3DA0A

Crystal structure of a cleaved form of a chimeric receptor binding protein from lactococcal phages subspecies tp901-1 and p2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
132
structure length
132
Chain Sequence
NVVHKTGDETIAGKKTFTGNVEVNGSLTLPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cleaved chimeric receptor binding protein from bacteriophage
publication title Crystal structure of a chimeric receptor binding protein constructed from two lactococcal phages.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Viral protein
total genus 22
structure length 132
sequence length 132
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3da0A01
4IOSA 2BSDA 2BSEA 2F0CA 3EJCA 2X53A 1ZRUA 4HEPA 3D8MA 3DA0A 3U6XA 2WZPA 3HG0A 4HEMA
chains in the Genus database with same CATH superfamily
4JN2A 4PJHA 1V8HA 3GXDA 4R7DA 3RTQC 3O6MH 5IBLD 5IGXH 3U79A 4Y19E 1MAMH 1FG2B 2UWEA 4H0GA 2ADGA 1IKFH 4NZTL 4ZUWA 3QXDA 4WWKA 5ESQB 3I9GH 5C0CE 3WOVA 4WUUB 4OZHE 3HCVB 5A2KH 2FO8A 3ROLA 3ML8A 5C71A 2PMZA 2ARJB 3HG3A 2JK5B 4JN1L 3JXAA 2IXQA 5B7MA 1F11A 1Q9KB 1T0OA 1ZA3A 2DQTH 3DGGB 3RZCA 3WSQL 5KUKA 4I3RH 5E94A 5E9DB 5FGCB 4DEPB 3HZKA 3ULAB 1G4RA 4FG0A 1S7XA 4I89A 4Y8AA 3OQ3B 4H8PA 1DQVA 1T6VN 1EIBA 4QRAA 3PL6B 4AJYV 2DMGA 3GEWB 3C87A 1WEJH 4DEPC 5DJXA 1ND0A 5T1DL 2XTJC 1I4FA 1KJ3L 2AJZB 1UJTA 3QJHA 4HUMB 5I1DA 3GB7A 3SOBH 3T9WA 4OLWL 1KULA 2IC2A 4PMFA 2G75A 3HPLB 4N8VB 1G7PA 1VFAB 1IMHC 1QQDB 4AC4A 4FTVB 1FL3B 1RZ7H 4YXHL 4WO4D 5KVFL 4QNPF 4G2AA 3BKMH 1FYTE 5LDUA 1S9YA 3BSZA 1CDYA 3IJ7A 1D5IH 2P43B 2J8UF 2G5UA 1ADWA 2OM5A 2AKRB 5FW7A 3WDJA 3EJRA 3AY4A 4L0YA 5D8JL 4AENB 3NIGE 3BGFC 4YR6B 1QFUH 3C8HA 4PJ9D 2GB2A 3A6CH 3NFNA 2OK0L 1DJWA 1OT1A 1MY7A 1BHGA 5D7LD 1YPZB 4LSSH 1B4TA 3IU3A 3VRLE 1XB3A 2DW5A 1CDUA 1PFOA 1R5WB 4PJBB 2QQKL 2EUZA 3PDOB 3QFJA 4J23A 1DE4A 3D69A 3RTQA 2DF3A 1WTGT 4G6ML 3KWUA 1WBXA 3OB8A 4PAZA 3WUZA 4JUSA 4WI5A 1R5VB 1DDTA 5C0EA 2H7WA 4EN3D 5HHPA 4ZS6D 2X7LA 3EO1B 3GEFA 3NIDB 3EJUA 1FG2A 2F53D 4OD3H 4P2RD 4ZMPA 2EIMB 5TPWL 1I8LC 4M5ZH 4K5MA 3EKCA 4F20A 5ESQA 5KSBB 4WUUA 5IMLB 3HCVA 3F65A 3WNNA 2GFBB 2YUZA 3ECUA 4QHMA 3MACL 2I26N 4KUZL 3ASNB 2JK5A 4R96B 1GGIL 1H3PL 4CC1A 3PP4L 1LJMA 4Y9BA 4QXWA 2V2TB 5KW9H 3QWQB 1GZPB 4P23D 1Q9KA 2FVNA 5IY5B 3FUMA 3DGGA 4C59B 1LNUB 4J6RL 3SIKA 2QPDB 3F6LA 1E9QB 3U6XS 4PRPB 1U4EA 1BGXH 2WSPA 3GSNH 4MB5A 5AZUA 4L23A 1BVZA 1KCBA 1LQBC 3PL6A 1Y6NR 2BY2A 2EIEA 5TFSL 3INOA 4FXGB 4KV5E 3LZNA 3AQZA 2DTMH 1UGNA 4OR1A 5EFIB 2VXVH 1NEZG 1CTNA 3ZVVA 5C07D 2R0LL 2CLZB 2MEJB 5FW6A 4IU3B 4IK6A 4N6RB 4KAQH 2GBTA 1UWXK 4B0MM 2APTA 1JF1B 5CZVL 1CURA 3HPLA 4PIRF 1U6AH 4N8VA 4RMUA 1VFAA 3QDJE 1AR1C 1KEGL 1QQDA 4G9FB 3BKCH 4FTVA 1JI2A 1FL3A 4HWBH 4ETQA 2HVBA 1V3LA 1NAKL 4CSTA 4NUQA 3SO5A 4KUCF 1NIBA 4O00A 1M1SA 1ACYH 1UB6B 3ETBF 2F8XC 2DMHA 5ICUA 4P59L 2AKRA 1RUMH 4FQJL 1JVKA 2J25A 4BRJA 1RZGB 4AENA 1QTPA 4YR6A 2IF7A 1V54B 5CUSH 1NCOA 4Q56A 3UTSE 1SF3A 4HKJB 1BP3B 4K55A 4WHYG 3UBXG 1BFVH 1MREH 1TT6A 1YPZA 2J8HA 2FQFA 4YVUA 1JVLA 4OLYL 4Z0BL 2WUBH 1HJCA 2V4LA 5E9NA 1YZZA 3I9AA 2LR4A 2MMXA 1BQHG 3QG7H 1R5WA 4LSQL 4PJBA 1C5BH 4YNYA 3VO0A 3TFKD 4A04A 4UF7C 4UILL 3TIDB 3UYRH 5I19H 3UOAB 4H8HA 2E3VA 4BGLA 4JQIH 1DQLH 4KRPD 5D2LB 5CGBA 3VDAA 2AQ1A 1M7XA 2BVTA 1XIWB 1NOAA 1CD8A 1CFNB 1UASA 1UUSA 2OS7A 1J9RA 1QKZH 4AL8H 3VGEA 1R5VA 2KC0A 2CK2A 5KVFE 4DGUA 1J0IA 2OJ1A 3LRGA 4FNQA 4CDGC 4OGYH 1OTUD 3EO1A 1PSKH 1C9SA 3NFSH 4O2EB 1XIWC 3T0WA 4Y4HB 1GC1C 5DZOA 4BK5C 4LSRL 3FCSB 4NNPL 3PU7A 4JM4H 4L3CB 5IMLA 4H1LH 2K78A 3A24A 2VDPL 5IEKB 5C0IB 4PB0L 1NGZB 2VXTH 1QYGL 4U6YB 3UTPD 4F8QA 2MCPH 1TZGH 2VDRH 1UH3A 4R96A 4OQTA 3NIFF 5EZIL 2JJUA 2V2TA 2HRPL 1GZPA 4K3GA 2DQUH 2X89D 1GAFH 5LXGL 4JFWA 2CCVA 2B59B 1X5LA 4WEBL 3WAJA 1E9QA 1E7UA 2J21A 3HG1A 4PRPA 5AW3B 1PF3A 3ZHNA 3VGHA 2OJEB 3MLSH 4LLWA 2PTTB 5J57B 3ZY7A 2F58L 2Z8RA 2P42B 3ZK0A 4B3EA 3U4BH 2ZUVA 4FXGA 1K2DA 3U4KA 1Y6KR 5GS0H 3BRDA 3C09B 4N2BA 4S1DD 1AC6A 2KPWA 2VWEE 3FO2B 1WBYB 4GXVH 1JZJA 2CGZA 4IU3A 1GHFH 1SN0A 4N6RA 1P84J 1FNEB 1OB0A 3ESMA 1JF1A 5DMIL 4M43H 4OU3A 5JW4Q 1DFBH 3U2JA 3C09C 3NSDA 3FT2B 3DVFA 4RZKA 3P4MB 3H2PA 5IHHA 1I8IB 3D0LB 2XC8A 3A47A 3SYPA 2ZXQA 2DI8A 2KT6A 3HW7A 3EJPA 2PYED 3A3YB 3GIVB 1IZKA 2AJXH 3VXMD 1AR2A 1X44A 4FFZH 2C3HA 3BJ91 3CZLA 3PHSA 5I6KA 3E80A 5BZDA 2B8OT 4X4MA 1B0RB 3EGXB 3NCYP 1UD5A 1RZGA 3S37X 3U2SB 1CQYA 2DEYX 3EYUL 1ORSB 5BRZB 1SXBA 2VOTA 4NPJA 2C4XA 3DMMB 2JB6B 4FNUA 4FG4A 4HKJA 1W6WA 4ORZC 5KANG 4FHJA 4ZX5A 5A1AA 2DV6A 4ADGA 4DAGH 3THMH 3I6KB 5IFHH 1CBJA 2DYPD 3S3BB 4FQHB 4GXUN 3DMMC 4KK6D 1G7LB 3SY0B 4PJ6A 3SPJA 3ZE2F 2R9HD 2XN9B 4O58L 5LHDA 1U8QA 4ONGH 4O4YH 5C08B 3MNDA 4GSDL 4AQOA 3FUIA 5D2LA 2E6JA 1XIWA 2JE8A 1CFNA 4OZIA 4BK5A 1KYUA 3ZHFA 1YEHL 5J5EA 1PMYA 2ENSA 4B9JA 5CP7B 4A7SA 1WT5A 2ZXWB 1SY6L 4Y4HA 5F7DB 1QPXA 5HGAA 1R1CA 5I30H 3FCSA 1LK3H 4OM1L 1T03L 2WXPA 2BP8A 5IEKA 3PDGA 3VI3E 5C0IA 4XVJH 1NGZA 4LCVA 4U6YA 3WV0A 4U3XA 4KZDL 2WCGA 4UDUB 4ZSOE 4MRBA 1X4XA 5EBWB 4KY1H 3QUZC 1DBBL 3AABA 2XT1B 4XN4A 4F1SA 5T5FH 1U3ZA 2B59A 4K3EH 3DJZA 