4IRJD

Structure of the mouse cd1d-4clphc-alpha-galcer-inkt tcr complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Enhanced TCR footprint by a novel glycolipid increases NKT-dependent tumor protection.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 63
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irjD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irjD02
3HAEB 2DWDB 5JHLH 4KKNA 1WICA 3UTPD 2HTKC 2APXA 3CFJB 3E0GA 5MERA 2OM5A 3PWUA 3QPXH 5LQBL 4JGMA 4JY4B 4F7PA 5BO1H 1ZXQA 3NFSL 1IGML 5D1XB 2YD7A 3OAYH 5DYOA 3ULVC 4OD2B 5EBWB 1FGNL 3K1DA 4ZUTA 3H9HB 5T3ZD 3V4PL 4HKXB 5E94B 1V7NL 2FIRT 4NYLB 2CMRL 3TCLA 1T89A 3F7RA 2AEPL 4G3YH 3X3FH 5JMOC 1PY4A 5E99L 3MZGB 4Q9QH 4P0DA 5HHNB 3PQYE 1HXMB 3L3KB 3DV4B 3ZE1F 3WNPA 5FK9A 1XGRB 4POYA 4IMKA 4I3GA 1S7QB 2ENYA 4QRTB 2NY3D 1BJ1H 2DL9A 3MRKA 1EJ6A 3ROLB 3L7FA 3E6HB 1P7QD 5BVPL 4KPHL 2IPKB 1FNLA 1KFAL 2BSSA 4NKIH 2EXWD 4KDTA 4MJID 4AL8H 5FB8B 3FOMA 4WGWB 5L2JB 1E4KA 2NLJA 4HD9A 2I9TA 3T2QA 3U36A 3V7AG 3L95B 3X3GH 1NFIB 1YYMH 3CC5A 3MLZH 3IFOA 1OHQA 2J4WL 4HWEL 3NH7L 5DJAB 1NCWH 3ARBC 5EU3A 4HIJB 4Q9CA 1LE5A 4DVRL 3EYSH 3JTSB 3H3KA 5JQHC 4JDZA 5D7IE 2VLKD 3K74B 4G42A 3U0WL 5HTSA 1U93A 1F6FB 2VXQL 3VA2C 1JHLH 3TO4B 1ETZB 2P42B 1QLEH 1Q72H 1P9MA 4C4KO 5CHNB 2H2PD 2K1MA 3FZUD 4XCYA 4OTXH 4JFFA 5KVFL 4D9RD 2HKFH 2P5WB 1FL6B 3S34H 5HHPA 2DAVA 3PDOA 3WXWH 1QSEA 3RVXC 5JUEL 5HI5C 1BMGA 4Q9RL 3MRHB 5IT2L 2N4IA 2XZCH 2ZOLB 1C5CL 3IFPA 4MVBD 3OL2A 4ZFOB 2G60L 1KJ3H 5F7NC 2DQEL 4FXGB 5GZNC 2NXYB 3LH2H 1J87A 5LG1A 4PJXE 4X6DB 3ZYIA 3L3IA 3L3GB 3LEYH 2ERJB 3IDGB 5GSVA 4YFLF 4A2MA 4PJAB 4O2CB 4QXUH 5SWZD 4YAQB 3VXSE 5KAQG 5IB2B 3C6LB 3GBNL 1ZLVH 4U7KA 1TMCB 5CGMA 2CIIA 3LB6D 4WFGE 5ID1A 4GS7B 5C86A 2UVEA 43CAB 1DBAH 2HRLA 1OT2A 3SDDA 2FWOA 4J3SA 5EZLA 2M8XA 4CNIA 3U46A 2JB6B 5EU7C 3GMPB 2EDNA 1IC5H 1QACA 5C2BH 5IB4B 2VR4A 1T7VA 1A4JB 1OSZB 1YPZA 4Z7UA 5EC2B 4Y16A 2ZUWA 2VABB 4Y8AA 4NNPH 4U1JA 1F58L 2FCBA 2E7LC 3MV9E 4Z7WF 3FL7A 5C07A 5F7UA 1R3IL 5J13B 4JFPB 1W2KT 5IGXH 1NGPL 4AEHH 1CG9A 1QP1A 3HAEG 4LRNL 1L0YA 3QHFH 2G2RA 3CVHA 4G9FD 4XP5H 1NUNB 4ZYKB 4PJ9D 5IQ9A 3TBYB 1LEGB 1YY9C 4HWBL 5BXFA 2FO4A 5J1AB 1C5DA 2RCSL 2Q76B 4MD0B 1X7QB 3CDGA 3MRCA 4YJZL 4EN3D 2HT2C 5DQ9A 4XVTL 1ZV5A 5HHVH 3SOBL 1VEMA 3HI5L 5D7JB 1NL0L 2F53D 4F3FA 2HH0H 2A74B 5H94B 3IDJB 2M1KA 4OIIL 4P2RA 3NAAL 3HZKA 4X4YA 3CFCH 1EFQA 1ZHKA 3C9NA 3O9WB 4HJJH 5HY9B 3G6JA 1D6VH 4BFIA 4CMMB 4DVBA 1CS6A 4XBGA 2GUOA 5I1HH 1EEYB 2WANA 4PGDA 2GCYA 3O11A 3GIVA 2VZUA 3EYOA 3RQ3A 4TSBH 2OCFD 3L3DA 2A0LD 1UQSA 2VUYA 4NO0D 4KTEH 2DLHA 2VLLA 5ANMA 1P4LA 5B39B 5JR1H 3G6JF 3M07A 2XG5A 1L9MA 5L0QC 3CDCA 3DVNA 3CVHH 5F1NA 4IS6B 3EUUA 3VH8B 1N5AB 4KUCD 1JYXA 2XZAL 4O5LL 2P7TA 4HKJA 2OJZL 4LVNC 1CGTA 4APQD 1EXUA 4K3DH 3SE9L 1QFUH 4XPGH 4G8EB 4WW2A 4P2OC 1ZVHA 1Y18A 5C08E 5ERWB 3T2NL 3GMMB 3KPQA 3SKUD 1OGTB 5CZXD 4K7FB 4OZGE 1A6WL 2IPUK 4WWID 2WWKO 3VRJB 2F8VA 4PJXB 3ZLQC 2R69L 1QHOA 1F02I 1J0IA 4RBPH 4PY8I 4J4PC 4P3CH 1TVHA 1FVDB 3BEWA 3BPCA 5CD3B 5IEKA 4YH6A 3VWKD 3WE6A 2X4PB 5INDB 1QBLH 1PG7W 3PV6A 4WRLA 4F7MA 1GYAA 5FGBA 3RU8H 2Z8WC 2OMBA 2XV6B 2BSTA 3KNBA 4Z9KB 5K9QI 4K3GA 1D6EA 3GNML 5J0BA 3RZWA 1WZLA 5TJWK 1XF3B 2OL3B 3OZ9L 4RBPK 2R2EA 1OAZH 3QB7C 4FFZH 3VXRD 4B0MM 4GKNA 4L8DB 3I6KA 1CCZA 1NCBL 4QT5B 3QUZB 1LP9A 3G6DL 4HIEA 2BMKA 5DEGA 1IM9B 2DKSA 1BGXH 4MNHA 2Z35A 1EEZB 2F19H 5DC4B 4PGEB 3GM0A 4ERSH 5I8EB 3RTQC 1MCIA 2HFEA 1FNAA 1K2DB 3KPPA 1XR8A 4CVXB 1HHHB 4DZBA 3L5XH 4QTHA 1J1OH 1GIGH 4QXWA 4ZUWB 5HHME 1R5IA 4I2XB 1I1AC 1D9KC 5EO9A 5FF6B 5T3XH 1OY3B 5I6XB 1P2CB 2IAMA 3PWNB 3HHRB 3I3BA 3QEHB 1N7MH 5KSAC 3MJ8B 5T33H 1B2WL 1DBJL 4DW2H 3QRGH 1JF6A 4Y5VB 1A3RH 3DVFA 3SDAD 2GK0A 4KJQC 2BXZA 1A9EB 1VKXB 1U8OA 2BJMH 3BH8B 5E2WH 3NFNA 4JHZA 1BBDL 32C2A 1JHKL 3MGAA 4QTIL 5JLZB 5J6HA 4LMQE 4ODHL 1FL5B 1CDCA 1GGUA 2BNRD 4KRNA 2YS4A 4Y7MA 4G43B 5CJOH 3SPVB 3G08B 3GSNA 1BIIA 2OYPA 5C0AE 1IGCL 1OARL 3IXAB 4RMWA 3CLFL 4WU7A 3VXUA 3QEQD 1OP5H 1K4DA 1YEGH 5JW4R 5DD0H 5CSGA 5JO5A 3SY0B 4OQTA 4P4KC 2MPAL 4XMLL 2R23A 2MSPA 1B6UA 2EDKA 1N6QH 2XY1A 4OZGB 3ILQC 3QQ9C 1G84A 5DS8A 5BQ7B 1YEHL 5FCUH 1L7TH 4PFEA 1RUML 2QQKL 1NMCB 4ESKA 1I7TB 5B39G 3IDNB 2WAHA 5AG8A 4XNUL 2V7HA 1MCPL 1A7PH 4ZFOL 3MV8E 25C8H 2E9WA 4U3XA 1TCRB 4RFEB 1U92A 3KLHC 4KY1H 5ESVB 1E4XH 2HLAB 4KMTL 1I1CA 3OF6D 5EC1B 3VH8G 1NDGA 4L29B 3QQ4B 2KKQA 4KGJA 5IWLC 5C1MB 4OCYH 4N0UB 5CEZD 4IRZL 4LSUL 1CE6B 3O6KH 1Q9OB 3JWOH 3OKMA 5JPMB 3GSNH 2CR3A 3VFPA 2FATH 3FN0H 3DTXA 4YK4C 1CDYA 3D39A 2OI9B 4OQTH 1OL0A 4Y19D 4KZDH 1B88A 2SEBB 2YSSA 5T1LB 3DX9B 4WDIA 4KVNL 4ZO6A 3BO8B 2YKLH 5JPNB 1BX2A 3JV6A 2ADIB 2WBWB 2XYCA 2CDGB 3Q1SL 4X6BA 5FDYA 1IM3A 2E7CA 5JOPE 3TIEB 5HHXH 2F9BT 5HHMB 3TPKA 2DQDH 1E4WL 4NSKB 5DDHB 2VLRD 3U30C 3H9SB 5J9PB 1JF1A 4WW1A 5FO9B 5D6DC 5IHUH 1ZT7A 5FYJU 1CLOH 4EUPB 1LO0L 3LS4H 1I4FB 2OK0L 5JW4M 2X7LA 3QA3B 3G5ZB 4YDVB 5E08H 3IRZA 3WNMA 3LEXB 1NPUA 3AAZB 3FQWA 3VXNA 4RMVA 1NSNH 3SGJC 4MB5A 4YPJA 4TSCL 3RX7A 1X5AA 5J12B 4XXDB 3SDDD 4MXQD 2H3NA 3O2DA 1K8DA 