3DA0A

Crystal structure of a cleaved form of a chimeric receptor binding protein from lactococcal phages subspecies tp901-1 and p2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
132
structure length
132
Chain Sequence
b'NVVHKTGDETIAGKKTFTGNVEVNGSLTLPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cleaved chimeric receptor binding protein from bacteriophage
publication title Crystal structure of a chimeric receptor binding protein constructed from two lactococcal phages.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Viral protein
total genus 22
structure length 132
sequence length 132
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3da0A01
3EJCA 3HG0A 3DA0A 2X53A 2F0CA 3D8MA 2BSDA 3U6XA 2BSEA 4IOSA 2WZPA 4HEPA 4HEMA 1ZRUA
chains in the Genus database with same CATH superfamily
3S4SG 3QSKB 4NKIH 1IC1A 4BXSV 5I1DA 2MTPA 3CUPB 3K8KA 1M7UA 4XZUA 5KN5A 2ZKHL 5C2BH 3CFMA 4WLCA 1LDSA 2WLLB 5CN1A 4K3JL 2CK0L 1XH2A 1PZ3A 3DDGA 4MB3A 1NMBH 4W9LC 5BS0D 4RRPM 4Q9RH 5HVWA 3RNKB 4I48A 3UBXA 3BZEB 2XA8L 4PWIA 4KK6C 5AWNH 1T2XA 5C8JA 4Y4FD 2ARJQ 3O6FC 4GUPB 4MYPA 4NNXA 3T08A 5KAQF 2E6QA 3BH8B 3DKHA 3SBPA 1FFOB 4BFOA 4MX7A 4X8JA 5T1KD 5KUKA 1PF3A 5E6UB 4R2GD 2VCOA 5I2IB 4LRNL 3TP4A 3V0FA 1X7QB 1KOAA 1RIHH 4YSTA 2QMKA 5TGBA 1C16B 3VXQA 2XWDA 2A5UA 1ZTMA 1GGCH 2D7PA 4Y4HA 4RIRB 4E9RA 3ZDXB 4QHKJ 3ZHLA 3GLZA 2IXQA 5KSBE 4H1LH 4L8CA 3BPCB 3F85A 2KZWA 4PGDA 3B7TA 4CC0A 2H7WA 2IANA 4OTXH 4KTEL 4LB8A 2A74C 3FHAA 4U1GB 3ZKXC 4N3TA 3N40F 2DICA 4OT1H 3OF6D 3ZR6A 2WK2A 2IBZX 1FGVL 1F90H 2M1KA 2QPSA 5JMOC 4OZFA 1C5CL 4LEEA 3FF8A 3O6LH 5DTFB 3ZE0F 2GYSA 1RZIA 1ACYL 1A4AA 1N10A 4L0ZA 4PLNC 5FUCC 3O3EB 4OM0H 5FM5O 5IHLB 3CSTA 4YUEL 4ZOEA 5F7AA 4WEUD 3Q2WA 2DQGH 2A7BA 2B5IB 4HD9A 1IAII 3QARA 3U30B 1S7UB 3FU5A 4AVJA 1GSKA 2Z8WC 1NEZA 3UGEA 3GUFA 4Y2DD 5T1DH 2FJSA 1T22B 1HS6A 4BE5A 2X38A 2XICA 1GYAA 2QADC 3KYOA 1EXHA 4WSGA 1I1YB 2HVJB 2DIBA 1EJ6A 5LGKA 4JZJB 3QGVA 1OB0A 3BKCL 1JGLH 5FYJE 3FQWA 2HH0H 3MGOA 1HXKA 4I3RH 2BSDA 3UTZA 1F97A 1PX4A 2LLLA 5T3ZH 3ZLQC 2AXGB 4W6YB 3T8MA 1LJMA 2Q86A 2KDGA 3WELA 1IQWH 1W6WA 1RERA 4M8VA 3T09A 1S9VB 5I73B 4ANVA 4Q9QH 3S8WA 4FL4C 3VRIB 4ERSL 2IF7A 4MWFA 4Q6IA 4F7TA 3RPBA 3KPSA 2MQCA 3CVIL 3HUJB 2MTAA 1LQBC 1QSZA 3W9DA 3V52L 3RFZA 4NZJA 1PQZA 4JM2F 2Z0BA 5FF6B 4YDIL 5IKCA 5JPMB 1RJZA 5K39A 2OQJA 4LEOA 3PWVB 4HZLA 4GKZB 4IMKA 4KNTA 1OGAE 5GGVH 5AAMA 3RVVD 1KELL 1NDTA 1NL0H 2BSSB 1S3KL 2I9TA 2L4OA 5B1CA 4HAGA 3U1SH 5I1KH 3E7JA 3LPGA 3OKMA 5DJ6A 1UXWA 2O26U 4A68A 5KSBA 5IESL 4PBDA 4FYRA 3KBPA 2V3EA 1I9IH 4NHCH 1Y6KR 4PV9A 5J9PB 2FLBT 2PO6D 2BNRD 5ESQA 2R0WL 3LN4A 2CU9A 4ZPTB 3ULUF 1E6OL 1ZS2A 1XCQB 3WDHA 3QG6A 2EDOA 1M71B 1AAJA 1U3HA 2ZX5A 2IDCA 3KXFD 35C8H 3QNZB 4X2UA 1CIUA 2WB7A 4OCWL 5L88H 4JK0D 1NAMB 3D09A 2WTOA 1QW9A 3O3DB 5BO1H 1N5YL 2RIKA 3BN9C 4P23C 3MV7E 1NC4A 3V5HA 2EVGA 2WXOA 5FKPB 1U95B 2ZCKH 3OZ9H 1A4BA 3GJFB 5C0AB 4GW1A 3AFLA 2E6JA 4M6AA 4B9IA 3VD2A 4ZAKD 3LD8B 1XSJA 4JY6A 4LARL 4UT9L 5DVKA 3DMMD 3WN5A 1J05A 2OR7A 2ZPKH 1MVUA 4F2FA 2DYPA 4HUUB 4YHKH 5IB1B 2CO6A 5AB0A 5IIEB 3VXSE 3D69B 4CL7A 3DI2B 3LHPH 4PRHE 3SKUD 4TYUA 3RY5A 4QRUA 4Y8DC 1OTSD 1DZBA 4UDTA 3QPXL 3ARFB 4H7VA 3RNQB 2DQTH 4YZFF 2ZUYA 4DGIL 1JERA 3TX4A 1O5DT 1TO5A 1ZVYA 3V9EA 3HZYA 4ABWA 2IQ9H 3IAQA 1M4KA 1CLZH 4PYHA 3GXFA 4KMTH 3QYCA 1J5OL 1P6FA 3HFML 1A6PA 1Y7VA 3BKML 2YMXH 2XQBH 3K2IA 3LH2L 3QCTH 1OHQA 1BF2A 3MLZL 2UX6A 1F56A 2OMUB 3EGDB 3N44F 4N68A 1I9RL 3DWTA 5IJVB 5LN8A 1UA3A 3K5SA 2E56A 4Z0XA 1FL3B 1PZBA 5L4JA 2HX9A 1AHMA 2OPCA 3ZTNL 2X6CA 3WNNA 2RAMA 2ADGB 3HPLB 2EYTA 1UCBH 3FQNA 1BEYH 1IGTB 2BSBA 4F9PC 3VFSB 3DJTA 1KIUA 2AJVH 4NXKA 3WFCL 4HJSA 5K33A 3LX9A 2Y06H 1LNUA 4LSQH 2UXFA 4P3CH 4X80H 4ZO6A 1EBPA 2EYRA 3CGTA 4CSZA 4DPCX 5D7IE 3UOAB 3IGFA 3C60D 3TO4B 5F6IB 1OSEA 3KPNA 3Q2CA 3I2CH 2COVD 3QHFL 2Q0ZX 4ELKA 1UTDA 2CIKA 1LE9A 3QZOA 1E3FA 3UC0H 4AKQA 1TQCB 3Q1SH 4UNTA 4MDJA 3QUMB 5GGQL 4KTGA 1ADWA 3VWKB 1TKWB 3L1GA 2ESVE 3SCMB 2AK4B 4EXKA 3LZQA 4N6RA 1SEBA 1HYSC 3KVDD 4XWGH 3RIFK 3PV7A 1NUNB 1NWPA 4C56B 1CJYA 1RZ7L 2XYBA 4Y4FA 3SD5A 1CD0A 2BZ7A 3OAWA 1M7IA 2QKIA 2O5YL 3K6DA 4XNMB 4FNLL 1NAKL 3EHBB 4S0TD 4CADB 4PJ8A 1ANUA 3GI8L 4Z7QB 4MD0A 1GKEA 5A3IC 2QMJA 1UKSA 3E6HB 3V4VA 3MACH 1EFXD 1BA9A 5B7FA 4XP1H 1GOGA 4S1QH 3C2SA 4X6FA 3UH8A 3TA4D 1JZIA 2F7RA 3RKPA 3D25B 1Q1PA 5KW9L 4HIIB 2ZXCA 1WBYB 4XPBL 4UOJA 3NP4A 4JR9L 1RPUA 1KCUL 2Y7NA 3D0AA 3TJHC 1ZHNA 2GAZA 1KZQA 3RWFB 3IT8D 3VI3F 2BLFA 4UNIA 4YBQD 2V7NB 2Q7NA 1XH3A 1G9NC 2CK2A 4GSQA 2EDMA 4U6TA 4YHZL 3MNVB 5C0JA 2P7TB 5GZND 4WCYH 5FYLD 2HSIA 1I7RB 2AQNA 2H1XA 3L7FB 5EORH 2HWZL 3MGAA 4JDZA 4F27A 1U91B 4NQEB 5J12B 5LXGL 3BKYH 3QJFA 2ZIDA 4GI9A 2CBMA 1YYMH 2P42B 1I9EA 1CZ8H 3MNWA 3L6FA 5ANHA 1T0PB 4FFYL 3RWHB 5CIPB 5IVXF 3SPJA 5B3SB 2Z1KA 3APNA 5BV7B 5EIIB 4D0BB 1Z7JA 3HZMB 3PGCB 5IBUG 2FTAA 5LAPA 1Z5LB 2Q2LA 1VZHA 4W9EC 1IGJB 1XR8A 2WW8A 4G5AA 4B7IA 3TTYA 5HSFA 3DPDA 5CLWA 2XQYA 4HV8A 5FO9A 3WY3A 3RL2A 3LPOA 2HKFH 3VU1A 1MCRA 4ODVH 4WWKD 2YJQA 2XZQL 1RXLA 1C08B 3PDGA 2FWOA 1ERNA 4N26A 2J5WA 1U8KB 