4IRJD

Structure of the mouse cd1d-4clphc-alpha-galcer-inkt tcr complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Enhanced TCR footprint by a novel glycolipid increases NKT-dependent tumor protection.
pubmed doi rcsb
source organism Mus musculus
total genus 63
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irjD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irjD02
4LPWA 1VPOH 1ORQA 4HBCL 1F4HA 2HT2C 5I6XC 4J6RH 2NXYB 5F1IA 1X5GA 3HLAA 3A67H 3B43A 5EZLB 1OWWA 4C4KO 4G7VL 3QJFA 1R5IB 1S7QB 4JFOA 2V2WA 3QXDB 4JFFA 1L6XA 1JF5A 3CFDB 3LQZA 3FT2A 4JQIL 2XZAH 1CQKA 3QT2A 1KT2A 3L7EA 4MNQA 4EI5B 3KYNA 2W9LA 4AZ8A 4MA8H 5GZND 4TRPH 2XKNA 5FOJA 4A2MA 4OM0L 5GSRB 3KWWB 4PJDA 4AIXA 2XPGA 3WN5B 3OV6A 4XGZA 3STBA 4OGYH 5DDHA 5I1IL 1BD2A 2GHWB 5HI4D 2XN9D 5E5MA 4XBGA 5D7JA 3L3IA 5I8CA 4P9ML 4JO4H 3LKQB 2UUDK 5BRZD 4LVNB 1TETH 4YHKL 5EN2B 4X0KA 4J3TA 3GMMA 4V2CB 1RUAH 1QHPA 2AK4E 2JKXA 4L8SB 3SBWC 4ZFGH 1B2WH 1JVKA 1NL0L 2P8PB 4P3DA 4DOHB 3KXFB 4H0GA 3MRRA 3TIEA 1HCVA 3CDGB 2H32H 4PY7A 5CJOH 3OKMA 4JJHA 3DUHA 4G5ZH 3FAWA 2DDQL 2ZKHH 5DO2D 1P7QB 5DGQA 4FQJL 5M94B 3O3DB 4PJCA 5D7LE 5IBLD 4H88H 1OAUL 5HPOA 5D96C 3PWPA 1E4KC 3RGVA 2R0ZH 3OG6B 4JRYB 1E4XH 1OCWL 4J3SA 4MA3A 2NX5E 1H3VA 1DUYB 2I9TB 2ICES 2EKSB 3EJYC 4JHAL 5E8EB 4FQCL 1HYSC 1KIPA 2AEWA 1FNLA 3QO0B 1JPGB 3CSPA 1YNTB 3V0AC 2CDFB 5T3ZE 3RY4A 2HA1A 1YEIL 4Y5YA 4AMKL 2AI0L 4OCXL 2BVUA 4OLVL 2EYTB 5K33A 5J56B 3FTGA 3P3YA 5EO1A 1FFPB 4JPVL 4NQCD 1TZGL 5IFAH 3IJHA 3MBEA 1LEIA 2AXHA 4UTAH 5JDSB 5T33L 2AW2A 3UYRH 4JG1H 4LPVA 5FDYA 1K5NA 1EFXD 2P8MA 2VQ1A 3AS0A 2C7UA 3IDJB 3LDBB 2B1HH 4TSAL 4BH8A 1MFNA 2ZSVB 1UM6H 1N3NB 4DQOL 2XACC 2NY1C 3PGFH 3S4SB 3DV4A 5IR1B 3ZT5A 4NO0D 1A4JA 2APWA 4GMSH 1BBDH 3EDKA 3ARBB 3WIHL 5ANMA 1AKJA 3LKOA 3UO1L 3WD5H 4UDTB 4K7FA 3NIGE 3MRBA 2VWEE 3NA4A 2IC2A 2YEZB 1ZT7B 2A9NL 1PW3A 2VDKL 4X9FA 1CDHA 5JXEC 2AV7B 4K23L 1ZVSA 1ODAA 3AREC 4B41A 1X5FA 4KV5F 4POZD 4F15C 5DZLA 2CPCA 3QIWA 1ZHKA 1MFEL 1XGPB 2C5DC 4YHML 4KU1A 4D3CH 3FO2A 1WBZA 1QFOA 1T3FA 3MRCB 4Q0XL 4Z7NE 5GRUH 3EOTL 1PSKL 2XNAA 2DLIA 3MJ8B 3FB5B 4QHNA 4MXWH 5DD6A 3TIDB 4EKXA 1DBAH 1KB5H 1JN6B 4LHJB 4F57L 5C0ND 3NIDE 4I18A 3UJTH 4UU9A 3QXWA 1XH3A 3WYRA 4PJBA 4Z7OE 4D9QE 3QEQB 4OI7A 5EO0A 4WTZG 5DLMH 5HYJB 2BY1A 1OT2A 1UFUA 1BX2A 1XGYH 2E7MA 3VD3A 4MAUL 3ULVL 3D69A 1NMCC 4QTHB 3V4PL 1FZJA 2DWDB 1P84K 4JVWA 5D2LA 4NO5B 3TYGL 2GW5A 3CK0L 4MSWB 2YUWA 1I9IH 4MXVE 1OARH 3ARVA 3QUML 4OKVB 4ALAL 1IM9B 3VD4A 1PY9A 4Z77A 3PDGA 5C6PB 3VE0B 4P4KA 3S37H 2DQFA 4ELKA 5J11B 2C4FT 3BYTA 1S7RA 1HNFA 4GS7C 4R7NA 2OP4L 5BOZG 4PV8A 1C16A 3DXAD 4LCWD 4R26H 1JI1A 2CD0A 4XNXL 3VWJC 3C60D 1NFKA 3C6SB 2XN9E 4HKBB 3GMQB 4QCIA 5TFSH 1OB1A 1J88A 1FC1A 2VXTH 3MUGB 4QRRD 3CH1A 3LZFL 4YXKL 5BRZE 4QF1B 3SKNA 1A1OA 2J4WH 3SDDD 2KDGA 3SDCC 5DEZA 4NZUL 1A1MA 4XB7A 4E42A 5I16A 4H5SA 5ETUB 5H94B 1B88A 4FMKA 2PCPB 1TJHH 2X2YA 2VZUA 1S7TA 4OFYA 3CGTA 1NANH 5F88A 1MVUB 1YDPA 3MX0A 2V5YA 1TPXB 4MNGA 4Y5XB 2OK0L 2NW3A 5DRXB 2PO6A 1XIWA 4NM8L 1ZSDB 5GGQH 5HHNB 4RGNB 5E1AB 3QI9A 4ZPTB 2NY3C 3WDIA 4Z7NF 4OZHE 3TO4D 3V5KB 2H32B 3HB3C 2NLJB 2EDEA 5HHQB 5TPWH 3O3UN 5ISZA 3BH9A 3MA9H 2AJVH 1U8OB 3D1MC 3KPRD 4YZFE 5L8JB 1B0RB 4OLXL 1S7UB 3MNZB 5T1LD 3WIHA 3NIDF 1WBXA 1J8HD 4YDJB 3HC3L 3IJSA 4Z7OF 2W0FB 2J8UB 1NGXA 1ZT1B 2X4OB 4M93C 5TJWK 3GKWH 2IALB 5FDWB 1MAKA 2W9DL 2ARJB 4ORGA 2K1MA 1KPUA 3OB0K 3D18A 4FXKA 4OI9A 4S1DC 2WBJB 4XBPB 4M4RA 3JWOC 4QRPB 1CE6A 3ARGA 3AY4A 4MXVF 2UZYB 4MA1C 2PYFB 3L5XL 4Z0BL 5IVZA 5GISH 5KSBA 1DCLA 3SOBH 3RY5A 1S9KC 4NQCE 3W5MA 2QJDA 3MOBH 1CFTB 1CK0H 3WMSA 3C08H 4H26B 3O4LA 3LKSB 3MRDB 1G7HB 4APQB 1CDYA 1MPAL 4DCQA 3VFTA 1S5HA 4H0HB 4JY4B 5JIKA 2JCCB 3BW9A 1N6QL 2ZOKB 2PKDA 4PLKD 3UXFA 4M6NH 1UYWL 2EXWD 2AEPL 2A6KB 5JOEA 3QEUA 4Y5VB 1B6UA 3P9LA 3V5DB 4YDLC 4HX1B 1YEFL 4GRLD 2GAZA 4P2RD 3FL7A 3LS4H 4GW5A 2ICWB 4OB5L 1WZLA 4EI6B 1LO0H 5JW4Q 1NBQA 4R6UA 5FXCH 3K3QA 3MFFB 4FFYL 5IESH 4NFCA 1A6VL 4UQ2A 3MCLL 1B0WA 5ALBL 4Z7UE 2FR4B 3ABZA 2ARJQ 3P4NB 4L3EB 4O4YH 4Y4FA 3D25A 2EE3A 5E2TL 5K9OB 3EHBD 1I8LA 4U1NB 4IRJD 1VGEH 2O93L 2MHAA 4F9PC 1YJDC 4WWKD 1QPXA 2W38A 3OJVC 3ZDYE 2ADFL 2ZSWA 4Z76A 5IUSA 4OZHF 3WFDL 1S9VA 2BSTA 2DWEA 2L0DA 3MJ9H 3PP3H 1IZJA 1QRNB 3MNWA 2Z8RA 1JNHA 1RULL 3QCTL 3GBNL 2DD8H 1A3LH 4MMZC 2W9EL 2YD5A 3UYPA 3L9RA 2NXYC 1J1XH 5CKGA 3DURB 4WEMB 3BIKA 3KYKL 3V8CA 2APBA 3BJLA 4RIRA 4B7LA 1KB5B 2FZ3A 2WMPA 5GS1C 1A4KA 3EO9L 5DJXA 1KSRA 1B9ZA 4NZTH 5B38B 4XNUL 3CFJB 3E6FB 4QEGA 5HSFA 4R2GD 3QP3A 1CLZH 4M8QB 5T1MA 4ZAKB 4OZIE 5T3ZL 3SDAB 5I1HH 4EI5C 1HDMB 5C0IB 2NTSP 1CVRA 3RGHA 1MI5D 1QSFB 3NZ8A 2P1YA 3R4DA 4JLRA 3WN5C 4X4YB 4BSVB 2B2XL 2XA8L 5IROC 4F7CB 3UZVB 3FQRB 1Q8MA 2Y4SA 4DGVL 5HHVH 3CUPB 5I71C 4OUUB 5DEGA 3DXAE 3BEWB 4LCWE 1U91B 1WV7T 1AC0A 1JRHI 3DIFB 4I3SH 4NGHH 1A14L 4XB8A 5DJDA 3UROR 2XTJB 3VGAB 4HG4J 1P2CB 4L8SC 5MENB 1JHTA 3LAFA 5HD8D 1T5XA 1UACH 2W59A 1SY6L 2O5XH 4QRRE 4KZEL 1X4ZA 3KLAB 1AD9B 25C8H 2FIKA 5CEXB 2WLYA 4IJ3B 1KTLB 4EJ1C 3IU4L 4JQXA 2CLVA 3I9GL 1G7QB 5JOFB 