFA 1T7VA 2AI0H 3KXFE 4GKZB 4N9GB 2FJGB 2XACC 3E2HC 3SHSA 4HGWA 5T3ZL 3O3AB 2DBLL 3MRPA 3DO7B 3T0WA 4NM4L 3MOBH 5LG1A 1Y18B 4CU7A 5INDB 2EEBA 2QQLL 1KJ2L 1UCTA 2IC2A 4M1DL 2CRZA 4UBDD 2H41A 2WP3O 3OAUL 1YECL 3TBYA 3MGAA 2VZOA 3WO4B 1IVLA 3QH3B 5EZJB 1WBYB 3BGFC 5LQBL 3U30B 3S96A 5E2TL 5BO1H 5ERWB 2FWOB 1N0LA 2JCCA 1QSFE 3MLTA 1X4YA 3V4PH 5D93C 1JV5B 3VXSD 1GC1H 4DOHE 2CKNA 4UUJA 4MD4B 3KLAA 5AYUL 2P8PA 4JFQB 4DW2L 3QXVA 1UG9A 3AAZB 5MEPA 1YPZA 5BRZB 1FVCA 1NGXB 5DRXB 5DR5H 3VGGA 2IANA 5HHVH 4U6HB 3VXNB 1QRNE 1JE6A 2Z4QB 1K5NA 2PXYA 3FHQA 3MCKA 4XMLL 4Y2DA 2GEEA 4JRWA 1ZVHA 3S4SA 2EC9T 3MFFA 1F6LL 4M48L 4BFGA 4GG8B 3F12A 4LCUA 3GMMB 1LP9B 4KJPC 4CDGC 4MA7H 4PJXE 5IBUB 4HUUA 2XTJC 2DQHH 3FO1A 3AXLA 5CSGA 4XXCA 3ZKMD 1RZKL 3VFOB 2HTKC 5GS1A 3KLHD 3CSGA 25C8L 2EDTA 1NCWL 4EI5A 3KPPA 1BVZA 2IH1B 4YK4B 5T3ZH 4NNYA 2DBLH 4NM4H 4NQVA 2ICWA 3P11L 5J4MA 2QQLH 5FHAL 4M1DH 3TO2B 3LKSA 3QUKB 4F9PA 3M8OL 5JQ6L 1YMMD 3OAUH 1YECH 1S9WA 4U0RB 3WDJA 5CP7A 3MV9D 1DTUA 4NQDB 1FVDB 1I4FA 2VITA 3RWFB 2EO1A 2KKQA 4E41A 1FGNL 4PJFF 1P7HL 3FOLA 5LQBH 1YEKL 2QBWA 3QXUA 5E2TH 1MCQA 1T7WA 4GXUM 4P57B 2XQYK 3RGVA 4PR5B 1V3LA 5LWYL 2W0LA 3SGEH 1SEBB 2NXYB 4GRWF 4GSDL 1YJDC 4NT6B 4NUGL 4P46B 3VFTB 5AYUH 3C9NB 4DW2H 4I48B 1A5FL 4P2QA 1IMHC 3UJJL 4NYLA 4X4XA 1S9XA 4JFPA 4G9DA 2HH0L 4XMLH 5D2NB 5D7IA 4UNVA 5KOMC 4PPTA 1KJ2A 1TQCC 4NZRL 1GGYA 5HPMA 1V3KA 4D2NA 5KS9B 1VGEL 2A74B 1PD6A 3PQYB 4I0KA 3DMMC 2EDEA 3IDYC 4BFIB 1RZKH 4I4WA 5HHQA 5T5NF 3LN9A 25C8H 2HT2C 5IB1A 1NCWH 1LP9E 1OLZA 1RIVL 2LABA 3FT3B 3QJFB 4C58B 2H2SC 2X1OA 4JGJA 3P11H 5CLTA 3TA3D 2FL5B 3D39B 3MJ9L 4LCYB 4U1IA 5J13C 3M8OH 1QSZA 2Y36L 5JQ6H 3B3IB 4Q9BA 4GRLC 1TCMA 3MUZ1 2OBGA 3DVIA 2ADGA 1NH6A 5SWZA 3W81A 4OZHE 2FGWL 3BP6B 1FGNH 4JFOB 4R97C 4OF7A 3SGJC 1D5XA 2BMKA 1YEKH 5DD0L 2B4CL 4OZ4B 1ULVA 4BZ2L 5F9WC 4KTEL 4NQDE 3TVMB 4L4VA 5JOPE 4OLEA 1FZMA 5FO9B 1G9EA 4XX1G 4FFZL 5GGUB 3VJ6A 2A6DB 1HH9A 4JZOB 4GSDH 4NUGH 4POYA 5FO8B 2RIKA 4XC3L 5H94A 1A5FH 4GS7B 5A3ID 1JK8A 4MSWB 3UJJH 3FT2B 3N1MC 3CDGA 1XIWD 3OXRB 2HH0H 4DKFL 1TIUA 1UENA 4P4KD 5IG7B 5F89A 3L9RA 1DDHB 1P7KB 3BYTA 4M8QA 2MKWA 3GSOB 4NZRH 5HBBA 1FJ1A 4X7EC 3GMPB 1QO3B 1VGEH 1LQSR 2PYEA 4LLMB 2GSIB 1XGUB 1YNTA 3V7MA 2C1OB 4RRPG 3HE7B 2LQRA 5I2IA 1EFXD 1NDGA 1RUKL 5A2FA 5TDPB 2MCG1 4MJ4A 1JYXA 1A8JH 3V6FA 1RIVH 4HIEA 1T0PB 3KYKL 5KS9E 4WVRA 1I9IL 5TJWK 1D5BB 3WL9B 3MJ9H 3VRIB 1N8ZB 2Y36H 5FK9B 2AW2A 1I3RA 3KDMA 1HSBA 5CJQL 5FEBA 2F53A 4ODBD 4P5MB 4ZG1A 1G0XA 3H6JA 3RZCC 2FGWH 3D39E 1XR8B 1XCTA 3BEVA 5DD0H 2B4CH 3K2MC 2MQ3A 9CGTA 1BBDL 4BZ2H 3QIBA 4HIJB 4MLSA 1BAFL 1OAQL 4KTEH 4GBXC 5JA9A 2NNAA 2GI7A 5HSFA 3TP4A 5IJKC 2Y23A 4FFZH 4HUWA 4NO2B 4X6FA 4X4YA 2GHWB 2DICA 1ZT1A 4XC3H 4PJAB 4JGMA 4XCFL 4F57L 1ZHLB 3WCYA 3IDXL 3V2AR 1XH3B 3H9HB 5HYSB 4DKFH 2J7LA 3MO1B 4JQVA 4ZNEA 1G7JB 2ARJA 5GZND 3MJ9A 3AS3A 3L5IA 5HI5C 3OKDB 1TTUA 3LEXA 3WV0A 4IS6A 1YN7A 4HPYL 3RI5K 3SY0A 3GIVA 5F7NC 5GS2H 4WO4B 1RURL 1RUKH 2ZUQB 5DXWA 4JO4L 5CINL 1RFDL 1C12B 1CFSA 4PBWD 2Z91A 3KYKH 2H9GA 2VKWA 1CF8L 1I9IH 1EHNA 3LKNB 1PAMA 4R0LB 5BZDA 2IALB 3QUYD 3MLRL 2K9UA 5I74B 5TGBA 1S7UB 5KZCB 5D6CA 4I3SL 2BOCB 2GAZA 3EKCA 4O2EB 1D7FA 5BOPA 5CEXB 5HYFA 2FR4A 1EZVY 5DQ9A 5CJQH 1HDMA 4P48A 3LN4A 4PRNB 5ID0A 4HZLB 5GZOC 4FRWA 5I76A 4IOIA 3FQTB 1Q0YL 3FO9B 1ORQB 3B9KD 4WTZA 1BBDH 2ZG3A 4P23A 3D2UD 3KPSA 3KAAA 5HHOB 3P3YA 1MF2L 1BAFH 1OAQH 1JF1B 1RMFH 2NY1D 1LHZA 3HG1D 4B7LA 4BSWA 3VXMB 3MLVL 3TFKD 5C0CB 4E42A 4U1GB 3FT4A 2NY2D 4XCFH 3I6GB 2MKLC 4F57H 3FN3A 4PRIA 3QCVL 4POZD 5DS8B 3O3DA 3HNTL 3RGHA 5JUEL 2AK4A 2EH7H 4PJAE 4MJID 3WS6C 2RBLA 1M4KA 4PREB 3SKJL 