1J0KA 3OXSA 1GHFL 2Y25A 5MEOB 5HGHB 2XWJA 4X7TA 1HSBB 1KTLA 3BWAA 3K4DA 3MCG1 2QQNH 2A1WH 4PLKC 2D03H 3MA9H 5FV1L 1N0XH 3WS3A 2YEZA 4HPOL 3VU2A 4JRXE 4MQXC 4ZSOE 5FUOL 2W1NA 3TIDA 5I0DA 4YXLH 4H88H 4OJFH 3WIIH 4OGYH 4BKLA 4HC1A 3AC0A 3BJLA 3KPSE 4GW5B 4UMGA 3IETB 5CJBA 4TN9A 5C07D 3VI4E 1KBGH 2VSDA 1G6RB 1HEZB 4KJYA 5IROA 5E2VH 3HKFA 4L4TE 4NC2B 4QRRA 5I1EH 1MHHA 1T20B 4YBLC 4HS6A 4B50A 3R06B 4RISH 1OAUH 1N8ZA 3WUWA 3T0EA 3HNSH 2JTDA 4HH9B 1MCWM 5AUMA 1ZLSL 2QSVA 4FQLH 4PLOB 3D18B 3T04D 1A1MB 4ORGB 2XT1B 5JDSB 1JMZA 4P2RD 3UTPE 4N8CH 4MA3A 3EO1B 1IC7H 4M8QA 3BYYA 1MRCL 1NCDH 1P7HL 3IJHA 3IAGC 1YNLL 3O2DH 1GGIL 1DQLH 5FXCH 2AXGA 5DK2A 4H25B 4X9GA 5I19H 5DJDB 3RWHB 1S7RB 4RAVB 4MNGA 4OV5B 5T3ZE 2BK8A 4L1HA 1AO7A 4JRYD 5IJKC 3VFTA 1JPFB 1AR1C 3MXVL 5FYKH 5HGBB 3H42H 2J8UB 4NO5B 1RULH 1QSFB 4BZ1L 2CDFB 4HC1H 2OL3L 3EZJB 2VR9A 3VXMB 3X13B 4HSQA 4BH8B 3HC4H 1MJ7L 3WS6C 3FQUA 5JNYB 5HI3D 1MCFA 3MNVB 1GOGA 4HG4K 5TFSL 3MR9B 3QWOB 3HCVB 3S5LA 4DGVH 3EDKA 3MFFA 5IR1A 3WIHL 1JI1A 2J8OA 1W0YT 1YJDL 3VWJC 4MJIE 5D9SB 1ZS8A 4FFWD 1U8KA 4BK4A 2OTPA 5SX5H 4R4NC 1SYSA 1W0WB 3U7AA 3MRRB 4AEIL 1A1NB 4HDIA 2FRGP 2W0FB 1QZ1A 1RJYA 2BVPB 5T3XD 2VLKE 2BXYA 3BW9B 3U4EB 3CUPB 1HHGB 1K6QH 2HMIC 5KTEL 4RFNC 1LE9A 5EIQA 3OKOB 1TQCC 1T80A 1WZMA 2E7MA 5FUCC 3HZMA 1X5YA 4YEFA 3OAZH 4F58H 1H8NA 3OKKA 1FFQA 1T83C 5TPWH 4DKEH 1KEGH 1FE8H 2NCMA 5TQ2L 4D9RE 4EUPG 5JHDB 4BUHA 4O02H 1BQUA 2IALB 2ESVA 4H8WH 4NQDB 3EHBC 1UJ3B 2B8OT 3RWJB 3VXPB 1RY7B 1KOAA 4MMZC 12E8H 3UJIH 5DJ6A 3C5JB 5JZ7D 4X4ZA 1U8IA 1T1YB 1RUKL 5DR5L 1WC7A 5E00B 3PWJA 2R8SL 5F1KC 2D7NA 1ADQL 1FIGH 3UYRH 4PJDE 3AS0A 3ZHKA 4UQ2A 2PYEB 1A5FL 1G7IB 3QO1A 5E95B 1JNJA 4RIRB 5C09A 3DRTA 5SWZE 4HS8L 3R1GH 3BKML 1DQTA 5HI4D 2H32A 2BVTA 3FO1A 2IQAB 4HCRA 2CKBB 2AK1L 1JNHA 5I18L 1CZ8L 2IAMD 1Q9WA 1BM3H 1S3KL 3AUVA 3QNZA 4GAJH 5CJQH 5D8JH 4R90L 5C92A 5IVXA 3ILPB 3W9DA 3F8UB 3MUGA 4PJFF 1KB9K 1YC7A 3P30L 1NEZA 2ORBL 1VFMA 4JM4L 4ZPVA 3WL9B 5DUBA 1A14H 3GSOA 4JFOB 4F57L 4IOFD 2OMNA 3RWCA 4JPVL 1N64L 1JGEB 2EDJA 2D4DA 5T5NG 3ZHDA 4F7EA 3TNMB 5IVXF 3KDMA 5AYUH 4PLJC 4HKZB 2DKUA 4Z7OE 3MBEA 4XNMA 5MI0B 2EO1A 4ELKB 2ICWJ 1SJEB 1CFSA 4G9FE 2NY3B 4PJCF 5DWUH 2X4NB 3ZE2F 3WFZA 5BV7C 2O61B 2N7BA 1II4E 3BH9B 3VXUD 4AG4H 2YD5A 4PRPD 4KUZL 4FQIH 3ZZ1A 1AXTH 4JZJA 4OFVA 1YEEH 3RY4A 4M7KL 4XCCL 4F9LC 1P5UA 1UM5L 2B1HH 3AFLA 4HGWB 4LCUA 3ZTNH 1EAPB 4EIGB 4YHPA 2ZJSH 4LHJB 2H32H 4X0KA 1P1ZB 2PO6B 4NPYA 4HCRH 2F53E 2GSGA 1IEBB 2VKWA 4PG9B 3T3MF 4NHCL 1XCQA 4Q7DA 1CXFA 2BFVL 3JWDL 3ULSB 2J6EA 3CH1A 3L3JB 3S9DB 3CSYB 4Q2ZA 3I9GH 4HEME 3NOIA 4S1DD 4JPIB 2QKIA 4PJGB 2AJVL 1A4KA 3TP4A 5HVWA 3L5HA 3FQTA 1YEDA 1TJGL 1Q1JL 3DRQA 5C0ND 4YQXL 2DJUA 3LPGA 4JKPL 3LQZB 4Y5XB 3TO4C 1AI1H 1EGJA 1MI5D 2RHEA 4JFYB 3ALPA 3NMEA 3RWGA 4WO4B 4X6CE 1BZ9A 5D5ME 4X9IA 3RX8A 5DVLA 4PLNC 3D39D 5C0GA 3R8BB 2R0LL 4L9LB 3O41A 3O3BB 3WIFB 4HBCL 5DJCA 3UTQB 4HJGB 2IG2H 1HQ4A 4LU5L 3ZDYF 5DQJB 5HYQA 2X41A 5EBLB 5CSZB 3QFJD 5ALBH 2PTUA 1G6RL 4GG6F 4P2QB 5HYJA 5I1CH 2A9ML 1CK0H 1WLHA 2Z8SA 5FUZH 3HS0A 4PG2C 2J6EH 4XH2A 3NPZB 3OKEB 5L9DH 1A7RH 2BSED 4MGXA 1LO3H 4ELMB 2KQNA 1QD0A 2VZTA 3P9WB 2CGRL 1JZ8A 2NXYC 3VXOB 2OTUA 4KKCC 2ERJC 2IPTL 3RY6C 2CUMA 4JFDB 1FLTX 5EU6A 1AY1H 4ZAKA 3C6LC 5JMRA 1PD6A 5F70A 1YNKL 1VADB 1I8LC 1INQB 4XI5C 3SJVD 4N5ED 1GPOH 1QFOA 3OJVC 1IGIL 5AZEH 2AGJH 4G8GA 4OZHF 1CR9H 3C5ZA 3U79A 1ZVYA 1S9XB 1I3UA 4NN7B 4YGAB 1DL7H 1EGJH 3ARDB 1E0OB 1UB6A 1R3KB 1QRNB 1T7XA 1H9VA 4JHWL 2LTQB 4LSTL 3HRPA 1NMAL 4F7TA 2F5BL 3VXRE 2GAZA 3FOLB 3D48R 2CD0A 3DV6B 3DUHA 3L7EA 1KPVB 4KK8C 4X6EB 4QGYA 2W9LA 4L3CA 4XP4L 1XR9A 1ZT4B 1GVIA 3OG6B 4KROD 5CINL 2YPKA 1RZIA 3MLUH 2ZCHH 4M6MH 7CGTA 4QOKB 3V0AC 2UWEA 3TWCL 4GRWB 1I7ZA 4RFOL 5JORB 5FYKD 1CGVA 2AAVA 5FHBH 4EN3B 3FQRB 4NJAH 4U1HB 2APVA 4KFZC 4Y88A 4G8IB 1Z3GL 2NY0D 1XGUB 5D1QA 4OLEA 3GIZH 4LAQH 1NFDE 2CLZA 2ZCKL 4R0LB 4PJ7A 4QRRD 3ARRA 2QQQA 3PABA 4P5MB 4U6XB 1HH9B 4JLRB 3EO9L 1RSFA 5ACLA 1WAAF 2ZUVA 4HUXB 4FQQB 1XIWD 5GGSA 4KJWD 1QTYT 4HV8B 5DD1L 4OAWB 4FHBD 1T03H 4NKMB 2Y06H 3X12B 3FB8B 5HPMA 1OM3L 1IKFH 2CIKB 3HC0A 1UVQB 1G9MH 3FB6B 4UINH 5HVHB 4BQ8A 3ZE1E 3F7PC 4TRPL 3ZYOA 2BNRE 3QUXB 1AO7D 4X6CB 2XWTA 4QNPE 4XP1H 4P57A 3MRGA 2EH7L 4Q0XL 1G7MA 5D7SH 1OTSC 3QEQE 4HUMB 4HFWA 4ZOCA 4NKDA 4YHLL 5IW6A 1RIUH 4R4BA 1JFQH 3UPAA 1DE4B 1UCTA 2A6DB 1RIHL 3WJJA 3KPRA 2BRRL 2EE9A 4PREB 2Q20A 1FAKT 3OKLB 4U2ZA 2IQ9H 3DX8B 1KJ2B 4UT7H 3NFPA 1TZGL 2HFTA 2GY5A 1U3HC 1AFVL 5ID0A 5DMYA 4N9GA 3QXDB 4JY5H 1T1ZB 4ODWA 1I7RA 1CE1L 4UILH 4GXVH 4LBEA 3GMNA 2DI8A 5SWSA 1KUMA 2ITCA 3QO0B 1MJJB 3HE7D 4XCEA 3RPIA 3B2UC 1HWHB 4FABH 1MLCB 5GZOD 3FMGH 1JNNH 1FQ9C 1Y0LA 2X4SB 3CXDL 4N0CC 1OF2B 5DFVC 3TZVA 5IB3A 2GITB 1WWBX 3QCTL 2KUTA 2Z92A 3MRFA 4IRSA 5EG6C 1PKQB 1NCCL 2XXCB 1I9EA 2CKBL 2CDEB 3RWFA 3DHMA 1CI5A 2WIIB 3FN9A 4JQIL 2D7MA 3S36L 3WFDH 5CEZE 4NDMA 2EDBA 1VFBB 1XGYH 2DQHL 4Y2DA 3VMPA 5JA9A 1MEXL 3IDXL 3T4AA 2WINB 1TQBC 2R4RL 3WLBA 4MDJA 1TTFA 4Y19E 3ALXA 1MCOH 4X5WA 4FXKB 5EWIH 3CLEL 3FTGA 4NQSB 4ZTOL 