4IRJD

Structure of the mouse cd1d-4clphc-alpha-galcer-inkt tcr complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
b'AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Enhanced TCR footprint by a novel glycolipid increases NKT-dependent tumor protection.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 63
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irjD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irjD02
3QUZD 5LGJA 3QPXH 5BOPA 5I17A 1X5KA 3MXWL 3SY0A 1AI1L 3QWRA 5JHLH 1BX2B 5FO9B 4YHOH 3GMPB 1SEBA 2E9IA 4NN5B 3RBGA 1V7MH 3E3QC 3T77A 4KI5E 3BEWA 4DZBB 4WI7A 3DIFB 4OCLC 4XBPB 3UJTL 5C0BE 2R1WB 1RJLB 4OCXH 5LG1A 1GC1C 4XNXH 5C8JB 1GYAA 4NPYA 4XPGH 5I8KL 1G9NL 4V1DB 2E6JA 2Z9TA 1WC7B 1G6RH 1RZFL 4JPKL 2AK1H 4YFEA 5EPMA 1ZTXL 1NUNB 4HH9B 3O0RH 3BYYA 2RQ8A 4QXWA 3QWOB 5TDNB 4YHZH 5DFTA 2XNAA 5GGSY 5IGXH 4MDJB 4LP4A 1YMHA 2NY1D 2WBJB 2X44D 2E7CA 3HN3A 2VLKA 3MV11 1P7QA 1ETZB 2DLHA 3LD8B 3UX9B 4HUXA 4MB5A 2UVFA 4Y4HB 3RI5F 3TVMA 1FAIH 1KOAA 3OPZH 2HH0H 4NRXA 4G3YH 5CBEA 3S4SB 4KJQC 3V95A 4DJMA 1RZKH 5DVOA 3P0YH 3ULUD 5HDBF 1QPPA 4KK9D 2BSSA 2P46B 1ZWIB 1ZLWH 4ZNCD 3ALWA 3VW3H 2YMXL 4H8WC 1T7WA 1MCFA 4KJQD 4O9HL 2O5YL 1JGUH 3KPOB 4ODBD 4WVRA 2H32H 5JDJA 1K6QL 3O3DA 3TBVA 1HN1A 1XCQA 3UBXA 4LSQL 1GJIA 5L2KD 4Y4KB 1NLDH 4PJBF 1N59A 2CDFA 3WFCH 2D03H 4QOKE 4K8RL 4K9EC 3KLAA 2FWOA 4Q7DA 1KPVA 1NL0L 4QY8B 4S0TD 1P1ZB 4L3EA 5E4IA 3FN0L 4U49A 1BWMA 2AEQH 4HBCL 3DETC 4KK5D 1YEJH 2A83B 1KG0B 4OLWL 4F57H 2DQDL 2WW8A 2ID5A 5DQ9A 4ERSL 1MHEA 3P77B 1UWXH 2V17L 3DETD 1MFBL 4IRJB 1B9ZA 4WO4A 4LCWB 3D39A 4ETQA 4ZO7A 2GT9A 4U6HB 3JTTA 5T5NG 3QXTA 4I0KA 2QSVA 5ICYA 5IHLB 4P5TA 3DX9B 1E6OL 3F12A 2Y23A 2WK2A 2N7BA 1I1YB 3X3GH 3PGFH 2DQFB 2VE6A 5J6GA 2P49B 2VL5A 1QFUL 5I1HH 1FCCA 3U9PL 1OPGL 4YE4H 3QXAB 1EEQA 2A1WL 1KN4H 3M8OH 4Q9QL 1XR8B 4WI9A 4OCRH 3PWVB 3BVNA 3MQIA 3RDTA 3EDEA 4JDZB 4JZNA 1KEML 3CVHH 1OTUC 2FNBA 4ZXBC 1NSNL 1QSFE 4HG4K 2M8XA 5CGYC 1A47A 1OTUD 3DXAD 5I16B 3TBTB 4ZXBD 5CCKH 5DUBA 2EE6A 2XACC 5C0GB 1G7PA 1P9MA 4XNQB 2ATKB 2PYEA 5DK0A 4HV8A 1FCGA 3V0AC 1N64L 5CGTA 4B50A 3O3UN 2DQCH 5DMJB 1U95B 4BK5A 12E8H 1PEWA 3V8CA 4JFDB 1PLGH 4O5LL 5D1XA 4HKJB 5FYKE 1PG7W 1AGCA 1RD6A 4Z0XB 3QWRD 4HGWA 3X13B 2OTWB 4LGSB 1TITA 4NO0A 1Q0YL 5BW7A 5IVXB 3DX8B 3TBWA 2V6HA 1XZ0B 1PQZA 3NFSH 4X80L 4YDJB 4F2MA 4PJ7E 1AO7B 5C6TH 1MNUL 4EUPB 2W07A 1K4DB 3VGDA 1GZPA 4JQVC 4PRAB 1TNNA 3QDJE 4YC2C 2GUOA 5DZLA 5CFHA 1FO0A 3RAJL 2AQ1A 5J57B 1MI5E 4HGMA 1INQB 5JORA 1T7XA 4U6TA 5KSVA 2IALA 3O3BA 1X4YA 3MNZA 4HPYH 2VB5A 5EA0L 4OF5A 1LE9A 3H9SD 1II4E 4LKXB 1QD0A 4WIQA 1A9BA 3GSNL 3BPOC 4NT6A 4DGYL 4NKMB 1MQKH 4OV6F 1MLCB 5I0DA 1HSAA 3NIFF 4EN3A 2CIKB 3EFFA 3PQYB 2NX5B 3VXUA 5HHPB 3AS2A 1XF3A 1ADQA 1D6EA 3L7FA 4J3UA 5F9OL 5DJYA 2ZOKA 5K93A 3M17A 1TTGA 3ZTNL 5BV7B 5KW9H 1HYSC 4KC3B 3LS5L 2O5XL 3BQUB 4P46A 3SJVB 1NGXA 3TVMD 3S88H 3CFCH 4UBDC 4UUJA 1RURL 1X5YA 5FKPB 2EC9U 1IEHA 4XGZB 2Q8BH 3F7PC 3V7MA 1NFDB 1E4XH 4LPTA 3ZT6A 1ZT7A 2ZUYA 2FJGB 2XV6B 5GZND 1JHKH 3ARWA 3RWIA 5F8RC 1N4XH 3LV3B 3OAUH 3BSZL 3OGCA 3OJVC 4MSWB 2F54E 4LLMA 3BW9B 3Q5TA 2RR3A 5FYLE 3NZHL 3VFWA 1AP2B 1TFHA 3FO2B 4JLRB 3VDCA 4BQ6A 5ICZA 4OGAD 1IAIL 3MUGB 4JANB 4FXGB 3UPRA 5IK3A 1T04B 4PJDA 1G6RB 4FTVB 4RAUA 4B5EA 4JREB 2B2XH 4L3ED 1CBVL 1F2QA 4GRLC 4OSUH 1QSEB 1ZAGA 5FYJD 2I27N 4AQOA 1A64A 4JFFB 4PJXA 4G6JL 4F7MB 4GRLD 5FECB 4CW1B 4GUPB 4WO4D 4PJ9C 4P5TC 1FDLH 4ZSOE 5ISZA 3T1FB 1FNGB 4LNRA 2R1XB 2JCCB 2NMSA 2I5YL 3VFSA 4NZUH 2BNQB 3T8XA 3N85L 5H35A 3QZWA 1FLTX 5EOTB 1D5XA 4PJ9D 4P5TD 1XGUB 1EIBA 3B43A 3T65A 5CJXA 3QQ4B 1SY6A 2YD6A 1HZHH 4P4RB 2NXYC 4X6CE 2EH8L 5CD3A 1C7SA 4NKOA 3HMXL 1AR1C 3RDTC 3IS1X 1M1SA 2LAGB 2A38A 2NXYD 1BAFH 3RVTC 5IW1A 4Q0XH 4KZEH 1NDGA 1OAUH 2VDPH 3P4NA 1CZ8H 4KJYA 3RDTD 1NMBL 4OUUB 5DRZA 4ZUWB 3L5XH 4G80A 2UV3A 4K55A 1KCVL 1NDMB 5GRUH 4ZQKB 1RIUH 5A3ID 5F7UA 2AK4B 1W0VB 2BVPA 4O2CB 1TVHB 4K3DH 2HKHH 4XPBL 3SDDB 1LEIB 4C54A 5DK2A 1DBKH 3ULUH 4JAMB 5B38G 1JRHH 3LQAH 1KYOJ 5DVKA 4MAYC 4RAVB 2D3VA 2GTWA 2MPAH 3DLQR 4KTYA 1FN4A 3KLSA 3MROB 4FFZL 5BW7C 2HAZA 4ENED 4J3VA 4XXCC 5D1XD 3P9LB 1N0XL 4WTWA 4WJ5B 2VXQH 4EI5A 2X4PA 4NHCH 1VFOA 4LEXH 4NO0D 2SEBA 3T0EC 3CDCA 5I15H 4PGZA 4AL8H 4AM0A 1YEHH 4GOSA 4NQEB 3S37X 5L0QC 4XVUC 4UOJA 1A7NH 3T0ED 1F6FB 1QQDA 2HFTA 1VFAA 2CDGB 2E7MA 5DVMA 2R15A 1XAUA 5HXMA 4UAOB 2J8OA 4UT9H 4ORGA 3WIHL 2FJHB 4XVUD 4Z78A 1WFTA 2NY2D 3MFFA 4LLUA 2EKJA 1F3JB 1YN7A 3MACH 4OZHB 1FE8H 1CICA 1U8JB 1JWMB 3NIDF 3S96A 3UYRH 3MYJB 1QFOA 5GS1C 1X5IA 4Z7OF 4E0RA 3QA3B 3QO0B 2F19L 4RGOL 4EN3D 3K4ZA 1SYSA 3MUY1 4JRYE 1DANT 4Z7QE 2R69L 2YPLE 3B3IA 4ONOA 4U1IA 2JJTC 4DUXA 4Z7VA 1QBMH 3G6JB 4JQXC 2MWCA 4Y8AA 4I1NB 4LEOA 5TQ0H 5IKCA 3QPXL 4OLEA 1NCDH 3QUMA 5JHLL 2BP3A 4ZUUB 4YHOL 3IJYA 1G6VK 1WJ3A 3PWNB 4X7EC 1V7ML 4N1EA 3RNKA 5EO9B 3IFPB 2APFA 3DWTA 1C08B 1JI2A 5JMRA 4GS7B 1QFPA 4U33A 6FABL 5F7DB 1QLRA 2WQ8A 3L1OH 3IDGB 3VD4A 4HMDA 2V7HB 4OCXL 1Y18B 3VXQA 1VSCA 2Z4QB 4AH2A 4XNXL 4UIKH 4XPGL 1HQ4A 1FORH 5C9KA 1BF8A 3UBXG 1KLFA 4I2XA 