3DA0A

Crystal structure of a cleaved form of a chimeric receptor binding protein from lactococcal phages subspecies tp901-1 and p2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
132
structure length
132
Chain Sequence
NVVHKTGDETIAGKKTFTGNVEVNGSLTLPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a chimeric receptor binding protein constructed from two lactococcal phages.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Viral protein
molecule keywords Cleaved chimeric receptor binding protein from bacteriophage
total genus 22
structure length 132
sequence length 132
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3da0A01
4IOSA 3D8MA 2F0CA 3DA0A 4HEMA 3U6XA 2BSEA 2WZPA 3HG0A 2BSDA 2X53A 1ZRUA 4HEPA 3EJCA
chains in the Genus database with same CATH superfamily
5ECGA 4TPRH 1M6UA 5EUOA 5HY9B 5FO9B 4C56D 1DQVA 2PO6A 1IAKB 5HSFA 3UYPA 1F4HA 4AM0B 5TF1H 2APTA 4JE4B 1PX8A 4X6BA 4Z1PA 2XC8A 1J11A 2Y4SA 1Z5HA 4F91B 3K5SA 3NEEA 3DI2B 4JKLA 3VXSB 4NWUL 4ZSOB 5K59F 3D69A 2WQRA 3FSZA 3WHXB 3BJ91 1X4XA 4HW6A 4IOFD 1W9XA 4TSCL 3DVIA 3LN4A 4WTWA 5EU7C 3T1WA 3WTTA 2LLGA 4I0PC 5D1XB 1FH2A 4XH2A 4BGLA 2EXWD 2NNRA 1KTJA 3MLWL 4OF5A 2ZXBA 1FFTB 4O2EB 5T5FH 5GRXG 5MEND 1FGNL 4K8RL 5KOVC 2WVTA 3DX9B 3LXCA 4LAQL 2VISB 1K4CB 1IB5A 3V0GA 3UBFA 1R5WB 2QGDA 2ZUWA 1PMYA 3GBMH 2YQBA 2ZP8A 5F21B 2R1WB 2YXVA 2EE2A 2C9UA 5E2WL 4DQOL 4MQ7B 5C92A 3NCJL 1DSFL 2A4ZA 4ZUUA 5I6LA 4I18A 3ZT7A 2WXQA 3B7RL 5D1XC 2BNUB 3IN2A 1GZPA 1MIEH 2CGYA 1KZQA 3DJSA 4YBQD 3D3VB 2X4QB 4RMRA 4MMXC 4ZUTB 5EF0A 4JN1L 4CILA 1SJMA 3NTCL 3D06A 2VISA 4Q0XH 5CHNA 1FFRA 4YNYB 5C07D 4Z7OE 1EDHA 1E7VA 5J13B 3NIGE 1SDYA 4G80B 2K4WA 1P4BL 1YVLA 2YZ8A 1CGYA 4DN3H 5MEQA 1HTYA 1YEDB 2ENSA 5SWSB 1QX1A 3DSNA 4NKOA 4UNVA 5K59E 1B0RB 1UKSA 2PYFA 3BDXA 4Z95L 1QNZH 4JFDB 5D2NE 3SDCD 3CSFA 5DUML 1CMOA 3NH7H 1MQKL 1OGTA 4J3SA 1UA3A 4LLQB 4BA8A 1BXVA 2H45A 4KTDH 2PYEB 5GRJH 2BP8B 4G80A 2FB4H 2XPGB 2DDQL 2ZKMX 3AAZA 3DVGA 2NY2D 3DX7B 1XBRA 3LMJL 5DHVH 5AVTB 3CH8A 4LHUG 2ADFL 3LRMA 4F7EB 4NC1E 2IBBA 4JEGB 1FE8H 4DWHA 4OZIB 3TTYA 3UIZA 2WB7A 1FLRH 4ICXA 3DARA 1LWRA 3DYMA 4GBXB 2WLKA 4M5TA 2OL3L 4WEMB 4BFJA 3HB3D 2VDQB 1HL4A 3SO3C 4XP1L 2EXYC 4QWWC 1X5HA 2C34A 4FXLA 4U6YB 5C08D 2VN6A 5EC2B 1U93A 4U1JB 4F58H 1X5GA 3L5HA 5D6DA 1DL7L 5I0YA 1IBYA 4K8RC 4LLWB 3LN4B 1MF2H 1MI5A 5E6UB 4QRPA 2F7PA 5D96B 3LH8A 4OI9A 2WTRA 1TSHA 2EYSA 2YAHA 2WGXA 1K5NA 4D0BB 4AL8C 5JA8B 4YGAB 4A55A 4QRUB 3M07A 1UEMA 3L4YA 3H0TB 3P3YA 2EUZA 4JFFA 2B1OA 3WAJA 1S7XA 2R1WA 4KV5E 3PWVA 1DUZA 2Y6SC 4QRPB 3T0EE 2UZXB 3LZQA 1JZFA 4LCIL 4E9WA 1HE8A 3LKQA 5F97E 4IKIA 4JFEB 1E40A 4JANA 1SFHA 2J5LC 1A1OA 4M5YH 2OMWB 1IX2A 3RGHA 3OX8A 4PIRF 4U6XA 3VMOA 3QXDB 1PF3A 5T8IA 2W9LA 3NEXA 5EOCJ 3PCYA 3EDFA 2PWFA 2PCPA 3P9MB 4LKCA 4M29A 3FQTA 2X87A 3FSOA 3VXUA 2NY5H 3NZHH 3QCVH 1JDDA 3TS8A 1S7SB 2O5YH 5I1KL 3SO5A 1BECA 3T4AC 3L1FA 1LO0H 2C1OA 3MRCA 4WKXA 1QRNB 4R0LA 4L4TE 3H53A 4MXWL 4F1ZA 1VESA 1QBAA 4WI0A 3QH3B 3K74B 2HXAA 1KYOK 3V0WH 3TH3T 4CGUB 2XX0A 1PKQA 5H2BA 3IFOA 4LIQL 1BF2A 2KLTA 1U8CB 1JP5A 3HLAB 4WWPA 3PWLA 5AFAA 2K7PA 3H9ZA 4FQXD 1B9KA 2C1OB 2RACA 3TA3D 3NSDA 4Q7DA 5HI4C 4AXWA 5ABAA 1WH0A 4IKKA 4GBXA 1RZFL 1DQIA 3BPOB 3DDGA 5E1AA 3EGDA 1S78C 3QAZC 1HN1A 4XPBL 3ULUH 3UO1L 4A04A 1C1EH 4FEMA 2WXOA 3KPRD 5I8EB 3JV6B 1GIGH 1VJSA 1H3XA 5I1GH 3VYNA 3I6LE 4WSJA 3FKUS 4M1GL 4WUUD 4YHZL 3WFHB 3ULVE 2DBLH 3DHMA 1GH7A 1TNMA 4K2UL 1MRDL 2P24A 1K3ZA 1YO4A 5DZVA 4N22A 4PJ8C 3DRQA 4CDGC 2ZWKA 4MASA 4P99A 3U0WH 5E51A 2ITCB 1DVTA 2EDJA 5HYQB 5D7HA 1UOKA 5AAWC 1A9EB 2YA2A 4AUYA 4QOKD 4G9FE 1RZIB 3MNZA 4KKQA 1KJ2B 1N68A 2AJVL 1LL1A 1WHOA 1HIML 3TXAA 3E38A 4KY1H 1E6JL 4UV7L 3RWJB 2J55A 5FKAA 1NEZG 2K8MA 2GTQA 3ARPA 1NM4A 5ADPH 1YA5A 3B8SA 3MLUH 1A9EA 5DZJA 2VAAA 2J72A 4U6XB 1E5YA 3MNZB 1BBDL 3H3BC 4LARL 5DHYB 5KVEL 2LV4A 5F96L 4HUVB 5CWSB 5HHOB 5AENA 1BJ1J 4YMPA 5FYKH 4RSYA 3QDHA 4WFGE 1JF6A 4IRSD 4AK2A 3V6OE 4J12A 1XEUA 4UOW1 1AGFA 1OAYL 1Q90A 5E8PB 3TF4A 2IPUK 5BRZE 2V5YA 5EF2A 4HPOL 5IOPA 4M7LH 4EO5A 4J6RH 4FD0A 4LSUH 3WN5C 3BKJL 1MRFH 2FK9A 3CDZB 5CGYD 3SPVA 4CRPA 3BD5A 3TWCL 2YPKB 3T4AB 1RSFA 4AXWB 3NCWA 3ESOA 2Q76B 3C6EA 2R2CA 1NL0L 2DYSB 5L9DH 1FNSL 1IZKA 1F3JA 3I3EA 3W38A 2NY7H 2OTUB 5E7BA 2BFGA 4BXSV 3NJJA 3VXRE 4EN3D 3UTZB 1TENA 4R8WL 5FGRA 2JK5B 1NC2B 4QRSB 3DXAD 3G5XB 1GZQB 4MMXA 4PG2C 5I1DA 1EERB 4L3EB 5DYFA 3QJQB 2F19L 3K6OA 3QWNA 1IE5A 2UWEF 4G8AC 5KZCD 4EVNB 2Q7NA 1F86A 4XMLL 1JXJA 2ESVE 3MUGA 3IBEA 3TH2T 4CNIA 3MXVL 2R51A 1G7QB 2LLNA 4ODWA 5JMRA 1S7QA 2WYTA 4OCYH 1UA6L 3EDKA 5J89A 1VCBC 5TDPA 1AR1D 4DP1X 5LG6A 2XWTB 4PJXE 4RDQG 3V55A 3AG1B 1AXTH 3I75B 2OMNA 2TSBA 4HBCH 3RY6A 3SDYL 1HHHB 1RJCA 4Y2OB 4LDCA 3OM3B 4YBQC 4WU5A 3S88H 5D7LE 1D6VL 3HNVH 4G11A 4ZS7L 4L0PB 2XIIA 3MV9A 4BBWA 4XCFH 4HIJB 2ZYHA 2VLRD 4MB3A 3ECBA 4KK6D 3LRGA 4IRZA 5M7QA 4JDZB 3T8MA 1CFMA 2DW5A 4HUVA 1T0MA 1TEYA 2C4FT 4LPTA 1IVLA 3F7VB 5BO0D 5JOFB 2FL5B 1SY6H 1YY8A 1F4WL 4X9GA 5IFHH 1UJ3A 2YK1L 3L1GA 3PV6A 4UF7C 5GZOA 1DN0B 4N3UA 3AU1A 5CLTA 3W5NA 3FU6A 4H8UA 1G7IA 3GLAA 3NUKA 