2DBJA 5GRXG 1JPST 1F6AA 1R3JB 4HF5L 5ICYA 3LD8B 4KKAC 4HHAA 2R2HB 3QUZC 1TJHH 4IMLB 1KN4L 2YK1L 3DXAA 1WZ1L 1U8MB 4OGXH 1NFDB 4M7LH 1C7TA 4NZTL 4KRPD 4M1DH 5M7QA 4LSDA 1A7NL 1YJDC 2VLRE 1Q0XH 1KCUH 2A73B 5IK3A 4HKBB 4KKLD 4ETQA 5FOBB 4M00A 4E5XB 5TGBA 5CD5C 3ZDXF 3GJEA 3FONB 1CBVL 1EIBA 4CDHA 3ULVF 3L5WB 3M17A 1G7JB 2X1WL 3D3VB 3QG6A 3UBXI 5I6XC 4LCWA 1HOCB 1T6WA 2WSKA 3S4SA 1A47A 1CU4H 1EVTC 4Q6IA 3SDAB 5MEQA 3BDYH 3GI9H 3ZSTA 3MCKB 4D9QD 4PUBL 1KCSL 2D7QA 1M7XA 3ARTA 4OZ4A 3EYQC 4JGUA 5HHQB 2OR9L 1W8OA 4GW1B 4Z7WE 5HD8D 2MQ0A 4I0KA 3M8OH 3VXQB 1MFCH 1Z9LA 3MRMB 2BNRB 3HNTL 2MNUA 1J10A 3SQBA 2E7BA 4KVCH 4LVHC 3PNWA 4P59L 4ALAL 1YPZE 4Z7UE 4ETYA 4WVRA 4ZO9A 1A64A 3RGHA 2LV4A 4ZFZB 1QG3A 1G0DA 3NCFB 3ARBA 3ULVH 2CLRB 3L6FB 3LZFH 4BFGA 4TPRL 5EUOF 3VFVA 1A3LH 1H3PL 5C07E 5B38A 5DHYB 15C8H 3HC3H 5DSCB 3WKML 1N6VA 2XKSA 4NM8H 1A22B 1A2YA 3JWNC 5FA3A 3HRZB 1JGDA 4PTUA 1JVKA 1EK3A 1KPUA 1E27B 5EZJB 2R56L 5KANG 4O51A 3U9PH 5KSVA 4MAUL 1XF5A 4TSAL 4PRNB 5CEXB 4ODXA 1NMCC 5AD0B 4WEBL 4IOIA 4OD1L 5AAWA 4P2RE 2VITA 5CMAA 2I60L 1SJHB 3EJJX 4G9DA 4QRSA 1YUHB 3IDYB 3G6JE 2GJZB 4PJIF 5L8KB 1FGVH 4IHOA 4LNRA 5I66B 2H9GB 4KK9C 4AZ8A 3UTZB 4MXVF 3EZ8A 1AKJA 3MCLL 3F7YB 1WVZA 3QCUL 4XBPB 5DRNA 5DD5L 4JRYE 2R9HC 1C16A 3LKRB 3ZKQD 1J9CT 3FB5B 1T2XA 3BZFB 2R2CA 3IVKA 4NZDA 1MNUH 1DQQA 5GGRY 4R7NB 2X1QA 5DJXB 1N3NA 4AIZB 4JFED 5I1LA 4Y4HB 2OI9C 2XN9A 1CD8A 5GRYA 4G6KH 1MFBL 1D5MA 2WLZA 5IMKB 3DMMC 3OQ3B 1I1FA 4OLUH 1D5BB 2AXHA 3WFCL 2VLRB 1BFTA 3F5WA 1R3HA 4U6VH 3IU4H 4W81A 3OHXB 5DD3H 3P0VH 1QLFB 1UZ8A 1G7LB 3GSWA 4CW1A 2E7LA 1NDMB 3BSZL 5HYJD 4MHHI 2XA3A 3JWDC 5TDOB 1L6XA 3HG1D 1RJLA 2XG4A 3VFRB 4W68A 2P24B 4PRBB 4O2EA 3UAJC 2VL5B 1CFVH 2VLMD 1FNSL 2BHYA 4RDQF 2Y7QB 5IM7B 3H0TB 1FG2B 2OSLA 4LQ1A 1AIFA 1DQJA 2VJXA 2X4RA 3SN6N 5T3XE 2AEQL 1G7HB 3A6CH 1J1PH 5IF0A 4NQED 1O7SA 2F74A 2ATPB 5L6YL 1QQDA 1RZ8A 4X7SL 5IVZB 4JY6B 5F9WB 2HFFA 3UXFA 3PXJA 3MLXL 2IEPA 2QJDA 5AG9A 1YEFH 3QEUB 1S7UB 1IMHC 3AXLB 5JQ6L 1F3DH 4G8GD 3C5ZD 3QUKB 4UTBH 5J12C 3D9AH 4JR9H 3U48A 2FZ3A 1PG7H 1UT9A 4HK0B 1G0YR 2NY2D 4OCXH 2OLDA 2EKSB 4R9HA 1MAJA 1I8KB 1CIDA 4M5ZH 4JN1L 5K9KB 4LSVH 2W9DH 2EDXA 3K2MC 4WGVB 3JV4B 1KJMA 1X5IA 4JJ5A 3L9RA 5C0BB 4JG1H 1B0GA 2PXYB 1RK0B 4OLWH 5DLML 2VISB 3QNXA 4PRAB 2W65B 2HN7B 3IU3B 5DI8B 2QSCH 3W5NA 3UROR 3GDBA 1KJ2L 4HG4J 1NEUA 1WQVT 2EIZB 4NUJB 1DEEB 2UZIH 5DRXA 5D1QD 1K4CA 3U7WH 5LXGH 1JUFA 1KCVH 1H5BB 3BGMB 3BT2H 5DJ2A 3KHQA 4NJ9H 3MGOA 1FHGA 4XNQA 2BOCA 2X4TA 4OT1H 5GJTH 3SGEH 1NLDH 3RVVD 2L7JA 2VZ3A 3OKYA 4N90D 3QH3B 4OLVL 1ZGLB 3TT1L 5D7LD 3T1WA 3UTSA 4ZOEA 1ZT1A 5HHOD 1I1YA 4J4PA 1EVUA 2UVFA 4WI3A 4UIMB 4BQ6A 4LRIC 2G75B 1T04B 3LN4B 3DYMA 5HGDB 5K9OB 4W6WB 5EO0A 2CJUL 2YD3A 4I13B 3T0BA 4JG0L 2V5MA 1G7PA 4MQSB 5C70A 4X8JB 2O5XH 1JRHH 2Y07H 4N0RA 5DD6B 5E8OB 1NGWA 5E6ID 3VXUE 1KC5H 4ZUSA 3PWVB 4PRPE 1PY9A 2HVKB 2ZPKL 4K94L 5D1ZC 3RDTA 5IB5B 3TT3H 4P3DA 3KPRD 2DQTH 4M1CC 5CBEB 5FFLA 5I1IH 1U58B 2H2SD 5ICXB 3TJHD 5F9OL 2WQRA 5JIPA 4ZXBC 3IDUA 1CIUA 5ADPH 3QG7L 1B4JL 3MOAH 5I71B 1T4KB 2P44B 3BESR 4OFKA 3RTQA 4L3EB 1BVKA 4N0FB 2FX9L 4YUEH 4M6OL 4ODSH 1X5FA 1IFHH 3NPSB 1FFOB 4OLZL 2NW2B 1JYWA 4FQHA 1I1AA 1D9KA 1E6OH 3ZYZA 5AYQA 1MI5E 3DUSB 3NZHL 5IKCB 4U1MA 4WU5B 4C56B 1ROWA 2UUDH 5DMKA 2R29H 1AHWB 3D39E 3D25A 1A8JH 1U8PA 3IT8D 3TN0B 1WBZA 2WBJC 3F58H 1HHJB 1J88A 3E8UL 5EU5B 1P4BH 3QFJE 1ZTXL 3S3JA 1UJ3C 4Z77A 5EPMB 3DXAD 3ULVD 4ZO7A 1U91B 4UV7H 2DLEA 2VDKH 3G04A 4D0DA 4MMXC 5TE7H 5I8OH 2C4XA 2BNQA 3DX7B 1FVCB 2IPUG 3TLRA 5FO8B 1BD2B 4LLYB 5KVGL 2Q6WB 3BEVA 1LO4L 2IBZY 4P4KA 4PR5B 4BYHA 4RX4A 2AEWA 1T5XB 5GS0D 3QZWB 3SJVE 4LCWD 3DO7B 4G6JH 1RVFL 3EAKA 3VDAA 4FP8L 2FECL 4KK6C 2C26A 5I16A 3O4OB 5A3IC 4KKBD 1HINH 1U6AH 1ACZA 1MCLA 1Z9MA 1DLFH 4JHAH 1J0JA 4LLUA 5C9JA 3FCTA 5EORL 3ESVF 5B3NA 3QDJD 1QYGH 3K81A 3ALWA 1BAFL 3G5YB 4D2NA 8CGTA 4KAQH 2DQIL 4A6YB 3I02B 1WIOA 3O45B 1I3RB 4H26A 5DA4A 3CFEA 1ZGLM 4PRPB 5FYKE 1ZLWH 5IWLA 5MI0C 3AVEA 3P4MA 2NY3C 1F4YL 2DTMH 1DBML 4RAUB 1ZK9A 5BVJB 1A6ZA 1GJIA 4M7LT 4PP2A 1FV1A 4YDKH 2J7LA 4QRRE 4HX1A 3CK0H 2BX5A 6FABH 1GL4B 4I3SH 1UACL 2JIXA 1YMMA 3NCJH 1LK3L 4NQXA 2OP4L 2ZWLT 5BZDB 3IF1A 1PQZB 5F1IA 2EDLA 1LNUB 4Q9BA 2B0SH 3LN5A 2DIAA 3MX0A 3UEZA 1AJ7H 4P49A 5TDPA 4H0IA 1JPGB 3HR5B 1KYOK 5HI5D 4RMUA 2FSEB 3GI8H 1TJIH 3BGAA 1TCMA 1ITBB 4PB9H 5EA0H 1NGYA 4DWHA 4YPGA 3TH3T 3QDGD 1S8DB 4X4XA 4XXCC 1LK2B 5D6DA 2P8LB 4JO3L 4MNGE 1AKJD 1Z2KA 5LQBH 1R24A 5GZND 4GBXB 1AO7E 4DCQB 3FZUC 3NFSH 4GRMB 3QP3A 1GH7A 5J4MA 1IGMH 3Q3GB 4HLZG 4BZ2L 2XKNA 4Y5XC 3W9EA 4D8PB 3RUGA 1RJZA 2R1YA 4WCYL 5K9JL 1FRGL 1MCEA 4NRYB 5MENA 3O4LA 1T1WB 1KIUA 1FG9C 1V7NH 3AY4C 2CMRH 3PP4L 5GIRA 3SGJA 4FQJL 2FEDC 4ODVL 4L9LC 1MHEB 2Z4QB 1FZMA 2AEPH 4QO1A 1PZ5B 3B5HA 3RWDA 5E99H 1JTOA 2NNAA 2VH5L 1J05B 5FEBA 4P5TB 2JCCA 2BC4A 2GJ6A 2D7OA 3A6OA 3FFCA 4LHUA 4NZUL 4X98A 3NZ8A 4DUWA 5EBMA 4AM0B 4G8FB 5BVPH 1WFNA 4PGZA 2N1KA 3SJVB 5KSUB 1KFAH 3QI9B 4H20L 4QHNA 2UZYB 1WFOA 3R0MA 1ZA6B 1YY9D 3RWIA 5H37G 1G7QA 2CRIA 4V1DA 1GAFL 2O5ZL 