3J7HA 1FGNL 3A6BH 4DK5A 2NY5C 2EXWC 4GG8B 4TQEH 5EZPA 3UX9B 3W11D 1TTBA 2Y4SA 3D06A 3GJEB 2QFPA 5EPMA 4G9FB 2RFXB 1MY5A 2ESVA 1ZLVK 3OZKA 1GJIA 4QGYA 3WFDL 5KSVA 5CJQL 1NC2B 3Q1EA 1HOCB 1CD1A 2MNWA 4U0RB 1DE4A 5SWZB 4O2EB 5JUEH 1HVXA 1DDTA 3PWPE 2N7SA 3TN0B 5EG6C 2DQDH 2JE8A 4J3OD 3DUSB 2EEDA 4WSJA 3V0JA 3DBSA 3W0WE 1U21A 2UVFA 2WPGA 1T1XA 3WLBA 4YHIB 4PJ6A 3IE4A 3QIWA 4E0RA 1BF5A 4NRXB 5GHWL 4MKMA 4KROC 2YAMA 3MFGB 2I25N 2WUBL 4OCSH 3UROR 2F8XC 1MLCA 1R47A 1WWBX 1RHFA 3FCTA 2NY3C 3CVHA 3NIDB 4YHNA 1LK3L 1S7RB 2YPKA 5BRPA 2E9IA 4IRSC 5KVFE 4AH2A 4UYQA 4BWUA 5IOPA 4YHYC 1KIPA 4LVOB 4P2OD 1MW0A 5D2NE 1HHJB 1QYGH 2C34A 4XNZB 2O5XH 5CD3B 1EK3A 2H0JA 4NT6A 4UM9B 2JCCE 2HLFD 5K1NA 2LU7A 3B7UX 4HH8A 3RKDC 3OL2A 4X6DF 2BNRA 4L1BA 1R1CA 1SFDA 4P5TD 1JGDB 3MHZA 1MRFL 2HUEA 3JTTA 2XV6B 2ZONA 3M8OL 1NCNA 3U9WA 4GRWE 3FO2A 5DJ8A 5CILH 3KXFA 5CCJA 3FUFA 1NFAA 4KJQD 4TULL 4CMHC 2OYPA 2D31A 3SZKC 2HN7A 2RGSA 1FIGH 1UD4A 1BJ1H 4ODTL 3MUJA 3LKSA 2ZUQC 1HCVA 2WO4A 4U6VL 4X5PA 4A2DA 2AJYL 2GBAA 4O9HH 3TNMA 4BH8A 5I1JL 5C0FA 3MOQA 3CHRA 1BFOA 4KI5C 3FPYA 4B6ZA 5JQHC 2E47A 3E8VA 4DTGH 4ZAKA 1D5IL 2GC4C 4Y5VC 3L3OA 3AAZB 3AXLA 4XHJC 4TQPA 4M6OH 3TURA 2P8PA 2VDNL 3O2DL 4RGOL 3VFNA 3LIUA 4AIZA 1KB5B 1HEHC 3B9EA 4B0MB 4HS3B 5E9NA 3P4OB 4TTDC 5DMKA 1Q9LB 2CIIA 1PZ5B 2FL5A 3LPFA 3T2QA 4QRPB 1I7UA 1KYOJ 2Y7MA 1YEFL 3KJ4B 2JTDA 5DT1L 3WJJA 3P9WB 1QWUA 1IZJA 2YD6A 1XF5B 5MI0B 4PHXA 3RPIA 1FVDA 4BSVA 3PWPA 4F91B 4RSVA 2K78A 1BVOA 4HFUH 4H0LC 4MDIB 1KPVA 4KK9C 3W0WA 3DO7B 5D70H 3WSQL 2CHDA 1JYXA 4XB7A 5KSAC 1BFVL 3NTCH 1EEZB 3SQBA 3ZL4L 2UXGA 2BOBA 4BZ2H 2CKBH 1FLRH 5AW7B 5I18H 1DL7H 3WNJA 2LT9A 3ZDXE 3ZDYB 3HE7B 3FUJA 4BDVB 4BGLA 1DUZB 4OF6A 4TVPE 5D2LB 3UDWC 1SM3H 3EYFA 2UWEF 2ZICA 1G43A 3WCYA 3GSOA 3V6OC 4ZMWA 3MRHA 5GZOA 2YK1L 5F21B 3II1A 3MREA 3VFRA 2ZAGA 3DURB 2OXHB 2FJGB 3B2UD 1WFNA 4Y9EA 1BCIA 4LPTA 1PLGL 4YDKH 1PIFA 4OUUB 3GYRA 1V7NH 1A7RH 1WEJH 3QVAA 4EN3A 4LSDA 2CKNA 3ULVC 4LLWA 4L18A 5TD4A 1KJ3L 3EJUA 3O9WB 3JV5A 4MJJA 2YD9A 3WFEH 3G5XA 4K9EL 4AM0A 3HNSH 1D7FA 3M86A 1FO0H 3Q2NA 1HHKB 4N5ED 3B2VH 4U05A 1BAWA 3FBKA 1OW0C 1H3VA 3DROA 3EYQC 4CN4A 4PS4H 3DX8A 3IJ7A 4TNWK 3NESA 4X9IA 3S5LG 3WIAA 3HI5L 3HS9A 4HUVB 1MSPA 4IJ3B 1I53A 1FZMB 2EE3A 2WLLA 2A77H 3GHEL 3NA4A 4R84A 4AIXA 3PNWB 3WIHH 1W16A 2GSGB 4KHXH 3BZEA 1NCAH 3V0WL 1EFXA 1FNSL 4YSPA 4A39A 5IBLC 2CQVA 4GUPA 4YXLL 3AS2A 2LE9A 1C8QA 2UXTA 4LSRL 1FFOA 1KZYA 4PJGF 5BCAA 3F62A 5J6GB 3HUJE 5LWYL 3SHSA 1ETZB 5JQ6H 1A66A 4D0CB 1BJMA 2YC1B 4N8PA 1VESA 1X7QA 1A65A 4YSDA 1IVLA 4PU2A 5HYQB 3EBIA 2E7HA 4MXWH 1FFQA 2GCYB 2F0CA 1XR9B 4ZDHA 4ZMLA 3QUYC 3FOMA 1A14L 2UZIL 5GZNA 2VXSL 3DIDA 4G82A 4I88A 1Z5HA 4KXDA 2KT6A 1WE5A 2ZJSL 4W93A 3RB5A 4LDEB 3FFDB 3AXHA 2QLYA 2IG2H 4BFKA 4ANXA 2MQ0A 3QR1A 4UNVA 4PWEA 4PBXA 2QV4A 4QXTB 2AF2A 3M7OA 1MZZA 3OC5A 3S7GA 1X5ZA 5HI3C 4PJBF 5KEZA 1QSEB 2OMWA 4JN1H 4RX4A 1TU2B 3TYFA 1J1XH 1U3NA 3ZQ9A 3ATDA 3OG6B 4Z78A 2H2SD 1S7WB 1CR9L 3OQRA 3QIUC 2DQHH 1A1OB 1PPIA 1WFUA 4HOZA 3L4WA 2X1QA 4NLAA 2C26A 1TQUA 4MJ5A 4XAWL 4YHMH 2GTQA 5C0AE 5C7ZA 4AE0A 1LM8V 4TL4A 3ATBA 5T5FL 4OFKA 5TE7H 5DVLA 3K6FA 3UO1L 1UOVA 2HMIC 2K45A 2CXGA 5E95B 1T22A 3SY0A 3SJVD 3UEZA 1AC0A 3CZJA 1I1YA 2HVJA 2LAGB 4JZJA 2FSEB 2CR6A 4BE6A 3E38A 1CLYH 2KYIA 2AVGA 5IHZA 3NZSA 4W9DC 1UA6L 2AABH 3UTSD 4JVWA 2AXGA 3V0VB 2YOAA 3L5IA 1HESA 3G6JB 2KKQA 5C70A 4P3WA 1S9VA 4HKBB 1MHCB 5SWSB 2JKLA 1SXSA 3OJDB 3ABKB 4X4ZA 3VRIA 5I6XC 4AMXA 2R0KL 3NIFF 3HUJA 3PJLA 1MJ7H 2H0FA 5CEXB 1DQQB 4LASL 5FF6A 5JPMA 5DJ2B 5DO2C 3V2AR 3L4XA 4Z3TA 1N0LB 1YC7A 1I75A 2OK0H 3NSDA 4P5TA 1BD2D 5FS5A 5FYKH 3VXOA 3IMWA 1FYTB 3QUXD 5DHMC 4ETYA 2D0FA 3EDEA 4B60A 4Y89A 1LO5B 1BJ8A 1YUKB 5CLTA 1HK6A 3VH8B 4NZRH 1KTKE 3GEWB 3HC4H 3GMRA 3O6KL 5A16B 3FS9A 5EC2B 1QZ1A 4KFZC 5J9PA 4XTRD 3F8UB 4A6YH 4LU5H 1BECA 2F5BL 3MRFA 4ZPTA 4P59H 1NGQL 2FBRA 5DUPL 1WGOA 2E0PA 5DC9B 4P9HH 1M71A 4UIKH 4G8AC 3UTTD 2XTSA 1AZUA 2FYVA 1A7QH 1IUZA 4OSUH 4TUKH 3S2AA 3AU1B 4KHTH 1A47A 4Q6YA 2AK4E 3VFMB 3VQMA 3O3DA 3EH3B 4MMZC 3SBQA 4PJFF 2CUHA 1MNNA 4YDJB 1OVZA 1U95A 5C0AA 3GJFA 5BVJA 1ZLUK 1SQ2N 1X3DA 2I27N 4HHGA 4MCZB 4FJYA 3HB3D 2YFOA 3SGEH 3KPQB 2B4CL 5F2FA 4MZRA 4IRZL 2WXFA 2JKNA 4JL1A 3NA9H 1SJMA 4HUUA 1G7IB 2VSMB 5IB1A 4NCC2 4Z7QE 5B3JE 5IFAL 4QTHB 1W0WB 1KTDB 2YARA 3FTUA 5ECJE 3D69A 1TZAA 5D5MF 1KTRL 5SV3A 4WU7B 4BZ1A 3BRFA 3FSVA 2IWFA 5BUPA 4R5XA 3B2MA 4NNPL 2A6IB 3H56A 4OLUL 1OGSA 3RNQA 1WZLA 4P46B 3IU4H 1ID2A 2G60H 4TMPA 3P0YL 4C54A 2L7UA 2YUWA 1DO5A 2ZX9A 3PHOB 4NGHL 1A3LH 2O30A 4H44C 1FVCB 2DJMA 4AQAB 4QXUL 1OPGL 1P84K 1FDLL 3SIKA 5I19L 5CINH 3KGUA 4WO4C 3SPCA 4BKSC 4MZIA 1ADQL 3A24A 4X50A 2CPUA 3IM1A 2PYFB 2OMUA 1E8XA 3EGDA 5I75C 1QZNA 5IJVA 4APXB 1FL3A 5HDQL 4G6AD 2AQQA 2APVA 4NQEE 5HHOB 4FFWD 3CDZA 4MZ3A 4BM7A 2RD0A 2ADGA 4APQD 1H6FA 1XGTB 4WI2A 3L3HA 3VFSA 4PRPB 1LK2B 3PNRB 5JOFB 5DHEA 2J6EA 4FG2A 4KRPB 5DUBB 1S8DA 3MR9A 4OGYL 3C08H 5ACLA 3U46B 3NBNA 3UXFA 2Z31B 2R1YB 3FMGH 4NHUB 2ZX7A 1L0XA 1AZCA 4LCIH 4IOFD 2XY1A 5FYJL 4YVNA 3TO4A 5JA9A 3U6RB 5HPOA 1QUNA 1L7IL 5E2JA 2NLJB 