2G60H 3H9SA 2XFXB 3OGOE 3O6MH 5DUML 3UC0L 3NCMA 5IB3B 4X4XB 4AH2B 4Z7UF 4LGSB 2YMXH 4WU5B 4TNWF 4XCNB 1F00I 5JORA 4XC1H 1XGQB 1XCQA 2DICA 4OF5A 2J6EL 2X4QB 3P73B 4TN9A 3ZDYF 2F54A 1QPPA 5IW6A 1MREH 1FVEA 1Q72H 3BXNB 4X7CC 3REWA 1T0NA 3EYSL 4LCIL 2UZIL 1KPRB 3SKJH 3HI1B 3S36H 4B53A 3GI9L 3KPRE 4WW2A 5DQ9A 5ERWA 2Q6WA 3IKCB 3HI5L 1IAIL 1J8HE 1AXTH 4N5ED 5D5ME 3CSBA 1VADB 1ZVHA 5DF0A 1T0MB 4NFDA 1FG2B 4KY1H 3P0GB 4JREB 5C08B 4RCAA 4JFEB 5DC0A 4GBXA 3EOAB 4AT6A 4XP1L 1J18A 3CXDL 2DJUA 2CQVA 3GSVA 2ZP0T 1D6EB 3S88H 2UWEA 5FM8A 5C0BD 4HGWB 2AK4A 2IWGA 5FYJU 4OZIF 1ZWIA 1U2CA 2DQIL 4M5ZL 3W9DA 5I1DB 2VLRD 4KDTC 4NQEB 4TSCL 2ZOLA 1NFIB 4UT6H 2NYYC 4JQVC 2NNAB 1H3XA 4XNQA 5IMKB 1A6UL 3SGJC 3ARBC 4NC1C 4NRYA 4CRPA 4OD2A 4I5BA 3LEYL 1U8KB 1RZ7L 5D7LA 4U1HB 3TBTB 1AHWA 3RAJL 4V1DB 4U1GB 3MA7A 3N1PC 1YQ2A 5MEQB 2NX5A 1RU9H 3GSQA 4P2RE 4RMUA 5F9OL 3TCXA 5SWZB 3M1BA 3LV3B 4G8FB 4EDXA 1EMTL 5IEHB 3ARPA 2QQNH 1KCSH 1R3IL 2EDTA 4HWEH 1Q0YH 1UM4L 3F5WA 4PS4L 3ZMRA 2JJTC 4KJQC 1PZUB 3CDYA 1P7KB 2J2ZA 1JZ4A 3PE9A 4AJ0A 1MCDA 2A38A 1OAYH 3IFOB 2ESVD 1QBLL 1KC5H 2GFBA 4HWUA 3GO1H 5TE7H 5FHBL 2UYLB 4WCYH 2E3VA 2X9YA 3ARDB 4XWOD 2DBJA 5C0CB 4P23B 4MXQD 3KPQB 3ROOA 1ZGLM 2GY7B 3S35L 3VG0L 5D8JL 5ACLA 4QHKJ 4NJ9L 4DKFL 4YHIA 4J3VA 5FHAH 1QNZH 3L3JA 4PRIB 5D6DC 5C0GA 5KS9B 2DM3A 1BIIB 3BO8A 3E2HB 3CFCL 1KB9J 2P42B 5T5FL 1I9RH 4D9LL 1FRGL 4CAGA 2CR6A 1VHPA 5J11C 2D0HA 1CFSB 4WEBL 3V9FA 3TN0C 1BVKB 1QSEB 3FHQA 3KPLB 3WFBH 3QJHB 4PJIE 4QHLB 2J6EA 1MI5E 3SE9H 3B9DA 4ZO6A 1K2DB 1KYOK 4QRUA 3ALXA 3HE6B 4K8RD 5C8JB 4HT1H 3PXJA 4NJAH 5IBTH 3U2SA 2EIBA 3P0YH 1J12A 1CFNB 5IB4B 5LAXA 4JDZB 4NQDA 1FAKT 4MJ4A 3LN9A 1NC2A 1IJ9A 3LMJL 4BSJA 1DVFB 4GRWH 5MEOB 4G8IA 5F7HA 4GT7A 3UTPD 3L3GB 2A74A 3QRGH 4ODWB 4AM0A 4GRMA 4MD0B 4RNRB 4NPYA 1G0YR 5DK2B 4ZPVB 4M1DL 1TPXC 1T5WB 4KVCH 5F6IB 1OAKH 5F7DB 5F89B 5GRVL 4RGNC 1CXEA 4YDVB 2A83B 4E0RB 3G5ZB 1KJVA 3CFIC 1I7TB 2M2DA 5EZOL 3S97C 3VXNA 1R3JA 4PUBL 5D6CB 4LSSH 1ZOXA 1BM3H 1MFDH 5DD0H 3DYOA 1NJ9A 3FCTB 4XRCA 4Z7WF 1GZPB 3WS6A 3JTTA 4XP6L 3BD3A 5BZDA 3TBVA 3FONA 2VMFA 3NABL 1KTKE 1OL0A 4M03A 5E6IA 3LB6D 1M7IB 2JTDA 3PHQB 5GS2D 2VQTA 3X11B 2WBJC 4PJ8D 5A16B 1JPFB 1KJMA 5ID0A 4WI9A 1AR2A 1GGUA 4S10A 3S96A 2A73A 2AGJL 4QXGH 2XN9A 4G43B 1G9NH 4ZS6D 1D6VL 4C54A 4LRIC 5CBAB 5GJTL 4HS8H 4WDIB 5EIQA 4Y19B 2X70A 2DKUA 4NNYA 1IL1B 4P5TA 5C0BE 3FT4B 3THMH 4APQC 2Q86B 4GAJH 1IQWL 4GKNB 4M6OH 4X6DB 3DUSB 4WUKH 1CGXA 4PJIF 1TJGH 2ITCB 4U3HA 4QRTB 3C8HA 2VLRE 4HXAL 2DIBA 2E27H 4PJ7F 4Y5VC 4HEPG 1V7ML 5ACMA 3ZTNH 2AEQH 2XZQH 2GJ6B 5E94B 1GCFA 5ACZA 2R1WA 5JIPA 4YXLH 3QBTB 5IB5B 3CPLB 1LO3H 4F33B 3EYVB 2DLTA 1S5IH 3DVNB 1WBYA 1E6JH 7CGTA 1D7FA 2DF3A 2VB5A 3N85H 3L1OH 4G3YH 5KVMC 4H20L 4PRAA 4UIKH 2XWTA 5JMRA 1A2YB 2EYRA 3HAEH 1F02I 1TLKA 2CRIA 4WENB 4WY7H 1FV1B 1WIPA 1MH5A 2J5LB 1FYTD 4PJGB 3DHJA 4F7PB 3UTTA 1QVOA 1AO7B 1MHCB 1N5YH 2ESVE 2XQBH 3VRLF 4AK1A 1J0HA 3QUXD 3IFPA 3P77A 2D9CA 4NQCA 1MRCL 5LBSH 4JKLA 5KN5B 2B0SL 4HIHA 1WTGT 1H8OA 1OAQL 2V5RA 3MV7B 2E6JA 2YK1H 1EFXA 3LKRA 4LKXA 4PRBA 1KENL 5HDOA 4M7KL 4OGZA 4KJPD 4M48H 3PGCB 2X4SB 3HPLB 5TDPA 2OXGA 1D5XA 2FEEL 2R2BA 5CCKL 3PNWB 5HGAA 1BQHA 4ZAKC 3GSOA 3QA3A 1NCCH 4NO0A 5IHUH 3SDAC 1ZHNB 2B8OT 4S1SH 2EH7H 1REIA 5E2JA 3IDMB 2ATPA 3IJYA 3RY6A 1EA9C 2WWMD 3MROB 1KPVB 4QHUA 2NY6B 1NQBA 2G9HA 1BJMA 3WKNA 3C5ZD 43C9B 4ZUUA 1KXQE 3GMLA 4UIMA 1TNMA 4NUJA 5FCUH 1K8IA 1INDH 3SDXE 2H26A 4X9GA 4CMMA 4R4BB 3VGAC 3QQ9D 2XTJC 3VFOB 2DQUH 3DVGB 1F6AB 1QBMH 3K46A 3EYQC 4U1MB 4HS3A 1P9MC 3Q5OA 1MNUH 2ICEB 2A77L 4P2OA 1PD6A 4IJ3C 4X80H 5TF0A 5FUCE 3C8KB 3TBWB 1Y0LA 2BMKA 2CDGB 3O6KH 3UTPE 3RDTD 2XQYK 5AG9A 4U1SA 5CBEA 1T1ZA 4RQQA 5I15H 1MJJA 4MJIB 1MCQA 3C9NB 2MOVA 4GRWB 1T7WA 4KTEL 3FN0H 3Q6GL 5BZWA 2DM7A 2BVPB 4NWUL 3X12A 1BBJA 2FL5A 2DN7A 4HDIB 1IEAB 1T20B 5FGCB 1A9BA 2YPLB 1AQDA 4FFVC 5I9QB 5IT2L 1MCPL 5I1GL 3MRGB 1MQKL 4OZIA 4IMKC 1KN2H 4NO2A 3NCYP 4ZTPL 4XPHH 2KQNA 1Z5LA 4FRWA 3VGBA 4U6YA 4CADB 2R2HA 43CAB 5TF1L 3OQ3B 1I3RA 4F3FA 3SQOH 5EIIB 5J89A 5D71L 4P2QB 3P0VH 3U7AA 4TNVF 3IF1A 1EO7A 4QGYA 2VSDA 5I75B 3QHFL 4KDWA 3DARA 2ARWA 5I76A 1KCVH 1YYLL 4EQ2A 2UV3A 1FO0H 1PZ5B 4IEFB 4NWTH 1N6UA 4PTTB 5HGHA 2HRPH 4ODUA 1RPQA 4TUOA 3K80A 4JFQA 4TQEH 3RZWA 1JZ3A 4ZD3H 1DQJA 1Z3GL 1AD0B 4JANA 4KPHL 1JMXA 2WP3O 3IYLW 4QRRA 3AGVA 3UX9B 4PJ9D 3SDDA 2EH8H 3MJ7A 4Q97A 3C6LD 1I75A 4OV6F 4G6JL 4X9HA 2D2OA 1FHGA 4U7SA 4QGTA 5FUZL 1NH6A 2VLKB 5BO1L 4NKQB 1I7UB 2FCBA 2NTFB 3B6SA 5ICYA 3WFCL 3G6JB 1QFWL 1UKTA 5BV7L 1W2KT 5TE6H 1A7RL 1G6RL 5JIIA 3HNTH 1J1OL 5EBMB 4XAWL 1IAII 3CMOH 5L9DL 2F15A 3TO4A 1K3IA 8CGTA 1YNKL 3MRKA 2A2QT 4LFHD 3VRJB 1HHGA 4NHCL 5C7XH 4IOFD 5D2NB 1MCFA 1QBAA 4RGMB 1J8HA 4LLUA 5D5MA 1RJCA 1T21B 4QHMA 5KVGH 2AAVA 5LQBH 5CJQH 2R0KH 1RJZB 4OLYH 2N56A 5BVJB 1FLRL 3ARDC 1MIEH 3FFDA 5A2KH 5I30L 1DQQA 2VIRA 4P23C 3AXLA 1O0VA 1FYTE 2AXFB 1UCBL 2BNQB 3PWVA 4RZCB 4TSBH 5BW7C 2GKIA 3HAEB 3ZZ1A 3QFJD 2QADB 4OJFL 3PDDA 1RMFH 3FMGL 3GSUB 3FOLB 2X41A 3BHBA 4RMVA 3WS3B 1KN4L 1E6OL 3QHZH 3EJZC 