3X17A 1UC6A 1F3DH 2FX8H 5HJDA 2OJEA 4F7PA 4LOVA 2PTTA 4PP2B 1A7BA 1BEXA 4G5ZH 4ZPTA 2NZ9D 3T04D 3BSGA 1LGVA 3LKRB 4JB9L 4N9OB 3VMPA 3TV8A 5CCKL 4GBXD 2OYMA 5E2WH 4K4KA 1WBYA 3PP3H 1IAIM 3HTLX 4BFGA 2G3MA 2W9LA 1AO7D 3DX3A 1FNEA 4FABH 2XYBA 1L6XA 3TWYA 4LARL 4RGNB 1EJOL 2F18A 2HX8A 3FT2A 4FLHA 3VYNA 2XIIA 3JWNE 4CU8A 1JJUA 3BW9A 1I8IA 3D0LA 1AZVA 3RFZB 3L3HB 4RGNC 2LHAA 1JZ4A 1SDDB 4R4NC 3GIVA 4RETB 3GLZA 3IFLL 5I1IH 3DWTA 2V17L 2HJKB 2X40A 2BNUB 3O3AB 2IGLA 2XZAH 3C2AL 3E3QC 3D33A 4GSUA 1WG3A 3EGXA 4WNJA 5MEQB 5FM5M 3RFZC 5L8JB 5SWZD 1ZJBA 3U2SA 4MB1A 4JY5L 5BRZA 3OL2A 2ISDA 3DMMA 2A73B 2UZIL 4EI0A 5IESL 4UOZA 3RIKA 4OCXH 4XXWC 3OQRA 5L4IA 4O02L 2Y3AA 2JCWA 1YJDL 4TQEL 3IM1A 1YC7A 3I6KA 2C3XA 3GXUB 5FV1L 3N3EA 4FQHA 4NQQA 1JGUH 3B56A 1G7LA 3SY0A 5AZEH 4Y5YB 2XN9A 1XGRB 3HC2A 2WIIA 4GUCA 4KDWA 4KKCC 4G8IB 3UTPE 2A9NH 3ENEA 5C08A 5C0RL 2WGNB 4FCHA 1L0XA 4X8CA 4TLTA 2W65B 2DBLH 1X9UA 2VC2B 4Y5YC 4ICWA 4R2GD 4ADJA 2BY3A 1OAZH 1PKOA 3BQVA 3HC0B 3N1QC 3L2NA 5CP7A 4Q9QH 1ZTMA 4HJSA 4HF5H 1TTBA 4ELKB 3S34L 2BWIA 1ULVA 5F7DA 4BHUI 3LQZB 4P46D 4OZGE 4JO4H 4YGVB 4H88H 3SCMB 4OD1L 2V37A 3D2UD 3OXSA 4KX7A 2J1XA 4MCNA 5FGRA 4A1RA 4LSDA 5MEOB 1G7QB 5B38B 2EZ0D 4F57L 4XC3L 1ZKAA 2P5PA 3IGUA 4UDUA 3SCMC 3OAZK 3W9DB 3QQNA 1DUYB 3I75B 1TYRA 2DIBA 3IGFA 1N5AB 3CFMA 3IPBA 2X2HA 3EHBD 3GBMH 3HI5H 4YK4C 3K46A 1S5IL 1PVHA 1G94A 3I2CL 3UMTA 1CFBA 5IFJB 3NIGF 1PX4A 1IFHH 5D7EA 4PP2A 1HVXA 3ARGB 4HAFA 2WZPA 2Q8BL 1H8OA 2ADIB 3VXME 3O0LA 1I8AA 3P40A 2IBBA 3DX8B 4M6NL 5ALCL 1O9WA 4JR9L 5I0WA 1GTNA 4NM8H 3ARGC 1QLEB 1VGKA 5BS0B 1J1XH 2ICWA 3N04A 5ERWB 4OLUL 2NNCA 3QA3B 2F7OA 3AC0A 1E6JL 3IDGB 4PQXA 4CAGA 1FFTB 4X98B 3HLKA 5E6IC 4RQQB 3D1MC 3HE6D 3RFZA 3L3HA 1JYNA 3SE8H 2NYYC 5IJDC 1TQVA 4S10A 4XMXA 1IM9B 2OTWB 2HJKA 4ZMZA 4M4RB 4S2SB 2BHYA 3O3AA 4LVOB 3TASA 3ZDZB 2H32H 5MEQA 1YQVH 2EYTB 1MI5D 2HWZH 4WCYL 3HN3A 1ZA6A 4X7DC 2IGFL 5CF3A 4QWWD 2A73A 3CFDB 2ZCHL 3IPFA 1NTDA 3H3PH 5CR8A 1PJ9A 3QHFL 5AENA 1YO4A 3NBNA 1E50A 3VI4B 3GHEH 3MBEB 2Z7YA 1J8HB 1MNUH 4FFYL 5GJSH 3FTZA 5GJTL 4HC1A 3NACH 3EDEA 1CL7I 4Y5YA 1XGRA 4Z78B 1RURH 1G5AA 4PJFE 4B0MB 1L7TL 4KNUA 4WGKA 2P5EB 1HKLL 3MBEC 5F9DC 3WTSA 3Q2VA 5DD3L 3HLAB 1SM3L 2Y3NA 1OD7A 2W65A 1LP9E 1YEGL 4X6BB 1UM5H 1EXUB 1SJHB 4NO0D 1I9RL 3HC0A 4Q97A 3A5VA 1JGLH 3DIDA 4ANVA 4ELKA 3DHMA 1F3DJ 1NWPA 2ZWLT 4HX1B 3VW3H 2DMKA 4JHVA 1G9NH 4AMKL 3FB8B 3LQZA 1TQTA 4YGVA 5C0FB 3SCMA 4JY4B 5LKNA 2VUKA 1XH1A 3FRUB 5DD1L 1W72B 3FB5B 3WHE0 1HQ4B 5MEOA 3OLGA 2O26U 5JA9A 4AM0Q 3BUIA 3W9DA 1HXMA 1AO7E 4JEGB 4UI2A 1DUYA 3I75A 3LKSB 1FIEA 1N5AA 2YUWA 3MMEB 2AEQH 4K5LA 5EBLB 2R39A 1SQ2N 1ZVSB 2XTLA 2A74C 1M7UA 3FO9B 1CF1A 1ECZA 3JZYA 4KI1A 5KBKA 3P0GB 1WWCA 5CCJA 3ARGA 4J27A 2ADIA 4MTMA 1NICA 5CNHA 5MHSE 2JQAA 3DX8A 3CXHJ 5D4IA 4IHOB 4AY0A 4HS8L 1NEPA 2V9UA 4DEWA 2DQHH 1JS4A 3EFFA 3FONB 3MLWH 4N4YB 2ED8A 1IUZA 1MXDA 2IBGA 5BXFB 4JDEB 4D8OA 5E6IA 5BS0A 5ERWA 3PJLA 3MTXA 4C55A 1MFAH 4OLZH 4WI9A 3ULUC 1DCLA 1UVQB 4FNPA 3QA3A 5JIDA 1G4MA 3IDGA 5KVEL 3NJKA 3ZU8A 5HDQH 5KYUA 1CGVA 4X98A 3FUFA 3LPFA 4HKXB 4DN4L 4RQQA 2ERJB 2YJLA 3BZ4B 3ZBMA 3MBXH 3H2QA 1MWAH 5IK3B 1IM9A 2NY4D 1CGSL 2OTWA 4S2SA 3BWSA 4YO0B 3KR3H 2LFEA 1DANT 2BWDA 2EYTA 5HJGA 4RVBA 4YE4L 2LT9A 2GUOB 5HDOA 2IAAC 3CFDA 7FABL 1DN0B 3QQDB 1DJGA 1D5ZB 4KKPA 5CJOL 2Q8AH 4GLRH 3VI4A 3MBEA 4Q58C 1TJHH 1PZ2A 2X6BA 5D6DC 2IV9A 2VXQL 3QBTB 2UUDH 1JRHI 3CBKB 3UAEA 4Z78A 5E23A 1ZVHA 2ZJSH 2MKWA 3PRZA 2GBAA 4XVTL 5TTRA 4ZQTA 4G80B 1AS8A 2P5EA 1CF8L 1RIHL 5GGVH 4J3OC 3HLAA 4X6BA 2X1XR 1EXUA 4X5RA 3SBRA 5I1LB 1SJHA 2VRAA 1C16B 2B08A 4HWNA 2PWGA 5MI0C 1JGIA 2IAMD 2J5LB 4WFEE 2DJ4A 4HX1A 3OZ9H 1J0YA 2R4RH 3FB8A 4NHCL 4ZX4A 1WFOA 3ALXA 5C0FA 4FQ1H 4JY4A 2ZONA 1JV5A 1I3RB 4GMTH 1SLWA 3FRUA 4GPVA 1W72A 4OJDH 2J5LC 2WKLA 3FB5A 3EYQC 5D1QB 1HQ4A 4DP0X 4EUPG 2A74A 2CLVB 2HX9A 3FT4B 3N55A 2N4IA 2CE6A 4DOHE 1X9LA 1QOKA 4PGCB 4EJ1C 3LKSA 3HUJE 3MMEA 1B0WA 2YRLA 5D1QC 5EBLA 1ZVSA 4WGVB 2QLYA 4M1DH 1U3HC 2NUTB 5C8JB 3KVDD 1S7TB 4KVPA 5DHVH 4BBWA 1VESA 4GSQA 4UQDA 5DD5H 1E65A 1N5YH 3CDCA 2VLRB 3HFFA 4F58H 4PTTB 1EK3A 1WITA 2JKNA 5KVGE 3KPRE 1KN4L 4IHOA 2WXOA 4N26A 3NIFB 4PRID 4LP8A 5ITBH 3FONA 2PLTA 4RNRB 5F9WB 5BXFA 1WFJA 4JDEA 3ROOB 2G2RA 3JV0A 2DQJL 3ZE1F 1NCWH 4IBSA 3ZTNH 4QJ5B 4F2MB 2Y5TB 1DJYA 3V4UL 2UY7B 3MRNB 3FQXB 4HKXA 5IB3B 3RWEB 1X5MA 2EDEA 5EEXA 4K9EL 1AZUA 3MSPA 5IK3A 1IJ9A 3KPNA 3GTNA 2EP6A 5IVXF 1D9KD 5CAYB 4YO0A 1HESA 1F02I 4V1DD 3N50A 4TUOB 2XTJD 2Y06H 1R4XA 5H4YA 4DTGL 4F9PC 3VYPA 3WU1A 1WRFA 4U7SA 4XWGH 2UVEA 5DUPL 2GUOA 2IOOA 4E41B 1F4YL 3VI3F 2YBGA 1DN0A 1DVSA 3QQDA 1HHJB 5I6LA 2YA2A 1D5ZA 5MEPA 1ZAGA 1KDJA 3LRHA 5GZOD 4GXUM 1Q1JL 5CWSB 3EJQA 1Q90A 2EIJB 3LSOB 1KLUB 3MV7B 4HW6A 5TF1H 2VLJB 4XOEA 4G80A 4M1GH 2A9DA 1X9QA 2DLEA 5BVPH 3TEWA 4PJ8B 4BKSC 5I1LA 5D7IE 5CKAA 1C16A 1U8HA 3ZZ1A 1XXDC 2MPAL 3DX4A 1I82A 3EOBB 4Z1PA 1A6UL 3IGAB 4AUYA 2ZOWA 2I9LA 4WFFD 1WCQA 4XCCL 2J6EH 3ARDB 4PCKA 1AFVL 1JMXA 1OL0A 3NH7L 3T4AC 4KJWD 5HJ3B 1I3RA 4TNFA 4KROC 3JYBA 5ILTL 4KC3B 5D1QA 1SYSB 3ARDC 3QAZC 3T6WA 2CLVA 2VZVA 