4GAJL 3TVMB 2D3LA 3K1DA 3BP4A 5C08D 3DUUA 1N3NB 1CI3M 1SHSA 1IILE 1XZ0B 1ORSB 3QUMA 4FN0A 3VWKA 4G9FE 4GG6F 1TKWA 2B1HL 2CGRL 3SCMA 2B0SH 3VRJB 4AQZA 2VR7A 4J3OF 5K69A 2R4RL 2MCPL 1MCDA 2Q8BL 3B5HA 5SWZE 4C56A 3PGFL 3S5ZA 3VW3L 5IQ7L 4PGEB 3GSRB 3SOBH 1DVZA 3T0AA 1AKJD 1A6WH 4XNMA 3OJVC 3MNZB 4H1LB 4IBTA 3V7AE 2XVKA 1QMUA 2D7TL 3W39A 4CADA 4NQQA 4HIJB 4ABUA 4ES9A 3CTTA 4OFYA 3E6HA 2NXYD 4OCYH 5CP3H 2LQRA 2DDQH 2VR9A 5CXPA 5D7LD 4FEIA 3L81A 2IPUK 3LTVA 2XJLA 3NIDE 3A6OA 3P4LA 4QYOA 3D25A 1CD9B 4XB3A 4L8DB 1CVRA 2Y0SA 1L7TH 4LSSH 3AREB 4AYEC 2PR4L 4L1LA 3GGWB 4L4TB 3V4PL 3SKJL 3MTXA 3RWFA 1RLBA 1GC1H 1K4CA 2H3KA 4KO5A 5GJTH 1HI6B 4JQIA 1GZHA 2DLFH 2MSPA 2E4TA 2V7NA 5C0EB 4WNSA 2OULB 3FNKA 2FECI 3LKOB 3MNVA 1GYCA 2P7TA 1T4WA 4K3HA 4CILA 3BWUC 3BRDA 2P45B 4I0CC 1TQVA 3ZIYA 2ORBL 3L7FA 4JHVA 4LMQE 3W1ZA 3WV0A 3LNIA 4X7SL 4GUQA 2CO1A 2GEEA 2PWEA 3P9MB 5F7EL 4ELMF 4NQEA 1WTLA 3MLYH 2AJZA 4JRXB 1ZE3H 4E9VA 4MB4A 4M7LT 1DJWA 4GP4B 3RWHA 4RBPK 5CIPA 1T1ZA 4R4BB 2W95A 5EIIA 4J1UB 4D0BA 1J9SA 3PGCA 1DBKH 1Z5LA 2OL3H 1ZPLA 3MJ7A 1IGJA 1LO2L 4JDVB 3QWRA 3L9BA 2IVFC 3GRWA 1HEJC 5F7DA 1HNGA 3V4VL 5IHBA 4KQ4L 2HTLC 4ORGB 1TTAA 5IMKB 3QZWB 4ZS7H 3VNZA 1C08A 1WAPA 2GI7A 5DGRA 5C09B 1U8LB 4YK4C 2WZ5A 6PAZA 3BDYH 3CXDL 2J4WL 5DD0H 5AVSB 1GY1A 2X89D 4GG8A 2ZUWA 3GJEA 1FZKB 4QRPE 1OTUD 1XMEB 2X9XA 3MV9D 3LXCA 3OG4B 5DO8A 3ZSSA 2OR9H 4GFXA 1IEAB 1AQ8A 1I8KB 2V9TA 2W9EH 1NC2A 3LS4L 1DANU 1VPOH 3NVQA 4KQ3L 1KPUA 2BIQA 2D7QA 5SWZA 3AY4A 3S35L 4N9OB 4O2EA 3ULAB 4K8RD 2UY7A 4KJYB 5KS9B 2YPLB 3RGHA 3QG7H 3FO0L 2BNQD 3QEQD 2Y69B 3DUSA 3WMQA 2XI9A 1J8RA 3FHEA 3OBAA 1JZ2A 1U8JB 2E4FA 3Q7JA 5DDHB 3AT9A 3EJYD 5DJDA 5ABZA 1X5FA 1CFNB 4U3SB 4QUOA 3RWIB 1ZVNA 4YHIA 3OR7B 4Y5YB 3E2HC 4M8QB 1MIEH 2ZG1A 3BZDA 3FRUB 4GW4B 3AADB 3ZDYE 4F57H 3FJTA 5CJ8A 1KG0A 5E5RB 5D2LE 3H9SD 4LLUB 3QR0A 1ZSHA 3WO4C 3F7VB 2QGBA 1LDPH 2BPBA 2P5EB 3ASOB 3MNDA 1A21A 1BD2A 3OPZL 4KY2A 5DJCB 5F88A 5EA0L 4HWZB 2QSVA 3SKOB 3OKYA 4LESA 4MA1C 3TT1L 1HZLA 3MLVH 3KLAB 1HHJA 3QUZD 4JFDD 5LCVA 5CD3A 4U1HB 3RGBA 3SDDD 3UJTL 5EEUA 4PWGA 4UM9A 4IK7A 4IS6B 3JWOL 2VABA 4NO5B 4ENED 4KKZA 4L3AA 3HG3A 2C9VA 2ICEC 2WBKA 4YZWA 3H7BB 1JGDA 4PI0A 3NSJA 5BW7A 4IKNA 4ZPVB 5F1KC 4Z7UA 4PJ5D 1PNDA 4IGBC 3UTTA 3WKML 5KYNA 2NMSA 3CXHJ 3EYSH 1CBJA 5DFAA 3K7UA 1EDQA 1HIML 3OGOE 4OAWB 4AEFA 3NEEA 4OCLC 5HDOA 1OGPA 1IKNA 1Z9MA 1N6VA 2B3IA 1DSWA 3DV6B 3WYRA 4MVBD 2PTUA 2AJ3B 3OV6A 1RJLA 3NQKA 1MUJA 4MA3B 1QATA 4M9OA 3T2NL 4FQCL 2KERA 3N6YA 2J5LB 5ILTH 1KEGH 1DFBL 1CGSH 4A7QA 4ZSOA 2A6KB 5HD8D 5LBVA 3PWLB 1U6AH 3P9LB 1B2WL 1MHPH 1W8EA 2XN9B 3G3LA 4HS3A 4ELDA 3GHBH 1NTDA 3P4OA 1LO4L 1PSKH 5IP4A 1PZ5A 4L4VB 1IJ9A 3LDBC 1MREL 4QRPA 2GIXA 4AJVA 1RUMH 5B3NA 1D7DA 5GPRA 5AW6B 5D1QB 1A9VA 2F18A 1XF5A 2ZOWA 3B2PA 3BUPA 2OXGB 3MROB 1BM7A 1MHEB 2FX8L 5ID1A 4MDIA 5EULV 1FNFA 5A6IA 3O45B 7FABL 3DO7A 2NX5B 1YO4A 2Q1EA 1JGUH 3QQDB 3A67H 4K5MA 1EEZA 4XXDA 2DEYX 5JTWA 3B9KC 4L1HA 4HAFA 4S10A 4CN6A 3GZQA 1OQXA 3QDGB 1NBVL 3BP7B 2C3VB 4MAZA 2APTA 3BWAB 3G5YB 1YC8A 3HE7A 4YL4A 4BDVA 1DUZA 1OAQL 2OP4L 5D2LA 2KLSA 1QFWM 5BVPL 3CX5J 2BNUB 2VDPL 4MD5B 3T0BA 4B3VA 1NPUA 4PTUB 5EHFA 3OAUH 1ZPUA 4WFGD 4APQA 2YIHA 3ZXAC 4QOKD 2FATH 3EG9A 1OF2B 5HJ3B 1YJDL 5LG6A 1SXZA 2XWEA 2Z8RA 3DURA 3HZVB 2OXHA 2FLMA 4XNYH 2FJGA 2A1WL 3NIGF 1QSEE 4JFYB 3JUYA 4NUMA 3S3JA 4LCCB 1U4FA 4JUSA 4OUUA 1M9SA 3B2DC 1TETH 3QO0B 4OGXL 4U1KB 5AL0A 3EIFA 3B43A 3NFPA 4O02L 1MDTA 3O9WA 3B2XA 2FJHB 5C08A 3HN5A 4B53A 1YQ2A 4JHWL 3V6BR 3EGXB 5B38G 3IFLH 1HWWA 3HKZA 4DZBB 2ITDB 2AJUH 2E8ZA 4UAOC 2YN5A 1FNHA 2YXFA 3EO1B 3Q5YA 2MKLC 1NGYB 5EU4B 3CVBA 3QDMB 1JUFB 4XVTL 3QH3B 3NCEB 3H3PH 4AEHH 1KDJA 3KGRA 4HUVA 1LGVA 2HJKB 3A47A 1TJGH 2JH2A 3WXWH 3PNWA 1M2VB 1G6RA 1BQHA 15C8L 4UTAH 5I24A 5C0BD 2DWXA 1KULA 3BSZH 3G6JE 1T1YB 2I60H 4FQ1L 3L3DB 5KVFL 2AK1L 1N59B 5SWSE 3DNKA 2Z4TA 4ZNEE 3EDJA 5F7NC 2VDLH 4GMTH 3ZYJA 1WAAE 3CHOA 2OW6A 2WVVB 2Z64C 3M46A 2X70B 3MCYA 3Q43A 5CJXC 2XRAH 1EXGA 3K2KA 1JVLA 1OP9A 3QZMA 1NJ9B 3CC1A 4D0CA 2EVHA 2AQ2A 2VLRD 4I18B 1YMMB 3FO9B 5HYQA 1O0VA 3AW5A 3ILPB 1GKOA 1MJUH 3QXAB 3V6FA 3FB8B 1J9CT 4P57A 1R5VB 4K3JH 1XR9A 3SDCD 4JMNA 4JFEB 4NZUL 1PLBA 2AQSA 5FM5M 5GS3A 5HYIA 2HLAB 3VSUA 3S9DB 1FYTE 3RTLA 2ERJC 4XI5D 2NQCA 3FFDA 2J43A 2IBGA 4G5ZL 4P2AA 2KPWA 4R0LB 3S88L 1UVQA 1ZD6A 1FE8H 3VCLB 3VD1A 1UM6L 2R51A 3B6SA 3AQDA 1WBXB 4YFDB 4Z7UF 1NANI 1VFBB 2FO8A 1RAMA 2PW1A 4PGJA 4BH7B 4ZG1A 4FFZA 1SBSH 3F2LA 2G30A 4W9KC 1MW1A 2Z9TA 3BH9A 4J28A 1QSEA 3D85D 3HTLX 4EDXB 4XNDA 4MAUH 4OFIA 4K3EH 2EVJA 3ARUA 1TU2A 2CCVA 1GZPA 2FIKB 4IKJA 4XPHH 1O6SB 4XC1H 1LMKA 1XF1A 3MKKA 1K5NA 3HMWL 2WIMA 1S7WA 1IC7H 4C4KT 2A83B 3AQXA 5CZXD 2BSCA 4Q7DA 3EJZD 2NNAA 2VYRE 5DCCA 4MS8D 4EOWH 1CFVH 1NICA 3HHSB 4FADA 3KPRB 4GAYB 1BZQK 4ZFGH 1QFWL 5AALA 2I32A 4N2LA 2Q8AL 1CVSC 2BNQA 3WENA 2FSEA 2QGDA 2IWEA 1MH5B 4Q6KA 3U7WL 4EI0A 4NUGH 1CN4A 3R1GL 3IJSB 4PH8A 2UV3A 2VKWA 3KPMB 4RMVA 3KWXA 4TVPL 4HOXA 3O3BB 3ET9F 1YCSA 4F3FB 2C3GA 3G6JA 5GS0D 4YJZL 4FQLH 1SY6A 4HKBA 3ZDWA 1MHCA 5SWSA 4HC1L 3GLEA 3OJDA 3CHPA 4ZNEA 3TCLA 