3DA0A

Crystal structure of a cleaved form of a chimeric receptor binding protein from lactococcal phages subspecies tp901-1 and p2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
132
structure length
132
Chain Sequence
NVVHKTGDETIAGKKTFTGNVEVNGSLTLPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a chimeric receptor binding protein constructed from two lactococcal phages.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Viral protein
molecule keywords Cleaved chimeric receptor binding protein from bacteriophage
total genus 22
structure length 132
sequence length 132
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3da0A01
2BSEA 2X53A 3HG0A 2WZPA 3DA0A 2F0CA 3D8MA 4HEPA 1ZRUA 2BSDA 4HEMA 3U6XA 3EJCA 4IOSA
chains in the Genus database with same CATH superfamily
5A2JH 4HCRA 4ERSL 1NPJA 1DSWA 4FQ2H 2GTWA 5HDWA 1T5WA 2BP5M 3ET9F 1P7KA 3M8OH 1E27A 1QI3A 2EIDA 4DEUA 4QY8B 1NCAL 3SJVA 1QABA 3B37A 4M8QB 4YGVA 3FUIA 1UACL 4ELDA 4FZ8L 2BIMA 1DL7L 1NBZA 8FABA 5IFJA 2NDGA 3QI9C 5DJAA 2VDKL 4L5FH 2V17H 3RVTD 3VXRD 3MI6A 3JWDC 3PQYA 4MA7H 1MREH 4Y16C 3U46A 2VN7A 3UTQB 3H0TB 4HUXA 2WW8A 3TZVA 1OOAA 4IM8A 1FVDB 1KXTB 4ZT1A 3FCSB 4K9EL 1BVNT 1YJDL 1C5DA 1I8MA 1T2QH 3NJFA 4I9WE 4PRNA 5C07B 1GY2A 2ZUQC 3MJ7A 2XXMB 3B7YA 3IDGB 2OA9A 2ZOLA 3AS3A 4HU2A 3ARPA 4HLJA 4LSTL 3UG4A 4CC4A 1K4CB 4QRQA 4FULA 4NZUH 2YPLE 4IGBD 1ZA6B 2FZ3B 1AO7B 4HWBH 4WNQB 1CMOA 5GGQH 5EHFA 5DHMC 5ICUA 5F88A 2IH9A 4WSKA 5BQ7A 1F18A 4EI0A 1QATA 3EYSH 4IGBB 2Q7AA 3FOLB 2JKWA 3QC5X 2FHCA 1NFDA 4LL1A 5GS1A 2W0FB 4ZFOA 1E6JL 3QQXA 4O51A 1BWWA 1UFGA 2HG5A 3AUVA 5CXPA 4KTYA 5K39B 3PP4L 2AABH 3QIUB 1DVFD 4AQZA 4YHKL 4P5KA 5D7IB 1BP3B 1ITCA 3RZCC 3Q44A 1FN4B 5DK0A 4NIKB 4AL8C 2BWDA 4GXUN 5EDXA 4K15A 2IXQA 3KWWB 5IV2B 3S88L 1WRFA 3QCUH 4ELMB 1KLGA 4XVJL 5K9KB 4DP5X 4U1LB 1LO3H 1P4UA 2WLIA 3K6NA 4O02L 1NUFA 1RIHH 2PTTB 1N2RA 1W8NA 1MFEL 4N9GB 2ARWA 3KD4A 4DVRL 