1KIQA 3F7VB 4G6MH 4M43H 1Z9OA 5KW9H 4J2XA 5DUPH 5C71A 3QIUA 4RWYH 3K1KC 2GUOB 1OM3H 4BA8A 1IVLA 3E2HC 1HKFA 2FYYB 4O02L 5HYIA 2JJUA 4NBXB 4HUVB 3SE3C 1F4AA 2NZ9D 3TNMB 2DQDH 2VN4A 4UV4H 3O8XB 5DHYB 5CZVL 3NFNB 5F9DC 5EO9B 5JW5B 1I1AD 4X98A 4PJHB 4GRLA 4KKBD 4P2RA 4P99A 4O2EB 1CL7H 3TZVC 5EOTA 5A1AA 3JBG7 4BQ9A 1IT9H 3HE6C 3NACL 1YYMH 2WNGA 3MRPA 1QR1B 4AL8L 1A7OH 1S7WA 4UMGA 3NPSB 1FZMA 3GHBH 1L7TH 1A1NA 3T65A 3PP3K 3R06A 4XH2A 1TFHA 4I3RL 3WSQH 2CO6B 3DROA 1DVFC 4IRJA 5CD3B 3GMNA 2CKBH 1LE5A 3EYUH 4WWKA 3RUGE 1MJUL 1IC7H 1KFAH 3OAUH 2VLLA 4YO0A 1PLGH 4HF5L 1UWGH 4MHHI 3S6CA 4LSQH 3BRGC 4P9HL 2Y06L 5EUOE 4MAYA 1J5OL 4PJXA 5F6IC 1UJ3A 4R8WL 4XXCA 2RHEA 2WV3A 3RVVD 2VXVL 4RAUB 2FEDC 4UT9L 2AQ1A 4X6CE 4JO2L 2VR9A 1MUJB 4GLRH 4R96B 4DZ8A 4I0PD 1F45A 1PKQE 4GMTL 5HYSA 4OZFA 2VYRE 5EU4B 4XI5D 1JIBA 1WWAX 3TA3B 2H2PD 3LY6A 5IFJA 3EIFA 1HIMH 4XBEH 2X9WA 3PABA 3U6RA 1Z9MA 1N26A 1G6RA 2X5PA 5GRYA 4G8EB 3U1SH 3ILPA 4IIQA 1CDJA 4I77L 4YWGH 3G5VA 2IAMD 3ZTJH 4NM4L 5I2IA 2HH0H 1YEJL 2E7LA 4XP4L 3O2DL 1WJ3A 1ES0B 2QQKH 2YXMA 1ZS8B 4YIQA 4LAJH 2XXCB 3WCYA 3DECA 4Q74A 3DMMB 4NQVB 1KIRA 5F7KC 2GSIB 1FO0B 1N4XL 5EZJB 2AJUL 1GYAA 2YN3A 4NO3B 1II4E 4P57A 4LQFH 5C6TL 1S7VA 4ODTL 2YHGA 3HPJA 3ZYIA 3LPWA 3B4NA 4IRZL 5GGVL 3WNOA 2RCSH 2BDNL 1AJ7H 1B90A 3WEXB 5I66B 1YMMD 1T7VA 3H9HA 3WO4B 1U8PA 3OR7A 1GGTA 2DMCA 4NKOB 4NQXB 4LSUL 2WUCH 1F8TH 4H25B 3RUGF 4K8RL 2JLLA 4EBQH 5HGDA 2XT1B 1F11B 2QSVA 4JRXA 4PP2A 1CXFA 4KQ4H 4Q9QH 5CJ5A 4R3SA 5EUOF 1JHLH 2VE6A 4RAVB 5GJSH 1VKXB 2YA2A 4XZUA 4EOWL 2CDEB 2OZ4H 4D9RD 2ED9A 1U3HD 4PRDB 4P3CH 3DO7B 2FWOB 1NAKH 1QG3A 1FN4B 2VDPH 1K4CA 2CR3A 3B2VL 5IB2A 1KBGH 1TMCB 1QZ1A 5FF6B 3QFJE 4DZBB 5GZOD 1LDPL 1JWMA 4CVXB 1MRDL 3OJDB 3CVIH 5CHNA 1W72L 1WT5A 3NA9L 5TQ2L 4O58L 3GEWB 5JA8B 1OTSD 1JPSH 2FH6A 3A6OA 1CICD 4DGIH 1GJIA 1IGYB 3RA7H 1N7ML 1A5FH 4LCYB 4W6YB 2QR0A 1L0YA 1JNLH 5D1ZB 3WBDA 4U1JA 5EWIH 5BVPH 2WW8A 4M6MH 2NY6C 4FHBD 3PIQB 1NBYB 2DS4A 4U7MA 3ZE1E 1JCKA 3PQYD 5CGYC 2BOBB 4JCMA 5CJ8A 1UQSA 1PX4A 4QKXB 4UDUB 1QKZL 4FABH 3L5WB 1JGVH 3NOIA 1EAJA 1NEUA 3IVKB 4ERSL 2HTLD 1BFOA 1X5ZA 1HEZB 3LEVL 1HSAB 5J3HC 3CFKB 5I0ZA 4EQ3A 5HHOD 4IS6A 1U8QA 3EFFB 4HJGA 1H5BA 4GG6B 3GSRB 3RWJA 1K6QL 2BOCB 3NFSL 2CJUL 3ZE2E 4PJFB 4BZ1H 2D31A 3QRFM 4RX4D 1P1ZA 1KCUH 1G6VK 5FECB 4M7JL 1V05A 3QXAB 3O2DA 2VDRL 2DB8A 2FEEI 5GGVY 3U9PH 1RI8A 1NUFA 2CKBB 2FO1A 4H8WC 5DJ8B 3FAXA 2ICCA 5I9QC 2XWJB 3ILQD 1RK0A 3U82B 1G7LA 1E4WL 1DSFL 3HRZB 2Q76A 2R69H 5FO7A 3F8UB 4UOW1 5F1KC 3SKUD 1F90H 3RIAK 3CH8A 1CFQB 2E9IA 4HCRH 2WUBL 3MMEB 1W8OA 1UH3A 5IVXA 1NGPL 5I75C 2Y25A 1KJ2H 4ETQA 4M9OA 5GHWH 1RURL 4L5FH 3SDXA 3RTQB 4J3UA 3DVFA 1YN7B 2ITDB 3NGBC 2G2RB 2WWKO 1PEZA 4JFYB 2XKSA 3WIIL 4PGDA 3OTTA 3E1F1 3OZ9L 2IH3B 2X44D 3B5TA 2EC8A 2GSGB 3D39B 2Z8SA 1XR9A 4F7TB 3D3VB 3SO3B 3HKFA 2FIRT 4OCSL 3H3PH 4FZ8H 4DK6A 4C56D 5ELIA 1CVSC 2OR9H 2XTLA 1B3JA 2AP2A 3CFBB 4OCWL 1I4FA 4FQIH 4BQ6A 4L8DB 3O2WL 1I1CA 4HPOL 1DDHB 1GXEA 1YMHB 2O61B 3MLSL 5I1EH 2VKWA 1W72A 3RVWD 3UAJD 4LDEB 3BKCL 3H42L 3OAZH 1J10A 4U0RB 1NBVL 1YMME 2E9BA 4RMRA 3OKLA 2JIXB 1U9KA 5L6YH 3I50L 4N0UB 4QRSB 3ZE2F 2R1YB 5D2NC 1UVQB 4RGMC 2LTQB 2VL5A 4FQQB 5IWLA 3L3DA 4OTXH 2AERT 4MLSA 1LDSA 7FABH 3KPOB 3UPCA 1CDBA 4BSWA 3GMRA 4F58H 2QKIA 1GPOL 1CFVL 4PJ8A 2VH5L 1GC1H 1OGAB 3BT2L 5FGRA 2A6IA 4X83A 1PBYA 1F4XH 1N59A 3GI8H 3MZGB 5HHPB 4D9RE 3UTZB 4XPFH 5JMOC 3KPPB 1KEGH 3W5NA 2B4CH 4AENB 3IDUA 4HIEB 3L95B 3V6OE 2HJKB 4ELME 2ADJA 3KPMB 1KF9B 1QFWI 2RQ8A 3IAPA 4ZFZB 1AGBA 4P46B 3T0VA 3C5SA 4TVPD 4NNPL 1MCNA 3U46A 1E4JA 1ULVA 4S1RL 5FGBC 3MGTB 4PGBA 4K2UL 4WUUB 5L0QB 3BUYB 4OQTL 3O8XC 2M26A 2VC2H 1N2RB 5DRWA 4WO4A 1IGJA 1SBSL 4MD5A 4RAHA 4PBXA 2OS7A 3ULUH 4U7KA 1DBJH 3V52H 4AG4L 4F9LC 2AEIT 3GM0A 2O5YH 5K93A 3PQYE 4MJ5B 2NY3D 2HJLB 4X9IA 5GGSY 5HDBE 4IDLA 1I8KB 3NH7H 3FQTA 2VOTA 5FA3A 1BLNB 3U48A 4ZO7A 4JO1H 1IC1A 3BGMB 4LSVH 4HUWB 1OQXA 1WICA 5ICXA 3V6ZB 5IG7B 3HRPA 4PPTA 4RA3A 5ADPL 1FL3A 5IW1B 2VLMD 1ITCA 2FGWL 5DHVA 5HHOE 2R1XA 4U6VH 5DUBA 3LEXB 3QB7C 4XMLH 1FYTA 2WBKA 3B9EA 1WLHA 1GGIL 2HFTA 4U1KA 5GGSA 3FFCD 4Y4KD 4KWUA 4XT1C 3OF6A 2Y5TB 2EDFA 1YEHH 1RUKH 4NKIL 3AMKA 5D9SB 4QNPE 4Z7VF 1BFVL 1YPZB 2DMBA 4LP4A 4YDKL 4WWID 2PXYD 5DI8B 3HC0A 5EC2B 5I1CH 5TDOA 3VXMB 1RK1B 2H9GA 4OIIH 1YEEH 3S7GA 4S0SD 4KHXH 1EEUA 2R0WH 2VN7A 4S2SB 3TA3C 1HXMB 3V79C 3D9AH 4IHOB 1FGVH 3BQUA 4MYWB 1U3JA 3VGEA 4EXKA 2AK1L 1AGCA 3T1WA 4MHHG 1CIUA 2MCPL 4P49A 3MACH 2C1OA 3O3EB 3D0LB 4HPYH 2MTPA 2R29H 4ELMF 2PYEB 3MR9A 1JGDB 4L9LB 4HWZA 5JW4M 1JRHH 5ENWB 4PD4J 1G1CA 3B8YA 1GGYA 2OJEA 4RGOL 5CILH 4W4NA 3VFSA 4HBCH 1UB6A 1A02N 3DV6A 3NN8A 1JPTH 3UP1A 4XP9H 3TT3L 5ALCL 1JTTA 1JTOA 2QQLH 1BOGB 2O5ZH 4JHZA 3SY0A 35C8L 1J86A 3DMMC 3RUGA 4CVWA 1V3JA 4LVOB 5KOMC 3WNKA 1HILA 4FQXB 1EUTA 3SCMB 2DQTL 1R3LA 3E8UH 3VFGL 4XXDB 4FP8L 2NY5H 3U7WL 2Q7YA 5K9KB 2COQA 4C56E 2WP3T 4I3GA 1ZT4B 2PW1A 5DURD 1I1YA 5FV1L 3JWNC 3RDTA 5HDBF 4Y7MA 3VXUB 1A21A 5LGKA 1LO4L 4X6CA 2Z4QB 3WO4C 2GK2A 2F58L 1IARB 1MAJA 3OXRB 4PR5A 5E1HB 1LO2L 