2BVOB 2EKSA 4HIHB 1EQWA 1QKZL 3LNFA 5I23A 3CC5B 2CAKA 2APFA 1BVNP 1HJCA 1DQQA 1LILA 1EAPB 4JFDA 2YEZB 5DS8B 3SDDA 1INDH 4P2RD 4LCYB 1F0LA 5DJ2A 2NR6A 3NABL 2J3SA 2Q9OA 3ZTJG 5HHOE 4UZSA 4G11A 2YSSA 3P3UA 3GSXB 4OLYL 5FFLA 1FYTA 1EO8H 1JGVL 1KYAA 4EIUA 1A3ZA 1LO5A 1MVYA 3ARYA 3PJSB 4PRPE 3T04D 4AYGA 3VH8A 5CU5A 3DOIA 5A16A 4M1CD 3LNHA 4OF3A 5EC2A 4EN2A 1SHWA 3MXVH 3EW3B 4RH4A 4PY7B 2CH8A 3IRCA 2C8NA 4M61B 3O4OC 2O5ZL 4A66A 5CLYA 1AMYA 1RIVL 4JRWA 2PTTB 2X4SB 3DXAE 4WHYG 5AQ0A 5DK0B 3ZSTA 4FF9A 1T20B 2XYCA 3N0AA 3VFMA 5DD6B 3US0A 4UQEA 2GJ6B 3WD5H 4OI8A 3LIZL 4JFUA 4YDJA 4RESB 1MAKA 3VYPA 4UTBA 4KK6D 3RUGB 2CKBB 2H0EA 2Q87A 1EHNA 5I1GH 4KGJA 4MCZA 3MUY1 5FDWB 4Z8FH 1TR7A 5I8OL 4LQFL 3QI9B 1MRDL 3VTMA 4KDWA 4UB0H 1TPXC 4XRCA 1G7IA 1AMXA 1ZGLB 4WI0A 1DTUA 1W0WA 4XP9H 3VFGL 1KTDA 1DZ0A 3DBXB 1Q0EA 2Z8VC 3IWUA 5I1LB 5I66B 4WU7A 2P5WB 1I7ZB 1RZJL 4PJHA 1N7MH 2KC0A 4H8UA 4PRDA 3HA0A 5FXCH 3U25A 1N5YH 2AEQH 2CRYA 1F4YL 4L4TE 3N04A 4NYLB 1AE6H 3BESR 4YXHL 1JWMA 5I15L 4K7FA 5AVXB 5AZ2L 1HKLL 3GI9H 3UO8B 3O8XC 2H32H 5ITFB 5IREA 5JIDA 4AQAA 4J3BA 5D93C 2VZUA 1M6OB 2V9UA 3LCYA 3QRBA 3R0MA 5F70A 3ROOB 1SOKA 4DGVH 3DX0A 4BFGA 2PYFA 3GF8A 1JE6A 2FT6A 3I6SA 5CR8A 1NAML 4QRTB 1NOLA 5KBNC 3FULA 4APXA 1ZSDB 3FYEB 4X0NA 1CG9B 3KYAA 5HHOA 3X13B 2NUPB 3FDWA 1ZMYA 4GT7A 4JRXE 4LSTL 4PY8I 3VJ6A 2LOEA 1JI1A 1E90A 3QYMA 3DYPA 3WJMB 3C87A 4FXKC 2HPTA 1H9VA 4HDIB 5TH2B 3PWNB 3TCXA 1IGFL 4KAQH 4A55A 1KMGA 3TZVC 5T3ZE 5GISH 3IGAB 5DUBA 2AP2A 1QNZH 3QUHA 4J6RL 4WWOA 5B39B 4GQ9H 1DVFB 3U46A 2Z31A 1I9JH 2EP6A 3KR3L 5SX5H 2R1YA 5LDSA 4BZ1L 2WKOF 1RULH 4LPUA 2UY6B 4G1MB 4NHUA 2QADD 5D9SB 2Z91B 1F5WA 5C09E 3UYOD 3MUGB 1P4IH 3KG5A 1H3UA 3TVMA 1WT5C 3MV8D 1TNNA 1BQUA 2N56A 2LVCA 1XH1A 4OZHB 1N3NA 5I17A 4OVVA 5KBDA 4OV5B 1XZ0A 1ORSA 3QORD 3VB8A 3HE6C 5AVVB 3ZTDC 4JPQA 2DQJH 2NNRA 2BSEA 2IAMB 4KTDL 1QBLH 3U48A 5KS9E 5SX4I 1CICB 1BXXA 2YPLE 3MUZ1 3QC6X 2IPTL 1I8IB 4PREB 2ALWA 4PGEA 3DJ9A 1AXTH 2WN3A 2O5NA 2R2BB 3MNZA 4H1LA 2P43B 4N85A 1Q72L 2WMPA 1T03L 1MFAH 3BQUC 5PCYA 1A7PH 1T6WA 4HIJA 2YRBA 1X44A 4CA4A 43CAA 2WXQA 5FUOH 1YLBB 1NMCC 3H4HA 3QS2A 3OX8B 4BRVA 5JXEA 1FP5A 3QJHB 2QGCA 2P5EE 5FC9A 4WW2B 4L8DA 4I0PB 4EVNB 2XKNA 2MQGA 3AREA 1MFCH 1IL1B 3MJGX 2CJSA 5BQ7B 2F7QA 3KLQA 1HDMA 4FNQA 4K71C 3MA9H 4WK0B 1AZNA 2X4QB 1HI6A 4PG2C 3G5ZB 4Y5XB 1BYPA 5C0EA 1JPGB 3POCA 4BUQA 4YO0B 1SUHA 3QUML 2X5PA 4XP4H 4P49A 1JFHA 4H25B 3SB3A 3VWJC 1DLFH 3P9MA 5CO1A 1Z3GH 2BW4A 4GMSL 2EUXA 3D4CA 3KPPB 1H8OA 1TO4A 5FR3A 4R4BA 3S3BB 5I6NA 3NZHH 4J1UA 2XTJB 1XQ4A 3FU9A 1CFMA 5L9DL 4LBEB 3JWDC 4NJAL 4ZXBB 5EUOF 5BRZD 4NO0B 1X9RA 3X12B 4JDVA 2Y22A 3GKZA 4UOW0 1D5BB 1KXVC 3FUKA 4HWEH 4ORGA 4MXQC 2H6UA 4CSPA 1ZJAA 5IMKA 3QZWA 3RFRA 3JV4A 1FAKT 2XCMC 2XN9E 3I50H 3MRKB 4DKDC 3BFQG 5ICYA 1KCSH 1J9RA 5IOKA 2YD4A 4L4VE 1OAUL 3QS3A 1DN0B 1ZEAH 2D0HA 1JK8A 4U6HB 2YPVH 1OAKL 4G3YL 1IEAA 2HJFB 2VXQH 1I8KA 4K9EC 4B0MM 1DP0A 4JQIL 5D1QE 4M5SA 3UZQA 5KS9A 4KJYA 4PJHF 5D1ZB 4JW3A 2XZAH 3K0YA 1UXLA 5IGXH 2WTRB 2NX5E 1U8JA 4IRJD 5HHXH 2Y07H 3UCRA 5DDHA 4U3SA 5L2KB 4WHYH 3RWIA 4A37A 3OR7A 3CFNA 4Y5YA 2OMXB 3CFTA 4U2YA 3QDGE 3FRUA 1GMEA 4GW4A 2QDVA 1TT6A 4LT7A 1JN6B 1JXKA 4LLUA 5AAWC 3BP6B 3X1EA 5J4MA 1EEUA 3F7VA 1XGPA 3RL1A 1E4XI 2P5EA 3HPJA 5IV2B 5DJCA 3SKOA 1Y07A 5T33L 5F9OL 3C6EA 2XDHA 1MJ8H 1BQ5A 2DKUA 5IK3B 1H6TA 2JK5B 4HPYH 2A6DB 3KLAA 4ODHH 2VM9A 4U1HA 4UT6H 2VW7A 4IS6A 4NO5A 3ARWA 4Y9GA 5HYJD 3SY6A 3Q8EA 3AG4B 4LL9A 2IH3A 2AEWA 1S9YA 1QWNA 1T5KA 2ZCLL 1CT8B 3H55A 4DOHB 3H7BA 4XN5A 4NBYB 2GKIA 5E9AA 3WJLC 4ZD3H 3MGTA 2EDHA 4HK3N 3EFFA 4OAWA 2E27L 5E56A 2JF1A 4QEGA 1HYSD 3B7YA 3DX1A 3RU8H 2A4CA 4JCMA 3WKYA 4JG1H 3SE8H 5JZ7C 3DV6A 1ZLWK 1RL1A 3QDME 3TF7C 1HFUA 3WIFA 2GBVA 3QAZB 4MJ2A 3II3A 3CH1A 2FZ3B 1I8LA 4MA3A 1QBBA 2I5YL 1HL4A 1X5JA 3D2UD 3PCYA 1ETB1 3RIKA 4DVRL 5D71L 3VG9C 2XETA 2FSDA 2NTFA 4CBPA 3EJSA 1UXMA 5FK9B 1TQTA 2A6KA 2QJDA 3U7YH 5A3ID 3PWLA 4HSAC 3P9LA 3C5SB 4WUKL 3P69A 4HEPA 1RUAL 2XN9A 2VISB 4XNUH 2BX5A 1M9WA 2HXAA 4XVJL 1UG9A 4L4VA 5LCVL 3U4EA 3P77B 4GW5B 2RJMA 2K1MA 4LSPH 4N90D 5FHBH 4AMWA 5H35B 4NP9A 3MLSL 2L04A 5D1QA 3G9AB 3TJHD 3CPUA 3KJ6H 3JVGC 5BOPA 4AZUA 1YMME 3OLDA 3RJQB 2OXGA 5ICZB 4U1MB 1MHEA 4L0YA 4R83A 3O45A 3CE1A 4V1DB 2NX5A 3NJVA 3WTVA 2EIKB 3QQDA 4JFEE 3PL6B 4PR5B 2OI9C 4PBWD 1HHHB 1KIRB 1Q9OA 4JY5L 4Y4HC 5JIHA 3NN8A 4PLJD 4NKDA 3QDGA 4PWHA 1ASQA 1FFPB 4AENB 2EXSA 3AWEA 1GZQB 1U42A 3BWAA 1ILUA 3F7PC 1ROWA 2D4FA 2PPCA 3MUHL 1GOHA 4MD5A 1A4JB 4UWQB 4OUOA 4YR6A 3HNVL 3C8KB 2Y5TA 1R3HB 4AYFA 1KJ2H 3P11L 3BGAA 1A6AB 1KCVH 5HJ3A 4PTTB 3L9RA 1FBIH 4BQBA 4NAQA 3HZVA 3EDDA 3O2WH 4XAKD 1AR1B 1K8IB 1UT9A 1IBFA 3EFDL 3M1CA 3MJ9L 2FB4L 1Y0LB 5EDSA 5I1IL 4LVNC 3BMWA 1KB5L 2GTZB 3MVSA 4HGWA 1VCBC 1WD9A 3WY1A 1QFUL 4L8BA 4MNHB 5J0BA 5E08L 3RI5K 3GDBA 3GIVB 5D7KD 3QO0A 4XX1E 1EFQA 3ALWA 3OAZK 4U1KA 4C8XA 3FU7B 5KYYB 5C71A 5I71B 5L4FA 1SXAA 2D3NA 2FJHA 2EXWD 2YRZA 5DQJB 4POUB 3T4YA 3WEXB 2DKMA 5EZJA 2BIIA 3QORA 2IMMA 1D9KB 3L9YA 2KHAA 1A7BA 4HXBH 1F13A 4YHLH 1JIBA 3EO1A 5D7SH 3UJJH 3IBEA 5CN3A 1NGYA 1R3JB 