5F72S 4J4PA 1G6RL 4D9RE 3S3JA 2AK1L 3O0RL 4Y19A 4G42A 4X7TA 2DF3A 5CKAA 4PJIF 4J3TA 4L4TE 4KAQH 4Y4FA 4HIJB 4YHZL 3QEHB 5IGXL 1Z9MA 5JW5A 3PP3K 5ISZD 3EJYC 1UEMA 5CJXC 1BZ9A 5A2LH 3KAAA 1ZSDA 3EJYD 3VRLE 4NZDA 3WLWC 1FAIL 3OPZL 2HH0L 4L3CA 4G3YL 1RFDL 1RZKL 3QXUA 3P0YL 1UKSA 3O41A 2UUDH 3EO1B 5MI0B 1V8HA 3VFVA 4YH6A 5AD0B 1FC1A 3X11B 4PRHB 3TF7C 3VW3L 3LPFA 3WIIH 2JKXA 1JGUL 1BBJB 3U7AA 3QQ9C 4PP2B 4NQCB 1IAKA 1NLDL 4Q6IC 1T5WB 1T89A 1FNFA 3IDNA 4ZPTA 5IWLA 4NNYB 2GSGB 3WXVH 4N9OB 3WFCL 1P84K 3QQ9D 4OJFH 1NEUA 5EBWA 1KENH 1XIWA 3IXTA 2CXGA 4NJ9H 7CGTA 4PG9A 3TN0A 5C0FA 1K8DA 2AEQL 3D2UA 1YEJL 2I9LB 1GGCH 4JN2B 4U1JA 3FO9B 4F57L 2CD0A 5I66A 4J3WA 2EDBA 3GMMB 4ODWB 1R5VB 3LKOB 1FZJB 3FAWA 4ZOCA 4LVOC 5F1OB 1XH3A 1TVBB 2DM4A 3REWA 1VA9A 2FD6H 3GHBH 5LCVH 5SX4I 4CNIB 1YNLH 5D6DC 1O5DT 4ZYKB 5I1GH 3QDJA 1EEZA 3MLZH 3VFMB 3LKPA 4RAHA 3X3GL 5BJTB 1IGYB 1WQVT 3NFPB 5I1HL 5INCB 3ZKQD 4YE4L 3QXWA 5FYJH 2EDHA 4MX7A 2XXCB 2F53A 5E2JA 1KN4L 3M8OL 4CDHA 2KBGA 2X4SA 1XF4A 4OCRL 3UTPE 3ZSSA 2NY7H 3KLDA 3CVHL 1Q1JH 4Z5RB 3PXJA 4U2ZA 4CU7A 2VTFA 4YBLC 4R7NB 2E8ZA 5F3HB 4ZFFB 1F11B 1FIGH 4ORZC 5CCKL 4HT1H 4NSKB 4AT6B 2WWKO 3I6GA 5JTWA 4G8IA 4QTHB 1QFWH 3F7QA 2D7QA 5JW4Q 4Y7MA 2AJSH 1AD9A 2VKWA 2VDOL 1XGTB 4JFHD 1Q9WA 2DQCL 1LWRA 4LLVB 5HGDA 5KTEL 12E8L 2GW5A 4KUCD 3Q0HA 1PLGL 1NLBH 5C3TA 3WFBH 1X6LA 4X5XA 3HZKB 1AD0A 1B3JA 2W60A 1IEBA 1IM9B 4PTUA 5ACLA 5ERWA 4KU1A 3BZFA 3NFSL 4XAKE 1RK1B 3HR5A 4JRXB 4O58H 3DJ9A 3VFNA 5C6TL 4N5ED 5J6HB 4M62H 1KTKE 5FEBA 4G8EA 4X6EA 4LHUG 3AC0A 2BMKB 4OM1H 1XF2A 1GAFH 3KPLB 1KBGH 4MJ4A 5D2NE 1CD1A 2D31A 3WIFB 4NP4H 4U6XB 3GJFA 4HPYL 1ZHKA 1UH4A 4WFHD 2DBJA 3L5HA 3G6AB 3BP6A 4UT7H 3JWDH 3B2VH 5KVGH 4J4PD 4FZEH 1CWVA 1MQKL 2GJZA 5J89A 4RMTA 1K2DA 2W0FA 4Y19D 3DTXB 5DDHA 4KJPD 4Y4FD 4DWHA 1BJ1J 3HPJB 1CL7I 4KKCC 4KROC 2F15A 1INDH 4TULH 3ZYZA 5KW9L 1XGQB 3OKLB 1CLCA 4R0LA 1FO0H 4JHAH 4CVXA 2DQUH 3C5SA 4YUEH 5EU6E 4KWUA 4FQHA 2PXYA 5FXCH 3VG9C 1IC7H 3N0PB 3K1KC 3S88L 2IH1B 3NPSC 3RUGA 3CFCL 4FQ2H 4NHUA 2NW2A 3VCLA 2Q8BL 3ALXA 1E4XL 2CKNA 5IUSA 1HYRC 3AM8A 3QZWG 3ULVE 1JHKL 5J1AB 3DXAB 3TBSA 1N4XL 3V5DB 4ZXBB 3O81A 3OAUL 5CEXA 4LCYB 1FFPA 5IVXF 3VWKA 5IG7A 1ADQH 5E6ZA 1B0GA 4A2LA 3FRUA 4IOIB 5DMGC 2ZUVA 3TPUB 1NFIB 3SE4A 4JM2F 1PZ5B 3MRCB 1P5VA 4YHIB 3TN0D 2B2XL 2IBZY 4Y2DC 4OSUL 1JYXA 4U6YB 1YC7A 3D2UD 1REIA 1KT2A 2NW3A 4EDXA 5L88H 5EC1A 2ATPA 4G8GA 2HLFD 5EOCH 4X7FC 1FDLL 5F7HA 3MRQB 3CC5B 2MCPH 3PHSA 3DECA 4NZUL 1SJHB 5GZOC 4LKCA 4PLJC 3UTTD 2OI9C 4CBPA 1G7IB 2G5RA 2RCSH 4YC2B 4C83B 3H9SB 5E6IC 5GZOD 2A74B 1HZHL 3QDJD 3DARA 4PLJD 4E42A 4UINH 2DI9A 4U0RC 3V2AR 2GEEA 1CD0A 5E6ID 4I0PA 4OCMC 3BPOB 4DK6A 3I9GH 1IVLA 1BAFL 2F53D 3S5LA 1NFDF 5IESL 1XEDA 2FB4H 4Q0XL 1X7QA 4KZEL 2VDPL 4QRPB 1CZ8L 3QIBA 3TCLB 1K3IA 4CJ1A 4S10A 4NC1E 1GHFH 4QRSA 2VXSH 5JA9A 3L5XL 3O6LL 4NNPL 1TETL 4JRYA 5GRUL 5EUOA 3MCG1 1RIUL 4HAGA 3DNKA 4G9DB 1PG7X 2IAMC 1H3PH 4K3DL 2HKHL 1SY6H 1DBKL 3ULUL 4MGXA 2BY2A 3MNVB 2IAMD 4NRZB 1JRHL 3LQAL 4D9QE 4Z7UB 2FEEI 4MMZC 1LO5B 2BNRA 2MPAL 5BMFH 3LEXB 2ZUQC 1HSBA 3EYQD 4J6RH 4N8VB 2C3VA 1WLHA 5FO8A 1KJVB 2VXQL 4LDEB 1IMHC 2YA1A 3FT2A 4NHCL 4WWKA 5KS9B 4LEXL 3ARFA 1G9MH 2JCCF 2UWEF 2FLBT 3HB3C 5SWZA 4AL8L 5KAQF 1D9KA 4BM7A 1YEHL 4H26B 1I1AB 4RFOH 1HXMB 5K59E 3HE7C 4L1DA 3KDMB 1A7NL 5D72H 1AQDA 4UT9L 5IEKB 3REVA 3ME0A 4GRLB 3HE7D 3GMNA 2CUHA 5MEQB 3MACL 5HDQH 3MX0A 5IMMB 1FE8L 3GZKA 5DZNA 3UYRL 4TRPH 1B0RA 3WBDA 4K3HA 1W0WB 4PJ9B 4NZRH 1S5HA 3QUKB 5D9SA 5EIVA 4G7VH 4UDUA 5ICXA 3S37H 5EBMA 1IAOA 1T7VA 1ES0B 3QCTH 4OKVB 3DRTA 3GM8A 3IVKB 3IJHA 1QBML 1RU9H 4K3EL 4L4VB 2UVEA 2VQ1A 4YZFE 5TQ0L 3TO4A 3UTSB 2PXYD 1D6VH 4YEFA 5JR1H 3U6RA 2VRAA 3BRGC 1NCDL 1U91B 3GSXB 4M1GH 3I6KA 3MBEC 1MOEA 3HUJB 3SGDH 2YD2A 1N6QH 3KJ6H 3KYNB 3NVQA 8FABB 3MBXH 3VWKC 3C6SB 4M61A 1HDMA 5D1QA 1M71B 5D70H 3LKSA 4JJ5B 3HAEG 1OY3B 1Q9OB 1CIUA 2B5IC 1BFTA 3VWKD 2DICA 3L1OL 5EZIH 1G0YR 3C8HA 1U93A 1S7WA 3VDAA 4UIKL 5JOFA 1FORL 3VFRA 1I3GH 4K3GA 4ODTH 1M6OB 4MAYB 1YYLH 3HZVA 3HKFA 3G5ZA 1VKXB 3QUMH 1G7LA 2G75A 5FO7A 5ITFA 4M7LT 1JMXA 3HNSH 4OZHF 4XB7A 4KAQL 4LL9A 2LE9A 5BVJB 4G8GD 3HNTH 3OHXB 1A1OB 3TM6A 4TSBH 1DDHA 5ABDE 5BQ7B 3T0EB 1F5WA 3KYMA 3CH1B 3MLUH 5L0QB 1CGUA 1S7VB 4PV9A 1P4LB 1SJVA 4U31A 4GBXC 5HPMB 3VXTA 1O7VA 1BWWA 4IHOB 1OP5K 4MJIA 4HF5H 4JVWA 2YA2A 1WBZA 1QR1B 3EYVA 3OXRA 1HCVA 2YSSB 4W4OC 1K4CA 1KIRB 1ZGLB 5DA0B 4HHAA 3ZE2E 4I0PD 3EGSA 3WIIL 4XCYA 2ZCLH 4IIQC 2OSLB 2FGWH 5GS1B 5DEZA 2I9TA 4QRUB 4KDTA 3MGTB 4XPAH 3QIBD 3C87A 3OR6B 3WXVL 1J05A 1KCKA 4QGTA 2X7LB 1RMFH 1U2CA 3K3QA 4OJFL 4TVPE 2DD8H 3DYPA 3ZMRA 4EKXA 5I1CH 5ALBH 4C56E 4TUJB 1KENL 3D87B 1LNUA 3G9AB 4NJ9L 1YY9D 4CRPA 3P9MA 1GGCL 3VRIA 2YRZA 3HRZA 1FL5B 3CFJB 1MCLA 1NCTA 3QEQB 3OWEA 2BVQB 1I7ZB 3ZSTA 2BNRD 5GSRA 4F15C 3K8LA 3CFDA 3IDJB 4TQEH 1MCPH 4LPWA 4MNGA 1AXIB 1D9KC 3VXSE 1AHWA 5C0DB 2Q7YB 2FD6L 3GHBL 5LCVL 4WWKD 3RY5A 4XTRC 3ARFD 5I1GL 2IBBA 2ADFH 5SWZD 3MLZL 1D9KD 2HJLB 5FUOH 5KOMC 2HVJA 4KXZI 3AROA 2MKLC 1IM3B 2YZ1A 4D2NA 2HG5B 4XTRD 1VFUA 4ELME 2X6MA 