3DA0A

Crystal structure of a cleaved form of a chimeric receptor binding protein from lactococcal phages subspecies tp901-1 and p2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
132
structure length
132
Chain Sequence
NVVHKTGDETIAGKKTFTGNVEVNGSLTLPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Cleaved chimeric receptor binding protein from bacteriophage
publication title Crystal structure of a chimeric receptor binding protein constructed from two lactococcal phages.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
total genus 22
structure length 132
sequence length 132
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3da0A01
3HG0A 4HEPA 2X53A 2BSDA 2WZPA 2BSEA 3DA0A 3U6XA 4IOSA 3D8MA 3EJCA 1ZRUA 2F0CA 4HEMA
chains in the Genus database with same CATH superfamily
4ELMB 4OLYL 3AB0C 3HVNA 1NCTA 1FFQA 2KPNA 5J9PB 1IKNA 1CGWA 1FGNH 4GT0A 4X5LA 2NZ1A 1CVSC 1RU9L 3MBED 2DV6A 3QDMD 3KNBB 3LQZB 3AAZA 1KCSL 4NUJA 3X1EA 1YEDB 2GI0A 3UPAA 5GS0D 5JHLA 1OGAE 4DGIL 1LD9A 2A5UA 4JY4A 3X11B 1OCZB 4LFHD 3UZVA 2B4CC 2HUEA 1BPVA 1PU0A 1BQ5A 1WBZB 3MGTB 4IGBC 1S7TA 2DM3A 3TNMB 2AS5M 1JWSB 3JV4A 2DI9A 3LEXB 1D6VH 1EJOH 1HKLL 2BMKA 1MFAH 3AQDA 2CA3A 3O3DB 4PGEA 1EZVX 3QFJD 3QO1A 4Z7NB 1UM4H 4Q6IB 1H3WM 1OM9A 4ZMQA 1G5GA 4JRYD 4R97C 1IKNC 2JH2A 1AGEA 4CU8A 2OMTB 3BQUA 1UGKA 2X12A 2IF7A 3G5WA 4NRYB 3WN6A 2WYTA 2WGNB 5DJZA 2BFVL 4PR5A 4M61B 3ZDZB 4PRHE 4PRBB 4JQXA 4Q9RL 3ECBB 4LHUA 4MRCA 4OGAD 1LQBC 2IJ0C 4LARH 1RJYA 2B2XL 3LDBC 5EC1B 4ADGA 1R5WB 5D5MF 4U7KA 3SBQA 1NBYB 3T3PB 3VFVA 3KM2A 1MRCL 2R23A 1JERA 2AVGA 3BW9B 1PCSA 3GLZA 4FQ1H 4WU7B 1D5XB 5HYEA 1JPGB 1SQ2N 4IDJH 3EOAA 2UWEA 1BWMA 4YXHL 3BQUC 4E36A 1XIWD 2FT8A 3E1ZA 1DBAL 4Z7QF 3UYPA 1SN0A 2A77H 3HCVB 3S2CA 3U0TA 3L9YA 2HT4D 4OLUH 4U3HA 4PG9A 5HD8D 5MHSD 3HZMB 4LLUA 3TO4B 2P3YA 4JQXC 1FHNA 2H2PD 2G0KA 1PQZA 3D0VA 4OFDA 3R0MA 2VRQA 1BOGB 3KXFB 1BXXA 4HD5A 4P59L 1A6VH 2KI6A 1RUAH 3NUKA 3I85A 2V17H 3IE9A 5CP7A 2Z7WA 1JOIA 4TLKA 5IK3B 3FO0L 1X5YA 2VDRL 4R83A 4V1DB 3VXQB 3HVDA 2R4SL 1AR2A 1JGIA 4AMKL 1S5IH 1FYHB 3DX9B 4YDKH 1HN1A 4PJCB 4R26H 1MI5E 3DPDA 2CXGA 1BA9A 4PV9B 4PW4A 4WO4B 3LN9A 3P2BA 5HXMA 3NJJA 3E3QC 1YNTA 2N7AA 5TQ0L 2DL9A 1ASPA 1YECL 2ZX8A 1E6JL 1VFAA 2IBZY 4M7LL 3L3JA 2R0KH 2DY2A 3CIAA 5ACZA 4FJYA 2NNFA 3FFCB 3VXRE 5KW9H 4OZIE 3MXWH 4FFVC 4ZQTA 1JZ7A 5FHBH 4F8OA 5SWSB 2WHVA 4UF7C 4XXCA 4HWUA 1I7UB 4HC1H 2HRPH 2W0LA 4GG6E 3OZ9H 1C16A 5CCGE 4YR6A 1COBA 1F4HA 4XNUL 4HW6A 4H8WH 3T0VA 5C7XH 2VGLM 5F1IA 1XF2B 5DFAA 3JWOL 3W5NA 2C3XA 2P5WD 3FO9B 1FHGA 4C55A 2BSRA 2NX5B 2VQ1B 3B7SA 1HL4A 2AJYL 4OZFA 5KS9E 2IANA 4TUKL 3FXIC 5D4IA 1KJVB 1WHOA 3DXAD 1PZAA 1HINH 3QNZB 4U49A 4WTZG 1T04B 1YEIL 4RDQG 1R3JB 1QFWM 2PCPA 2ZX5A 3OJDA 2RFXA 4XXCC 2C9XA 2YA2A 3LKRB 4EIBA 4ZMLA 1A7NL 3TBWB 2BP0B 2HVKB 4ATWA 4DW2H 5HPOA 4QHLA 1WUNT 4HGKC 4AI7A 5JOFA 3X12A 3QPKA 1U3JA 1INQA 3EYOB 2FWLB 3O2WH 5C0IA 3KYNA 4UTBL 2R0WL 1G7HB 4XP9H 2CAKA 3SGJC 5DQJA 4E9TA 5GHWH 1KBPA 4R5TA 5JNYA 1TVBA 3QYCA 2DTML 1BMZA 4GS7C 5FO9A 4MLSA 4X6BA 1GYVA 2WMPB 4QT5A 3ZE2E 1AJ7H 1ZEAL 3WEMA 1P84J 5INCB 3UC0L 2V33A 4P46B 3L4WA 1PX4A 5AUMB 5I0XA 1QAWA 3CK0L 3ZKMD 5SWZD 3FB6A 4AVKA 5CKGA 3B2PA 3F58H 4K3DL 4TSBH 5EMYA 5B38G 5HYJA 4YDNA 5BV7C 3KJ6L 4U6VL 2AV1A 4UTCA 5DA0B 4WU5A 2QL1A 2FECI 1NAMB 3MRIB 4AQEA 1SFDA 5F9JA 2X28A 3KR3H 2FJHA 4Y5XA 4HZLA 4ZMTA 1Z0NA 3INUL 1EEYA 4BFBD 4YHOH 3BSGA 3AWFA 3Q3GB 4FNUA 3QULB 4XPGL 4MSWA 5LJYH 2VZVA 5CD3A 3MLPA 2OR8A 3LOWA 3L6FB 2W5PA 5JTWA 1NGXB 4LU5L 4NO5B 2OX5B 1B0WA 3LHAA 2IO5A 2Y6TE 3WNOA 4A37A 2R1WA 4NT6B 4XMUA 5FW7A 1UUNA 1GH7A 2R7EB 2CKBA 3PLYA 4W9KC 5F8QC 3GIVB 4Y5XC 4H2AA 3NIDE 5E0FA 4Y2DB 1UD3A 4NNPH 2H2SD 5D7IF 5GS3A 1S7SB 5IGXH 2XN1A 1UKTA 3HNVH 4FQ2H 2G2PA 4NQEA 3MJ9A 5AVRB 3A3YB 2G5BB 3Q13A 3UDWA 1A0QL 2UZXB 5EU6D 5T1LB 5FF6B 4L8CA 1U3NA 3V6OA 4KDVA 2G9HB 4CW1A 4YDLC 1IM3A 3VWJD 1ZAGA 3SBPA 5EC2B 4WI0B 4AY0A 3KPQB 2ZXEB 1P2CA 4H2CA 3RL2A 3ARYA 4X5RA 5C0BD 4EUPH 2QGCA 3PGFH 4MTMA 4Y89A 4R6UA 1XGYL 4BSWA 2GIXA 2OI9B 2Z8VC 5EU4B 3U4BH 3P2DA 1GGIH 1L0YA 2H8PA 4CSSA 3UDWC 2DQJL 3H2WA 4LOEA 4G6JL 5KSBF 4G7VH 4H25B 3V6OC 2DWTA 1JNHB 2DQUH 4J3OG 2WKGA 1BMGA 3KVPA 2EDDA 1EHAA 3M1CA 4PGDA 2HJLA 3GJFB 1EANA 4G1EA 1PKOA 4QGTA 1T1ZA 3STBA 1FNSL 1TQUA 1J5IA 1A6TB 4TSAL 2GT9A 4YBLC 4FFZH 4ISVB 4I1PA 1JK8B 4ZMPA 4N90D 3WXWL 1LO3L 1Z9SB 5BPPA 5I73C 2W9LA 1FE8H 2CRIA 2I60L 1E90A 3IKKA 2B0SH 3SB3A 1WBXA 4IRZH 4NNXB 4JBSA 1W80A 4WI5A 2IDSA 1HEZA 1RUQH 1NOLA 5AD0A 5JIPA 2FHFA 3QPQC 3N04A 1BQUA 4DKFH 1NWOA 1MCPH 5CIPH 5CSZB 3OKEB 4BELD 3GFUA 5ISZE 4R5VA 2CRZA 2NOYA 3RL1A 3TCLB 4M1CD 3G5YA 2LTQB 3DX8B 3WG7B 2WLMA 5JMRA 3RVVD 3V7MA 2H0EA 3IETA 1KLUB 4DVBA 2ZWLT 3MQIA 3O6ML 3LS5L 2XQ0A 1NDGB 1D5MB 1PZ5B 3MMEA 4R7LA 5BOZG 1ETZB 1A2YB 2UZPA 2QMKA 1RPUA 1L5GB 3KBHE 2VL5A 2IAMB 3D1MC 2XZAL 2ZYSA 4P2QB 3DK0A 1KZQA 1X5IA 4ZUSB 4LDOB 3LN5A 4CC4A 2YFOA 2B1AH 4P57A 1X7QB 4F92B 5HDLA 1KPRB 2A99A 2Z0BA 4IHOA 4IOIB 2BNQE 1CL7H 2H1PL 5EORH 3STZB 1UXMA 4ZW5A 1BAFL 1TTBA 2DQEH 3VXMB 1RHHB 1ZDQA 2GJRA 3L4YA 3HZKB 3D39B 2J1XA 