3KPRE 5EU4A 3QDMA 1JUFA 3QH3A 4PIRF 2HJKA 3LEVH 1MFNA 1MELA 4JZNB 3FXIC 5CGTA 2XXFA 4AOFA 1G0YR 2J1WA 3D12B 3IDJB 4J3SA 4XPTH 1B4JH 4ODWB 1I1AD 4KROD 1T1YA 2N1KA 1CFQA 1N59A 1PZSA 4LNRA 2HUHA 5FM4A 2WUCH 2NY3D 2XWJB 2R2CA 4OJEH 3PAYA 4Q6IC 5DMGC 1VA9A 2WVVA 4ZRGA 4IRSD 4ATTA 4OFPA 1AZZC 2X70A 4DEPB 3HS8A 1F1AA 2F9BT 3AABA 3F6LA 4MCNA 3RFZC 5F1NB 1NJ9A 2A73B 4M29A 5FYJU 1MFMA 2YD5A 4I18A 1YMMA 3FO9A 3MLRH 1FH5L 3E0GA 1Z66A 3ILPA 2AJXL 4IMKC 5AAMC 3QXAA 3QQ3B 3RKDD 1HSBB 1R5VA 1J18A 5E7FA 4JFEA 2OL3B 1EA9C 3CFDB 4XBEL 2P26A 4FTVD 4R97B 2F53B 3VRLE 1JPSL 1A9EB 2L7QA 2BJML 3MLPA 4F5CE 1DN2A 1XF2B 4R0LA 1BVNT 4YFLI 1ZLVH 4YBLB 5I1HL 3TYGH 5D72L 1WWAX 4N2EA 3VCLA 3IPEA 3BDBA 4TXVB 4I85A 1VFBA 4GIOA 3S3PA 3X14B 4BH7A 5L4MA 4TSBL 3HNTH 1YAIA 1ZT7A 4KI5D 5EO0B 4EZKA 5BRZA 4GAGL 1U3HC 2DMKA 2K6ZA 2X88A 4NRZB 2NY2C 2FIKA 3V5KB 2F58H 1O6SA 4JFFD 4GS7C 3RQ3A 3U0TA 3CSFA 1KJMB 2ADIB 4XNQA 1J0JA 4L3ED 1OAXL 2VXSH 2GJ6E 5E8DL 1HH9B 5DC2A 5I1EH 5C86A 2A83A 3AWGA 2GFBB 1D5MB 1RU9H 4IDLA 4DAGH 1VKXA 2PNDA 3RUGE 2YBRB 3CK0L 5SWQB 3EH5B 1JGIA 4O58L 4FG4A 1V7ML 1G9HA 2Y36L 3QRGL 3BVNB 2YGQA 3HHSA 3WN5C 4I89A 4TN9A 3KPRA 4GAYA 1ZA3B 3N1QC 1FHNA 1UD5A 2H9GB 4L23A 1IIIA 2VQTA 1MH5A 4HXAH 1KN2L 4KK9D 3RGVB 4IBVA 4IRJA 2P5WE 3DK0A 1E4JA 5KSAD 4XXCA 1EV2E 3KPMA 2DLIA 4H4NA 4MBRA 5EDXA 2GK2A 4HPOH 1OXYA 4GXFA 4F3FA 2YAPA 4BHUA 1XIWB 2IGFH 4Y7OC 3MTRA 2COQA 1G7QA 3G9VA 2W81C 3GMQB 3IDYB 3GZPA 4FFZL 3TV8A 4HKZB 3WEBA 2BVOA 3BP5B 1QUPA 4HIHA 4JVUA 4D9RD 4IHOB 4U3CA 3CC5A 5E99L 2K0RA 5F96H 2EO1A 2D7MA 4OLVL 2YEZA 1NBZB 3ULSB 3WUWA 3C2AL 4ORZC 3CU7A 3VE0B 1LEIA 5CGBA 2BO0A 5EOCL 4B41A 4OM1L 3Q3GA 3QCVL 2VN5A 1VLXA 1GYUA 3QJZA 3OMNB 4OBSA 5ACMA 5A2CA 1ET7A 3C5JB 1ZHBA 3CSGA 3CZEA 3GSXA 1URIA 3ULVD 4GP5B 3QFDB 4F7MB 3MZTA 4E42B 3GD1C 3TO2B 4YX2H 2PWFA 3VGAB 5MEQA 2VLLB 1OT1A 5LGHL 1BEXA 5E8EB 2IBBA 1B0GB 2ZCZA 3FRPG 3INUL 1R3KB 3EYQD 4PY7A 5DLML 1T04B 5HVFB 4M61A 4XVSL 4HUNB 2CHXA 4CU6A 2OCJA 1TCRB 3D52A 4CKVX 3LMJL 2X7LB 2ZWZA 3CIAA 4WTXA 5C0RH 1MI5B 1YYCA 4XO4A 4KZ0A 3HI6H 2YD8A 2NQDA 5HGGS 1B0IA 4OZHE 4ZO8A 4R90L 2X4SA 3B1UA 5G5DA 3SE4A 5E4EC 1T20A 4ADIA 4LDCA 5DD6A 3ARTA 1KEMH 4AMKL 4TF4A 1VGEL 3MRJB 4O2CA 5JHDD 4BZ2A 5DMIL 4ODXB 2CKBA 4G8EB 1Z32X 2WSPA 4Y4FC 1OF0A 3ELQA 2N59A 2QKIC 2H6PB 4WV1B 5FDWA 2FJFB 4L2LA 5IB5B 1BQLL 5AW8B 4Z7VB 4PY8J 3QI9A 4H13C 4C58B 1WGVA 4H2AA 5JDSB 1NGQH 2DOCA 2D0GA 4PJ8C 1V55B 5DRZA 5E1QA 2NCMA 3OHXA 5HPMB 5C0NC 4FYSA 1ZGLA 3EKCA 2LHAA 2XVBA 3DBXA 2VDKL 5GRUL 4NS0A 5EB9A 1HXMB 3H53A 4PV8B 3U9PH 3U9UB 2VERA 5I1LA 5I66A 1I7ZA 3QUYD 2FEDC 4PJAF 3BYYA 2HCZX 5F9DC 5TK2A 5IG7B 4F1ZA 1JZ5A 1X5HA 1SHMA 1P6WA 3P73B 3Q48A 5CBAB 1PGRB 4M1GH 4NYLA 3CSBA 4S1SH 1PD0A 5MENB 4MRCA 1FCCA 1RHHB 2X44D 2BCKB 5ITFA 2FE0A 2V17H 1E5YA 4GPVA 3SDYL 2DWTA 3EF7A 4DO6A 1LD9B 1M6OA 3IBOA 1JG9A 2AC0A 4CVUA 4HJGA 4OLZH 1K4DA 2O6FA 2R69H 5EUKB 2W38A 5HI3D 3SQRA 1GGYA 1QA9B 4WWID 5ALBL 5E2UL 1SF3A 4OCRL 1ZSDA 1JYVA 5FA3B 1CG9A 1P5UC 1NBQA 2X4PB 5AZUA 2F54B 1O9ZA 5DWUL 1PY0A 3TFKC 5T1JA 2NUPA 1KCRH 4UTBL 2MQ3A 1BX2A 3AC0A 5A2IH 3Q13A 1SYVB 4FXGA 5E9DB 3HJEA 4HDIA 3RTQB 3KYKL 2XTJE 3PWNA 4I2XE 3WIHA 1P9MC 5BXFB 2IDSA 4MNGB 5LNEA 2CE6A 4HWBL 5DK2B 4A63A 4CRPA 2XT1B 5I0YA 4H8WH 4MAYB 4JNXA 5B39A 1DVFA 4DGYL 2HMID 4QLWA 1O75A 4WI5A 2JWYA 5BOJA 2QTEA 2NYZA 5C6TH 2UY6A 1NOAA 5D9SA 3JWOC 1BAFH 2VDLB 2Z91A 3EJCA 4M7LH 4QTFA 4WI7A 3WDIA 2B2XL 3MUGA 1KPRB 3ATAA 1UQSA 4N2KA 4N0UA 4NQCB 4PJ9B 3L5XL 3TBSB 3GK8H 5ICXB 4OV5A 4J3WA 1I1AA 4HIEB 2IAMA 3EYUH 2EIZB 1BGXL 2F61A 4KZEL 3SYCA 1A6ZB 3BLBA 1CICA 3FB5B 1A6VH 4Y1AD 1F42A 1YNKL 5FYKE 1I8IA 3FT4B 1YUHB 5JXAH 4EZLA 1EANA 2OMYA 5LBSH 1VZIA 3QUGA 5CU9A 2R2BA 5C07D 5L2KE 3NH7L 1NCOA 1OSPL 3T6XA 1FI8C 3MODH 4NKIL 3QIWC 4GP8B 3FQRB 3VFUB 1PZUB 5DO2D 2NY0B 5C2BL 1BIIB 3CSYB 1G5AA 3OX8A 4FMFA 2ZD0A 3QJHA 2YWYA 4OH2A 4X9YA 5TPWH 4WW2A 3LZOA 3RURA 3SDAB 1NMBL 2HVKB 4Q9RL 1P5VB 4PB9H 2IPUG 3ME0B 4EVNA 2BOCB 1IL1A 4OD3H 5BQ7A 5AWNL 1PZ2A 5E94B 3BDXA 5EBWB 3VYOA 3EJPA 4ODBD 4QAWA 1IX2A 1NINA 3G5ZA 2XWTB 1ET5A 1JPGA 5MHSE 4UDUA 4DOHE 3GSUB 4N25A 3LNGA 5I76B 3VXRB 5K59E 1TZOA 2XQYK 1OANA 3V0AC 4E9LA 4H25A 1RIHL 1PW3A 1QFHA 4PW4A 5C0GB 1GGCL 3D18B 5IJCC 3VB9A 2BHZA 3VFWB 3ZKSD 1MCWM 2DS4A 4S0HA 3KPPA 2FQEA 1E5ZA 5DURD 4HOMA 1KSRA 1SDDA 1JPFB 2J8OA 4L5FH 1Y1UA 4OTXL 1GYWA 4QHMA 4ZAKC 4ZXBA 3ZKMC 4JPVH 3DVNB 1YJDC 3GXMA 2BC4B 1D5BA 3L3OC 1U8IA 5I28A 5FGSA 3C6LB 5AOIA 5CEZH 4HBCH 4WGWB 1JRHH 2DQCH 2Y7SA 4GKNA 5DJYB 2WANA 1WICA 2QKSA 4UI2A 2BMKA 1F90L 3UBHA 3BGMB 2C3HA 5DHYB 4F8OA 4OI9A 2WM0A 1I8AA 5LQBH 2BIMA 1A8JH 1CXKA 4GY4A 5IY5B 3PXHA 3O6LL 1ZTXH 3TV3H 3WLWC 4HKXB 2ARJB 4OM0L 2HJFA 1RKRA 2VLJD 2LU5A 4MJ6B 3WJJC 5FCUH 2XXCB 5DC0A 5I8CB 4MGXA 2DQGL 5E1AB 4LEBA 4NI3A 4WIQA 5AKVA 1WFIA 1BP3B 2YD2A 3MRCB 5KWYC 4V1DE 2H5UA 1U2HA 5HHPB 1PFOA 5T1DL 4WO4D 3TLRA 5L2KA 5E1GA 4C47A 1IAIM 2H1LM 2WGNB 4A2GA 2P24A 1U8OB 3TL5A 4G8IA 3GSNH 4QRSB 5LXVA 1BVZA 1JN6A 3LS5H 2BY3A 3FONB 1T2QH 2YKKA 1JGLL 3BP6A 1AO7B 2HH0L 4I3RL 2X2UA 4NUQA 3KWWB 1RZGB 2WXRA 2YN3A 3MRLA 4PWKA 3T6WA 