4ZSOB 3TA4D 1ZDQA 2GEEA 1XBRA 3W39B 1KTDB 4D94A 2XNAB 1FGVL 5E4OA 3CLEL 4I18A 5BOJA 5FKPA 2X1PA 1MXGA 5TTRA 2ZPKL 1A6TB 4PRHB 5EIQA 3ARBA 3P4NB 5DMIH 1CXLA 2DQIH 2JKIS 1U3HB 1HEHC 1UM4H 3BXNA 3EYQD 2VLKB 3VFVB 1YNKL 4A67A 1ZXQA 2EECA 2FGZA 4XCEA 1FE8H 4WJG3 2IGFH 1X5LA 3MRRB 1D5MA 3DX8A 4OM1L 4XX1E 4DK6A 3NN8A 4KRNA 2J4WL 4P23C 2VLKD 1ZXKA 1HSBA 1UM4L 5T5FH 4XI5D 4F2FA 3W3BA 3O3EB 2AZUA 3O6KL 1CE1H 5AZUA 3F12B 2BSCA 1D6EB 4K73A 4KX7A 4BFOA 4Y0GA 1IB5A 4X5WA 1N5YH 3SZ6A 1HILB 4WO4A 1RY7B 3F01A 1MW0A 5CEZH 1BA9A 1ZJBA 2YC1B 3EZ8A 5KVEE 2XSKA 2GI7A 2BH0A 4G3YL 1HI6A 2EDBA 3KVPA 2JCCB 2FJFA 1RKRA 2VLRE 1BHGA 4X7TA 4R5TA 4WI4A 1HT6A 3KS0H 2RCSL 4NI3A 4XI5C 4N0FA 4AYDC 4YDIL 1GMEA 3K1DA 4XOBA 3RB5A 3TJEH 4ZRGA 3EJZD 5ANMB 3TO2B 3JBG7 2WD0A 4PS8A 5G2NA 3S34H 2BSDA 5C3LD 2R1WB 3LN9A 4B9JA 4UQ9A 3K8LA 4QJ3B 4UOZA 1KLGB 4JB9H 3F00A 3FT2B 4B5ZA 5C0BE 4S2SB 1TEFA 3J2PA 2XZQL 3LXCA 4PTTA 4YZFE 3UTSE 1XR8A 1T6WA 1ZGLP 1KCLA 2OJZH 3L2NA 3ULSA 2BJML 3QYMA 1ZHNA 2EKJA 4NCC2 4AZ8A 4PJ6A 3BPOC 4M7LL 1PZ5A 3TYGL 2MOGA 3ETBF 1TQWA 3SPVB 5JQ6L 1INEL 3GM8A 5T3XD 3H9YA 3IXTB 3BN3B 3BVNB 3T77A 4K5NA 3LYRA 1EAPB 1XL6A 3X14A 2ILLA 2K3TA 3RTQD 4JRLA 1TTAA 4H8VA 5I16A 3T6QC 3QH3A 5JO5B 3FSWA 4GG6F 1LTXA 1U8IA 2D4DA 3QWNA 5I76B 1H3WM 5HHOB 5KW9L 3BHBA 3AMKA 4QYAA 1HFUA 4L3EE 5CJOL 2QQKL 4GBXA 2VC2B 4MB5A 4L37A 5L7XH 1GHFL 2Y0SA 2E7DA 1I8LA 5LQBH 4Y4KC 5LGHH 3T4AB 1G7HB 3LQAL 1LO5A 4YDIH 4YPGB 3AG1B 2AEPL 1QOKA 3VCLA 4DP6X 2CO1A 5E1AB 3DX4A 3CFEA 4KI5D 1U58A 3TWYA 1T0NA 4FQJL 3QEHA 1I8IB 4ODUA 4TUKL 3HE6A 3SCMB 5KEZA 2QDWA 1GZPA 3PQYE 2Q10A 5FOBB 1EJ8A 1K72A 4MGXA 4ZXBD 1DLHA 2RH0A 4PJGB 2DQIL 5JOEA 2FWOA 5HGGS 2V5SA 3DSNB 2F8VA 5DHYA 2WO4A 1M42A 5AVSB 3UYRH 4UTAH 4KNTA 2F53D 3HZYB 3B5GA 5AB1A 6FABH 2EUWA 1P7KB 3LZOA 4U1NA 3S4SA 2V9RA 4DP9X 4KFZC 3T8VA 2GVYA 7FABH 2Z0UA 3RI5K 1CD1A 1M7DB 3PWPD 4KI5C 5HYSB 4AH2B 4OQTA 1QYGH 3FU7B 1D5ZA 1A9EB 4HA1A 