5E5MB 3NH7H 4HWEH 2I07A 3A6BL 3U4BL 3VXTB 1MFDL 5T1KD 5HYEA 1XH3B 3ARDC 2CK0H 4S11A 4MJ6B 4XT1C 3N1MC 1XZ0B 1TXKA 1VDGA 5D2LF 2LTQC 5DRWA 4E41B 3MO1A 3GJFK 2YUWA 4YFEA 2CRYA 1R0AL 2VXQH 1Q0YL 1LEKA 3VRIA 1F2QA 1EEUA 4UDTA 4PJ9C 2NY0B 3QZWG 1KNOA 4U1GC 3GSVA 3S36X 4PY8J 4G6ML 3BGFB 5IJKA 2AV1B 4PRIA 2DKMA 2HJFA 3BISA 5KVFH 2DICA 4H1LA 4EN3C 2Q8AL 4BQBA 4EQ3A 1AGEB 1PX4A 5CP7B 1INDH 2R1WB 4O58L 5JUEH 5KS9A 4YXHL 2BOBB 5DHVA 4R0LC 1XIWB 4PJFE 3L3HB 1C5CH 1CGUA 4R4FL 2X4OB 3WS6A 1QRKA 2G60H 3V4UL 5F7MC 4EI6B 2DQEH 3KPOA 4HWBA 2UYLB 3DROB 4D9QE 3KYKL 5JW3L 3V5HA 3IYLW 5HDBF 5IVXE 3GBNH 2W38A 1DN0A 5HYSA 3OR6A 3VWJA 2A0LC 3LV3B 3BIAX 3DURB 4FTVD 5EU4B 4NBYB 5TF1L 3TC9A 1MLBB 2XI9A 2A6KB 4PJCE 3HE6D 3UTSD 5LGKA 4J4PD 3CVIL 2AXFB 3TBTB 4ONHB 4UNUA 5HVHC 2P47B 1B9ZA 3BAEL 3CX5K 3VFNB 4XWOD 3QUXC 5BRZA 4NT6A 1FO0A 5EZOL 3ARWA 3BQUB 4APQC 4TUJB 4H1LH 3HPLB 5ITBL 3ZL4L 1F58H 2IH1A 2Y23A 1ZA3B 3DBXA 3T3ME 1MRDL 1PSKL 5E9DB 1MVUA 3DSNA 3O3AB 5DHVH 3B9KD 5CZXC 2QR0A 1R3IH 2Y72A 4U1LA 1IQDA 1NGPH 3WNNA 1VACB 4LRNH 3MV01 3RDTD 2R2BB 2Q7YB 5DRZB 1T83A 1RURL 4HWBH 1I9RL 2IWGA 3VWKC 2RCSH 2QHLA 4M4PA 2DLFL 2FEEI 4D0BB 1PJ9A 3CAFA 4XVTH 1UCBL 1DUYB 4IRJB 4MJ5B 1NAMB 3SOBH 3HI5H 5DVKA 1NL0H 2FYYB 3V9FA 2NX5A 4UQ3B 3QHZL 3FKUS 4OIIH 1NGZA 4WHYH 3NAAH 1T0MB 2P4AB 3MODL 3O8XB 5KAQF 4ENEC 3WO4B 4FZ8L 2V5SA 4MZ2A 3S96B 4CJ1A 3CIQA 5CWSB 3V6ZA 3D87B 4PGCB 1FO0H 2H1PL 1I1AD 4F7CA 2G9HB 4XRCA 3ROOB 3ZDYE 1QSZA 3H7BA 1BOGB 1EERB 4K7PL 3BMVA 1VGKB 4QHMB 1N26A 4JFEE 5ICZB 2XWBA 1FZKA 1A6AA 4NN6B 3QJHB 1MCRA 2DWDA 5F9AC 3FT4B 2C7UB 4A6YL 4JY4A 3AROA 5D72L 5KZCD 4KJQD 5D1XA 3CZFB 3OV6A 2XZAH 4O5LH 4GH7B 4OD2A 2OJZH 1NCNA 1FZOB 3H9HA 3S35L 4U7SA 3BZ4B 3SE9H 3CNKA 4PJFB 4HKXA 5E94A 5HYJE 2F5AL 3MFGB 3HPJA 3FO0L 3EFDL 3T2NH 3HG1E 5K93A 3W81A 2HJKB 4OZHE 1A6WH 2ZP0T 1TENA 2APBA 5HHNA 2VLME 4D9LL 2R69H 4U3HA 1HXMA 3L3KA 3DV4A 1XGRA 1VPOL 4LFHD 4NQEE 4P4KD 3SDAC 4OZFB 1UA6L 2GI7A 4QRTA 4RX4D 4F9LA 4WI4A 3ILQD 3QQ9D 3DX6B 3ZKND 4NM4L 3E6HA 4PJCB 5C0CB 5IW1A 4G8GE 2IPKA 3EIFA 4Z8FL 3H3PH 5FB8A 2HP4A 1HCFX 5ECJE 3VMNA 2RB8A 1F3RB 1IAMA 1Q38A 3L95A 1NFIA 3GNMH 4RGOL 4UNVA 5F88B 4LSPL 3KLHD 3MRNB 4OZIB 1R5VB 4X7FC 5DJAA 2J88L 1J86A 3OZ9H 2B5IB 1FPTL 3EJZD 3IS0X 3JTSA 3PP3K 1NCBH 4Z0XA 4NWTL 1DVFB 1WAAE 4DFIA 3VI3F 4TULL 3VJ6B 3TO4A 1CFNB 1ETZA 3CXHJ 3BP4B 3HMXL 2PTTB 5C3TA 2VXUL 3QCVL 5DZLA 5CHNA 4HWZB 5CBAB 1BJ1J 4RMRA 2H6PB 3VFUB 2Z0BA 1JMXA 5I30L 1CXIA 2VQ1B 2VTFA 2FX8L 1X5ZA 3PGDB 2NY5L 1FL6A 5FV2A 2IFGA 5ABDE 4X5LA 4YHYB 1KELL 3VG9B 3MRHA 1CXEA 3N50A 4N90E 3IDYC 1XGQB 1XF2A 5D7LE 3UMTA 1T21B 3KJ6H 4PG2A 5EOQL 5HHOE 5IESL 3ME0A 5KJRL 5DJ0B 2E27L 3IXTB 4ZFOA 1B2WH 1DBJH 3RA7L 3Q5YA 2Z93B 4BA8A 4FXGA 3DVGB 1TETL 4X6DA 3GBML 3EOYG 3L3GA 3ES6A 3IDGA 5IBTL 3RY6A 3QXUA 2VDQL 1CTNA 4PJAA 4O2CA 4GG6B 4YAQA 2HFGL 5IB2A 3C6LA 2LE9A 4MCYB 1BBDH 1JHKH 4QTIH 1KTDB 3OKDB 1I8LA 4G6AC 3RY5A 5F3HA 1WSST 4ODHH 4Y4HC 1KIRB 43CAA 3O4LD 3FO9B 3NCYS 3KPRE 1HDMB 3UYPA 2JB6A 4K3HA 1IGCH 3GMPA 1NBYA 3CLFH 5IHBA 1HILB 5IB4A 1EO8L 5I73B 1A4JA 1OSZA 3HG1B 5KVEL 2MPAH 1OCWL 1V3LA 5EC2A 2VABA 4OZHB 1IL1A 4F8QA 1PX3A 1YEHH 2AABL 3PQYA 3UJJH 1GC1C 1RUMH 4LKXB 2HRPL 1ZEAL 2QQKH 4JFPA 3FFCD 4LHUD 4NQEB 3QULA 1MIML 3MLTB 4XNUH 1MCPH 3B6SB 3TBYA 1LEGA 3QDMB 2VDOL 4U33A 4OKVB 2XRAL 3ARFB 5J1AA 3FFDB 2MCPL 4GKOA 4JREC 4MD0A 1N4XL 1X7QA 4KMTH 4UZGA 4L4VB 2E8ZA 4KQ4L 1NCAL 4KZEL 5F9WC 1JWMB 4V1DD 5FYLL 2A74A 5H94A 5HY9A 1I8IB 3BD5A 3O9WA 4CMHB 2DM4A 4IRZH 4LSUH 4CMMA 5ENWA 4RA3A 1EEYA 2WIMA 4WI7A 3UO1L 2F8OA 1T7ZA 4QY8B 1A6UL 2ED8A 4W6YB 4OZFG 4X8XA 4KVNH 4ZG1A 4U7MA 1MUJB 3BPNC 3DXAE 3ULVE 4NP4L 1G9NL 3X17A 5B39A 4EDXB 4PRID 1UENA 3Q1SH 1S7VA 2IMMA 3D2UD 3EYVB 1FYTD 2WWMD 4DGIL 1BZQK 3P4LA 4IS6A 4OF8A 1N5AA 4EI5D 1E4WH 1H5BC 3DIFA 4LCWE 4G8EA 1JGUL 5D7LB 1U3HA 5ERWA 1E28B 3LRSA 3MBXH 3GMMA 1OGTA 1NAML 4JM2F 4K7FA 2OK0H 3VRJA 3GMRB 4PJXA 3B4NA 2ZG2A 1P84J 3B43A 5CILL 1CXLA 3T08A 3QDJE 5CD3A 4J7RA 4LDEB 4MCZA 1WFUA 1HZHL 4TSCH 2X4PA 4R2GB 5BJTB 1ZAGA 4FS0A 5E6IB 2Y6SC 5IHZB 1GHFH 1RUAL 2R1XB 2BY1A 1DSFL 1MCHA 4M3KB 4AK1A 5HI3C 2FHCA 3HTLX 4U1KB 4HPOH 1EFXA 5I75B 4PP1D 1OP3K 3TJEL 3SDXF 2AXJA 5JXAL 4TNVF 3I75B 4HQQL 4F15B 1X6NA 3UTTD 2FB4L 2R0WL 1XF3A 2OL3A 4PJIE 4GOSA 4P23B 4JFXB 4XCNB 5ESAB 2MOVA 1S7SB 4MXVE 4WI2A 4QT5A 3QUZA 4MD4A 4JRWA 3P2TA 4WUKL 1CL7L 8FABB 4QXTB 1IM9A 1CWVA 3LRHA 4CVZB 1DUZB 4OUUB 4D94A 5I71C 4DOHE 1EEZA 4PGEA 3WIHA 3LHPL 1WT5C 1SEBB 2YA0A 1K2DA 3B2VL 3QDGE 4CVXA 2P5EB 1HHHA 3CDYA 3NPSC 1MRCH 4ZUWA 1H15B 4I2XA 1YNLH 5SX4H 5LWYL 4MXWH 2YRLA 5H2BB 1GGIH 5FF6A 1MJ8L 4ZD3L 1VGEL 1P2CA 3PWNA 1RU9L 1T6VN 2ZNWA 5K59F 4Q74A 4W70A 3MXVH 1L9NA 4OBSA 4LEOA 1AHWC 1CFTB 2IGFL 5C7XL 4YE4L 3MREB 4BZ1H 1KEML 4ZNEE 2OL3H 5JZ7C 1VKXA 3U9UB 1EPFA 3BH8A 1BVLB 1FBIL 1YDPB 2AW2A 5KBNC 5L7XL 4TNVK 1MJ7H 1IZKA 5JLZA 5D1XD 1JNLL 5GXBB 4Z7VF 2YC1B 1U3YA 2JJUA 5J6GB 1FL5A 5TFSH 3QXAA 3RNQB 4PLJD 3BRFA 3FT2B 4PJHB 3WIHH 3IXAA 5F9JB 2VN4A 4KHXL 1YJDH 5C08A 5K9QG 3IRPX 5TQ0L 3STBA 3FRUB 3N0PB 