3DSNA 5H2BA 3LKRB 3BH9A 4KMTL 4XBPB 3MNZB 5HJ3A 1CFBA 1EH9A 4G43B 5J6HA 3WO3B 1LD9B 1VADA 3MRKB 3U9UB 4HPYH 1QVOB 4OLYL 5DC9B 1RURH 5C0RL 4FXKA 4JO4H 1RFDH 1ZS8A 3P0GB 4RAUB 3VFPB 3RIAK 3Q6GL 3D25A 3B43A 4KRLB 1CF8H 1AC0A 4L4TA 3VH8A 2F8VA 3MLRH 1Q94B 5DD6B 4KJWD 3QAZC 3DTXA 4M02A 1AIFA 2ZUUA 4I3SH 4EN3A 4JDTL 3ZHKA 4Z7VB 4Y4KD 2XICA 2E7BA 1QBLL 4LASL 5F6IC 4KTDL 1EUTA 3O4LB 3DV6A 1Q0YH 4TNWK 4AT6B 4X6CF 1MF2H 5GSVA 5DVKA 2OMNA 1WT5A 3K80A 3QNZB 4JRYA 3A6CL 2EDXA 4OAWB 3MLVH 3IXAB 5EU6B 4WDIA 2ICWJ 4UT9L 4EZMA 1MFNA 5EC2A 5HHOE 2CKBH 3PV7A 4LOUC 3QCVH 3WN5B 5ID1B 3VXME 1WWBX 4HHAA 5C0CE 2OR8A 5DK0B 3AUVA 3T0ED 3HNTH 4U1HA 4OZFG 1MELA 4DK3A 2X41A 5JUEH 3VD9A 4D8PB 1I7ZB 3QRGL 4Y5YC 4F7EA 4PJEA 4HC1L 3RWCA 4KMTH 5I9QC 3O6FD 5E7BA 5I30L 3JZ7A 2VXSL 3LKPB 1DQQA 1S7QA 1F58L 1V7ML 4YGVB 4OLYH 1T66C 5IW6A 5C0RH 2BRRL 5E94B 2A6KA 3CUPA 3MRIA 5ACMA 3Q6GH 4LQ1A 4O4YL 4RNRA 5GGRY 4AM0B 2YC1A 1UM4L 1QQDB 1XF3A 4OFIA 2VLLA 3MJ8A 4G8EB 3QG6B 2AJUL 3W11D 2ATKB 5HHPA 5C0DB 3I6KA 4JDTH 1ZMYA 2V9QA 2ADJB 1PKOA 3GBML 3RTQB 5F7YC 4WEUD 1QBLH 4JPVL 4MHHG 3S3SA 2FEDC 4LASH 5F3BB 4KTDH 3EDKA 3HC3L 3HRZA 2NY0B 2HFGL 3BO8B 4LLYA 4PP1C 3ARFD 2NLJA 4WWKB 5IV2B 1FNLA 4D9QD 3VU2A 1WICA 3A6CH 2MHAA 4G6FD 4TUOA 4NWTL 1G9ML 3GGWB 4B0MM 3D3VD 4LSUL 1J0YA 5E9DA 1M6OA 3L3IB 5FYKU 5ITBL 4UT9H 1WF5A 3QIWA 2BDNL 5AD0A 1BFVL 1PG7W 2NW2B 4LGSB 2MMXA 4WUUA 3D1MC 2HAZA 4KKLC 1KCVL 2MCPL 1WCQA 3QULB 3G5YB 4N0FB 4LIQE 5EA0L 1EEYA 1X5IA 3RAJL 3QRGH 3BPNC 2NW3B 4HC1H 2FD6L 5FECB 1IC5L 4JQXA 4NWUL 5E1AB 5I30H 2VXSH 1VA9A 2R2HA 4PGJA 4MD0A 2VAAA 4OZIB 2YUXA 1X9QA 1V7MH 4PJHA 3WLBA 1J05A 3K4DA 4ODUB 2D7QA 2BRRH 4CGTA 3REWA 2VR9A 1MVUB 5I1LB 4O4YH 5DEGA 1F4HA 5I6XC 1UM4H 4MAYB 4ELMA 4NC0B 1ACYL 2HRPL 2AJUH 5IMOB 2H6PA 2X1WL 2HLAA 4RGND 2VKXA 4FQXD 3GBMH 4JO3L 4XNQA 5EU3B 4ZPVB 4G7VL 4JPVH 4WI7A 2EC8A 4Q6IA 2I25N 3HC3H 3BH8A 5IVOA 1YN6A 2HFGH 3RNKB 4JFDD 4MJ5B 3ES6A 4J3OC 4ZFOB 1I7RA 1U8OB 3FQRA 3BUYA 2QSTA 3OKNA 3KPMB 4NWTH 1G9MH 3DYOA 3U0PB 4HC1A 3TO4B 4BQCA 5H37G 4LSUH 5ITBH 5DJDB 4E9LA 1U93B 2BDNH 1JYNA 3G08B 3NMEA 1DQML 1BFVH 1NANH 5DZNA 5C09D 1DEEB 4HBCL 5ESAA 1RZ8A 5DJZB 5DJYB 1KCVH 2MCPH 4R0LC 4KKNA 5EA0H 5SX4I 5I74C 1C08A 3RAJH 3QCTL 2V5SA 3ME0A 5EZIL 4M7LT 1EO8L 2FD6H 2VL4A 3FOMB 1A6VL 4NZDA 1IC5H 2M8XA 2FNBA 1BZQK 2AQ3A 2AGJL 3FHAA 5HHXL 2AV7A 2WINB 5AZ2L 2Z31A 3SGDH 4QRQA 1E0OB 4JFZL 4P3DA 2BC4A 5B38B 3WFBL 5D1QB 2VDRL 4Z7OF 4QHKJ 3SDDC 4ODHL 3DX9A 1TPXB 4OZIE 4EQ3A 3EYQD 1ACYH 2DLFL 2HRPH 4EDXB 2ZOLB 3UJTL 4AG4L 5IEHB 5HHMB 4YDKL 4JO3H 4L8DA 4L9LA 4G7VH 1D6EA 1HN1A 3RWJA 4PRAB 2QR0B 5JHDD 4ZQKB 3OXSA 3SE4A 1MY5A 3DGCR 5LGJB 1YDPA 1ZT7B 3ORJA 2YD6A 5F1IA 1KN4H 3MNVB 3T3PE 3DVNB 4JRXA 3DXAA 4M7KL 3ULVD 4TSBL 1KT2A 5LXGL 3BT2L 1MFAL 4ZTPL 4K23L 1DQMH 3KNBA 3BZFA 4NHCL 3OJMB 4JFHE 4HBCH 1FZJB 6FABL 3AU1A 5IGXL 4LVHC 3QDGD 1UZ6E 3JXAA 4NGHL 5SWSB 4JM2D 2PO6D 3QCTH 4XXDB 3PWVA 1IL1B 4GAYA 5EZIH 5JORB 1VEOA 4FFVC 1EO8H 1P84J 4UI2A 4UOW1 5EBWA 1A6VH 3MGTA 4GKNA 1E4JA 1JGEA 3MRGB 4X7TB 5ENWA 5F1KC 5HHXH 4J4PC 1FE8L 4K94C 3VRLF 5AZ2H 1O7SA 1FSKB 2X70A 1HH6A 1JN6B 1NL0L 4PJBB 2C1PB 4PJHF 3LV3A 3I75B 4JFZH 4OCWL 3S34L 3WFBH 3FFDA 5DJ0A 2QL1A 3DX8B 1Q9LB 5DJXA 4Y19D 1I85A 2VDRH 5AWNL 1KTLB 2CDFA 4D9LL 2IWGA 1JCKA 4ODHH 4V1DD 3RL1B 4P2YA 5K9QG 3OTTA 1J86A 5CEYA 5D7LB 4ELMF 2DLFH 3MRBA 5GXBB 4Y4FC 3UJTH 4AG4H 4TTDC 2FYYB 32C2B 4ZAKD 4YDKH 5FOBA 4LLQA 4KVNL 4YDLC 4IRJB 4JKLA 4QGYA 4TTGA 1NKRA 5K33A 3PDOB 1QLRB 2XOTA 3ZZ1A 4Y4HC 1U8MA 5F1NA 4L5FL 5IJVB 4ZO9A 5HHME 3VWJD 3L5WA 3MZGB 3QNYA 2J8UA 1UB6A 2JIXB 3CFDA 1VFUA 4M7KH 4TSBH 4N90D 5LXGH 3BT2H 1MFAH 3OGCA 