4J28A 4BCZA 3C5ZA 1S7QB 4KY1H 4LNVA 4Y9CA 4Y9GA 5IB4B 4EUPA 2EIZB 1U93B 3P4OB 4Y1AE 2E8ZA 3MNZA 2IEPA 2YN3A 3EKCA 3Q3GA 2YPLB 3OKKB 5MEPA 4XRCA 1NCUA 1M05B 3MLRH 3FFCE 5IBLD 2WLJA 1YYML 5AENA 3MRJA 1CGXA 1ILSA 4J3BA 4WNSA 2RQ8A 3QP3A 4J23A 1ADQA 1E4HA 1H3XA 3U79A 4JCWA 4LOFA 2ADGB 3QQDA 1V7MH 2FO4B 1R9FA 3QUZD 5DHXB 3F8UB 3E6FB 3KYMB 4L1BA 3L4YA 1DQIA 5T1KA 4YE4H 3ZIMA 2KUTA 1QFWM 1JXJA 4K4KA 2OQJA 4JO2L 4TL5A 5HD8C 4JO1H 2UXVA 2BLFA 5IESL 1MLCB 1R33A 3MV9D 2AQQA 3OKYA 4UB0L 4M7KL 4ZUWB 1C5CL 5E7FA 3GUTA 4DH2A 3O2DL 3MV7E 1HQRA 2HFFB 4Q14A 1MCOH 3M86A 2C3GA 1CLYL 1O7DE 1HE8A 3P4LA 4HLZH 3FQTA 4HXAL 2ZKMX 2EEFA 4XB7A 3T2PA 1BQHB 2VQ4A 3P54A 1ZCRA 5EU5A 1SEQH 2NY2D 4LHUD 3FTUA 4MX7B 5JNYA 2OXGA 1A4KA 3ZKMC 5LXVA 3IFPA 4ODHL 3PAYA 3RUGA 4L37B 4X4ZA 3F84A 4WRLA 5FO8B 5C0IB 5GS0D 2RJMA 4OFYA 5L7XL 3DMMC 4AIEA 1JV2B 1BFVH 1N2RB 4BWUA 3RWJB 2NW3B 1VFAB 4WHCA 4URKA 1O6TA 2MIZA 4ONGL 3VFPB 5IW3A 2V33A 3CCHA 4DVBA 4HOWA 1G6VK 4E36A 4U49A 5IQ9B 1CD0A 2KLSA 4TNVF 3CFBB 5C6WH 3GTTA 1P84J 3S37L 3TGXA 1ZE3H 4YWGH 3P9LA 1AQKL 2XN0A 4LT7A 2H32B 4WW2F 3AW5A 3CJJA 3L2MA 4PJ9A 1CXKA 3MRKA 3V5DB 3CV5A 5DRWA 5HYQA 3OQRA 4P3CL 5H2BB 4GUQA 4AQEA 1A6UH 3BP4B 1D7CA 5E8EB 1T0MB 2TAAA 3SYPA 2WXQA 4IGBA 4AW4A 2I9TA 2H1PL 1YAIA 2PPAA 3SDAB 1G4MA 3H6JA 4PB9H 3ZZQA 3HN8A 4KJYA 2YO3A 4LGPB 1W0VB 2BFGA 5CWSB 3HRPA 4NXKA 1ZA6A 1HH9B 4NO3A 3DYMA 3RX8A 3OZLA 4IRJB 3D6GA 1KB5A 1MCRA 1SOKA 4Y9FA 3TZVD 1A6ZA 4Z3JA 5D7JC 3X1BA 1QNZL 4HJGB 5HPMB 2YEZB 4XP6L 3V6OE 5IHUH 2AMGA 2YC1A 2ZOUA 4NO3B 1ES0B 1JGVH 3QUXC 3T0EC 3LPGA 1IGYB 5I8EB 3ML9A 5EO0B 4BFJA 2EDLA 2JI3A 4RA0C 1EAQA 2XV3A 4FQLH 5JDJA 3MUGA 3NRPA 4DGVL 1F8TH 1JAEA 2CM6A 4BFKA 2X6VA 4PJFE 4HSAC 2EDWA 2A0LD 5EF2A 4P4RA 5DUBA 2XUWA 1G84A 4G70B 4X7SL 3A24A 5E8EA 1HQ4A 2JB6A 2L7JA 5ERWB 3WLBA 4M43L 3P30H 3BIKB 3F7YB 3HRZC 5CLZA 3T0ED 3OKMB 4HF5H 1H6EA 2ZKHH 4XO8A 5A6IA 5KBDA 1RK0A 4IOSA 4NJAH 4XCEB 4DKTA 