1HH6B 4WHTA 3TCLB 1L7IH 1BQHG 2ZWLT 2F53A 4HK0A 3MRIA 4MDJB 1FSKB 5EU5B 4DFHA 4OQTA 3IU3B 3ISWA 4PP1C 2C3HA 3I6KB 3U4BL 5F9JB 4KKCC 1INEL 3HZVA 1UWEL 3QWOB 4PG2A 1PDKA 2ZZUT 3WFHA 1NL0H 3KJ6H 4F2MA 4YUEH 1TTUA 3TBYB 1A64A 1EV2E 1I7ZB 5DVLA 3BMVA 1ORQB 1YQVL 1H3GA 2A6JB 3U0PA 3VRIA 5JPMA 4JB9H 1Y18B 1GGBL 1GAFH 5DGRA 3QDGB 2APFA 4CVUA 4U4BA 4CBPA 2HKFH 3BVNB 2GEEA 2AJXL 1U8LB 2GIYA 1AR1C 4L8BA 4Y8DC 2GJZA 1IGFH 3QJFB 3ARZA 5LXGH 3MCKB 1OY3B 4JFOB 4PJ9A 3TJEH 3LQZB 4G8GD 2VAAB 5HDLA 3Q1SH 3FRUA 1QLRA 5DJ6A 3RX7A 4PREA 4TVPE 2Q1EA 5I1JL 2XKNB 5D1ZC 1TZHA 4PJDB 4KFZC 1CGVA 5F1NA 5C9JA 5KVDL 4XGZB 4JN1H 1YEIH 1I85C 3MBXH 5F7WC 4LCCB 5D7JB 3L3IB 1FQ9C 5I8CB 3DX9B 2M8XA 3TPKA 2H1PL 1IKFH 3CC5A 4W81A 4JRYD 3EOBB 1U58B 1HK6A 2I25N 4UNUA 2R39A 4GXUN 2X7LA 1Q94A 1T1YB 1MCBA 1XF2A 1D9KD 3FB6A 1DLHA 5JXAH 4HV8B 4P3DB 4PIRF 3QO1A 1RUML 1LE9A 2AXJA 3MRRB 3HMWH 2Y1VA 1G9MH 2W65B 5FYKU 2VLME 4PGCA 1SEQH 2YZ8A 4KMQA 5MEPB 3W11C 1SJHA 3EO0A 4MGXA 5L7XL 1U0QA 3UO1H 1SJVA 3DX6B 3FFCE 3QFJA 2ADIA 3T4AB 5EC1A 1P4IH 1A0QH 4C55A 3PWPB 3RGVB 4HKZA 4F37K 4HZAA 4HIIB 3CZJA 4MA3B 4KVNL 3B9KC 1HINH 3A6BL 5H37G 1KIPB 3CLEH 4OLUH 1MFEH 4HQQL 3PGDB 2AXGA 1AE6H 3FO9A 4YHMH 2CIKB 3KLSA 3QNZA 2OBGA 3L5JA 1QA9A 4FFWC 3KYMA 3DLQR 1C5BH 3FTGB 1NCWL 3RTQC 5FYJH 2VRAA 2BK8A 3MBEB 4QY8A 3RIFK 5DD3H 4GAFB 1RJLA 5KSUB 1JGLH 3QUZA 3NFPB 3O9WB 2P8MB 5LVEA 3V4PH 4BH8B 1MWAH 5J4MA 3D85B 5HVHB 5JPNA 3IXTB 3SO3C 2ILLA 2CLZA 3VGFA 5BQ7A 3P4MB 3BWUC 3I6GA 4XVSH 5T3XD 3X3FL 1H3UA 2DBLL 2ZUYA 3GJFH 4PJEE 5EA0L 3BZFB 3G6JF 3LN5A 5FO9A 3QUMH 3SHSA 5ANMB 2Z92B 5CD5D 1NEZB 3KR3H 4UI2A 1WGOA 3PDOA 3M8OH 2EZ0C 5HYJD 5JLZB 2DLEA 3T2NL 5L2JB 4U0RC 3MRJA 1ZVSB 4M1GH 4JRWA 3QEGL 1C5CL 5AD0B 4OV5A 3RNKA 3QIWB 3RPIA 4HMEA 2VXUL 4KROD 4FQHB 4K3EL 4XNXH 2EIEA 2I9LA 1HHKA 5GGTH 2K7QA 4JFZH 3ALPA 2LTQC 5E99L 2AABH 4ZFOB 3ZSTA 2BHZA 1OAZL 5D1QA 4MNHA 2XNAB 2BSSB 1ONQB 4DKEH 2RBLA 3TNNB 4DN3L 4XNMB 5DXWA 4NZUH 4ONHA 3MLUL 1FFNB 4I18B 4BH7A 4UU9B 4WVRA 2ZPKL 2DYPA 1UEYA 2J88L 3QDMB 3O6FB 3BX7C 1BX2B 2IAMA 3GHEH 1VFMA 4K3GA 5DJ0A 3MLWL 3SGDI 3A6CH 1B4JH 4KUZL 5CSZA 2R23B 5D2LB 2OK0H 1MSPA 4YHOL 3HUJF 3NCFB 4P46C 1AXSA 5EOQL 4LIQE 4JFDD 3WJJC 1QO3A 4NKMB 2LE9A 3EGSB 3G6AA 4G42B 1EZVX 5L0QC 3KJ4B 3BIAX 2DM2A 1S7RB 4NUGH 4G8GE 3KDMA 4Q7DA 4JFPA 1X5LA 1ZAGA 2LVEA 3MFGB 5HYSG 3QPQC 4OZFG 1YMMA 5K59E 2IPUK 1G7IB 1WIUA 3U4EA 2EEAA 3C2AH 1WCQA 4TUJA 4PJEF 1RVFH 3EDDA 1U8NA 4PB9H 5AYUH 2V2TA 3MUZ1 2F9BT 1VFUA 5TE4L 3QUYD 4V2BA 4OZGB 3S5LA 4BK5A 5E4IA 5IQ9A 5T1KD 1LK2A 4JRYE 1LEGA 2HT3D 1X4XA 2ED8A 3HC4H 4KTDL 4HUUA 2E7HA 1T22A 1WFUA 3DETC 1OTTD 1TVDA 2DIAA 5E9DD 1S7TB 1U3HA 5KJRL 4YQXH 3QZWG 2HWZH 3ZLQC 1ERNA 4QRPD 4MNGB 2NW3B 1XIWB 3Q5YA 5LGHH 3HNVH 3Q6FB 5C09B 3KPNA 4PTUA 1M71A 4D0CA 5HDQH 4KJWC 1EXUA 1RZKH 2C3WA 3Q48A 3HI6L 2IG2L 2NR6D 1HHHB 3U7YL 2XIDA 1EGJL 5H2BB 1MCIA 1WBXB 3G9AB 4HGKC 5SX4I 1Y6KR 1CICA 5DJYA 5E7FA 2EDKA 1I1RA 3VWKD 4OSUL 4ODBD 3D18B 5C07B 3MYJB 4KAQH 1RIVH 4OF7A 4DVRH 5DJ2B 4YBQD 4X6EB 5I73B 3RWGA 3IGAA 3PQYA 5IB1B 4HXBH 4L9LC 4KUCD 5J6GB 2EDQA 3QULA 3X17A 2NW2A 2YPVH 4K71B 1YY9C 3O2VL 2BNRB 2P5ED 4NIKB 1ZK9A 1S78C 1DBKH 1K8DA 3VH8A 1U92B 2N1KA 5I1LA 3WNLA 3OR6B 3RVUC 4WHYH 4G6FB 5I8KH 2OTWA 4HFWA 1KULA 4R4FL 2OTUB 5I1KH 3S35X 4LVOC 4L3ED 3VFTB 1S5HB 4FQXC 3S98A 3SCMC 3BW9B 4M1CC 3DRTB 3GSNH 4R97C 4HAGA 4ZUTA 3W2DL 1TZIB 1ZTXL 4TVPL 3FB7A 1VEPA 1M7DA 5T3XE 3ROLB 1DEEA 1MWAB 1KLUB 1NCBL 1YC8A 1TTGA 1QRND 3BKYL 3HFML 2IQ9H 5DJCB 4OLZH 4PB0L 2DLFH 2C1PA 5KAQF 3QUMB 3TJHD 2XA8H 2R0LL 5HYJE 1XF4B 1A6PA 4FTVA 3QPXH 1CR9H 1FLTX 1FSKC 4RMTA 1WF5A 3C87A 4MB5A 1ZMYA 2VITA 2VXSH 5IJKA 4BYHA 4ZS7L 4ETYA 1OPGL 5A40E 5DD1L 4KK8D 4CU6A 3EYOA 3KS0J 4U6XA 1S8DB 4NYLB 3BESR 5F3BB 2EYSA 5C86A 3J7HA 4LHUA 4JR9L 2ZSWB 1BQUA 1SY6H 3QNYB 5IMLA 1TCMA 1S9VB 2BZDA 2DWEB 3MNWB 4Y2OA 1NLBL 4UTBL 4J8RB 3E6HA 1JNHB 4ODVH 4XVTH 2H8PB 5JZ7D 1WAAE 4M62L 4ENED 1BJ8A 2BVQA 5F7YC 4XVUC 1FH5L 4JKMA 2GITA 3VXOB 4ZFFA 4WI3A 5DQDH 3CVHH 4LPTA 5K9JL 4RIRB 1EEQA 2BC4A 3JWOL 5D7IE 1MLBB 4AIZB 2IH1B 2NY2D 4YFEA 1TVHA 3AREA 2PTTB 5DMKA 5DJXB 4LMQE 3VGGA 2C3GA 3MLXH 3MGAA 4MA7L 3LQMA 1YEGH 4KKLD 2DQGH 3R8QA 4C56A 4Y4HB 2P24A 3MV9D 3I75A 1CU4L 1PG7X 2B4CC 5T1DL 2APTA 2VDNL 4JFDE 3K2UL 3OAZK 3W39B 3EYSH 2BVYA 4I48B 2ZCKH 4LCIH 1D5ZB 1R5WA 4ODSL 3NZ8B 1NCAL 3SGEI 3VW3L 2D4FA 1CD8A 3EZJB 1VGKB 3LKNB 3DPBA 4C83B 4YK4B 3IFLL 4KHTL 4LCCC 1Q9KA 5D7JC 3S3SA 3VXPB 2ZUWA 1A7QH 3U0WH 5HYEA 5L2KB 1EGJA 3QG7L 4MS8D 4Z78A 4YFLI 4L4TB 1GH7A 3ULUC 4YNYB 2R9HD 4HS6A 3VFUA 4N8CL 4RMWA 2D7QA 5DWUL 1JHTB 2ZNXA 2GK0B 1QQDB 4ZSOE 2J7LA 2ERJB 5D1XB 2FIKB 4HC1H 2DLGA 1QBBA 4QRQA 3KS0H 3BE1H 3ZKMC 2B39A 4QXUH 1IILE 3WFEL 2I5YL 3PWNB 1DUZA 3INUL 4GG8A 4LLMA 4K7PX 2IPTH 3GMPB 1FZKB 2QEJA 3JV6B 1OP3H 5E9DE 3MNVA 3VFRB 1OGTB 1YJDL 3MLZL 3W82A 2XZZA 4KQ3H 2DL9A 4UT7H 2ORBL 3RAJH 3RGVC 3RWDA 4QRPE 4XCFL 3H6JA 5E2WH 4P2CG 3VWJA 1N64H 2MNUA 4CNIA 5ADOH 4OGXL 5IW6B 1FVEB 2VZVA 1FAIH 5C0AB 4ZTOH 1ND0A 4NQED 1ZLWH 4LLVB 1U42A 3B2UC 4MDIA 1I9JL 4MNQD 