5I26A 5HGHB 2OL3H 2HVKA 5D7SL 1F58H 2BY1A 2WXHA 3E6FA 4MZIA 5EO1A 5DJ6A 1AS7A 1X9QA 5ID1B 4U7SA 1HS6A 5FIEA 2ZAGA 1BZ9B 1EAOA 1MG3C 3KPSE 3P9LA 4XCEA 1CK0H 3SZ6A 4X9BA 4P4KB 3SPCA 3AU1B 2B1HL 1MFBL 3CFBB 3ZQWA 3MLTA 3O4OC 3D48R 1XFPA 4W9HC 1KOAA 4BKTC 3T0BA 1OGAB 4IBWA 1WA0X 3V8OA 3H7BB 4FXKB 4ZFFA 3F58H 1G7JB 3PP4H 1D3CA 4YHIA 1RQ5A 2B14A 2OLDA 4HUXB 2NUTA 4CMMB 3QCTL 4MMYA 1U30A 4L05A 4PJDA 4LLYB 1KENH 4GIAA 5I74C 1C8QA 4BJLA 1ADQA 3UEQA 1FDLL 3RWDA 1B4JL 1ZMYA 4FFYH 1CLOH 3CLFL 4Q74A 1NCJA 3QPQD 1WBYB 1WC7B 3EG9B 5IHUH 3B9KB 1YQ2A 4NHCH 2HLEB 2F7RA 2F7OA 2AQ3A 3ZLQC 1AQDB 3ZSSA 3FN0L 5CZXC 5ANMB 3K6SB 4MQSB 5B22A 1OGPA 1QRNE 4L8DA 5TQ2H 3S8WA 4Y2OA 3E8VA 3V0HA 4PY7A 4H26B 1LK3H 4X9HA 4XMZA 1OAKH 2CIKA 2DLTA 2GJ6D 3OLEA 3DXAE 1DANT 1JZDC 3OB0K 1Z7JA 3ML9A 4JDVB 4ETQB 2NTFB 4AIZB 1XF2A 4YDKL 1P7BA 5JXEA 4XO8A 2C3VA 3O9WD 4HIXH 1FO0B 2GJJA 1FVEB 2XIDA 3BPCA 4HJJL 1S7WA 1OGTB 3PXJA 2Y3NA 5CJQL 5DRXB 4AGNA 1C12B 1H6TA 4NKDA 1EHXA 3RTQC 1QHQA 3IDYB 1BWMA 3HVNA 1Z32X 3FU8A 4W68A 3WFCH 2QV4A 1XF2B 2EO1A 3AS2A 4MA1B 4U6VL 1HCYA 2ODHA 1DZ0A 3ZZ1A 5EEYA 25C8L 1RZFH 3U2SB 1CXKA 5ITBH 1BPVA 4N8CL 4ONFL 4WFGD 2F5BH 1OPGH 2UX6A 3W3BA 1C1EL 5I17B 3ZYZA 1A21A 3O3EA 2Y36H 4FF9A 1A14H 2FJSA 4PJIA 3DV6A 1UZGA 1IC4L 2ED6A 3VD7A 1MFNA 4YBLB 3QFDA 4YXHH 1OXYA 5HGAA 2GUOB 2LE9A 1CU4L 2AXJA 2MTPA 2YD8A 3NBNA 2QSTA 3GSVA 4PW9A 3WNPA 5KWYC 2V7HB 4TM9A 2M83A 1TETH 3TYGL 3MR9A 3BUTA 3QXUA 3BAJA 1FFNA 1RVFH 5E8EA 5IJKA 4XMVA 1J9SA 1IV8A 1EO8H 2LGNA 2Q8BL 4TNWF 1E6JH 1IEBA 4QXUL 2COVD 3D0VA 5C70A 3MRNA 4TOYH 3WS6A 1QNZL 4LHJB 3NGBC 2DIJA 2RQ8A 1EHNA 4L2LA 1WDAA 4FFYA 4MDIB 4R96A 1ZV9A 5KBLA 3PF2A 2OKMA 3KPTA 3KYAA 4KJQD 3S37H 3SY0A 4YWGL 3BX7C 3ORJA 1GSKA 2DIAA 1AG0A 3R7RA 2I7OA 2PPFA 2LU5A 1IUZA 2A74A 3PGCA 4POZD 1HFUA 2A4EA 1GCFA 4RMTA 2JKRM 4PJ6A 1FVEA 3KGUA 4Y19D 5D1QC 5JORA 5BV7L 3CZJA 1TIUA 2ICEB 3QJFA 5L4JA 5ISZB 2WBJD 1EGJL 3LB6C 1FYTB 5K9OA 3WXVH 2NY1C 1I8UA 2VDOH 3HBPA 3T8XB 1NCWL 3EFOB 1X5XA 5F7EL 4NN6C 5GGQH 1V7NL 2MNUA 1HAWA 3CFCL 3RTQD 3GZQA 2VB5A 4RIRB 4PJBF 2NY4B 5CZVH 1TLMA 2NLJB 1IC1A 2C9RA 5DD0H 3QUMH 3QWRD 1YEIH 2IAMC 2P3YA 4A7TA 4OF8A 4L1SA 1TITA 1UWYA 1G9HA 2K3TA 3NFSH 1DVQA 1JWUB 4HIHA 3MJ9L 1LNUB 2Y7SA 3DX6A 2XTJB 3JWOL 1QSFA 1BP3B 1KN2L 1WRFA 1CR9H 2W81C 2ZKHL 1L6PA 4MA3A 1Z66A 3JTSB 2FSEB 4U6HA 3S35X 5HYQA 5E2VH 5CBEB 2AANA 3IXTA 2J2ZA 3QDJD 4QXGH 1JS4A 1DR9A 4PU2A 3TC9A 4ZMYA 1P9MC 4HFUH 3PABB 4LZKA 1LD9B 3DROB 3LIZL 2PTTB 2YEZB 5MEPA 4JKMA 1U8NB 3ARGD 3KPPA 4BM7A 1CDUA 3CFQA 3IMVA 2XN9E 4JAMB 3H42H 2IJ0C 5CR8A 3CTTA 2YWZA 4P9HH 2FSEA 3ZT6A 5EEVA 1OTUD 3NJHA 3DSFL 4WW1B 2F18A 2V5TA 4GQPH 5GGUA 1HEZA 3F84A 1I82A 4I85A 2C9AA 5E0QA 3OHXC 2O5ZL 4QO1A 4M02A 4QPEA 2F74B 4WWOA 5E6ZA 2YK1H 1KCVH 1H15B 2WNWA 1AZUA 1N3NB 1JWSA 3T0WA 3GI8L 3FQXA 1HSBA 4UV4H 1YNTF 2AQTA 4PTUA 3LQZA 4XMTA 1YMMA 2BHUA 5AOMA 2D7MA 3UO1H 4Q9CA 2FQFA 5DGQA 4URKA 2EE9A 2XWDA 1DBJH 5CEZD 1PAMA 1XR9B 3TBSA 3VH8G 1KEGH 1WEJL 1ZT1A 2NZ9D 5E00A 2DWYA 3EF4A 4LHUD 4RFEA 4YHZH 4FMFA 3N44F 1CD1A 2RTTA 1DVFC 3BP5A 4N5UA 5B7MA 3EW3B 3AMKA 3FUDA 4FTVD 3ZDXE 3FPXA 2AEOA 1J1PL 3PUCA 3RKDD 4EEEA 5I75B 1QLRB 1NBZA 3CZSA 4KI5C 2IPKB 2F08A 2G2RB 5T1KD 3OMZA 3W81A 1JSYA 3IETB 2A5UA 2QKIB 4NWUH 2WINA 3FUFA 2IMNA 4MYPA 1G43A 2JK5A 1FL6A 4UT9L 3AZUA 4QR7A 2OP4L 3QZLA 4M03A 4ZFGL 1KGWA 4H2CA 3OC8A 4NNYA 2AFNA 3V6OC 1J0YA 1DBMH 4TVUA 5GRYA 4P5MB 2WBKA 1PJWA 2DICA 4YDLB 5FM4A 5LJYH 4MA3B 5DR5H 5T5FL 2ICCA 2HTKD 2VUOA 3KYOB 3G5VB 1R4XA 2VXQL 4B0MB 4AJVA 3EGXA 3GGWA 3GBML 7FABH 5HYEA 4JHVA 5I1CL 1G7PB 1SJHB 3BLBA 4AK1A 5D1QD 1U4EA 4KRPC 2EIBA 2EQDA 1DQLH 1ADWA 2QADC 1IEAB 4PTTA 5MP6H 3NJFA 2F8OA 4D9RE 1YPZE 3KYOA 5FYLH 3RUGE 3FH7A 4ODVH 2DQFA 4ZW5A 1WITA 1EBAA 4X99B 4UDUB 4WGKA 4EN3A 3AXIA 3ZKQD 1MRFL 4LPXA 4JDZA 1MFAH 1NCDH 3MSPA 4NB7A 2NW3A 1JTTA 3WFZA 5I15H 1ASQA 4TUOA 3MYJB 3MNVA 3T5WA 4NLHA 5L7XH 4ZO8A 1Y1DA 4PTTB 5CILH 3BKCL 4RAUA 4KHTL 1R5VA 4WENB 1UJ3B 2XLLA 5EPMA 2UXVA 2N0MA 5ICXA 4TRPL 1XH3A 5CINH 5BXFA 4XC1L 4PGJA 1A3QA 2RCSH 3SY6A 4MNGA 2E3VA 2HRPH 1D5ZA 1T22A 2VMCA 2B9BA 3MJ7A 4PVBA 3V0VB 4ADIA 1F41A 3U4KA 1OW0A 4A2FA 4ADGA 3G6JA 3H4FA 3TEYA 4XPTL 3P77A 4OF7A 2UY7B 1CIUA 1MFEL 3P9LB 4XCEB 2F54B 4PJ5D 2OQJB 2QGBA 4K23H 3S4SA 2W07B 3U9UA 1IBZA 2GCYB 3GC3A 2A6DB 2JIXB 1XB3A 4AQ8A 2WINB 4XP1H 4RA3A 2ZX7A 4W6WB 5AWNL 3M88A 4FFWC 1OGAA 1M7IA 2AEIT 4AYGA 2ZOTA 3FN9A 3MV7A 1WT5A 4XNZC 2XVGA 2QSCL 2G3MA 4BK8A 5HYJA 3RDTD 4ZW3A 4ZODA 2K0RA 4EI5C 4DP5X 5E9DE 3N0PB 3SEPA 4AVJA 1D5IH 2OMUA 3FRUA 1SXSA 4Y4FA 5I5RA 3QJUB 1NEPA 3MRKB 5FDYA 4Q9BA 2ENQA 3TBVB 2CLZA 2AHIA 3QPXL 3RFRA 3ZDYF 2GI7A 4YDIH 1CFNB 4JN1H 5H8DA 1SY6L 2GB2A 3HZMB 5D7IB 5KW9L 1OF0A 5ANMA 3QI9D 4PP2B 3V4UL 3HC0A 3JT0A 1W72B 4L4VE 3U6RB 5KSVA 3B3IB 1CFVH 2A38A 4JY6B 3WG7B 1NBVH 4WHYH 3VD9A 3GIZL 3N43F 4NKMB 2VLKB 1S9XA 4KTYA 3U0PA 3QBTB 5D7LD 3DO7A 4NQDD 5HJDA 4BWWA 2C7FA 3BYTA 1FYHB 2EH7H 3BUIA 3LKRA 1L5GA 3TT1L 4XXCC 1UOVA 1HXMA 2CRMA 4L1BA 4N90D 5J6SA 4XB7A 1D5MA 3HZVB 4GXVH 2G9HB 4J1UB 4HS8L 1C12A 4NKDB 4PFEA 3V0IA 3FFCD 1Z3GL 5CZXD 