3FT4A 1U3HA 2ADFL 5I1KL 1J87A 4PWJA 4L1SA 4NLHA 5HPOA 4PGDB 1F1DA 3L4XA 2JSFA 5AB1A 3IBEA 5KEZA 2HKHL 3KLAB 1XDTT 4NO2B 5C0BE 4I0PB 3O6LL 3GM0A 1GS8A 1WAAF 4JO2L 4N0CD 1F97A 1FVCA 2NUTA 5C8JA 1IQWH 1S7TA 4FYTA 4X5WB 1QSEE 1BCIA 4YDVA 3KJ6L 3U83A 3O8XB 3BXNB 2R8SL 2VLRA 3KEDA 4JGJA 2OI9B 3U9PL 1S6NA 4I0PC 3VD7A 5F7KC 4PTTA 4OJFL 2PKDA 2R56H 3AM8A 5F72S 4U7KA 4RNRA 5B1JC 2OI9C 3VA2C 3ROOA 4XMLH 1BXXA 3QUXD 2MOQA 3OZKA 2DQCH 4XMPL 5GHWH 5E8OB 2Y5TA 5E56A 3WEAA 4F2MA 2UY7A 3JYCA 3HC4L 2DYRB 3BESR 2FD6H 3MRNA 1G7JB 4KJPD 4F9PA 2VQ4A 4OLVL 5IB3A 5E5MB 1DVFC 4K3JH 3RWEA 2KDYA 4RA0C 4W1TA 3ZO0A 1P5VB 4PRHB 5I15L 3BKYL 4D9LH 3HG1D 2Y22A 3LS5H 4CMMB 2MIZA 2VCOA 3ZW3A 5GISH 3MLRH 4TUOA 4HXAH 3ZT5A 1YECH 2P5WE 2J4WL 4NQDE 3K6FA 4JM2D 2XFGB 4YSDA 1I1CA 4WJG3 1CUOA 2IALB 4ZMAT 2GC7C 4E41A 1PX3A 3QPQD 3FTVA 4HPYH 4TULH 3VXOB 3IAGC 1AR1D 1HHJA 4FLOA 3KS0H 3U1SH 5EUOB 1R3IL 4PJGE 4R6UA 5TJWK 3BISA 1A14L 1KTRL 1U3YA 1N19A 5CWSA 1FAIL 3MV7A 2IIJA 4JMNA 1KLUA 4F8LA 5BUGA 2E9WA 1DSFL 2FEEL 1MDAA 2VLJA 3FH8A 4QXUH 2D4FA 2J2ZB 5HPMB 5D72L 4JGUA 1I7ZB 3X3FL 2BSRB 1UCTA 3GLEA 1U8IB 1BVOA 4NZTH 4PJ8A 1Z9SA 1XD0A 3FCTB 4MKTA 3AGVA 1IGCH 3QI9B 3EOBA 1FGNH 3P0VL 3TO2B 1UM6L 1IBDA 3IGAA 5E70A 5ESAB 3WIAA 1H3VA 1G6RL 2FTAA 2ESVE 3ARDA 1J12A 4ZMNA 4LESA 5I71B 1T83C 1KXQE 2W9DL 1RZJL 1TTGA 4FZ8L 5HJ3A 2A6DB 1FNSL 4ISVB 3S37L 4OZFB 3IFNH 5I1GL 4MAUL 3Q13A 4BQ8A 1SYSA 1P4IL 4GLRI 2HB0A 3EG9B 1MFBL 2KHAA 1MEXH 5I71C 3C5ZC 4Y2DD 2DQIH 3P4NB 4LEXL 4PGDA 1BJ1J 2BIPA 4PJIF 3KLAA 4RMBA 2YPLB 5T5NF 4NO2A 4NBZB 4I0PA 5D1ZI 4URKA 5J56B 4HT1H 3QDMB 1U95B 4M7JH 4DP8X 4X5WA 3U48A 1FZMB 2CRYA 35C8L 3IXAB 1UYWL 2VXUL 3IN0A 5BV7H 2FT6A 3HB3B 3O8XA 1OK8A 1QHPA 3BXNA 3EGSA 4H5SB 1ID5I 1JTTA 2AK4B 1NMCB 4OLWH 3SDAD 3VWJD 4OF5A 2WLLB 2H1PL 1IM3B 1BZ9B 3D3VE 4H20H 2Z0BA 1DBJH 3HB3C 2Z8WC 1EJ6A 1NMCC 3K71A 2Q10A 2HLAB 1CICC 2VH5L 4PJFF 2B14A 5GRVK 4HIXL 5DZJA 5TK4A 3WY2A 4BEIA 4JANB 2CR3A 4EVNB 2ROYA 2VO8A 3W56A 3BD5A 5D8JH 5E5MA 1P6AB 5JXAH 3QWRD 3WXVL 2Q86B 4V2BA 1CYWA 1P5VA 4PRHA 3OHMB 1WA0X 4OCLC 4XBMA 4OAWB 4BV1A 1BQRA 4IU2B 4CMMA 4J28A 1URZA 2X0UA 2BSEA 3TEZA 3LH9A 5F0JB 2IALA 3NUKA 2Y6SC 2NY0B 5F88B 4G1MB 5F93C 1FWXA 5AL0A 4JKPL 3CE1A 3VXOA 1MPAL 3UTTD 2B7DT 2ZUXA 4JG1L 4K23H 4XVSH 2E9IA 5EUOA 1UD3A 1UFGA 4L4TE 1BFOB 3BC9A 4EDXB 2NY0C 4E9YA 5KVDL 4GRLB 2EECA 3D4ZA 2DLHA 5J0BA 3S88L 3ZMRA 4ZUTB 2YARA 5EF0A 1WUNT 2J2ZA 5HPMA 1I7ZA 2XPGB 2BSRA 3BVWA 5E1HB 4PVNA 3FHEA 4P4RA 3SBWC 2EXSA 2CIIB 2FIKB 1U8IA 3PHOB 1UJ3B 4UAHA 3VFVB 3F7QA 3FCTA 1ACZA 3QCTL 1E8ZA 3GSRB 4FN0A 3TO2A 5E6ZA 1DQDL 5ESAA 5BO1L 4KVNL 2X4PB 5GRYA 5HDBF 4IRZA 4TL5A 1H3PH 1UJ3C 1UH2A 3AITA 3ARTA 3DMMD 1F90L 3EJSA 1HK6A 3C5ZA 4FFWC 5EOTB 2YD7A 3AB0C 4BK4A 4JPVH 2A6DA 4NN6B 1CN4A 3I3DA 4OZFA 4Z7WE 2PPEA 4MJID 3EG9A 1MCSA 5AVXB 1RKRA 3P4NA 4U6TA 4GG6E 2YPLA 5BRPA 2LU5A 3QDMA 1Z5HA 5AVWB 1U95A 3WELA 3A6BH 3VACA 1S2EA 4A6YL 1FZMA 1IILE 1ZLSH 3IXAA 3WIFB 3ZDXF 2YRPA 3WIHH 4F80A 2GSMB 4H5SA 4OB5L 2IWKA 1CPUA 2AK4A 3FQRB 3T2OA 4OY9A 5DS8B 4LDEB 3WFBL 5CZVH 1NAML 1SLUA 4ODHL 1XGUB 2WLLA 1E5CA 1IM3A 1BZ9A 4UQ3B 1KEGH 2NXZB 1I1RA 2AGJH 1DEEB 3PGCB 5EO0B 4Z18A 3QUZD 3FCBA 2VDML 3GTVA 2GJ6E 3MU3A 5KS9B 1Z32X 5IB5B 1VSCA 3QPXH 5C3TA 2HLAA 5I74B 3GBDA 5DR5L 4C56B 1T20B 1NCDH 1F4WL 3QUMB 2NXZC 3PXHA 2DBJA 4RESB 4ZX6A 4JANA 4P59H 3VGAB 4EVNA 3SDCD 5D4QA 4ZFZB 1N12A 3D07A 4FQJH 5I74C 2IBZX 4MNGE 5EO9B 4DH2A 2Q86A 1KY7A 3DO7B 5FIEA 2NYKA 1B4JL 1RMFH 2BPBA 1QNZH 2Y0SA 3IDMB 4OAWA 5ABAA 4IU2A 1KIRB 3VXSB 4AGPA 4NWUH 3VGAC 1EEZB 3OKLB 2ITEA 1YNLL 1B0IA 4ABQA 5FEBA 3NT0A 4OLYH 4Z0BH 5I0YA 5F88A 1Z66A 4G1MA 4M7LL 1U91B 3T2LA 3WGUB 1EEYB 1HSBB 2J43A 3OGOE 4APXB 1OP4A 1KB3A 3K1DA 1BJMA 5FS5A 2XHNA 3QVAA 4IRJD 1PIFA 1I7RB 1M6OB 4CSZA 3CXDL 1BFOA 3RKPA 5SWSB 4EDXA 2XQBL 3DROB 2TAAA 3MRBB 4RGND 3S2CA 4OI9A 4GRLA 3SBWA 1Y18B 5IQMA 4R4ND 3P4LA 1B2WL 4ZUTA 1A22B 1NLBH 1BF2A 3IMRA 4ZW5A 1JPGB 4X80L 2CKBB 2XPGA 4IKIA 2W1NA 4ONFH 4YDKL 5ENWB 4LLUA 4X6CF 2FIKA 3E0GA 3PHOA 1UJ3A 4LSRH 3SPIA 3KHOA 3VFVA 1J88A 4NNPH 5LAPA 3GSRA 3W11D 5DS1A 3ZKQD 2MOVA 4XXDB 5LWYL 3CZEA 1EMTL 1QBML 4LBEB 4NN7C 2X4PA 2VDQB 1WIUA 5J89A 3MLYH 3JWNH 4GS7C 4XMWA 4MRCA 5T1MB 5EOTA 5KSVB 2FNWA 3APMA 1OAUH 4Y5VB 2X2YA 5GS2D 1QZ1A 1ZLEA 5LXGH 3WFDL 4X6FB 1GGCL 5HI4D 3CV5A 4DQOH 1E4HA 2EH7H 1O5PA 1T4KB 4LEOB 1MQKH 4FHBD 4ZFFB 2P48B 3TH3T 2OXHB 4JPKL 5KVDE 3L7FB 2F58H 4DVRL 5DFWH 4P4KD 3P3TA 1AD9B 2ZD0A 4OBRA 4HIIB 2HH0H 2VKXA 1UA3A 3MKGA 2P28B 4OTXH 5GGSB 5B1BB 3ZRCC 1YN6B 1P1ZB 2BFVH 3RVXD 1M7IB 1RFDH 4MLSA 3JWDH 3WIFA 3IDUA 3S35X 5EV7A 4G6AD 5DS8A 3CK0L 1ONQB 2W60B 2DWDB 1XGUA 2D3JA 2QVIA 4K2UH 5CO1A 1EHLH 1EH9A 4UQ3A 3SCMD 1DEEA 3PGCA 5EO0A 1OCCB 5KS9A 5L2KB 3GHBL 1A6WL 5IB5A 3TO4C 4C56A 2ZUTA 2CH8A 3TZVB 4GAJL 4U1LB 3HNVL 1T20A 2CLRB 3TVMB 2WKOA 2AJVH 3QUMA 3RPKA 2DMCA 2ZZUT 3UDWC 4XB3A 3LEVH 3LB6C 5MENE 4ZFZA 4FNLH 2B77A 5GGRB 5K9JH 3MA9L 2OR8A 3TVMC 1H6TA 5D7IF 4MMZB 1URLA 3BHBB 3S36L 4EXPX 3DO7A 4G8GD 3NDYE 3FQ4A 3IDMA 4N2FA 1RHHB 1KIRA 4KRNA 1CLZL 3VXSA 4JFZL 4OCMC 1EEZA 4Z76B 2WVUA 4FL4B 