1RUQL 4PS4H 4AEHH 1WAAF 3MLTB 4Y5YC 2EXYD 1OD7A 1OSZA 5DRNB 4FG6D 5D4QA 5EFIA 3UPRB 4HJJL 1LEKB 1BREA 4OCYL 1MJ8H 4F80A 2JCCE 3BPCB 1BD2D 5K9QI 2FD6L 4GBXB 1JWSA 4AT6B 3MBEC 4KRPB 3OB8A 3DBXA 1EH9A 5HYQA 3LOWA 3RZCD 1CE1L 1AGEB 3O9WC 2QHRL 1FNGA 5C2BL 1I3UA 4Z0XA 5F96H 4XPAH 5KSAB 5LCVH 3HNSH 5JHDD 5HVHC 4DGYH 4ODHH 3OKOB 3KAAA 4LIQL 3IFNH 3MOAH 4XCEB 3G04A 3PWJB 1XEDA 5JW4R 1ZLSH 1JK8A 2D0GA 5I19H 3PJSA 4I5BB 4NZRL 1XF3B 4L3EE 4PLJD 4BUGA 3FFCA 1IAMA 2HVJA 4TPRH 3E3QC 3HS0A 3D2UB 3KNBA 3FOMA 4XVJH 1ZA3B 3SE8L 4I4WA 1QRNE 1S7SA 2PXYA 3GSNB 5KSVA 4WNQB 1XF5B 4FQ2L 2YC1A 3QIWC 2ZCHH 4TUKH 4U2ZA 5J9PA 4LLYA 1A7NL 1RZ8B 1WUNT 5IHLB 3FQWA 5E6YA 3RNQB 2FSEA 2IGFH 2QTEA 4N0CD 2DQCH 2OL3H 5CP7A 3PL6B 3OPZL 5HHMD 3H8NA 4Q2ZB 1A3QA 4I18C 3HZYA 4FZEL 2FO4B 5KTEL 3O6FC 3OJMB 2WAHA 3OWEA 2YBRA 2E6PA 4K9EH 1LQSR 4KJYB 1F2QA 2JJSA 4XX1G 2EDJA 4RFEA 3HMXH 4DTGL 1IC4L 1MHPH 2NY0D 4YHIB 3FB8A 1PG7H 2R56H 3L3JB 2KQMA 4M7LH 5FUOH 1RZIB 4B0MM 1CTNA 2APVA 2EC9T 1UZ8B 4P5KB 1CDCA 4P4KC 3GB7A 3KJ4C 4YXHH 5BMFL 1G84A 1HXYB 3CVHB 1AKJD 4I2XE 4R90L 1FNEB 1DLFH 1AQKH 4F9PA 4JHBA 2QV2A 3MV9E 3ZDZE 3ES6B 1K3ZA 1TIUA 4KUCF 1T2QH 4AEIL 2OCFD 2CKNA 5C3LD 2LVCA 3AMLA 4O9HH 4LEOA 3T8XB 1DQML 3GRWL 1JTPA 4QRUB 2FLBT 4X4ME 1DQLL 5FM5M 5D72H 5FKAA 3U2SB 2K3TA 3BKJL 1FDLL 5DR5L 5EZLA 5HHXH 1MIML 3UZQA 1R5IA 1S7QA 1H8NA 3R1GH 5DS8B 5A3ID 1CBVL 3S3JA 3ORJA 3QXDA 3OX8B 1NDGA 3CFDA 4KK5C 4K7PH 2A74B 3V0WH 4GRMB 4PD4K 4LRNL 4YX2L 2VL4A 5GSRA 3KWWA 3WN5A 5HI5D 2X4NB 1DQDH 1XIWC 1BPVA 3QI9C 1N0XH 4JDTH 1RZJH 1G9MC 3LKQA 3QCVL 1UM5H 4BFIA 3O6LL 3VXNB 1Q0XH 1NUNB 3GSXA 2NXZB 2IBZX 1IGCH 4H1LH 1P69B 4XRCB 4UBDC 1SM3L 3LIZL 3JTTB 3G5YB 4L8SA 5BZDB 1J1PH 4G8GA 3H3BC 2BRRL 1MF2H 2I07B 1DL7L 2P8PA 4LQ1A 3KXFA 4NQEE 4RISH 1VPOL 3SO5A 3CDGA 1CD0A 5KVFH 4MNQE 4J6RL 4MQ7B 1KJMB 5I73C 5ID0B 3BPLB 4HJ0D 1NC4D 3JSSA 3RI5F 1PVHA 3A67L 4Q6IB 5L88H 2XN9B 5CIPH 3X14B 3O3DA 1BD2E 4K71C 4U31A 1C7TA 2YA1A 5BRZB 4JRYA 5H37H 2I9TA 1DQTA 2R8SH 2EKSA 4HKJA 5E8EA 2XZAL 2YUZA 1D9KA 5BJTB 2Y36H 1MHEB 3QO0A 4MA8L 1JPGA 4TRPL 5JHDE 1YNTA 2CDFA 4DN4H 1A3RH 1BWWA 4OGYL 3IRZA 5BS0D 4OFYD 2B20A 3H7BA 3K8MA 3ULVC 4U33A 1QLEH 1WWBX 2W91A 4H0IA 2PO6D 1KIUA 4JO4L 3AFLA 4OZHB 1FFPA 5ACZB 4XPTH 3QHTC 1NGQL 1TETL 1CXHA 4PJCE 5JDSA 3EZ8A 3MV7D 1RUAL 1ACZA 1WBYB 3P30H 2X05A 3FT3A 1C08B 4I0CC 4ZFGL 1B2WL 3TWCH 4Y8AA 2XWTB 3B8SA 1Q9OA 3IDJA 2EYRB 4DAGH 2FJHB 4LSPL 2ZSVA 3R0MA 4KDTA 4MCZB 1I8LC 4MQSB 4JQVA 5CJOL 3MSPA 3WFZA 1F3JA 2ZKHL 3GRWA 1UWXH 3ARGD 4UDTA 5HHME 4NQCB 1C1EH 3UJIH 2R0ZL 2YEZA 3SN6N 4EEEA 1ZT7A 4LVEA 2OL3B 2AV7A 3GJFK 3VD7A 5EUKB 4F7EB 4NP4H 2XWBA 1ZKAA 1XMWA 4ZOCA 5F7NC 2PN5A 2XG5A 3O4LD 3VXRD 1J0JA 1D5XB 1XGPA 3NVQA 1X4YA 5CLTA 3GSOB 3MRCA 4NO0B 2HLAA 1JPST 3MJ8A 4HWNA 3D6GA 3FB5A 5KG9A 1P6FA 1TJIH 3TIDA 2X4UA 4P59L 2R2EB 2XICA 5IFAL 4NRXB 5GGUA 4YK4C 5HJ3B 4UTAL 2NY4D 2ZJSH 4P0DA 1D5IH 2KKQA 3UYRL 4JG1L 3KYOB 5HYJA 5C3TA 4MJID 4OZ4B 4UIMB 4Z7UB 4NUJB 2B1HL 1FC2D 4JY5H 4NO5A 1KGCD 3PGFL 4CMMB 1RJYA 5A2FA 1VEMA 1FGNH 1NBZB 1FL6A 4Y4FD 2Y07H 1BBDL 3EOYG 5AWNH 3WXWH 1NMAL 1O5DT 4OKVA 5CP3H 5D6DA 3JXAA 5ITBH 3T08A 2IAND 5D1XC 3WD5L 4MCYB 3VE0A 5AYQA 4N0FB 2E9JA 4M61A 4PJCF 3GMOA 1UH4A 3P4OB 3K74B 4LAQH 5D7IA 4PJBE 3RBSA 4PJAE 3T3ME 4X7DC 5BZWB 3MLRH 1BBJB 3DO3A 5EZIH 4D3CL 3C6SA 1A9BB 2J3SA 1AQDB 3BYYA 5FEBA 5EBLB 4R0LB 5GRUL 1I8MA 4OZIB 3MUGA 2YUXA 1T89C 4JFDA 2CUHA 4NO2B 4QF1A 4MXWL 2UY6A 4U6YB 1DBAL 1KB5L 4WW2C 1LP9E 4EUPH 4GUPB 2YD8A 1RZKC 3BN9C 1BGXH 3UJTL 3EDFA 1TXKA 2VLKD 5ETUA 5H94A 5I8EA 3MJ6A 5DLML 2PCPA 3IF1B 4KK6C 1XGYL 4JHWL 3EO1B 4GBXC 2HLFC 1MVUA 4KRPC 3KHOA 4ISVA 3HE7B 4Y5XA 2V5MA 3QDHA 3DXAB 5KANI 5DRXA 5AAMA 4LCWB 3LPFA 3KG5A 5HHNA 1OHQA 2J1KA 1I9IL 5E1AA 2IBBA 4QXWA 3C60B 1ZA6B 1LGVA 4TUOB 1ROWA 3MXVH 1OARL 4JFQB 5KSAC 1ZXQA 1IMHC 3V5KA 2H32A 4ZSOA 1HKLH 4MVBC 2NLJA 4JANB 4KGJA 5HHQA 2VDLH 1CXKA 3QUYA 5CLWA 1B0RA 1V3LA 1XCTA 3MNZA 3S37L 4S11A 4S1QH 4JKWA 1MCEA 5CIPB 4YDJA 3JV5A 4HK3J 1QHOA 3B5GA 4ZXBD 2W0FA 2J8UA 3MRNB 4LBEB 2X4OA 3B3IA 5FDWA 5K9QG 2EDWA 3H9SD 3V6FB 2ARJA 1G7MB 2BSRB 3B6SB 2WBJA 1T04B 4R26L 4JJ5A 5BS0E 4QRPA 1VACB 4KKAD 2PYFA 2QADD 5TFSL 1VFBB 4NQUA 2VXTL 2VZOA 3TO4B 2F54D 1CFTA 2J4WL 4BZYA 3KPRB 3U9UB 5T1LB 3MV7E 1Q1JH 3GKZA 1JZ2A 4H26A 3LKSA 1J8HB 4LLUB 1G7HA 4APQA 2E7CA 3O41B 2DTSA 2WANA 4JY4A 2ATKB 3PL6C 4QHMB 2JCCA 3VWKA 1OLLA 4PJBF 5DQJB 1MFAH 5JO5A 1BZ9B 4CJ0A 2X40A 2YD6A 5JIHA 2A6KA 3T1FA 3PHOB 5GGQL 4HX1A 4JZNB 5IQ7H 4RWHA 5D2LF 3S5LG 1R3KB 5IHZA 1Q9LB 5TPWL 3MA9L 3MFFA 3TFKD 1LP9F 4HFUH 3P9MA 1AGDB 5KSBE 5INDB 4LSTH 1IFHH 1J0YA 3MV01 4GOSA 4UT9H 1BF8A 2FR4A 4NC2B 5LWYH 4NZJA 3GKWL 4L3EA 3O4LE 3VXRE 2Y7QA 1VCAA 2VWEC 2Z91B 1HWHB 4CL7A 4R7DB 3GJEB 2YPKB 5DJZA 4P2RB 2VXQH 5GISL 1QRNA 4YHZH 5EPMA 5IVNA 3CZFB 3SOBL 3ZKQD 5EOTB 1HE7A 4LLAA 1PYWB 5GS3A 1MAMH 3MOBL 3VA2C 1CK0L 1JFQH 1S7WB 2R4SH 3C08L 1FZMB 4I77H 3DURA 4ZDHB 5DEFA 1A1NB 1XGUB 4MJIE 1KB5A 4UUJB 5C0RH 3DUUB 4GRWE 4UILH 5B39G 3RU8H 1M6OA 5B38A 4XP4H 3CCHB 3TBSB 3DROB 1KGCE 3E6FA 