3SY0A 2JJTC 5E5RB 5FGCB 4JZNB 2P1YA 4OZGA 1ADQA 1JJUA 1CTOA 4OF6A 3MYJB 5BQ7A 5EUOB 4M43H 4IOFC 4AEIH 3BRDA 3C8DA 4HFUL 3QDJB 1WBYB 1I7TA 3IDNA 4M03A 3O4OC 1BFSA 4RGMC 3VGFA 4UB0L 3EDJA 3C5SB 2O26U 2HWZL 1SJVA 3QIWD 4RFEA 4V2CB 1Z6JT 1AP2B 2HLAA 5KTEH 5EC1A 4Y1AB 4LLDA 1E6JL 5HVFB 4XC3L 3S6CA 4JEGB 4JKLA 4L29A 3QQ4A 4RMQA 5GRWA 5MERB 2BVEA 2EKJA 1A21A 3TV3L 3C87A 4KMLB 4PJIB 1CE6A 4X9BA 5JPMA 4QRPB 2UZXB 3TO4D 2VMFA 3PWPD 1Y6KR 3TCLB 2SEBA 3MNWA 5DR5H 4JKKA 5I9QB 4XGZB 5D6CB 2R8SH 5K33A 4P4RB 4M3JA 3BO8A 4DOHB 1ADQH 1K5NA 5JPNA 2NYYC 5A2LH 4S1DC 1A5FH 2ADIA 2Z9TA 1OAQL 2CDGA 2DQCL 1H3VA 4U1SA 2P5WD 2VDNL 4HS8H 1FJ1B 2X9YA 3BKMH 3QDGB 5EO1B 1H3GA 2OR7A 4YHIB 3TIEA 4FTVE 2AK1H 4IM8A 5C0NC 4FXLA 5I18H 4U6YB 1CZ8H 2IADB 4WI6A 1S3KH 4NSKA 5DDHA 1FNGB 4R90H 3UTSE 3WNOA 5J9PA 2QHRL 5FO9A 1C12B 1Q94A 3P30H 1R3LB 1CGXA 2PYFA 2ORBH 4JM4H 4YLQT 1WWCA 5I1JL 1YQVL 4F57H 1I4FA 3FO2B 5IMMB 1N64H 5CLTA 4UI2A 3CU7A 3QA3A 3G5ZA 4YDVA 3C6LD 5IUSA 3FRPA 3RL1B 3AAZA 4I3RL 4JE4B 2VDLL 2B4CL 4X7DC 5A16B 1VB9A 4ZPTB 3HLAA 4RWHA 4XXDA 1IC1A 5MEOA 5HGHA 1WCBB 3ZTJG 1AH1A 4Z18A 1HSBA 1S5HB 4P5TC 2AI0L 5MEPB 2HTLC 4KUZH 5C0AA 4L8CB 4Z78B 4M7KH 4XCCH 5KVMC 2E9BA 1UM5H 1V3KA 2PCPB 4XCYB 2NY5C 4NQUA 1IAOA 4JFFB 3VGBA 3OX8B 4PB0L 5HHPB 4NHCH 2J2ZA 2VXVL 1G6RA 1HEZA 4N5EC 2BFVH 3JWDH 3QI9C 4NCDA 2P48B 2BERA 1T20A 3DLQR 3MV8A 3V52L 1J8HB 4HH9A 5F7EL 2AJVH 2IH3A 1LDPL 3D18A 1A1MA 1IC4L 4KROC 2GY7B 3C60B 4ORGA 5D7JD 1TJGH 1Q1JH 5JDSA 3TM6A 4YQXH 1A6VL 1MIEL 4JKPH 4NQCD 3EO1A 1N6UA 2OZ4L 5E2UL 3O9WD 3CX5J 5IEHB 5TE6L 4H25A 1U8NB 2NY0C 4OLYL 1LEIB 1P53A 4RAVA 4LRIA 4CNIB 4OV5A 1FC1A 4JGJA 2R0LH 3BGFC 1JPFA 4HBCH 4YR6B 4G7YL 5HGBA 4LU5H 5I1DB 4NO5A 5ACMA 2CSPA 3CDFA 4K7PX 2CDFA 5JIIA 3P11L 1G6RH 4DJMA 1AGFB 1XIWC 2A9MH 3NVQA 3VXMA 3X13A 1OTSD 4G80B 4BH8A 1S9VB 5D1ZA 3SGDI 5D93B 1CG9B 3WFHB 5JNYA 1LD9B 3LKOB 3CVHB 3MNVA 2CGRH 4FTVB 3MXWL 3MR9A 3QWOA 2J8UF 3HCVA 2ATKB 3N9GL 1EZVX 2IPTH 4EZMA 5BXFB 3HE6B 5L8JB 2FO4B 1C5DB 3MRCB 1YNKH 3BUYB 3RZCD 3MLVH 5D9SA 4ZXBA 2WK2A 5DMGD 1W0WA 5DFVD 3SE8H 3ARYA 3HZKB 5F6IB 3MRRA 1ZHKB 1A1NA 4JHWH 4LSTH 5FECB 1NMAH 2W0FA 3M1BB 2F5BH 3O6ML 4DVBB 4B41A 3B9KB 3BQUC 4XP4H 4PGDB 5CINH 3BW9A 3D6GA 3FAXA 4ONFL 3U4EA 3CUPA 1G9NC 1HHGA 4Z5RB 3UC0L 3TWCH 1TPXB 3OKOA 4PY7A 2B1AL 5EIVA 3HE7C 4K71B 3U7YL 4X99A 1Z3GH 5B21A 4GMTL 1KTKE 5JHDA 2X4QB 3N1QC 1VENA 2IALA 2BDNL 4HKJB 3PGCB 4L4TA 4NQDA 3WCYA 5GS0L 4S1QL 1UJ3A 3RWJA 5A2KH 3EO9H 4WW2B 3N1PC 1S7WB 2LABA 1T1YA 4LIQL 1DQML 4RDQG 5DD1H 3BD4A 2PW2B 1OTTD 5I8KH 3O8XC 1JZ6A 3WO4C 1NANH 1G7IA 1OM3H 1V5JA 4RIRA 3RBSA 2I26N 1TVHB 4LK4A 3BPCB 2IQAA 2CKBA 5I15L 3GO1L 3QAZB 3KR3L 4TRPH 3RUGE 4YBHA 2PF6A 3ILPA 3PV6B 3DUUB 3EYQD 5I17B 3O4LE 2W9EL 1D7FA 1RZGB 2EH7H 4Q0XH 1CLYL 4JFOA 3WXVL 3V79C 5D4QA 1JZ4A 3BIBX 1G0XA 4YHLH 2EDEA 2AJ3A 1C8PA 1JGEA 1RIHH 2BRRH 4KKLC 3TNMA 1DN2A 4HKZA 2R2EB 1TZGH 1AFVH 1X44A 1S9YB 4JJHA 3FFCE 1FNHA 1CE1H 5E4EC 3HZYA 1SJEA 1MFNA 2H26B 3BH9A 3OXRB 2Z35B 2PKDA 3CXDH 3VFWB 1Q9LA 1FL3B 5D2LE 5DO2D 5HD8C 3U1SL 2R4SL 3QCTH 3SCMB 2HFEB 4MJIA 4HGWA 1NCCH 1P1ZA 2PO6A 3SGKC 4V1DE 2CKBH 1IEBA 4LSQH 2EDOA 4JQIH 1R5IB 4GLRI 3S36H 5EO9B 1KPRA 2WM0A 3KJ4C 2XTLA 4JO2L 3L3JA 3CSYA 2DQHH 4NNXB 3UPRB 1MEXH 2XZCL 3BPLC 3Q0HA 4RWYL 5C6PB 1SBSL 3KS0J 3SKOB 1AGBB 1SMOA 4OCNC 2R4RH 3O2VH 4L8SB 4NOFA 4PJGA 2ZUYA 4KK9D 3GM8A 3CLEH 2XTJB 4XXCA 4ZTOH 1T2QL 2DLGA 3MRJB 4JPWH 4HF5H 2FNBA 3QJFB 3H2WA 2R9HD 3NABL 4NZRL 3T2PA 4PRIE 3B3IA 2JE8A 32C2B 3LQZA 1KN4H 1IRAY 2NW3B 1FYTE 4Y5XA 2YK1H 2FR4B 3T2OA 1WZ1H 3CPLB 5KS9E 4JFYA 3JZ7A 4M6NL 1DBAL 3KYMB 4P48A 4NZTH 3E6FB 4PJGF 2ADGB 3V7AE 1A7NH 2MQCA 1O7VA 4M93B 4WV1C 4L9LA 4XMPL 3I85A 3O3BA 5T1LD 3UTQA 5HBBA 4HJGA 4U49A 2EDQA 2DI9A 3TBSA 3KXFD 5DQJA 3SQOL 2FL5B 4YHYC 4ZODA 1CBVH 5D2NB 3VG9C 3MOQA 1OD9A 4OSUL 5MP6H 4OCWL 4P2QA 2QEJA 1OOAA 1KCKA 5TF0A 4PUBH 1QR1B 1KCSH 3OKEA 5IQ7L 4RZCB 4J3UA 1EUTA 2OR9H 4ELMA 2EECA 3H9SD 1WCQA 1X5XA 3VXOA 1EMTL 3HNTH 2M26A 1UJTA 4ZS7H 2PR4L 4JFDA 1INEL 5E8DH 1UC6A 1S5IL 2VZOA 1MAKA 4P59H 1VADA 4ALAH 5LAXB 1PW3A 1INQA 1QR4A 2V2XB 4DK6A 2HG5B 4MNQD 1WFTA 3PUCA 1KF9B 3CU1A 4LARL 5JOFA 1S9XA 2BHUA 4TPRH 3ARDA 3THML 1HN1A 5HDLA 1H3PH 1QRNA 1R3KA 3UTTE 5GQBA 5LVEA 3PGFL 4JFQB 5FUCE 3MUZ1 3WKMH 4OI7A 2WUCL 3FOLA 2DMCA 2EYRA 4X6EA 5I73C 3H8NA 3SDCD 1ZT4A 2F8XC 4QWWD 4G9FA 1QO3A 1MHCB 4QOKA 2R56H 4CU6A 2GTZB 3MRIA 4MAUH 5JORA 5D2LB 4TSAH 1I1RA 5DUML 1D5IL 4EN3A 3FQRA 4U1HA 4WEBH 4G8IA 4OD1H 5L2KB 1IM3B 4LOUC 2I60H 2F53A 2NY1B 3CVHL 4R0LA 3C5ZC 2VIRB 2DWEA 1UEMA 4K3JL 3SKJL 1T0NB 3PXHA 4R8WH 1UKSA 4GRWF 4P5MA 4U6XA 1HH9A 4JLRA 1QA9B 2VZVA 3V8CA 3QCUH 4NKOB 3P73B 4HUXA 5DD5H 4FQQA 4RQQB 3NIGF 4HV8A 3ZHLA 4H5SA 4OAWA 5CIPA 1FFNB 3IS1X 4CMHC 4NKMA 4LCYB 3X12A 4GSDL 2EDDA 5JOEA 4FQ1L 2B4CC 2Y36L 1F00I 2CIKA 4GG8A 2OTWB 1PLGL 1UVQA 1AGDA 1MCSA 3V0VB 2FJFB 2XQBL 4E0RA 1RUPL 1MFBH 2KPNA 3VGGA 1K8DB 1HH6B 1BBJB 2BVUA 1IAII 3UP1A 3SDYL 3QUXA 4X6CA 4GRWH 4EI5B 4X7TB 5B4MD 1JHTB 4S10A 3T77B 3WFCH 1U3JA 2P46B 3EDDA 2WLYA 2DDQL 