5EOQL 4ZTPH 4K23H 1U95A 3PL6D 4OLVL 4WEBL 4NHCH 6FABH 3T3ME 3ILQC 5IGXH 4JQIL 3LKQA 1C8PA 3H3BC 5K93A 5E2VL 3OPZL 1BD2B 4XRCB 4JM4L 4NGHH 4ZSOA 5HYJA 3OGOE 2C26A 2A77L 4ZODA 3BPCA 2JK5B 1JGDB 1EAJA 4JJ5A 1VEPA 1KJMB 5FV1L 1FE8H 3QJHB 3RWGA 1HK6A 1HCVA 1NL0H 1OSZA 3U46B 4OCWH 5FF6A 1CQKA 2WQRA 2LU7A 2PKDA 3T1FA 5CIPH 4JZJA 3RA7L 1UJTA 4J3XA 5AWNH 4D9LH 1D5MB 2Y9RT 2DKSA 3CD4A 4OJFL 4Y5VC 4PJBE 2R1YB 3RDTD 1A6TB 4AEHL 1NBQA 5A16B 4L8CB 5K9JL 4JJHA 4B50A 1I8MA 3M17B 3C5ZC 5JO5A 3JV6B 3L3JA 4QRTB 2K3TA 4KVNH 1AGDA 5D1ZC 4HUVA 5D7LE 1S7XB 2EE6A 4HKZA 3PIQA 4L5FH 5DHYB 1XZ0B 3QZWG 1T1ZA 3MACH 4M7ZC 2J88L 4GFTB 4R7DA 2UZYB 3H9SD 5DVMA 4DTGL 1KUMA 4LCWB 5ICZB 4OIIL 5E4EC 4MZ3A 2FX7L 4J3WA 4NO5B 5EOQH 2IEPA 1T2QL 2BZDA 4IRSA 4KMQA 4E5XB 4OLVH 4WEBH 3TNMA 5BW7C 1L9NA 3X12B 3DVGB 3I6LE 3QDMB 3P4NA 4NO0D 4O51A 4JQIH 2C4FT 4YAQA 5E2VH 5C0JA 1GYAA 2F74B 3OPZH 4HJJL 4JM4H 5D72L 1Z0MA 1E4XL 3UBXI 4NQXA 3FB8B 2H32H 2A77H 3ILPB 4Y16B 4FQJL 5D2LA 1JBJA 3CDCA 2AJ3B 4JVWA 4OQ1A 1BD2E 3MRLB 1PVHA 4M93C 4YNYA 2GJZB 2E5EA 1Q1JL 1JJUA 4FZEL 1QOKA 4AEIH 4FQPA 4OBRA 1C5CL 3MUY1 3PV6B 3RA7H 3MJ7A 1FFPB 1U3HD 4UDUA 2Z8RA 2XN9D 4JE4B 5CEZD 2B39A 5K9OA 4OJFH 1N3NB 2NY6C 2BVPB 3C6LC 3VGHA 5CJ8A 3OX8A 4ZOCA 4AEHH 3E6FA 1OP3H 3FQUB 4HW6A 3WSQL 4APQB 5K9JH 1XF5A 2BSRA 1F6AB 4Z95L 3OKOA 5B4MC 1G7LB 4QRPA 3RPIB 2DAVA 1P4BL 2NXZD 1I1FA 5AAWA 4XCYB 4DGIL 4YJZL 1RZIB 3WNNA 1FQ9C 4GMSL 1DSFL 4OI8A 1MHCA 2J88H 3ARBC 5DSCA 1NGWA 2FO4A 5JPNA 4DTGH 1HQ4A 3I85A 3QISA 2AEWA 3WHXA 1HQRA 2EYRB 2R69L 2H32A 3F6LA 2J8UF 4OIIH 4JANA 3DHMA 3I3BA 2FX7H 2IH3A 5EFIB 4L3ED 4LEOA 1T2QH 1AKJB 4WI8A 5D70L 3GHBL 2I07B 1LEGB 4ONHB 4X4ZA 1ACZA 3HMXA 3ZSTA 4IJ3B 2L0DA 2AJZB 1Q9OB 4HIIB 1ODAA 4LCWE 4Q58C 1NC2A 1F4WL 3P4MA 1UWXK 4HJJH 2W0FA 5D72H 2B5IB 3MOQA 3QDME 2AEQL 4FG6C 4DAGL 4OD2B 1E27B 4FQJH 1S5HA 2HVJB 3JTSA 5AUMA 2VDNL 3S5LG 4K7PL 3QEUB 1Q1JH 3FQNA 3NVQA 2C4XA 4IMLB 4FZEH 4KRMB 5C0FB 2V5YA 4Z76A 3VXPA 3MA7A 1C5CH 2DLTA 5HI4C 3UDWC 1EERB 5EPMA 1WZMA 1ZLSL 3IJYA 5F88A 4OF3A 2OZ4L 8FABA 1JNNL 5DJ2B 5F6HJ 4MJIE 3PDDA 3FCTB 5BJTA 4R2GC 2HFTA 4GKSA 4ORZC 5K59E 3CFKA 3WSQH 1P4LA 1CK0L 3ARGC 4P4RA 4TYUA 4UZGA 4Z95H 2W65A 1D9KC 2VLJD 4O2CB 1X3DA 3QFJA 1P4BH 3MRDB 1CXKA 1IM3B 4DGIH 2YRZA 4X8JA 4KQ4L 4GMSH 4F7PB 1DSFH 4HWZA 1UXSB 1OGAD 5DC0A 1K4CA 2YD3A 1G7HB 4P3WA 1X4XA 4OCXL 2R0KL 4ONGL 2XZAL 3RX7A 2R69H 3VXRD 3FB5B 5GGVY 4PJIB 5CD5D 2EXYC 4G9FD 1NBYA 2P5WD 1FSKC 3DMMA 4U0QB 3EOBB 3IU4L 3GHBH 3OR7A 1HXMA 4YFLI 1DBML 3CFEA 1XT5A 3MRJA 2AXFB 1IAKA 4M43H 3LQAC 2E7MA 1F4WH 4X5WB 4LSRL 5C0AA 3GUTA 3W9EB 3GSUA 2AEQH 2WWMD 4DAGH 1BX2B 3OJVC 3KJ6L 5SV4A 5AG9A 2EDKA 1IT9L 3MMEA 4GRLA 1YA5A 2G75B 5J6GB 2VDNH 3G5VA 4IRJC 2P8MB 4MA1C 4K7PH 3MYJA 3TN0B 1CQYA 1MHHB 3SGJA 3NA4A 2W60B 4QEGA 3P73A 3BIKA 1R5VA 1ZLSH 3C60D 4PRPB 5FYKD 3ARED 3S7GA 2OZ4H 5E4IA 1JNNH 2Q6WA 3RVXD 2VZSA 4F7TA 2X40A 4N0CD 4OT1L 1C16B 2DJ4A 3H2WA 5CUSL 1VFAA 2YRPA 2ZUSA 1CK0H 3QDJB 2DLIA 2K7PA 3U2SB 4NQEB 1QA9B 2GTWA 3BQUC 4IDJL 4O00A 4KQ4H 3KG5A 2Z92A 4KROB 1X5GA 3WNLA 1MPAL 4OCXH 2R0KH 4ONGH 2XZAH 4R7NA 2BNUB 4IHOB 5MERB 3SDAB 5ELIA 1FNEA 1G7PB 5C08D 2H2PD 4JY4A 4XH2A 5JMRA 3IB4A 4OF0A 2NY4C 2IAND 3IU4H 3C5JA 4KMLB 5KG9B 5FV2A 1DBMH 1XGQA 1UB5B 4R96B 1CD1B 1QPXA 4XP6L 3RNQA 1FIEA 4PJIE 2OL3B 3EJZD 3H9YA 2B1HL 4J3TA 1CD0A 1PZ5A 4Y1AA 1XF1A 4LSRH 4OM1L 4XVJL 1HILA 1J0IA 15C8L 4QT5B 3KJ6H 4H8WC 2DD8L 1F3JB 1IT9H 4EI5D 1ZHBB 1VCAA 2OXGA 2OCFD 3QP3A 3IAPA 3I02A 5D9SA 3S98A 3RZCA 1X44A 1BP3B 2A1WL 3KR3L 4MJ6B 4U1SB 3MGOA 2BSTB 4NQSB 3G5XB 2XI9A 1BVKB 5KOVC 4GBXA 2D9QB 2ATPA 4OT1H 3BW9B 3VDAA 4N1HB 5CUSH 5IJKA 