4M6NL 1HSBB 5FK9A 1U3ZA 1D5BA 1F4YL 3TA3D 4IRJB 4M8QA 4ZAKA 4Z7WB 2P8LB 3L3HB 5C0IA 3LS4L 4YO0B 3UTQB 2VLLB 5J0BA 2IANE 4D0DB 5GIRA 5JQ6H 3L5HA 1LO0L 4R4ND 4XCCH 3VH8G 4JO3H 4MA1B 1ZHBA 4BSVA 1JF6A 4P3WA 1UJ3B 3VFWA 2P49B 5IESL 4F7CA 1U8MB 3FQRA 3LVEA 4HLZG 1MY7A 5F71A 4KI5D 4O4YL 3BEWA 4CGTA 2FHFA 4OZFB 4XWGH 3DIFA 1VGEL 3CDFA 4HMCA 5IBUG 3WS6C 1P2CA 5H35A 4R2GB 4KGLA 2XXMB 3UDWC 3PABB 4PY8J 1FPTH 3JTSB 1LO5B 2YS4A 3MJ9L 5BV7B 5DK3A 1HHJB 2L4OA 5EU7E 3KLAA 1AD9A 4PJIB 5GZNC 1MI5B 3MZTA 1KTLA 4YDLB 1NSNH 5F6HI 5E08H 1A3LL 5KSBF 1G7QA 5JOFA 2Q20A 4X4MA 1FIEA 4PJ7B 3BPLC 2XFXA 1J1XL 1WK0A 3ILPB 4IIQB 5HI4C 2VLKE 4Q6IC 5IB3A 3G5VB 4X4XA 3AAZA 4AH2A 2CK2A 3W9EB 4Z95H 1H15B 2DL2A 3BSZH 4NZTL 4BK4A 9CGTA 3BFOA 3SGKA 2X4QA 3UJJH 3QZWB 3P73A 4LHUG 1QTYT 1CLZL 4NQDD 5DRZA 4YIQB 3BXNA 4OCNC 3RIAF 3S9DB 1NC2D 1OP3K 4IMKA 4YPGB 4NRZA 1KPRA 3ULVF 4P57B 4MX7A 4LCUA 4N1EA 5EU6B 5E5UB 1HNGA 3IDIA 3V4UH 3ZT6A 5ID1B 1I3GL 3HPJB 4O2FB 4MWFA 2R4RH 5LGJB 4HUMB 5DO2C 3T4YA 3H9SE 4JFEA 5IBLC 3EOAA 1SEBB 1ZLWK 5HHVL 1DBBH 4K3DH 3PWUB 4I3SL 5F1SA 1CF8H 4XP5H 5GS1B 3WLBB 4HGWA 3WO3B 4DUWA 5F8QC 1UACL 3X3GH 2O5XL 4EDWL 2A9MH 5I1DA 2RAMA 2F54E 25C8L 1T66D 4NQEA 5DC9B 4R3SB 1R24A 1WC7A 1NFIA 5E6ID 2GTZA 2G60L 5IMKA 3GK8H 2BHYA 3O6ML 5E8NB 3S3PA 1U41A 1QYGH 3Q2CA 3O3BB 2YMXL 1FVDB 1K6QH 1XT5A 2AV1B 4LMQI 3NFSH 4U1HA 3TBTA 4XC1L 1NMBH 4JN2B 4I0KA 3RZCA 5I71B 1QFHA 2ICWJ 5C0BB 1MREL 1Q72L 3G08A 1IC5H 3LN4B 2UWEE 4G8FA 4P5TD 1BQLL 5CHNB 3S36L 5IEHA 4DFIA 3CXHK 5JHDA 5DVOA 2HTKD 2VLRB 3ZKND 1P7KA 1WZKA 3RWHB 1AXTL 4TTDD 1RZGB 1IEBB 4DW2H 2Y6SD 5I8OH 3RQ3A 3DSNA 3IFOA 4K9EC 1DSFH 4BQBA 4KY1L 3VXSD 4DVBA 3WHXB 4UINH 4L9DA 3GBMH 2D7PA 3VI4E 4U1JB 4P23A 3IAGC 3S88L 3KPQA 2WLZA 2FB4L 5E70A 1UQSB 4X7SL 1X7QA 4POZC 4FQLH 3NIFF 2BX5A 4BKLA 4LOUD 4UT6L 3MJ9A 15C8L 2AJZA 5FYKH 3MRLB 4PRIA 1U8QB 3T2OA 5KS9A 4MLIA 1H5BB 1BIIA 4YHLH 2ESVB 3T0DA 4L1DA 3X13B 3UTTD 3SE3A 2F8VA 1CFSA 2D31B 1EJ6A 5C0NC 2WIMA 1Q38A 1BVKA 1P1ZB 1QSEA 1U95A 2BSED 3KPLA 1RU9L 2DAVA 4OCWH 4JM4H 1A6TB 3SGDH 3VJ6A 3ZKXB 4OIAA 2JK5A 3O2WH 4XCYA 4QHLA 4HZLB 1XZ0B 1K2DA 4RDQG 1GGCH 3HE6A 1KCSL 4HWEL 5CEYB 1Q0YL 5C8JA 2DI8A 4YHNB 4TNWK 1WFTA 5IGXH 2GT9A 2N7BA 4WW2F 4R0LC 4LPYA 1OAYL 1QRKA 3FQXB 4KI5E 1KC5L 2Q76B 4JDZA 3GO1L 5TE7L 2X4TA 4BJLA 3MV8D 4WCYL 1RZJC 4BQ8A 5MEOA 3JZ7A 3WIFA 2ZUSA 3ARFD 2BFVH 4ODWA 4MD0A 1L4IA 1MEXH 2I27N 4RNRA 5DT1H 3VFVA 1B4RA 1D5MB 2EDYA 5DK2A 4UB0H 2HJFB 2UWEF 3SDXB 3HE7C 4M00A 4MB3A 2FX7H 5F89A 4L4VD 3C60C 4YDVA 4EIZC 2A83A 4E0RA 1OD9A 3QWQB 5FHAL 1QNZL 2QHLA 2SEBB 3ETBF 1EHLH 5AUMB 1I9RL 3E0GA 1A6WH 5D6CA 1XR9B 2XA3A 1AP2B 3FCTA 2A0LC 1GZPA 4HBQA 3V6BR 4P2OD 4NQDE 2BXYA 1DFBH 1I4FB 3WFBL 1JF1B 3TVMB 3SE9L 1M7IA 3PHQA 1GHFH 3X11A 3ZHKA 1FL5A 4X7FC 5M7QA 4PJAA 2P7TB 5A16A 1OGAD 1UCTA 5KANG 1JPFA 4HT1L 2W60B 3O45B 4NJAL 5IBTL 4G43A 3P0YL 1Z0NA 3TO4C 2VERN 5CBAA 2H6PA 3WHE1 1MRFH 3JWDH 2WK2A 4WDIA 3SPVA 1LP9A 1NLDL 1IL1A 5EORH 4WHCA 4AYFA 2Q86A 3L3DB 4GKNA 3QRGL 2HP4A 3BRDA 3DUSA 1DN2A 1SQ2N 3ULSA 2ITCA 3TN0B 2K9UA 4QRTA 3GMRB 1B0GB 2QKIB 1P5UA 2RFXB 4PJ8B 2IADB 1OAKL 3WHE0 2PW2A 2A6IB 4OF8A 1U8IB 1NC4A 2XY1A 4IRSD 2GJ6A 2YD1A 3MC0A 5IB5A 3STLA 1JNNH 1CI5A 1DTUA 1T0PB 1HCFX 1BM3L 2FDBP 3CPLA 4XHJD 4F33A 1MFDL 5DD0L 3EYVA 3VD9A 4QTIH 2KBGA 4Z8FH 2ADJB 3NIGF 4PLNC 3KVQA 2P46B 2VABB 3ZYOA 1FV1A 4WV1A 2BJML 3RKDD 2EXWC 5DRWB 5EBGA 3KPSB 5BS0A 5E00A 2IEPA 4MD5B 2Y23A 4F7PA 4U1IA 1AO7A 1MHCA 3D87B 5JW4N 3JVGC 1F6FB 1G9NL 3QSKB 2Q87A 3VXSE 3VFMB 1H3TA 4HAFA 2V7HB 3WJLA 2YA0A 1OP9A 4HS8L 5CUSH 1S3KH 1NANI 3MV7A 3N1QC 3THML 1L9MA 4GAJL 3TF7C 4LKCA 1UWXK 1A8JH 4M6OL 1IGMH 4WUKL 1NGYB 5FM4A 1TJGL 2X4SA 3HPLA 4NSKB 2Q8BH 5CFHA 2CIIB 3EHBC 4RFNB 1FL3B 2E27L 4IRJC 3PNWA 4OM1H 2X4PB 3SJVD 2AKRA 3ZTNL 3KLDA 1ZHNA 2AEQL 3U36B 4EN3D 4M5YH 1CGYA 35C8H 2XZQL 5GGSB 1DN0A 3UTTE 4XHQA 4YXLL 2Q7NA 3MROA 1MCWW 1KPVA 3QUXB 2E8YA 3PV6B 1KLGA 3CMGA 5KAQG 1UJ3C 1LO3L 1EVTC 2CLRB 1MY5A 1E6JL 4WGVB 3N85L 1T4KB 3L1OL 4G3YL 3KLHD 4UIKL 5TDOB 1T1WA 2ZG1A 2H9GB 3G5XB 1EO8L 3QIUD 4HUXB 3RVUD 3VXRA 3AB0B 4WY7L 3VFOA 3O11A 1P4LB 2HFFA 4OIBA 4U49A 4R2GC 1F6AA 4N90D 4B7IA 4QWWD 1CGWA 5INCB 4I8DA 1N5YL 1JYWA 3D39E 3SCMD 5BV7C 2XQBL 3H2WA 5E2UH 2ICEA 3D3VE 2C1OB 3BPOB 5JNYB 3C8KA 3MV8E 3TBWA 5TGBA 5LBSL 2CDGA 4HIXH 4IIQC 1SHMA 1KEMH 1GZQB 2AJYH 3WE6B 3OBAA 1CTOA 4F37F 2YK1L 3C5ZB 4MJIA 4LGRB 4JGUA 2OJEB 4M48L 2E7LC 2VKXA 2YD4A 4LF3B 4PGEA 1AGFB 5DJAA 4XC3H 1IEAA 4L4VE 4JFXB 2YPLA 4Y2DD 1KXVC 1NCCL 5IHUL 5HD8C 1JV5A 4NFBA 3SY0B 2D03H 4S1SL 3RUGB 2EH7L 4UQ3A 2IANA 4CADA 1MCOH 3HR5B 43CAA 2YN5A 1A9EB 3DNKA 1PJ9A 5EUOB 4PRPD 1J05B 2O26U 4MAYD 3STZB 4YZFF 1NDMB 3GNMH 2VZSA 4X6CB 4NZDA 5FCUL 3V4VH 1INDL 4HKXA 4OD1H 2DI9A 5F3HB 3TC9A 4JAMB 1OGAE 1PKQB 4WI2A 1IBGH 1X5IA 3BP4B 4PTTA 1G9EA 2DQUL 4GSDH 4HK0B 1QBML 5JA9A 3L3KB 1NKRA 3DOSA 2MPAH 1MNUL 4K55A 5KZCD 1OT1A 2LQRA 1VESA 4X80L 4P4RB 4QT5A 4LSRH 3UZEA 5HVGB 5DVNA 3O6KL 4N5EC 4MZ2A 2RR3A 2VLKA 3BKMH 5I15L 1I7UA 3OKYA 1MFBH 3FN0L 4IOSD 5C0FB 3U0PB 5JPMB 