3L45A 4PJHB 2XDHA 1HIML 4NKOB 2IADB 4JQVA 4ZDHB 5GS2H 1C1EL 4LIQE 5IVOA 1P7QB 4NJAH 3L3IB 2X4QB 4H0GA 4G6FD 2EXYC 5DUJA 1EPFA 1FGNL 5I1GH 3WIIH 4AQAA 2VDNB 2BX5A 4CC4C 2DYPA 1JXGA 3X1FA 1I1FB 4KROB 4RAVA 1J12A 1CGSH 5LUMA 1BQKA 1DQMH 2EIZB 5LKNA 2CBMA 2ZCHH 3RUGB 1M42A 3BN3B 4H26B 1MW1A 2KZWA 3D07A 3S2AA 5LDUA 4UOW0 4NO3A 2EIMB 3NMEA 1TQBC 4HK0B 1AVAA 1CLZH 2EAEA 3W9DB 3AY2A 2QJDA 3BEWB 5FYKD 1BYPA 1NDTA 2KQMA 3UTSA 1WVZA 4OD2B 1EJOL 1TVHA 3MBWB 4KI5C 4JQVC 5DYFA 3KVDD 2AFNA 3SN6N 5IHBA 1PY4A 1S78D 1ODAA 5ADOH 3W3BA 4DVRL 4UT9A 2FVNA 4JDEA 4NC2B 3CQPA 1UZGA 3AJ7A 3NJMA 1JZ6A 3DETC 3VM5A 2XXFA 4OFIA 4ZMOA 3EDJA 4A2LA 1XHHA 2Y5TB 4G8IB 1ZK9A 4L3EB 1I8MA 3V0AC 2OP4H 4QRTA 1K8IA 3TJEH 3WY4A 4LARL 1IM9D 1GYAA 5AYQA 1DE4B 3MTRA 2E0PA 2R4RH 4RA0C 4ELMA 2ZCZA 5K1JA 5E1AA 5C0AA 3CZKA 1QSEB 1DHKA 1Z3RA 2M83A 3VTTA 3VXSB 2ZXCA 4R2GB 4FQ1L 3WTSA 3GMPA 1DVYA 4HCRH 1OARH 2DJUA 3LQZA 5E2WH 4QXTA 2UVEA 4IDJL 3HE7A 3PHSA 1L4IA 3ZN6A 3VXOB 1YEDA 4HH8A 4XBEH 3U9PL 3X11A 1OOAA 2VXUH 3TBSB 2P1YA 3P40A 3ALWA 2A77L 25C8H 2OL3L 3BMVA 4H8HA 3HE6A 4W9GC 4HHAB 4OLUL 4K15A 4S1SH 4AGPA 2BY0A 4GRWE 4ABQA 2H6PB 4KKRA 1HYSC 3MGTA 4UOJA 2XACC 3M7OA 4K5PA 1IX2A 3P4OB 4X5PA 4WW1B 5DEFA 3ZTJH 3HHMA 4IBTA 2VLLB 3T8VA 1A8JH 2HZHA 1JE6A 2OMXA 4Q6IA 4X6FB 1RUAL 4F24A 2V17L 5E03A 1D5ZB 2R83A 3LX9A 3ZQ9A 3B56A 2AV7B 1S5IL 1TU2B 3HE7C 4XMKH 4YDKL 1VFUA 2N01B 4R26L 3TEXA 2FX8H 4NRYA 1E43A 3FONB 4DTGH 2XWDA 3VD5A 2F8XC 2PTVA 4TVUA 4PRBA 3HE6C 3NOIA 3II1A 3A6CH 3OGCB 4MXVE 5D71H 3M17B 1HC1A 1Q8MA 3O4LE 2R2CA 3ULVC 3DX7B 3KDPB 1AXTH 2C9AA 1NBZB 4YDMA 3PQYD 5DUMH 4HAGA 2R0KL 4YE4H 5AB2A 3BO8B 4NO0A 2EE2A 2ITEA 3QJXA 2IWEA 2BK8A 3BW9A 3MXWL 4ACPA 4FQIH 5ECGA 4MAYD 5BJTB 1M53A 2BS71 1DVZA 4W9DC 4Q6IC 1XF3A 4Y7MA 3IM1A 4HC1L 2HRPL 5HVHC 4U2ZA 3TBCA 4BQ8A 3KPSD 1CE1H 3OZ9L 1JYXA 1ZGLB 4R96B 3TBVB 5MP6H 2A6KB 3WELA 2PYFB 2K9UA 1UT9A 3U2SA 3MO1A 2UY6B 3EUUA 3HCVA 5KOVC 5C7XL 1SLWA 3HZMA 3QCTH 3QI9D 3FN9A 5GS2D 4HUUB 3FT3A 5AZUA 3D2UD 3VGBA 2R39A 4KJYB 1WAAF 4P5KB 3QRLA 4XN8A 4B96A 2JQAA 1BX2B 1VFBA 1PF3A 2UVFA 1BOGA 4P2RE 3KXFA 3SJVE 3NACL 3O41B 1RVFH 3KWXA 3UX9B 3VXQA 1LLAA 4KHTH 1WD8A 4N8PA 4KJPC 3ATBA 3MV8D 2Y69B 5FDYA 2MOQA 3DX9A 4XHJD 2XN9E 5LNEA 4DW2L 1ZANH 5I0DA 4PV9A 3V8OA 4PRHB 4WO4A 4CNIB 2JB6B 5FM8A 2L8AA 5EHFA 3O2WL 3UBXI 3CVBA 3FSOA 3BSZH 5I2IB 4XP9L 5GHWL 5CCJA 3SZ6A 3WOVA 1UJTA 4AV5A 3QORB 3GXMA 3MUUA 3V0IA 2IGFH 4JY6A 1U33A 2YOCA 4J23A 2H9GB 5HYIA 3VXNB 3G5ZB 4LLVB 1CIDA 1AJ7L 3A6OA 4UCFA 4GBXB 4XMWA 4PV8B 5KBMA 3SZKC 4S1RL 2WKOA 3ROOA 4A7UA 5JW5A 4QO1B 1RULH 3MLSH 4LLQB 4M5TA 2P5PA 3QWQB 4XNMB 4Z7WA 4ZYKB 5I8CB 4KK5C 1QO3A 4ZJ9A 4WO4C 1XF2A 3TCTA 3GSVA 3FO9A 3HA0A 3EH2A 2AXHA 2NX5A 1W16A 3T0EE 1E9OA 1A47A 4YHOL 4G9FA 1EWHA 1KJVA 5B4MC 4GRMA 1KIPB 4TLUA 4X7FC 3B6SB 2ZUSA 3QNZA 3K1DA 4PW3A 5CEXA 4GINA 3RURA 1LWHA 3C9NB 1REIA 5T3ZH 1FIEA 5A2BA 1TXKA 1X5JA 2I24N 3UBXG 4A7GA 3E8UH 5HDBF 2BP0A 3TBWA 1MCEA 5JXAL 1G9MH 2HJKA 2LOEA 2BNRA 3EYOA 4URTB 3CUPA 1LE5B 3FOMB 1XT5A 1RP8A 1AO7D 2J6EA 1T6BX 3RFZB 3DURA 1VZHA 1Q9WB 3HBGA 1LO4H 3D4GA 4CBZA 3GBEA 5L6YH 4NQDD 4OZIB 2WMPA 4XWOD 5DZPA 4BZ1H 5IGXL 2XA8H 2FR4B 4K5LA 2Q0ZX 2ORBH 2EIKB 3HNVL 4EIGB 2Y06H 4FQ2L 1FZKA 2FTAA 1D7BA 4CN4A 3MVSA 2CLRB 1FN4B 3E38A 4BEIA 2Y22A 1BZ7A 3PNWA 5EULV 2HTLD 2VN3A 2Y7QB 4HWZA 1OLZA 1QSFA 4JANA 4CILA 2MPVA 4QRUB 3SYQA 3LNEA 3VB8A 3LNHA 4CVXA 1KN2H 1T0MB 3CFTA 4QCIA 3MRIA 4PRPD 5DMJB 2IWFA 2OMUA 1RD6A 4B5ZA 5KS9B 3RFRA 1HNFA 1A3RH 3BD5A 4LEXH 1XD1A 3QULA 3BGFC 2F58H 2D0FA 1TTGA 3PF2A 5EU7E 1X44A 3PGFL 2HX8A 3GRWH 3L6FA 1QI4A 4MHHI 1NGXA 4NO5A 4XCFH 1A4CA 5FCSH 2OX5A 4BZYA 2BVOB 4FL4C 4WEBH 4DSYA 3M1BA 3U4BL 1GGIL 4NNYB 2I85A 1GC1C 4X6CE 3LS4H 2VXSH 1BVNT 1IBYA 1KLGA 1L0PA 4G7VL 4HSCX 2X4RB 1RZPA 2DQUL 1XF4A 4ZNEA 2QSQA 4Z18A 1F00I 2R7EA 4PJDE 4LPYA 3X14A 1DJXA 1WWCA 4ZMAT 1P5UB 4GAJH 3UPRB 5FV2A 2CHZA 3AU1B 4WWPA 2WZ6A 5CHNA 4FFZL 4YMPA 1WFTA 3V5KA 4MDRA 3BWZA 4PWEA 2CCWA 1A25A 1T0OA 3R19A 3BISA 3MRLB 1CFNB 3ISRA 4AIXA 3KDMA 2G5BA 4OVVA 4LVHC 1RH8A 4MAZA 5DRNB 1RUQL 2GQHA 2Q1EA 5DLLA 2O61A 1EEZA 3V6FB 5HHOA 4DKFL 4L5FE 1MCPL 1ZV2A 3PAYA 4QUOA 3CDZB 3GIZH 4MHHG 5C0GA 4WI0A 1SF5A 4Z6AT 4WUUA 2UXFA 4X4XB 3S3SA 3IJHA 5EU4A 4KNTA 5HJDA 5B39A 1DUZA 3BXNB 3VQ2C 4LLMB 4JVUA 4CDGC 1G1CA 2ZSVB 3C5SB 1K2DA 4NQQA 2VDMB 2WY3B 3VI3E 3QUHA 4H25A 1EIBA 2B1HH 4HPHA 5KVGH 3ZE2F 1WIUA 2MTAA 3S3CB 2B1AL 5DMKA 3HI6H 1MH5B 2Y23A 1CF1A 3NIDB 5E0QA 1FVCB 1UM6H 1JYNA 2Z8WC 4QKTA 2MNWA 2Q7YA 3G9VA 1CL7L 4ISVA 4Z7OE 1I85A 5EORL 3QRBA 5ABAA 1Z9SA 3FQNA 2IDTA 3HLAB 4G8AC 4OT1H 4PW9A 1IKFH 1XSKA 5IY5B 4L1HA 1QATA 4E9LA 2OI9C 4R4ND 1PBYA 4WTXA 5E00B 1UQSB 5EIIG 4FZEH 3B2DC 3DGGB 4K5NA 3VFGH 4FYSA 3OR6B 4NJAL 1EBPA 3NJKA 3ZTDC 2UYLA 4MKMA 4Z7VA 2O93L 5IIEB 4BCXA 2E8ZA 2HRGA 5CSZA 5DHVB 4KNQA 2YD6A 2FLBT 3D3VE 3BRGC 4RX4A 4GJTB 4RRPG 2CUHA 5C0NC 3H9HB 4YBQC 1DQML 2QGEA 2ZCHL 4K2UH 1I85C 5C9JA 3MTXA 1OF0A 8PAZA 1ESOA 1JTTA 3HS8A 5I15H 1H5BA 1CLZL 2QLYA 1A65A 1D5MA 1NDGA 2ATPB 4AH2B 3EJZD 1NUNB 4ZX5A 1L5GA 2ZXWB 4KTDH 1Y1DA 1E8WA 3SDDA 4OZHE 