5FYJL 3OL2A 5IBUB 1NCBH 2I07A 2A77H 3GSOB 3IB4A 2DLGA 2R2HB 2NY7L 4KTDH 2VISB 1Q1JL 1MH5B 4OGYH 3BP7B 1I7RB 4P9MH 3GUTA 4MD0A 1FIGL 5E00B 2I25N 1BVLA 1H3VA 1MPAH 4HT1L 5K9KB 5IIEA 5E9DE 2WV3A 5MEPA 4B7IA 2WBWB 5DHXB 1QFWL 3SGEI 4QNPF 3E6HA 3QNXB 4S2SB 4GMTH 5JPNB 2AJSL 1MHHB 2EZ0C 4ODXA 2W38A 1F97A 1HKFA 2BVEA 3T4AA 3TO4D 4JCMA 3KWWB 3WFBL 1NLBL 1I4FB 4L29A 4R4BA 2OL3B 2FLRT 1CE6A 1WITA 1DBJH 1IBGH 4PGEB 3KYAA 4L8DB 3MRIB 1HIMH 3JWOC 4Q6IB 4PJEA 2YBRB 5HHVH 5HYJA 3SGKC 1CCZA 2DJ4A 1OD9A 4O58L 5FHAH 1IQWH 3DVNB 4Z76B 4M62L 5IJKC 5CP3A 3L3KA 4PFEA 4PY8I 2HMIC 3QFDA 1OARH 1WEJH 1FNSH 1QSZA 4TUKH 2CIIA 1K8IA 4OM1L 1GAFL 5DD6B 1KBGL 5ACMA 5EOCJ 4NP4L 2HMID 5DD5H 1VADB 1X3DA 3IYLW 4ZFGL 2IANE 3F5WA 4UT7L 1NC2A 3JWDL 5CSZB 1AY1H 3B2VL 5KVGL 2WWMC 4FZEL 2R39A 1E28A 5T1MB 2Y25A 4F7CB 4LVOB 1MFCH 4B41A 3CUPB 5JOPE 3A6BH 3LRHA 1FZOA 4P2RE 4WEMB 2CKBB 3EO9H 3FRPA 3L5WB 3RPIA 1BF2A 5IMKA 1KF9B 2DIAA 3SCMC 3ZL4H 3ILQC 4WFGE 1INDL 3H3BC 4TULL 1U8LB 4TNWK 1HILA 2WLZA 3ULUF 1ZVYA 3O4OC 1WZ1H 3SCMD 2L7JA 5HDBE 1FO0L 4JHAL 4MLIA 4UTBH 2F74A 2DQUL 4YUEL 4GFTB 2RGSA 5E8OB 4YHLH 1IC7L 2CLZB 3GJFH 3HC3H 4FQ2L 3M1BA 4MJID 2CO6B 4LSDA 2PF6A 2BOCA 5A40E 1Y0LA 5DRWB 3V0VA 3VFPB 3KXFE 3VXRE 4LNVA 3F62A 4KGJA 1A3LH 4YBLB 4N0UB 1RJZB 2P43B 3RIFF 1ADQL 3BZ4A 3TFKC 1D5BA 2AXFA 4G43B 1S7TA 9CGTA 1AXTH 3MRRA 3QULA 4RSVA 1ZANH 1JWSB 1LQSR 3DMMC 5J9PA 4XXDB 1AIFB 3LH2H 3UYOD 2XQBH 3DO3A 3TNMB 3SPVB 3KPRD 4KGLA 4BK4A 2E7LA 3GK8H 1D5ZA 2BX5A 4QRRA 1IGIH 5L88L 3V6ZB 5EOCL 1U8NA 1DSFH 2DL2A 2MCPL 3X12B 5TDPB 1HH9A 3C60A 2BVTA 4E41B 5HVWA 2RCSL 4GRWB 3GSUB 5H2BA 1QHPA 3H6JA 5DJ0B 5J13C 1JPFA 3WSQH 4UINL 1AGBA 1ZKAA 5K9OA 4Y5VA 1EA9C 2P8PA 1DBBH 4PJFF 3FB7A 1U3HA 3I9GL 1KJ2A 3MA7B 4PRIB 3U0PB 4YK4C 5L2JB 1X5ZA 3LKNA 2WSKA 2FB4L 2P7TA 3RKDC 4H5SA 3QISA 1GHFL 5C08E 2VXSL 4WI2A 4WW2C 5IB3A 3RWEB 1C7TA 2V5RA 5IB1A 5EU4A 2X05A 4LVHC 4KROB 5AZEH 1W72A 4DKEH 3BUYB 4NQXB 1H3PL 3MJ9H 4XZUA 2EDNA 1SY6L 1EFXD 2ITCA 3PG2A 3MRFB 1RSFA 2VLRE 3QUYC 3OKNB 3VG9B 5E95B 2C1PB 3BZEA 3NPSB 4APQA 2GTZA 2XIDA 1M7IB 5C07E 5BMFL 4P0DA 2XG5A 4LSTH 1T80A 4Q2ZA 4J6RL 5I76B 1HNGA 1LO0H 2B7DT 1VEMA 3V7AE 3U30C 1CR9H 1PG7H 4NO5B 2QSCH 2IC2A 1XGRB 1G9ML 3BESR 5HYJD 3DBXB 3OJ2C 5FAAA 5FB8A 4RA0C 5CSGA 1YEDB 1FFNB 4R7DA 4FG6C 4RFOL 3MLSH 2R0KH 5D7IB 5DYOB 5KZCD 3ARRA 3ZYOA 1A4JB 5D72L 1KTLB 5JW4M 3DOSA 4Y2DB 3GKWH 4Z7NF 1I3RA 4FG6D 5F1SA 5TFSH 5E5RB 4WV1A 4XNMA 3EKCA 3OZ9H 3RRQA 5HDQL 3NIFE 3PDOA 2NY0B 4HS6B 4RBPK 2QADC 4TRPL 1F4WH 4R6UA 1MLBA 2BVUA 3UTTB 4NZRL 1KB9K 5B3JF 4G7VL 5CILH 5CGMA 4Y16A 3S37L 2YWZA 4QHUA 5HI3C 3P4OB 4Y1AA 3QCTL 5CUSH 2OI9B 4LOUC 2K9UA 2CUIA 1RU9L 5E6IB 3SDCA 3SDAA 3AMLA 3Q3GA 4P5MB 5HI3D 1QRNE 5ESVA 5DR5H 3EYOB 5JQHC 1VFBB 1TJIH 4HLZG 1CXKA 5KANI 1D6VL 5JR1L 5DEFA 2WUCL 4Z7UF 4M1GL 5JHDD 1UWGH 3BEVB 3GI8L 5H37G 3CZFB 2RJMA 1CFBA 3KJ6L 1N6QL 2B4CC 2XY1A 5C71A 3MBXL 3DROB 2A6IA 4I13B 4W68A 1EVTC 5D7JC 2OR9H 3IETA 3PABB 5D70L 3TO2A 5KS9F 1F3DH 2OXHA 5F9AC 2NR6C 1BLNA 2IAMB 2YD9A 1A7BA 5EZIL 4XMLH 4G9FA 2Y1VA 4X6DB 4MJ5A 2NR6D 1C5DA 4XCNB 3WE6B 2XXMB 2V2XB 1YJDC 2X89A 2A6KB 2N1KA 1I3GL 2BY3A 5SWSE 4ODTL 1YYLL 3UXFA 4PJ5A 3RL1B 3PWLA 3QUML 3JTSA 3KS0H 2YD3A 2ZUQB 3AGVA 3WEXA 3HNSL 4ZFOB 1I8LC 4QRRD 4GJTB 2X1WL 3HG1B 1DJSA 4NFDA 3M45A 2NZ9C 3HNTL 2ZSWA 4TSBL 3AVEA 1FFOA 3VXSA 1SEQH 5J3HC 2HT2C 3P4MB 3BP5B 3FB8B 3JWOH 2KZ1B 4CAGA 1A6UH 3L3JA 3O9WB 2NZ9D 3MLUL 5T3XD 4H1LA 2HN7A 3C60D 5AWNH 3HE7B 3U9UA 5J3HD 2XPGB 1FVDB 5F88A 3RVUD 1U8QA 4OFVA 4XH2A 2GCYB 1TZIA 3GMLB 2IPKA 1QLFB 1TLKA 4LHJB 1CFSB 5T1DH 4ELMA 3VU2A 1KV3A 2B39A 1R24B 4HF5L 3B5HA 4HJ0D 5IEHA 5DRNA 2MNUA 1C5BH 1KUMA 3RGVC 2QV2A 2XZCH 1A5FH 4NBXB 2ZCLL 2VLMD 2FGWL 4S0SD 5CBAB 4OD3H 5DJZA 3RGVD 4HH8A 5DJ2A 4FS0A 3RIAF 4DGVH 4U3XA 4XPAL 4HSQA 1TENA 2P5EE 1IGTA 1G7HA 5JZ7D 2R29H 1YQ2A 5CWSB 3VFTB 5BZDB 1RMFL 1T3FA 5E9DA 2DD8L 2XTJD 4RZCB 1BQHA 2VITB 4TTDD 5I1CL 3U2SA 1S5IH 3BIKA 5ALBL 5C0CB 4YO0B 4NUJA 3V6OA 2IFGA 3L5JA 2DYPA 1DQTA 1JI1A 1JN6A 4ZPVA 1TZHB 3QNYA 1AGDA 2AERT 2D4FA 2EKSA 3QSKB 3NCEB 3E0GA 3MBEB 4APQD 2NYYC 2VERN 1UXWA 1QFHA 4JZJC 4D0CA 5MEOA 4R26H 3G08B 4TQEL 2Y4SA 3L6FA 1MCPL 2FJFA 2XZZA 3LRSB 4MNQE 2NYYD 2EYSA 5BRZE 4X5WB 4XP6H 3QDGB 3ZKNC 2XWTA 1O0VA 2WIIB 4I48B 4JCLA 4JVPA 2ADFL 4PGDA 1FZKA 4WCYH 4OV5B 3SDXE 1HINH 5FUOL 1GH7A 3DV6B 4KMLB 1S78C 2BHYA 5IV2B 3O6KH 3ZKND 3BGMB 3FB5A 1X5JA 4UZGA 5KG9B 1NCBL 2A0LC 4JFEE 5F71A 5E08H 1LK3H 3NIDE 2A77L 4LDOB 2H41A 4Z7OE 3SKJH 2JJSA 4WUKH 4JDVB 2LVEA 5F7YC 3WNMA 3FQTB 3FL7A 4OGYL 5C9JA 1FZMB 1U8IB 1MHPH 4PRDB 1MPAL 5MENB 1HHKA 3C5ZA 5IJVB 4Y1AD 3PV6B 4TOYH 3FZUD 5HDLA 4GBXB 4AEEA 4GMTL 2X4OA 1FBIL 4N8PA 1BD2D 4P2QE 1ULVA 1QG3A 3CK0H 4I9WD 1I9RH 3BPCB 1T5XA 3R8BB 4IIQB 4S1QH 2XKUA 3KXFA 2FL5B 5MERA 1IBGL 4PJBA 1J0JA 1KJMB 2Q87A 1HIML 3MRGB 5HHVL 4NO3A 1HEZB 3GMOA 2GJJA 5FHAL 2QR0A 2J2ZA 1IQWL 1OGAA 4D3CH 5IMLA 4GG8A 2DWDB 1WEJL 1HKLH 4PRPE 1FNSL 4PJGE 4TUKL 4L8CB 4NCC1 4PBWD 3WNPA 3V4PH 1LE5B 1A2YA 3TT1H 2R0ZH 2Z31A 4R96B 4G9FD 1KPRA 5LJYH 5DD5L 2PW1B 