2D9QB 4OFDA 4OT1H 5KVEH 2YOCA 2XY2A 5EBMA 3ARQA 2V17H 2ZUUA 1KN2L 1T83A 3P9WB 3QIBD 4XPHL 4UAOB 4L8BB 1IAOA 1WT5C 3IXAB 1J0ZA 4JPIB 1IGIH 4YGVA 3U0TB 3JUYA 5D2NA 1S9XB 4KVNH 3SQOL 1PEWA 5TH2B 3C6LB 1JYXA 4ZXBA 3N1FC 3DI2B 3P0VL 4XTRD 1ADQH 1WZMA 5EIVA 4PREB 5J7CC 1T21A 3T77B 1FFOB 4LDLB 2A1WH 5FA4B 1RJZA 1TZHB 5BVJA 4JZOB 1KCVL 5F1NB 3JV0A 4U3XA 4NOBA 1FO0L 2ENYA 5ESVB 1KG0A 4NWTL 4P5MB 2AXFA 4RZCA 1KELH 2HRPL 1BIHA 3HAEA 1ZLVK 2C3XA 5MP6H 4JM2D 4CJ1A 1FP5A 4ZD3L 4KRMB 2HT4D 1NCWH 3GSUA 3FOLA 3WS3A 3CC5B 3FQNB 3F7VA 2EH8L 4JRXD 4KMTH 4NDMB 1XF2B 3N9GH 2AQ2A 2FH8A 4NQSA 3FB6B 1DLHB 2GUOA 1H5BC 2Z93A 2FYYA 3QO1B 5HPMB 4HUVA 5FGBA 4MJ6B 3MO1B 3TNMA 1MOEA 2IFFH 3O8XA 5DHYA 1ACYH 4XNZB 5FOBA 5E24E 2NPLX 5JW5A 4XMKH 5TE6L 3SJVE 3V7AE 4XWOC 3FO1B 3HNTL 3QEHB 1YUHB 4MXQC 3ZKXC 3PP4H 1LD9A 3CMOL 3QFJB 2Z8WC 1CCZA 2WZPD 2JELH 1OTUD 2X4RB 4F9LA 5C7XL 4HKZB 1QR1A 3VXQA 4YHPB 1DJSA 4PBVC 5I17B 1C5CH 4G80A 3D85D 2WINB 1V7NH 5KVGL 1P84J 2BERA 5CJQL 2R0KL 5LQBL 4OLYL 5FO8A 1MIEL 4C58B 5CD3A 4N90E 4TSBL 5IV2A 1X9QA 1I1AB 1RMFL 3RJQB 5GXBB 1CGSH 2FATH 4TNVK 3QHZL 3MLUH 4K8RC 4G6ML 4M43L 2Z31B 4RAUA 5DUPL 1MUJA 3AS1A 4YAQB 3T09A 2FECL 4RWYL 1OM3L 1C7SA 3W0WB 3PWLB 1N8ZB 1IZKA 2DQDL 5SWSD 2CLZB 4UV4L 5EU4A 5FUCC 2CUMA 3AROA 5IVOA 3TA3A 4OD3H 4LU5H 1S7XA 2D7MA 3LN5B 2H3NB 1F58H 2E7BA 3TVMC 5FFLA 2OI9B 1CL7L 1SYSB 3D48R 1IT9L 3LS5H 1H0DA 3T3PE 3PV7A 4PRPE 1YYML 4E41D 2KH2B 1GVIA 1IGTB 1A7OL 5JUEL 3GBLA 1L7TL 3GHBL 4PJXE 1XAUA 1F6LL 1YZZA 1G7PA 4OV5B 4OGAD 4I0PB 5D5MF 3WSQL 4CMHB 3TO2A 2I9LB 1MFCH 1WCBB 1HQ4B 12E8H 4WRLA 1NUGA 1ZS8A 3EYUL 3DMMA 1IC7L 1KFAL 3OAUL 5IIEB 4NQVA 2UY7A 1PLGL 2XI9A 1E28B 1FO0A 1RHHB 3AU1B 1UWGL 4LSQL 4YR6A 3LB6C 4NO3A 4WEUD 4C4KT 1WSST 4PJ8C 5CINH 1L0QA 4G6AD 4BH7B 3TZVB 4PYHA 4X6BB 1UADC 4G6KH 2CGRH 8FABB 2IAMB 3WEXA 5I66A 5B38G 4ZS6C 5I0DA 3K7UA 4JGMA 2PNDA 4LLDB 5B8CB 2P43B 4X99A 1M05B 4NKDB 1BEYH 1HIML 4XBEL 3NZHH 1U6AL 2XQYG 3GUTB 2AJSH 4M7LT 4H8WH 3K1DA 5ESAA 4HH9A 4YDIH 1QEWA 2CDEA 3GM8A 3U1SL 4F8TA 4YWGL 3SKMB 2YKLH 1MLCB 3FQUA 2YUVA 2DIJA 5IKCB 1IKNC 4N8VG 3ZL4H 1WFNA 2PR4H 4ZODA 2HH0L 1P6AB 3DO7A 2V2XB 3VA6A 3WXVH 1YMMB 4QXTB 4ZQKB 1FN4A 5FKPB 5C09D 3CAFA 2F19H 2QQKL 4Z7VB 5CEZH 4ONGH 5HGBA 4Y16D 2V2TB 5JHLH 4CVXA 2CXKA 5CWSB 3OJDA 2AQ3A 2OSLB 4ZG1A 1NGZB 4O5LH 5IQ9B 3OKDB 1I1FA 4LQFL 4RFNC 3T3PF 3IDXH 4HUUB 4JRXE 1IGYA 4PJXF 4QHKI 1O7VA 2NY7H 2QSQA 1AJ7L 1U3HB 1IQDB 4KK9D 3QUXC 1NBYA 1I85A 2BOBA 3KPNB 4PTUB 4ELMB 4D0CB 2WUCL 1IAIM 4UDUA 3T04D 4EBQL 2VISB 3IVKA 3L5IA 3B83A 4KQ4L 1HEZA 4KJPC 1HSAA 2G75B 3WL9B 4Q9QL 2GCYA 1JHLL 3AB0C 1F4WH 5GJSL 3TT1H 2OZ4L 1CICB 4Z9KB 5DJYB 2E5EA 3EFFA 4GG6A 2EDBA 3GSRA 1WVZA 4WO4D 3DWTA 2BOCA 4P3CL 3VXSA 1UGNA 3BPOC 5B39B 4PJFA 1NAKL 2WWMC 3RL2A 2F5AH 4X6FB 2VDPL 5FECA 3RWGB 3PQYB 1YN6B 3BDYH 1KBGL 3QXAA 5CGMA 4XPGH 3C5ZC 3EDEA 3MRHB 4ORZC 1OQOA 3IAQA 3CVIL 4RFOH 1K8DB 2CKBA 4M62H 4JKPL 5HI3D 4MQXD 3VH8B 5DJ8A 5I1LB 1VEOA 5E56A 4AEEA 1JPSL 4QYOB 3QQ9C 5C92A 4DGIL 2XWJA 4J4PD 3RA7L 5HHOB 1U36A 1A5FL 1CLYL 3HRZA 3NCJH 1JNLL 3CSYB 4JEGB 5JR1L 1HOCA 5EWIL 3SEPA 5BVPL 2G5BB 1HH9A 4M6ML 5ITFA 5SWSE 4ZUTB 5EU3A 3FB7B 3IETA 3OF6D 1M7DB 3PXHA 3U83A 5IBUB 3RDTC 4TOYH 4JM2F 3SDYH 4FABL 1JGVL 3RTQA 4POYA 1WISA 1CT8A 5AZEH 1YN7A 2ITDA 4E41E 2G2RA 4HWBH 4JFYA 3QQ4B 4FQ1H 4N8PA 2VITB 3QG7H 4J3WA 2GSGA 2F74B 3D39A 1BFSA 3BQUD 4G9DB 2IFGA 4F7TA 3D3VA 3EYOB 5GS0D 3OHXB 2YD7A 4U6XB 3K4ZA 3L7FA 4BZ1L 3MV8A 4Y4HD 4PG2C 1KCUL 2ZUVA 3CFBA 3ARFA 3O0RH 4UNTA 3JWDC 3VCLB 4CN1A 4Z6AT 1DDHA 1YMHA 3U9PL 4A2LA 2HN7B 2O61A 3F12A 5IVXE 1ZANH 3VFPB 3V0VB 1UB5B 2P4AB 2BVQB 3INUH 2GITB 4ONFH 4L4VA 5GRJH 1DE4B 2OM5A 3H7LA 5L2KD 4UAOC 3I2CH 3MLZH 1GIGH 3DRQB 2R69L 2JIXA 1BVLB 4L4TD 5DMKB 4N0UA 4QRSA 4GKZB 1F90L 2R1YA 3WLWD 4HCRL 4PJ9C 4W6WB 5I1AB 3BAEH 1EK3A 2DRUA 4C56B 5I18H 3C6LC 2P24B 4FQQA 1TNNA 4X7EC 3S34H 4OZGE 3SKOB 1A7PH 1EFQA 1KJ2L 3KPOA 3C5JA 5GHWL 4L5FL 5J1AA 5IMMA 2VDML 1OGAA 4HEME 5A2JH 4CN6A 1W0VB 1OWRM 4B5EA 3LHPH 3UTZA 3KPPA 4PJ5B 2IPKB 2F53D 1IAKB 4Z78B 4AENA 3L95A 2OZ4A 2HJKA 1T6WA 1JE6A 4OLWH 1BAFH 5C09E 3FN9A 3H3PL 4FZ8L 2V5SA 4IOFC 2OR9L 5C2BH 3KPMA 4LARH 5C0AD 2HVKB 1YC7A 2VLJD 2Y72A 4FQIL 4ZYKA 3ET9F 4OFPA 5B4MD 3WJJA 1FNFA 1Z9SA 1GOFA 2FX9H 4OFVA 3MGTA 1X44A 4WUUA 3BUYA 3MODL 4ZO9A 1X5HA 4XNZC 5I1EL 4ZNCD 5IK3A 5J1SC 4LLMB 2CK0H 4IRSA 4WFGD 2V5TA 5SV4A 4WGWB 3NGBB 5L6YL 1T03L 2MQCA 3QQNA 4A6YH 2Y9RT 4HMDA 2HJLA 4CNIB 4JPWH 5GPRA 4P2YA 4OTXL 1I8KA 4WTWA 2VNCA 3LQAH 3BGMA 3RVTD 1TCRB 3V6ZA 1F42A 5IG7A 4F58L 5IVXF 4MDIB 4X5XB 2Z35B 2NZ9C 1L9NA 5D7SL 1X3DA 1GC1L 2HFGH 2HG5B 2WIIA 3LEXA 3SDXF 2ZUQB 5FIEA 1F4XL 3GI8L 5AZ2H 1I1AC 4XPFL 1ORSB 2A6DA 3QNXB 5H8DA 5ABDE 1JUFB 1KEGL 1C5DB 2Y5TA 1JWSB 2B4CL 1U8JB 3F6LA 1XR8B 2HKHH 3D2UD 5E8DL 5D9SA 1YPZA 5ECJE 2Z31C 1OW0A 1DANU 1FNGB 3BH8A 5DI8A 4GQ9H 3VXMA 1RK1A 1ZEAH 1WQVT 2VDQH 1KYOJ 4YC2B 5T5NG 3RWCB 1KNOB 3RWFB 4S2SA 4DTGH 3G04B 1HXMA 4HHAB 5F7EH 5F9AC 4LASL 3QISA 4L8CB 3SJVA 3ULUL 4EN3A 3PL6D 3OJ2C 2OI9C 5AAWA 3UTSD 5ILTH 4XX1E 2HMID 