3U7YH 4XC3L 2H6UA 4Q9QL 1IVTA 3RFZB 1D5RA 3MOQA 1BVNP 5I5MA 2APBA 1PY4A 4P49A 3QPQC 2BNRE 3DURA 1DQQB 5EZIH 3RWIB 3SE4C 1I7RA 4GAYB 2VXUL 2DQCH 1YEHL 5KYWB 1VHPA 1WWAX 1DSYA 3T2OA 1HNYA 2KC0A 4QKXB 2NNCA 3UTSD 3COOA 1IEHA 3ULVH 1JHLL 3CSPA 4L5FE 2AJZA 4G1EB 4QJ3B 5CXPA 5HTSA 4A37A 2VYRE 4GSDH 4F92B 3EXJA 5BUPA 2XWJA 3SJVE 4XPBH 3ULUL 2NZIA 1L9TA 1F4XH 2DMCA 4PEEA 2VXSL 2OCFD 4YJZL 1JI2A 2CGRL 4NRXA 3VD3A 1QBML 2E9WA 2PPAA 5DO8A 3P4MA 1J8HB 1NKRA 2BZ7A 2GFBB 5I5IA 1U8OA 3MBWB 3JWDH 1XTLA 3DIFB 1RV6X 1LO3H 3WE6B 4APQC 1KTBA 4I2XE 4R0LC 1IL1A 4KO5A 4UM9A 4IS6A 5CJ8A 2YSSA 4OKDA 4XWGH 5F3BB 2GTZA 2XWBA 2XSKA 1NKOA 3MRMB 5IKCA 2BCMA 4C47A 5EB9A 1A9BA 5F6IB 2XOTA 3MMEB 2BS9A 4HWZB 2OMXB 4FG6C 4XHQA 5KBMA 3N9GL 3ELAT 4NKMA 1H5BC 4UM9B 5ACLA 3VWKB 3D2UD 1TZHB 3SPHA 1ZDQA 5F3BA 5SWQB 3FOLB 3A6CL 1QAWA 4PCKA 4HKBA 3SKOB 3OAUH 3MRFA 4H0GA 4G9FD 2Z1KA 1FFQA 5DWUL 4RZCA 1JUFA 3MLVL 2D31B 3X1BA 2CHNA 1ZVSA 3MCKB 3GRBA 3QEUB 3GMMA 4GG6E 4PJFE 1EZLA 1DJXA 1G0DA 4NZFA 3TEXA 4F8TA 4KJPC 4KQ0A 5T5FA 2X6MA 4XAWH 4AJ0A 1COBA 3U6XA 1X4ZA 5IQ9A 5J1AA 5LCVA 3RP1A 1MJ8L 1RLBA 4GSRA 2YMOA 1QSFE 5FYLD 5A6MA 4PREB 1ZVSB 2P26A 4ZNEA 4OLUH 2MCAA 3QEUA 4LL4A 1MJJB 1GC1H 3I2CL 1C9SA 1BM7A 1I3GL 2EDBA 3LXAA 4MVBD 1OK8A 2EDMA 2J88H 2NY6C 1MWAB 3APMA 3ZGHA 4U3SA 3ARFB 4M4RA 2IBZX 4F2MA 1AMYA 2Q7AA 1KTDB 2DBLL 4QYAA 2YQGA 1JV2A 3T2LA 2GSGB 1KYDA 2LFEA 3V2AR 5MHSE 1WF5A 3CC1A 5DR5L 3BP4B 3QUGA 1DE4A 4DK5A 2V5SA 1UXWA 5K1NA 2XY2A 1DLFL 4DN3L 4HV8B 3OLIA 2I9TB 5J9PA 5C9JB 4HK0B 4AENA 5GSRA 4F57L 5JLZB 4X5WA 4OI8A 4TNVK 1IGJB 3PREA 1AIZA 2XT1B 3THMH 1V55B 4OQTH 3CXFA 2VOTA 5DFAA 3MDJA 4PRNB 4JVWA 1FORL 4R7DA 5EU6A 3ZTJH 2CLRB 2VSKB 4LHQB 3RJOA 4AC4A 4ZMPA 1CT8B 2DD8L 3X14A 3QP3A 4UNIA 2VSDA 4EDXB 3MV11 1FP5A 3TZVC 2EXTA 1UA7A 5EIVA 1ZIBA 3N40F 5D7EA 1O6TA 4YSAA 1DFBL 5ICUA 5DA0B 4YO0A 5ALBL 2OYPA 1XL4A 3T0ED 4OZGE 4LO9A 5GS1A 3Q7JA 4MJ5B 4K55A 3O3AB 1QKZL 1QTYT 2F54E 3D07A 4HH9B 5AW7B 4IIQA 2JQZA 3OLDA 4JZJB 5T3XD 1KV7A 3ULUE 1E4KC 3QHZL 3IDGB 1MF2L 1BG1A 1XMWA 1MCOL 2YAOA 4KTEL 4NC2B 2H26B 3KR3L 3NK3A 1RK1A 3BLKA 3MRGA 5DRZB 4YOKA 3GSWA 3L3HB 5HHVH 3BIKA 4RWHA 5TDNA 4POYA 2BSRB 2GABA 1RK0A 3B1UA 3HW7A 3KPQB 1OT2A 1T2QH 3L54A 3VACA 4CSZA 4W9EC 3GKWL 3L2NA 4P2QE 2NX5B 3IDJA 3N04A 5DD5L 2Y3AA 5F7FA 1UQSA 1R3IH 3LV3B 2J71A 1EAPB 1HKLL 2EDRA 3H2QA 4N2KA 4X4XA 1XSJA 4N8VB 4LCIH 4EBQH 4G82A 2VL4A 3K0WA 5LB1A 3EYOB 5D7IE 2XXFA 4H25B 5HPMA 3HPLA 3AXLB 4X0NA 3DVNB 1AFVL 1JK8A 2D2OA 3I3DA 1NUDA 1T1ZA 2GITB 4TYUA 4RVBA 4LPCA 2DQEH 3NP4A 2XETA 3X3GL 1EAPA 4FQXC 3VVWA 3QCUL 4L9LB 2ZOWA 4PWGA 5CJ5A 4GKNB 5L8KB 4M61B 5IJVB 1OLZA 2OL3A 1E9QB 3QR0A 2IANA 43C9B 5IVZA 4X5WB 1HHGA 3VFGL 5IIEB 1KENL 2WQXA 4TSAH 5CSBA 1I7ZB 4ELKB 4R4FL 1EDQA 4C54A 4OVVA 3WXWL 3GSNA 5FM5M 4Y4HB 2YPLD 5TGBB 2R8SL 1QASA 2BVOB 3AT9A 4PMEA 3UZQB 3P0GB 3ABLB 1ZANH 5IEHA 1RUAH 1ZWIB 2VLJA 1OCRB 4NO0D 4R90H 3VYOA 5CN2A 1LK3L 2ZX6A 1CYXA 3QEHA 2BFVH 1BEXA 1M2OA 1RU9L 2PW2B 3MQIA 4NZ8A 3PHAA 4X7FC 3V0JA 4ELKA 5G5DB 3IU4H 1VCAA 3T2NH 1TYRA 2YSTA 3ZTEA 4W9FC 2IO5A 4Y4KA 1MAJA 1EVUA 1L6XA 2FLRT 2GK0A 2XWRA 4XI5C 4XRCA 8CGTA 1JHTA 3DTUB 3QQ9C 5IVXB 1GIGL 4MNGB 5C09A 4APXB 2YGQA 3PGDB 1P7HL 3GRWL 1SLVA 2Y7OA 4M5SA 2YGVA 4AGLA 3GFUA 3DX4A 4K3GA 3TN0B 5JMOC 4NQEB 2Y5QA 1JHLH 3HE6B 4PV8A 1EZVY 4ZUVB 3GXUB 2FZ3A 3QDME 3NA9L 5FFOA 4MWFA 1VGKA 2FSDA 1E7UA 2CQVA 5C0DA 3GBNH 2AKRB 4AT6A 4DN4L 3RJDA 1FG2A 1J5IA 3L9RB 3KE0A 1IBBA 3H54A 2YPVL 5E2JA 1KIRA 3CMOH 1I8IB 4YDZA 4APXA 1AOZA 3OKMA 4U1IB 4ZW6A 1FBIL 4KJYB 4LSSL 3WD5L 5D2NC 2V5MA 1FVDB 5J5EA 3BGMB 1IAKA 3P30L 3AG2B 2IH1A 4AZ8A 5L8JB 3ZE2E 1JFQH 3HS0C 3ETBJ 3W9DA 1PCSA 3DVNA 4Z7IA 4YVUA 2ZAIA 5B7EA 5JPMA 3FRUB 1SBSH 1H3VA 3L4UA 3VWJB 1INEL 4NO2B 4X9YA 3U2JA 4XWOD 5ETUA 4ZD3H 3WY1A 5BNXD 4Z7UB 5KN5B 3AY4A 2X4SB 3HRPA 4PSPA 1SLWA 4WW2A 4OUOA 1KGIA 5J12C 3X11B 4XTRC 2DWEB 3SGEH 1HHGB 3IBOA 4XNUL 4EPSA 3LZFL 5C0CA 4JPVL 2B3RA 1AKJA 2YAEA 2ALWA 3WKPA 4OGAD 5LAPA 4ZRGA 3T8VA 3BVNA 3ATAA 4N3TA 4N0FA 4LXFA 4HEPG 1S9XB 3PYCA 4GRLC 3U0PB 1JN6B 3OKKA 4HS3A 3G6JE 3NSXA 4ORGB 2HJKA 2VGLM 4N2GA 1CFTA 4FNLH 4WEBH 4OLXL 4KUZL 6TAAA 3MV7D 1KT2A 3FT2B 3MC0A 3E80A 3T77A 1MZYA 2JKWA 1DDTA 1QR1A 4P2QA 5TFSL 3G08A 3U36B 4ZUUB 3T1FB 4B7IA 5D1QE 1IMHC 2ZICA 4I18B 2JCCE 3B56A 1NLDL 3P3TA 3VXSE 4EI5A 1UYWL 1E4KA 2TAAA 1WFOA 1OB0A 2CPUA 2HJKB 1HZHL 2Y7LA 3AREB 2F19H 4OY9A 2BC4A 4FG4A 2HUEA 3A6BL 3S3JA 2AW2A 2MHAA 1C16A 4I0CC 4IEFA 4N2MA 4NZRH 2VDMH 4XOCA 3HI5L 2UZYA 2VNCA 4JREB 5AAMA 2ARJQ 4YHKH 2VXTL 5I6MA 2BIQA 4G9DB 4U1MA 5DEJA 1GZHA 4WGVB 1KJMB 3IS1X 1TJXA 2GIXA 5D5MA 4X6DF 3QQ3A 3B43A 4M8QB 2FYYA 2V33A 3FQUA 2J6EH 4YAQB 4Q89A 1X7TA 4XVJH 2VL5A 4FEIA 1TQBB 2GFBA 3S98A 5ES4B 1KDIA 4JQXA 1VADB 2NY6B 3O4LA 5DJYB 5T1LD 4P5TA 5IQ7H 4EE2A 3LRKA 1I4FB 1I1FA 4YDVA 2Y7NA 4NQEE 4U1JA 8FABA 5DFTA 1A6ZA 4MAUH 4Y16B 4CN1A 1KLUA 1GYCA 3PL6C 1L0QA 2OMXA 5EUKB 2WTRB 3SGJA 2QT6A 3QAQA 3BAEL 2OCJA 2IPUG 3UP6A 3NABL 5D5MF 5FC9A 1L4IA 4YLBA 1J18A 1CTNA 3BQUD 1H3TA 4FC3E 1KCVL 3HFFA 3GDBA 4Z7WA 1CIDA 1E67A 2QL1A 1O6SB 5ESAB 3B1TA 