3R18A 4H8VA 5DYFA 5T3ZL 4JG9A 1AS8A 5GZOC 2P80D 5IK3A 3K74B 2JK5A 3LS4H 1JYNA 1IQWL 2R7EB 2A6DA 3RDTB 3N1MC 1ZAGA 4Q9QL 3KLDA 1JGEB 4FI8A 2NSXA 3S3CB 2AXFA 1OW0A 3PABA 3QHZH 1TJIH 4OGAC 1JF1A 3U2JA 1BLNB 4D9QD 3KM2A 1TEFA 4EN3C 3THMH 3IMSA 4DW2H 2BVYA 1WO2A 2Z35B 2VDOH 4J5VA 4ZTOH 3WTXA 4JVPA 5FO8B 1N6QH 5GGVL 4RISH 2E7BA 1NL0L 4FJZA 3SKMB 3QZNA 1NUGA 3U1SL 4G8FA 5I1KL 1ZGLP 4YIQB 4NUJB 3RVWC 5DFWH 5JHDA 3D30A 5J89A 3L7EA 1S9XB 4TRPH 3PS6A 4NHCL 1I9IL 4W1TA 5IQOA 4WFFE 1DDHB 1R75A 4L29A 4W4OC 4ENZA 2RBLA 3WOVA 3DHPA 2WKLA 2R23B 5EZOH 1UM4L 5G4OA 1PBYA 2UZYA 2GJZA 2H32B 4JDTH 5FK9A 1BBDH 5FW8A 3SO3B 4HCGA 3C5SA 4QXWA 3D1MC 2JJVA 1FNEB 3BD5A 5T1LB 3TTSA 1FV1B 1SJXA 1U4EA 2VISA 35C8L 3AY2A 4IJTA 4EI6B 2CO4A 5L88L 1UGKA 4X9GA 1U8MB 3P77A 2YOCA 4GW5A 2FHBA 3TH3T 4R5VA 4AUYA 5BO1L 5G4MA 4JANB 5H35A 1OP3H 5LGYA 3OZ9L 2ZCKL 4BWTA 2YZ1A 1KV3A 5ICZA 4U1MA 5L0QB 4YBQC 1GVIA 4FI7A 5LO7A 4V1DA 3T2NH 3F04A 1XVSA 4PR5A 4NIKB 5GZNC 2NDFA 5T3XD 2ZPKL 1HHHA 1KIRA 4YHKL 2CDEB 3VVWA 1FFPA 1TENA 2F53E 2HT4C 3ARXA 4IIQB 4S1RH 3BT2H 3K6SB 3LHPL 1M1SA 1NOFA 4XBGB 4G80B 1NCTA 4HSQA 2WWMC 3C8KA 4KI5F 4B9KC 5L8KB 1R3HA 4LOFA 4Y16B 4IBQA 3OWEA 2DQTL 1KTBA 2OX5B 4U1GC 1A6AA 4YBHA 4U2ZA 1MCEA 1KYUA 3V7MA 4YFLF 4DEUA 1K8IA 4N0CD 4UNUA 1CLZL 3ENEA 5JW5B 2VDRH 1HX0A 3ALPA 4KMTL 4O4YH 3T3MB 2XVGA 1Y0LA 1NIBA 3P40A 2XQBL 2APSA 2GTZA 3QCTL 4E9WA 1CFSB 1SMOA 2HTLD 3H6JA 3RBSA 3FU0A 3ARSA 5CCGE 3GIVA 1MCWW 4N8CH 5KYYA 3FU7A 5MEOB 5EEYA 5DQJA 1EDHA 4QYAA 2B5IC 4PJEB 5HHMB 4BSWB 4E5XG 5A1AA 1YEKH 3U30C 1D9KA 3VM5A 1SPDA 4JDEB 3K72B 5CP3A 1CB4A 3I6LE 4U3HA 2FGWL 5E2TH 5CWSA 1JV5B 1UCBL 1BEYL 4DKFH 1R3JA 2KLRA 2AJVL 1MWAH 3NAAH 4NWTH 4KVNH 4XO5A 1NCWH 4Z7IA 3TASA 4J3OC 4JZJC 5ESVB 2B08A 2Y06L 1AQKH 3JQOB 4LSQL 4P3CL 4X80L 4JZNA 3Q05A 5C07A 3IDJA 1VADB 4NC0B 4WWNA 4TUJB 4ES8A 2Z4QB 3NCJH 3I2CL 3O6FB 3R4RA 4P5MB 4LDOB 4JREB 3ZBMA 3D4ZA 5IFHH 4J3XA 4OZIF 5I73C 3UC0L 3Q1SL 4XCYA 5ALCH 2XIIA 2XWJA 1NCIA 4N8VB 2AXJA 4RBPH 1JBJA 1AGDB 4XWGL 1X5AA 5FECB 2OSLA 3OSVA 5F1NA 1JWSA 3E1ZA 2X42A 2WBXA 2A73A 2ICWB 5JPMC 2DI7A 2Y6TE 3CQFA 4OY9A 3ULVF 4HLEA 3BZ4B 1SN0A 1QRNB 3QQ3A 3MJ6A 1HSBA 2OL3A 3VXMD 3CFDA 2BVEA 4B9ZA 2RB8A 5IB2A 3DRTB 2VAJA 2EEXA 4JPKH 1MQKH 4ADJA 2F53A 1RZJC 1U3JA 1WCBB 3MACL 2VR4A 1A9EA 4IGBD 4KJQC 2DBLH 1JFQL 4XP1L 4S1QL 1XF2A 3LPPA 1HQRB 2XV0A 3OB8A 1BYNA 4C83B 4O00A 1TQBB 1QD0A 2PCFB 3MCG1 4GLRI 3X14A 3QIBB 1KLUB 1HQ4A 2H3NB 2EJ1A 4MD4B 2PCXA 1HL9A 1ZA6B 1MI5E 2P8MB 3FUHA 3GBEA 5H94A 5IHUH 3GIZH 4B9FA 4NRZA 1DQIA 2XKUA 2J1YA 3BEVB 4KI1A 5LUMA 1KJMA 2FD6H 2ADIA 4WCYL 5J1AB 1LO0H 1XXDC 2D7NA 4WNQB 1HH9A 4MMXB 3PIQB 4NB7A 1IM9B 1D5MA 1PG7W 3V8OA 3T2LA 1OEZW 3KS0H 3SQOH 5EORL 5FIEA 2YBRA 4D8PA 5DQDH 3UTPD 2R29H 3A4DA 2P8LB 5HVHB 2C9XA 3LD8C 3BKYL 3NGBB 4UBDC 1YYML 5D1XD 1CZ8L 3NCYS 4Z7VE 3TH2T 3BVNA 1E9OB 4LOEA 1E0OB 4DFIA 1ZA3A 5IT2H 4JO3H 2DM7A 1J8HB 1E28B 3FTZA 2E9WA 2A9DA 5DJZB 3WAKA 4N2OA 4FA6A 2H9GA 1DBJH 3ARZA 4POZC 3MV9E 2EDNA 2QR0B 3LN5B 1HWHB 5DD5H 1QSFB 4KH2A 5CR1A 3GNMH 2HKFL 1MCNA 3B9KD 2P4AB 4ODVL 4FQPA 4GUOA 1VACB 4XWOC 5J5EA 4FL4B 1JS4A 3SDXF 3A6BL 4PJDA 2BSRA 3FAWA 4TQEL 5MENE 3BIAX 3HMXH 3X1FA 4LPCA 4WO0A 3EH2A 3BP5A 3G6AB 4Y2NA 1B6UA 3QDJD 3OKDB 5DF0A 3BLKA 3RA7H 3WNMA 43C9B 1W0VB 1IMHC 5F9WC 5JUEL 4EZJA 1NBZA 1N6UA 3KDPB 1G7JB 3VE0A 4LP8A 2DQDL 5ABAA 2B15A 2HRPH 3SZ6A 4OJCA 3ILQC 2G4EA 4HLJA 3OKLB 2F54E 4I5BB 4XMPH 3KNBA 1JYWA 4ZMYA 3C5JA 2VWEE 5E9DE 1BWWA 2JXMB 3VG0H 3QFDA 4EUPG 4F7MA 5L7XH 2IIJA 4E42A 2AFNA 3NCCB 4OCSL 3TO2A 3FCGA 3U4BH 1AH1A 2VLLA 1ZKAA 4MNGE 3VI4F 3F7RA 4N5EC 4LFHG 3RWDB 5JHLH 1B0GA 1QR1B 2OTWA 4R6UA 1R3KA 3GJFK 4WSKA 4RGNB 4OQTH 3E6FB 1DJGA 4P2QD 1T04A 1QYGL 4RFNB 3IPBA 2O5XL 5F6IC 3TO4C 1UOWA 2IDQA 3DX2A 2X7LA 4UQDA 1MI5A 4NZFA 4OZ4B 2KL6A 4K2UH 3JTSB 2I7OA 4NQCE 1TQCC 4TSAH 4DH2A 3CZUB 4IW4C 4P23B 2UUDK 2YGPA 3VWKC 4ABVA 5HGBA 3SCMC 4TQIA 3MU3A 3ZDZF 4M7JH 1KT2A 5DZJA 4WI9A 2TSAA 2X9ZA 3D34A 3KEHA 5D96B 3MRJA 5F72S 5CILL 4HIXH 2VSDA 1MW3A 4ODXA 1UB6B 4G8EA 4P5KB 2QHRH 4K07A 5KVGH 2H6PA 4AI7A 2FJFA 1FIGL 5IB5A 1TZGL 4Z7VA 4LLMB 1NGWB 3D39B 1F2QA 3AM8A 4O9HL 3EHBC 5JDSA 3SOTA 1L0PA 5KSUA 5HPMA 3V95A 1G0DA 3U9UA 2PPEA 3BO8B 4PV8A 5TE4H 3US9A 5JO5B 1DEEB 4M6OL 1Q90A 4XBPB 5FV2A 1UH4A 1XB8A 5GJSH 2AVFA 4AIEA 5C9JB 5CBAA 2PKDA 1JXFA 1EGJH 5MENA 2NY4B 3KH3A 2PWGA 3CZNA 1RHHA 2BCKA 3LSOB 5I5MA 2B1AH 3GS4A 1UD6A 3LQAC 4ANUA 2CUAA 4NZDA 4XMZA 3VXRE 5EUKA 3BI9X 2R1WB 2VIRB 4HFUL 1QA9A 3NPSB 2WVSA 3HBGA 2X4PA 2OA9A 5D70L 4AGPA 2F54A 1TOXA 4P4KB 3NTCL 3MN8A 5J12C 3UMTA 1J1PH 4BZ2L 2CKBL 1FLRL 5I18L 1P7QB 2AQPA 1WUZA 4KX9A 4Z7WB 3S8FB 1SYVA 3C5ZB 4KKBC 4B96A 2K8QA 1HH6B 1DL7L 5BV7C 3P0GB 5I6LA 3NZ8B 1B0RB 1QHPA 4YXHH 4YNYA 1SM3L 4MNGA 5JIQA 3S6CA 1KLFA 5DK2A 3PY9A 4I9WD 4YSSA 5HYSG 4MAYA 5IF0B 1DSYA 3ARGB 4XN2A 4AJYV 3TEXA 1M42A 3PXJA 3T3PB 1PU0A 2NW2B 1ZHKB 2E59A 3SD2A 3TA3B 4PPTA 2E75C 3ZUNC 1P4UA 4N4YB 4YDKL 4NQCA 4PJ9A 4AKPA 5AEAA 3TBSA 1PD6A 1V7NL 1A7RL 1TJXA 1WEJL 2MWCA 4MMYB 4MLSA 4HIEA 4W6WB 4KWUA 4UOW1 4F24A 1A6ZA 3WFEL 1Q0XH 2AMGA 3AY4C 4U0RC 