5DJ2B 1B2YA 1G0YR 1M2VB 4OGYL 4K7PL 4X6DE 1F3RB 4HUNB 5FOBA 3HFMH 1LM8V 3TO4D 3OVUB 5ADOL 1ZT4B 5CBAB 3IGUA 1X7QA 1NKOA 3SCMD 2G4EA 2V5SA 4DP1X 1KPRA 3DVGB 3KL3A 1IC7H 1PTZA 4Q9CA 1J10A 2LTQC 5J13B 4I9XA 1IIKA 5EF2A 3IRZA 5F89A 2ADIA 1RHHA 2OP4L 3KYMB 1OAJA 4YHNA 1BD2E 4YGVA 3QCVH 3TJEL 2DIEA 3HZKA 1A6WH 3D39A 4Y4FD 5DEJA 1H5BC 3UTQB 4PJHA 3H9SD 5D93B 3BESR 2X4TB 4GSDH 4KFZC 1OAUL 1I8AA 4NKOA 3U4AA 1B6UA 1P7QA 3VGHA 2X4QA 1M9WA 1TSRA 3TA3D 3SDDC 3M88A 2C4FT 3QZBA 4X83A 4HCRL 3WTYA 1OARL 5ISZB 3GMOB 5E2WL 3MV9B 2Q20A 2F6AA 3FQWB 1QHOA 4GQQA 1MPAH 3ELAT 4N9GB 2VR5A 4XBEL 2VXUL 4KNSA 3FFCD 4YC2B 4WAFA 2HKFH 4M9PA 4RFOH 25C8L 2EIZA 2RQ8A 3EO0B 5BUAA 4OI7A 5D2LB 4QR7A 1OQOA 4H26A 4FQQA 4KITB 3QHZL 5SWSD 1MOEA 5HGHB 1MNNA 5TF0A 3FN0H 3DARA 2O6EA 2DDQH 4TXVB 1CDJA 2WWMD 1A1NB 1SEQH 5C6TH 4APQB 1QTPA 4YDJB 4E42B 3ZL2A 1DQJA 2WYIA 4NZJA 2NXYD 3DVIA 2X4NB 4MCNA 3V5DA 5GGQH 4XGZB 4QNPE 4FTVB 5MERA 1JUFA 4XMKL 1QASA 43CAB 3MNWA 2FX8L 3H3KA 1CR9H 3JSSA 1W6LA 3FRUB 3DOSB 4KROC 1GGTA 1PG7W 2Y5TA 4G8IA 1KUMA 4L3EA 1GS6X 2JSFA 1L9OA 2LV4A 3IFNL 1XAKA 4L1BA 3DIFA 1JV2A 4ZFZA 5DGQA 4D3CH 1L9PA 1AXTL 1TETH 3U4EB 3L1OL 1LE9A 2BIMA 5DUML 2ICEB 4YE4L 5JA8B 1AD9B 2AXWA 2WBKA 1QSEA 3MCYA 3QQDA 4XPTH 5ESQB 4ZZKA 1IGCH 4N0FB 1M57B 2SODB 1NM4A 4MJHA 5E94B 3SKJH 5FR3A 2HPTA 4O02H 1U4FA 3G9AB 1AS8A 1IFRA 4OW6A 1KGJA 3VXOA 1CE1L 5AL0A 3TBSA 4BUHA 4E41E 3NZUA 4MA1B 3QNYB 1WC7B 5E6YA 4FFTA 5IJBC 3W57A 4W1TA 4HHAA 1HHHA 2VDQH 3BDXA 3GXPA 3QCTL 1NEZG 4P46D 1XFPA 1HEJC 2ATAA 5DJ0A 2ITDB 4HUKB 1GW0A 1T7XA 3RGVA 4HZ1A 1I53A 5HYSA 1CJYA 2K7QA 4LDEB 1RVFL 1THCA 3OG6B 4Q2ZB 5J12C 2EINB 1D5ZA 2NLJB 1OCWH 4IBSA 3WLWD 5B8CB 2VIRA 5IW3A 5C08D 1CDCA 5GS1B 3GNMH 4Y1AB 4CU7A 4QTIH 1ZANL 3Q8FA 4U1KB 3KYAA 1KCLA 3IPBA 3WKMH 3UAAA 2YPLE 3T0BA 1KCVL 1L7TL 4ZUWB 1CXLA 3BSZL 2P7TA 3PREA 4B27A 1NBZA 4PGJA 4OIFA 1AOZA 5DZLA 4AJVA 4DK6A 2J5WA 2IGFL 3BO8A 4ODVH 2BP8A 3QDGB 1DN0B 1ONQB 3EFFB 3RGVC 3ZO9A 1TLKA 3MNVB 1AZZC 3IDGA 3UAJD 2PKDA 4KKZA 2CIIB 2WVSA 5DRZB 2WXOA 3VWKD 1ANUA 3RZCD 3QWOB 3CQFA 3RWHB 1RULL 3MLSL 1DVTA 3TT3H 1AKJB 1E4XH 1NMBH 1SEBA 3ECWA 4UDTA 4Y2DD 2YQ2A 1NCAL 5D1QD 3G6DL 2WLNA 3QZLA 1OWRM 4YHMH 2EUXA 4UIMB 2YLHA 3BZ5A 4KJYA 1S7QB 3S3JA 4F7MB 5D96C 5MEPA 1BX2A 2X88A 2XPGB 4RGND 3QUMB 1IAIH 3UTTE 3L7FB 2JKSA 3GBNL 5A2JH 3K5RA 3TZVA 2ZWKA 5T3ZL 5DK0B 3IRCA 5ID0A 3AWGA 1OOWA 3GDCA 3KHQA 2TRHA 1BQSA 3OKNB 4A66A 4MS8C 4ZK8A 1KY6A 5I76B 5IVXA 3IMVA 2GC7C 4FG4A 1U58B 1XCXA 1G9ML 2WLYA 3BE1H 4ZXBD 4X9GA 4AYBA 5HDRA 4CNIA 4PVLA 2EEDA 1FC1A 3SDAB 2MMXA 4BKSC 4OFYD 3MDJA 5DMGD 3O8XD 5B3SB 3QQ4B 2OS7A 5HHNA 4DK5A 3QXAA 3GDBA 1N68A 4JG0H 3TPKA 2WYHA 4MNGE 1LO4L 2APFA 1TZHA 2VABB 3BKYL 2H9GA 3HFFA 4NO2A 2NQ3A 3VXNA 4LLVA 2VXQA 3VNZA 2MSPA 4G1MB 4BZ1L 4GBXA 2XA8L 3EYQD 3MLZL 1NC2D 2ORBL 4GRWF 1BF8A 1K6QH 1LO5A 2MOVA 3TZVC 2Y06L 4LCUA 1B0IA 1U42A 3CZSA 2PPDA 1D6EB 3OHXB 2R1YA 2XIIA 4LLQA 4Y19B 5CEZE 3W0WE 3BWAB 5I8CA 3WD5H 1Q9OB 1ADWA 3ABKB 2AQ3A 4ZO9A 4Z7AA 5DWPA 2QSCL 1KN2L 1MNUL 2O5ZH 4UT6H 3OC8A 5IBLC 1I1AB 3L7EA 2K7PA 2FNWA 3P4NA 3C08H 5B38B 2OJ1A 5D1ZI 4BK4A 2PYEE 2CCVA 5EZPA 1A3RL 2J4WH 2SEBB 3B6SA 4LEXL 4P2RB 4F2MA 3SJVB 2N7BA 5I1LB 4L1LA 5LGJB 1U41A 2JMRA 3P4LA 3VTAA 3C9NA 3OJ2C 1WV7T 1NM9A 3NAAL 4GBXC 4MXVF 4XCFL 4ONFH 2B9AA 2XN9B 4HJGB 4PJ7A 3OC5A 2BSBA 4DPCX 2PP9A 1OP5H 4YSQA 2WKLA 2WBJD 1DSFH 2WNXA 3H3PH 3B9VA 3FOMA 1TFHA 3RFZA 2LGNA 4OJAA 2ZICA 4B3EA 5GXBB 1DQQB 2N1KA 5AB0A 1ULVA 3FT4A 4GAJL 4KRPB 4MJ4A 5ACMA 2IAMD 4F8PA 2R29L 3IXTA 3OKLA 4PVNA 4OM1H 2W07B 5KWYC 3POCA 2FR4A 3RA7H 1MSPA 3V0VA 4JO5A 1W0WA 2YAPA 3P9LB 5LBSH 5J7CC 4CN1A 4EVNB 4YSRA 3LJ3A 1R34A 3KLAB 2WXMA 2XNAA 4M1GH 5JORA 3D25A 4LSTH 2QGBA 5IEHA 3CFNA 2K9FB 3BKJH 3K6IA 2RD0A 4RA3A 4X4ZA 1Y6KR 4WGWB 5AW6B 3WEXA 5E7BA 4FNTA 3B7YA 1IBDA 3VXUE 3EJPA 1A7OH 2GITA 3T0EB 2BSCA 4PJEE 3GIZL 1SOSA 3SE4A 3RFZC 2H1LM 2BY1A 4Z7UA 1E67A 4ESKA 1WE5A 2A6JB 2Z4QB 1QUNB 1HJCA 2CUAA 1EJFA 3FUNA 4NQCD 5FFLA 1GGBH 1XSIA 1R3IL 4DOHB 1WA1X 2O6FA 1AQ8A 4BZ2A 2BVOA 3MZTA 1F3DH 2OMYB 3HB3B 4NNYA 15C8L 1ZTXE 4OM0H 2MIZA 4X5WB 2DWEB 2JIXD 1IEHA 2X4RA 5KVGL 3FUKA 2FO4B 2N3JA 2XFXA 2D7QA 3BH9B 3W56A 3HI6L 5DO8A 2CBQA 2YD8A 4TNVK 3TIEB 1HDMA 3SE4C 1UM6L 2IBBA 3QRFM 1PLBA 1NCHA 1P5UA 2Y1ZA 3UPRA 3AU1A 2X05A 1NIAA 3OKOB 3EYVB 4ONGL 3EH5B 2VR9A 4M93B 3VXTB 1CFNA 2WO3B 5ERWA 3VD9A 4QRRE 3V10A 2WLLA 1J5HA 4Q8BA 2KMWA 5MEOA 3VFGL 4HF5H 5ICYB 3FU6A 4FTDA 1G9EA 4XN5A 3TEWA 3SPCA 4L29B 1M4KA 1P0SE 2EXSA 4Q58C 5E1HB 3V6FA 4YAQA 2ROYA 1QRNE 5JYLA 5FYJD 1ZVSB 2YGPA 5KYWB 3CDZA 4U1HB 2OCFD 2GEEA 2VH5H 4GW5B 4NHUB 3ZHNA 5T1DH 1BXVA 1FVEB 1P5UC 4AG4H 4N2LA 3VXSD 4JHWL 4QXUH 1KB5B 3ESUF 1M1XB 3MRPA 1E2WA 4QHKJ 5I15L 5F3BA 1I3RB 5T1KB 3JWNH 3N91A 2X09A 4X6CB 3BXNA 3BPLC 4LLMA 2ZSVA 3REWB 2WTOA 4KTDL 2HT3C 1GGCH 5KTEL 1MLBB 1DJWA 4W9LC 3VFMB 5TJWK 4PJDB 3U1SH 2C5DC 4A1RA 4AXWB 1IC7L 4U1NB 3F7KA 1AH1A 4JFDE 3ZT5A 2MHAB 2HKHH 3DX2A 4ZG1A 4IYKA 1Q72H 3GUTA 1ET7A 1V55B 5I1IL 3QCVL 4WKZB 1E7UA 2RB8A 1A6WL 3CH1B 4D8OA 3ZE0F 4JFFA 3NVQA 3MRKB 4GSDL 3TBTB 1UQSA 1VZIA 4XN9A 