2ZG1A 1QSFD 5DJZB 3TIDB 3BSZH 3U0TB 1DE4A 3RIAF 2A6DA 3RVVC 4PREA 4UT6L 3WD5L 3VXMD 3OKLA 3DX8A 1KJ2A 1JN6B 1OAZL 1UADC 4G7VL 1VFOA 5I74C 2QSTA 1FNSH 4Y4FD 4Y8DC 2XXMB 2ZKHL 3UBXB 3QO0A 3T0EB 1RK1A 1MJJA 3T8XB 2AEQH 2RGSA 3K2UL 1MLCA 3EO0A 5CIPH 5C0FB 2X4SA 5L6YH 3MC0A 1OF2A 1G9EA 2F19L 4XP9L 1QHPA 2GITA 3MLXH 3VDBA 3VI3E 1PKQA 2BCKB 5E6IC 4YGVB 2WIIA 2DLTA 3IKCB 4XWGL 3UTTB 2AXGB 2IAND 2Q87A 1MAML 3X11B 2VB5A 1NH6A 5I75C 2WINA 3L5JA 2XACC 3MRQB 3PWPE 4F15C 2Y5TB 4FXKA 5JA8B 5EFIB 4TOYL 5DLMH 5J3HC 1QEWB 4LMQI 4NQSA 3OMZA 2ARJB 2VYRE 1KJ2H 2VUOA 2CXKA 2DM2A 1C7SA 1UWXH 2R2HA 3IGAB 4IMLA 3RIAK 5FDWB 2P5WE 1MWAA 5JHDD 1U8MA 3G6AB 1JTPA 4NQDD 1NFDA 2ZCLL 5GGUB 4BUGA 4I77L 1IEAB 1NC4B 2V5TA 3MFFB 3B8SA 5IR1B 4WIQA 4HKBA 5ACZB 1UB5B 5FOBA 4CKVX 4E5XA 3VCLB 4OLVH 1U8KB 2DQGL 3TT1H 1X3DA 2PYED 3FONA 3V6OA 3L5WA 1KN2L 1G7JA 4O2FB 1N6QL 1DZBA 1HOCA 3N85L 5I8CB 3SDAA 1UWXK 1TNNA 3A67L 3MCKA 1AGCA 4LDOB 4HDIB 5HHQA 1VESA 1UG9A 1AQDB 2EXYD 4IJ3B 1CICB 2CJUH 1TZHB 1F6LL 4KK6D 4JG0H 3VXQA 5JXED 4JDTH 1OAYL 4XPAL 2VQUA 3MRMA 2BNRA 4X7EC 5A3ID 1IGJB 5EOCL 4LLVB 5D7KD 5CS7A 3V7MA 2E6JA 2ZPKH 2ADJA 3QEQA 3TNNB 2EDWA 3AMLA 1MWAH 4ZFZA 2UY7A 1HKLL 2EIDA 1FIEA 5FM5M 1MHPL 3DECA 5DHYA 5GS0C 4MYWB 3VD9A 2BNUB 1ULVA 2ESVB 4Q6IC 1JV5A 4M7ZB 4UTAH 1BJ8A 2JK5B 5F9OH 5JW5B 4BQ9A 2FATL 3W5MA 4I9WD 3QG7H 1B4JH 3HRZA 1E27A 2EE2A 4KZDL 2XA8L 4KKBC 3T0AA 2FX9H 2AKRB 4M6OH 4OIBA 3QIWB 5CEXA 3OF6A 2DN7A 1XCTB 2PO6D 5AD0A 5C09B 4OLZH 3DRTB 1JGVL 2YXMA 3EGSB 2H32B 3QWRA 4XX1G 4NQCE 5CEYB 1SJHA 5ISZD 3S7GA 4OFPA 1YUHA 4XNYL 2GJZA 3NZHH 4LDLB 3VGAB 1RZ7L 2H9GA 3QIUB 3UTZA 5F7DB 1CVRA 1EX0A 3BZEB 3MLRL 1NANI 3F7YA 4XBPA 1CLOL 3LKRA 2NXZB 3PWPB 3FB5A 4NGHL 4Y19A 5KG9B 2AK4B 3ULUF 4LVEA 1OB1B 3UBXG 4OD3L 3D5OF 3E8UH 1KIPB 1ZTXH 4HUUB 3GMOB 3IJYB 4MZ3A 5DJXA 4AIZA 1ZHBB 3TA3B 4Y4HA 4QRQB 5I9QC 4XNMB 4WO4D 2AV7B 4M4RA 5ALCL 5IMKA 2FEDD 4Z7QF 1JL8A 4RMTA 1D5BA 4TTDC 5KVGH 3K3QA 2VLRA 1LO4H 2WBKA 4C58B 1BVZA 1N0XL 5EDXA 1DANU 3OHXA 4QHLB 3OJMB 4JZJB 3RJQB 4CRPA 4Y5YC 1QLFA 1G7LA 3MUHL 4JAMB 1J8KA 1NDMA 4P2QD 4FP8H 5GRJH 5DC9B 4M61B 3VFRA 4ZFFB 2P24A 5IMLB 4PRBA 5CEZH 3SDXE 4K8RL 4LVOB 5CUSL 2VL5A 4HMDA 4MSWA 2FX7L 4EVNB 1BP3B 3P4NB 2DQFB 2Y7QA 3H0TA 4Y0GA 1FG2A 5IM7A 4RISL 1OAUL 2VZ1A 2ZNXA 5EORH 4Z7WA 1SBBA 1G7HA 3QQ3A 4NRZB 2L4OA 4JFDD 4CUCA 2QKIB 2ATPA 1VA9A 1BAFH 2YMXL 5IVZA 4JY6A 2DQIH 5J1SC 1C5BH 4K23L 1W72B 1S7UA 3QEUA 3AXLA 5BS0D 4PD4J 3QUKA 4RNRB 3E2HB 2NY4B 3ARDD 4V2BA 1VCAA 2F54D 1QRND 1F4YH 1IC7L 1DBMH 4WFFD 4G5ZL 4HK0A 2EKSA 4Y4KB 5FO7B 3NGBC 1UH4A 5E8PB 5K9KA 1MQ8A 1UACH 4JFZL 4ODUB 4UAOB 1LK3H 3ARXA 2OP4H 4JHBA 3JV4A 1X4YA 4QOKD 4KC3B 4XMKL 4X6FB 3DETD 1HXYB 5C0BA 3H42L 2VISA 4PRAA 1GC1H 1RULL 2W65A 5K59E 2DQUL 2HN7A 3ZYJA 3IU3A 5DI8A 4GJTB 4PJEF 2EIZA 1JPSL 4NUJA 2YUZA 4OUOA 3HC4L 1IGTB 2BY3A 4I2XE 4NQCB 1H5BA 3BGMA 4YC2B 3TYGL 3ZKMD 3LPFA 4YXKL 4X80L 2VKXA 1F3DJ 4OB5H 2DMKA 5J11B 4JO3H 4KGLA 3MV7B 4S0TD 1LO5B 4Z7VE 4PBXA 3QH3A 4LKCB 4JRYA 4BZ2H 1ZGLA 4WCYH 5K9JH 1FRGH 4MHHG 4NC0B 4OM1L 3PP4H 4UIMA 4FQJH 1KGCD 1T04A 2G75A 1CD9B 4ODVH 1KIQB 3PF2A 5HGDA 1EA9C 3I3DA 4JM2B 1A1OA 5K9OA 2C3HA 4XPBL 3L7EB 2VH5H 1PYWA 3QUXD 1URLA 3BVNA 2CUHA 1HHIB 1F3JB 1RZIB 2VSCA 4X8JA 3EOTL 1HSAA 4FQ2L 5DD6A 4MWFB 1YEKL 3BHBB 5E8OA 4CJ0A 4LPVA 2DQJH 3PWVA 4NZUH 4XZUB 4R6UA 4HK3N 1CGSL 4YDLC 3RZCB 5CBEA 2MQ3A 1U58A 4QHKI 2DL2A 3JSSA 4H20H 3HE6C 2CLZB 2JJWA 1UZ6F 5ICXA 4NHUB 1X6LA 3PABB 1D5XB 3SDXB 3WDIA 4XWOC 4OM0L 1GAFH 2O5ZH 12E8L 1T4KA 3A6BH 5D7IF 2EDRA 3U4BH 4QCIB 4EOWL 1MFDH 2QL1A 5DF0A 1ZANL 4L3EA 4N0FA 3D69B 4LGSB 5F6IC 1WT5A 4CU7A 4OQ1A 4JKMA 3B9AA 3STZB 35C8L 3B9KC 1R0AH 2D7TL 1FFOA 2NW2A 1Q0YH 4MD5B 4ENED 4ORZC 3RDTC 4M7JL 1A7OL 3AREB 4XB7A 4N0UE 4XAKD 3S98A 3RX5A 2FD6L 4YHNB 2P8MB 1TPXC 3DUSA 5D8JL 4WY7L 4G6MH 4WU5A 2A6IB 4BSJA 4HPYL 2D9QB 5I76B 1AHWA 2Q8AH 4ISVB 1KJVB 1WZKA 4P57B 2MKLC 2RIKA 3B9EA 4F2MB 1A14L 4O58H 3TPUB 4YXHH 4ONGL 4HFWB 3KXFE 1JZ2A 3DO3A 4YNYB 3EOBB 5EU5A 4R4FH 1ONQA 2DB8A 3OTTA 5EPMA 1U91A 4DGYH 1CF8L 3KYKH 3WKNA 5JW3H 3R0NA 3LN9A 1RFDL 4WFED 4FZEL 5DWUL 4WI9A 3H9SE 3LSOB 3DX7A 1FVCA 5FO8A 2Q6WA 2JJTA 5FM5O 5TF1H 3TZVB 4Z7VB 2MFNA 5I1KL 2P8PB 1S7TA 3CVIH 3D3VD 3QZWA 4JN2B 1XFPA 3QAZC 1TIUA 3DO7A 4MNQE 2C1PB 5I1AB 3BAEH 1T1XB 5IG7B 4H0GA 5EZOH 1U8QB 2XZQL 2VO5A 5LGHL 4Y2DB 4NO2B 5ITBH 3ZL4H 1GOFA 1MRDH 1PSKH 4UDUB 5F7HA 4ZUVB 1VFAA 4LEXL 3G5YA 3QXVA 5H37H 1FN4A 4A6YA 3N1GC 3I02A 3O45A 1I3RA 3WN5B 4U31A 3VFMB 4PRPA 4Q58C 1F6AB 5B3JF 4DZ8B 1ORQA 2EH8H 4J8RB 1RURH 1A7BA 3HA0A 1I9RH 4HZLB 3BIKB 1OAKL 3QXTA 3ZKNC 4RAUA 3DGCR 4MA1C 2DLFH 5BVJA 4AEEA 2V2WB 3QUMA 1UCBH 3MRPB 1RMFH 4BM7A 4N9OB 5DA0B 4XTRD 1QNZL 3QHZH 1HK6A 4QLRA 5FHAH 2W60A 1EJOL 5BZDA 1PQZA 3MODH 4J6RL 5HGAB 1DQDL 5TGBB 3PG2A 4MDIB 2R15A 3HNVL 2ID5A 1MCNA 2YWZA 3QG6B 1JPGA 2H1PH 5EN2B 4PRDB 4AMKL 3QWRD 1OTUD 3ULUD 2FSEA 1XF1A 3EJZC 4K7PH 2PW1B 1LO3L 3NIDE 2NMSA 1WK0A 1MI5A 2P8LA 4X83A 1Z0NA 4A6YH 5DUPH 4DCQA 2A6JA 1FH5H 3MJ7B 1W72L 1WWAX 4GRMA 5D72H 5DHXB 4R3SB 3PNWB 