4HJJH 2Z35A 3RI5K 4BH8B 4FXLA 4QRTA 4PJXF 5D7LE 2DQTH 3RWHA 5JPMB 1AY1L 25C8H 4RMRA 4PJ5D 4UI2A 4F15B 4JM4H 1JGEB 1MFCL 5CS7A 1S9WB 2VAAA 3A6BL 3CDFA 3K80A 5EU7C 4NQSB 1IC1A 3OX8B 3EO9L 4NRYB 3ZL4L 3WJLA 4MCZA 2ICWB 1OSPH 1UZ8B 2EDWA 2PYFA 2GIYA 4HGKC 5E5MA 5FDWB 3VXNB 1LEGA 4BKLB 2YC1A 5DRXB 5CP3H 4LMQI 1NAMA 2IADA 3OV6A 2H26B 4FQXA 4PTTB 1WZ1L 4BQCA 5C92A 3EHBD 1QZ1A 3IT8D 4UTBL 5I30H 3S97C 4YPGB 4YHLL 2A9NH 1B0WA 2NY4C 4GLRH 4HX1B 3SN6N 5JXEC 2FR4B 2ITDA 3HC3L 4CN6A 2XN9D 3IU3A 1FHGA 5T5FH 3OKEA 2RHEA 3RTQA 2Z92A 3SKMB 3EFDH 5JXED 2B1AH 3NACH 4GMSH 4HUWB 1KCUH 1PYWA 3L7EB 3KJ4C 3MRBB 2HRLA 1ZA6A 1OW0A 1GGBL 3QIWA 5EC2A 3EZ8A 1IARB 1E4WH 4LRNL 4OFYD 4QHNA 2V2WA 4RDQF 1MUJB 1JHTA 5LBSH 5I2IA 4NWUH 3RVXC 4G8FA 1CG9A 3NOIA 5FCSH 4I3RH 2XQYG 1MCSA 4YHPB 5C0AE 1AXTL 3L3IB 3TIEB 3EJZD 2FRGP 4ZD3H 1ZANL 2R23A 4V1DE 5HHOB 3LH2L 1JF6A 2DYPD 4RFEA 2P8LB 4D0BB 5EO0B 2FATH 3DO7A 1I7TA 2XQBL 3GK8L 3V6FA 2F8XC 4D8PB 1AGEA 2YN3A 5CKGA 1WV7T 5AUMB 4IJ3C 1IGIL 4AJ0A 3AMKA 4XB8A 1DSFL 4NOFA 5KN5B 2YXMA 4MA7H 1GIGH 2B4CH 1OQXA 1RJYB 3DYOA 2G60H 1UA6H 2QHLA 3H2WA 2AJXH 4JEGB 5E1AA 1BJ8A 4P3DA 1LP9A 3NN8B 5FUCE 3WSQL 2YRLA 5H94A 1FIEA 4D94A 1DBBL 1PW3A 2DJUA 2XKSA 4OZGA 1YJDH 3IRPX 2JJSC 2G5BA 1FG2B 1T1WA 5GGSA 2H9GB 3L3OB 3D0VB 1CXLA 3BFOA 4AEIH 2HP4A 4U7SA 1UG9A 5HTSA 3ARDA 4POYA 1JWUA 3SCMB 5EIIA 1T20A 5CZKA 5AZEL 5T3XH 2UZXB 4DKEL 1IJ9A 3DX6B 1AXSA 2VXTL 4LLDA 3DGGA 4Z7VF 1BVKA 3O4OB 3MJ9L 4MCYA 3QHFH 3PGCA 3C5ZD 1XF5A 3TYFB 3DX7A 4KUCF 3VI4E 3P4LA 1U3ZA 1YPZB 3OKDB 3CXHJ 3OAZH 3MRJB 3B8YA 3FFCB 4OZFG 5EORH 1Q0XH 1T1ZB 1F3DJ 4LCWE 1ORSB 3QCVH 4LSTL 5HHNB 3RWGA 1A6ZA 2FO4A 5I1LB 1J0YA 1LO0L 4JPIA 4HIHA 3EYUH 4LSSH 1OB1B 4CMMB 4ISVA 4XP1H 4PJ8C 1PG7L 5D5ME 3UTZB 2QSCL 3LKQA 1VACA 1CT8A 4GAJH 3MOBH 4U2YA 3V4VH 3W5NA 5I1JH 3BHBB 5F7FA 2DDQH 3F7YB 4PJ8D 3MLSL 1OGAD 2R0KL 3KPRB 4GRWF 3QI9A 4PJAE 4YAQA 3VMOA 3DMMB 3U0TA 3GKWL 4OFDA 5SWSA 1LEKB 5TFSL 3QFJB 3QXDB 3HS0A 3L3DB 4WI5A 4JFOA 2Z91A 3OZ9L 1ZLUK 2CK0H 4NZTH 3AAZB 5A16A 4CGTA 3BDYH 4JHWH 3O45A 1NBYB 1WBYA 4RMSA 3QH3A 1D5IH 1F4WL 3C2AL 3D6GA 1I3VA 1KFAH 3MREA 4J1UB 5F1NB 1T6VN 2UZIH 5CILL 4ZUTA 4YDKH 3LRGA 3LKRA 2A9ML 3AFLA 5CUSL 2VLJB 1L6ZA 4YXHL 5C1MB 3EDKA 3MV7D 3AU1B 1T22B 1S7XA 5J13B 3NZ8A 1R3JB 5DR5L 4FQXD 1WCBA 4U6VH 1TJIL 1HE7A 4YFDB 2H45A 1X5GA 3G5VB 5E5UB 1TTFA 1MEXL 2Q86A 2VQTA 4K7PX 4P5KB 4YK4B 5DXWA 3U83A 1DUYB 1UWGL 3O4LE 5ADOH 3IF1B 3RTQD 5IVXE 4M8QB 3TBYB 1MCIA 2YPKA 1N5YH 4WW2B 2OR9L 3CDGA 2P5EA 3VA6A 2HTKC 3F7VB 1EFXB 5B39B 4NKQB 2V5MA 1I1RA 1C12A 3ROLA 1ZVSB 5CEYB 3ZTJH 5BS0A 3CSGA 3OKOB 5IW3A 2Y7QB 2VQUA 1A21A 5HHMB 3QUYB 3ARYA 4NM4H 1VERA 3GNMH 4LVNC 4BQBA 1NH6A 3VD5A 3CU7A 1OF2A 5K9QI 5F6HJ 5K33A 4HS3A 4KVCH 1UXSB 1XGPA 3QAZC 1BQHG 3IJSA 4QTIH 3HFMH 3PQYE 2VLLB 4QT5B 3U30B 2NX5E 1MWAH 3KPNA 3VH8G 2YN5A 5FKAB 5BRZA 1SEQL 1G84A 4A6YH 5DHVB 4DTGH 1JV5B 3PL6C 3JWOL 5DJCA 1KXQE 1A6UL 3NGBC 5EZJA 3PWPA 3OJDB 1Q9LA 4PJHB 3DVGA 1BOGB 5AWNL 5J12C 2AJ3A 3P30H 5INDA 3SJVE 1P7HL 1HI6A 1JP5A 4WY7H 3MJ7A 4KKLD 4FFVC 1NFDE 1C5BL 4BA8A 1ZEAH 1CDUA 2XZCL 4X8JB 1A5FL 4PRBB 5TGBA 5DO2C 2QADB 3QIUC 1A6AB 1LDPH 3ARDC 1UJ3A 1MAKA 2H2PD 1QVOA 4OD3L 3RHWF 4FQQB 4DGVL 1MCOH 1A1NB 2BFVH 1YNTA 5DO2D 4N8CH 4PG2C 2CDEA 4DEPC 1FJ1A 2R29L 4XAWH 3ARDD 1WWAX 2E7HA 4HWZA 2F5BH 5D2LB 3ET9F 1KCRH 1S5IL 1T2JA 2WINA 4H1LH 4FFWC 4YIQA 1RULH 3GSWA 2OJEA 1FVEB 4BSWA 4QXUL 5JHDB 4X6DF 4JGJA 2EDXA 4P2QA 5C0JA 4G6AC 1JK8A 1H5BC 1YDPA 1QSEE 3MRNB 3QP3A 2GJ6A 4WUUD 4JFFE 4IS6A 5B8CA 3SEPA 3D25B 5ESQA 2XT1B 4G6AD 3TNNA 4HIEA 2H8PB 1TCRB 4R26L 3FQNA 2AKRB 2UWEE 5D7JB 3LZFH 2BNQE 43C9B 4YHNB 2AV7B 2ZOLB 1QPXA 4XP6L 4M6NH 4F9LA 5CZXC 1E0OB 4PRPA 4WCYL 2J12B 1HINL 3OG6B 3GJEB 3JSSA 2EH7H 1S7RA 3BAEH 4RNRA 2ZWLT 5IQ7H 3BXNB 5SWQB 3O6KL 5DJXB 1SYVA 3FMGH 3QI9D 1ZMYA 5CZXD 1C1EH 1T7ZA 2MQ0A 2XKNA 3TESA 3HZMB 5E08L 4PJIA 1AKJB 1LK3L 2PO6C 4KRPC 3SKJL 4QEGA 5I8EB 4WUKL 1MFAH 2NTFA 4MVBC 2PO6D 5IFJA 4KRPD 1JTTA 4HK0B 4I77H 1NGYA 3EO0A 2AK4E 3AREC 3LSOA 2Q76B 3O3AA 1MHPL 1C5CH 2CRZA 2VABB 3B9KA 4NQDE 1FYTB 5J11C 1WF5A 3EUUA 5E6YA 1P7KB 4TOYL 3IDIB 3MRDA 5F9JA 5EOQH 4JHBA 3GO1H 1RIVH 2VWEE 2AEIT 3P40A 5KSUB 3CK0L 1I9RL 5L7XH 1BX2A 3RGVB 4MD5B 5FO9A 3T2OA 3GMPA 1UCTA 3FB6B 1H3XA 3O3EB 4FA8A 2ZUSA 4S1QL 4X99B 4DZBA 2V9QA 4WHYG 5HYQB 4FZ8H 3WCYA 3DIFA 4J2XA 4AIOA 3EAKA 3NIGF 4XBPA 4NFCA 3BKCH 3BGFC 2R1WA 2P5ED 1RJLA 1IAII 4M9OA 4NQEE 4D3CL 3K8MA 1HKLL 3OTTA 4B7LA 15C8H 5C8JA 5IW6B 3UJIH 1BREA 4TNVK 3V4PL 4HUUB 3TT1L 5BS0D 2Y5EA 2R0ZL 3HE6C 4V1DA 1WC7A 1CLYH 4HJJL 4OKDA 3MMEB 3BN9C 2E9BA 4HH9A 25C8L 3ULVL 4G6KH 1BFVH 1WZMA 3QWOA 4JZJB 5TDNA 2FYYB 3IKCB 4JM4L 3HMWH 1QYGH 4MDJA 5ILTH 4P2YA 2VZTA 4ODHH 2WBJA 4P2OC 4MJ6B 1OSPL 1I9IH 1U8PB 5DJDB 3Q1SH 3QR2A 1ETZA 1ACZA 2AXGB 1MELA 5EUKB 3RZCC 1G7MB 4CUCA 3CFEB 4Y4HA 1EJOH 2FH6A 3S4SA 3PWPD 4U3CA 5C09D 3UO1H 2E9WA 4G6FB 5I30L 5HVHC 1B6UA 2A9NL 3OB0H 1ZWIA 3V7AG 3KPSD 5GGRB 2XG4A 4XI5C 2HT3C 4PY7B 5T5FL 3FO0H 3KPOA 4HZLB 2AI0H 1UQSB 2HLAB 3EFDL 2B1AL 3NACL 4GMSL 1KCUL 4P99A 