3DHUA 1M7XA 1ZTXH 3PJSA 2HCZX 4M1CD 3L13A 3MA7A 5MERA 1A1OB 2W0LA 4M48H 1REIA 1ZEAH 4GPVA 1CG9B 2VUKA 1FZKA 2Y2YA 4ZO9A 2PKDA 4WUKL 2A6JA 4GY4A 5ESQB 1XB6A 3UXFA 1PZ5B 3JVGC 1UEYA 1CS6A 4JFVA 1ZLSL 1OQOA 4N2DA 2H1LM 3RURA 1YEFL 1EFXA 4PWJA 4U0QB 1JWMB 4MVBC 4HUUB 3TIDB 1AQHA 1N64H 3VFOA 1AFVH 4UAOB 4GJTB 2J20A 5KBPA 4LCCA 3RWHB 2OZ4H 1A6WH 1PZ5A 5FGBC 3C9NA 3BP4A 4F7CB 1UXLA 4AEFA 1PKQB 5H2BB 1P2CB 2EACA 1U41A 1CYWA 4OD3L 2XV2A 4HCGA 32C2B 4JFFE 4KJPD 2IFFH 3DJTA 3CAFA 4B3VA 4DCQA 3LZOA 5IR1A 1DCLA 1S6NA 3B2VH 5GS1C 2ZWZA 3QUYA 1WUNT 1A4AA 2LTQB 4K9EC 4ODSH 1JXFA 5FWQA 3O4LB 2FH6A 4S10A 3IDIB 3KPSB 5LQBL 3WN6A 1RUAL 3DSFH 1CQKA 2P7TA 3DOHA 3BP6B 4JO3H 2XA8H 3ZL4L 1P69B 4GLRH 3S7GA 1X5FA 3NCYP 1QSZA 4Y2DA 3UPRB 5DD3L 3EOTH 3NYKA 1G9NH 4L8SB 4ZDHB 3LS5L 2B2XH 4JQVA 3Q8BA 4FULA 5FO7A 4JRYB 2ITCA 4XX1G 1ZLVK 3ZTJG 1QLEL 1A6TB 1FO0L 1FIEA 1XCQA 1Q9WB 3IRPX 3H6AA 3QRGL 4I18C 3RTLA 3S5ZA 4ES8A 4PRHB 2IH8A 4MJ5A 3R18A 1GR7A 2YPLE 4CKQA 2HX8A 4JFPA 3J27A 4LVNC 3TO2A 2VZTA 3HUJA 5EUOE 3IJEB 1GS8A 3ZY7A 1P6WA 5MERB 2CJ3A 4ATWA 1XCQB 1G94A 4QRUA 5D7JC 3X1FA 4EXKA 2QLYA 1FZKB 2H8PB 2ISDA 2QDVA 3RBSA 4L0ZA 3L5IA 1RK0B 3VX0A 5DD6B 3SYOA 2EIKB 5ERWB 2FTAA 1CDIA 1UQSB 1ED3A 1C7TA 4IGBA 4OJFL 4L9DA 1E3ZA 1YDPA 3HZYA 4HJIA 1XGTB 2OSLB 3HUJE 2AQNA 4IBZA 2E7LA 2H8PA 4AZUA 3P0YH 4KXAA 1FZOB 2I07A 1UD8A 4M7ZC 3VXTB 1QWHA 4XE0A 4Z7NF 4G5ZH 4RFOL 5DF0A 2QQKL 3MU3A 3CFKB 4NJAL 3FAXA 3ZBMA 1XTMA 2MQGA 4N2BA 3UTTA 4QIRA 1WTGT 2YFNA 4AMKL 1YDPB 3HZYB 3PNWB 4X7SH 2MTAA 5FYKU 3N40P 2XQBH 3EYQC 1Z0NA 4M56A 2W60A 1IM3B 4JO4H 2OTUA 1BLNA 2PTVA 4OZGB 3L8QA 3KHOA 1VACB 3ULUD 1H6EA 4ISVA 4W9KC 4TLTA 5JDJA 3PNWA 2BVPB 2VZ3A 4KTEH 4TL5A 2ZXDA 2MKWA 4M3JA 3QGVA 4G7YL 3BWUC 1AXSA 3EO1B 4GRLD 2PW2A 5E6YA 4CNIB 3VRJA 1AZVA 3P9WB 3EBAA 3PUUA 4LEXH 4BKLB 4W9CC 2CCWA 4DOHE 7PCYA 1P4IL 1ZXKA 4FZ8L 5AOLA 4XCCL 5D2LF 2JJWA 1N59A 3N85L 1SOXA 3C6LC 3L5WA 1I1YA 3RBGA 5HDBE 2VMJA 4DQOH 2P24B 5GJSH 1BQHB 3P4OB 4GFTB 4ONOA 1G5AA 1LP9F 5EWIH 3MV9B 4LOFA 4BK5A 3KM1A 4BFGA 3EH5B 3MFFA 2FATH 4HU2A 4X50A 3QCUH 3K5RA 2BVTA 4RGNB 1E8XA 4W4OA 5FX3A 4AKOA 2R4SH 1A1NB 1LO4L 4R2GB 1D2PA 1XL6A 2YN3A 1ODAA 3S96B 1MCFA 4YLQT 1KTLA 4QHMB 3TCXA 1QFUH 2IQAB 1J86A 4XNXH 1HZLA 4FKKA 1KIPB 4YIQA 3L3OC 5I0XA 1FNAA 3H42L 4AZ8B 4L4VD 3MLPA 3FFOA 2E7CA 3CQQA 4I3RL 4YDIL 3LPPA 2IALA 5C71A 5F7DA 2O5ZH 3FHAA 1I3VA 5GISH 5TDOA 4FYRA 3B9AA 5H4ZA 1S7UB 2CO2A 1RSYA 3AQZA 2B4CL 2P42B 2FGWL 1XF1A 3D2TA 2CKBL 2DQJH 4RMSA 4ZAKC 3VSVA 4BSWA 2ENPA 3U83A 4GUQA 4OFQA 5D1ZD 5EA0L 3KLDA 2RBLA 1HXKA 3OGCA 3S8GB 5KBKA 1DL7H 3VXSA 3FQNB 3FHEA 3SDCC 1CVRA 1ZTXE 1MCWM 1KDJA 2FT8A 3JWNE 2Z8WC 3AQXA 4NUMA 1CURA 3U7YL 4AV4A 3UTZA 4LLVA 4NNPL 5F8QC 3ZTNH 3KYMA 3TV3H 3T3PF 1FG9C 1UCBL 1W8OA 1FBIH 4KKZA 1VSCA 4I3GA 3RUGF 1VA9A 2VXUH 3L5WB 4UT9H 1G4MA 4UQIM 3WO3B 2AXGA 4XE5B 4PRBB 4FL4B 2R69L 1X5LA 1YEFH 3B2UC 1FNHA 3DRTA 3FU3A 2CBPA 2ZOOA 4P5TC 1SDDB 4GW1B 4J8QA 4ZTPH 4X42A 2CHXA 5JO5B 4ZD3L 3UL4A 2GYSA 3H8NA 3ZMEA 4XPAL 5HYSA 1QNIA 3IKCB 1U3ZA 4HULB 1Q9OA 1MZZA 4ELMA 2AJYH 3QCVL 3FU7B 5EV7A 1JRHL 3B5GA 2BVQA 3IB4A 2NT1A 2IFFL 2P9RA 4GMTH 2IEPA 1GC1L 1QQDA 2XFGB 4ABVA 3VXRD 3EYFB 1OAUH 2BMKB 1MRCL 2BIIA 3SDAB 4BZ1H 1P6FA 3U6XS 1CL7H 5IG7B 1KYAA 1Q38A 2NY0C 5AZEL 4JO2L 4X98B 5I17A 3MV8B 4YFEA 4KROB 1F6FB 4IU3A 1Z5YD 2FH8A 2CJUL 1ORQA 4IMLA 2FIRT 1F4AA 4PV9A 3L3DA 3RGVA 4CSSA 1F45A 3I50H 5DQJB 5F0LB 1YNLH 2HJLB 3FFCE 2ZXWB 5DJ6B 3JQOB 4K8RH 1UENA 3RZCD 5J8OA 3MTXA 2ZCLH 1QLEH 3DJ9A 4IOSA 1MHCB 1F02I 2XFXA 3ARDA 3MFGB 1MW1A 3BP7B 4IU3B 4KXZI 4ZG1A 6PAZA 4XP4H 1YMME 4FLOA 3TZVD 1J9RA 5I9QB 1URZA 4LCUA 4DKAA 5IZ7A 4OZHB 2QMKA 5DYOA 5EEZA 3RGVD 5CP3A 3NTCH 4GIOA 4Q0XL 2NSMA 2E75C 4K71C 3GSXA 3QIBC 1FH5L 2BINA 2Y1AA 3RUGB 2XFXB 3ARDB 1B3IA 3RVWC 4IKNA 2BNUA 3GQFA 1FV1B 3KH4A 2NNXA 4PGDB 5T1LA 2JB6A 5DDHB 2J4WH 5C0EA 4LLYA 5FXCH 1TQUA 1H5BB 2DWSA 2O61B 1DVXA 3ML8A 4UU9B 3T6QC 1CDHA 4RAHA 5AB2A 5EZJA 3VRIB 5D4IA 5MEQB 3KR3H 2F0CA 3KDMA 4K5PA 4XPGH 3QC5X 3V6ZB 4MA8L 4FMVA 2P44B 4G1MA 3IKCA 2J6WA 3QNXB 2WV3A 1LYQA 1W6LA 2HFEB 2IFGA 1CI3M 1NIAA 3GMOA 4GXUM 4N6QA 4XVTH 3VXMD 3LMJH 4PJGE 1JDAA 2DZEA 3QJFB 1UOWA 5ALCL 5JQ6L 1MFMA 1PYWB 2Y2TA 3OHXA 1NGQH 4LKCB 2WKGA 4NFBA 2VC2H 2Z31C 5F7MC 4DH2A 1M1XB 2OK0H 2PNDA 3KW8A 32C2A 4K3JH 4YSEA 3IAGC 1HHJA 4R2GC 1RFDL 2OJZH 2EO7A 3CUPA 5IB4B 1RZKH 3CFDB 2PR4H 3LB6D 3RAJH 2N56A 3THML 1IKNA 4NO3B 1KCUL 1MDAA 4MYWB 1GVIA 2AQRA 2FUTA 2KHAA 4BDVB 2WTOA 2LVEA 4LBAA 3LKOB 4IMLB 4NOFA 5B1KA 3WKML 4YSSA 4Z18A 4B9CA 1M9WA 4GYBA 2IGFH 4XNQA 5GGTL 4CW1B 4K7PY 4RGMB 5CLWA 4MAYB 3UPRA 3AJ7A 4WW2C 3RWGB 3O2VH 4PJ9D 4NERA 3ARXA 1TO5A 4HJGB 4BDVA 3X3FL 1KPUB 2XZCL 5FUZL 4GG6F 4FFZH 3TL5A 4IRJA 5DRWB 4JR9L 5HGAB 4EF3A 5FB8B 5HHMD 4DP8X 3U9WA 4IBUA 1E50A 3L7EA 3QUZC 2YOCA 4GO8A 4EXPX 4JGMA 3REVA 2C3GA 2UZXA 4ERSH 4DKEH 1OSEA 2PF6A 4PN6A 5DUPL 4HIQA 2X9ZA 4NBYB 3HAEA 3MRHB 1FV1A 4RGMC 3D05A 1M6OB 4N8UA 4PLKD 2JB6B 5DDHA 5FAAA 4E68A 4IRJB 2NY5L 1C5BL 3Q3GB 4G8GA 4Y5YA 2WHVA 1NEZB 2L7EA 3K46A 4ONHB 4BWUA 2X6VA 2X3CA 1NDGB 1LO5B 1YEGH 1QFUL 