2J8UE 3TH4T 1A6TB 5E6YA 4D8PA 3STLB 1QSFE 3S35H 4NRYA 3KXFB 1T1WA 3FQNB 3QQNA 4G6AD 1WITA 3VXME 3QUMH 3VFVB 3QFJA 3FO0H 2VXTL 4Y4HD 3EFDH 4BK5A 1MHEA 5GGVY 2Z4QA 5DC0A 1PZ5A 3HMXA 1A2YB 4TVSa 1J05A 1OP9A 1HCVA 4D9LH 1AXIB 4P5TA 5D2NC 1YY8B 2C4FT 4M6ML 4AQ1B 1VPOH 1U0QA 2E5EA 2EO9A 1UA6H 2VAAB 4XNXL 3BOVA 4IIQB 4NM4H 4AM0A 4G8FA 3S37L 3PIQA 3IB4A 4IOIB 4R96B 5KSUA 3SJVA 4Z8FH 4MNQB 3QI9A 1ORSB 2R0ZL 4LAQL 3AB0B 4J23A 1ZA6A 4CL7A 3MGTB 4RGOH 2G5RA 4S2SB 2IANE 4J1UB 4LSPH 5HJ3A 2VLJB 4WWKB 5IFJB 5E5MA 1SVZA 2J88H 5IBLD 3QT2A 3Q48A 3SDCB 3DI2B 2DI7A 1XH3A 5E8EB 1FPTH 4JO1L 4HIXL 1XZ0A 2AP2A 2PUQT 4U6HA 2Y06L 4DAGL 4NWTH 4E41A 4U6TA 1PFCA 1WF5A 1ZE3C 2NQCA 2YR3A 4TULH 3WHE1 3VW3L 3P0YL 3HMXH 4U4BA 5I1LB 5C0DB 3SKMB 2VXUH 3QCVH 5EOTB 5JHDE 2Q3ZA 4NQDE 4C55A 5I30H 2AV1A 4HW6A 2R0KL 3WHXB 2FX8H 4LAJH 3V5DB 2FIKB 3INUL 2NY5H 5ESQB 2HKHL 5C0BD 4XP1L 1AGEA 5A1AA 2PXYD 5CP7A 1KELH 2R1WA 5D7SL 2NY1C 1CFQB 1UZ8B 4HXAL 3OPZH 3DI3B 3EDFA 1XIWA 1JFQL 2XZZA 3I50H 1RD6A 2V5RA 2PYEE 3L3HA 5EOQH 5IESH 5KJRH 2X4OA 5EIIB 4K8RC 2E27H 43C9B 3RA7H 1RJLB 3MLSL 5H8DA 4EI6A 2UYLA 5IJVB 3DROA 2GIYA 1KT2B 1FYHB 3GBMH 5IBTH 2VDQH 5TH2B 4TYUA 2HFGH 4FABL 4XHJD 4AT6B 2F74B 2QLVB 2EC9U 3DURA 3Q6GL 3QBTB 5EU4A 4WUUB 4M9PA 1MLBA 1CD1B 2FECI 3LKQB 5D7KE 3CMOL 2A6KA 1I75A 2AXFA 2WWMC 3TBTA 4ONHA 5IFHL 1CXKA 1MELA 2XNAB 1AR2A 4NRXA 2LVCA 3VFNA 4JB9L 2XIDA 4EI5C 5INCB 2Y6SD 1EO8H 4FQCL 3BQUA 5B8CB 3TBWA 4Z6AT 1NAKL 5KVEH 1MCCA 1F4HA 1D3CA 1OCWH 1WGOA 4TUJA 3HPLA 3S4SG 4CU8A 1ZA3A 5E9DA 3VMOA 2AABH 4Y4FB 4I9WE 1KJMB 3F7QA 4Z0BL 1Z9SA 2HRPH 1ZEAH 3HE7A 1VACA 4I0CC 3MMEB 4N1CA 1MIMH 2R2BA 1L6ZA 3DHJA 2Q7YA 1FFPB 4YFLI 5DRZA 5FAAA 5L8LB 2D9CA 5L0QB 2P43B 2VDOH 2XRAH 5DRXB 4E42B 3KAAA 3QHTC 2MCPH 1N4XH 1M71B 4GW4B 4LVNB 4OGXL 4IDLA 4KQ4H 4P46B 4D0BA 5ISZE 1NCAH 4KZEH 2YA1A 3KYOB 4ZFGL 4RCAA 3FHAA 1DUYA 4MJ5A 1NAMA 4P2OB 1KXQE 4N0YL 2FYYA 5FYLH 4UQ3A 2IANB 4PGJA 3T3PF 1YN6B 3WDHA 4GUPB 5FGRA 1CQKA 4C83B 1T0MA 4L3ED 2AJZB 4PP1C 3V5KB 1NGXB 3O8XA 1CFBA 4PJGE 4KMQA 3RJDA 3S96A 2YBRB 1IGYB 1ZT1B 5CWSA 3R8QA 4PGCA 3UO1H 3MRLB 3OJDB 1A6UH 2G9HA 3ROOA 5IMOB 2ZZUT 1BOGA 1T22B 1VGKA 4QHMA 1G9NH 3E3QC 3LKPA 5ICZA 4XCFL 3QJHA 4XB8A 4C56D 2UV3A 5GGSY 3FT4A 1DBBL 1N5YL 2C7UA 5CZVL 4DGIH 3TN0D 2QADD 4ZUSB 4DN4H 3CZFA 2ZSVB 3PL6D 2E3VA 1FZOA 5GHWL 3H9ZA 5IVNA 3BZ4A 2A38A 4PJFA 4XP6L 1JGUH 5ELIA 4P2QE 2ZG3A 1OPGH 1FORL 3LY6A 3BP7B 2ZOKB 1MFEL 3HC3L 1NAMH 4PRHB 3CFKB 2BSRB 2HJKA 1SQ2N 4ELME 2NY7L 1UM4H 1IT9L 1BD2D 4XPFL 5CILH 1WEJL 3LMJL 4PJBB 4TUOB 4JFDE 3UZQA 4OZFA 1HZHH 3DX6A 2A77L 2EZ0D 4JZOB 2GYSA 3SGKA 4PJCA 1RUAH 2HA1A 5BS0E 1CICC 3VGEA 5C0CA 2YPLD 1DSFH 2R39A 5D1XC 4HS3B 4PJ8B 3F12B 1D9KB 4GMSL 2D0HA 4FMKA 2F54E 3JXAA 1QRNE 4WFFE 3MLWH 2K7PA 3WLWD 5KSAB 3QPQC 3TJEH 5IIEB 5F88A 1NLBL 5JXAH 3RGVB 4OZIA 1R5VA 3VGHA 4HQQH 1UWGL 2FB4H 2R0WH 4EIZC 1JYNA 4QOKE 5E8NB 1FLRL 1M6OA 4AJ0A 5HGGS 1U9KA 4GRWE 3NN8B 4HUNB 4PJAE 1DVFA 2YD2A 4M7ZC 3DVIA 1W0VB 4WUKH 3VJ6A 1CL7H 4Z77B 1CFNA 2JF1A 3CSPA 4OZIF 3BI9X 3BP4A 2PTTA 3T65B 4HWZA 5CBAA 3LHPH 2H6PA 3GMQB 5GGRB 5GGVH 5ISZB 3QIWC 4WV1A 3B2VH 4OZFH 1UXWA 3PGDA 3FJTA 2NYYD 4P3WA 3QYCA 4EXKA 4U6VL 5KSBB 2CRMA 3F6IA 1RI8A 1MJ8H 4CVWA 4ZD3H 1VGEH 1RU9H 1XGQA 3I84A 1T21A 3MROB 3QIUC 3IXTA 2AJSL 3O3EB 4YHZL 2Z93A 1KGCE 1SYVB 2OR8A 2IGFH 5C7XH 3DVGA 4JQVC 4YE4H 1CFVL 2NXZC 1IKNC 4LLMB 4JFEA 1OAXL 3ARSA 4I18B 3CFDB 4GG6A 5T1DH 1RZKL 4GBXD 2VWEE 4MCYA 1FBIH 1KCRL 4UBDD 2CLVA 1KTDA 3OKDA 4K3EL 3QUYD 1JNLH 1B0WA 5DEFB 1YEIL 1R5WB 3TA3C 1KIRA 4PS4H 4OF7A 3WO3B 2B2XL 1TITA 3FO9A 4CN1A 2NR6C 1HDMA 1LQSR 3V8OA 1MVFA 4MB3A 2GFBB 4KHXH 1HILA 1A6ZB 3ECBB 3IFNH 5TQ0H 4OCXL 4U05A 1QBML 3OGCB 1X5LA 3HG1A 1Q9KB 3GSQA 1L7IL 4OZHA 4P5TD 2N7AA 2HTLD 1YMMB 3TVMB 4YO0A 2FEEL 1BQHB 4WI8A 4LKXA 4Z76B 4PJ5D 4HFUH 1R6VA 4NQEA 2LU4A 5GS1B 3MLTA 3MSPA 4LVOC 3B6SA 1WBXB 4UB0H 3OAUL 1PKQE 3QDMA 1T66D 2HWZH 3QNYB 4GS7C 5BS0B 5C0EB 3ARFA 3QI9D 4I4WB 3S8WA 1I3GL 2G5BB 3HUJB 4L4VA 4PYGA 2CQVA 2F54B 2YD8A 1OVZA 2J8HA 3KPMB 1E6JH 4XAKE 5F97E 4XC3H 4YPGB 3W82A 3P9MB 2GT9B 1JWMA 3OKNA 1E4XI 5E1AA 2V17L 3E2HC 1BHGA 5SWQB 5GS3A 1I8IA 3TV3H 3W9EB 1FC2D 4E41D 1BREA 2R1YB 3OSKA 4Y4KC 5DK3A 5J13C 4PJDF 3TGXA 5MENB 5GIRB 4QY8A 4DKAA 1WAAA 4M9OA 3GSRB 4UAOC 1TVBB 1MUJA 4ODBD 1EHLL 4YWGL 3MLYL 1P4IL 5BCAA 3D0LB 3C6SB 3OGOE 4EDXA 1OAQH 3GB7B 4WFEE 2DQCH 5GSRB 1E4JA 2I5YL 2FGWL 4CDGC 3EYVA 4POUB 1QFPA 4TVPD 2GJ6B 5D7JC 3V6BR 4P2CG 5C8JB 5D70L 4YC2C 2HAZA 3V6OE 2L7UA 3D3VE 4KWUA 3O9WC 5TDNB 4MQ7B 4ODTL 5D7LA 2QHRH 5J11C 5HHOA 2YRPA 4AENB 1E28A 3H9YA 5I1JH 1YQVH 5H35B 4YBLB 1U42A 4GO6B 4LLAA 5EZIL 1G7QB 3GMRA 3GK8L 5ADPL 4KK5C 4ZQKB 1IEHA 5FYLD 4I3RH 4AH2A 1GGBL 2Q86A 3O6FD 2VDLH 3RKDD 2RJMA 5CJ8A 3AGVA 2B4CH 3ARQA 2Z91B 3T4YB 1KXVC 2OZ4A 4HIIB 5BJTA 3NACL 4JM2C 5E6IA 1BQSA 5IHZA 2R1XA 3MUY1 1WIPA 3DJ9A 2E9IA 4JFHD 3VRIB 5EULV 2AI0H 4U1KA 4AQOA 1OGAD 3BQUD 1U8LB 3CFBB 5CJ5A 3V0WH 4B53A 5HPOA 1T5WB 5I2IB 2FJHB 5BOPA 2MWCA 5E9DD 5HDQL 4H1LB 4PB0H 3RZCC 4JO4H 2VXVH 4MAYB 4JFXA 2Q1EA 4XCNA 