1H8SA 3SOBL 3NCYP 4UNUA 5D7JB 1JNHA 4RCAA 2H3NA 2DWDA 4PRPE 1FORL 3UTSB 3AB0C 2FJGA 2D7TH 4WI2A 2FBOJ 1T5XB 1ZGLA 1A9EB 2I27N 4OM0L 4Z18A 2P43B 4WFFD 2WNGA 2VXTL 4OI7A 3HI1B 1FFOA 2Z8SA 3BWUC 1MPAH 4K3GA 4HGKC 4Y16C 4NQEE 3T77B 2BK8A 1NAML 3GMLB 1KB5B 4FHBD 2YEZA 4UQ2A 1QSEB 4P2QD 5JXED 1DVFD 3BPOB 3LDBC 4XAKD 4MCZA 3QXWA 43C9B 4PY7A 1WBYA 3B2UD 2R1XB 5ANMB 5IBLC 3D69A 4XP6H 3IVKA 1AQDB 1NUDA 4PJ9B 1A6ZA 3W39A 2HJKB 3RI5F 2SEBA 1HHJB 4OM1H 3MNWB 4XVJH 1X5AA 15C8H 1MI5B 3GMOA 4ZOBA 5C7XL 4J23A 5C0EB 12E8L 1T22A 1JP5A 4MD5B 4W4NA 2ZOKA 2DD8H 5EZLB 3VFWB 4XGZA 3V6ZB 5BRZA 2IMMA 5DRXA 3WIHA 4FMKA 4UQ3A 4HIHB 1MLBB 3BKJL 3FB6A 3VXNA 1G6VK 1U91B 2A1WH 3KR3H 2FLRT 2GJJA 3NTCL 3BE1L 4GG8A 1WCBB 2ZSWA 4EUPA 1LVEA 3EO1B 4EOWL 1T2JA 3AMKA 3SOBH 4FTVA 4X8XA 5FUCE 4X98B 2P5EB 3ROLB 4LLDB 1FORH 1T04A 4WHTA 2WWKO 2R4SL 3O6KL 2ZSVA 2DYPB 2Y06L 1KTDA 4OM0H 2IFFL 4X5XB 2VXTH 3G6JB 4PTTB 3O6ML 3TO2A 2VLRD 1YMHB 3EJYC 1AGFA 3UTSE 2IBZX 3WS6A 3QO1A 5MEND 1NAMH 3CC5A 3QHZL 4RMVA 2KQMA 5BQ7B 5E6ID 3BOVA 4NCC1 4QOKB 5JHDE 4P57A 3SDCC 1QSEE 3CH1B 1WJ3A 2P7TA 1AO7A 2AQ2A 4YBQD 2ZZUT 5KSUA 1A2YB 4G6ML 1JWUB 1SEBA 2FEEL 3TBTA 5C7XH 1SMAA 1N6QL 12E8H 2VB5A 2DLEA 5ANME 3ULVE 3RFZC 1Z5LA 5GS3A 5HDBE 5IB3B 1LNUB 2AV1A 2C7UB 2IGFL 1F4XL 4RFNC 3NACL 3BKJH 4HS3A 3QDGE 4QTHA 4XNXL 4C56D 5I17A 1QPPA 3QB7C 3O8XB 1KB9K 3NTCH 5D2NA 3BE1H 3EJJX 4NPYB 1UQSB 1WVZA 1YYML 2DLHA 1DUZB 1PY9A 2X89A 4EOWH 3LS4L 4YHYB 3PQYA 3AC0A 1NAMA 4L8SB 3Q3GA 4BFIA 3CMGA 1FZOA 2R4SH 4N8VB 3O6KH 3UTOA 2Y06H 4LRIC 3QIBD 4OGXL 3RL2B 4LPYA 1OY3B 2IFFH 3QUZB 1ZANL 3PWPA 1CDCA 4DN3L 5ADPL 5T1DL 1QTYT 2P5EE 3L7EB 4V1DE 4FQ2L 3FTGB 4MNQD 4R8WH 3O6MH 5BS0D 1CT8B 4Y5YA 4LCYA 3NIGE 1RUML 1RI8A 4JREB 5HGAB 3D9AL 3B3IA 3IFPB 4G80B 2X4TB 3QHZH 4ZOEA 3EDEA 3ZO0A 3NFPA 3U4AA 3JBG7 3G6JE 1GGIL 4KI5E 4XVUD 2PR4L 5FGSA 3V6OE 4MYWB 1J87A 3FO2B 5K9QI 1KTRL 4LKXB 4QRRD 4PJCA 5J1AA 3R4DA 3T2QA 3MR9A 5GRYA 3GSRB 4K07A 1TXKA 1NC4B 4G6MH 2VWEC 1S5IL 3MA9L 5GGUA 3UZVB 1N6QH 1H15B 2YS4A 1U8QB 2R2BB 4D0DB 4OV5B 4QOKE 4N90E 4G7YL 3VD3A 4ZUWB 1AD9B 2OR7A 1EXUA 1EBAA 4ORGB 2XZQL 2IGFH 1F4XH 4CNIA 5F8RC 4XNXH 3JWDC 5IG7A 3JWNC 3MV7A 5F9JB 5KVMC 4LPWA 4Y2OA 4KROC 2ZNWA 3BVNB 1BF2A 3Q48A 5EIIA 3SDAC 5FGCB 1YYMH 5KBNC 3UBXB 4BQ9A 2IAMC 4KK9C 5CKAA 4NQCD 3LS4H 5HDQL 5MHSE 3BPLB 2APXA 1XGUA 5J12C 1FYTD 1KIRB 4CN1A 1RUPH 2OR9L 3I84A 3GEWB 1QFWM 3O45A 2V7HA 1IQWL 3E8UL 1KF9B 1N59B 1VFBB 5ADPH 4DN3H 5JOEA 5T1DH 3L3KA 1D5BA 4FQ2H 4U6YA 1MCLA 2BCKB 4DGVL 3CFIC 1RUMH 3D9AH 4R90L 4KWUA 5EO9B 5IVNA 2Y07L 5BCAA 2Y4SA 1IEAA 3PWLB 5FA3B 3HUJA 5GS2D 3OR6A 5IVXE 2XG4A 1GGIH 3RIFK 2PR4H 2V7NA 5HVHB 4BYHA 3VFMA 2D31B 4QHMB 2AK4D 2DL2A 2OS7A 3MUHL 3KLDA 5C0NC 3SE9L 4PTUA 3H9SE 4QRUA 1P2CB 4NO2A 1S5IH 3MA9H 4PJDA 1GSMA 3OAZK 1Q72L 3BP5A 3K46A 3X14A 1G6RB 4G7YH 4LP5A 2XZQH 3IRPX 1I1AD 1A47A 3J7HA 2V2TA 3QPXL 2HFFB 2Q7YB 1XR9A 4OI9A 4M7LH 3WLWD 4PRDB 1ND0A 2YK1L 2HLFC 3TBSB 1OTUD 3OKDA 4MNGE 5HDQH 2VO5A 1JYVA 5GS0L 5KS9F 5T5NG 4K3EL 4W81A 3B9EA 4XZUB 1WTLA 3RUGA 4P2RB 3ZHDA 4ZUSB 2OR9H 4WTXA 4KK8D 5FGCE 1LO5A 2AQ1A 1RIHL 3K1DA 1IQWH 1K3IA 1TTGA 3E8UH 4LQFL 4R0LA 1KGCD 2HJLB 4H25B 4H20L 5B39B 1FFNB 4JO2L 1DBAL 1CL7I 1G7QB 4K8RC 5CEZE 4DGVH 4BUHA 4BFEA 1RPQA 4P5TD 4R90H 4F7MA 5DURB 4YZFF 4CUCA 5CEXA 2Y07H 4GRWB 3EDJA 1OF2B 1C5DA 4FQHB 3U48A 4UDTA 2CLRB 3DIFB 1V3JA 3ARWA 3FQTA 1G9NL 1ORQA 2ZKHL 4QHUB 1JHTA 1D3CA 1ZGLP 1P7QB 3MREB 3T65A 1JF1A 3SE9H 2J5LB 3ALXA 4JHBA 3SDDA 2QKIA 4EXKA 1ONQB 1F4AA 3QEHB 4X4MA 2KBGA 4TNVF 3SE3C 2Q8BL 1OP5K 5ICYA 3OMZA 1Q72H 3ESUF 4CADA 4XB8A 2NTFB 5IQ7L 2VLMD 5DS8A 3QPXH 5DEFB 4IM8A 2EYSA 3HPJA 