4Y4KA 1YEKH 4XI5D 4OCNC 5T5NF 5EUOF 2BNUB 2WAHA 2MQCA 5E94B 2VDKH 1E4WL 4URTB 1BD2B 4LHUB 5LBSL 4PD4J 5EU3B 3KR3H 4NWUL 1MHCB 2ESVD 4I3RL 5DUPH 4QY8A 1NAMH 1P1ZA 4ZD3L 2A83A 1KG0A 2G9HB 4DOHB 3NCJH 1B6DA 5FUZH 3BD4A 2FATL 4P2QD 3WDJA 3P77A 3MRMB 3FQWB 1BIIB 4IRJA 4LCWA 3WKMH 1MWAB 2GJ6D 4U6HA 4A6YB 2LABA 1EO8H 4MA7L 1GIGL 3DX9A 2B4CL 3I6LD 2G60L 3D0LB 1UA6L 4U1LB 1NGWB 1SVCP 3MGOB 1XF1A 1I1YA 4GQPH 2MQ3A 2AJXL 3OKMB 3PP4H 2DQFA 4X7DC 2OR8A 4PRPD 1WTLA 4WWID 2IPTH 4XHJC 2QKIB 5KVEH 3RZWA 3QXAA 2D7OA 3DYMA 3AS3A 4LPCA 4M5YH 1XR8A 5DC9B 3B4NA 1YJDL 1SBSH 3PWVA 2M26A 1TJGH 4JDZA 4LLYB 4XHJD 4KK6D 4YNYB 2R4RH 4AEIL 1INEH 5HY9B 5F93C 1BQUA 4P57B 3BPLC 4OI8A 4ONFH 5I16A 3GEWB 3TBTA 1YNKH 1C16B 5GQBA 4GKNB 5T3XL 5C0GA 2NY6C 3P3YA 4QNPE 3W82A 4XNQA 2ATKA 4BFIB 2XN9B 3QHFL 2W0PA 3B83A 4FMFA 2NY4B 2YZ8A 1CTOA 1U95A 4ELKB 4PLKC 4LPVA 4JFDA 3OB8A 1V5JA 3RVWD 4HKJA 5EORL 1Q0XL 4Z0XA 3V5HB 3LY6A 3X13A 2OTWA 4HXBH 3QCVL 3E3QE 4PLKD 1HHIB 5IVXA 3KJ4B 3DX8A 1JBJA 3G5XB 3EYUL 1XZ0A 2JLLA 4YDJA 4XP1L 4HC1H 1JUFB 3VGHA 1AO7A 5HJ3B 4EUPA 3P11H 4GW1B 1J9CT 1K4DA 4GAJL 3MOBL 3RJDA 3V4VL 4PRAA 3RNQB 5I1JL 4Y5XC 3MV8D 2DDQL 2GKIA 5MHSD 1WISA 3VXPB 3TA3C 1INQA 2OMNA 3ESUF 4YDVB 3WNNA 2VUOA 4PV8B 2V9RA 5DFVC 3TA3D 4LKXA 4LGPB 5SX4H 5C0BB 4IMKC 4KKAD 3E2HC 2NNAB 4NKMA 3S36X 5DFVD 2CK0L 3TPKA 1MLCA 4NZTL 3BDYL 4JHWL 4IJ3B 2AEWA 3LEVL 1D5IL 2CIKA 3PQYA 2NX5A 1KFAL 5HHPA 2VDNH 4YXKL 2UZIL 3EW3B 5LGHH 4YFLF 3WUWB 1RUKH 4YDKL 1OD7A 3TJEH 2DM3A 3ULUE 1JFQH 1MCDA 2WBJD 2IFFH 4XWOD 3BQUA 4U1KB 1ZLVH 1EO5A 3ZE1F 4PIRF 3SJVA 2F58H 1GOGA 5JIHA 3RVVD 1PEZA 4L5FH 4U6VL 5FKPA 1E4KA 4XGZA 3TJHD 1YPZF 5L2KE 1NFDA 2FJGA 3OG4B 3B5GA 4M4RA 3LV3A 3WHXB 5ADOL 4Q6YA 1PKQB 3SQBA 4MSWA 2EDLA 5DJAB 3BW9A 2QL1A 1Q94B 1N5YL 4Y4KD 5I1EH 4HEME 7FABH 1AP2A 3FO2A 4JLRA 4WNQB 3MUGA 2ZPKH 1CXHA 3MJ6A 4JANA 4XCEB 4FXGA 3F7RA 1T04A 3QO1B 3V5KB 1G6RA 4FTVA 5E7BA 5DHYB 3D85B 4NM4L 4K7PH 5D4QA 3GNML 4IRJC 1QSEA 1CU4H 3LN9A 4WTZA 4JFFA 4QOKB 3GIVB 1OLZA 3BH9B 4F7MA 4KVCL 5FECA 4LCUB 4CW1A 4XC1H 4IRJD 4GUPA 4LCWD 4QTIL 3T1FA 1FNGA 2WMPA 3PF2A 2R1XA 2JCCA 4KJWC 1MWAL 3MLWH 2NY5C 4PJ8B 2BNQA 1KYOK 2HFFB 3LHPH 5K9QG 4A6YL 4DTGL 5EOTA 4RRPA 1ZHLB 1XGUA 1CDJA 1KGCD 1F4XH 3QQ4A 2BY0A 4OQTA 2EEAA 5T1KB 4P4RA 4ZTPH 2AABH 3P30L 4BZ1H 2C4XA 4PJFE 4WY7L 1CL7H 1CGYA 4EI6B 1ZEAL 2DLTA 4LIQH 4O02H 2AV1B 4N68A 3DXAE 4PREB 1LDPL 4OUUA 4ZUWA 4JKKA 1C8PA 3RKPA 3HAEB 2ENSA 3MV7B 1NDMA 4ZQKA 1MCOL 1WWWX 2BFVL 5T1LD 2AK4A 3T2QA 1W0VA 4N8CL 1JNHB 4WW2F 1CTNA 2Z8VC 4XAWL 4O2CA 1ZHNB 1TVHA 5JIIA 3W39B 2F5BL 2Z0BA 1G1YA 3SDDA 1LEIA 3FJTA 1KCRL 3PHQB 2PETA 4JAMA 1RULL 4H25B 1QSFB 1OWWA 2E7BA 4P59H 2ZG1A 3IFNH 3ILPB 4RAVA 2Y5TB 3BO8B 3C6LC 4HWNA 1LK2B 3MROA 1F3RB 2CK2A 4JFDD 2DBLH 1BZ7B 3P9LA 4NBYB 4JG0L 4WJ5A 2H1PH 4PJEF 5D7SH 4S1RH 4U1HB 5GSVB 4LLQB 3BX7C 3F6IA 1U9KA 3LZFL 4ODUB 3FTGB 5M95B 1EMTL 4U1SB 1NC4D 1UYWH 3AXLB 1DCLA 1PSKH 5D7KD 2XFXB 1AO7D 4M6NL 3Q48A 4NQEA 5GGTA 4M7KH 3PV7A 3H9SE 2EXWC 4PJHF 2EH7L 3BAEL 2CDGA 4Z7NE 2X4UB 5IQ7L 3GBMH 5GXBB 3FMGL 1R5IB 1HHGB 2FJHA 4XCCH 4PJ7B 1C1EL 1F3JA 2D0GA 3DI3B 4OZHA 5GGRY 5DF0A 5EWIH 1Z3GH 1U8JA 1JWMA 3QAZB 4EVNB 4L9LC 1UWXK 1CD9B 3MYJA 3QA3A 3QO0A 5B3JE 1H3TA 1MI5B 1X9QA 1KULA 1MFAL 1RHHB 4I77L 2NX5D 3DUHA 3PL6B 1T83C 3KYKH 2GQHA 1ZS8B 1C5CL 1X5LA 3G6JA 4FQIH 1T0MB 2IGFH 1P53A 5J12B 5EOQL 3GO1L 1RIVL 4DUVA 3BQUD 4NC1C 5FGBC 4U4BA 3CMGA 1EXUB 1ROWA 4Z7UE 5C3LD 5L7XL 4XPTH 3HI6H 4LRIA 4ZUUA 4MZ2A 3PWNA 3QIUB 5EO9A 3IFPA 4FZ8L 3S4SG 1C08A 4DEPB 3BKCL 5F7DA 1F4AA 3IDGA 2V7HA 1A8JH 1Y18A 4AEHH 2E27H 2Z4QA 15C8L 5FDYA 5FYJE 3WYRA 3UJIL 4WUUB 3SE3C 3PXHA 2F54B 4F33B 4FTVD 1CLYL 4ZOEA 1H5BB 3MODH 4MNHB 1ZA3B 4NO2B 5CHNB 2FZ3B 4G6KL 1BFVL 5BZWB 4HIJA 3HMWL 3QEHA 1ITCA 1QYGL 2ZCKH 4KK8D 5GRWA 5ILTL 4LHQB 4HUMB 4HUNB 1QO3B 4WHDA 4CJ0A 4ODHL 1CDYA 5E03A 3FOMB 4HKXB 2BNQD 4F37K 1I9IL 1FL6B 4UMGA 3Q1SL 3EIFA 1Q9KB 1XCTB 2V7NB 3UAJC 4YDLC 1NBZB 3KPMB 4JFYB 1EJOL 4TTGA 4L4VE 3ARGC 3UO1L 4ZSOB 3EO1A 4N1HB 1X5AA 5AD0A 3X11A 4PRHA 2XYCA 3RU8H 2BC4B 3FO0L 2PO6B 1BBJA 4KRPB 2AI0L 3WHE1 4P4KC 4PP2A 4NQCA 1T5WA 1YEKL 4X6CB 4NNYA 1YEIH 2GSGA 3AREB 2VDKL 1OTTD 3TV3L 1AFVL 1GVIA 3IDMB 2AK4D 5J11B 3KR3L 5DUPL 1NAML 1J7VR 1B88A 3SDDD 4U1NB 3BGAA 2P5WD 2VNCA 1UH2A 2I9LA 1IFHH 4MWFB 4JN2A 3FO9A 3NCJL 4BH7B 5FUZL 1TPXB 1FLRH 3GMMA 5I18H 4ODWA 3I3BA 1R5VA 3LKOA 5HGBB 3WKML 1FZJA 4Z95H 1B2WH 1JTPA 4BQ9A 1TVBA 4WFEE 1EO8L 1MRDH 1T6WA 3T0EE 3WNLA 1J8HB 2RAMA 4YWGH 4CNIA 3BGFB 4HXAH 4ZYKA 2Y6SC 1JCKA 3VFMA 4MQTB 3PP4L 2IMMA 1IGYA 5BJTA 3N06B 3NFPA 1CFTB 5INCA 3CFKB 4MB4A 2IPTL 3HE6B 1RQ5A 5KVEL 3BRDA 1N8ZB 2CSPA 5SX5H 2DOCA 3SO5A 4MHHG 3GSRB 4I18C 3MCLH 4M5YL 5IMOB 5JO5B 5GGUB 1SBSL 2FX8H 2X4RB 1SVZA 1TJGL 1DQJB 5EU5B 2R4RL 4Z5RA 1UH3A 1INEL 1EAPB 4R7NA 3LIZH 5IBLC 5F3HA 4ZFFA 1F11A 4ONFL 4P2OB 5C09B 1YNKL 4NSKA 4AT6A 4QTHA 5IBLD 3KPSB 3OKYA 3RZCB 5HVHB 1XGTA 4LK4A 4LLVA 5I71C 1PJ9A 2H2SD 1KJ3H 1OM3H 1UENA 2YPLB 3RY4A 3HZKA 3CX2A 4RWHA 3IU4H 3T09A 4HXBL 1IM9A 4TUOB 3ZHLA 3G04B 5BO1H 4X0KB 5GISH 