1QWUA 3NCMA 4XNBA 4HALA 3LPWA 3V79C 1G1YA 3OR6A 3PS6A 1TR7A 3HZYA 1N0LB 2D2OA 4XCNA 1OSZA 4HK3N 2DQMA 5D7JB 4Q7DA 4UILH 1UD6A 5IIEA 1G7IB 1UXSA 4Z3TA 4LCWE 4YIQA 3MN8A 4K3JL 2GAZB 2J5LB 2BOLA 1HSAB 1EXUB 3CLFL 3BYYA 4MMZB 1MPAL 3EGDB 4P3CH 2H0PA 3N2JA 4MYWB 3UCQA 4X4YA 2HKFL 4RFOL 1UKQA 1KCWA 2IGTA 3MGOB 1HCFX 3BCDA 3L4CA 4NFCA 4DN3H 4QXVA 2OTWB 4FQLH 4HEPG 4IOSD 4GW1B 3FN0L 3PAVA 2XC8A 2DPKA 2DDQL 5K9KB 1OGAD 5DS2A 2FO8A 7PAZA 3BJLA 1SEQL 5C6TL 4NWUL 3VI3B 4IKIA 2QV2A 5DJ2A 1W72B 3DX0A 3QDJB 1AMXA 2LVCA 1SJVA 5KEZA 4PLKD 5DUPH 3RVTD 5GGQL 3ULVF 1BYOA 1ZT4A 3MUY1 3DVGA 1MWAH 1HJBC 3CU7A 5EN2A 1CR9L 3VG0H 1JNLL 1IAIM 4Z7OB 3QXDB 3JV6B 1EAQA 4HJUA 4DZBB 1CTMA 2YD0A 3ETBF 3DA0A 3KYMA 4CVZB 5EO1A 3EZJB 3CN3A 4KJQC 4NQXA 2P42B 3GZPA 1TETL 2YO3A 3SGKA 4ANUA 3EHBB 1H6EA 1AE6L 1KTDB 5AW1B 3KZ8A 1PD6A 3P3UA 5L8KB 5MENE 1ZS2A 3DSFH 2X53A 4XPTL 4UV4H 2F53E 4LOUC 1IGCL 2MEJB 4N0YH 2EDOA 4AKQA 3SKJL 4Y9CA 1ET5A 4MJ2A 4O02L 5J6SA 4BQCA 2DEXX 3MV9A 3Q05A 3P73A 3D3VB 3NH7H 2ZIDA 1MAMH 4N9GA 4RIRB 3WKYA 3KPRE 2CGYA 2FJUB 5D2LA 4Z78B 1H8OA 2VDQL 2WZPD 5AOIA 3CSTA 2X1XR 2ZXGA 2EC8A 2B4CH 2WK2A 4I48A 2XT1B 4YHYC 4IJTA 3NFPB 3GB7B 1CT8A 5D93C 1FSKB 2F7IA 1FPTH 2ZNXA 3SGKC 1A1NA 2GTZB 2WQRA 1OTUD 1FYTE 2X2HA 4PD4J 1E0OB 4YDJA 4E42A 1F1GA 4W9IC 2DLTA 1KCKA 1BBJB 2V6HA 2EJ1A 3QWRA 4ENED 2X4NA 1RIHL 2ZP0T 3CZUB 1OCWL 4FTVA 3E80A 4J7RA 4M4PA 1BFVH 3VD7A 4UQ2B 5CLZA 1TTUA 1FA4A 2CNZA 3FRUA 3N43B 3DOSA 3FUHA 4QTIL 5J8OA 4YC2C 1EVUA 3WKML 3K71A 5JHLH 2Y0SA 5FO2A 5HI4C 3DYPA 1P84K 3SD2A 3U4EA 5HDOA 4YHPB 1RIUH 1Z1WA 3JYCA 2P80A 4X7SH 3GTVA 1MI5D 1IEBB 4ODVL 1XCQB 3VI4A 1EAOA 4IDLA 5KYNA 2VNCA 2GTWA 4N0FA 4KJWC 4ZFOB 2YBRB 1C7TA 1YC8A 3KLHC 3EYFA 3ZL4H 4NZTH 3TT3L 3ZKND 1HQ4A 3VXRD 3KH3A 1E4XL 1NMBL 2HFGL 4FQJH 4L8DB 5I17B 3GSXA 1WC7A 5AKSA 1JPFB 4EAEA 4OZHF 3BZDA 5KVDH 4YHML 4F37F 4X6DF 5F1SA 3OMIB 4C83B 5FW6A 3ECVA 4AIZA 2BCMA 2WKOF 5CAYB 1YNKH 1E9PB 1NDMB 5LHDA 2FE0A 3OB8A 4YUEH 2WQWA 1IAIL 4Z7WF 3WXVH 2WNWA 4XB3A 4G2AA 2Z34A 1U8QB 3VFNA 3LQAL 1NCIA 1G7QB 3NRFA 4IRJD 1N70A 1A9BA 2NLJA 3LKOB 1G6RB 3HUJE 3MYZA 3T77A 4OD1H 3ZHKA 4BFRA 1PZUB 1FZMA 4Y1AA 4KKLD 3CDCA 4NOFA 3QIBB 4P2OB 3WY3A 1W8EA 3BE1L 4MA1C 4YGAB 4QOKB 3UGXA 4F2FA 2D7TH 5HHPA 1SDDB 4ZUWA 1HYRC 3RTQA 2P8PB 3CJJA 2W94A 4Y9FA 3O6FD 1DSWA 1ND0B 2WO4A 4A7GF 1CE6B 5EIQA 3QDGA 1ONQA 3IN0A 1I1YB 2O72A 5JMOC 2AXFA 4LSQL 3QUYD 1RZKL 5FKPA 1RHFA 2Q2EB 1K6QL 5ENWB 4P4KB 2ID5A 4X8XA 1OP5K 2N1TE 3M6DA 4TNGA 1IJ9A 5TE4L 2Z7ZA 3ILPA 4E41B 1RKRA 2CE6A 3VRIB 4GAYB 4XO9A 5E4AA 5FGSA 3AC0A 1H0DB 1KTCA 1PKQE 2O5ZL 2Z0UA 4UT6L 3S4SG 3KM1A 4UIMA 1R33A 2MNUA 2Y1VA 1QNZH 3C08L 3QCUH 5F6HJ 3RTQC 1S7QA 3FT9A 4F7MA 4GRLB 2J4WL 1TYJA 2XPGA 2XCMC 2FEDC 2OSYA 2XKNB 3QUMA 3N3EA 4TTDD 2DWDB 4AM0Q 3K3QA 4G80B 4OUUB 5DO2C 3WI9A 4ONFL 3PABB 4LL4A 3BD3A 3OKNA 2IFGA 4J3UA 2VCOA 3FW6A 4AQZA 1U58A 4YZFF 1GZQB 1DSFL 4HCIA 2YPLB 3H3PL 4OQTA 3UBXB 1Z5YD 5GGSB 1LVEA 4IGBD 1ZVHA 4I18A 2BVTA 5IFJB 1Q0EA 1F13A 3QQ4A 5DXWA 5F7NC 1AS7A 1R5IB 4HKBA 2VABA 4LFHG 4PHZA 4OZFH 4OU3A 4TVPE 1ETB1 4ANWA 4OM1L 4W4NA 4XX5A 5BXFA 3NT0A 3SGEI 5LBSL 3ZKXB 1RUPL 5IQ9B 1D6EA 4ZFFB 3OHXA 4M1DL 4XT1C 2AJUH 2Z92B 3CQQA 4C4KO 1S7RB 4M1GL 4Y19A 1JWMA 3BWAA 4LSTL 1DJHA 1Q9OA 2CWRA 4WFFE 1KWGA 5A7EA 3SGDH 1VB9A 3M86A 5ALBH 3OR7A 1A7OL 5BV7H 5FDWB 3LAFA 2P49B 4I18C 5B38A 2Q76B 1QYGH 5IJCC 4AZUA 4LF3B 3DV4B 3AG4B 4IS6B 3LH2H 5HPMB 4P2RA 3F7YB 2VE6B 2XTJB 3SJVA 2CDEA 3UTTB 5C7ZA 1ZJBA 5C8JB 1OW0A 3DMMB 3QJRB 1YCSA 2PWFA 4DO6A 1AOHA 2HLAB 1HOCB 2I9LA 4KV5E 1S7XB 2M8XA 3L9EA 4F8QA 3MX0B 2L7EA 4MDIB 4HJGA 3BQUD 2ZWZA 3OHXC 2AQQA 3ALXA 2VMJA 1WITA 4OM0L 2DQDH 2VSKB 5JPNA 1AC0A 2X4UB 4CU6A 4UUJB 1P4UA 3V55A 1J8SA 2A2QT 1T2QH 2R1XB 5CN2A 3WEAA 2CJUH 4AC2A 4MNGB 1MFEH 1U92B 1NLBH 4X98B 1SJEB 4XNZC 2W07A 1OW0C 2GFBA 2HVBA 2VN4A 5D7EA 1RK1B 2DQGH 1LP9E 1UHVA 2ZKXA 4F33A 4DP7X 3B3IA 4C54A 1CFBA 2GK0A 4EVNA 3PJLA 3TS8A 4ILDA 4F5CA 3IN2A 3KGTA 3UH8A 5D7SH 3D85B 3KLAA 5AWNH 1S9WB 3MFFB 2NXZD 3DBXB 4HF5L 1X4ZA 2DM4A 3N44F 3QQNA 4X0KA 4ZMZA 5C07E 1P53A 2DJMA 3L5IA 2OMWB 3WFBH 4QAMB 3IGAB 5BO0D 1LTXA 2PYEB 4JFOB 3D8MA 1FL5B 5KVFH 4KY1L 2VH5L 3T8XB 1NPUA 2CKBH 3UC2A 1Z3GL 4FFVD 5F6IB 1LEKA 4AG4L 1CICB 1WAEA 3NESA 3LPPA 2B9BA 1S9YB 2DI7A 4Z7VF 5ISZD 4NBYB 5D1XE 5A2KH 4NQUA 5DTFB 1ZDSA 2QVTA 3O0LA 3V4PL 4B9KC 3A4EA 4X5WA 3MJ9H 1SXCA 2DQFB 1E27B 5FEBA 5FA4B 3VCLA 1XB8A 1CD1B 4U1GC 4M5SA 2EH7H 1QI3A 3U1SL 3CDYA 4HIHA 1SMDA 3I02B 3TIEA 1JXFA 3QEUB 3L4XA 3OQ3B 4PGZA 5AW2B 3LRLA 4J1UA 4HZAA 3KMDA 3HN5A 3OKOA 2CSPA 2EDNA 3EYVA 4BD4A 1Q72L 2A6IA 3VXTA 2WCGA 2ZONA 3F6JA 3WLBB 4JFSA 5JO5B 2EZ0D 1VENA 2AK4A 2WAQA 5F7EL 2CLZA 3EJTA 2BNQD 4G8GA 3HB3C 3N55A 5ICYA 1Z9PA 4PYHA 4PSRA 1FVDB 4L29A 3QJFA 5EIIB 5AZEH 4UILL 2NNAB 4E9WA 4PJFA 1DQIA 5H94A 1AXSB 3W9EB 4PJEB 4U1HA 4M7KH 2O6PA 5JQHC 4GW5A 4NHUA 4P3CL 4ZAKA 1FVEA 4J3OC 4QJ4B 1KJMB 1ACXA 3DX6A 1M1XA 4XN4A 5IR1B 1BMWA 3RWJB 4FQLL 4JO4H 5IW6B 1TKWB 2GB2A 1TSHA 3G5VB 3REWA 4O2EA 4PJ9B 2EDYA 2CQVA 2ZX7A 3GSUB 4RFEA 2EVIA 2IV8A 1YJDL 2E6PA 1U8OB 3FQ1A 1A7QH 5DUPL 2PF6A 