2EDRA 4L8BA 4JFFA 5GRJL 4HGWB 2YK1H 3MRPB 1UWEL 5ALBL 3D85D 3INUL 4PV8A 2NX5A 5T5FL 1YEEL 4OUOA 5GS0H 4K3EH 3TZVC 1LD9A 1WBZA 3GMQA 2XQBH 1YEFL 2O5ZL 4KRPB 5FYLE 3TBYB 4FS0A 1JGUL 1F3RB 1CGVA 3ELAT 3FZUD 1RIHH 3KVQA 4LQFH 4JKKA 4PJ8D 4H20H 4JO2H 1LILA 2DM4A 1J8HD 5DD6A 3S96B 1DBAH 1ZA6A 4P2OB 5E9DD 3MCLL 5T1LD 3S35L 2D4FA 2JCCB 3MLTB 3N0PB 1T89C 3RHWK 2VJXA 5DEZA 4PY8J 4PJFE 1BVLA 1QKZH 4ZUUA 3ROOB 2QHRL 4UUJB 3HUJF 4J4PA 2VLJE 3O4LA 3KLAB 3EYFA 2P8PB 1G9NH 2ZKHH 5MEPB 1YPZB 1FVCB 3DI3B 4MB4A 1MCDA 4GRWE 1OGAE 2PXYB 1WFUA 1QLEL 3MCKB 2D2OA 1UADC 4Y2DB 5EU6A 4WHYH 3C2SA 3S4SB 3MFFB 1S8DA 1MCCA 2Q8BH 4G9FE 1UWXH 4LCUB 4XVTL 1D5IL 4QXUL 4Y4FA 1EHAA 4PJAF 4HUUB 3FO1B 3AXLB 1EV2E 1KXQE 4Z7NF 3LN5A 5GS1B 1T7XA 1NFDA 2N7BA 2DJUA 4MQTB 3K7UA 2JJSC 4U3XA 4ZFOL 1J1XL 4Y4HA 5C6PB 4D8PA 3KPPB 4OZGA 3VGBA 3F7PC 2EDYA 3WNMA 5GRJH 4NNYB 1UWEH 5ALBH 3RVWD 4NQVB 2ICWB 3INUH 5FDWA 3MBEC 5T5FH 1YEEH 4OFYA 3LKSB 3TIDB 1CWVA 1YEFH 3BRDA 1S9WB 2O5ZH 1A6AA 5CP7B 5EWIL 2X4NB 1CGYA 1I4FB 2VITB 4KXZH 4E41B 1CXFA 3FOLB 3ARYA 3MPCA 3T09A 3RGVB 3MCLH 2OX5A 3S35H 5EU7C 2VZ3A 4RA0C 1CDHA 1T1XB 2ADJA 1HYSD 3K1KC 2QHRH 3G6DH 5C9JB 1INQA 3SKOA 3BO8A 2JCCE 4LPUA 4NYLB 4X4XB 5KSAD 5IV2A 4JFPB 4G9DB 4IMKC 1ES0A 3OKEA 1P69B 3UPCA 1MLCA 3IU3A 5D7IB 4Y5VA 5KN5A 4MQ7B 3T0XA 1KJ2B 4XVTH 1D5IH 5HPMB 4MXQC 4QXUH 4EEEA 2NW2A 1HIML 2IANE 1X5XA 3C5ZA 3WHE0 3QIUC 1JI2A 4Z7UA 2X9XA 4LHUA 4I4WB 5D1ZA 5F7WC 5HHQB 3FRPA 1J1XH 5IB1B 4N8PA 2O61A 1QEWB 1RULL 1IAII 2OXHA 2Q8AL 3Q5TA 3K2UL 1BQSA 5E1AA 2AJSL 3QQ3A 5D5MA 4JY6A 3U7AA 4U1IB 4RIRA 3CXHK 4KTYA 2H45A 4ODUA 4NP4L 5EWIH 4L3AA 5BW7A 5C8JA 2ADGB 2FO1A 5SWZB 3ARRA 4EJ1C 4LSDA 2UWEA 4TVPE 1D5XB 2BMKB 3QPQC 4CN4A 2CDEA 4L4VB 1QR4A 1FZMB 5KSVA 4RX4D 1HH9B 3WYRA 4Z7VF 5JPMA 4I1NB 1ERNA 4R3SA 5DQDL 5H94B 1WEJL 1BECA 4XNZB 3U4EA 1V5JA 4MJ5A 4ZFOA 3LQAL 3CDGB 3DARA 1EGJL 4LLWA 4X9GA 3MFGB 1CXIA 3CX5K 2MFNA 5F89B 3U0PA 3L9RB 2P48B 4M8QB 5DJDA 4P2QE 3C6LA 3HE6C 2DQDL 2YPLD 3O9WD 3TBWA 4K55A 1FJ1B 4JCMA 5T1KA 4XAKE 3CVHB 1I8LC 3SCMD 2XWBA 4X6EA 2JLLA 3U6RA 2PYEB 3X13A 4JVPA 4K7PX 3IDIA 3S9DB 5T3ZE 1RJZB 4BQBA 5LAXA 2F54D 5D7IE 5I2IB 1NMCB 1NDGB 3WUWG 5E7FA 3V6FB 3C5SA 4A6YL 4HIEB 3ARBA 1RULH 3VGAB 1FFQA 2Q8AH 4RISL 4CJ1A 3K2UH 4JFEB 2FHBA 2AJSH 2VLKD 3QI9B 4YXHL 3P40A 1SYVA 4MAUH 1DEDA 1RHHA 1GZPA 3AVEA 3CLFL 4PYHA 4NP4H 4Q74A 4JHAL 1I3RB 3KDMB 1OTSD 5I1CL 2WANA 2F53B 1F3DJ 4EVNA 1S7WB 2VSDA 8CGTA 3VG9B 1BF8A 1XCTB 3BEVB 3DWTA 3UAJD 2CRIA 2EXWD 3ZYZA 3HAEB 3NZHL 5FXCH 5DVLA 2NNAB 3NAAL 1RK0A 4HUWB 5H35B 2A6JB 3MJGX 4CU6A 4X4YB 5D1XB 1N26A 1ZT1B 5DQDH 2XRAL 1WEJH 4PRAA 2DMKA 4GLRH 4ZQKA 4L4VE 2ZPKL 2VIRA 1J0ZA 2AEIT 4JEGB 3UDWA 2NPLX 3LQAH 2KQNA 3V4UL 2P49B 3R8BB 4K3HA 4WU5A 5F1SA 1WWAX 2DQDH 4H8WL 3KYOA 2IPKA 2Q76A 2NY7L 3ARGA 1MRCL 1YC8A 3MLWL 3QQ4A 1D9KA 3B6SA 4KJQD 4YWGL 3SY0B 3GIVB 3ZE2F 1SJHA 1UM6L 4UBDC 3VWKD 3GFUA 4P2OC 5SWSA 1CFSB 2Z91B 4A6YH 2AKRA 4DUWA 5JW5A 1IL1A 2J8OA 4KKAD 5C07A 1WC7A 2H9GB 4J6RL 4RISH 5BZDB 1IGYA 2ESVA 3MRGA 3DBXB 5TGBB 3PJSA 5D5MF 5A2JH 5DLMH 4YXHH 2XKNA 5D6CB 4OZIF 2GAZB 2C1PA 3CLFH 3QUXD 1A4JA 2FR4B 4JHAH 5DQ9B 1HDMB 5I1CH 3DX8A 3WFHB 3LN4B 1PJ9A 2QADB 3VH8G 5ID0B 1YY8A 3QUYB 2UWEF 5CWSB 1EGJA 4LPCA 1HEZB 2P24A 2FRGP 4P23B 1BIHA 3KPSB 3NZHH 1IKFL 4WJ5B 3NAAH 4AIZA 2F53E 3V7AG 5TPWL 3GB7A 3A0OA 4IRJA 2Y25A 2ZCHL 3T3PF 3PDOA 1LO4L 2XRAH 5DZLA 4PRIB 2ZPKH 1A1MA 1H3UA 4LPVA 3UYPA 3O3DB 4MNQE 1JF6A 4A6YA 4HK0B 5BS0E 4N0UA 3V4UH 3ZKMC 4HULB 1IFHL 5DHVB 3KLHC 2DTSA 4H8WH 5H2BB 3K8KA 3BH9B 2NY7H 5HJ3B 1JZ6A 2BNRA 1MRCH 3MLWH 5J6HB 4BUGA 4YWGH 4ZNEE 1PKQA 5FO7B 4MB5A 1M05B 1UM6H 3D5OF 