4GS7C 3BH8B 1CVSC 1ONQB 2ESVB 4HC1L 1RK1A 4JRXA 4HFWB 5J6HA 1YECH 3P11L 4NM8L 2K1MA 1WIUA 4PJDE 3QG7H 2BMKA 4BYHA 1CDCA 3NH7H 3KPLA 2BCKB 5GRZA 3WIFA 1IT9H 4U6XA 1S9YB 4PJXE 4O2EB 3G6AA 4HIXH 3ABZA 2IF7A 5ISZE 2EIEA 3TH2T 3DTXA 2EC9T 2VDNL 3HPJA 4MB3A 5LGHL 3IFOB 3AY4C 4EUPH 3TJEL 4GXUN 1JFQL 5TJWK 3FOLB 1XGQA 4OCYH 3OKLA 3BYTA 2IFFL 4OD2B 1ACYH 4XMKH 5MI0C 1EUTA 3CX5K 4H20H 1KLGB 4L4TB 2W1NA 3W9EB 2F58L 2IH1A 1S9XB 4HDIB 3S36H 4L5FL 1CLOH 1W0YT 4NBZB 3WFDH 2IPUK 3H8NA 5TF0A 4HMCA 4LBEB 1DVFB 3DV4B 5J1AA 4PRHD 3DXAA 4DCQB 1QHOA 3V5DA 4ZXBA 3SGEH 3RP1A 5FIEA 2AJYH 5F9DC 1DEEB 4LCYA 1WVZA 4NQCD 4UDTB 4HWEH 3UPAA 5I1EL 5F3BB 7FABL 4IOIA 1F13A 1U8OB 2ZPKL 2NY6B 2BHUA 2VXUH 3TPUA 5BV7H 1L9NA 3Q5YA 4IM8A 1NFIA 1TTUA 2MFNA 1JIBA 1PZ5A 3MRCA 3EDJA 2OP4H 4YHIA 1IE5A 2R2BB 1WFOA 3MZTA 4K7PL 2Y72A 4U6YA 4OF7A 1CU4L 4Y5YC 5TE7H 2QQLH 4C55A 1X4ZA 4XC1L 4QXTB 5F7NC 4G7YH 3MRHB 4X98B 5EB9A 3MRQA 3UBXI 5HYSG 4JVUA 3CC5A 3MV8B 2UZYB 3MLWL 1SJHA 1X44A 2ADGB 4LF3B 3TZVC 3LHPL 3GBNH 4YGVB 2P47B 4JQVA 3VDBA 1G7IA 4C83A 4Y5XB 1UB5B 1F4XL 2X41A 5E8NB 3H9SA 3TA3B 1DBMH 1F58H 3TZVD 2A74A 4W4NA 4ZTPL 2AABL 2X4NB 4BZ1L 1FPTH 1AE6L 1CL7L 3E2HB 4X4XB 1U8KB 4LIQL 1PY9A 3OXSB 4O02L 4QRPA 3BWUC 3TCLA 4N0FB 1CIDA 4NDMB 2D7TL 2W91A 4Z7VE 1NPUA 3MLRH 4HUVB 4C57C 4G9DA 4JFHE 2R9HC 2PR4H 3T04D 1OGTB 3BKJH 4JFQB 2R4SH 2YS4A 4OQTH 4PBXA 1QFWI 4MA8H 5L8KB 4N9GB 3NCBB 3MNVA 4X9GA 5J1TC 4NRZA 2IWGA 4GXVH 4P59L 4Z7UA 3MUZ1 4F7EB 1JZ3A 2ADIB 1EHLH 2UUDK 3IFNL 1LO5A 3S8WA 3LEXA 4NN7C 1EZVY 4N8VA 1MQ8A 3U7WH 2DBLL 1KJVA 2H1PL 2FECI 1W2KT 1IM9D 1OQOA 4S1RL 5KS9A 2FSEB 4M02A 1JGVH 5HVGB 4P23C 2FHBA 2ZUWA 1UYWL 3I02B 4JRXD 1PSKL 4RBPH 4H26A 1I1AA 4R8WH 4M7KL 1HXMA 2WIMA 4WFHE 3KDMA 8CGTA 1BFSA 4I2XE 3SKNB 2EDEA 3GBML 5IEKA 4GRLA 5DC4B 4XCCL 4CDGC 2J8UB 3W5MA 4Y19E 2KKQA 5MEQA 3LQZA 5I1DB 1D5MB 5IMMA 2OR7A 5EWIL 1TVDA 1Z3GL 2RBLA 1K5NB 4UQ2B 4M4PA 1PX3A 4Y8DC 1W0WA 4PJ9A 5D2NB 3QUKA 2CXKA 1NBVH 3QNZB 2APWA 5E0QA 1ES0A 4OKVA 3KYKL 1GOFA 4UOW1 4ZOAA 5C7XH 3IVKA 5GGTH 2EO9A 4FQIL 5DMKB 2IGFL 4L4VA 5CD5C 4HEPG 5C2UB 4K7PY 4X6FB 4LDLB 1HHJB 5ID0B 3UTSA 3BI9X 2OQJB 5EZLB 5IHZB 4Z9KB 1NEZB 4XP5H 3ZYJA 1U91A 3GSXA 3G6DH 3HI6L 4XPTL 4W6YB 3HUJA 1OAKH 4LFHG 5EO1B 5T1LB 1Y6NR 1T2XA 3KYNA 2PN5A 8FABA 1N5AB 2D9CA 3C6SA 5EU6B 2R1YB 4OAWB 3MJ8B 4BSVB 1M71A 4JJ5A 5F44A 3EBAA 1Q9OA 2FEEL 5CGYD 5HPOA 1ZHBB 3MRPB 2EXYC 1BM3H 4NC0B 2E27L 4AEHL 2XA3A 3N1MC 3CSPA 3VGBA 4D0DB 2EXYD 1M6OA 3EOYG 3GIZH 4MAYA 3MODL 4OLUH 3C6LB 4NNXB 5FOBB 4M1CC 3M07A 4PJ7F 1ZGLM 3KG5A 1VKXA 3LAFA 4EDWH 2OZ4H 4XXCA 3BMWA 1NC4B 2CJUH 3EJJX 3LCYA 4M1CD 3UTTE 5BVJA 4ZUSB 1JYNA 3OHXA 1A1OA 2ZCKL 2UY7A 5BQ7A 3T0EA 2C1OB 2Z8RA 3RIAK 2VDMH 3CH1A 1I8KB 1S7VA 3PJSB 1TCMA 1P4LA 3ARXA 5HPMA 1KTDB 1LP9F 1BZQK 1Z5LB 1GPOH 4IHOA 2ICEB 2Y9RT 2F53E 1FP5A 1KELH 1QR1A 3Q6FB 2YSSA 4OZGF 5D6CB 1KIRA 5HI5C 1ZGLA 2EYTB 3RU8L 2VJXA 4S1DC 2JIXB 2DMBA 5SV4A 1JVKA 1CLZH 4L9LB 2OSLA 5GS1A 5IF0B 1FC2D 3RWCB 5HI5D 3CPLB 4DN4H 4QRUA 3WS3B 3MGTA 4QRPD 1WBXB 3OR6A 2X7LA 3DURB 2YEZB 1EAJA 4JY6B 1HH6B 1U8MB 2JJTA 5DJ8B 4TUJA 1N3NB 4JQXA 1EK3A 1HYSD 4JB9H 4X6DE 4GAYB 1L4IA 3QDMB 1IFHL 1URLA 1G7QB 4JPWH 4XHQA 3IRZA 1BOYA 1FL5A 3CFJA 4UBDD 3QEQA 1FLRL 2BVQA 1I7ZA 5I18L 4JPVH 3PHOB 4DKAA 4CVUA 3O11B 4Z95L 4XVTH 1T66C 3IDJA 2UYLB 2E3VA 3CCHB 3QPQC 1Y6KR 4P3WA 5K9JH 1MRDL 5C0DA 2Q7YA 1I1AC 4J23A 2VSDA 4YWGL 1T66D 4AZ8A 4HXAL 5J4MA 4WGVB 3GFUA 1Z9OA 2YWYA 2HJLA 1I1AD 2NLJB 1IM3A 2HG5A 4U0QB 4JR9H 2FEDC 2FIKB 1DQMH 3MCLL 3GSOA 1UCBH 5GPRA 2FX8L 2R2HA 2FEDD 1IILE 2VISA 5AG8A 1MH5A 4TVSa 1A3QA 5IQ9B 2IPUG 3BP7A 4PS4H 1I7RA 5I1IH 3LIZL 1H8NA 5E00A 4CVZB 2WUBH 2J88H 5K9KA 4RGNC 4GRMB 3UZQA 4YDLB 1GC1H 1BEYH 5JPNA 1I8IB 3QNXA 4S2SA 1U58B 4R9HA 3RUGE 3ARGB 2VSCA 1MHHA 4EEEA 2C3XA 4RGND 1DQQB 4L4VD 4I4WB 1KN2H 3KWWA 2WM0A 1AR1D 3D1MC 4V2BA 3UTSD 1I4FA 2OL3A 3VFOB 3DUUB 3IU4L 1G9NC 4JKPH 3NCFB 4PGEA 4P4KB 1WGOA 3RVTD 4QHMB 2J3SA 3SGDI 5BO1L 4L8DA 3MRIA 5GISL 3NIGE 4Q6IA 3A6OA 2YBRA 4V2CB 4K3JH 1H0DB 1WT5C 3DVNA 4Z76A 1YECL 3TCXA 2P5WB 1UEYA 2YUWA 3CU1A 3QG7L 3NH7L 5DD6A 5DJ6B 4FQJH 1IT9L 1VADA 4KKNA 3MLVH 1IAIM 1VDGA 4G8GE 4HIXL 5CSZA 4MAYD 1BHGA 3IXAB 4H8WH 3UC0H 3V8OA 2VDQH 2YUXA 5T1MA 1RUQH 4F7CA 4XC3H 1KPUB 2YUVA 2OCFD 3CUPA 2IJ0C 1SHMA 1S7QB 1B4JH 2CKBA 3L5WA 1FNEB 1TMCB 1F4HA 4WFED 5D6DA 1A4KB 3ARBC 1U8LA 2D7NA 5AEAA 4K9EH 2GK0B 4DGIH 4ZUVB 1ACYL 5E8OA 1CFNB 1J12A 4GAGH 4H20L 5E1HB 4CU8A 3SBWC 4KTEH 1A7QH 2CLZA 4K8RC 3S36L 5I0ZA 4OZFB 4JE4B 4I18B 1CLOL 4CMHC 5KVDH 3WFDL 3U4BH 4AY0A 4W6XB 5HI4C 4Z7QF 3DUSB 5DRWA 3VFPA 4H0GA 3RWJB 2AJYL 5EUOE 3TH4T 1MVUB 1R0AH 4N0UA 1RJZA 4HWEL 5FFLA 4YBQC 4U1MB 4OI9A 1J1PH 4G43A 2VXUL 5TDOB 5BV7L 3GSVB 3V0WH 1JWSA 4YBQD 2OP4L 4XXDA 1AIFA 2BNRE 4GO6B 5I71B 4FFYH 1BECA 3TNMA 3SPVA 5TE7L 4KZDH 3CH8A 1V7NH 2DWEB 2HKFH 2IG2H 3QEQD 4C56B 3V6ZA 1M4KA 3E1F1 5DLMH 3QYCA 5F6IB 5SWZE 3CSYB 3X12A 5TDPA 4LCCC 3GBNL 1WSST 4E41A 2HJKB 3ARPA 3L3HB 1KXVC 3GSUA 4IRSC 2WNGA 1DBML 1F58L 3QQ3B 5DJ0A 2GI7A 4KMTH 2DKUA 3DHJA 2R2EB 4HWUA 