4ODXB 1ZKAA 2XXMB 3MLVH 1MWAL 1S6NA 3QNFA 4XNDA 4XPFL 1NBCA 2V3EA 3UTZA 1EHLL 4ZAKC 2R0LH 3IDMA 3MAWA 1ZHKB 3K2KA 4NX0A 2E7DA 4D7BA 4QRRB 3CN0A 4BBWA 4WKZA 1TO5A 4G3YH 3MRKA 4U0RB 3K4AA 2CMRH 3GTNA 3TBTA 1A6AB 3ULSB 3V6BR 3KL0A 4PJ5A 3KEHA 3CFEA 3P9WB 1N0LA 2IBGA 1K5WA 4N1EA 3DUSB 2IQ9H 5D7JA 2IAAC 4N0YL 2A73B 1QRNB 4C4BA 4P4RB 4EZJA 2VERA 1HSAA 2MFNA 2Z31D 3NH7L 3Q2CA 1BF5A 3H56A 1L6XA 1MAML 4MMZA 4E9YA 4FI6A 3EGDA 3WHE1 4XC1H 2OULB 3HZVB 3UO8B 4H8QA 4AL8C 2VLKA 3MNMA 1MG3C 5C0CA 4DKEH 2X9ZA 4GW1A 2B4CL 3QR1A 2ITCB 4N0UB 5K9KA 3ROLA 1HHJB 3LKQA 1FPTL 2UUDH 4LMQE 1I7TA 1UT1A 3MSPA 4OF0A 1MDTA 5E23A 1PY0A 1YPZE 4IKLA 1W72A 3QDJA 2XWBA 4X50A 5D7JC 2QKSA 3MLXH 5GQBA 4JO1L 3N1PC 3QARA 4YOKA 5EBWA 4MMZC 2D73A 3VFUA 5AW9B 2CBPA 3JV6A 2ZG1A 3QXDA 4JFDB 5D7KE 2XA3A 4XNAA 5JHLL 1F6AB 1JBJA 4YE0A 4CVZA 1A7PH 1UB5B 2K3HA 3GSOB 4HAFA 4ICWA 4R4BA 1DSYA 1X5GA 4JW3A 1RIUL 2NY4B 3DTUB 1QLFB 4DESA 1KMGA 1ZWIA 4XPAL 2NY7H 2NW2B 1VGKB 3APFA 3FQRA 3O4LD 2Y07H 35C8H 4LCWB 3KS0H 4W68A 1F1AA 4MNQA 3UTOA 5BNXD 3ZL4L 4NZTL 1BFTA 3P30H 3PWPA 3RX8A 4D9LH 3TEZA 4BRVA 1G0XA 4RIRA 3H6JA 4KO6A 4UT9H 4OJDH 4A7QA 5HHMB 4XMLH 4Z78A 1UVQA 4J27A 4D0CB 2A1WH 2CPCA 2YAEA 1D5BB 5KVDL 4YX2H 1KELH 1PAMA 4HEMA 2WBXA 2ZOUA 4RAUB 2LU7A 3H1ZA 1YNKL 4L4TE 3WL9A 5GZOC 3LIUA 1NEZB 1J5OH 2J6WA 4YUEL 3QPQD 2C9QA 5L2JA 2PO6B 2DQIL 2BHYA 2XWJB 4ZS6C 3OX8B 4I2XE 1TJHH 4ANVA 4OD1L 4UQ2A 2WYZA 1O6VA 4KPHH 4ZMYA 5TPWH 4MWFB 4X4MA 2JLPA 1WRFA 5IB5A 4HH9B 2XICA 3TIDB 1XTMA 1KB3A 2D7TL 5BRZA 5AB9A 4CMHB 1VZGA 4PJ8B 1IC0A 3ULVH 2GC4C 4N24A 2VZOA 4FNQA 3HG1E 5EB9A 1BQHG 5IVXF 3LEYH 5MENB 2EUWA 1CTOA 4FULA 1FNLA 2BJMH 2YBRA 1PAZA 1T80A 3BLPX 2C1PA 3K74B 5JA9A 4X8GA 2VC2B 4LSUL 2ARJA 4X99A 2BOCB 4FLHA 5BQ7A 4CJ1A 5HY9B 3S5LA 5I17A 5EEZA 3KPRB 4KRPD 2W92A 1SJHB 2YARA 3RPIB 3MR9B 4RISH 2FK9A 4BQ9A 5HHQB 2IQAB 2XTSA 4AM0B 3QCUL 1QNZL 1MCQA 4C83A 4AGOA 4JR9H 2OMVB 2YJLA 4PQXA 3QFJE 1NDMA 5FUCC 3C60B 1FYTB 5ID1B 1GJIA 2CU9A 5BZZA 4J8RA 1OANA 1S9VA 1HWHB 2BY2A 3UYRH 4DEWA 1OCCB 3QXVA 3UBFA 2J20A 1CS6A 3O3AB 1XSOA 4OGZA 4R7XA 4XP1H 2R56H 5DLMH 5I1HH 4BKLB 1YRKA 3KWTA 3RIFK 2OZ4A 3ARDB 3QIBA 3VG9B 1EZLA 1WAPA 4AV0A 5JXEA 4QOKA 1BM3H 4IMLA 5LGKA 3NA4A 4UYQA 2X7LA 4NP4L 1SDDA 5CZXC 3RKDC 4LXFA 3MGAA 4PJ7F 4XO5A 5LAXA 5JW4R 1CE6A 1JZGA 1MFVA 1Y07A 4BFGA 5G5DB 3V9EA 2OA9A 2W81C 1JDAA 1XR8B 1TTFA 4BFIA 3HC0A 3QQ9D 4QD2E 2I07B 3RVXC 2Z3FA 4KXCA 4P4KA 3CHSA 2AGJH 3P77B 4QXGH 2AMGA 3KGRA 2AJUL 4W9JC 1ACZA 2AXGA 1N2RA 4G7QB 3B4NA 4J3SA 5MHSE 3EXJA 1CU4H 3VRIA 4GAYA 4ETQA 4YFLF 3QIBC 2GSGB 5JXEC 1MUJB 1EFXB 1H0DA 1J0JA 5EOTB 1G7LB 5ALBL 1CLOH 1MCWM 2CXKA 3H6AA 4X4KA 5BV7L 3CPLB 3X3GH 3CMOH 5GRZA 3UTSD 1KEGH 4EUPG 4GRLA 2X3AA 3LH2L 4U0QB 4WK2B 4HKZB 4MMXA 2XKNA 1EO7A 1T1YB 1Z6JT 3S48A 2IOIA 4OY9A 3KEDA 3D87B 1NMAL 4DHLA 4OUUA 2OSLB 3PABA 2EIJB 2ESVE 1GOGA 2JTYA 4MD5A 4P4KC 2CIKB 4YDZA 3QXWA 2W60B 4KQ3H 3TTYA 2VXVH 2CO2A 3QSKB 3ZRCC 2EDEA 3B43A 5FECB 2QPFA 4Z7UF 1KWKA 4P9MH 2DQDL 2GI7A 3BUYA 1TZ8A 3LSOB 2A7BA 3GJEA 1A4JB 5IFJA 5T1KD 2DQ6A 1V7ML 4PRNA 3BUIA 1T2QL 3TYFA 2CJUL 1R5IA 1SLXA 3K2UH 3EADA 4EOWH 2IH3B 2B39A 2FIRT 3ARZA 4I87A 5D9SB 5C0AD 4GRLC 1MFEL 1JVLA 1O6SB 2ZZUT 4WCYH 2YGVA 1YY8A 4A7VA 1QTYT 5IQ9A 3C12A 4FNSA 4KFMA 2BH0A 1IBZA 3UZQB 5D7SL 2Z92A 2J88L 1WQVT 5AWNL 2DMGA 1XO8A 3GZQA 3F7RA 2P46B 1MFCH 2X1QA 4ZTEA 5C3LD 4FG2A 3WNPA 3S35X 1B0GB 1PKQB 1JHLL 5HVFB 5DI8A 1I7RB 3DXAE 3ULVD 1KB9J 5D1ZB 2DWSA 4PTTB 2DBJA 3OBAA 5D4JA 5F7BA 3K7UA 3L5WA 2F61A 3DV4A 3HUJF 3F7YA 2J6EH 2VE6A 4WHDA 4Z3EA 2CKBL 1KPUB 5DYOA 2CO7A 4LEOB 2YN3A 4HOWA 1MREH 1U95B 2BOBB 2P24B 3K46A 5F9DC 2XWTA 4JPQA 2HJFB 1N5AB 1HOCA 1HXYB 4HGWB 1I9JL 3ZKXC 1N0XH 3C5ZB 4GSUA 4H8PA 1W6WA 4QY8A 1FNEB 4JLRA 4PRDB 4DK3A 4DFIA 1DN2A 3MJ9L 3VUAA 2IPUG 1GC1H 3N41F 4JPKH 2GCYB 4U1JB 3OB0H 2X4UA 4KKAC 1FG2B 3L9RA 4UUJA 4F7PB 2EH7L 4FQHA 4Q6KA 1DANU 5CLTA 3Q2WA 1GHFL 4M8RA 1QNIA 4QI3A 1F11B 3U7YH 4KRNA 4NO0D 1U92A 3DROB 12E8H 3G6AB 2XTJC 4OLVH 4HJ0D 3FT2B 3PHQB 4GSRA 3SPVB 5SWZE 2Y24A 4DO5A 2CZNA 2BS8A 4H1LG 4I3GA 1KXQA 2RR3A 4JEGB 3L3GB 4D8PB 4YPJA 4GXFA 3D85A 4I0KA 4MASA 1XR9B 3MFFA 3QZWA 4XXWA 3ELQA 3QPXH 4G59C 2X6AA 1TZGH 1WISA 3GEFA 3LN4B 4XI5C 3T3MF 3WUWB 4FXGA 2OMWA 2K6YA 2XIDA 1F6FB 5AZEL 5HJBA 1XB3A 3LZPA 2EUVA 3A4FA 4L3AA 1MFBH 3GD1C 1KCBA 2ODHA 4M7KL 3VNYA 3EHBD 4DETA 2D7PA 1FL5A 4JFYA 3N1FC 5DVMA 4AUJA 3MJ8B 4DCQB 3FO2B 4DFHA 1XF1A 3KCPB 5DGRA 3IMRA 5CGYC 3V2AR 1CICA 4DH2A 2CPUA 4TUUA 1JSYA 2D0HA 1S9YA 2VUOA 2VWEE 3S0PA 1G87A 2TSBA 3M07A 5E9DE 3IJ7A 4UTAA 4JO4L 1MLCA 3QHFH 4R7VA 4OLXH 4XXWC 3MRGB 3P3RA 1BDYA 3NP3A 3ZE1E 3QEQE 4C56E 2WCPA 4WTWA 2BIOA 4X7DC 4FXGC 5EA0H 5SX5H 1TFPA 1O9ZA 3V0FA 4FXLA 2GBTA 3QUZD 3ZDYE 1J9TA 2CHDA 5EU3A 2E27H 4OF5A 4OUOA 5I1KH 1MFDL 1DL7L 3DO3A 2EC9U 4KC3B 2R0LL 1PEZA 3MODH 5F6IC 4NKDB 3TFKC 5LQBH 4WWKD 1CICC 3OLGA 1LP9B 2AEPH 5EU6E 5CJ5A 4G3YL 4HT1H 2QADD 2QTEA 3Q2VA 4MJIE 2CR3A 5JO5A 4NBXB 5ICXA 4EI5B 5JW4Q 4J2XA 3ESNA 2B3RA 5C07B 3GSRB 5L0QB 1MJUH 4NYLB 2IQ9L 2VDPH 2HFTA 3OPUA 4OV6F 1P7HL 3FU7B 2NNAA 1BD2D 4LBEA 4E0RA 