4NZUL 3BQUA 4FXKB 1ZS8B 2HMID 1L7IL 2CPCA 3D25B 2W9EL 4F9LC 5MP6L 4L4TB 4X6BA 3GSXA 3VH8B 3R1GL 1KJMA 3DTXB 2G5BA 4QHLA 1AIFB 1W8NA 4M4PA 4EN3B 1Z9MA 3QWRD 4GRMA 4YHOL 4YBLB 4JDZA 1A1NA 2R0WL 3DV6B 3IKCA 3SN6N 1NKOA 1NEZG 1IKFH 5GSVB 4U6XB 1O5DT 4D0CA 4JRYB 2PETA 5MI0B 3FFCB 4L3CA 5IUSA 1VGKA 4WDIB 1NMBL 5TPWH 5CHNA 3TYFB 2ZCHH 4P59L 5EC2B 3KPSE 1LO4H 4RFOL 5ACZA 1S7XA 1BQLL 1PSKL 2ADIA 1A7BA 1L0XA 3BYYA 1Z2KA 4HHAB 4HWUA 4P2CG 5GJSL 3IF1A 4U1HB 2FATL 5L2KA 1IFHH 2OTWA 3SO3C 4F7EB 3KPRD 4FXLA 4PJEB 4PRIE 1HWGB 1LO2L 4WFHD 3RWCB 2OMBA 2VC2L 1YNKL 3SKNB 3DVGA 5F9DC 4ODVL 3K4AA 1DQQB 3N1QC 1S7QB 2M1KA 5IIEA 3TA3C 4PLKD 3NGBB 2AK4E 1GZQB 2XA3A 2ZWLT 4NZUH 1N0XL 2F74A 4PG9A 1BGXL 2E6JA 2DDQL 3CUPB 3MRIB 3L5XL 1L7IH 3FB8A 4RNRB 3ILPA 5MP6H 4Y16A 1A7RL 2YC1B 3R1GH 1XF3B 3MJ8B 4LVOC 2AJ3A 3IDNA 1ZGLM 5DQJA 5HHPB 3I6KB 4YHOH 4PJBF 3PV6A 4L4TE 1PBYA 5EN2A 1B4JL 2R0WH 5ISZA 3HRZB 2ITDA 1P53A 2W0KA 3AS1A 4LLYB 2NLJB 1W0YT 4YDJA 3NPSB 5L8JB 2CDGA 4L1HA 5A3IC 4BSVA 5FDYA 5I75B 2MHAB 4OGYH 3WHE1 4TUOB 3V7AE 3H8NA 3WEXA 2JJWA 3QG7L 5ESVA 1NMBH 3QIWB 5GSRA 4P59H 5AD0B 4RFOH 3IJSA 1BQLH 2W59A 1PSKH 3OZ9L 4WUUB 4B53A 4JRYE 4QWWD 3T4AA 2KH2B 5C3LD 1KGCE 4H1LA 4U7SA 4ONFL 5GJSH 2EKJA 2E8ZA 2FATH 1EEYB 3QO0B 5C3TA 3QI9C 1IQDB 3QXTA 3AFLA 4X6DA 1LO2H 4ZXBD 3C8KA 1KXTB 4GXUN 2EDDA 4ONHA 2VC2H 1YNKH 3WS3A 1G84A 4ODVH 1Q9OA 4MD0B 3WNKA 2VAAB 3MC0A 3LCYA 3JWDL 4PJHB 3KXFD 1H3GA 3WLBB 1J05B 1N0XH 4PJEE 1CXEA 1BGXH 7CGTA 2DDQH 4X9FA 3L5XH 4HXAL 3LPGA 2LU4A 5DEGB 1A7RH 2HVJA 1NCBL 3HA0A 4ELMB 5MEOA 5CLWA 3SJVA 4GAFB 5D1XC 2H6PB 2GJ6D 5I8CA 4Z6AT 2EDJA 2E9BA 3ET9F 2OL3L 1SM3L 1UKSA 1B4JH 4ZD3L 4Q6IB 4U1KA 3SDCA 3BH8B 4RAHA 1YN6B 1ZE3C 3LVEA 2YD9A 1I7RB 1UM5L 5I1EL 4Q7DA 3FRUA 3FQRB 3BUYB 4QHNB 5IB4A 3QG7H 4KDWA 1IJ9A 1ED3A 1F5WA 3MRDA 5E56A 2APVA 2HT3D 3W0WA 5GZNC 3OZ9H 2JJUA 5AYQA 1RZ8B 1QRND 1VDGA 3NFNB 4M6ML 4ONFH 2YXMA 2GQHA 2R0ZL 3C08L 5E9DE 3MRQA 3K8LA 4UV7L 3ZTNL 1C08B 2EICA 4WUUE 4O02L 3QDHA 4G8GA 2C3GA 1OP5H 4YX2L 2AV7B 3QUYC 2YBRA 1BLNB 3JWDH 4U7MA 1YY9C 2Z31B 4LRIA 2EDHA 4QRQB 4P3DB 2BC4B 1IM9D 4ZYKA 1OP9A 4HXAH 3W9EA 3EZ8A 1KB5L 3ARVA 3VRLE 3PP4L 1UZ8B 3DX9B 3D6GA 1CICD 1NCBH 2KPNA 4PJHE 3OSKA 4KZEL 5DGRA 1BHGA 5KTEL 4PGBA 1ZV5A 1LK3L 4RMTA 2NY1C 3F62A 4L8DB 2OL3H 4L9LB 4N0RA 5K59F 1W8OA 4ZD3H 5DGQA 4ELME 3TFKC 3IJHA 1VB9A 1EA9C 5C0BA 3BRFA 1DANT 4YHIA 2NY2C 1UM5H 5I1EH 3JTTB 3ZDYE 1YDPB 2J6EL 2VQUA 4POZC 3QDJA 2ZP0T 5F1IB 4JRXB 3DXAB 4ALAL 3L3OA 3EBAA 1JHKL 3GSNB 1FHGA 1KNOA 1EVTC 3KNBB 3BZFB 5L0QB 4Q9QL 1FH5L 3AU1B 1Z9OA 4LSPL 1DN0A 1JNLL 4M6MH 3C08H 1ITCA 2R0ZH 3SDAA 4NDMA 1SQ2N 1T20B 2IAMA 4UV7H 3ZTNH 3FQWA 2PF6A 3PWVB 1MAJA 5IQ9B 5BRZD 4O02H 5EBWB 2C3XA 3NZ8A 3MGTB 4GKNB 5DJ6B 1JGEB 1CD1A 5ENWB 3VXUA 4KJWC 2X70B 3C09C 1HH6B 2HP4A 3P9LA 2JB5L 4MQSB 4NN7C 2XG5A 3FFDB 5DJ0B 1AXIB 4N1CA 5DJXB 3BFOA 1WV7T 4QT5A 3LH2L 5MI0C 1KB5H 4Y4KC 3PP4H 3WXWL 4KFZC 2VR5A 4F37F 5KTEH 4KU1A 2CH8A 4LCCB 4OCNC 1N5AA 4GXVL 4MMZC 1FZKA 1LK3H 4RGMC 5DK2A 5I19L 5FOBB 4LLQB 1A6PA 5H8DA 5IESH 5I8EA 2Z8WC 4NQSA 4LSQL 1MFDL 1U8MB 4HIXL 4LRNL 4CJ0A 3RIFF 2XQYG 5IROC 4NQDD 1B0RA 5JOPD 3FB7A 2W38A 3L5WB 1F11A 3UTTB 4NNXA 1M71A 2XZCL 2YKLL 2WQ8A 2BXYA 3QNYB 1SJEA 1U8KA 2Y7QB 1UVQB 1UB6B 3IDMA 1W0WA 4OFDA 1JHKH 3T0EC 3TH2T 5I18L 3Q0HA 3OGCB 1FAKT 1U95B 1HXYA 4H26A 4Q9QH 1FH5H 5CP3H 4GH7B 2NY3B 4POUB 4Y5XC 1R24B 3O6FC 4LSPH 3LKQB 1JNLH 2NXYD 4JRXE 3DXAE 3A67L 4P46D 3T77A 5D96B 4ZSOB 5HYJB 2QSQA 4DK6A 3AM8C 2DLGA 3BPCB 4YHZL 1FNFA 4JJ5B 3VDCA 4AEEA 3RWGB 3DURA 1AQDA 1CLOL 1OSZB 2GITA 2JB5H 5FF6B 2HJKA 3W11C 2O93L 2X89D 3O41A 3T1FB 4JZJB 3PQYD 1EHXA 1MI5A 