4KXCA 2ZCKL 5I1JL 1I9JL 4KAQH 1OP5K 3MJGX 4DK6A 5KANG 4WK2B 3A5VA 3CDCA 3R4DA 2LLLA 2YD9A 4UZGA 4YHLH 4DGIL 3NSYA 3P3UA 4DN4H 2ITDA 3SY0B 5AD0A 3V4VB 4XMXA 5IESL 3VDBA 1BXXA 1SY6A 2WAQA 1S9YB 3LX9A 4FMKA 1BF5A 1NCCH 4JPWH 4W70A 5DD3H 1F97A 4NQCB 2N1TE 3LZRA 3L7FA 4FP8L 4JRXA 4QNPE 3KXFB 1JV5B 2OZNA 4CVWA 4UZUA 3HN5A 3ZE0B 4U6TA 4ZJ9A 1D9KB 1W8EA 2EDNA 4TPRL 4NO5A 3ESVF 1WGOA 4OJDH 1W80A 2RMNA 1TQCB 3ZYJA 2ARWA 4N6RA 5I8OH 5KYYA 3FT4A 5BZXA 3KH3A 4G7SB 1X5MA 2JJUA 3A4FA 3OAYK 1WZLA 4PLJD 1J5DA 2VXVH 5FO2A 1J8RA 3MAWA 2A77L 4XXDB 1YMMD 3KBHE 1MCLA 2EC9T 5DVLA 1JZ6A 4A6YL 1PKOA 4J3OH 5LGJB 1XGZA 4E42A 4NUJB 1QRKA 4KITB 1DO6A 2ROYA 3QK0A 4L8SC 5D55A 2MNJB 2VW6A 3OZKA 4NUGL 3LEXA 4BZYA 4H8HA 4H8VA 3ZO9A 3MODH 4L23A 1LEIB 3RWFA 2RFXA 4UT6L 3Q05A 3WJMA 5KVEH 1G7QA 4ODWB 5BOPA 3AT0A 4G5ZL 2XQYG 3VI4A 1IT9L 2DQFB 3KM2A 4I13B 4ZW8A 4NZJA 3U4AA 4CC4C 3RWCB 1LD9A 3DROA 4LSVL 1J88A 1GGUA 4YHNA 4MZRA 3VXSD 2NY0B 3GPSA 3PQYE 1LE5A 3O81A 1BGXL 4IIZA 5LNGA 4F5CA 5CEXB 1XD0A 1AE6L 1WSST 2F1AA 2Q3ZA 3B7SA 5DURD 1YEKH 3T0VA 2V6HA 3ZKND 4OIIH 5GGUB 1THAA 2Z92B 5GRWA 5DFVC 4PD4K 5D72H 5JW4Q 3MJ7B 3QHFL 3BAWA 2N3JA 4G7YH 2ZWSA 5MENB 5CJXA 3TIEA 3P11H 5D8JL 4QEGA 5DMJB 4L3CB 4PJAB 2A9BA 3RZWA 3QZMA 5J3HD 4FQJL 2SEBB 4MXVF 1SYSB 1XF4B 5HJGA 4F15B 5GRZA 4QAWA 2GW5A 3D33A 1I75A 3HKZA 4MD0A 1XR9A 5DMIH 5F8RC 5E0FA 3GSNL 3TEWA 1AD0A 4KKLC 1JE6A 3GXPA 3WEOA 3WIHH 4JY4A 2CR3A 4FL4C 1RK7A 3RNQB 3OB0H 4KK6C 5AOZA 3LXBA 2AJSH 4NP4H 4UI2A 3DK2A 4LNVA 1CD0A 2BSDA 2YXWA 1UA6H 4P4KA 2XWZA 3G04A 3G7TA 1YHPA 3QJSB 1A9VA 4BKSC 4TQ8A 1JYNA 5FEBA 4OV6F 1WIPA 5SWSD 4ELDA 4YZWA 5IMMB 5F9JB 2X6BA 1K8IA 2EICA 2J4WL 4QHLB 1S3KH 3QB7C 3AADB 3L16A 4JFDD 3SDCB 5C1MB 2ZXEB 3PL6A 2QGCA 1MHPH 2H2PC 3G6AA 1E3FA 4OZFB 5I5JA 1QVOB 4MX7A 2FRGP 1YN7A 2CG9X 5IBTL 3RWDB 3VFTB 4YS4A 5E1IA 1YN6A 5F9JA 3BDYH 4P3DA 3IJHA 5KVFE 2JI1A 2DQEL 5J4MA 5EBGA 1W0VB 4GI8A 3ZKXC 1UWXH 2HLFD 1RPQA 2ZUXA 4DP9X 3VFGH 2VC2L 3FTVA 2DTMH 4LLQA 4MX7B 4LPVA 4DUXA 3A4DA 4EJ1C 5IEKB 3U1QA 4N25A 5AEAA 3SDAC 4P3DB 4RGOL 3EYFA 4XVUD 3EH2A 3D0LA 4V33A 1OGAE 5FW8A 5A43C 2NW3B 1U42A 5DSCB 4WV1B 5KSBF 5C2BL 1I7RB 3LPWA 1M71A 1DVFD 4B95C 4QTFA 2SODB 2VDOL 1UM4L 4K94L 5FFGA 3HE6C 1HNGA 4L5FH 4OZ4A 1JAEA 2XZZA 2MOQA 3CFCH 5CGTA 3VFRA 1PFOA 1VFBA 2WW8A 3BT2L 3VU1A 4PLNC 2IAMB 1M57B 4Q52A 4KK8C 4LLWA 3CBKB 4DVBA 3KWUA 5JIIA 4J39A 1T6BX 4YC2B 2J8UF 4J2QA 4JPKL 3NFSL 3G6DH 2DI8A 2UY7A 4IYKA 5DVNA 5IM7A 2GJ6A 2FLMA 3FU5A 3KW7A 4ZI8A 5A1AA 4ELME 2OR8A 4R7NB 2JIXA 4TS6A 2NNFA 4HX1B 2ZUQC 3F65A 3PDOA 1UXSA 5TQ2L 4XZ4A 1HL5A 2J12B 3P3RA 4QHUA 5JXED 2DQMA 2HN7B 4HC1L 1QRND 5JIQA 2P52A 1B0WA 4MSWA 1ZLDA 5BJTB 4B9FA 1JI1A 1E4WL 1MCSA 3VI3A 1U8KB 3P30H 3CFMA 2BSBA 2ZCKH 5I1JH 2O72A 3DO4A 3TFBA 2XTSA 4EOWH 3D0VB 3RQ3A 1UXSB 2A4CA 2DQUL 4ZMLA 1BBJB 3VRIA 3R4RA 4TVSa 4NXKA 5EORL 5F9OL 3VWKA 1TKWA 1E4XI 5D7IA 3AXHA 4R97B 3II1A 3RTQA 3JT2A 5B3NA 1S78D 3EHBD 2ZP0T 3Q2WA 4CSTA 1FN4B 4MXQC 4OD3H 2L0DA 2R2BB 3N43B 1YYLH 4J4PC 4NQSB 4XZUA 4XX5A 4YHMH 2PWHA 4XBPA 3KPRB 4X6CE 4M43H 3WMPA 8PAZA 5D96C 2LU3A 1JGLL 2YUVA 2Y36L 1MFCL 4IBTA 1MNUL 3BKYL 2HT2D 3OQ3B 1WBZA 2X0VA 5IJKC 2NY1D 4D9QD 2M1KA 3Q2CA 2WBJC 4LGPB 5FCUH 4R7NA 3NCMA 5C0BA 4KBPA 5PCYA 5EZOL 3QFDB 5TE7L 2GTWA 3DV4B 4HKXA 3ZHKA 3DURB 1U6AL 5I8EA 3IMRA 3VFPA 4HQQH 1OP4A 4WK4B 1G1YA 3GSVB 3KNBB 2H6PA 4M7LL 4PJXA 3F64A 4AIOA 4Y4FC 3C6LB 1ZCRA 3BEVB 3QRGH 3GLZA 5ESVB 3F2LA 5IB5B 2DM4A 5DVMA 1TQWA 2AJZB 4JG5A 2N01B 3BH8A 3D39A 4Z7VE 4XNAA 3BKML 4MRBA 2YGOA 4XBEL 5HHOD 2Y6SD 3W11D 2G5UA 5HGDB 4NKIL 1EBPA 3L7EB 1L0PA 4AYBA 4LU5L 3KPMA 1I53A 3JVFC 4NFDA 1QEXA 2ENJA 3GD1C 2VDKB 4HKJA 3PHOA 4NFCA 3KEHA 3QDMA 4MHHG 4WI8A 4Y4HC 1ET8A 4X6EA 1UB6B 3IPBA 3O8XC 3T65B 2BOCB 5J13C 5ICZB 1NGWB 1BEYL 1JZ8A 2WQWA 3ZHLA 3EOAB 3MBWA 4L4TD 1LDPH 4HHAB 1BYPA 5HGDA 4HAFA 4AKQA 2PR4L 4ZOCA 1LO5A 1QFWI 1YMHB 4NPKA 1FAIL 2K70A 2XRAL 2HTLD 2NQDA 5F3FA 1VEOA 5GS1B 5JPNB 2FB4L 5F70A 5L2KD 3HE7D 3INUL 2XG5A 3GMPB 1JZHA 2EXYD 2FO8A 4A66A 1YC7A 4WW1A 2GI0A 4LPYA 4PCYA 2XA3A 1N12A 3S88L 1CLYL 4J3VA 4OZHF 3BKCH 3TJPA 1FE8L 1HCFX 2MMXA 4LSQL 3W39A 1A8JH 4ODUA 4UILL 1KCLA 4XNXL 1MW2A 1T0NA 5SWQA 4DGVH 4I0PB 1M9SA 2OULB 5KZCB 5BRZB 3S3PA 3PHSA 1KCWA 1GYWA 4NDMB 2BSRA 4M6NH 3NSCA 3OWEA 2X44D 1IIIA 3CFUA 4RH4A 1A7RH 4YSQA 2BVYA 2YO3A 3UBHA 4AKPA 3MNWB 4BFBD 1ONQA 1U95A 4X4XB 4HIEA 4M6MH 3BHBA 4AI7A 4A2MA 4N5EC 1Y6NR 4D8PA 3RGBA 1PG7H 1CD1B 2HWZH 2QPSA 1HINL 3QNZA 2IWEA 3DGGA 4G59C 1YZZA 3L48A 1F58L 1KYOJ 1OW0C 3DGDA 2Q10A 1YY9D 5CIPA 2EZ0C 1XGQB 3TESA 1UZ8B 5C3TA 4I48A 1RXLA 3JVGA 3DMMD 5GZNA 4ZPVB 1V3MA 1A0QH 1JTOA 3JWNC 5CJXC 3TBCA 4CUCA 4TVPH 1A2YB 4YSTA 2OXHB 3LN5B 3GXNA 1JPFB 4OCLC 2G60L 3PABA 5LGKA 3T3MF 5FYJE 5DJZA 1QLFB 1KYUA 1U8QB 2HFGH 2RFXB 3MBED 4J3OG 5TGBA 3A23A 1TVHB 2KL6A 2E76C 2JQMA 2L7JA 4JHWH 1GKOA 1A4JB 2M8XA 1P9MA 1Z5LA 4F20A 4AENB 3MRBA 1AGCA 3ECBB 5DJ8B 4Q6IA 3RA7L 4HHAA 3SDXB 3TNMA 5L2KE 5DHMC 2BNRD 2EUVA 1IRAY 2F1BA 3RB7A 3RWCA 1E90A 1GPOH 4YHOL 1N70A 3N1FC 2QPFA 1BZQK 1A7QH 4O02L 2YWYA 3MUJA 3ARBD 4P4KD 5E8OB 3QWOA 