1AQKH 3OKLA 1HZKA 4Y8DC 3CG8A 2W0FB 1CQKA 3WD5L 5A2JH 4E9WA 5JW5B 3U7YL 1EEYA 1HSBA 3ZE1B 4APXA 1XV8A 2V9RA 4DGIH 4O58H 4H1LG 4OVUA 2CG9X 2EXWD 2RIKA 2K3TA 4G6FB 4JFYB 4U1GC 4U1MB 4LKXB 4H8WH 4ZNEE 3IDYB 1I7RA 1M6OA 2A6IB 4GSDH 5D7HA 5E6ID 3SJVB 5BS0D 5SWSA 3MRBA 3MJ9H 1Y18A 4Y89A 2NYYD 2ZKHL 1YEHH 4HAGA 4GQRA 1MW0A 5IVXB 5DD0L 4Y4KB 4ZMYA 2RCSH 1JPGA 4PWIA 2CKBA 2WBJB 5C9KA 3BZEB 3H7BB 4HIPA 3P9LB 5CILL 5ENWA 3U2IA 4ZAKD 1IAMA 1TO5A 4DIXA 3QUYD 4TTDC 2YGVA 3PJNA 4AQAA 4JBSA 4Y4KC 3QQXA 1CXLA 3O2DA 2WBJC 4NDMB 1R0AH 4MAYC 3RHWF 4LBEA 3SZKC 2WANA 4U1HB 4JFHE 1DQML 4DCQB 5L8KB 5DJ2B 5T1MA 3OPUA 2HRGA 5KSVA 4NT6B 1DBBH 4XMKL 3IU4L 2J5WA 2GKIA 4W6YB 5KJ7E 1EDQA 4LOUC 3WN5B 2OULB 4PJEE 4MZ3A 1T4KA 4LEOA 3CVIH 3ZKXC 4ZFFA 1MJUL 2G3ZA 1YYCA 2OXHA 2YMTA 4KKNA 3L7FA 4YHZL 5DZLA 4YLCA 4NJAL 5D93B 4TSBL 4Y4FB 5E9AA 1WHOA 1JGDB 3GWJA 4CGTA 1AD9A 5AWNL 5HVFB 4HIIA 4JB9H 2J44A 3WN5C 4G6KH 3HG0A 4HZ1A 1YN6A 1P1ZA 1M7IA 1IBZA 3CFKB 4K7FB 5D93C 4JL1A 4LARH 1ONQA 1EJOH 5J12B 1CI5A 1TZOA 3AY2A 2W60A 2DWDA 5J1SC 5FUZH 4J2XA 5LCVH 3DBXB 3UDWA 1OOWA 1FVDB 4DEUA 3RNKB 2HFGL 1RPKA 5B38G 2WLIA 5L2KA 1RUPH 5DVLA 1QZNA 2CU9A 5J12C 3TZVA 4U1LA 2CLRA 3TVMA 2XWEA 3G6JB 3IFLH 4N90E 3TN0B 2QPEB 3WI9A 4HH8A 2TRHA 4EEEA 1INDL 1DVTA 3DHJA 4NAMA 2CHZA 5GGRA 2MWCA 5A43C 4IBZA 2DQDL 3KYKL 2F1EA 3ARPA 3F7RA 4MMZA 3K6IA 3BHBA 1IGTB 5IESH 1BMZA 3VB9A 1RHHA 1UOLA 1MOEA 4H8UA 2YQ3A 4FOMA 4Z76A 3FAXA 1P4BL 3O6FC 1CVRA 1VJSA 1UATA 4C4BA 4LL1A 4O51B 4PB9H 2CBOA 3LKNB 5JW5A 2VLKB 4PJCF 4QXVA 2Y6TE 3ZL4L 2EE2A 5G5DB 3JUZA 3KD4A 5FM5O 3ULUD 1TJIH 1E42A 5F96L 4JFYA 4X7TB 4GAGH 4U1MA 2NY6B 4LKXA 2WWOA 3V5HB 4BH8B 4HGWB 1EEUA 1WBZB 1X4ZA 2A6IA 4S0TD 3SJVA 5FFLA 1JDAA 4L3AA 1MN4A 4GIPD 2OYPA 3S5LG 1ZJAA 2L4OA 2NY7L 5F1OB 4X8GA 2DIJA 4PY8J 3T0VA 5IVXA 5ELIA 4Y4KA 3T65B 1ILSA 2GJJA 5GS1C 2WBJA 4Q6IB 5F1IB 3TX4A 3BZEA 3H7BA 3BD4A 3P9LA 1AOHA 5DURB 3G3LA 3BVTA 1WZKA 4FI8A 3LN4B 1C1EH 5CLZA 3CQFA 3QNFA 1E3FA 1K4CB 2F54B 4MMXC 5GGQH 1KXTB 5DLLA 4H26B 4Q6IC 1OZUA 2QMKA 4GKOA 1OP3K 2EDQA 4UOW0 3A0OA 5F70A 1NGPH 3CH8A 3DXAE 2OSLB 4DCQA 5DJ2A 3ULUL 2D9CA 4Z95L 2XV2A 3ZT7A 2WLYA 3PFUA 4NT6A 3TJEL 1TNNA 3V6OC 1EZVX 2K9FB 3IJ9A 4XP1H 4J3OD 1PLGH 5HYSB 1S5IH 1JCKA 3HMXL 3CWGA 4MGXA 3WN5A 3ULVF 3NAAL 2WSDA 3I2CH 1TCMA 1XF3B 3DSNB 4K94L 4RFOH 3K3QA 3R7QA 3MPCA 4ES9A 1PKQE 3UO1L 3RGVD 5SX5K 3CLEH 4JG9A 2Q8BH 3SE9L 2FYYB 1IC5L 4Y4FA 1BD2D 3SKNB 5F21B 1AIFB 3GO1H 3ABMB 3FNKA 2OV0A 4L1BA 3BWUF 1AOZA 4MJJA 4UQEA 5ALCH 3RWJB 1IVLA 1MELA 5C0NC 1A9EA 1DR9A 2F19L 2NTFB 3CFKA 2VERN 4G7VL 5JHBA 3EH4B 4M29A 4NCDA 1AI1L 5FFGA 4G8GE 2WTRB 5J9PB 2MQ0A 2NX5B 3Q43A 1E2ZA 1UCBL 2ZOLB 4QRPE 3DBXA 1FVDA 5F1SA 3CN4A 4PJIB 3PYCA 4NZRH 4WTZA 4PY8I 2CGRH 5D1QD 1MIML 5F7MC 4QOKB 3G6JA 5D4HA 1AH1A 3NCWA 4ZT1A 3TN0A 1U3HD 5GRXG 2ZF9A 5LBSL 4FCAA 3DTDA 2ICES 2IG2H 3O6FA 4Y5XB 2ZXGA 3VXUB 3R18A 4YDIL 4BZ1L 2P7TB 2HLFC 4S1SH 3MLVL 3RJOA 4OUOA 4JNXA 1IGTA 3KM1A 3RG1C 3U6RB 1CS6A 4Y5XC 1OAQH 1V3KA 5IJBC 3P3YA 4O51A 3LKNA 2P26A 4FFYH 2VLKA 2VSCA 1QFWH 5DZPA 4F91B 3AXLB 4N1HB 5G5DA 3N44F 3O4LA 2UYLB 2FATL 1GR7A 3V5HA 1J8SA 1L7TH 4BH8A 3FTYA 5GS1A 1WBZA 1Z9NA 5DK3A 3ATBA 5A6IA 3I85A 3L5HA 4TSCH 2GHWB 2X5PA 3LPWA 4UCFA 2DQGL 4NQED 1Q9OB 2FB4H 3NCMA 3LZPA 3LCYA 3UYOD 5CJQH 5KVGH 2WHVA 4Q6IA 2GTQA 2AXGB 4WHDA 1UXWB 4G7QB 3U4EB 3JV5A 3LN4A 1DQQB 1SMDA 1YY8B 2ITCB 1KJ2H 3RWCB 1K4CA 1RUKH 2F54A 2JJTC 1KBVA 1KXTA 3P73B 4H26A 4L8DB 3V6OA 4ABWA 1IIIA 1FVEB 5AVRB 2OSLA 4Y9CA 4WKZB 2HG5A 2DJSA 2V3DA 1PG7X 3EDFA 3GM8A 5ICYB 4NJ9H 5A6MA 5GRJH 3AGWA 3IFPB 2Q20A 4JG0L 2QFPA 4NFDA 4R26L 1EAQA 5KUMA 5E08L 4TVPE 5H2BB 4XOBA 3F6JA 3HE7D 4YHOL 4QJ4B 2YXFA 1SNRA 5HYSA 2FNBA 5FDWB 3BE1L 2LLNA 3CN3A 4NZJA 1ID2A 2E9BA 4PREA 3N6YA 5A16B 1YEKH 3IDXL 3DV6B 4RGOL 1A7PL 1A4CA 1Z3RA 3QNXB 3LYRA 4NKDB 4L4VD 5T8IA 4HIHB 4UQBA 1KTCA 4WK2B 5I82A 3SKNA 1AIFA 2HT3D 3LD8C 1XXFC 3TNMB 3V0DA 1MHHB 1GJUA 5HDBB 3SKJH 4E9TA 4HS8H 2V2WB 3CVDA 3RWJA 3QS3A 5AYTA 2XXMB 4YQXH 4BWWA 5KVMC 5FCUL 4IBYA 3O2VL 4KROD 2WTRA 1U2HA 1ZK9A 4LVNC 3DK2A 5J9PA 2NX5A 1KZQA 1RAMA 2A5UA 3HHSB 2H3NB 4X8JB 2CHNA 2ZOLA 3ARRA 5AOLA 3D8MA 4M7LT 2EE3A 2OMUB 3KXFB 3NYKA 3B1UA 2P24B 4QOKA 5DRNB 1KOAA 2WNGA 1KELH 1RD6A 2Y25A 3ESNA 1TLMA 4AXWB 1BG1A 4Y5XA 2YEQA 4QHKJ 3ZDXB 4TPRH 4WGWB 3VXUA 2E8YA 3ECWA 2DDQL 4UMSA 2IAND 2XVBA 4AC2A 4B96A 2AERT 4OCWL 1N6QH 3IK2A 6FABL 2DWSA 4RRPM 3R7RA 3U6RA 1VZIA 3D6GA 3NCJL 3PFQA 5ACLA 2ZYSA 1FYHB 4YBLB 3Q2LA 3Q6FB 4RAUA 4YLBA 3AXLA 2BVPB 1E4JA 2YN5A 2UYLA 3SGKC 4W68A 5JTWA 2O5YL 5EBMB 4AL8C 3BYYA 2JV6A 3DTXB 2FEDD 2E74C 4PG2C 1NBVL 1Y1DA 3NJJA 4YBLC 2D03H 2QZQA 4FNTA 1KBBA 4ODWB 1DVFD 2X2JA 3OBAA 2CD0A 4XNMB 2EDTA 5KYWB 3IT8D 4GH7B 2HUHA 3WUWB 1KGWA 1Q9OA 3CLFH 2JJTA 3PLYA 1HOEA 2AXGA 4M00A 3TA4D 1UXWA 4F27A 2OAAA 3U4EA 3TFBA 1Y7VA 1MJ8H 1ZS8B 3AT9A 5IBTH 4P0DA 1OGAB 4NHCH 4OIBA 1DQQA 3VXRB 5F2FA 1YY8A 5HD8C 2ITCA 2VLME 3NABL 4UZGA 3P73A 5T3XL 1IBYA 1KF9B 1JZ8A 2F61A 4L8DA 4LL4A 3H9SB 4GKSB 2GAZB 4KHTL 1IKOP 1FVEA 4WTQA 1LDSA 1JZ3A 4WTWA 4WKZA 4HJ0C 3T0DA 1T1WB 32C2B 3IFPA 3POHA 2P47B 