1AI1H 3LH2H 5TDOA 3WXWH 3RX5A 1ZT4A 1OT1A 2J6EA 2APBA 5EZLA 2J1KA 2VDOL 2YN3A 3ARFC 3OF6A 4GXVH 1MLBA 3WNPA 1KB9J 1ZLVK 1I8MB 5I19H 3L3JB 3QEQB 4C54A 4WFGD 5CP3A 3MROB 1AGDB 2RQ8A 3D39D 1IGJA 3O2DA 1U8IA 4LSQH 2DI9A 4P9HL 3BESR 1MFDH 3LB6D 4ZS6D 4HIXH 4LRNH 4X5LA 3STBA 4HKZB 5C0GA 5IP4A 4R7DB 1T1ZB 5CD3A 5GGRA 3HMWL 3SE3A 5GGSY 2XZCH 2YKLH 1MAML 4X98A 4LLDA 1AR1C 5I18H 3MLZH 2R4RL 4IRSB 2VH5L 3TVMD 4RWYL 3TNMB 3EYVB 1J0KA 4FFYL 4KV5F 4G8IA 4OIBA 3P4NB 3MSPA 1UWGL 2J8UE 4O51B 1Y6KR 2EDOA 3E2HB 3A67H 4LAJH 4YAQB 4Y89A 2AERT 4WI6A 5DJ8A 1Z9SA 4LVNC 4NQXB 2BNQB 1HCFX 3TZVA 4YHZH 5D2LB 3JWOC 4U33A 1KCKA 5D4QA 5DFWH 2V5TA 1HSAA 2NYYD 4YNYB 3X3FH 4ZSOE 3HFML 5HYJE 3O3EA 1J5OL 4O2EA 3STZA 3BGFB 4RGNC 1A2YA 4FQXC 1T21A 1JIBA 1AXSA 3MJ7B 2PTUA 1JWSA 1T89A 3HE7D 5K9OB 5D93B 1LNUA 4OCRL 2HFEA 3T8XA 1S78D 2VDOH 3OX8B 1B90A 4S2SB 1OTTD 3D48R 4KKLD 2BHZA 1XF5B 2BSRB 2KZ1B 1INDL 3OKOB 4RA3A 3EHBD 3DOSA 4QRPB 1J0HA 1I1FB 2JELL 4WI9A 5BZWA 3MLYH 4P9HH 5I1GL 5FAAA 1YZZA 1MHCB 2IQAA 1J10A 2EIDA 2OTPA 3HMWH 5DSCB 3QCUL 1NGWB 1MAMH 3WHXB 3R06A 3M07A 4DN4L 4PJ5A 4JANB 2XTJB 2MSPA 2IH3B 2R4RH 4LEOB 2VH5H 4RWYH 4FFYH 1FDLL 2R2EA 2JJSA 2WP3T 5FYLL 1UWGH 3DNKA 2X7LA 4K71C 1NC2B 1O0VA 3P4MB 3IFPA 2W0FB 5F72S 2D0FA 3F5WB 3MBEA 1CGUA 1JZ8A 1QHPA 3UZQA 3RY6C 1S5HB 3JTSB 5IMMA 5FFLA 1FYHB 1FPTL 1A3QA 5HHNA 2DKMA 3FQNB 3HFMH 3EYQC 3BZ4B 3CZJA 4Z76B 3VXPB 3MA7B 4KKCD 3GSRA 5EPMB 5D2LE 5IW3A 4NFDA 5TF0A 4ZUTA 8FABB 2R2BA 1UYWL 4WI4A 4RRPA 2YHGA 5BJTB 4ZUWA 4WO4D 3EIFA 4GKSB 4OCRH 4ORGA 1A4KA 4QRSA 5GQBA 4NIKB 3LPFA 3ZKND 1A9BA 2XV6B 3NBNA 1IAMA 1P4LB 3HLAA 3GMRA 1OSPL 4P4RB 4PIRF 3QBTB 1INDH 3QFJB 2JELH 4I13B 4OIAA 4IMKA 1AHWC 1N4XL 3LKOB 1U8HA 5KZCD 5I1GH 3UBXA 1T6WA 4YHPA 1WIOA 4P99A 4HWZB 3RVVD 3QCUH 1K4CB 4LLVA 4L4JA 4HQQL 2A9ML 5JQHC 3QHFL 5EUOB 2R9HD 1TQCB 2KUTA 4QRPE 4RWHA 4DN4H 3NIGF 1NBYB 4CW1B 2GFBB 5HHOD 3DMMB 3UMTA 3QIUA 1YQVL 3IDYB 4JM2C 1BOGA 5CFHA 1HXMB 1FDLH 3CFEB 5FYLH 3MRJB 3VXMD 5C0CD 3G6JF 5LVEA 4HJ0D 4ZFZB 4ETQA 1T83C 2XTJE 3MRHB 1A0QL 1T1WB 5EO9A 4DZ8A 5C0AB 4LCCC 4U4BA 1RZGA 3TNNA 3T1WA 4EKXA 3VI3E 2PUQT 4GRLB 3MMEB 4WY7L 3GM8A 3MUGB 3G5VB 2XA8L 1FPTH 1SBBA 1T03L 3BUTA 2V2XA 3TM6A 3MYJB 3HZVA 3TC9A 5E24E 4JPWL 1IKNC 4R97B 4Z78A 5I8KL 2DQTL 2IBGA 5CGMA 3P73B 5BV7C 3BIKB 1R5VB 3VXTA 4ELKA 5F9WB 1UYWH 3OB8A 3QR2A 2Q6WB 1D5ZA 2C3WA 2EIBA 2GY7B 3F65A 4KY1L 2APWA 2HG5B 4NRYA 1K85A 2X6MA 3G5ZA 2QHLA 4MQXD 1VFAB 1NBVL 4UOJA 3UPRA 3UYOD 4ZS7L 3S36X 3HZMB 2Q7YA 1I8IA 1OSPH 3V0WL 3VWJC 2EDQA 3TT1L 3MXVL 3ZT5A 2GTWB 2VUYA 1N4XH 5FKAA 3KLSA 4MNHA 1KFAL 4LEXL 5BVJA 3PL6C 5C9KA 2Z92B 3L6FB 3V5KA 3CGTA 4HPOL 2A9MH 4HQQH 1XCQA 4R7NB 3HE6A 3O4LD 3QHFH 4P2RA 3V8CA 1FNEB 2WLYA 4AMKH 1U2CA 4JY4B 4XH2B 1I8LA 3VFRB 1RZFL 4OCYL 4PRHA 1YQVH 3BZEA 3C5JB 1IZKA 3OG4B 2X4SA 5B39A 1VESA 5EU6D 1G7QA 5DVNA 1NQBA 2XY2A 4LBEA 3RNQB 2XIDA 1KEML 3KPQA 5GS0D 4Y1AB 1PZ5B 1A0QH 4YIQA 3BJLA 1NFIA 2JTDA 1HILB 2VMFA 4NJAL 4GW5A 1LE9B 3DIFA 3BDBA 1OT2A 1JTOA 5E8EA 4WY7H 3OWEA 2XA8H 4YQXL 1T03H 1T4KA 1VERA 4JPWH 3I02B 3RDTC 5C0AE 3RZCB 2FECL 1OM3L 2DQTH 3MGOB 1ZA3A 2BSSB 2UY6A 4GBXB 1FV1A 2ATPB 2WBWB 4KY1H 2NTFA 4C55A 1NBVH 5GRWA 3RWEA 5D8JL 4S11A 3ILQD 1CXHA 4JFXA 4ZS7H 1JNHB 3E0GA 1DBJL 3S97C 2DWDB 4F8TA 3V0WH 3TCXA 1ZVSA 3TT1H 3PP3K 5TF1L 1ZGLB 4GJTB 1JF5A 1B88A 2VZ1A 5IBUG 2FJHA 1KFAH 4LEXH 1XF2A 1SVCP 3RTQD 1FFOB 5F93C 3ZE1F 4HPOH 5K9KA 2GJ6E 2NY0D 2YEZB 4UQ2B 4JDVA 1RZFH 2VXVL 4QTIH 4OCYH 2D7PA 4WWKD 4MDIA 4MCZB 5J11C 4PY7B 1NSNL 1KYOK 4KDVA 1A6WL 5E2UL 4P2OA 3D69B 3IVKB 2DQCL 5FA4A 1A6ZB 4JHZA 1KEMH 2R15A 3GJFB 3VD5A 3W39B 5I1JL 1S3KL 4I0PB 4PJGA 