2G9KA 1T89A 3MA9L 3LJ3A 4JCMA 4LIQH 3UGXA 2WSDA 3NIDE 3T3MB 1EMTL 2WUCH 3BO8A 1ILSA 1II4E 1OAKL 2G30A 1FNFA 4CJ1A 1UM5L 1OGAD 2YIHA 1U8PB 3OZ9L 1ZE3C 4FXGB 5HJBA 5FFLA 1EFQA 1JZ2A 1WFIA 4Z0XA 4YFLI 2MPVA 4OFVA 2VIRA 3V52H 1WWWX 2B4CH 4Q97A 4UB0L 4MWFB 1MWAH 2P28B 1OP9A 1TVBB 1CE6B 2VLKE 3QUXD 3SE4A 2V2TB 5E8NA 3PWJB 2DQHL 1MLBB 4LEOB 4DZ8B 3PGFH 5IW1B 3HMWH 2Z9TA 1ZLUK 5E95B 1G7LB 5KJ4A 2D8KA 3RNQA 2W0FA 3B34A 5K1VA 3BGMA 1RZ8A 2HTLC 5EIIG 1J1OH 1PPIA 1TPXB 3APCA 1J5HA 5AAMC 4E9VA 1P5UA 1YPZB 1ZKAA 4JFOA 4MNQA 1UATA 3D69B 4TV3A 3RWEB 3GDCA 4UQCA 4D9LL 1IGTB 1QLEB 4AYMC 1NGYA 2W0KA 1PNDA 3VWKC 1NAML 2VITA 4LMQE 3VJ6A 4PJBB 3P2DA 5DHVB 3G5VA 2CRYA 1JVKA 5JPMC 3VGAC 2JB5L 1URIA 1HQ4A 5ADPL 5HYJB 2DQIL 2YGNA 3HPLB 1H3PH 1MW0A 2JMRA 3LPFA 4F8QA 1ZLEA 4ZBJA 4F9LA 1MNNA 2VR5A 1SF3A 3CPUA 5K33A 5DJXB 4AGOA 1KLFB 3FN3A 4P2RB 4F8PA 4PJ9C 3M1BB 1KEML 1QSVA 2YD1A 4JO1L 4XNYH 4CDHA 3IU3B 4PJFF 2OL3B 2K7QA 3JYCA 4Y4FD 4DPBX 3UZVB 5CILL 5DVKA 2N4IA 1SXZA 2WOBA 3AM8A 2C3VB 5DWPA 1X5ZA 1GAFL 2JKTM 3HRZB 4TRPH 1FO0A 1NGZB 1FFOA 3K6NA 4AQAB 3OKNA 2APWA 1OZUA 4X6DE 3H3PL 2QVIA 5FF6B 5C0RH 4ALAL 1MRCH 5ICXB 4HD9A 1I1CA 1DTUA 1XH3B 4AVKA 4HPHA 4HMCA 3UZVA 3ZDXB 2MOGA 4G8IA 2XZAH 2VDLB 1I8LA 4PJEA 4N9GA 1QACA 4S1SH 4YSDA 2PYFB 1M71B 1SUJA 4U7KA 3GJEB 4YSCA 4GRMB 1NCNA 1DBKL 2UZYB 4W4OC 2YD0A 4ZSOE 5AW5B 4HQQL 2Y7MA 4GO6B 3QIBA 1MJ8H 3PWJA 3NJVA 5B3JE 1NMBH 4OGQC 1DP0A 4AQ1A 4ETYA 1CB4A 4UQBA 3SPGA 1MVUB 1DBAL 4OFYA 3QI9A 3WXVL 1F13A 1LQBC 3CIAA 4NQXB 1W72H 2E0PA 1QPKA 1AO7B 4N87A 3UPAA 1JF1A 4HT1L 3T3PE 1P5UB 1YPZA 3LNGA 4GI6A 1UOLA 2VN7A 3IE4A 1AS8A 4HEPA 1MCQA 2Y9RT 1JZ5A 2H1PL 3U4BL 3MCG1 3PJNA 3QIBD 1QFWH 3BAIA 2GK2A 3V4UH 1I8KA 1X5YA 3FO2A 4OFPA 3ULVF 4I8DA 2DEXX 5BS0D 2ZOLA 1AMXA 5HHPB 2QADB 3L81A 5C07E 1HQ4B 5B1JA 2W94A 3GIZH 4UTAH 1JNLL 2G75B 4E41D 3HJEA 1K5NB 2PP9A 4D0BA 1OPOA 2E56A 2NSQA 3UP1A 5I1EH 5ISZD 1CR9L 1WD9A 4Z0BL 1U8JB 1OM3L 4U1HA 4KMLB 5K9KB 4BFFA 2BCKB 1ZGLA 3JWNH 4WNQA 3M46A 1SQ2N 5KSBB 3ZU8A 2Q87A 1PIFA 3ETBF 3KVDD 1T66C 2GSIA 1FFOB 4AQAA 2ITFA 5HDQL 1EHAA 2ZOUA 3LIZH 3O41B 2RA1A 3RDJA 1IAII 1WVZA 3OQRA 1YEHH 2R23A 2WZ6A 3RAJL 3UAEA 4BH7B 3MA7B 4PJCE 4ZZFA 3IM1A 3MRJB 4PJEB 1ACYH 4NYLA 3L1OH 3SKOA 3SYAA 2DJ4A 1UCTA 3BSHA 4M6OL 4HLEA 3UTOA 4JFQB 5FECB 2P5EA 2UY6B 1JHKL 2YFOA 3CZFA 3GJFK 1WAAE 2IC2A 2Z4QB 3ISWA 4WI0B 5HHVL 1AI1L 2OPCA 2H32H 2X0UA 4LCWA 3QIUC 5IW6B 5IHHA 3O6FB 1A4CA 4K71B 4ZMAT 3U4EB 4NGHL 1ETA1 1FCGA 3O2VL 1OTSC 1TZGL 3FUEA 5L0QB 2V2XB 4G6KL 4JFQA 3ARGB 4MB5A 4GAGL 4RQQA 3T6XA 3VXPA 5FECA 3ROLA 3UYOD 5TK4A 5L2KA 5KYUB 3KCPA 2FJHB 3QNYB 2WWOA 4H20L 1FDLH 2WIIA 3GMRB 3Q1SH 4PWEA 1OAXH 3MJ8A 2B4CC 1A6AB 3OJMB 5DQ9A 4JG0H 5L4MA 2G5BB 3GSOA 1DZBA 2E4FA 3FN0H 4GT0A 2HFGL 3PIQB 1P5VA 3MX0B 1F3DJ 2ZUTA 2X4TA 1HH9A 4M62H 2HRGA 3EBIA 1U2YA 2CLVA 3CZEA 5G55A 2GBTA 3LOWA 1JNHB 4MD4B 4N0UB 1UXWB 4OZIE 2FNBA 3PQYA 2XUWA 4GOSA 1QYGH 1QUPA 5AG9A 3ATEA 2FUQA 1NCTA 4KAQL 2WOYA 1RZIA 1DYZA 2RR3A 1WZ1L 4O5LH 1N4XH 3FB5B 1F6AA 5GZNC 1VKXB 3KYNB 4Z5RA 5JIPA 1UT1A 2XKNA 5I16A 3TVMB 3LQZB 2XQYK 5C0BE 4K8RD 1K2DB 1HHKB 1ZVHA 2AV1B 4W9IC 3FYEB 2VAAB 4PG9A 1MWOA 1Q0EA 4TVPD 4Y9FA 3VG0L 2CHWA 4XAWL 5KVFL 4FP8H 3UERA 2CO6B 3FDWA 3GMMB 4Z7UE 1ECZA 2H4EA 3MV01 4R7VA 4YO0B 1YEKL 5TD4A 2WANA 3FSVA 3US9A 2APFA 2CDGA 3HBQA 1Y7VA 4FQ1L 5AKSA 1J0JA 2EIZB 3HG0A 2AV1A 3GRWH 3UO8B 1NANH 2Z7WA 2JCWA 2HLAA 2Q86B 3DTDA 4G6AD 5L7XL 5FOJA 2F53B 1FZMB 2QKIA 3QXTA 3KL3A 1MPAH 2KZWA 1CD9B 1TTCA 3GBNL 1FH5H 1XR8B 5AW6B 4FTVE 2IWFA 2CDGB 2EIJB 2ED9A 3CFTA 1L3WA 3D8MA 4MS6A 4S2SA 4BWTA 4P59H 3TU6A 2ZD0A 2H0JA 3HE7A 1LDPL 3HS8A 2D7QA 2AVFA 4NUGH 2R69A 4HF5L 4QRTB 5H35B 4LDLB 2VDRH 4JKPH 3SQOL 1OK0A 4HUKB 3MBXL 3G5XA 1P5VB 3MX0A 4MA8H 4D0CB 5JHBA 3WLBA 4R4BB 3IDMA 4ZAKB 1JPFA 4DP0X 1TJHH 4NQVA 4X6DB 1KEMH 1T1ZB 2GITA 3CN1A 4FLRA 4P3WA 3JZ7A 4NSKA 5K39A 5FV1L 1XXFC 2VTFA 3TLRA 4EUPG 4FXTA 4QDGA 5TH2A 2YLKA 4QRTA 3GSUA 1KCRL 1OCCB 3M17A 5LGHH 1MHPL 4WY7L 5H35A 4MBRA 3HIZA 5ALBH 1AGCB 5DJ8A 1ANUA 3OGOE 4F2EA 5FHBL 4KRLB 1NIDA 1LEGA 4XGZB 2BHFA 4JKWA 1BVZA 4JFZH 3DUHA 4ZYKB 4CVXA 3RVTD 2ADYA 5F0PB 2F54D 2ITEA 4TUJB 4BIKA 4FNLL 5DEGA 1MCOH 1K2DA 1XT5A 3STZA 4JCLA 4UOW0 4BA0A 2YD3A 2IPTL 1CBVL 1T0OA 3QJZA 1OV8A 4BFKA 1FSKC 2FX7L 2WXFA 3NPZB 4QTIH 2AEQL 3GM8A 3UTSE 4FA8A 3RHWK 5C0AB 2PCYA 2MCG1 5JUEH 4RGOH 5FKPB 3RDTB 4CVXB 5CZVL 3S4SG 2VIRB 3GSWB 3L3HA 1NMAL 2PP7A 1YEIL 2GJ6E 4PS4L 1FZJA 3P77B 4JDTH 4KO6A 3QZBA 1TVBA 2CSPA 2VABB 4FFZL 9PCYA 4LESA 1AQKH 1CL7I 3VFUA 3F5WB 3TH4T 2Q3XA 4MA1C 3WELA 2YUXA 2AJSL 2X1WL 4NP4L 1LO2L 2G60H 3CHPA 2FVNA 2VXTH 3AQDA 5C09D 3D9AL 4TQEL 3X3GH 4FYQA 2VDPB 3QEGH 3TPUB 4N8PA 4F7KA 1DQJB 2HKHH 4JFOB 1QSEA 1WA2X 2FECL 3DOIA 1R24A 1CF1A 4YDJA 1VFAA 1BZDA 4EI6B 4NQDB 5DEZA 4WTXA 4U1IA 4X5PA 5IJCC 1SJEA 3MRKA 3X13B 2I60H 1I9JH 2NZ1A 2J6EA 4Y19E 5KG9A 2FBOJ 1FIGL 4Y0GA 5C3LD 5DUMH 4QKTA 5I1EL 1BQLH 5SWZB 2J5WA 3WLWD 1I9EA 3VXTA 1KIQB 4PJDF 1OT4A 4MMYB 1HJBC 1HWHB 1OVZA 4OLEA 1OCWL 2NXZD 4B9KC 4E0RA 4NT6A 3BZDA 4H44C 1I1RA 4X6CA 1NCOA 4Z7UA 1PQZA 2UZIL 1E4WH 1L9SA 