1U8LB 1TUPA 1MHCB 1IC7H 3UZQB 3RHWK 1SMAA 3GNML 1CR9L 5H2BA 1L7IH 5H8DA 4PJDB 5HHME 4G6JL 5I26A 3RKDD 3S0PA 4XP5L 2VO5A 5FDWA 3O0RH 4X6CB 1NUGA 1HI6B 2H0FA 5EZOH 5DWUL 2XWJB 1FQ9C 5IB1A 5A16A 3DV6A 1SVZA 3S8GB 2IOMA 3QNXA 3CX5K 3MLXL 3MV11 5LN8A 1MRDL 4JFFD 4MA8L 4NKDA 4HIHA 3JT0A 4FQLH 3QYCA 4PHXA 3TNMA 1MHHA 3SYCA 1KN4H 2Y7LA 1SHSA 2V2WA 2WUCL 2Q9OA 3GRBA 5DMGC 4UAOB 3V4PB 4BUGA 1NCGA 4EDWL 2FBOJ 3FUJA 4BHUA 3HHSA 1INEH 2H3NA 4X8JA 1YDPB 1TENA 5LQBL 3C5ZD 3CN0A 1HKFA 2VDOH 3N06B 4UAOC 1YY9C 4UTCA 3KXFA 2NSXA 3RX8A 2VN4A 2AJSH 3L8QA 4R84A 2PN5A 3KPSB 1SEBB 2P24A 4DVBB 5DRNA 4LPVA 5KSAB 3F62A 2X6CA 3MFFB 1PY4A 4APQB 1QWUA 2F9BT 4AXWA 4Z3TA 3RVWD 4E42B 4FZEL 5DUPH 3WLWC 5AG9A 3O9WC 1F4YH 1ZT7B 2DJUA 4YHYB 4K8RL 1T0MB 3W0WE 2HRHA 3UEQA 5KSAC 3SGKA 4APQC 3UZVB 1V27A 4GOSA 2Y07L 5HHOE 3ZQWA 2IQAA 4KI5E 3T2NH 4PG2A 5TE7L 2F5BL 4JO1L 4N85A 1TETH 3Q6FA 3JWOC 1CICD 3O3EA 4LNRB 3VWKB 1HH6B 2BVPA 3HR6A 4YHYC 1NBYB 3QDGB 4IOIB 3EZ8A 3NVQA 4GQPH 5EBMA 1ZXQA 2L8AA 3DTXA 5B39B 2Z6FA 3C60D 3U6XA 5EORH 4ODWA 4MA1C 1JWSA 1C8PA 3VWKC 4XNMA 4P9HC 5KYWA 2JF1A 3WUWA 3TEXA 2J55A 1CG9A 4N0YL 4M8VA 2YQ2A 4QGYA 3L5WB 3PREA 4N0FB 2XQYG 3ZE0B 4P2QB 1NLDL 4DGVL 1ZS8A 1R34A 2Y6SD 3B43A 1OGAA 4WIQA 4L5FL 2YSSA 1LMIA 5JIMA 4L4VE 1KCLA 4G70B 3S3JA 1QSZA 1NA8A 5IF0B 5ILTH 3H9SA 4GKSA 2JELL 2GAZA 1KPVA 1EAJA 2BH0A 5AW7B 2X4SB 3PWUB 5D5MB 4GQ9H 1RJLB 1T80A 1K6QH 4JPQA 1ED3B 1T1WA 3V6ZB 32C2A 4BQBA 4M93C 1JPEA 4CN1A 4PP1C 1U8LA 1MHCA 1SOSA 2ATAA 3UZQA 5IFJA 4XNBA 3T0ED 2D0HA 4PJDA 3SDXF 5FM8A 2HYMA 3B8YA 4JKNA 4EOWH 3S8WA 2PCYA 1TQWA 2E46A 1F4HA 1HI6A 1TFHA 1CFMA 2XWJA 1DBAL 3PPSA 4BZ2A 3J2PA 4YZFE 4Y0GA 2PYFA 4UTBA 2VRKA 4MLIA 2R8SH 1BM3H 2I60L 1XR9B 3F7VB 2OP4H 1I9IH 2DPKA 3VGBA 4PCYA 4AYEC 3TT3L 3WXWH 3ZYJA 5CIPH 1XCTB 5JHDD 2IANE 4LASH 4ZTOL 1RJYB 3BVDB 1F8TH 4IJ3B 3VGDA 4YUEH 1NSNL 4Z7QE 5T3XE 4BJLA 5HYIA 1YDPA 2O5ZH 5E8DL 1X6NA 1QG3A 2FGWL 2XBZA 3BAKA 1HHGB 3U0WL 4JRXB 4IJ3C 4YIQB 1MVFA 3KPSA 4CRPA 1SEBA 3HBQA 1AY1H 5I15H 4DVBA 3O9WA 4N5EC 5KAQF 1XGQB 4UQ9A 4CC0A 3Q6GL 1WQVT 5KSAA 1D5MA 1R3JB 1H0DB 3MFFA 2JCCE 3P3RA 4APQA 4HJEA 4V33A 5CJBA 2GITB 2HPOA 2GIMA 4E42A 1QRNE 3EJTA 3G6DH 3PJSB 3NCFB 5F89A 4JRYB 1T0MA 3C6LC 2AZUA 4MD0A 2YAMA 1BXVA 5E2UH 2ZPKL 3UZVA 3QC6X 4POZD 3W81A 2I07B 3PAUA 5E1QA 4L37B 3BT2L 5GGUB 2ZAHA 3FUNA 3BUDA 4HPHA 4EZKA 4LNRA 3VWKA 1HH6A 1P7KB 3HAEB 5HGDB 1NBYA 1UA6L 2FBJH 3QDGA 1DSFH 3AACA 1JNNL 1CZ8L 3H9HA 2BNRD 3DKHA 4IOIA 3RX9A 5DVOA 1U42A 3VNZA 5B39A 5AB2A 1YAZA 4HSAC 4F24A 3NZUA 1Q1PA 5DUBA 2R1XB 4G42B 3X3FH 3BLPX 4FMKA 4XCYB 1KIPB 3ZXAC 2L3BA 4JFEE 1OHZA 3FSVA 3HZYB 4Z7UE 3NJNA 3G5XB 1PD0A 1JERA 1WFMA 1ZIBA 1UM6H 3OKDB 4N0FA 1OZTG 2APVA 4P2QA 2OR9L 3GKWL 3HJ0A 1OSEA 1JGVH 2WY3B 4KY2A 3L4VA 4PJCB 3FO1B 2V5YA 1JWMB 4LLMB 1RZJH 3A67H 4POYA 5IF0A 3S37H 5I18L 3H0TB 1B2YA 1RXLA 1LEGB 1P4IH 2EDKA 3MLPA 3Q0HA 2FQDA 1R3HB 4HEME 2X4SA 3PWUA 5D5MA 1O7DC 1RJLA 1ZIAA 3DIFB 4DQAA 1ED3A 4LEXH 1HWHB 4HSCX 3V6ZA 1NDGB 4WDIB 1ZGLB 5DSCB 5IWLC 5J3HC 4M61B 1W0WB 4J2QA 1GGBH 1LHZA 1VERA 3GRWH 1JF5A 2Y7OA 4U0RC 1EWHA 2VXUH 4ODXB 4PVMA 1XR9A 3F7VA 1JGEB 3ZGHA 4GJTB 2E0PA 3K0WA 4FADA 3HNTL 2D2OA 5FYJH 2YJQA 2H1PH 2KUTA 3Q44A 1T5WB 1XCTA 3HPJB 3U46B 3KPLB 1RV6X 3MODL 1RJYA 4L5FE 5JDJA 1KGJA 1IARB 1FZKB 4P5TD 4PJ7F 5HI3C 1A9BB 2YGOA 4G43B 2VUOA 2W59A 4JO3L 3KG5A 2ATKB 4YHLL 1HHGA 4MNQB 3WXVH 3CVHL 4TQHA 5E5RB 1RK1A 4PH8A 2DLTA 4H0HB 3N0PB 3ZTDC 1R3JA 1H0DA 3C6LA 4OSUL 3OKEB 1Z3GL 4P8QA 1EV2E 2GITA 1W91A 3BVXA 2VZ3A 4MYWB 3PJSA 3EZJB 4BQCA 5F97E 2XWXA 3GS7A 4LSUL 4JGNA 1L9QA 1P4UA 1WCBB 3MR9B 4FX5A 4JRYA 3SDDB 5HYEA 1OWRM 5A2BA 1M3IA 5JOEA 1FSKB 1NMAL 1E9OB 4JG1H 2I07A 2VE6B 2VDKL 4H25B 4B9KC 4U05A 2ZSVB 4GT7A 4L37A 3DSFL 1ET8A 4KFMA 3C5JB 5GGUA 3TO4D 2QQNH 4J12A 4WO0A 3HAEA 5HGDA 3SDDC 3S88H 1X5YA 4E9LA 5DK0B 2UXTA 1FSKC 4A2HA 4ZS7L 3WCYA 2R1XA 3FMGL 4G42A 1QSFD 4XCYA 1ICTA 1KIPA 1T3FA 4OW6A 4R4FH 4ATWA 1ZPLA 3HZYA 4AEEA 3T0EE 3G5XA 4ANXA 4Q2ZB 4PEEA 3MV8B 1Q72H 3DX9A 3OKDA 4AG4L 3M8OL 1F00I 5IHWA 2FWSA 4KVNH 3MV9D 4PJCA 3FO1A 3N44B 1JWMA 2VR4A 4LLMA 2IMNA 3DJRA 4FQCL 4XX1E 5AKRA 5KG9B 5IWLA 3CH1A 2FJFB 3H0TA 4ALAH 4NAQA 1GZQB 1LEGA 1FL6A 2XBTA 1R3HA 1S7SA 2DMBA 1T1XB 2X4QB 3DIFA 3C8DA 4NKQB 2YBRB 3D48R 1NDGA 3BFOA 3ZTJH 4WDIA 1K5NB 4FP8L 5DSCA 1ZGLA 3TA3C 2HCZX 3QCVL 4M61A 3ZYZA 2R2HB 3L54A 4K9JA 1CFSB 1W0WA 1Z5YD 4GUPB 4PJ5B 4ERSH 5PAZA 3ET9F 4A6YH 4TTDD 3LPOA 4ODXA 3WFCH 1OANA 5C09B 3QIUD 1TU2B 2ADJB 2EKJA 4JJ5B 1JGEA 3REWA 4CMHB 4MAYD 1KBGH 3FSAA 2D0FA 2CXGA 4JZOB 4NAJA 5IUSA 4MJ5B 3OSKA 4JDZB 1T5WA 1FN4B 2MKLC 3FTWA 2W0LA 3H1ZA 3HPJA 3QEUB 4PJAB 3KPLA 3U46A 4GMSL 5B1CA 3INUH 3ME0B 4CMHC 5AD0B 4UB0L 1FZKA 3FU8A 4M3KB 3KLSA 1NINA 3CC1A 4PJHE 4G43A 4HALA 2YD9A 2ATKA 2NW3B 2GJZB 3ABGA 2KLRA 3SDYL 4LVHB 1WJ3A 3OMIB 2Y1YA 3ZIMA 4IBUA 2F74B 3OKEA 2UZXB 3BH8B 4UMGA 4UV4L 3RVUC 4L1DA 3FRPB 4RFEB 5EU3B 5D1ZB 3NK3A 3QNZB 1DUZB 2EEDA 4C4KO 1WCBA 2F15A 3IJEB 3MR9A 4LCWB 3SDDA 2ZNXA 5IW6B 3QIWC 4DKDC 2K8MA 1E9OA 3B2XA 3CIAA 4H25A 5SX4I 2X87A 2ZSVA 3QCUH 5EN2B 3C5JA 4DW2L 2P8MB 