4TVPH 4J2XA 2SEBB 2X1QA 1GL4B 3ROOA 3STLB 3GMOB 1QFPA 1T22B 4NJAH 2ZOKB 5TE4L 2DM3A 4OZFA 4RGOL 3PABA 1CR9L 1U3HC 3BP4A 4XGZB 4YQXH 1NDMA 4Y1AE 4UQ3B 3FB6B 4Z7WA 1OM3H 2DIAA 3VXSA 3V5HA 4Y7MA 4MS8D 4YHML 3AY4A 3NCFB 2BVTA 3NCMA 2ICCA 3TH3T 4ESKA 1RZ7L 2ZSWB 1T0NA 3O81A 1EPFA 4EUPB 2NXZC 5TQ2L 1I9EA 2FB4L 1H0DA 4FZ8L 4RDQF 5I1AB 4FTVB 5D8JH 4TSAL 4EBQL 2AABL 4RMUA 1DBJH 1T04B 2FHCA 1VENA 4WHTB 4MAYD 2BY2A 1FG9C 2ZSVB 5TF1H 1KTDB 4HX1A 2EKSA 2IPTL 2ZNXA 5E00A 3SGDI 2FHFA 1KJ2H 4RMSA 3CXHJ 2AAVA 3TIDA 1TNMA 1AGFB 1E4WL 3CVHL 1GIGL 1UEYA 2V2WA 3QO1B 3MRNB 1GAFL 3CC5B 1AGCA 2VXVH 1BFOA 2X4NA 3TBVA 3SPVA 4JFHD 1MCBA 2B8OT 3B9DA 1NSNH 1UJ3C 1GRWA 1H3TA 1A6WH 3KWWA 5E2UH 2J12B 3TO4D 1YMMA 5LBSL 3ECBA 4XNYL 2HT4D 2DQCH 2P7TB 3MV9A 1AO7B 5EU4A 2C3VA 3PGFL 4NKIL 5I1JH 1S3KH 5KSUB 1T1XA 1VEMA 4DEPC 3QAZB 3TBTB 4U3CA 4DVBA 5F71A 5C9JA 1Z5LB 2X4RA 4BA8A 3V5DA 4RGOH 3WDHA 1CR9H 2AV1B 4LGPB 4FOMA 4GW4A 3CX5J 1XFPA 1BOYA 5DMKA 2I9LA 5F6IB 2AEPL 4HS3B 4QTHB 5I17B 1CVSC 2YPKA 1CDYA 4YHMH 4AJ0A 3MODL 4I5BA 1TVHA 4M48H 1XF4A 3IAQA 4MQ7A 3KGRA 3S8WA 1RZ7H 5BRZE 1QZ1A 5TQ2H 2FB4H 3DV4A 4FZ8H 1BWMA 2NY5L 1NAMB 4OLWL 3Q3GB 5SV3A 4TSAH 5D1QD 2X4UA 4EBQH 2AABH 1FZOB 4YFLF 1HWHB 5DVOA 1QEWA 1T0MA 3MOAL 5IW1A 1Y0LA 5CD5C 1HKFA 3PWPB 4FTVE 4O58L 2IPTH 5HHMD 5FHAH 3SO5A 1QBML 4XNUL 4Y5YB 1ADQA 4UINL 3CVHH 1E4WH 2P47B 2RR3A 1GIGH 1L6XA 1DCLA 2VR4A 5I9QB 5DHXB 4ODWA 1AC6A 3NFPB 5E6ZA 1GVIA 3WKML 1RK1B 3TA3A 4DZBA 1IGTB 2Q86A 2WWMC 1ZEAL 4MLIA 5LBSH 4XNYH 4LAQL 4PJCB 1MY7A 5J1AB 4IRZL 2JCCF 5LWYH 3PGFH 4NKIH 2FX9L 3P77A 3MR9B 1ZHKA 2P8LA 3C87A 4C4KO 1X6NA 4C83B 2DMBA 4PB9L 2XWJA 5DFVD 4I18C 3C60C 1NJ9A 3FAWA 3AREC 1EZVX 2DTML 5ACLA 4LF3A 1EXUB 1AO7E 1RV6X 5J9PB 1BPVA 1MJJA 5SWSD 3RVXC 5DYOA 1YPZF 4D94A 4N0CC 3HR6A 3LQZA 2AEPH 4CNIB 2YA0A 4LP4A 2E7LC 2UZXB 3HAEH 1UCBL 3MV7B 3MODH 1K4DB 4CAGA 5EIIB 3ZKSD 1DE4A 1M7IB 4HWNA 2ICEA 3CVHA 2DQJL 4PJ7A 4OGAD 2YRLA 2NY5H 3KHOA 5HYSG 4OLWH 5EOTA 3S3PA 4NBXB 1J1OL 1RJZA 5D2NE 4JG1L 3SQBA 4RBPK 5D7LD 3MOAH 2H2PC 3O45B 2V7HB 3PQYE 3B5GA 4O58H 3SDYL 4JFEA 3L3KB 4JHWL 3CPLB 2C3HA 4U6YB 1HI6A 1QBMH 3RWDA 3QI9A 4XNUH 2CXKA 5SX5K 4UINH 1EFXA 3HNSL 1NGYB 4IRJD 1ZLUK 3BPNB 4OKVA 1AGEA 5DA4A 4UT7L 1IEAB 3ARDB 1EEZA 3HUJB 5TDNA 4Z7QF 3OR6B 1G7MA 3WKMH 1S7WA 4WFGE 2ERJC 3I6LD 2CRYA 4HT1L 2V7NB 2JIXD 3VFMB 1FN4A 1ZEAH 4YZFE 3HAEA 4LAQH 3MLUL 1ZSDA 1K8IA 4PTUB 5A40E 4QRUB 2FX9H 5H35A 5I6XB 2A6JA 5B22A 2NMSA 4PJDB 1BBJA 1CXLA 4XCEA 5D1XA 4Y8DC 1KSRA 3BP5B 1PEZA 3X14B 4PJCE 4X7SL 2DTMH 4X80L 2IQ9L 3BD4A 1BD2D 2PTTA 1GC1C 2AJVL 2V2TB 3HS0A 1UCBH 1XR9B 3GBLA 3QXAA 5GRVK 5I71C 1GOFA 4MVBD 4K3DL 1ND0B 5D7IF 4I2XA 4KK5C 3CLEL 3RU8L 2DQJH 2OK0L 1R3IL 2RCSL 3LAFA 1HHIA 3C2AL 1WAAA 3MV7E 3RUGB 5DT1L 4KHTL 3O3BA 2G2RB 5HGHB 4NRXA 5TFSL 3VA2C 4JG1H 1Y6MR 3B5HA 4JLRA 1LO5B 2CQVA 5L8LB 1CL7L 1ZLVH 2HVKA 3DX7A 5J3HD 5JXEC 5DHVH 4LSVL 4I0PC 3SDYH 1DVFC 4JHWH 2W92A 1J11A 3DBXA 4CVWA 4JN2A 3VRJA 3B2UC 3HNSH 1VFOA 1F97A 3UO1L 4F7MB 5DRWA 4YXLL 3UJIL 4UT7H 4UOW0 4WENB 3WFHA 1C5DB 2R0LL 3QUYA 5I73C 3TCLA 4UDTB 4HT1H 1HHGA 4ENED 4LMQI 5CWSA 1EK3A 1HEZA 3ZSSA 4LCWD 4MZ2A 1JHTB 1JPTL 4WJ5A 2X44D 2F5BL 3WE6A 3MLUH 3T65B 3HUJE 2DQGL 4P9ML 4R26L 1YEJL 3SDDB 4R4ND 2QKIB 4QXGL 3QDMD 5E8OB 1U58A 4WWID 5ICYB 1NMAL 3IFNL 5DJCA 1WIUA 4U7KA 3D2UA 3KJ4C 1I1YA 4N68A 4X80H 2IQ9H 4X7SH 5TQ0L 3V8OA 4CADB 2QEJA 2AJVH 3HG1A 3IDXH 4S1SL 4QY8A 5C6TL 1ZXQA 3I50L 1OQXA 4HK0A 1V7NL 4PJDE 4Y16D 2EYSB 3HPJB 3TEUA 5DHVA 1QFWL 1MFBL 4P5KB 4K3DH 4L8BB 4JFFB 1A7QL 1U2HA 4R6UA 4JKPL 4Z7NE 3CLEH 4PGEA 5IFAL 4PV8B 2NX5B 1K8DA 5IB2A 3RU8H 5IB5A 2OK0H 5C0IB 1R3IH 2RCSH