2DIEA 3GI8H 2NY3D 4MB4A 3T2NL 4HAKA 1ES0A 4LQ1A 1R0AL 1RPUA 1IM3A 4M7ZB 1WZAA 4HWBL 2Q6WB 1TCRB 4B7LA 4B96A 4D9QE 2R1XB 2OM5A 3O3DA 1JG9A 4TUJA 4FXKC 5HHXL 4F37K 2MWCA 4NBXB 2GK0B 1BAFH 4XRCB 3BSGA 4ZFZB 4H8PA 4H8WL 1R5IB 4PRHE 4XPHL 1U58B 2DLGA 4IIQC 5DLLA 5LBSL 1JHKH 3K4ZA 4MNHB 3TCTA 1UGKA 4HXAH 2QSVA 4L5FL 3DRTB 1AS6A 4A2EA 3CBRA 4DO5A 1B4RA 4PV8B 4CBPA 5IB3B 2LAAA 4HSAC 5K9QG 4JY5L 1VFMA 4RBPH 3QFJB 4LVNB 5HYSB 3K72A 2CWRA 2NXYB 4B53A 1I8IA 3DVFA 3IPFA 1BVKB 2BO0A 3S9DB 1RP9A 2BVQB 2VDNB 4H20H 5EG6C 4BRJA 3QORB 5A3IC 3QEQD 2QV2A 4Y2LA 1NGXB 4IJ3C 4HJTA 5FA4A 1D6EA 3CFEA 1MCHA 4M5YL 4MMZC 2YKLH 5CS7A 2ESVD 3D18A 1VGEH 1SMDA 4HJEA 5D4QA 1DVZA 2XKUA 2XG4A 3C60B 3SD5A 2BWQA 4I87A 1QFPA 1A4BA 2NDGA 3D2UB 4X8CA 4JPIB 1KJMA 4H0IA 1L9OA 2B3IA 4WW2B 5TE4H 3SQRA 2D0FA 3KD4A 3QQ3B 4G3YH 5CJBA 1PZAA 4G9FB 5DI8A 4HGWA 3M8OL 3MR9B 3F12B 5C2UB 1AHMA 1BYOA 4HETA 1VLXA 2OMYA 2HJLA 5ABDE 4NKIH 3LKNA 3CHRA 2A73B 2BIOA 5HDWA 3ZDWA 3OR7A 1KB5H 4LIQE 1SEQH 2EVJA 1EAQA 5I73C 4O51B 3QUYC 4GRWF 4U1HB 1AKPA 4XN2A 1HNFA 3SOTA 4F9PC 7CGTA 4UDTB 5DK0A 4X5LA 3V4VH 4KHTH 5I8CB 1KACB 3B2PA 3VXOB 5B8CB 5IFAL 3FHQA 1BHGA 1S8DA 2W65A 1A3RH 3MLYH 5DYOB 4BSJA 2BS71 3FT2A 3QEQE 1BSIA 4IOIA 3CSYB 4P2QB 5DZAA 5K69A 3A47A 4WSKA 1AHWB 3GSXB 4NN5B 3SODB 2K45A 3NIFE 3WOVA 3ARFD 3GSNH 1EEZB 5G4NA 2A6IB 2PXYA 3KBPA 3VA6A 1Q72H 4F7TA 1YEWA 3BKYH 5KVDL 5JNYA 3QWQB 4N2HA 4EIGB 1B90A 4YN3A 4P5RA 1ITCA 1R3HA 2WCSA 4G8EA 4WWKB 1Q94A 2A9MH 2W9EH 1N0XH 4LB8A 5L88H 3EJCA 4G6FB 4G6ML 5DK2B 4R3SA 1ZLWK 3T3ME 1JXKA 5IB3A 1A3LH 4OFDA 4CL7A 4BUGA 2VR6A 4MQXD 2A6IA 3V6OA 5K5YA 4HISA 3O6FA 3SDXF 4JRLA 5A16A 3DBSA 4G1MB 2L7UA 3T8XA 5DO2C 3C8KA 4PH8A 5LAXB 3QG7L 1T0PB 3ZN6A 1PZ2A 3S5LG 1JV2B 2PO6C 1MCDA 2CRZA 4DTGH 2V7NB 1FL5B 1U8HB 3LN9A 3WY4A 3CFEB 2VM9A 4H40A 3TEZA 2CU9A 4KTDL 4U1GB 1YEJH 3E7JA 4UTBH 4LCCB 1NM9A 2EKJA 3D2UA 1HI6A 3NQIA 5F3HA 2DLFL 2E74C 1QQDB 2H7WA 5HHNB 4YXKH 2AEPH 3FOMA 5KS9A 4G9FA 1MY5A 3GMLB 4PVNA 2CUAA 2EIMB 3F7YA 3IMBA 2CR0A 4XNQB 1KBWA 4QD2E 3SOBL 4PJCA 4PR5A 5AOIA 1IQWL 2WO4A 4N2LA 3QIWA 1VEPA 4GS7B 4FFZA 3IMSA 3QUYD 4IBYA 4AX3A 1HKFA 4PJ8A 4F37F 3V4PB 2D03L 2I26N 2GC4C 1HH6B 3RHWF 1CBVH 1AI1H 3FT0A 4G6AC 3EDEA 4S1DC 1VENA 1MI5B 5I2IB 1S7TB 2EE3A 4JE0A 1QSEE 2WUBH 1AHWA 4XWOC 4LOUD 4R8WH 4DNLA 4Q56A 3TA3A 1WFJA 1EIBA 1KY7A 3FRPA 4W6YB 3G5WA 2W80C 4FERA 1QWUA 3N85H 1J0ZA 4BFRA 2KYIA 3BPOC 3LQAC 2WUCL 3IDXL 4JFFB 3AREC 4PTUB 1U8MB 1M2VB 4N2IA 2AXHA 3PQYD 3R06B 4FOMA 2V9RA 4Y1TA 3SQBB 4WDIA 1PG7L 3NESA 2FR4B 4G71B 4P46C 3TBSB 1A6WL 2R56L 5A3ID 1FZMA 3P02A 3I6GA 1HXYB 2PTUA 5F9WC 2AJ3B 2D7TL 3F8UB 3QXDA 2O6EA 4JMXA 1UKTA 3PGFL 1JPTL 1A1MA 4JK0D 5JW4R 2H6OA 4Y4HD 4KH9A 4LKXB 5ERWA 5FS5A 3FTSA 1NWOA 4FKEA 3WY3A 5JDSA 4Y2DD 1J1OL 3W11C 5IHWA 4NO0B 4I9WE 2DWDB 1H3GA 1RJLB 4P2OD 1JK9A 3D3VE 3MRCB 2YBRB 4PB0L 5EORH 3KPOA 4E5XA 2V3FA 4GRLA 2Y06L 4RDBA 4JFTA 1EO7A 1UM6H 3GMQB 3CMOL 1HI6B 4M6AA 4FQHA 5LGYA 4MHHI 3VFNB 1A1MB 1I7ZA 5C08E 3V6FA 5KS9B 1NFDA 3CFKA 3S3DB 5C0FA 3SBPA 5K39B 2DQTL 3UH8A 4XXWA 4PJEE 4WFFE 2DIBA 3HLAA 1E5BA 3ZDYE 3VRLF 4DP2X 1NLBH 2BSSB 4YFDB 5CGMA 4JFHE 4MA7H 3V5HB 2EDTA 1TJMA 4ZDHA 2OMZB 1KWGA 3FF7A 5D7JA 3HC3H 1VF5C 1MNUH 2DKUA 2EH8L 4NQED 4P5SA 1TTGA 3ROOB 2OSYA 1MXGA 3G9AB 1NFDB 5CCGE 3HHMA 3MA9H 4JFUA 2IOOA 4PJ8B 1PCXA 1RHHB 4EUPH 4M9OA 1QTPA 4XNUH 5CM1A 2FDBP 1MH5A 3QQDB 4GB9A 1NJ9A 3M86A 3NZUA 4A63A 1CLZL 2KUTA 4YEFA 2O6PA 3FB7A 3RWFB 3BPLB 1T1YA 3ZIMA 3PWPD 1VPOL 2WTPA 2OAAA 3PFQA 4RISL 4XBMA 3BEWA 4ZW7A 3PE9A 2XN9B 5KTEL 1G7MA 2Q0ZX 1O0VA 5IMKB 1KCSH 3GYRA 4RAUB 4A7VA 4FZEH 4KUZH 3VM7A 4G6JL 2R2EB 3EH4B 4YK4B 1N59B 3VWJD 3DIVA 1NBCA 4MDRA 15C8H 4J3TA 5FV2A 2Y22A 3CNKA 1DANU 1FHGA 1N7MH 1EA9C 1IC7H 4LFHD 4TQPA 5DA4A 4PS7A 5IMKA 4NJAH 3DLQR 3KAAA 4QGYA 2DEWX 4OZGF 2DKSA 1E4HA 3ZE2B 3W0WA 1UT9A 3AFLA 3FCSB 4D9LH 3KHQA 3B5HA 1HDMB 4M7KL 3LDBB 5D7IF 1NDGA 4U49A 2VDKL 4UIKL 4YPGA 1DEEA 1BEYH 3WUWA 5E08H 5EEUA 1JVLA 2DM2A 4XN8A 2JLLA 4JZNB 2WSPA 4NKQB 5HVHC 3K7UA 4PAZA 1U4FA 3C5JB 3Q9QA 1FAIH 1KXQE 4JFZL 3HKFA 3WUZA 5A2AA 2B39A 3MV7B 5CEYA 1RI8A 4YE4H 5CSZB 2IQ9H 1SEQL 3VFWA 5JW5B 4XCYA 3EJYC 2JE8A 5C0FB 1TVDA 4NNXB 3BW9B 2VN5A 1RZGA 4NQCE 2O26U 3W82A 4GSQA 5SX5K 2Z34A 2CLZB 1K3IA 4KZEH 1MOEA 1PQZB 4FHKA 3IRZA 2H9GA 3PXHA 5DMGD 4ORGA 4ONFH 1NMAH 1ICTA 3FO9B 5EBLB 1I7TB 4FZ8H 4QRFA 4ALAH 2VLMD 3ROOA 3AT8A 5AW4B 4DW2L 1UWEL 4CU7A 4DGYH 3SGKC 1RHHA 3UAJD 1H9VA 1RZGB 5C86A 4ZQKA 3OMAB 1EHKB 4L3EA 2X70B 1KG0B 2E27L 5L2JA 2GBAA 1XIWB 3FB7B 3QDGA 4NHUB 4OF0A 5EBLA 4A2DA 4C56B 1JNNH 1U36A 3DJZA 2NYYD 2V2WB 2UUDH 3HMXL 4L1DA 4NCC1 1Z0MA 1ZK9A 1W15A 5AKRA 2NCEA 4TSBL 1BZOA 1VIWA 4IDLA 2EDEA 4J1UA 4WSGA 1MIML 4KDTA 5K9QI 5HVFB 2C3WA 5DZPA 2XQYA 1NOAA 4LCYB 3SPJA 5I28A 5DJ2B 5LN4A 4JO5A 1DQQA 2F8VA 4N0RA 4XPFL 1SOQA 1PZCA 1PLCA 1XWVA 4J3WA 4OKVB 1N19A 1PS3A 4MNQE 2QQLL 4Y16D 1FNGA 4B9PA 3Q13A 4WQOA 3W37A 4XP5H 3U46B 3GSRA 1KELL 4JN2A 5DRNB 1MCBA 2R29H 3ESPA 4LCYA 4L8CB 3TGXA 3NJLA 2JV6A 1TOXA 1BVOA 5LCVL 4DJMA 3FYIB 2VQ1A 4FQQB 4JPIA 4A2HA 4Z7QE 2HPTA 1ASPA 2EDHA 3DK0A 