4Y4KB 1DBJL 3O3EA 3V52L 1GL4B 3IDGB 4R90H 3NAAH 1EAPA 2DQHH 2O5YL 3HS0B 3KNBB 2PYEA 5DMYA 3RVVC 4L9LA 2XZCH 5ENWA 3NH7L 1EHAA 4PRNA 4WI4A 1SJEB 4HCRA 4WI5A 4I0PC 2P47B 4JO1L 4LSVL 5E8PA 2D7OA 1JNJA 4CMHC 3RKPA 3DTXA 3BGAA 2FJGA 1T7ZA 4XI5C 4U6VL 3Q5TA 1KJ2A 2H2PC 3F7RA 2F5BH 4JZJA 3HUJB 1WZ1L 3GGWA 2LABA 1F3RB 4Q58C 1H9VA 4FQXA 3SCMA 1LNUB 4MD4B 2VDOH 2H2SD 1YEHL 2FECI 1RUKL 4CW1B 5ESQA 1WITA 5K9KA 1HZHH 3TH4T 3SE4A 3F58H 5I1CL 2IAMC 2Z4QA 1H8SA 5T3XH 3QUZD 2YBRB 4L1HA 4OIIL 1YEEL 3OXRA 3T0EB 4KHXL 1I7RB 1HH6A 1Z6JT 4NCC2 3TCLA 5B8CC 3RVXD 2R0WL 2HFEB 2VO5A 4RFEB 1CG9B 1LMKA 1FGVL 1ETZA 2B1AL 3QG6B 4MDJA 4PJEB 5L2KE 5EU5A 4Y2DA 1S9YA 3IU3A 4LLQB 3NTCH 3I6KA 4L4TE 3MACL 4U6HB 5F9JA 5HXMA 4XAKD 1F2XK 5C70A 3QWOA 4PRPA 2R29L 5E2VH 2EKJA 5F93C 5DURB 3V2AR 3BP7B 3TBYA 1I7ZA 1C8PA 3DYPA 4PFEA 4D94A 1MCJA 3EYFB 4LEOB 5CILL 1NCDH 5DMGD 2A6JA 1JPTL 1FCCA 1HI6A 4XP9L 5DFVD 4N0YH 1Y18A 3QDGA 5FKAB 1RFDL 2C9AA 2QQLL 3L6FA 3BVNA 2O5ZL 3DVIA 1U8LA 4FNLH 4D0BA 2F53E 4WJ5B 2NXZD 3OXSB 2AJ3A 3E8UL 3BZ4B 5E95B 2I26N 4FN0A 5D1QD 4GLRI 2NY5L 3MCKA 2IMMA 5FAAA 1NDGB 4OBRA 3VD5A 2VAAA 1MCSA 2D7TH 3DGCR 5C0AE 2VLJE 3OMZA 3GFUA 5MHSD 1U3HC 4ZFOL 5J8OA 2DYPD 1T7YA 3S37X 3V6OC 1L7IL 5M95B 1KTRL 1WTLA 5FYLH 4LCCA 3DX9A 4ACPA 5C6WH 2AS5M 3AS2A 5GZOC 4WFGE 1FBIL 1HYRC 4BFIB 2JE8A 1T1XA 3QIBA 1NGQH 1WFOA 3GSXB 3EOBA 1U58A 5J13B 5DD5H 1PQZA 1N0LA 1T1YA 1OTSC 1AY1L 3RHWK 4TULH 1CICC 2RJMA 2DTMH 4G8GB 2WM0A 3KJ6L 4HV8A 4YUEL 4KV5E 4LSPH 4A6YB 3HZMB 2W65A 5IF0A 3DGGB 3AVEA 4JB9L 1ZLUH 1GAFL 1EEYA 5MEPA 2HT2D 1KTDB 2HKFL 5DYOB 3DX6A 4JM2A 1DBMH 2MWCA 3T4AA 4W4OC 1IGFL 1LK3L 2HTLC 3GDBA 5LXGL 4HIIA 1AI1H 2YXFA 4WHDA 1MCHA 1RUPH 3ARSA 3CFEB 4YFDB 3TJEL 4HKJB 1CDIA 1QFWM 4ODXB 3Q1SL 1D9KB 4NHUB 1UXWB 3OKKA 1F3DJ 3BZEB 2OJZH 4F7MB 3MGOB 3PGDA 4JN1L 2CIKA 3BEVA 3OGCB 4X6CF 3H9YA 1XGTB 3MBXL 1YEKH 3H7BB 4XNYH 3GIVB 2EIZB 1L0XA 3BP5B 3UTSE 1QFUH 2KUTA 4NNXA 1A6ZA 4P59H 3ZHLA 1JGEB 4HG4K 5FB8B 1IKFL 3ZO0A 5GGRB 1EJOH 5KSUA 2L7JA 1C12B 1W0WB 3K0WA 3O9WA 3NFPA 3MLYL 3FT3B 5DFTA 1JGUH 3ILQC 5JXAL 1Q9OB 4CVZA 5IJKC 4LVHB 5J6HB 4ZUWB 3D85A 1CD1B 1MJ7L 3IXTA 4UV7H 4X8JB 3HMWL 1KCLA 1G9ML 1R0AH 3KHQA 3P4MA 4GO6B 4OCRH 4GXUM 1SEQL 1YNLH 3HAEG 3BZFA 1U93A 1NMAH 4RSVA 5EOCJ 1F3JB 4Q9RH 2Z92A 1ZGLP 1P4IL 1A0QL 1NEZA 3TEUA 3TV3H 1TVBB 1JI2A 3CU1A 4JVPA 1FORH 1H3PH 5E6ZA 5JLZA 5L2JA 3DX7A 1RZFH 2P5WD 1HINL 5IEKA 5IOPB 2XWBB 5AD0A 3EAKA 1FZOA 3CLEL 3EJYD 3GSWB 4OLUL 1XF1A 1HYSD 3PUCA 4FQHA 4EVNB 1AE6L 5ICZB 2NZIA 3M17B 5SWSA 4PG9A 4JY6A 4ZFOA 4BUHA 4G7YH 1FVCB 2HLAB 2BSSA 1C5BL 5KG9B 1F3DH 1ONQA 4IDJH 1EBPA 2X4UB 5FYJL 5GGUB 3TNNA 1XGRA 4XNMA 4XAKE 1CZ8H 5DD3L 1FFNA 4E41A 1JGLL 3FHAA 3QDMA 3RVWC 3O6FA 3UAJC 3V5HB 4JHWH 4Y1AB 4Y88A 4FTVD 1MWAL 4L3CB 3A0OA 1W8NA 2R23A 3B9KB 1RJYB 4KROB 1KLFA 1FL6B 4XVSL 4ZUVB 4JDVB 2NY1D 3HCVB 4FFZH 6FABH 3WUZA 1BHGA 5E8OA 4K3JH 3MUJA 3NCBB 1V5JA 3QCUH 4NKMA 4QOKB 4LHUD 3EGSA 3NPZB 1KJ3H 1FJ1B 2BP3A 4G42A 3KR3L 1S9WB 4M61B 3GMOB 4JG0H 1BVZA 3M8OL 3ARTA 3MRQA 4X7TB 5EOCH 3EJJX 4JE4B 1FE8H 5MHSE 2Q8AH 4M1GL 3EFDH 4CU7A 5D7IB 3R8BB 5JXED 3HE7D 1LHZA 3F7YB 4UOW0 1G7IA 3WDJA 2FBJH 3ARED 4CDGC 4ZO8A 3O3AA 3QUKA 5GGTL 4JFZL 5TDNB 1AFVH 4I9WD 2AABL 2GQHA 1JMZA 2R15A 1I8MB 4GH7B 4JFDB 4PRHD 3ZE1F 5IFHH 4OZGA 4DKEL 1WEJL 4LEXH 4N9OB 2OYPA 2A0LD 4ZOEA 2BCKB 1D3CA 2ZUQC 4OKDA 1FIGH 3AM8A 5I8EB 5GS0L 1AIFB 2KL6A 3GHEL 3LRSA 2H41A 3TLRA 4ISVB 3A6CL 1B4JL 1NGWB 1OAXH 5MERA 5IM7B 4BZ2H 2WSKA 3Q6FA 4HGMA 5C09A 1EIBA 1KB9K 4HIJA 1RSFA 4YFLF 5SWQA 4Y16A 4ZSOB 2I60H 3L3OB 1UA6H 3MOQA 4OF0A 4YC2C 3QUYB 1CGUA 1HHHA 1CLOH 5T1KB 1XCTB 2X1WL 5H2BA 3MUY1 3MREA 1R3HA 4NUGL 2JB5H 2ZCLH 3B3IB 1YY8A 5E9DB 5GRWA 1PFCA 3PHSA 4Y4KC 5C07A 1VFAB 3MYJA 4X5WB 3D0VB 3S36X 4HW6A 3MLVH 3RBGA 1IM3B 4Z5RB 5DJ2A 3B5HA 4JJ5B 4X6EA 2D7NA 2CRZA 2LU4A 5IB1A 3C2AL 3VGHA 2FJFB 3GIZH 1RVFL 4CN4A 5J6GA 4PB9L 1N5AB 1JHKH 1QLFB 5AYUL 2PXYC 3VWJD 5DMIH 2XG4A 1QACA 2BNRA 2IQAA 4KH2A 1U92A 3OR6A 3HC4L 4U1LB 4LPUA 3QR2A 3BWAB 2OTUA 4QLRA 3SDCD 3T0WA 3SQBA 3VWKB 3TYFA 32C2B 3TPUB 4WI6A 3DRTA 5JO5B 1K4DB 4O00A 2DQJH 4YQXL 3N50A 2WQRA 3N1MC 2HWZL 4J1UA 4LLWA 1TZIA 1KCKA 4LNRA 1F4YH 3H3KA 3CX2A 3ROLA 3T1FB 5LGHL 3HNVL 1MWAA 1KLUA 5HDQL 1RZKL 2FX8H 3QDJB 1Q9WA 4YEEA 2OQJB 5DJCA 3OL2A 4G9FB 5IHZB 1UXSA 3T0EC 3GJFA 2BNUB 2P5EB 2GTWA 3P9MB 3HB3D 2JJSC 3QUMA 4N9GB 3J8F7 1XF4A 2P5WE 3LH2H 4J4PA 1P4BH 1X5KA 4OAWB 4KAQL 2Y7QB 4WW1B 4GAYB 1RIVL 1S8DA 3QQ3B 4NYLA 5F3BA 4DVRL 1DP0A 4MB4A 4AQOA 4S1DD 4HXBL 5DJZB 2VAJA 3QNYA 4Z18A 4XMPL 5EPMB 5F70A 4J8RA 2YPVL 5GGTA 2H8PA 3LSOA 1DBKL 4WU7B 3H0TA 2CMRH 5I8KL 3VXOA 1FNSH 5DEFB 4BM7A 3V95A 4AIZA 1MLBA 5I1KL 2IH1A 1OSPH 2PTTA 3I02A 4FTVE 1M6OB 1MQ8A 5TQ0H 3WKMH 3QFDA 4E5XB 3GSNL 4IOIB 4NCC1 5FK9B 1D5BB 2EDRA 3CLFH 4Y4HA 4XPBH 3QAZB 1RIHH 4GW1A 3W39A 4I48A 2UVEA 2JB6A 1D5ZA 2CH8A 3MXWH 2C3VB 5GIRB 2IQ9L 4GKSB 5BXFB 4NT6B 4OLZL 1VGKA 3LKNA 1QD0A 1ZHBB 2ID5A 3M07A 4C83A 2DLFL 1I3GH 4B50A 3VFWB 4YJZL 2DQEL 4JFHD 3QPXL 1CR9L 3VXPA 3OKEB 4KXZI 5L2KA 2VXSL 4LVNC