3FB5A 1JHTA 3HNSL 1FO0L 1NFIA 1YUHA 3HLKA 3X11B 3HAEA 3B2VL 3CCHA 4N0FA 3SE3A 4UUJB 3LOWA 4KX8A 4FCAA 1QO3A 4PS4L 4XNBA 1OCZB 4PJDF 3O11B 3BISA 4NQTA 3VFUA 1YZZA 2BWDA 3HC3H 4HLZG 4MCYB 1F3DJ 2EH7H 3CSYA 1EHLH 2ADYA 2BIOA 2A77L 5FPIA 4WHTB 1AO7E 4ZX3A 1UWXH 1MFBH 3LRMA 1MEXH 3WIHL 3SGDH 3SDAA 3FFCB 1HSAB 4FQJH 5AW9B 3GSQB 4KHXL 1P5VA 2BOCA 5IJKA 1NCAL 1UHVA 1CTOA 3KEDA 3OZLA 4JPSA 3ZJAA 3T6ZA 2DQEH 2RCSH 5EBWA 4ZFQA 2BHYA 5E0FA 2GT9A 2V9QA 1XGRA 4XX5A 3VMNA 4DKEH 5HHQB 5GRYA 2XWTA 2WLZA 4U4BA 5JQ6L 4MDRA 2DY2A 3GSUA 2WLJA 5I76A 3PWUB 1L9SA 4NQXB 1I7TB 1Y1DA 3R4DA 2G2RA 5BW7C 2FBOJ 2BERA 2HX8A 3OAYH 5FKAA 5KG9B 4MXWL 3RHWK 2VR3A 5C0GA 3LZRA 4OU3A 4PVNA 4NPJA 1XDTT 3VFWA 4D0DB 2VLMD 1IKNC 1Z9LA 2ZWYA 3K6OA 4OF0A 4PRBA 4NAJA 1JPFA 1N5AB 2IG2L 3TJEH 3L4CA 4TNFA 1BYOA 3DVGB 3RRQA 1M57B 1KLGB 3DVNA 3HS0B 4XPGH 2BC4A 2VW6A 5D1XA 5C3IA 1ONQA 2AERT 3W81A 3C6LA 4YMPA 5JORB 5J1TC 1G1CA 1CURA 5DJYA 3FTVA 2AJSH 1YECH 5F7WC 1MN4A 1H5BB 3BGMA 3QXUA 4LCWB 4EUPH 4JN1L 4NPYB 1O9VA 2JQMA 1IVTA 3KLKA 3L5JA 1R17A 4KXCA 1J1XL 1F11B 1I1FA 4L9LB 3WY2A 2ARJA 1H19A 3KJ4C 1JXJA 2DQHL 3CFCH 4U1IB 4HUXB 2Q3AA 2XKSA 3K80A 4MJ6A 3ATFA 4URTB 4NENA 4YHML 5I8CA 5MI0C 3K71B 4XVUC 3IFPB 3O8XD 5EBLB 5TE7L 3MRCA 1QSVA 3BWUF 4KGLA 2G5BB 4Z9KB 5ECGA 3C75A 3QDJA 3WUZA 2AXHA 3NJFA 3VXUD 5F7UA 5FCSH 2WQRA 3DGDA 5DZOA 3F5WB 1U8OA 3ZT5A 1J0KA 4QRSA 1PYWB 3HE7C 3IRZA 1R19A 1JHLH 1GAFH 1CLYL 3BXNB 3FONA 5JLZA 4G6AC 2QQNH 2XFXB 1AO7A 4ALAC 4YHYB 2W65B 4FFWC 5CAYB 3KWWA 1NCCH 4HH9A 1E30A 2AABL 1BLIA 1BM3L 1SYSB 4APQC 5H8DA 1JSYA 5AUMB 1T6VN 5F0PB 3RDTA 1UWGH 3TZVD 3RWCB 4ODUB 2B16A 2PR9A 4K7PH 3Q6GH 3T3ME 3NJXA 2ZX6A 5K9QG 1NCBH 3OMAB 3N42B 1MJ7L 4Q58C 1BLNA 2N0MA 4P2QA 2VDQH 3ARBB 3O41B 4NZTH 3KS0J 2PP9A 4RRPA 2VDMH 2Z35A 2I24N 3IVKB 2E74C 3O9WC 5FO8A 1BSIA 2FVNA 4PJEE 2ZOKB 3CDCA 5HHME 5JMRA 3MQIA 3SKMA 2XWCA 2OK0L 3QEHA 2V8LA 5FYKL 1FVEA 2CMRH 1LP9F 5EN2B 3HRPA 4YIQA 3MRQB 5GGTH 4FAAB 3GFUA 4NZRL 3KDMB 4TPRH 1S9XA 3NCYP 3HC4L 4Y5VB 3IS1X 3DO3A 4LVHB 4IJ3C 4PMEA 1DDHA 1F2XK 4G71B 4JQVA 4XR8C 5ANMA 3UIZA 4PJIA 4YGVB 2R23A 2XG4B 4LU5L 4A6YL 5AVUB 4CGUB 3MBEB 5AB9A 2WXJA 2XX0A 4P59L 1PEWA 2CRMA 2OTPA 4QRRD 5DS2A 4P9HL 1OY3B 4UIKL 1FNEA 4KXAA 5T1LA 4OSUL 4EI6A 4TUKL 1A7QL 4N5UA 4KHTL 3D3VB 1U8MA 3T0ED 1F6FB 4B9PA 2ETWA 1ZT4B 5BZDB 2DL2A 1X7SA 4JANA 2E9BA 4GUCA 1MRCH 4E9QA 2H3XC 5EC1B 4CVXB 1NGPH 4W70A 3VSTA 3ECWA 4NKOB 2NUTA 3UYPB 1U41A 3WTSA 4FQXB 2OMVB 3HG4A 5GSVB 3L08A 4F8TA 4PRIB 5GIRA 1P0SE 5K9QI 3HG1B 3GLAA 1QRNE 4DQOH 2X6VA 1RQ5A 3VD9A 3PG2A 5JNYA 4LHQB 1F3RB 1UT2A 4ZX4A 3NA9L 1GGUA 1R5WB 1TLKA 3OMZA 1PL3A 4FG6C 4QHNB 2CDEA 3TXAA 5ADOH 4ZO7A 2XIBA 2FQFA 9CGTA 4FQIH 4QIRA 4QR7A 3VWJD 4XBGA 5IUSA 4X7TB 4DCQB 3GEFA 3RWJB 3K8LA 4DVBB 3PHQB 5GS2D 2OYKA 1FFNA 2C9SA 4Y16A 4AX3A 2MNUA 5T5NF 2OX5A 3IU4L 3KHOA 3F83A 4BIKA 1U92B 4FHJA 4X4ME 5EOTB 2G60L 3LEXB 4QRAA 2E7CA 2A9AA 1A3LL 4PJ7F 3WE6B 1T7VA 5DEZA 5CINL 5FUCE 5TQ2H 5DSCB 2DLEA 4UQ2B 4MXQD 3OKKB 3JZ7A 3I75B 3PFQA 3QNFA 4MNQD 4P06A 5MEOA 3ESMA 2NZIA 4LK4A 2JKIS 3EJTA 4RMBA 4BSWA 2J25A 1IU1A 3ZQXA 1F1DA 5CFAA 1YEIH 1FN4A 4MQ7B 1NPJA 1EZLA 1CFTB 3R0NA 4JDEA 3F6IA 3K72A 1JV5A 2VL5B 2C1OB 5IMOB 3UBXG 4K8RC 4WFED 1J8HE 2BP3A 4X5RA 5ESVA 3C08L 1TJHH 4P9MH 3ZZLA 6FABH 2VZSA 3EO9H 3HC0B 1QSFE 3LYRA 5H4ZA 3GPEA 3FMGL 4GIPD 5E08H 1A9BB 4LCIL 4HPHA 4TUJA 4GBXB 3EDFA 4JKMA 2Z4QA 2WQAA 4J23A 3PLYA 1O7VA 2JLLA 4X5QA 4Z0BH 4P0DA 4HG4K 1BREA 3LKRB 1DJZA 5AYQA 2B0SL 4N8VA 1I4FB 3LRLA 3N1PC 4PCKA 1AGDA 2EIJB 1QABA 2X1OA 2DQFB 1NSNH 2WBJB 4FZ8H 4EBQH 5FECA 1B3JA 1ZHLB 3OD3A 3SDDC 4D9LH 2ICWA 2ZE0A 3VGDA 3SOBL 3WFHA 2NR6C 3BZ4A 1QRNA 1A6WL 4LDLB 4DP8X 3S8GB 3ZE1B 3V4PB 3BOVA 2YEVB 2AKRB 4GRLB 1D6EA 4RMWA 5E7BA 1K2DB 3DRTA 1ZK9A 1SJEB 1EJOH 2FIRT 3A21A 4JB9H 4OCYL 2O93L 1WCBA 2DDQL 3X17A 1KGXA 5KBPA 4D8OA 4OZFG 5C97A 3BUQA 1HQRA 4JL2A 1W9XA 1CXHA 1UD3A 4C83A 4BCYA 2VKXA 4RGNE 4PJXF 1YYLH 1L7TL 4LSSL 2PCFA 4KV5E 1KLUA 4JZOA 3UBXI 4Y19B 5JZ7D 3GSWB 1LEGB 2H3NA 1ZK5A 2P9RA 2ITCB 1ROCA 2OS7A 1YPZB 2NYYD 3FRPB 1ZA6A 3NDYE 1GC1L 1NEPA 3A0OA 2P8MA 4FFYA 1MAMH 4ONFH 4RLDA 5GJTL 3ZUCA 4CUCA 3OR6B 5HP5A 2DLFL 3QIUB 4OLWH 3W5NA 3BAIA 5KVMC 5E5MB 3BEVA 3DX4A 4P99A 1WRFA 1WVZA 2L0DA 3T6QC 4QF1B 4WNQA 4MMXA 3PIQA 1IM9A 3ZO9A 4PJIF 2P8LA 1IAMA 3N55A 5HY9B 2Y5EA 2KPNA 3MLYL 4TVSa 4QNPE 3GSNB 3N1GC 2J12B 4OFVA 2EC8A 3S97C 1E9OA 3D39E 4ZUVA 1BIHA 2ILLA 3VFTA 2BZCA 5B7MA 1DBKL 3DX9B 2OL3L 4DUVA 1B88A 1E28A 5AB2A 5DJZA 2QBWA 2J73A 3JWDH 2QR0A 1YN6B 2BRRH 1QSFA 3L48A 4BD4A 3VXUA 4WEBH 2WWKO 5CJ5A 4Y4HD 2MKWA 4WEMB 4ZS7L 2ZYHA 3V0GA 1X4ZA 2BFGA 3S0PA 3BDYL 5DD0L 1QR4A 1IM3B 2QEJA 3PWJB 3RX7A 1MCLA 1OD9A 4KXZH 3WBDA 3MRNA 4BK5A 4K5NA 2VDOB 1INQB 5J13B 3G6AA 1TMCB 1AR2A 1GS8A 1V7MH 3CN3A 2OR9L 3OM3B 3B9AA 4NSKB 2XJKA 2W9EL 2WNXA 1VPOL 5G2NA 4M7ZB 2AQ1A 1G7JA 4M3JA 3HHRB 3QG7L 3QWOA 1LQSR 4YSEA 1U93B 1FNLA 1AZBA 3ARPA 2FYYB 3T5WA 3T71A 3VXNA 1PX3A 5FGBA 1G7LB 3OKLA 4I5BA 2GG1A 5EU6B 4XP6H 4LVEA 1RK0A 2BP0B 3GMLB 4NENB 1YNTA 5HDWA 4Z7WE 2DLTA 1CO1A 1MIEL 4M6MH 2JXMA 5HHVH 5IQNA 4F57L 