1AR2A 4BE5A 3DVGB 3RIKA 5AVYB 1E2VA 2X4RB 4FNPA 5EBWB 1SM3L 4OLYL 2DWXA 3VXRA 5BS0E 5IWLA 4NNXA 1UWFA 4XPHH 2PUQT 4L48A 3C5XA 4PJAF 5DJCA 2O6DA 3CX2A 5C07B 4ATTA 1Q4NX 3SKJH 5DD1L 5ACZB 4Y1AE 2YD2A 3BZFA 1E27A 1QWNA 2EDWA 4U05A 2WNKA 3MLZL 1RIVL 1F42A 5F1SA 4ZTEA 5A7EA 2ATAA 3UTPE 1MWAL 2XCMC 3BGFB 1QMUA 4U7MA 4K3DH 2QR0A 2W8CA 3UTQA 3CZUB 1JCKA 1PLGL 2JCCA 3L4WA 3N2JA 4EUPA 3RZCA 2F2HA 3OLGA 4FQ2H 4PP1C 3D3VA 5HYFA 5BUAA 5IHUL 5GS3A 2JQAA 3DIDA 4OIBA 4ZPTB 3RVVD 5GHWH 3UCRA 4BK4A 1B3JA 3IMWA 1EX0A 4XMKL 2QR0B 1JGUH 3MOAH 3PWVB 4R3SB 3EG9A 4P3CL 1KBKA 3ULSA 3C12A 3DSNB 3GTVA 4Q6YA 1IFHH 3O4LD 4GBXD 4HFUL 5F44A 1ZHBA 1PD0A 3HB3B 4LSRL 3RIAF 4FQLH 4YHYB 2PXYC 3M8OH 4I1NB 2L4OA 5C08B 3RWHA 4B9ZA 3DPBB 3L3IB 4PB0H 3H6JA 5B1CA 2BDNH 4HUWB 1X6LA 1RJZB 3CFNA 4QCIA 5I19L 4JO1H 3A0OA 5DRNA 3HUJF 4L2YA 4S1QH 1BZ7B 1NANI 3LZFH 4LOVA 4ODHL 1ZLVH 3KPSA 2H47C 4O00A 5F3HB 3V4PH 2EADA 3IFPB 3V5DA 4G8FB 4HF5H 2ICWB 5EC2A 4PRHD 2Z4TA 4PV9B 3K1DA 4J8RB 2BH0A 4PJDE 1UFUA 4O02A 1DEDA 3D30A 2CDEA 4O5LL 4EKJA 3AMLA 5KVDE 3FONB 5GSRB 1SN5A 4L8SA 2R4RL 5DJCB 2XTJE 4I5BA 4QF1A 1ZHNB 1TQBC 4X6FB 3EGDB 3EYSH 5G4MA 1IBGH 5E6IC 4CADA 3ARYA 2FJUB 3I9GL 3L95B 1NUGA 5FHBH 1IAIL 3BI9X 5ABZA 1S7TA 4AQ1C 1A4KA 4YSPA 3Q06A 3REWB 1DJZA 1XGRB 3ASWA 2Y07L 5I1AA 2QEJA 3TBYA 4Q6KA 1AAJA 1OALA 3C2AL 4JANB 3WTVA 2K3HA 1X9RA 3KLKA 3HA0A 2FQGA 1E28A 2BERA 4E9SA 3QNFA 4JFSA 2R2HB 4OM0H 3AC0A 3EJRA 3GXFA 2ATPA 4HS6B 3MROB 2FEDD 3ZZQA 4M7JH 3TFKD 1N5AA 2HJFA 4IU2A 3HZKB 2C26A 3RWJA 3VW3H 3O6ML 1QSFD 4FA7B 1CCZA 1E5UI 2FIKA 1KIUA 2Z8SA 4JM2F 5F89A 3C6SB 4LL9A 5GGSB 1WPCA 1X5JA 3MLXH 2BP5M 1LO2H 3MXVH 5I1HL 5AVZB 1PDKB 2X41A 2P5PA 3D25A 3AWGA 3MZTA 3NH7L 4OIAA 4Y5VB 3V8CA 5HHOA 5C6TH 4KOBA 3VRLE 2WZPD 1HHJB 1XH2A 3QS3A 2EDFA 3T0DA 2B77A 4OIIL 3PWLB 1DJSA 3LYRA 3IDNA 4NDMA 3SKMB 3EBGA 2FT7A 3ZE1E 1VERA 4GRLB 4NO3A 3OKOA 4PRAB 4GG6B 5AW1B 2Z31A 2W60B 3NFPA 5D4HA 4JGJA 4H25A 3AS0A 2VO8A 2F6AA 3GB7B 5E4EC 5IB2B 2IF7A 2UXFA 4P0DA 3NIGF 4V1DB 1FIGH 4R7LA 3L7FB 4BH8A 4X5QA 1QA9A 2QPEB 1BREA 2P5WB 4KKRA 5F7WC 2BSEA 2WBWB 4MAYA 1UWEH 4KNQA 2AABL 3OV6A 2XJLA 3UX9B 1QI4A 5DHEA 3MJ9H 3MV9D 5IMOB 3WDIA 2EDKA 3C2SA 4QY8B 2HZHA 3SCMB 1BOYA 1CFSB 2EYTB 4OUUA 5DRWA 4BQ8A 5KYYB 3B8YA 3WNIA 2JFCA 2VW7A 3G5ZB 4R2GD 3GMNA 3ZO0A 4JFWA 2ICWI 2WO3B 3NCCB 2P80A 5EN2A 4Z77B 4PJ7F 3REWA 1KB9J 3MRDA 5EA0H 1T1YB 3RVUC 3SYQA 5IK3B 3MV9E 5AKVA 2IBZY 1WBXA 5DC9B 3FB6B 4UNTA 4ZFOL 3SJVD 4L4VB 3BD4A 3ZQ9A 1R3KA 2LQRA 4AG4L 3UABA 4P9HL 4AIEA 4HFWA 1UD4A 2DOCA 3QPXH 1F5WA 2PTTA 4U1GC 5CWSA 4B27A 3KS0H 4J6IA 3BIAX 4KUCF 3HI1B 5JHLH 3TV3L 3WJMB 5AL0A 1JDCA 3EJSA 5AD0B 3CSBA 1DJYA 1L0YA 4HIJA 3V4VA 3ABZA 2PO6B 4QLWA 1CFVL 3UFIA 2HG0A 4TUKH 5MEOB 1HDMA 1GGCL 3LEYH 5D1ZB 2VDRB 1NC2D 1RL1A 4HFWB 3DXAB 3K81A 2D73A 3ZSTA 4P07A 2OJEA 1ITBB 4L3ED 3MACH 2A2QT 4HEME 1DCEA 5JPNA 1S9WA 1VGEL 3O3UN 5LQBH 1XGUB 3IDNB 4MXVE 5DUBA 4UMSA 2BJML 5T3XH 3VD5A 2E5EA 4K94H 3SDDB 4HS8H 1CLZH 1AR1B 4NQDE 4O58H 3S6CA 3ARBC 4TVPE 5ID1A 3BW9A 3RZCC 1H0DA 4XH2B 3T0EC 3IGLA 3FULA 1GZQA 4MMXB 4RX4D 5I1DB 3KWWA 4P2YA 4Q9RL 5FO9A 1HAUA 3HLKA 5LDUA 1OWRM 4L9LC 5B3SB 3FL7A 3HFML 1KTCA 2VKWA 3CXHJ 4G83A 5HHXH 3I6KB 4GIPD 2VLRA 3QHTC 2PPDA 1TG8A 4HWEL 1EUUA 2EEDA 1FAKT 2OW7A 1MREL 2QKIC 2QZQA 3L3GA 3FB8A 3U2IA 2OI9B 4JX0A 1WJ3A 2QGEA 3OAZH 4HS3B 1E8YA 2RAMA 2D7NA 2W38A 2X3AA 1DDHA 3OB8A 2WBXA 2ZE0A 4I0KA 4M7KH 4GXUN 5FA3A 5HBBA 1JZGA 3PWNB 4JVUA 5KVDH 1IC4H 1WAAA 4D3CL 2EZ0D 1P6AB 3LSOB 3ARZA 1Q8MA 1F3DH 3C60C 4WI9A 2Q8AH 1NGZA 2WLLA 2WZ0A 4KROD 4WLCA 1FJ1B 1LE5B 4LARH 4BFNA 1YN7B 1IEAA 1JZJA 4K4KA 5BRQA 1EUTA 1RVFL 3A3YB 4MQ7A 3K2MC 1K9TA 4G70B 4IEFB 2OYKA 1HEHC 3IKKA 5EIIA 4CVZA 4EZKA 2D7OA 3V4PL 3MRLB 3V0DA 4G9DA 3W56A 2XKSA 1QEWA 2UWEB 4N68A 1M7DA 2RCSL 4L4JA 3CC5B 4FA6A 2BSTA 4CVUA 4XP9L 5I30L 4KVNL 3BZ5A 1SHWA 1IGFL 3D0LB 2GJZA 4JZOB 3L3DB 3RGVB 2FD6H 5AZ2L 2BWIA 3GF8A 3B9KD 1RZQA 3HE7C 3V0VA 4I3SH 2VL5B 1SJVA 3DX1A 1MHCA 3BWZA 2PYEA 4I2XA 5FGCB 5HGBA 2XPGA 1RZKL 1EK3A 2JKIS 1ZT4A 5F1NB 3SOBH 4X7TA 3Q6GH 4FG6D 4RFNB 5I66B 3ZOAA 4PV1C 4K5LA 5B7FA 3OC5A 4NXSA 5JW3L 3UJIH 4Y16A 5GGVH 5GGSY 3VQ1C 4KWUA 2UZPA 4R6UA 5T1MA 4X8GA 4FJ6A 5LO7A 2KLSA 1H3WM 4QHLA 4FS0A 3RI5F 5EOCL 3RUGA 5EZLA 4FQCL 4E41E 1C08A 2NOYA 3NIGB 4UTCA 1KYFA 1J9TA 1YNKH 2FATL 4WO4B 1AYOA 5AL8A 1MHHB 1WG3A 3II3A 2WWKO 3HCVB 1N9PA 3L08A 4Q2ZA 5E99L 1IGMH 4HIIB 3FQTB 4AIZA 5FUCC 2EC8A 3VQ2C 1J9QA 1LP9B 5ICYB 3NIDF 5AW3B 1N0LB 4L37A 4N0CC 7TAAA 5AVVB 2OX5B 4IHOB 3EFFA 1MCWW 2WSKA 2IOMA 2KS0A 1XGPA 3J07A 1SXCA 1UWGL 1FORH 3B4NA 4YZFE 4Z7OF 1BBJA 1YEJL 2DD8H 3ASOB 4BH7A 2ZXAA 4LOEA 5CEZE 3NK4A 5IFHL 4JFEA 3BAXA 2UZIH 1NA8A 3M1CA 3OXRA 1R0AH 2UYLA 2P5EB 2UY6A 4G7VL 2ODIA 2EC9U 4KKBD 2IDTA 3MTRA 4AC2A 4XZUB 3L3JA 2YHGA 3MV7E 5ISZA 4IMKC 4K3DL 2A99A 3UYRL 3VXUB 3NGBB 2ARJA 2CKBA 5B39G 4JZOA 1IQWH 4Z23A 2VZVA 1KLGA 1UM6L 1WFTA 1XZ0B 1GS7A 4HUNB 3EXLA 2V2XA 1KPVA 2NXZC 3UIYA 2AQSA 4MMZA 4OZFH 4WWNA 2K9UA 5FUCE 4OD1H 1X5KA 4ONGH 2I9LB 2P8MB 4NRZA 4R0LB 3MLSH 4YGVA 3FQ4A 4J5VA 1XAKA 3KCPB 3FH8A 3FTUA 5IM7B