4PRNB 1MCPH 1U8NB 1B6DA 3MDJA 2QTEA 4XBGB 3X13B 2CAKA 4JCWA 4NKIH 5DZAA 1BREA 1GA2A 2QADB 3LDBC 4FQ2L 4HCRL 3TGXA 3V7AG 5DO2D 4PSRA 2E47A 1BVLB 5K1JA 5D7JC 4S1QH 4X9YA 1OAKL 2J7LA 3LRSB 2IO5A 2Y5QA 2QADC 3D25B 4Q2ZA 1SGKA 3O6FD 3PNRB 3P30H 3WKML 1QX1A 3ESPA 3H85A 4FQQB 4LCIH 3VD0A 4C54A 3ORJA 3OF6A 5IUCA 5KYYB 3NCBB 1UOWA 1CE6B 5KG9A 2VDNB 1FNAA 4YPGB 4YDMA 2FJFA 1GZQA 1GGCH 1SZNA 4RRPA 5DJ8B 2Z4TA 5IJCC 1RULH 3O4LD 2X4QA 1T1XA 1XF1A 3CUPB 3D85D 3DRQB 4U2YA 4UT9A 2YBRA 1H6EA 3COOA 5CGYC 5TDOB 3WNLA 4ZNCD 4K3DH 4HZLB 5B1AB 1K5NA 1EHNA 4ZRGA 2X0WA 2FEEI 3MA7B 4DVRH 4TOYL 2R2HA 3NSFA 4B60A 5JOPD 1CFSA 4NP4L 2CKNA 3DOIA 1A6ZB 2QPSA 2AP2A 4PJ5A 3Q06A 4FMFA 4KKBC 1YNTF 4X5QA 4U4BA 1THCA 1EDYA 1W8NA 2DWXA 5C09A 5I6NA 2WOYA 8CGTA 4LQ1A 2ADJA 2QQQA 4GI9A 4JJ5A 1A21A 4M6AA 4H2AA 4MDIB 5FYLH 2A83A 1XWVA 1TJGL 3B9KB 4JZOA 4N8CL 5E6YA 1ZGLP 4MJ5A 2K8QA 4KI5F 4JDZA 4OZHB 3QFJE 1FN4A 4PJAA 3QEUA 3RDTC 1V7ML 3MI6A 3ME0A 3L9YA 3GHBH 3P0YH 5AD0A 4LP5A 4GAJH 3B9KC 5ABDE 5IGXL 2IDCA 1ASQA 3SKUD 1MAML 1ZLUH 3FXIC 1IKFL 2NW3A 2GJZA 3VG9B 2BX5A 3I9GL 5E1GA 2J12B 2WV3A 1MJ7H 1PG7L 5A2IH 2CJ3A 1BWWA 5GGVY 4ZFOB 2F74A 4LKCB 3QIWA 2UZXA 3BH8A 3QQ9C 3VG9C 3FRPA 4RFEA 5EU3A 4YHKH 4XZ4A 5D1ZA 1DTUA 1YQ2A 4OT1H 3HS0B 3QNZA 1DUZA 1VKXB 3IJEA 4LCWA 3QUGA 5CN1A 5IW6A 2WWKO 4I2XB 5ADOH 1A64A 4PR5B 1CGXA 1N2RB 4I3RL 3ELQA 1HZHH 4XE5B 2PETA 5EN2A 3JWNG 3NP4A 1OEZW 3QZMA 4XODA 5E9DE 4Z3JA 1NM4A 4J1UB 1UEMA 3RL2A 3OJMB 3QH3A 4G8FB 4D2NA 2XY2A 4PGBB 2R83A 4UOQA 4XBGA 3DGDA 3X13A 3J07A 1P2CA 1WEJL 3ABLB 4YHIB 3ZKSD 2BHFA 3BFWA 3HFMH 3Q9QA 4NWTH 2RJMA 4WW2F 4D9RD 4LAQL 4YZFF 1BVLA 4NUGH 3SOBL 3LRSA 3D25A 4MCMA 2BS8A 3U0PB 4HXBL 1BAWA 3VXUD 1KGUA 2YD8A 3IVKB 4FQQA 4WI8A 1DQMH 1RZ7L 5D96C 5KYYA 2YPVA 3KBHE 1MLBB 5DCCA 4FTVE 3ZSTA 3BKML 1CE6A 2DM3A 3FN9A 3GSQB 2NT1A 1BQSA 4YPGA 4B50A 3VYOA 1LTXA 3CUPA 4J3VA 3DRQA 5TDOA 4IM8A 4HZLA 3MNWB 4YHZH 4ANWA 3MA7A 2V5SA 4TSBH 2TSBA 2I7SA 2AF2A 2BY1A 4JRWA 5AWNH 1A6ZA 1NKGA 3KGTA 3SQOH 4AGNA 4LSSL 4P07A 5J11C 2DQFB 3RDTA 1YPZE 1HXYB 3AT0A 3AZUA 1ZLWH 1TSRA 1YYML 4U3SB 4LRIC 2VKWA 5C1MB 4MDIA 1S78C 4WU5B 4W9DC 3B9KA 4A67A 3ZDYF 2N3JA 4OZHA 1RZFL 2Y72A 1EO5A 4I3SH 3ZLQC 4ZODA 4BFJA 2FJHB 2VZOA 3PWLB 4G1EA 4UZUA 5GSRB 4WHYH 2ZKMX 1EPFA 4FYQA 4R7LA 3IRCA 2OCFD 2XVGA 4OD3L 3KWVA 2WWMD 4M5ZL 1INDH 4QRSB 1KTKE 3RURA 1AC0A 1J8RA 3ZN6A 3B83A 3KYKH 5KSBE 2VM3A 3L9EA 4HIEB 2FWLB 2OL3H 4ZFOA 2BP0B 3TJHC 4LU5H 4XWOC 4EQ2A 1O0VA 4LKCA 1PFCA 4WLCA 4MXQC 4YHPB 4AH2B 5KW9L 3TCTA 3X11B 1HHHB 3HS0A 4CN4A 1VKXA 4TVPH 2FJUB 4RGMB 3EXLA 1BVKB 3VM5A 4UBDC 4I2XA 4PR5A 1N2RA 3BCFA 3RE0A 5EDSA 5DEGB 4KZEH 5E0FA 2IOIA 1BGXL 1FE8H 1L0QA 1FHNA 2PWHA 1AGCB 3VD1A 1NH6A 1OF2B 3QDJB 3X2QB 1XGYH 1ESOA 2NY7H 4G8FA 3QZNA 5T5NG 2PR9A 4YHIA 2BOCB 4KK5C 2DTML 2F7PA 2VXVL 3CNKA 1MFCL 4HA1A 3LN5B 4KAQL 4WFHD 5ID0B 3BUPA 1BDYA 4RDBA 5E8NB 1U6AL 4H0LC 3U0PA 5T1JA 3B37A 3ML9A 4AEHL 2OMVB 4F7EB 4LCYB 3BKCL 6PAZA 3IVKA 3ATFA 1OCWL 4HWBL 4FXTA 4W81A 4G9FE 1MLBA 2AQQA 2OZ4H 1FIGL 1BECA 3BPOC 3MO1B 3IMTA 3GSQA 4GQQA 3ZIYA 1RUML 3E1ZA 4WI4A 7CGTA 3R06B 4X4ME 3A21A 1OM9A 2IPUG 5CUSL 2ZUQC 3MNWA 5FDYA 3U9UA 2R1WB 3VTAA 4LRIA 2BERA 5D1XD 4YX2H 4X9HA 1BFVL 1MREL 4HETA 4YSOA 5HD8D 3RLSA 1JPTL 2DQFA 4UQ2B 2WUBL 1HXYA 2R69H 4L3FA 5JA8B 4U3SA 1E2WA 2YQGA 1UG9A 3QG7L 3ETSA 3Q1EA 1C5BL 4LGPB 2HKFH 4WU5A 4R7VA 2IPKA 5I19L 2XWBB 4Z7VF 2X53A 5INCB 5DQ9B 4JQIL 5F9AC 5K39B 3V55A 5CEXB 5HP5A 3MRLB 4Z3GA 5AG8A 5DS2A 1BQUA 2COVD 1QKZL 3VX0A 3VE0B 4ZYKA 2FJHA 3PWLA 4PW3A 1MIMH 4UINH 5GSRA 4I5BB 2OFQA 1A8JH 3VNYA 2P80A 1BAGA 3ES6B 2BFGA 3NFSL 4E5XG 4S0SD 2VZTA 1A65A 3C2SA 5GS0D 5F7AA 1F2QA 4QRSA 1DO6A 2QSQA 3GHPA 3GKZA 3L95B 4EBQH 1NGQH 2VMEA 4JM4L 3MLVH 4WEUD 1ZHKB 5J1AB 4IKNA 3QHZH 3O2WH 4WO4B 2WO3B 2YOCA 2BP0A 2VXTL 1RP9A 1T21A 4CILA 4Y1AD 2X6MA 3MQIA 5EWIH 2VDRL 1TZGL 4UIKH 4UTAA 2MCPL 4QUOA 4ENED 4RZCB 1MUJB 4ZOCA 3QIBC 4AH2A 5EBGA 3MAWA 3TBVB 3X11A 1HHHA 4WO4C 2DQUL 1WIOA 2K45A 4PBWD 3IBOA 5EZLB 5LO7A 4WI0A 1BVKA 4PJ9B 3V4VH 2FJSA 4NIKB 2EDJA 3CIQA 3NJHA 1JYXA 1U36A 2XZCL 4NPKA 1THAA 1AGCA 4IIQC 1OWWA 3MLSL 2VWEC 3QDJA 2VL5B 5D7LB 3US0A 1PD1A 5AYQA 1H8NA 3FU0A 1T89A 4WI3A 2LLLA 5GS0L 1KFAH 2BOCA 4NUJB 4RFNC 4GXVL 2GT9B 1ZWIB 3WLWD 4ELME 1GHFL 3O9WD 3LN5A 3UC2A 5ID0A 3CGTA 4M43L 1MWOA 1DFBL 5E8NA 4HOXA 4KKLD 4EN3B 4F7EA 4LCYA 3UTSA 1AMXA 2F53B 4P2RB 1PZAA 2GIXA 3R1GH 1FLTX 2FAUA 2IDSA 4JG0H 2AJXL 3CZKA 3MO1A 4EN3C 4FFZL 1GH7A 4ZS6C 4M62H 1FFNB 1A6PA 2OXGB 3BPCB 1A4KB 1AMYA 2UWEF 3AQYA 3R06A 4IIZA 1EA9C 3QJZA 4RGOH 5E0QA 3QXAB 3RBSA 1OGTB 2R1WA 2R29A 1AQ8A 3WUWG 5BRZE 4KQ4H 4P23B 3L3DA 5CEZL 3ZTEA 3KYMB 4DAGL 3THML 5F3HB 5IFHL 1AE6H 3Q8FA 2VW4A 3DX7B 4OGXL 4JPIB 2GQHA 1H3WM 4P23C 1JD9A 2CUIA 1A7QH 1OQXA 2XN9E 4O4YL 2XWBA 4LGSB 5CP3A 5C7ZA 3U25A 5INCA 3JVGC 5DQ9A 2ZOUA 5K39A 5CEXA 3L2MA 3MRLA 4RWYH 5C08E 4ZO8A 1S9KC 1W2KT 3MBWB 1ZSDB 4I9WE 3VE0A 3B2VL 2EAEA 4PJXB 5C07B 5AW2B 1LO5B 3A4AA 2ROXA 5EN3A 5KBLA 2VN6A 4I5BA 1D2PA 2YD1A 5C0AD 1JXDA 2X0VA 1A7RH 1BFTA 1R33A 1Q0XH 5I30L 1UZ6F 3CSBA 1XSOA 3L95A 5I23A 2ZX7A 4A55A 