1FPTL 1WFUA 4IRSD 3BKYH 3W0WB 3MA7A 1XGYH 4PRIA 5L2JA 3U0PA 2XWBB 2O61B 1YYMH 1SJEB 2YD8A 3DSFH 1JF5A 3RWEA 2DRUA 5HGAB 4YGAB 1CVRA 3MLRL 5J56B 3BUYA 4Z18A 4NQXA 3ARQA 2PR4L 3IDYC 5DURB 3BKJL 5AAWA 2R4SL 4OQTL 3MRFA 2ARJB 4MA8L 1MCJA 3ARSA 3CGTA 3OKNA 2DI8A 3WLWD 2C1PA 4X6BB 3R1GH 4GXVL 2EYRB 4ZAKC 3SHSA 1EHLL 1I7UB 5I8CB 1M7IA 1I8MB 1JPSH 4LLWB 5I76A 3U7WL 1ZE3C 3VH8B 3O8XC 2D03L 4NO5A 1XGRA 1JGVL 4PGCB 1ZVHA 2FBOJ 3DBXA 5J06A 3WJJC 5T3ZD 5EBLB 1JPTH 4WDIB 1HXYB 1YEDA 1FFNA 4R8WL 3LN4B 1L9MA 5ANMB 4EXPX 1S8DB 5D7IA 5DYOA 5JIKA 1A4JA 2HYMA 1KTLA 2OM5A 3C8KB 4BQ8A 4Y2DA 1CE1H 2HT4C 4MS8C 4Y5YB 2EECA 1QACA 2IQAB 4HS6A 5DEGB 3P0GB 2JF1A 4X83A 4ALAH 4X7SH 2HT4D 4XMPH 2X9XA 2OBGA 4KRMB 3UTTA 1MCWM 5FUCC 3ZKXC 3BN3B 3FCTB 3TZVB 3UTOA 1NBVL 5CJOH 2IANB 3P4OA 4BJLA 3BISA 3PGFL 4C4KT 5C7XL 1IL1B 3NTCH 5GGTL 3TEUA 2Q1EA 4MJIE 5E6IA 3ZE1E 3QRGH 1DR9A 3CXDH 4HK3N 4P5MA 1TZGH 3EYOA 1VFBA 4AEFA 1YPZE 3U4EB 4P2RB 5FK9B 4XP5L 1R3LB 3K4DA 3G6DL 5DQDH 3BEVA 1BQSA 1OAKL 3OGOE 3JV6B 3CZFA 3KHQA 1U3YA 2MHAB 4Q9RH 1BBDH 3DROA 3HRPA 4DKFH 4N0CC 4M6AA 3PABA 2BVOB 3TP4A 3MV01 3O6MH 3MGAA 3WD5H 4OZIB 4MD4B 3B5TA 2FX7H 2IAMA 4OZ4B 4XCFH 3BDXA 4N0CD 2DJSA 4WU7B 3FONB 1BM3L 3NABH 3KPRE 4X6DA 1EEYB 1IKNC 4F7PB 3VXRB 4XCNA 3WE6A 2BOBB 2V2XA 2A6KA 3L3GB 3WV0A 3GIZL 4OLUL 1QBAA 1IEAB 4J12A 3MCKB 3RL1A 4OFIA 2J8UF 4NN7B 4EDWL 4ZFOA 4K23H 4MNGE 3HG1A 3V79C 4H0IA 4TPRH 1A6VH 2CJUL 4LPXA 3LB6C 2YRPA 2ICCA 4P23B 3FB8A 2O93L 2Y06H 3O9WA 4ZS6C 2O26U 2VDML 4MA1C 3QUXC 3I85A 3MNWB 2VLJE 3GGWB 4POUB 4E41D 3HE7A 1OOAA 2XPGA 1FVDA 2GCYA 3GMLA 1GPOL 1QLFA 5ESAB 1CFSA 1MIMH 3QUXD 1R24A 1KELL 4HKBB 3HZYB 5GRYA 2FGZA 5FA4B 5DD1H 4CKVX 1EX0A 2PTTB 3UROR 5D93C 1YEGH 1CLZL 4PRID 5CBAA 4WW1B 4DN4L 1AH1A 2XZQH 4LQ1A 2CLVB 1N6UA 3BE1H 2OXGA 2P44B 2NXZC 5CWSA 3VFTA 5BZDA 4KKCD 3BKMH 5ENWB 4RZCA 4KROD 2VITA 1MCCA 3MUHL 5C0CA 4YO0A 4JB9L 1WIPA 5J0BA 1JZ5A 1MFNA 4K7FB 4X4YB 3F6LA 3AS0A 5C08B 4TNWF 3BWAB 3TLRA 4KHXH 4JPWL 1BPVA 3GJFK 5E56A 3MBEA 1JF1B 4JPVL 2ICES 2X70B 4PJEE 2FX9H 1T4KB 4XVTL 1UADC 5HYJE 3FN0H 3G08A 3LRSA 3UCRA 2VLRB 4ODSH 1VGEH 5M94B 4G6MH 5K9JL 5C0RH 3VI3E 4MXQC 4X5WA 2C7UB 3QDGA 1KB5B 4MDIB 2WIIA 4I48A 5C07B 4PJHE 5IB2B 4OCWH 4OV5A 5DMGD 4MXQD 3DV6A 2F8VA 5IB4B 5IV2A 2DLFH 3BGMA 3VD9A 3U82B 4AIZB 2IBGA 4JR9L 2KH2B 5KG9A 2NY0C 4Y2DD 5KOVC 5MP6H 4RDQG 3CX5J 1UCBL 3H7BB 3H3PH 3LOWA 2QHRH 4JDVA 2NY0D 4JY4B 3FQTA 3O6FC 3ARVA 2F9BT 1ZV5A 2AP2A 1UACH 4PS4L 4L8SC 4YQXH 5GGQH 1FZMA 2AEPH 1U8IA 4QYOB 1VEPA 2CR6A 3MJ9A 4PRDA 2WUBL 5MENA 2J88L 3O6FD 4MQXC 2A6JB 5IJVA 3WS6C 3PV6A 1GC1L 1BEYL 4GBXA 3U1SH 4ZNEE 5I1AB 3MRKB 5JHDE 3OJMB 1V3KA 4MQXD 5JW4R 1MREH 2Q7NA 2HJFB 5C0EB 1KN2L 4W4OA 4CN4A 3BPCA 1OAUL 3IFLH 3VE0B 5FA3B 3RFZC 1KNOB 5AYQA 4IIQA 2FL5A 4JKPL 5I1KH 1KJMA 3VXMB 1QRNB 3MRGA 3NAAH 1HEZA 4K3JL 3STZB 3HA0A 1IKFH 5E7FA 2BSTB 4MMXC 4IMLB 3MZGB 2BSED 2BXZA 4JN1H 4MA3B 2DWDA 5E8DH 4L8CA 5EFIB 1UJTA 1LE5A 2GSIB 4FQJL 4NOBA 4HK3J 3GRWA 4JPIB 4R96A 2Q6WB 1S9KC 2PW1A 2KPNA 1DE4B 4QRRE 4BH8A 3MLVL 1KXTB 5JPMA 4O51B 4H8WL 3UC0L 4LP5A 2OL3H 1DN0B 1RZKC 1I85C 1TDQA 2VDQL 1MJUH 1RUQL 2JB6B 4XC3L 1JGEA 4XVJH 3VRJB 1LVEA 1S9WA 5I15L 5T3XE 4NQSA 3HG1D 2A73B 1B4JL 3OX8A 3O9WC 4NRYA 1MIEH 5T3ZH 2ICWA 5IVNA 1UZ8A 3CJJA 5FDWA 3VXNA 4LAJH 4BKLA 5DRXA 1OCWH 3HB3D 4K9EL 3O9WD 2H26A 3W11C 4PTTA 4XP4H 4F9PC 3I3EA 1JZ4A 4GW4B 1OAYH 2C26A 1QA9B 2P24B 5HGHB 4MQ7B 4GAGL 4YPGA 1NAKH 4HX1A 4WHTB 1A7QL 2E9JA 2VLME 2FR4A 2X4QB 3T0XA 4NKDB 1UM5H 1V3LA 3RWFB 5KVDL 4MLSA 1KIPB 3U4BL 1NCWH 1FNAA 3SKMA 1MJ8H 3ETBF 4HUWA 1LD9B 3UDWC 3L7EA 3MRBA 4PGBB 2XTJE 1R3HB 1R0AL 3T2PA 1RZ8B 2CKBH 4EJ1C 1MUJA 2W65B 4RGNB 2C3WA 1J1PL 1R3KB 4YHPA 4O2FB 1MAMH 3L3IA 3TIEA 4UIMB 5C0CD 3AB0C 1CGTA 2W92A 1RIHH 5HHOA 1CFQB 2P8LA 3KPPB 5EO0A 4RX4A 4FFYL 4HS8H 4KZDL 1IAIH 4D8PA 1BQLH 4M7ZC 3NCYS 1V7NL 3HNVH 3DHMA 2PUQT 4Z0BH 5AUMA 2HKFL 2IG2L 3MBED 5DLML 2ZG3A 5KN5A 3R06B 3SGKA 5DI8B 3CXHK 1RJYA 3FT4B 5F6HI 3TIDB 5IJKA 1N26A 3IS0X 1T2QH 3QDGD 4PP1C 2Q3ZA 4NQVB 2HRPH 4MZ3A 5D1ZC 4F8QA 5ACZB 3NN8A 1MY7A 4KMTL 2QQKH 4KQ4H 3SO3C 5D71H 1OT1A 2I5YH 4PP1D 4MNQB 1RUMH 2NCMA 3MR9B 3BKYL 4F7TB 2VZ1A 1N7MH 1XGYL 1FG2A 3BIBX 4YR6B 1ED3B 2H9GA 1YYML 1NJ9B 3L3OA 1HHHB 3D0VA 3SDXB 4KV5F 1ZT1B 3DSFL 1DP0A 2JB5H 4Y1AE 3SCMA 3VWJC 4LU5H 2HVKB 1YMMD 3C8DA 4UB0H 1BD2E 3ARBB 3DX6A 4JFEB 2H6PB 1G7JB 1T1YB 2DQHH 4DQOH 3G6JF 3WN5C 4GRWH 4Z7WB 5MEND 4I9WE 1EUUA 1F6AB 3TYFA 4K94C 4GBXD 3SDYH 1YPZA 3OKDA 1YN6B 2VMFA 5F70A 4DOHE 5DSCB 3B2UC 3MRJA 3R1GL 4CMHB 3FFCA 2KQNA 4MJ2A 1A7OH 1T1ZA 2COQA 3EZJB 1JPSL 1ORQB 1ORSA 5HHNA 1H15B 3B9DA 2C4FU 3B2UD 4RCAA 5I1LA 3I75B 3K8KA 3FQUB 3PNWB 1KIUA 3I2CH 1OB1A 5EN2B 4CMMA 5L6YH 1PFCA 3E8UH 1OAXH 4DW2H 3UTZA 4XNYH 3D3VB 1GOHA 1JPTL 3RY6C 4G9FE 3BHBA 5IR1B 3F7YA 3KPRA 1F6LL 1E6JH 4X4ME 3DMMA 3K74B 4PJ5E 1SMAA 3W9DB 1LEKA 3KVQA 3QFJA 1CE1L 3QXDA 4M8VA 1JZ7A 3L3DA 1I1FB 3CLFH 5AG9A 3AAZA 5FM5O 1IGCH 1NBYA 4PJGB 4ALAL 4X7SL 4XMPL 4S11A 1AGFB 3STBA 1NKOA 4J1UA 5EU7E 5F1NA 1YNLL 2ZG2A 4LCCB 5CJOL 5D7LB 1FSKC 