3E7JA 3O9WD 2NR6A 4N0CC 2G60H 1AXSA 2EYSA 4PJEA 1DBJH 1VADB 4U2YA 5C92A 4G9FD 2D0GA 3FO1B 3CBRA 4FOMA 4AGMA 1C8QA 1CK0H 4XC1L 4HOXA 4N5UA 3PDOB 1KG0B 4M5YH 5IR1A 4DKEL 3L16A 5D1XB 3RWJA 3ZTJG 3AW5A 4K8RD 1M7XA 2R0ZH 4H13C 3N06B 4GW4A 1MHHB 5A16B 5I0VA 1J8HE 5EF0A 2X3CA 1WFJA 4J39A 1FGVH 1U3ZA 4PJ9A 2BNRD 2YXFA 4MVBC 3OMZA 1QLEH 3HHSB 1PDKB 4KK9C 4ODTH 3V4VA 1XDTT 3F8UB 1U8OA 3MLXL 2YGOA 2NR6C 2G0LA 4ODXA 1VDGA 1Y7VA 4N90E 5B7MA 1GAFH 1MCHA 2DTSA 1MIEL 4EQ2A 4JFQB 1XTLA 3PCYA 4ODWA 1OPGH 5KYUA 2VZSA 4WDIA 3N0PB 1L9TA 5DEGB 1VFMA 1A7PL 4GUOA 1SUJA 4N9OB 1DTUA 3ULSA 1O7VA 3QAZC 4QHNB 3EDEA 2AMUA 4ODUB 2X70B 4XHQA 2NY7L 3DUSA 4KX7A 5EBLB 1L0XA 4PJ9C 1RURL 3FTXA 2Q3ZA 2A73A 1QRNA 35C8L 2OBGA 3DUUA 1I31A 1U2CA 1YC7A 4N5ED 3P30L 4D9LL 1ES0B 4JM2B 4HJJL 4PHXA 4JGNA 1SJXA 1V54B 4HIJB 1T1WB 4N2AA 1QI5A 1WP6A 3JBG7 1T0NA 4UT9L 5EBMB 3VI4F 4NOBA 2OW7A 5FO7A 1JWUB 2FDBP 3FKUS 3NA9H 1LNUA 5CBEB 4YX2L 1KELL 3DRTB 5L2KA 2ITCA 4N0UA 1F86A 4UDUB 2DF3A 4LHQB 4PWKA 3ZTNH 1XVSA 4GAAA 1IAKB 3T1FB 2W0PA 1ORSB 4HJSA 2YD9A 1XBRA 2VDRB 3PDGA 3VRJB 4JCLA 1TJHL 4Q14A 4KPHL 2XQBH 5FXCH 6PCYA 3EGSB 4PM1A 3QBTB 1AS6A 2FIKB 3S97C 2RH0A 1F6AA 4B3VA 1BWWA 2BVEA 3TH2T 2NY1B 4UM8B 1JF5A 2XVLA 1YYLH 5EOQH 2X6BA 1LDSA 3ULVL 3QHTC 1QLFA 3L2NA 2J56A 5I26A 1IEAB 3LEYL 3KWWB 2OLDA 3AXLB 5HGBB 1J86A 2CDFB 2NW2A 5IB2A 4TQIA 2BJML 2HG5B 2KBGA 3B1UA 4LCWA 1FC2D 3BZFB 2ZWSA 2D4FA 3D7PA 3ZW3A 1R1CA 4X9FA 1X5XA 4MB4A 1FFTB 3RIKA 1U6AH 1N8OE 3QFGA 2KKQA 1F97A 3H0TB 2IDQA 3ZZQA 5F0JB 3FNKA 2F7QA 2FJFB 4LOFA 2EH8H 4RISL 2BVQB 1ZS8B 4WW2F 5D6CB 3X13B 4D0CA 2RJMA 4WUUD 3R1GH 4WJ5A 4OKVB 1RUMH 3U2IA 1XGUA 4N2BA 4BHUI 4JR9L 2WO2B 5EO0B 3EJCA 3GHPA 3K8MA 2BO0A 2NY4C 3ZY7A 4Y4HD 1PJWA 3CN2A 4ZQKB 2BVPB 4DP6X 1T21B 4Z3HA 4KRLB 3P69A 4Y16A 1ASOA 1VRSA 2ZCKH 5KZCB 2BINA 2X3BA 3AT9A 3UYRL 1XCWA 1KYFA 5GGTA 1HHGB 2FEEL 2XV0A 2YK1H 4XP1L 2R56L 4EDWH 1L3WA 5C0ND 4ZZFA 4UAOB 3CXDL 5EV7A 1R0AH 4PI2A 4HH9A 3ZGHA 2FQFA 1BM3L 5C0DB 4PYGA 2K4AA 3FHEA 3OLIA 3VB9A 1BIIA 3OWEA 4P5RA 4WFED 5D6DA 5T1MA 3IJSB 4YO0B 5AVUB 5T5FH 3ZDXF 1NCJA 3AZUA 3PY9A 4A2EA 5HVGB 1BQRA 2WNKA 1HCYA 1WPCA 1AQDB 4MBOA 4OD3H 3MROB 3FSZA 2P5EA 4PBWD 4EO5A 1CFSB 2ARWA 1F4XH 3TV3H 1L9SA 1A6ZB 4OLWH 5EOCJ 4Y16C 4D0BB 4MNHB 1VLXA 2GBUA 2X6MA 2AGJL 3X3FL 4PV1C 4BCZA 5HY9A 3EO1B 5CJOH 2Z7UA 4A2FA 1CU4L 4HG4J 3RPIA 2QR0A 3MR9A 1YPZF 5HHQA 3FH5A 3D05A 5EPMA 2IQAA 4AM0A 4AYGA 1CLOL 1OGPA 2QZ5A 3MRRB 5D6DC 1A14H 3X3GL 4L4TB 4UM9A 1HL5A 1MCDA 3B83A 4OJYA 5CEZD 1KEGL 2C7UA 4MZ2A 3W0WD 1SBSH 1WTGT 2XXGA 3QA3B 3S4SB 1WYJA 2K6WA 1NUDA 4XN1A 3SDDD 4AVJA 3J27A 1C5DB 3NJFA 4HGMA 3HNTH 4I2XB 32C2B 3H9YA 3Q1SL 4MXQC 3ARFB 3H42H 4UQIM 1ILSA 4AEHH 4KQ3L 2G2RA 2VXVL 2H0FA 3CXHJ 3IDUA 4BKLA 1JGDB 1NBVH 2AQ1A 2MTPA 2MKWA 1FH5H 4HIPA 5H4YA 4P9ML 3MUGB 1QMUA 3UXFA 4D7PA 4XMTA 1KC5H 4UZUA 4M7JL 5I8EA 5E5RB 3QYNA 4X42A 3FU8A 1KCRL 1USZA 3AXHA 4AQ1A 4EOWL 3MBEB 5CM1A 5FO8B 4DUWA 3A47A 5I75B 2IFFH 5G5DA 3IKCB 2YQGA 1PFCA 2Y1AA 1EDYA 3KPSE 1KV3A 3WIHA 2I07A 2BDNH 4UWQB 1UA3A 9PCYA 3UIYA 2L0DA 2WTPA 1SOXA 3P77A 1R5VA 1VGEH 3BP6B 4HXBH 3U2JA 4BFFA 5I6NA 1INDH 3TVMD 4BK8A 3L5XH 3OB0K 3VM7A 1JNNL 3S5ZA 5E4IA 2AAAA 3QJHA 2XPZA 3ARGA 2VUYA 3U46A 1EFXA 3FU9A 4YNYB 2ZP9A 5EOTA 4Z9KB 1U8KB 2Y3NA 5GGRA 3MA7B 3UP6A 3DGCR 3QFJB 4BQBA 1ACYH 3QP3A 1WFNA 2CBOA 4JRYB 4WUKL 3V52H 2J6EL 4AQ1C 3D09A 4HKZA 5GIRB 1BVZA 5HGGS 1YN7B 2WVVA 2OTPA 1R3LB 1MREL 3H2QA 4RESB 1FDLH 2X2UA 4U3SA 3VXUD 3OZLA 4WEMB 4E9XA 4JKMA 2OSLA 4OR1A 4EI6B 5K69A 4Y0GA 4HS6A 1N0XL 4F58H 2W60A 3U1QA 1G6VK 5DD5H 5JOEA 1R9FA 5TGBA 1M6OA 1UD5A 3LQMA 3CFKB 4K9JA 4LRIA 1TMQA 3WGVB 3WMPA 3PG2A 3G5XA 1GC1L 4JPKL 4LBAA 6TAAA 3ARGC 5E8PA 2J8UE 2E8YA 3S36L 1BZ9B 4GUPB 4UQBA 3CZJA 1U8NB 4JZOA 2EDQA 3U7YL 4YFEA 2V2TB 3VFWA 3W2DH 5GRWA 1B9ZA 3OAWA 12E8L 1CO1A 2H41A 2XVGA 4OLVL 1AHMA 5DS1A 1W91A 3SE9L 4J3BA 3OTTA 1QPKA 1DYZA 1SXZA 3GMNA 1KLFB 2HSIA 1YUHB 1J8RA 2HWZL 4FLRA 5SX5K 4OZ4A 2CA4A 3QPXL 1YAZA 4GKZB 4LRIC 1IBHA 1PKQA 1WCBA 4GIOA 3CHQA 3LD8C 4DQAA 5D1ZA 4CADA 1MFBL 3PJNA 3NN8A 4PTTA 1DDHB 4ENZA 2WUCH 5IMLB 1FZOA 2B5IC 1Z66A 4PAZA 1HI6B 4EKJA 1SN5A 4GUQA 4LEOA 4MD4B 5IMKA 2BOBA 4XBMA 1N10A 1QSVA 4DKTA 5E08H 2HJFA 3OJVC 1HXYA 4PJFF 2FGWH 1JD7A 3FH7A 4J4PD 1G1OA 2A4EA 3OXSA 1QQDB 1KULA 1FNEA 2JJSA 4QTHB 5I1AB 3L17A 3QHFL 1HSBB 4OLXL 3LPOA 2ZQKA 4PWJA 5E95B 3MLTB 5DHMC 3DTXB 4JRXE 1H3XA 5IV2B 2GCYA 1PZ3A 2H32B 4OFVA 5EA0L 5KOMC 3RDJA 5FLVA 2VJ8A 1DJGA 5D1ZC 3WY1A 2E27L 3EDKA 3TNNA 3FTWA 5I1KL 1OF2B 2N59A 2P8LA 2BSTB 4QHUB 4Y4KA 1UWGH 3CLEH 3FT2A 1WF5A 3MODL 4NSKB 3PHQA 4S1QH 3SPVA 5LQBL 2X4SB 3HS0B 3N1QC 5I28A 1EAPA 2AEPL 4PJGE 1L3NA 1O7DE 1T5WA 2QDVA 2XI9A 4TMPA 2AJ3B 2HFFA 2VSDA 2VDKB 4MS8D 4PJBE 4AZ8A 4D8PA 2NTSP 1Z5LB 2PWHA 1N67A 2W0KA 2Z8SA 3FQTB 3HG2A 4PJAE 5F7HA 4AMWA 2P5WB 3GXTA 4JPIB 2JJSC 4O2FB 5INDB 3HPLB 3QK0A 4U05A 3GBLA 1Y0LA 3LN4A 2VDPL 3UTPE 3WUWA 3WGUB 3VDCA 3DXAB 3QUKA 5C09A 1JZHA 4EXKA 4TULH 2Z64C 1HFUA 4DCQA 4YHZL 4UQDA 4NZFA 4AENB 2WTRB 1CK0L 4LLWB 4TOYL 4PD4K 4Y4KC 4M5YL 1CUOA 4KZDH 2ZSWB 1DP0A 2AJZB 3IDYB 