4GQ9H 4QYOB 5DHVB 1MCDA 5DMGC 5ESAA 1S7SA 4XC1L 3ZKXB 4YDJB 1MJUH 1P4BL 3V52H 8FABA 4QXTA 4NN5B 4CVZA 4OUUA 1MH5B 5F7EH 3ULUE 1DEDA 1JZ3A 1YN7A 1IAKB 3ZMRA 4C54A 4UUJB 1LDPH 1IC4H 4IRJD 3S88L 2ICCA 4TUKH 2WV3A 5F1SA 1SEBA 1A6VH 1MIEH 4MA7H 2NZIA 1XF4B 4KUCF 1OWRM 3OR6B 2OZ4H 5E2UH 3O8XD 5H2BA 5AZ2H 4Z7QE 5TE6H 2FBJL 4OLYH 5IV2A 2X05A 4HMCA 4EJ1C 4OV6F 1BQHG 2FJGB 5BRZB 1FO0B 1CFTA 2WNGA 3MREA 3ARGD 1F90L 1HQRB 5FM4A 1YMHB 1NQBA 3GUTB 3P11H 1QVOB 2W92A 3C2SA 3TO2B 3GKZA 1BVLA 1OTTC 1YDPA 1TQCB 4U1LB 2V9RA 1IQDB 4LPCA 4DTGL 3MRBB 2YC1A 4YBQC 1TTUA 3RNQA 3MXWH 4U1IB 3P4OA 4M62L 4D3CH 4PJHA 4CAGA 5KN5B 5F9JA 2ICWB 3FRUA 1ZMYA 3F7VB 3CK0L 1UYWL 3L1OL 4JZNA 3ZTJH 4Y5VC 2NX5B 3MYJA 5EUOA 4FFYL 1NCTA 1HHKB 1T0PB 3O6MH 4PJHF 3QDJA 1WBYA 4AIOA 3S97C 1AJ7L 3WSQL 3T1FA 5C0CD 4PV9B 3EKCA 2ED7A 4S1SL 4ONFH 5CAYB 4QXGH 4F7CB 3S37X 5ADOL 1AP2A 3UC0H 4LP5A 4Y1AA 2FDBP 4WHTB 2B1AH 4PJEE 3U7YH 3WN5C 5A2JH 1K85A 5DO2C 5A2FA 4KI5C 4MA8L 4GMTH 4CBPA 2FO1A 2X5PA 3KPNB 5C0BE 4GKZB 1NKRA 3LKSA 4PJIA 2BDNH 1H8OA 4CADB 4QF1B 5F21B 1X9QA 1DVFD 2K3TA 3QIBB 4J3VA 4S1QH 5GS0H 2CO6B 1S7XB 4QRPA 4OI9A 2JB5L 3LS5L 3CH8A 5A43C 4PGBB 5IFAL 3HPJB 1VFUA 4LIQH 4IDJL 2D4FA 4XGZA 5D6CA 1DQMH 4P4RA 9CGTA 3IDMB 5M94B 5BV7B 4XVUD 1KB5B 4U0QB 2E9JA 4GAGL 1FJ1A 1REIA 1BIHA 3QDGA 5EO1A 4QHUB 4Y5YA 4GAYB 4YHIA 5I15H 1GCFA 3GO1H 3WFBL 3GMLB 4QNPF 4U6YA 2IADA 3OAYK 3KR3H 1FNGA 5IW1B 4H1LG 3BE1L 5IOPB 2W9EH 1C12A 1R3LA 5C0RL 2WUBH 5L88L 1S78D 3HB3C 3BDBA 1CLYH 2AQ3A 4UOW1 3TBVB 3WXVH 3BMWA 5IMMA 3FO2A 5DURB 4QRUB 4ZNEA 4PB9L 1UZ6E 3RL1A 2X44D 4HUVB 1ACYH 3CXHK 3VFSB 2CK0L 5A16A 1HYRC 4ZPTA 2O5YL 4Z0XB 3AS2A 2W0KA 2HT3D 4PPTA 4UT9L 3DSFL 5HYSG 1WCBA 5DGRA 1S5HA 5CLWA 3P9LB 5MEPA 4WHYG 4L8CA 3U1SH 2R4SH 4Z78A 1SMAA 1IBGL 2PCPA 3D0VA 2DM7A 4LLQB 2ARJQ 3B9VA 4IIQC 2EYTB 3OX8A 1MQKL 1ZHNB 3W0WB 2MHAB 1CL7I 1INDL 4L3EE 5T1KA 4JO2H 3AB0C 4Y2OA 1XF2B 5DT1L 3HMWH 3QDMD 4LOUD 4RWYH 1SBSH 5IBUG 3GRWL 3ARFD 4NFCA 4JQXC 1J8HA 2IJ0C 3QEGL 4WWKC 5DZNA 3BDXA 4QGTA 4L4VD 4F33B 4YHML 1F4AA 3SDCC 1VSCA 1J1XL 2D7PA 1RZKC 3C60A 3ES6B 4QWWC 1MCWW 1T2QH 3DYPA 4PJEB 4C56E 3NABH 4NZRH 2AJUL 3MZTA 3O3DB 4ZDHB 2X2YA 1QFWM 4JANB 1EO7A 4KDWA 5IEHA 5F3HB 4GRLD 3VD7A 2C1OA 4GAFB 5DJYB 4M6NH 3WHE0 5F6HI 1U8NA 1LEIA 3KLSA 4HAFA 3GHBL 2WW8A 1I9IL 2VXSL 4XPTH 4XMPH 1NBYB 2OQJB 1BFVL 4YR6A 4D0CB 5DVMA 3G5XB 4HUWB 5I1DA 4U1NB 3SQOH 4LQFL 1SY6L 3JTTA 4XVSL 4MX7B 4OSUH 1IL1B 1AGFA 1F4XL 4OCWH 4OKDA 3PQYB 3D85B 5C0IB 4G80A 1ZLVK 3V4VL 1BD2E 1S9VA 5IQ7H 1X5HA 1YNTA 4OCSL 4I0PB 3VFGL 3WFHA 3QULB 1LD9A 4DFHA 1WUNT 3LKOA 1FDLH 4FTVA 2DYPD 3EYUL 5J06A 1YPZF 4Z7UF 2ATKA 1EMTH 3HE6A 4WTWA 2YPLE 2PR4H 2ZUUA 1INEH 5F89B 4FRWA 3JV0A 3KGRA 5F72S 1S5IH 3BUYA 5B3JE 2VERN 3K0WA 5DMJB 5B4MC 4LARH 4I5BB 3FQXB 4PIRF 3THMH 5E5UB 3PGFH 1DLHB 3NCMA 5FECA 3M1BA 4R2GD 3B9KA 2ZUXA 2WUCH 5ENWB 5B8CC 2OJEB 1RIVL 1FO0L 2YOCA 1NBVL 5D7IB 2W0LA 1XGTB 1ZSDB 2VQTA 3IFLL 3H6JA 4Z5RA 5HYIA 3MA7B 4Y4FC 1ED3B 5LGJA 2EEAA 3RVUD 2V2TA 5E7FA 5FYJL 5DUMH 2BY0A 1F42A 4FNLL 1D5IH 2WP3O 3DYOA 1S7VB 5IB1B 1JWUA 1TDQA 5J3HD 1IQWL 3MRDB 4P23D 1BQLL 2X4QA 3CZJA 1OLLA 4K3JH 3SKJH 3AU1B 3PGCA 4P46C 3DIFB 3VG0L 1P84K 4R7DB 3QDAA 1U3HB 1S7WA 3LRSB 3RNKB 4YZFF 2Z31D 2PW2A 4HWNA 3QFDB 4E9LA 3KPTA 1QFWL 4GSDH 2P5ED 4NC1C 4FQ1H 3JUZA 2Y36H 2EDTA 3VXSB 4RRPA 3DWTA 1PLGH 4MCZB 4WW2F 2XQBH 1RUPH 5J8OA 2QADB 3SDYH 5C0JB 3RVWC 3DUUA 3OBAA 1RZFL 5I17A 3PL6B 1ND0B 1RZGA 3H3PL 4FQXB 4O9HH 2AQ1A 2DDQH 1FNEB 1EFXB 1L0XA 2C3XA 5I0ZA 3MOBH 4EDWL 1TQBB 3VGDA 3HI1B 1RHFA 4UT6H 3WD5H 4LCCB 3VE0B 3MV9B 2QQLH 2VDML 1JWSB 3C09B 4G7VH 4CGTA 1RZJL 1S9YA 2YD1A 4PJ5E 5DJ8A 4MD4B 4PBVC 2ZKHH 1AD9B 1EAJA 4WNQB 2H26A 3K2UH 1M05B 2NY6D 3OXRA 3ULUL 2EXYC 3VFWA 2YPLB 1FL3A 3NTCL 4W4NA 1B0RA 4XP9H 5BV7L 1MREL 1PG7X 1KB5L 3SCMA 5JXEC 2MJWA 4KU1A 4JPKL 3VRLF 3DNKA 1OW0C 1LP9F 4K2UL 4XWGH 1EUUA 4PJ8C 1VEPA 2DMBA 2A83B 1MAMH 4NNXA 3UPRA 4E41E 3KJ6L 1QLRB 3SKOA 1AGBA 3L5IA 2VDRL 3BXNB 3RGVC 3CGTA 4LEOB 4L8SA 4Y1AD 4LASL 4WI5A 4TOYH 4YHOH 1NJ9B 3MRJA 1N59B 3KPLB 3QJFA 4L3AA 4LVHB 5DFWH 3JVGC 4NBZB 2NW3A 2FR4A 1UGNA 4TVPE 3CPLA 4HGMA 2PO6C 4G6FD 3ETBF 2ZCLH 3KYMA 3QXAB 3E6FA 4I77H 4QRPD 2ADGA 4M48L 5HSFA 4M5YL 4KHTL 4YX2L 5C08B 3GJFA 5KVDL 5ILTL 2DQGH 2FL5A 4TTDD 2X70B 3BX7C 1KN2H 5D2NA 5C3LD 3N85H 3F62A 3P40A 3VDCA 4URTB 3UJJL 3A67H 2RBLA 1QR1A 5FYLE 3IDIB 3C08L 4RZCA 4KI1A 4HJ0C 4N5UA 3QUYB 3ELAT 1A9BB 1FGNH 1OAYH 4XPAH 4I18C 1BEYL 2IFFL 5C9KA 4ZS6D 3V4PH 5EOCH 4JFHE 1KG0B 4WO4C 4RGND 1P7KA 1OP5K 1OGAE 1S9WB 3BN3B 4LLDB 2Y1VA 2D0FA 1IGFL 1JTTA 5LAXA 3KWWB 3Q2CA 2V2XA 2HG5A 1NC2B 1HKLH 3FB7B 5E9DE 2GQHA 1M7DA 3HN3A 1UM6L 4RAHA 1WTGT 1FVEB 1MHPH 4JFQA 2CUIA 3BP6B 3T3PE 3WNLA 4PJ5B 1ERNA 3GJFH 1JCKA 2XA8H 1MHCA 3MNWB 4KPHH 4JVWA 3TVMC 2GTZA 3WBDA 4KTDL 4HK3J 1K5NB 5D2LA 3DMMB 1BJMA 3EOAB 3BD3A 1UXSB 1D5ZB 1HWGB 4OFYA 4JFFD 5GS1C 5T5FL 3I6GB 4U1SB 1JGVH 1CD0A 5JW4Q 4HWUA 5L2KA 1QSED 2J4WH 1EHAA 1AD0B 1HI6B 4XNYH 3WMSA 2VIRA 5CZKA 4NN7C 2EEDA 1RZ7H 1T0NA 1ZWIB 5E56A 3W11C 4F9PC 1C08B