5L8JB 2VLJA 3X17A 1JPGB 5IFHH 4PRNB 2ZSVB 3NTCL 3AU1A 4IRSB 43CAB 1T22A 2XN9E 2E6QA 5AZ2H 3CXDL 3HLAB 1R3JA 1TZGL 3GHEH 3E6FB 3G5VA 4OGXH 1MCHA 4P5KA 3VXOB 1DUYA 1HQRB 5DQDL 3DI2B 4YHKH 3QUZC 3IF1A 4Q9RL 1BBDL 4M8QA 3TBYA 2DQGH 1WWBX 4DKFL 4WW2A 4X8XA 4LSRH 3F7VA 3O6ML 1EFXA 5B39A 3WD5L 4RQQB 3V6OE 2FX7L 4PR5B 1ZVSA 4XCFL 5CEYA 3DRQB 3IDYB 3OKOA 2Y7QA 3JVGA 3NABL 2DS4A 3QUYA 2QQNH 4C59B 4OI7A 4HD9A 3PIQB 2EZ0D 4WFFD 5HHOD 4ZAKB 4ZFZB 6FABH 5CMAB 2G2RB 4RX4D 4UT6H 5D96B 1R6VA 1UXSA 5B3NA 5C0AB 3QG6B 4K23L 4KRLB 2VLLA 4TPRL 1A6VL 2WP3T 4QT5A 3GSNB 3O8XB 4YPJA 5FKAA 4TSAH 1Z6JT 4OD1H 3V52H 5DHVA 1JV5A 4CADB 3D9AH 1N2RB 3WKNA 1TJHH 2Y06L 1F42A 1N0LA 3OJDA 4PJHA 4LQFH 1BOGA 5E2TH 2NY1C 1WZLA 2XICA 4GG6B 3WO4C 1MIML 3VMPA 3T2NH 5DD1L 4H0HB 3HI1B 4RWYH 2GFBB 3ULUC 4X8JA 1YEGL 5HBBA 4OIIH 4PRBA 5CIPB 1X4XA 3JZ7A 4L8BB 3RX8A 4KK9C 3LN5B 4RIRB 3LQAC 1A6AA 1SJXA 2WWMD 4LASH 1PKQE 4HIIB 1RFDH 4FQQA 4KPHH 3C5JB 2XZQL 3ZKXB 4KFZC 1A1NA 2WBKA 5FYJU 3BE1L 4JO1H 2ED8A 5KJRH 1J86A 4NQUA 3N1GC 3BKML 4OZIF 3ILQD 5D2LA 5CAYB 3ZDZF 3FFDB 1R5WB 1H8OA 2BK8A 4ZNEA 1FVEA 1CK0H 3K81A 5JHDA 2OK0H 5DS8B 4KHXL 3MRNA 4NCC2 2JJUA 4QF1B 1CDBA 4PJBE 1UWEH 4KK5C 3BP4B 3D25A 3FFCD 4XPHH 2W0LA 1QFWM 5IT2H 2FX9L 3ZKMC 2H8PA 1TCRA 5BXFB 2AKRA 5D7JA 3GMRB 5I9QC 4ODSL 1VGEL 43C9A 1OGAE 4G6ML 4YHNA 4ZDHB 5C0RL 2AV7A 2ZOLA 1G9EA 2VUYA 2VR9A 3ZKMD 1V05A 3S5LG 3TT3H 1M05B 4OCWL 1TQCB 3GJEA 3TFKD 1SM3H 4GKSB 2VIRB 2ZUUA 1SBBA 2DLFL 3BXNA 4HWBA 5DJXA 5SWQA 1T0NB 2ED9A 4PLNC 3DMMD 5D5MB 3HZMA 1J1OH 5MP6L 3STLB 1AKJA 2LAAA 3QFJD 1OSZB 4Z6AT 3QDHA 4IOSD 5I8EA 1I8LA 3H3PL 2OX5A 4UNUA 2QHRL 4PJAB 4HKZB 4OFKA 2X40A 3EOTH 3MV9D 4I3GA 3MV7E 1UACL 4YQXL 4HK0A 3ALPA 1FV1B 5GGQL 2D9QB 2AEPL 2Q76A 2VABA 3UEZA 4MA1B 1FYTA 3QUXB 2DMKA 1P7KA 3D48R 4BELD 4ZO9A 3IDIA 4J8RB 2VLJD 3O2VH 3U1SL 4LSUH 1A1MB 1IAMA 2OTUB 1MREL 4Y2OA 5KSUA 3GB7B 2DQIH 4XRCB 2CGRH 3OR7B 3RGVA 3EOAB 4MD5A 2D7MA 1P6FA 3IFLL 5D93B 3N50A 3FB6A 3O3EA 5JNYB 2ZJSH 4X99A 5I1KL 4JO2H 5HYQA 2FHCA 5E8PB 3RKDD 3NAAL 2VDOH 2X4TB 4JFXB 1IKFL 5KTEH 2NXZB 5TH2B 3WNKA 3JVGC 4JN1L 3MOQA 3QEGH 5J8OA 5GS0C 3O4LB 5E8DL 5IW6A 4I0CC 4HUUA 3N1QC 5GS0D 5HHMD 3QUYD 4U1GC 2GAZB 2LTQC 3MMEA 3KPQB 4K94H 5IB5B 3FQXB 3HC0B 3OAZK 4PD4K 1HK6A 2OL3L 4JZJA 4JM2B 1FL3B 2FYYA 4MXVF 2XQYK 2AJZB 3IKCA 1MJUL 4OLXH 1A6TB 3WFHB 4XVJL 1EERB 1MIEL 5F1IB 4MJ6A 5T3ZL 1U8PA 5DJDA 1WTGT 4WU5B 1OCWL 2AXGA 4Y89A 3MO1B 2ADJB 1LP9E 5EUKA 4JG1H 1GZQB 1G7MA 3ZO0A 3CFEA 4XP4L 2V5YA 1OAYL 4X9HA 3CAFA 2P8MB 1KEGH 3GRWH 1ZT4B 3T0AA 1NAKL 2EE3A 4OZGE 4RA3A 5GGRA 1UM5L 3L95B 4Y88A 1PD6A 3VFUB 1UVQB 4PY7A 2X10A 4QHLB 1NCWL 1NGZB 4HZLA 3TVMC 2QQQA 1UQSA 1CXEA 2HLAA 2JK5B 1X6NA 2VLKD 1MJ8L 2IH3B 4PJCB 1P7QD 3O6FB 3SKUD 4LCIH 2QADD 5HVFB 4Q97A 5GZNC 3IDXH 2BNUA 4L8SB 5E94A 2CKBL 5HD8C 5IROA 1BD2A 3HPLB 4LHUA 1UZ6F 5EU3A 1MHCA 2P42B 1MJ7H 4M7JH 1MAML 5HD8D 4LOUD 4WUUE 4OGAC 4WTXA 4FQPA 1VESA 2VDLH 1RIHL 2G9HA 1MJJB 1CGSH 3U46B 4ZODA 3MRMA 4HS8L 3FQWA 1CGXA 1EGJA 3CFBB 1BIIA 1BQLL 4AMKH 1MWAA 5F97E 3HNVL 2VN7A 2ZNWA 4Z0BL 3PGDB 4A6YA 32C2B 1NCNA 1BIHA 2EEDA 2FBJH 2EDDA 5D7JD 1EDQA 4WO4C 3D0LA 1H8SA 4U1LA 1NGWA 3MGOA 2DKSA 1T2QL 1Z0NA 4UQ3B 3OKMA 5A2JH 1NGPH 2HRPL 2Z93B 4X4MA 1IGJB 3EDFA 2QKIA 2QQKL 3D39D 4KQ4L 5IVZB 4QHKJ 5D71L 2UWEB 4GKZB 4JRWA 1RUML 4XNZC 3SKOB 3ULSB 1RZIB 3QDAA 1N7ML 4LLYA 4HMEA 4YNYA 5EH1A 1AKJD 4N0RA 3H9YA 3IKKA 4I5BB 3WLBB 3BPNC 5HYIA 5ID1B 1BJ1H 5HY9A 2JB5L 4P57A 4LU5L 1C16A 2A6DB 2H32B 4UB0L 4GKNA 2HFEB 3H0TB 2HT2D 4DQOL 2DQHL 3LEYH 5IESH 1I1CA 4BFIA 2IQ9H 2XN9A 5A3IC 1FYTD 1FGVH 1UKTA 3SDYL 3O6LH 4NNPH 4ELKA 5JXEA 1TETH 3WNOA 3C09C 1UM4H 1HNFA 3H9HB 5F7WC 3VGAC 1P9MC 2CLRB 1A6WH 4P49A 1RY7B 3HUJF 1A7OL 4NQDB 4JJHA 5FM8A 3V5HA 1RZ7H 3QJFB 2CR3A 4OFYA 4LAQH 4UU9B 5KSBB 5HYSB 1HHIA 1EO7A 3G5XA 5DUMH 3I2CL 5L6YL 2PYED 3JWDC 1JUFA 1OAXL 3E8UL 5F7KC 3S3PA 4AENB 4DW2L 4ENEC 1J8HE 4IDJH 4XNYL 5D1XC 5HJ3A 4GW1A 5BS0E 5F89B 3PWJB 3RNQA 2X9WA 3EYFB 3VXPA 1P4BH 1PGRB 3UP1A 4YDVA 3BUTA 4PV8A 1E6JL 3MTRA 3AB0B 3WL9B 5JW3H 5HYEA 3OAYH 1KC5H 4LIQE 5C0BA 5JDSB 1A0QH 2NNAA 2CRYA 3CLFL 4EIZC 2JELH 2VR5A 4DZ8B 5B39G 4M7ZB 5JQ6H 1JE6A 3ESVF 2VOTA 1IGCL 2NY2C 2EIZB 3SDXF 5IM7B 3WUWA 3KYOB 5C86A 3N9GH 3BOVA 3PWPE 3X14B 5C09E 3CVHB 2EDFA 3ECBB 5GRVK 5FV1L 3WFZA 3UZEA 5T33H 4EN3C 5IFHL 1ND0B 3KPSE 3UZVB 1NFKA 1JGDB 4U1KA 5D1ZB 5AZ2L 3GBLA 4N0YH 4Z7WF 2X1OA 3SO3B 5I73C 1S78D 4G6FD 1GRWA 4QRQB 2BJMH 3GHEL 4ONGH 3VXUD 4OGXL 3D18B 1PVHA 1RK0B 4KTDL 1BFOB 2A0LD 4JKLA 1JL8A 4YHKL 5SV3A 1H3UA 1YMMB 1T21B 4P46C 3WHXA 4K3EH 1PKQA 5JXAH 5DJAA 4P9ML 2DQGL 1Q94A 3FQRB 3QHZH 5IROC 2YD1A 1AR2A 2ESVE 4LSRL 3VWJB 1NCAH 4P46D 4WNQA 4JZOB 4NWTH 4XCEA 1W8NA 3WN5B 3L5IA 4LHUD 4D9LH 3QO1A 3V5KA 3GSQB 4NYLB 5DHYA 3D85A 3ZYIA 2QQNL 4M48H 5JUEH 3G9VA 1RV6X 2GJ6E 3FRPG 3T4YB 3JV4B 4F3FB 1NBQA 1M7DB 3RPKA 4QOKA 3GIVA 1CDGA 1DBJL 2MKWA 5GIRB 5TPWH 3BH9A 4UT6L 3I6LE 1E27B 4LCUA 4HULB 1QEWB 4PJGF 1RJCA 4PJ8A 2D2OA 5DD3H 4WI8A 4TSAL 2HFFA 4OD1L 3V52L 1OARL 1FH5H 1AC6A 3D9AL 4X9FA 1ZHLA 1TJHL 1U92B