3P02A 3PIQB 8FABB 4F93B 5BS0E 1H9VA 4NC1E 3ZXAC 2ZKYA 1J05B 2R0ZL 1HAUA 5GSRA 4LVOB 4YSDA 1WZ1H 4PTUB 3SKOA 1FGVL 4G42B 1NFDE 2GABA 3EJYD 1QLEL 4F1SA 5IJKA 1VFOA 1HWWA 4ODTL 3QC5X 4EN2A 3INOA 3F65A 3LNIA 4BH7B 3E6FB 4X7EC 5IHLB 1U91B 4FCAA 1GAFL 1IGYB 2J73A 5IOKA 1OGTB 3VH8B 5LG1A 4TL4A 1OPGL 2EXWD 4HV8B 5SWZB 5I0ZA 3L2MA 4A63A 3L95B 2E9JA 4OCMC 5CU5A 1Y1UA 5HTSA 3ARED 5I18H 3CDFA 4MA8H 3AG1B 1VKXA 4EI5A 3MV7A 5L7XH 3GSRA 1YDPB 4GIPD 2P52A 3CD4A 4P48A 4E5XA 3FU7A 4Z5RB 3BPCA 1J9CT 2DLHA 1B3IA 5IJKC 4N6RA 3HBZA 2ZNWA 4WWNA 4PJ8D 1RJLB 1VA9A 3SO3B 4JUTA 5E6UB 2QVFB 3FO1A 4A2DA 1G84A 3WNNA 1NMCB 1U8CB 3S35H 1DCEA 2F53D 1E4XI 1U8LB 3NA9L 5LWYH 5LCVA 5D5ME 4MQ7B 2ADJA 1SBBA 4HKXB 4ZX3A 2YMTA 3ZTNL 1MHHA 1N6VA 3L3DB 5A16A 4QYOB 1LWJA 4EI5C 5F8RC 5I1EL 2WXPA 4QRBA 5DJ6B 3DNKA 5C97A 1B6DA 3I6GB 5T5NF 1ZHBB 4Z7QE 1ROCA 5T3ZE 1T20B 1EUTA 1CF8H 3ML9A 4DP4X 4K5MA 4JO2H 2C9PA 3C60D 2XQBL 1FYTD 3VFPA 4FLQA 2ISDA 1OQXA 2VRKA 4KXZH 3FPYA 4NIYE 3NZ8B 4M6NH 3C8HA 1J0HA 3K4DA 1T1XA 4KY2A 4WF7A 1SHXA 2FX7H 4S11A 5EU6B 4KZCA 2RAMA 1CFTA 4NZUH 4CUCA 5JZ7C 1UEYA 4OAWB 5EOQL 3S34L 4MJIB 4DT2A 1CI5A 5DFVC 4QHNA 3VWJB 1QA9B 3QQ3A 5EEVA 3ARDD 3L13A 1ZGLM 4M7ZB 4C59B 4JRFA 5F1NB 2X40A 3U6XA 1UATA 2B16A 3LZOA 5C0BB 1LDPH 1LXMA 1U6AL 1JV5B 3NIFF 1PIFA 2WQXA 1XMEB 1T1WA 4JAMB 1GKOA 4OF3A 1SXSA 2YZ8A 2OJZL 3QUXA 5DCCA 5EBMA 4FAAB 3C8KA 3PFUA 3QR2A 3ZE1F 1U8IB 3R1GL 3C6SB 3GSWA 2PR9A 1WGOA 5F6HI 3MV11 4UDUA 3ZDYF 1OVZA 4W81A 2NYYD 3BP7A 4H5SB 3SDXE 3WE6B 1GRWA 3ISWA 3V9CA 2NZ9C 5AVXB 5TQ2H 3T1FA 3T2PA 1I9EA 3NEOA 2HLFD 2ZCKL 5C2UB 3GI8H 4LAJH 1NICA 3KG5A 4CAGA 1OAYH 3L3KA 4FXTA 4PRIE 1J87A 5GRXG 5DSCB 2YK1L 3R06B 1A9EA 1I1RA 3O45B 4EDWL 2WC7A 3EGSA 1R0AL 3VA2C 2CO6B 5KBKA 2FSDA 2FBJH 3QUXC 3H9SE 4H0HB 4JB9L 2EECA 3BP5A 5FB8B 1UURA 5AVYB 4AC4A 1VCBC 2GK2A 3I3BA 3WHE0 2WXIA 2LW3A 4Y9GA 3NTCH 5DQ9B 4K3HA 4WNJA 4GQRA 4OD3L 5TE7H 3KAAA 4J3XA 1WS8A 3PL6D 3T8MA 3KWWA 5H2BB 3AXLA 5HGBA 5IQ7H 2CDFA 1XZWA 4HUXB 2KZKA 1F4XL 3TV3L 3CFBB 1PGRB 1BQHB 4UU9B 5IKCB 2DQCH 4PREA 4PN6A 4CJ0A 1EMTH 2GBAA 5CJOL 5AW4B 3B5TA 3GBMH 4LQFL 2DMCA 4FGMA 2K70A 4MJ6B 5LGYA 2FJFA 1XGRB 4XMXA 3QUGA 5DRXA 2BVQA 5D6CA 4FKHA 4DGIH 3BIKA 2F5AL 1E65A 4N8VA 3G04B 4LSPH 4XXDB 7FABL 3FBQA 1A14L 5EO0A 1A1MB 4B41A 2ENYA 3LZLA 4JHZA 3CSYA 1SBSL 1ACCA 3LRKA 1U4EA 3HBQA 3HNTL 1HKLH 2D31A 3H42L 1HHGA 1RZJC 2VOTA 2JXMA 3HAEB 3LEVL 4AEHL 1JAEA 5EZJB 3F7VB 3AUWB 1A1OA 1NBVL 1FH5L 3FS9A 3D12B 2V2WB 1T7ZA 1CGYA 4WO0A 1U3HD 1KC5L 5KVGE 5EDXA 4PMEA 3U6RB 3CX5K 1JPSH 3A5VA 2FATH 3OM3B 4XE0A 4JFFD 4YO0A 4E9RA 5J6GA 3C5ZD 4J3WA 4HLEA 1HHIA 1XCTB 1ZT1B 5CP3A 5I0YA 3MROA 1N7ML 5I6LA 3VGAB 3BP4A 3ULUC 2GJ6A 2BLFA 2ZWYA 2BDNL 1MXDA 5JDSB 1YY9C 5EU5B 1C5CH 2Q2LA 3MRCA 1VGEL 2Y1YA 4HXBL 1INDL 1KEMH 3L5XL 4Z76B 3RWCB 3EO1A 3UMTA 4TVPD 3F01A 1PJ9A 3GXIA 4Y5VB 4RQQA 2QHRH 4UAOC 4LCYA 3VYNA 3M8OL 5B3JF 1I7ZB 2WBWB 1DBAH 3GQFA 2FQEA 4DUVA 4Y2OB 4AYID 2Q7AA 5H35B 1ACYL 2HAZA 5KG9B 4GKNA 2QPUA 3QA3A 1YQVH 4LP5A 3V52L 3AS3A 4MA3A 3F12A 3VD0A 4LL9A 4LOUD 3GXNA 4WFFD 1X9QA 4R3SB 4EUPB 5FWRA 1FDLL 5E5LA 5C08E 4NAMA 3U7WH 2VXQL 2MQ3A 4P07A 4F58L 4XRCB 5DD5L 1GIGL 4HFWA 1P4IH 1IM9B 4OV5B 2PTUA 4I77H 4L4VA 4UNVA 3IS1X 3FQXB 5K93A 4FQXA 1H15B 1OSPH 4UNTA 3FRPA 1E6OL 1P6AB 4NN6B 1EO5A 3J8F7 1NGWA 1RLBA 3MBEA 3QDMA 5GGUA 3U79A 3W2DL 5FO8A 4OCLC 1TYEB 4MQXD 3LKSB 3QUMH 3QIWD 4IBYA 2HRHA 5HYQA 5KSBE 3CXFA 4MCYB 4Y5YB 1D7FA 3APCA 2H26B 2VW6A 3K2MC 2PTTA 5F7DB 3ARVA 1PZDA 4ETYA 1UKSA 2APSA 2E6QA 1W2KT 4KH9A 3GKWH 4AEFA 3C09B 1PEWA 4GLRH 1U8KA 4XNUH 5CJ8A 3MA7A 4FQXC 1JGLH 5CIPB 4NAQA 3QFJA 5CLYA 4OQTH 4OZGB 2IMMA 2WUCL 2GSMB 4JRYA 2X9YA 4ORGB 4CMMB 3BAEH 5IUCA 1N8ZB 2D03H 5E2JA 2FLMA 2WWKT 3C5JA 3MBEC 3REVA 5A6MA 1YN7A 3JWNG 3QWRD 3WDJA 1R3LA 4TUKH 1Y18A 4J28A 3OF6A 5DS8A 2Y25A 5GS0C 5I6XB 5K9QI 5E08L 1QP1A 4YK4B 4EI6A 2EDMA 3LPGA 3T04D 3VSTA 2FGWL 2C26A 3MRQB 3TASA 1YEIH 3KLQA 1BZEA 3CFKA 3FCSB 2OXHB 3BVNB 3FB8A 3PQYB 4WNQA 4FLOA 3RB7A 5J11B 2NUTB 3VFRA 4HKJA 1BZ9A 1JPST 3IMWA 4HHWA 1C12B 4U6YB 4MAYB 1U8NA 3EW3B 3O3BB 5ETUB 4UTBH 4L8BA 3VGDA 1F58H 2WSDA 2XY1A 1IGTB 1UWGL 3CLEL 3KPSB 5E5MB 2DTMH 3ZT7A 3IK2A 1XIWA 1H6UA 3QZNA 5TH2A 1DDTA 4HK3J 2PMZA 1ZEAH 1CBVH 3QI9B 3Q5TA 4H1LB 2AZAA 4BZ2L 4XVJH 3WIFA 3OV6A 3NQIA 4OGAC 3D2UB 4JGMA 4BE6A 4PBVC 2IV9A 1ZV5A 4PVBA 3MRBB 3O81A 1B4RA 2JV6A 4MMYB 1WZLA 1KJ2A 4TULL 4X7TB 5E7FA 3RDTD 4ZUVB 5KAQF 1HXMA 5K9QG 2Y3AA 5IMLA 1F42A 4XB8A 1OAQH 4NUQA 2ATKB 3MV8B 2NY3D 2XWRA 5J56B 3R8BB 1JGUL 3QDAA 2ZD0A 5E8OB 3TBYA 4KZDL 1B88A 1NGYB 4P8QA 1G4RA 5DJ8A 1XIWC 3BEVB 4FKKA 3FAWA 5KUMA 2CK2A 4ZPTB 3US9A 3MRNB 2HT4C 4QRPE 4JM2D 3RGHA 5I1AA 5HD8C 1WZ1L 1HSBA 1G9HA 2KLRA 2WPGA 3MLTA 3FYIB 4K7PX 4WHTB 4K07A 1TTRA 2FJGB 2DIAA 5IV2A 4AW4A 2DD8H 3RTQD 1QX1A 5DWUH 5L4MA 1SQMA 7CGTA 2PPCA 4GKSA 1GY2A 3L1FA 1OF2A 1CFVH 3BLKA 3CG8A 4JGJA 4QHUA 3ML8A 4P5MB 3BZEB 1WD9A 3Q6FB 5GJTL 1J1XH 2X4SA 4L05A 1IU1A 1QWHA 1BAWA 2LVEA 3NCJH 1HEHC 2NY5C 1KACB 4JL1A 5AB1A 1WEJL 2P5WA 5INDA 3HPLA 4JZJB 3FSAA 5IOPB 5IG7A 1MG2C 5T33L 3CZFB 2E9WA 1TT6A 2NY1D 3D52A 