2V7NB 1K8IB 1ZHKA 4MSWB 4QEGA 5J1AA 4OCWH 3D9AH 4WO4A 1NCTA 3PS6A 2PW1B 5ABZA 4XVJL 5SV3A 3F7YB 4P3CH 3NCJH 4XH2B 5GGSY 3Q1SL 5I1HH 2AANA 4RZCA 3ZO9A 1MUJA 4HFUH 4KY1L 3TBVA 3GLAA 4YXLL 3B34A 1UOVA 5EZLA 4MMYB 5T5FL 4K3EL 5LAXB 2YD3A 1Q0YH 2FX8L 4U1NA 4M9PA 3V9CA 5DUJA 4R4BB 5DYOB 25C8H 2VDPB 2GY7B 1DJSA 1GW6A 5D7LA 5JHAA 4G5ZL 4N5ED 3UBXI 3T6ZA 2FSEB 4KPHH 2NSQA 2D73A 3BLBA 3RIAK 5E2WL 5IHBA 4PYGA 4QDGA 4NUJA 4LF3B 2H0PA 3NJIA 3KLDA 2GT9A 1ZWIA 1GY2A 5EOQL 3IDJB 4KRPB 5FWRA 4FABL 5D2NE 2O1AA 15C8H 3C6LD 1B9KA 3NABH 5T3XH 1HE7A 4IQHA 4EN3A 4LIQE 3SO3C 2WQ8A 3F7LA 3QZWB 5E95B 4O5LH 4U1KB 2F53A 5AUMB 1F1GA 4P2RA 1XH0A 4ZW8A 2QGEA 3QR0A 5ADPH 1FJ1A 3GC3A 3VFSB 3EYVB 4GINA 5FKAB 5A40E 4X50A 4G6JH 1FFNA 5IQLA 1OTUC 1EJ8A 4ACPA 2OXGA 3BPCA 2QEJA 1A4KA 4OZ4B 5JXED 1CTOA 3S98A 4P2CG 4W6WB 3LMJH 4R5XA 4HWUA 3L1OH 2RQ8A 3MRIB 3MRQB 1OGTA 3QXAA 2H9GB 1U8PB 4MA8H 3V9EA 3JWDC 4OCXL 2IWFA 4P23A 5KSUB 4BIKA 3RYMA 1QBLH 1NBZB 1NC4D 1E6OH 1S8DB 5F3HA 3CDGB 2VB5A 1G5GA 4AJWA 1ROWA 1JGUL 1KTDB 3EO0A 3DX7A 4JPIA 5AZEL 4M7ZB 4D8PB 4MKMA 3ARBC 3Q3GA 4M56A 4O9HH 2YFNA 2A9NL 3R0MA 4PIBA 1KN2H 5JYLA 4W4OC 2A9AA 1UZGA 3DX6B 3OMNB 2PTUA 2YPKB 2DBLL 2EYSA 3MBWA 1ZSDA 5BUPA 1OGPA 4PJXA 1OAZL 2BVQB 5J3HD 1LO5A 4Q9QL 2XWRA 2IVFC 4HF5L 3DJTA 2XKSA 3LZFH 1X4YA 3ILDA 5EZJB 2J56A 3MNMA 5B4MD 1FNFA 4JO4L 3LIZH 3QRGH 1MY5A 4H88L 1PLCA 5AAWC 1IBHA 1K8IA 5HYFA 4MSWA 4RH4A 4Z5RB 4WNQB 2PW1A 4DGWC 3F7YA 2PYEB 4KUCD 4XH2A 1DSYA 4ODUB 2B9AA 2Y07H 5CEZE 3VXMB 3KBEA 3QNYB 1GOFA 5INDA 2AS5M 4ZMWA 2CO1A 4NGHH 2ZUYA 4MMYA 2BZCA 3GBML 3HI5L 5LAXA 1S5HB 4KFZC 1OW0C 3KYAA 4XPAH 4B95C 4R4BA 5DYOA 1II4E 2DI7A 1IFGA 3TBCA 1N70A 1OCRB 1XO8A 3ATEA 4DZBB 2ZX6A 1ZD6A 5AVZB 1N4XH 4HUUB 1K3IA 1RZ8B 2DYPB 5KANI 4QKTA 2FSEA 1IEBB 1R24B 4LEBA 4FULA 2YD0A 3GIZH 2X4RB 1NLDH 4NM8L 1YPZF 2BSTB 2MHAB 3IJ8A 4MXWH 3UGUA 3IDJA 3NDZE 1J1XL 2CXKA 3ATAA 4QAMB 4ZUSB 4KK6C 5DUML 2R9HC 4HK3J 1L9PA 4PJBF 5CCGE 1JBJA 1MCOH 4D0CB 2A4CA 1VFOA 3QZWA 1QR1B 5JPNB 5CMAB 5DHEA 1AGBB 3VQ1C 5IQ9B 1NCAL 4PCSA 4U1KA 5AUMA 2YOAA 4JHZA 5FF6B 4X4XA 3VFSA 3EYVA 3QE5A 4Y9FA 5HHPB 4BSWB 3HAEG 5FKAA 1Y0LB 2LV4A 3WFHB 3T2QA 3MRRB 3MC0A 5JPNC 4OCSH 3NIDF 3Q2NA 2G3XA 1YQVL 4I0CC 4K71B 5GXBB 2HWZL 4KH9A 5ID1B 2GBUA 3APFA 3MRIA 4FJ6A 3MRQA 4B5EA 2H9GA 1O9ZA 1U8PA 3H3PL 3OKMB 2I60H 1LP9B 3ARBA 3LPGA 3FSWA 2X89A 5KSUA 3S48A 1L9TA 2BWQA 4K71C 3TT3H 3GHEL 1NBZA 3LQMA 5C3IA 4W4OA 4DKAA 1E3XA 1MNUL 1QLRA 1S8DA 5GJSL 4NZ8A 3SPVB 2YSTA 4JRFA 4L29B 2GEQA 5DQDH 1HZLA 4MASA 1J8HE 4YOKA 2CUAA 3NACL 4QF1B 3U1QA 3DI2B 3P9MB 3ZL2A 4DKEH 3F12B 4UOJA 3LNGA 3ZHLA 1RURL 2CRMA 3O41B 4UU9B 4D8PA 3DVIA 1Q0EA 1VENA 4X0KB 3DX6A 4ATTA 4AZUA 5JMRA 4GIOA 2YPKA 2NZ1A 4GBXB 1BMGA 1UM5L 4O02B 3TA3D 3V52H 5AAWA 1J7VR 1NCCH 1AO7B 2NZ9C 3L48A 3Q6GH 4F93B 5EZJA 3HS8A 3QEQD 1G9NL 4GBXC 1YJDC 2Y24A 3ZQXA 1J05B 3MOBL 1F18A 5F9OH 1JK8B 3S5YA 2XVLA 4Z5RA 4WNQA 3NZ8B 4OCRL 3CDZB 3ZDYB 4YS4A 1F45A 2PYEA 4Y7MA 4ODUA 1MFUA 1OW0A 1L9RA 3VXMA 4JFDD 1EAOA 5DA4A 3VD4A 2NCEA 3BT2H 4HV8B 3QARA 1KB5B 1SY6A 2AEQL 2DQMA 1UA6H 5SWZB 4B9PA 2W8CA 1S5HA 3N41B 4HPOL 3L5XH 1C5CH 1SXAA 3S35H 1SXSA 2LGNA 1KNOB 5K1VA 3RUGB 4Q4EA 2E9GA 4DZBA 2Z3FA 3CN1A 5BZWB 1RZ8A 2DYPA 4Z7OB 7TAAA 3P02A 2YAEA 2XA8L 1IEBA 3IB4A 3S3SA 3RVUD 3WFEH 2G2NA 1BEYL 2X4RA 3LVTA 3GKWH 3MLWL 2BSTA 2MHAA 3LXBA 1WZLA 1WAPA 3CMGA 4ZUSA 3ISWA 4OLZL 3D0VB 1UD2A 3QIWD 1EBAA 3ARED 1G9EA 2XRAL 4R2GB 4D0CA 1AGDB 5HDQL 1TCRB 4GNKB 4ODTH 5JPNA 8FABB 5CMAA 4Y7OC 1HFUA 4JRLA 1AGBA 5D2LF 5DLMH 2X44D 5F44A 5IQ9A 3MBXL 1MWAL 3UPRB 4OZIF 4JHBA 4P46B 5KBDA 4YSPA 5GGTL 1J8KA 4BSWA 5FA3B 1ZHNB 2AJ3B 1Y0LA 2H6PB 3D2UB 2Q7YB 3WFHA 3MRRA 5E8PA 3KR3L 2KDGA 3DOSB 4YHMH 3RA7H 3NEOA 3CSYB 5DXWA 1X5ZA 2XNAB 5D7JD 5CLXA 4P46C 5ID1A 2J72A 3LNFA 4J3XA 2QADD 3E2HB 2C9XA 3OKMA 5K5YA 3TH2T 1S7WB 1LP9A 1E5BA 3DV4A 2EE9A 4M8QB 1Q9WB 1QBAA 2CUMA 3UADA 1TJHL 1WF5A 3EHBB 1L9SA 2A77H 3OGCB 2EZ0C 3SPVA 2JKJA 4GKNB 4GP5B 4L29A 5B3NA 5JQ6H 1EX0A 4TRPL 1T22B 2QPFA 3E2HC 4QF1A 3P9MA 3F12A 2LVCA 4UU9A 2ZJSL 3CSGA 5K9QI 2DWTA 3CFIC 2QT6A 1WO2A 3EHBC 4E36A 2WC7A 5GGVL 2C7UB 1RZKH 3II1A 3U1PA 4X0KA 5IFAL 1GJIA 2HT4C 3OZLA 5AL8A 1SQMA 4JO3H 5EOCH 4GBXA 3FT3B 4O02A 1Z2KA 3IJSB 4L18A 2OCCB 1J9CT 4OFQA 5DEFB 1AO7A 2X42A 2WWKT 1NCBH 4KKBD 4OSUH 4UNTA 2BCKA 2XKUA 3OZ9L 4KO6A 1RZIB 4UV7L 4OFKA 1J05A 4GMTL 4ZOAA 2AAAA 3HE6B 3EOAB 4LPXA 1IBGH 5JW4M 3CDZA 1NWOA 3BSZH 3VFPB 1AVAA 3RDTD 1A5FH 3EFDH 4L3ED 2DEWX 4Y19D 4HUCA 4CBPA 1FO0B 4KITB 4M3JA 3U7AA 4HV8A 2YAOA 5C0CD 2AEOA 3NCYS 1KB5A 1MI5B 5SWZA 5J6GB 3NJFA 3GDBA 2WBXA 1OPOA 2D3VA 5I75B 3VD2A 4ZS7H 1AQHA 4BKLA 3UJTH 3FN3A 3I6SA 1ERNA 3FMGH 1KNOA 4B7IA 3RUGA 1ZANH 1EAPB 3WKQA 1JNJA 2ZOTA 3PWNB 2G4EA 3IJYB 5DD5L 4B9IA 1N5YL 3IWUA 5BZWA 3DVGB 4F58L 4QWWC 1JWUB 3HA0A 2VLRE 3KJ4B 3IWVA 3QQ9D 4AG4H 3GGWB 3CLWA 2A9CA 3QISA 2Y2WA 4F2EA 5ITBL 1IV8A 1BW8A 1SBBA 1HS6A 3DIVA 3NIFE 5HY9B 3FRPG 3D0VA 1NCWL 3IFOB 3AWEA 3KJ4C 4K3HA 2BDNH 1ZLVH 1MLCB 3ZTNL 1J5IA 4OJYA 4D7PA 3DYPA 1Y1UA 4NO0B 2Z7ZA 1IGML 1DBMH 1AGDA 1PIGA 1TCRA 4F2ME 8FABA 4IBQA 4FD0A 