4WK4B 1XAKA 4MJIB 3O3UN 5FM8A 5IW3A 4KRPC 5HI4C 3RWDA 1LDPL 2Y6SC 3F12B 3Q44A 5K9OB 2Z31C 1IGIH 3T9WA 1ESOA 4CW1B 3T3PE 3FZUC 3E6FA 3MLVL 4GOSA 3B3IB 3PP3H 3FOLB 3TVMC 4OZ4A 3LKPB 4KUZH 4BFBD 3JTSA 2VTFA 1MW2A 2GB2A 4M6NH 4LHUB 4KZCA 2X87A 4YL9A 3ARDB 5PAZA 1TZHA 4QRRA 1KGYE 4GO8A 3T1FB 4L3FA 2ZXGA 4LXFA 1TSRA 4HS8H 3EYSL 4P5KA 5HJDA 4NJ9H 1XEDA 4EI5B 4KDTA 5DEFB 5DMYA 4KVPA 3T0EA 3QA3B 3ZY7A 5DMGD 3ZHDA 5HVGB 5J3HC 2FJUB 3ULUH 3TBWB 4LLMA 1NGWA 3D39A 1JNNH 3FW6A 5TFSH 3BIKB 1LYQA 1SN2A 3GXDA 3JV0A 2B8OT 3QHTC 5KJ4A 3T8XB 4IBUA 3PHSA 2PYEB 4DN4H 5JXEC 1NWOA 3FCSB 5ILTL 5JO5A 1DEEA 1KEGL 3ZYZA 2D73A 5GRXG 1CGSL 1UXSB 1S5HA 2VDRB 4XBPA 3ZK0A 4BELD 3LRKA 1S7XB 3FFCE 3E3QC 3SYQA 1U6AL 5C9JA 3AREC 3BWZA 1MHPL 3T0VA 1M3IA 1M2OA 3U4AA 1PSKL 4W9FC 4Z18A 4UM8B 4BBWA 1RUML 5KBLA 3ES6A 3ABGA 4ZUTA 3MBXH 5DA4A 3IMRA 2DQMA 2O6EA 2VIRA 2R1WA 1Y18A 1U3HD 3PU7A 1KIQA 4PVLA 1TVBB 4P4KA 2NY2D 1JGUL 3A67L 3SGKA 4FA8A 1P7QA 4Z7WA 5IFJA 2FO4B 2YAFA 3C5ZA 3CFQA 5I0WA 4TOYH 1HH6A 1E9PB 1S7QB 3UG5A 1DJHA 2VN4A 2Q10A 3NZ8A 1B0RA 1KJVB 3SPVB 4DT2A 3EJZC 3W9EA 4H40A 3FU6A 2PABA 4UT7H 1HAWA 5CGMA 3IFNH 5IF0A 3BZ5A 4MS8C 4XN1A 3OAUL 3ARGA 3F7YA 4O02B 4U1JB 5DFTA 2FATL 4YHPB 2NW2A 3CLFH 2DYPD 4XNYL 1MOEA 3U6XS 3NCFB 4FLRA 3RVTC 1U8CA 3TA3A 4EJ1C 5KYWA 4LCWE 2F8IA 4PGCB 5E6RB 4KDVA 2Z93B 1E5CA 5FYJD 7PCYA 3FSAA 2V2WB 4MMYA 1TETL 2ROYA 4OZFH 4QY8B 3KBEA 4JGJA 3L4YA 2W60B 2GITB 3NEOA 5BUGA 5KVEH 4WGVB 1NFDA 4P5RA 3GKWH 2UVEA 1EHAA 1CDHA 3IFLL 4M5ZH 4WTZA 5I0ZA 2AJUL 2VN3A 4UUJA 1UM5H 3ABLB 3O11A 4OB5H 1JNHB 4IKIA 4Y5YC 3H3PL 5AYUH 4JFHE 5ES4B 2LFGA 4JY4B 1T21B 2W5PA 4MCYA 1TTGA 2C7UA 1QEWB 1JZ7A 3JXAA 1OGAD 1TJGL 3KGSA 3PP4H 3WXWL 4X4KA 4K5LA 4FS0A 3P30H 3FFCA 4UTAL 3HI1B 3GSQA 3BSZL 4ZO9A 1NA8A 5KTEH 2I60L 1M3JA 1G7MB 3VM7A 2ZUXA 4TLSA 1AYOA 3LKQA 4ZOCA 5KZCD 5JR1H 2A4ZA 4LLDB 1YNTF 7CGTA 3L3KA 2VDLL 4GMTL 1LWJA 5TE6H 1C5DB 1EHKB 5DJXB 3MX0B 2XRAL 4ACTA 3RWEB 1AD0B 2VW4A 4B50A 4X7EC 3ETBF 4YLCA 1ACXA 1MIMH 4KO7A 3GINA 3PWUA 3OJMB 1UZ6F 2DF3A 1I7TA 3F7LA 3QNYB 5E70A 4CN1A 1AHWA 5KG9A 1MJUL 3DUHA 5AKSA 3SODB 1E6JH 2XQYG 5GQBA 1A3RH 4H8PA 4ZYKB 1UB5B 4D0DA 1OQOA 5K9KB 1JXDA 1QP1A 4NQDB 3MV7D 4R7XA 4ZS6C 4Z7OF 2PXYB 2XHNA 3O4LB 3WE1A 4U7KA 2Y2WA 3P4MB 1I8LC 2ZX8A 2W9DH 3IDMB 3P4NB 4QKXB 5FFGA 1KLGA 1BZDA 1FE8L 3HS0A 4L3EE 2C4FU 3T0XA 1QFPA 1W80A 2CGZA 2IPKA 2J5LC 3F58H 4QTIH 3B9VA 5BMFH 3KMDA 2WLHA 1FWXA 5T5FA 5JORA 1SBSL 1TJMA 1BPVA 3JVGA 4PJ8D 1S7VA 5C0ND 2EXTA 3DIFB 3VXSD 4LCWA 1H5BA 3UP6A 4HJJH 4MAUL 4K3EL 2AZAA 3QFJB 4PRHD 4WW1B 3ETBJ 4NPYA 3D3VE 5HDBF 4XPHL 4XC1L 2FEDD 2AXWA 2IFGA 1F11A 2WNWA 3PFUA 3H9ZA 4L9LA 1IC7L 1SN5A 2JIXB 3MLTB 4HUXA 4U1IA 2EC9T 3N2JA 2F68X 5D1QC 4Z3IA 2C9AA 3TBCA 5EFIB 1T66C 3K71A 3FH7A 4A7GF 3IFPA 1A7NH 5E5UB 2WXIA 4PRIE 5EBLA 4LRIA 4OF8A 3HG1E 5C7XH 5IVZB 3HRZB 4P4RB 4EOWL 1J5CA 4KNSA 2R0LH 1CFVL 1CXFA 1K9TA 1TTRA 2CRIA 3ZE2B 1WS8A 3V0HA 3VMPA 4ZFGL 3L1OH 3F5WA 4TS6A 3TU6A 1CGTA 4RMTA 4QRQB 1C5BH 3VACA 1PYWA 1JPTH 3RIAK 4NUGL 3TIDA 2A38A 3EZJB 2XFXA 3TFKD 1IKOP 2GHWB 1XAUA 3V10A 3ZVVA 4BA8A 3AT8A 1BVKB 3QDHA 5AUMA 5IMLB 2FQGA 4PM1A 4FQLL 3RWCA 4AVHA 3SKNB 3TH4T 2CM5A 3GXNA 1HWGB 3UABA 3EO0B 5DHVA 1IC0A 1RZKC 3NRQA 3ARBA 4FMVA 4WFHE 3I3DA 4FXTA 1INDL 5EH1A 4BQCA 3IVKA 3MOAH 2NXZB 4X9BA 1KBWA 3REWB 3T3PF 1TTFA 1DBMH 2ZOKA 3ML8A 3ZTCC 4F8NA 4JGNA 3QORC 2HJLB 1TQWA 4X8CA 2ESVD 3AS3A 3GQFA 3L17A 3K2MC 5EN2A 1EO8L 4JRYB 1I3UA 1JZGA 3KDMA 1NCJA 4ZUWB 4Q4IA 2DWEA 5F71A 3MXVL 4PJCB 1GTFA 3MRGA 1CDGA 2BIHA 4OCMC 4LAQH 1F00I 1NFDF 3AQYA 4YGVA 2XG4A 4QCIB 5BZZA 4K7PY 4GRMB 3MBEA 3RZCD 1W72H 3QIWD 1RZQA 2NY1B 4RFEA 4IRZA 1UD2A 2X40A 3VD0A 4NN6B 4UOZA 2VXUH 4M62H 2R69A 3D3VA 1GCFA 4X0KA 3UTQB 2TAAA 4JBSA 1OT4A 5BZDA 3WD5L 2WQSA 3JTBA 3PQYB 1UATA 2YS4A 1JDCA 3NDZE 4NKOA 3UYPA 4I8DA 5IW6B 4I18C 5I1GL 3GUTB 2OMVA 3MAWA 5GSVA 1N70A 4PRIA 4Z8FL 3HG1A 1NPNA 4CDHA 4P05A 3ZE1E 1G1KA 2A99A 4L5FE 4G9DB 4WJ5A 1UM4H 4UB0L 1ZY9A 5ETUB 4PS8A 1R5WA 5L6YH 4TL5A 4XP9L 2VH5H 1ADQA 1KCKA 4H20H 4F15B 5CEZE 5DRWB 5HYFA 3CLEH 4I13B 4R0LC 4DCQA 3RWJA 1N7ML 4DVBA 2F2HA 3PHQA 3UZVA 1N64H 4QJ5B 4JJ5B 1ND0B 3RI5F 2AEQL 1U92A 3CMOH 4JFXB 4Y19E 1AE6L 5EOTA 3QO1B 1ZTXE 3LEXA 2HP4A 1FC2D 1YPZE 3EXJA 2N3JA 3GI9L 4R9HA 2ITFA 5I5JA 4XCEB 3ZKMD 4BKLB 1T5WB 5DSCA 4DGVL 4H8HA 3OKKA 3GM0A 1E2WA 3I75A 4G6JL 2V2TB 1BZ8A 4JO1H 5DS1A 3VGBA 3WMPA 5KYXA 1JZFA 1MFEH 5CP7B 3EFOB 4YHOH 2V8MA 3WLWD 3ZYOA 1FL6A 2P47B 4HZ1A 3M88A 1HILB 4FLOA 4PG9B 2VN7A 2JKSA 4EMZA 1KCLA 2C1OA 1IC5H 4XCCH 4FLSA 4KAQL 4XN8A 5ERWB 4XMUA 3MLUH 2ZP0T 3PWPD 5GISL 5GSRB 1QNZL 4QI3A 1OAYH 1KTLB 1A7OH 4GQ9L 3W0WD 5B4MC 4IRJC 3HC0A 1I9JL 2RQ8A 2IMNA 2XBDA 3E8UH 4XXCC 1RULL 2FH6A 4ZMQA 2VRQA 1T1WB 4GBXA 1DQTA 3GMOB 1PVHA 4Q4EA 8PAZA 1P4IL 4H2CA 3L2MA 3JUZA 1OB1A 3QP3A 1OGAA 5F3BA 3HN8A 2DQJL 1IAIH 1I4FA 4G8GB 2FGWH 5GZOD 4XOAA 1R33A 4M7KH 3F3HA 2DQFA 1QBLL 2WBJA 1ZVSB 2CWRA 2N4IA 1ZHLA 2DEWX 2MPAH 1KGCE 1REIA 3KVPA 1UJ3B 1AXTL 4F7PA 5EU6E 1ODAA 1G7HB 4OGAD 4KFMA 2ERJB 3BUBA 1ETA1 3GTTA 3QQ9D 3V4PA 2AKRA 1TYEB 4GRLA 4EN3D 1MFAL 2WKGA 1DO6A