3ARBA 1LYQA 2PETA 2ZKMX 3RWEB 4NQCE 3AMLA 5C6WH 4A68A 4XCEB 1QFWH 4G82A 2CJSA 2WTRA 3U9UA 4HIIA 4JQIA 1H3UA 4ES9A 3H8NA 3TWYA 3UROR 5LWYL 3BC9A 4N68A 3TFBA 4J3OH 2GUYA 3RVUD 2AJZA 3K81A 5J3HD 2FYVA 3PIQA 8FABA 1KTBA 1FCGA 1R24A 2J8UF 1J05A 3WMQA 2KHAA 1XGYH 3BFOA 1AO7B 3O6KH 4NQSB 1DJSA 1ZLEA 1ORQB 2NQCA 4ZUUB 1WLHA 2VDLB 1AR1D 2DQJH 4NQDB 1GY1A 4X80H 1E8YA 3ARBC 3ZJAA 2Q10A 4XE5B 1SOKA 1WZMA 2PW2B 4LCCB 4RMUA 4UQAA 1JIBA 3EF7A 1IGYA 1O6TA 1OGTA 2OZNA 3VH8A 5DC0A 3T4YA 3K6OA 4HWBA 4AYSA 1EZVY 2J55A 4HV8A 1KYAA 4PVMA 5SWZA 4BQ6A 3GKZA 2CLVB 4PJGB 5KZCD 4WVRA 3F7PC 2ADGA 3MNZA 5FUZH 3RWIA 1XXDC 4PJBB 3IDYC 1ADQA 4PJAB 3T1WA 2D9CA 3RHWK 5IM7B 5AW7B 1WFIA 4L37B 2EO7A 2I60H 4LVOC 4PRPB 5E1IA 2JKLA 4JDVB 1YDPA 1NKRA 1RJZB 3LKNB 1NAKH 3BPNC 4JREB 3S98A 1I1CA 5K9OB 4IMKA 1F4YH 1S9KC 5CKAA 3U9WA 1BVKA 1LDPL 2NSQA 5AOLA 5AZ2H 3FB5B 4KVNH 4WSJA 2HH0L 4QRAA 1U8CA 1AGDB 3BKCH 3TPUB 3ZLQC 3SHSA 3F04A 4H20H 4KX8A 5CS7A 1ZA6A 5IMOB 3ZKMC 5ANME 2XX0A 4AL8H 3QISA 4BYHA 5BS0B 3OG4B 3FCGA 2X10A 3L3DA 3GGWB 1K4DA 3MRHA 3X1BA 1NC4A 5DJ6A 3O6MH 3SKUD 2FB4H 4LPUA 4QRSA 2RBLA 4ODHL 4P05A 4QWWD 4WHYH 5TQ2L 4YS4A 4JN1H 5E6IB 3AFLA 3BDYH 1T20A 1OAYL 4IMKC 5AVZB 1KIQB 4XBGB 4H40A 2ZYHA 2IOMA 4AYDC 2EKJA 1KXHA 2QMJA 3FB7B 1NMCC 2FBJL 1TENA 5F97E 3P4MB 2DMHA 2JF1A 2YMOA 1KOAA 4EQ3A 2VWEC 1B3JA 3S37X 3NTCL 3HRZB 1TO4A 3VWJA 4JFXA 1RY7B 5TE7L 5AW5B 3UO1L 2ZOOA 1DANT 1TCRA 4JRWA 1EJ6A 4JFWA 3ZGIA 2V9UA 3RWDA 1S7UB 4FMVA 4GUCA 3FTSA 4HPYH 4XTRD 1C1EH 1EXGA 4E9SA 1ZXQA 3CC5A 4AQOA 2DQCL 4YSUA 2H2SC 4WSKA 5C0BA 1W72H 3KW8A 1H3VA 4U6XB 1EMTL 2F68X 3BX7C 3HG1D 5TF1H 5DZOA 1DJYA 3LIZA 4K71B 3GBML 4E2OA 5C0FB 5IB3B 5E8DL 1KPVA 4GNKB 4AIEA 4FFYA 1NFDF 1S8DA 5D5MB 2CK0H 3CLWA 1HTYA 1U8IA 4B6ZA 2AQNA 4M3JA 1PNCA 4LSPL 3PV6A 4FN0A 2YSSA 1JGEB 4JKWA 4ZSOE 3KLLA 1SRDA 4HISA 3KPMB 3WE6A 4LCIH 4WJG3 3VWJC 3I50H 2Z1PA 3QFDA 4M7ZC 1RK7A 1UWXK 3FCUB 4Z7QB 1ZGLP 1EERB 4BDVB 4IBVA 1WO2A 2NCMA 1R3HB 4QJ3B 1IGFH 3UZEA 2G9KA 3R06A 1LEGA 2BC4B 3EXLA 4DVRH 2CO6A 3DOIA 3QJQB 2Q87A 5JLZA 3EZ8A 1WSST 5FB8A 3GEWB 3MKGA 4H8WC 1JPSL 4V2CB 2FATL 2FWOB 3CVCA 3LHPH 3PWVA 1CG9B 4OZFG 2JCCA 1DLFH 1FJ1A 4KKCC 1SDYA 2AK4D 5I30H 3B2UD 2WXFA 2CM6A 4HUVB 3AROA 1AD0A 5H2BA 1L6ZA 2EYRB 3VD4A 1YEGH 5HDBE 3LV3A 3CFBA 5FPIA 3S96B 3BFWA 5FGCE 5DJAB 1BQHA 4AK2A 2EC9T 1GZHA 5IKCA 1C5CL 4PJXE 4N28A 4WK0B 3ABLB 1KEML 2WLIB 2WN2A 3UZEC 1BLNB 2OW6A 4ZAKD 4Z3FA 1O9VA 1WDAA 3V0GA 1XGRA 2QHRL 4NQTA 3WHXA 4PJIA 3U9PH 3MRDA 1JVKA 3IU3B 3DGDA 3VA6A 4KTGA 2OL3H 2NY6D 4XXDA 3N50A 1A1MA 1U93A 1JHTB 1YQVL 2A9MH 4G43B 3QEHB 4P9HC 5FWQA 3SCMB 3SQRA 3G3LA 3NFNA 4M1CC 3C6LD 3DDFA 3U7WL 1MVFA 3IU4H 3APMA 3OXRB 3UEQA 5M7QA 3HAEA 1GZHC 3JWNE 4MBRA 3CFJB 3DX1A 1JN6A 1P4IL 4Y4FB 3H9SB 4I77L 2V2WA 3IJYB 2EXTA 4HPOH 2CDGB 4JKKA 1HNGA 4FYTA 3T4AA 1AP2B 1PYWB 3ZU8A 3U6RA 4GG8B 2ESVD 1OSPL 4JFUA 3ENEA 3TA3B 1YMMA 1XCTA 3WJLA 2EDHA 1ZT1A 4PJ5D 5E99H 4X8JA 4RSYA 4L1SA 1FLRH 3ME0A 4GQZA 2NW3A 5J6HB 5AW3B 3I3EA 1SXAA 4JO3H 3QUML 5EU5A 2IH8A 4YQXH 2G75A 1BFOB 2XXCB 2B59A 3RWCA 1S7VB 1TPXC 3SDXF 1CYWA 4TSCH 3RILA 4L18A 4Y5VA 2ZXDA 2LT9A 5KYXB 1E28B 1BJMA 1R19A 2QFRA 3GKWL 1O9WA 4X6EA 3T4AC 3I6LD 2J1WA 2OZ4H 1HX0A 5C0CD 3SKMA 1JGLL 2OV0A 2YKKA 2AQ2A 4MCMA 2VKXA 2YAHA 4OQTL 4P5TD 5H35A 1BCIA 1WA2X 5E4OA 2NXYB 1GA2A 1AGCB 3BAEL 2WXKA 3SGJA 4P49A 2D03L 3WJLC 4D2NA 1IBGH 3VGAC 4R3SA 3VSQA 3TN0B 3JT2A 2GY7B 5FLUA 5SV3A 2KDYA 3PGCB 1C08A 2PWEA 3NACH 3D69A 4HQQL 4XRCA 1A4KA 5AAMA 4BFKA 3IPEA 2Y5EA 5CEYB 2D9QB 1IM9A 3KWVA 1D9KA 4OV5A 1A6PA 5D7LA 3CSGA 4Y5VC 1T2JA 1IV8A 3FQXA 3HHRB 1AZBA 3T0AA 4MGXA 4GT7A 4NN5B 5JHDE 4GG6A 3JTTA 5DHYB 2UZYB 1YMHB 4D0DB 1CDYA 2ZKHH 3NSDA 2FSEB 1F58L 1GZPA 1S78C 2XYBA 2NYKA 3K80A 5DRWB 4ZS6D 4DP5X 2CRYA 3FK3A 4XN7A 2CNYA 5D2NE 5F0LB 2X9XA 3OD3A 4MNQD 3M7FB 2VKWA 4MCYA 2V2XB 5AKRA 1WGVA 3PWPD 1CBVL 4IRZA 5J1TC 2B1OA 3D9AH 4XVJL 4S1RH 4NRZB 5FK9B 2CO3A 5AAMC 1XGPB 1D9KC 1CDGA 2KERA 3CCHA 3QG6A 5EEWA 5D7IB 3O3EB 4JFEE 5IEKB 3BRFA 5IHUH 4OZGA 4A7TA 2XG4A 3G6JA 1HZKA 4ORGA 4CMMA 1OALA 1OAQL 3PYCA 1NL0H 3HN3A 1N8ZA 4B9PA 3KBEA 4NN6C 4GO8A 3DPBB 5C08B 1MY7A 5AVQB 1O5DT 4JM4H 4ICXA 3ILQD 2C9SA 3MRQA 4FNPA 3S3DB 4A2GA 5E1GA 3LZQA 5FYLH 4O58H 5EZLA 2GIMA 1DZBA 1J1PL 2VLMD 1PZBA 3BDBA 5DJCA 1BXUA 3LB6D 2BNUB 5IJDC 1M7IA 3VU1A 2AABH 3FCSA 1FNGB 3BVNA 1GMEA 3PQYA 4OI8A 5BRZD 1I3VA 2DD8L 5JXAH 4JG9A 5E9DD 2QHLA 2VLRD 3FL7A 4JCMA 5DWUL 2FECL 1C12A 1T22A 5GGVH 2IC2A 3BKMH 4MAYA 3O3BA 1CN4A 3VWKB 1CFVL 4LSRH 3RZCB 4C56D 1CD9B 3QEQD 4I13B 1ZLVK 2KUTA 3BWUC 2YMXH 3GRBA 1J1XL 1UD2A 4HD9A 1BFSA 4KKBD 5I6XC 2LLGA 3GMLB 1XB6A 3NCJL 5KSBB 3DHJA 4QRQB 5D1QB 1BJ1J 3MCKA 3F84A 5DJDB 5F71A 2WQSA 3QI9A 4H1LA 1IBBA 3D2UA 1NCOA 4KMTH 3GT6A 1BVLB 1YN6A 2Z93B 2QQKL 2Z6FA 4TNVF 4MMYA 4DP0X 2VLJA 1KIUA 2ZYRA 4RGNB 3ZHDA 2HMID 4LLYA 4MJID 4LDCA 1TQSA 4X7TA 4ZUVA 1TUPA 3BVVA 4KKQA 5I1DB 4MAYC 2AKRA 1QFWL 2ATKA 3MV8A 2N56A 3B3BA 5F9WB 1WCQA 1ZHNB 4QHPA 3RVXD 2P44B 5IBTH 1UXLA 5KVDE 4X5XB 4ZXBB 1ZHLA 4XMZA 5F0MB 1FP5A 4P2YA 3BAIA 4ZPTA 4MB5A 1IJNA 3LRSB 3O6KL 4F57H 3O8XB