2VLLB 3UPRA 4FLSA 2QPUA 4P46A 2O6PA 3EJCA 3L4UA 5FA3A 1ZHNA 3D2UA 2H6PA 3KDMB 2SEBB 2QSCH 3Q8CA 1OP5K 3CBRA 3UEZA 3ARFD 3NJVA 2ICEB 2Y06L 4YE0A 3AU0A 3FU5A 3DOSA 4A39A 2EDXA 3CSYA 2W95A 4N8PA 2XNAA 1QPPA 4RA3A 2WQSA 3F04A 1G87A 2WZAA 1S7WA 1FYTD 4XAKE 3FB7B 2ICEC 2BVUA 4M8QA 3BUQA 1Q9WA 2FQGA 3OGCA 4XNAA 1NBCA 4GKNA 4GMSH 1NCJA 2WBKA 3WBDA 3LV3B 2FR4B 5TF1L 5LNGA 3ZTCC 5F6IB 4MZ2A 2UVFA 5A7BA 2ZUUA 1A6AB 2KZWA 1B9ZA 2OLDA 1XGZA 2C7UA 2VLJE 4JFDE 4NRZA 2BS71 5ECJE 5BVPL 4FTDA 3L1FA 3B9VA 4JG5A 3FT3A 1P1VA 3VMOA 1BZEA 3IJSA 1CGTA 1XBRA 5F6IC 1UD6A 5DEFA 4BFBD 3NTCL 1BYPA 4FFYA 3RY6A 1YRKA 4UV4H 2J6EL 1G43A 3NCXA 4HK3N 3BVVA 3MNVB 3QFDB 4HCIA 4QRUB 2EICA 3HE6A 3D5OF 3ARYA 3EOAA 3EDJA 5TQ0H 2XV6B 2YEZA 3X3GH 3VFPA 4AYSA 1F56A 2NY4B 2CDFB 1DYZA 3NA9H 1E40A 4KGJA 1FO0A 3HZVB 5EEZA 5D71L 1BOYA 2VR3A 3AQXA 3SGEI 2RFXB 5J6GA 1MI5A 4HS6B 4P3DB 1DN2A 2OMXB 1A4AA 2VUYA 4HCRH 5DJXB 1IQWL 1ND0B 2ZWKA 3WTWA 3G5YA 4KO9A 4ZMQA 1EAPA 3PWNA 2Q3XA 3IJYA 4F15B 3BUYB 3DVGA 1UZ8B 2CSPA 1OAKH 3TJHD 1JWUA 4CN6A 2CRZA 1HYRC 2B9BA 4NCC1 1G7PB 1ZK5A 3GGWA 3VM7A 3WKMH 2L04A 4MZRA 3EXJA 5HHNB 2VJ8A 3Q8AA 2H45A 2VN5A 4F15C 1QA9B 4GT0A 5HY9A 5JHLL 1ETB1 3UPAA 2EABA 4XMLL 4JKWA 4XP4H 1KB9K 1S9YB 3IFOA 2DQCL 1I1AD 1MLCA 5GHWL 2Z34A 4B5ZA 4NO0A 4KXAA 4AEIH 3B2DC 1RUAH 1NCUA 1ZDSA 2FD6L 5FXCH 2MJWA 2IAMB 1M53A 2LAGB 3JUYA 1A3ZA 4K3JL 2VLLA 3FQ1A 1MCQA 2EQDA 4MQ7B 2R2BB 3WAKA 4OCYL 2D31B 5DVMA 4D9LL 1GXEA 2W0KA 1X9RA 3B5HA 3F5WB 4X6DF 3KDMA 4KK5D 2DICA 4NP4H 2WGXA 3MLRL 2G60H 1DHKA 2FX9L 1YECL 2IAMC 2ICEA 4FQXC 4YSRA 4ZUUB 2NY1C 3OR6A 3FH5A 2AJYL 5EOCJ 4OQTH 3MJWA 1YNKL 2AVFA 3WO4B 3HG4A 1QACA 4TULL 1M4KA 3U1SL 4HJIA 2FQEA 2CJTA 1TMCB 1DE4B 4N8CH 4RBPK 1DSWA 1U33A 2MTPA 4BFIB 1VEOA 2I69A 1J5HA 5EUOE 2CBTA 3OV6A 4M6OH 1NL0H 3H53A 1N9PA 4UM9D 2BXYA 1PPIA 3LV3A 1CLCA 3E8UH 4M5YH 2WYTA 5EUKA 4HJGB 2FR4A 3QWOA 4AGLA 3VQMA 3UTSD 2V0AA 2X7LB 1A6AA 4K9EC 5CBEB 4L3EE 4U3CA 3MJ6A 4XOCA 2AAVA 1CGUA 4ANKA 5C0JB 2V9QA 1K5WA 4PRIB 3ZZQA 4XPFH 2X4NB 4PPTA 1W8OA 3OB0K 1IGCL 2ZT9C 1PG7H 1FGNL 1EVUA 4L8SB 2VXQA 3VJ6A 4QHMB 1MW3A 4GI8A 3GPEA 3D18A 4GXFA 4Y9GA 5C0BA 3MNVA 3QFDA 4TSAL 2EXYC 5E2JA 4GAAA 3IMSA 2RGSA 3M7OA 2IJ0C 4FXKB 4QRUA 1JZ6A 1LWHA 4L8SC 4QKXB 4NIYE 4EMZA 3IFNL 5DVPA 3IMVA 4LP4A 3H3KA 4AJ0A 5DC4B 4L8CB 1MEXL 2CDFA 1D9KB 4NQCD 3SKMB 4WU7B 2DQIL 1QD0A 4XNYL 3PY9A 4V1DB 4ZOBA 3HZVA 1PU0A 2XTJB 4FXKC 5FHAH 3IXTB 3CFCH 3T1WA 2RFXA 4UWQB 4HS6A 4P3DA 3JV6A 3K4ZA 4HT1L 4OF7A 5L4MA 2OMXA 2YPLE 4N3TA 1D9KC 4M7JL 4AV4A 1ZE3C 4NX0A 3SGDH 1MCNA 4JY6B 3QDME 4R3SB 3VSUA 5AW0B 2FH8A 1JYWA 3ZDZF 5BV7L 4LAQH 1EFXD 1J1PH 1SUJA 2O61A 4W6XB 4X42A 3BUYA 7PCYA 1UZ8A 1JUFB 4PGEB 4HP5A 4EKXA 2CM5A 2LFGA 1NGXB 1E4WH 2C1PB 3OKKB 3DX2A 4HXBH 2UXGA 4XOAA 2B15A 2AQ3A 1K85A 4H20L 4XR8C 5HHNA 2K7PA 1DBJL 3QIBD 4DFHA 3UIYA 3VI4F 5F7BA 1QA9A 5GZOC 4PD4K 2XFXB 4ETQB 2OJZL 4MHHG 1GC1H 4XO9A 1OSYA 5AZ2L 3BGFB 5ANHA 3DPDA 4WSGA 2EIBA 2YR3A 3CBJB 5BQ7B 1LD9B 4PI0A 4UT7H 2ARJQ 2H41A 3ECVA 4KHXH 2E6PA 4ZDHB 1IT9H 2IAMA 1HILB 3N91A 5JXAL 4EF3A 3DOHA 4PJGA 4MQ7A 2R2BA 2A6KB 2D31A 3F5WA 4HZAA 2XKNB 5KAQG 2XI9A 5BUAA 3PWJB 1LEIB 3GMMA 4ZUUA 4E0RB 4G5AA 1QRKA 2FLBT 1YYMH 1XEUA 5AW8B 1UT2A 1WWWX 1SN2A 4KJWC 4X99B 5EC1A 4YNYB 3RI5K 3FOMB 4BFIA 3L1EA 4K23L 4XVSL 2X38A 3OJ2C 5EF1A 3VFTA 1WS7A 4NI3A 3WKPA 1RZFH 3OD3A 4LEEA 1AHMA 4JFUA 3LNDA 4HJGA 2CJSA 1BZ7B 3PF2A 3X1BA 5CBEA 3VFWB 1ILUA 4PLNC 3ZQ9A 4BWUA 4YFLI 4N0CC 1AHWB 5C0JA 2VJXA 5TE6H 4Z7WB 5FUCC 5CFHA 4PRIA 4KH2A 2X4NA 4ESKA 1UENA 1IEAA 4A66A 4L8SA 2XZZA 3K6NA 1AHWC 4GRWB 2HT2C 3QUXB 4I1RA 4GG6B 1AKJD 4NI6A 2YXVA 3QORD 3PXLA 2VXSH 2A38A 4WY7H 4FXKA 4JPVL 1VFMA 1UWXH 3QUXC 3ABZA 4NYLB 1WFTA 4CADB 4L8CA 2WTOA 3HG1B 1D9KA 2E9JA 3SKMA 3M1BB 3J7HA 4WU7A 4F8TA 4V1DA 4QY8B 1JPSH 4KJPC 5I1JH 4LLWB 3IXTA 3KCPB 1CT8B 4JM2B 1JI1A 1G6RB 3FQTB 3OPZH 1P7QD 3BIAX 2XA3A 4AYMC 4AE0A 1K2DB 1SFDA 1ANUA 2R51A 3A6BL 1AR1B 4HSQA 4YC2B 2EO7A 4JY6A 3GXPA 4R3SA 1ZLSL 4MS8D 2YZ8A 3WIHL 4H0IA 4JM2C 1D5BA 3BVNB 1FDLL 1MFCH 1F6AB 5GZOA 1JUFA 4PGEA 1JZ2A 3HKZA 3QPQC 1NGXA 3A4FA 5G4MA 5CBAA 4MNGB 2C1PA 3OKKA 1RZJC 2E6QA 4YC2C 2AGJL 3BP5B 4XX5A 3K6DA 2WQWA 5AVTB 1YEEH 4AEHH 2ZAGA 2Q2EB 1R6VA 2P46B 1OCWH 1RLWA 2XFXA 4J3OF 4R5VA 4DP4X 3QPXL 1I31A 1FIGH 5KS9E 2ICCA 1UOKA 1NCDL 4C56E 5BQ7A 1LD9A 1D7CA 2EJ1A 3GI8H 3MXWH 4WWNA 5L8LB 4XPGH 4ZDHA 3DK0A 5BZDB 3IE4A 3DPBA 2IWEA 1HILA 2XOTA 5GSVB 4NLAA 4KXZI 4Z3FA 3MLTB 4LZKA 5IBUB 5EO1B 1EZSA 2A6KA 1RMFL 3CZNA 3CQPA 1QNZL 3APCA 2K70A 3RQ3A 4M03A 4K7PY 2XKNA 1W0YT 2IMMA 4NWUL 3PWJA 2X70B 2QELA 2KERA 2RBLA 4R0LB 4ZQKB 5K33A 1LEIA 3VXSE 3OJVC 1R19A 2XCMC 4E0RA 1E27B 1JPTH 2XPYA 2RB8A 4HISA 3D05A 4JX0A 4Y2DB 3ILPB 2VITB 5AVUB 4X99A 5F8RC 1AXTH 5I5IA 3QQ4B 1MCFA 1U8QB 3FOMA 4R0LC 3KZ8A 3KWWA 4U6HB 4Y16D 2ED9A 4TN9A 3V8OA 3QRFM 2VM4A 4OFIA 3D52A 2BM3A 1KLFA 4OZIB 4Y2DC 2C5DC 1I8LA 3WE1A 5SWSE 4K15A 3SOTA 1BLIA 3LXCA 1NLBL 5AAPA 1BZ7A 1XTMA 4E9RA 2ZYIA 5FCSH 3SDAB 3VFWA 3VWJB 4ONFL 1SLVA 3FTGA 4RSYA 4NQCE 3MZTA 3DC0A 5HGAB 1AHWA 5KOMC 2DJMA 4Z7WA 3RFRA 1K9TA 1ETZB 3V6BR 4K7PX