4E0RA 3WXWH 2VDMH 3WFBL 3H9SE 3SBRA 3IPEA 4XWGL 3IAGC 3PGFH 2N3JA 5ID0B 4XC1L 3OJMB 1IM3B 4Y5XB 3I75A 4MNGE 2HRHA 4D7BA 5LG6A 1J48A 2EZ0C 2ADFL 3N41B 1SEQL 3IETB 2WO2B 3ELAT 3MLVH 3V7AE 5EZIL 3LVEA 3OF6D 3KM2A 3FB6B 1KJVB 4P05A 3MRIB 1IEHA 3P4OA 4XO4A 2WCSA 1A4CA 1UT9A 3OV6A 3H7BB 1I3GL 5DQDH 3CZFA 1UJ3B 4DTGH 4CADA 4FLOA 5KYWA 2F08A 4AEHH 3QIWB 2F7IA 2NYKA 3C8KB 3LRSA 4Z9KB 5BO1H 4U0RB 1UG9A 4OCMC 5E9AA 5ICZA 1BOYA 3E6HB 4PRHE 5EZIH 3GSWA 2BFVL 3FQRB 4FXTA 4FQXD 4JM2B 5DK0B 2DLTA 3M1CA 4WGWB 1CYXA 5F72S 1UA6L 4NSKB 1F1DA 3QIBC 3S3SA 5CJXA 1OAUL 3WD5H 2NY3B 2CLVB 2WQSA 3AQYA 4ZUWA 4DGIH 3VDBA 3O2WH 3A23A 4XVTH 1HZHH 3EGDA 2IAND 5KOMC 1YJDH 4OD3L 1F4HA 1TLMA 3HUJB 1JF1A 5DEJA 4QO1A 1RURL 2EXWC 5F88B 1E9PB 2VERN 3LQZB 3NACL 4EN2A 2BSSB 1CLOL 2CLZA 3DHPA 4GPVA 4PB9L 4XVSH 5CMAB 1YG9A 1NCJA 4PJFF 5AAWC 1TFPA 2CGYA 3TO4C 3SDXF 5BV7B 3DHUA 4ETYA 5D1QB 1BZ7A 3D39A 1QWUA 1MHPH 5FGRA 4WKXA 3RX5A 4RETB 1KB5H 2I60L 2YD4A 4XP1H 1MAJA 4KVNL 2NQDA 3SKNB 3E8VA 4JVPA 4ZFQA 1QLEL 3JUZA 2Q8AL 4PJEE 5FW7A 3TO4B 3FH5A 2K6WA 4KZDH 1IZJA 1FO0H 4WAFA 3OMAB 4JY4A 3DV4B 5ID0A 4XN5A 2DM3A 4GIOA 3PP4H 5C0GA 4KPHL 3RWGB 1ZLUK 1JK8B 4MA7L 2O6PA 3L3IA 4Y2DC 4H8WC 2VZ1A 1J9SA 4FI7A 3I6SA 3BN9C 2Q8AH 2CRZA 4ENEC 3PAUA 5DFWH 5CMAA 1J0ZA 4I1RA 4D0CB 1NGWA 5GRYA 1BEYL 4MXVE 3AXLA 3GBEA 2DJ4A 1HEZA 2ORBL 4P3CH 4L4TB 3LDBB 5JORA 3DGCR 1F3DJ 4UOQA 1ZSDB 4RDQF 1I4FA 3ZDZF 4NQCE 1AI1H 3HE6B 3SCMA 1T89A 1T1XA 1GC1L 5D7LB 3L9BA 4P2QB 1EXGA 3MJWA 2WQWA 2XN1A 5J1AA 5IOPA 3NUKA 2KYIA 3S96B 4AENB 4NNYB 5CEZE 3M45A 1RSFA 5HGAB 5I5RA 1UZ6F 1YPZA 4BA8A 4PJ5B 3TH4T 4L1DA 4PFEA 4OKVB 2DQUL 3E8UL 3OC5A 1J1XL 3A6CH 1F1AA 5EEWA 2UX6A 3UP6A 4EAEA 2G9HA 1XGPB 3EFFB 3L1EA 2OCFD 1I1FA 1SDAB 5FM5O 3UO1H 1BJMA 3F7LA 2OULB 3GHBH 2FATH 4PJCB 1RUQH 3TCLB 3HVNA 2BFVH 4AXWB 2DQGL 2FX7L 2QQLH 4HOMA 1OK0A 3VXTA 3OAWA 1RQ5A 3L4CA 3MBWA 3F7QA 3BVNA 4KV5F 4KU1A 4KQ3H 1Z0NA 1PSKH 4FFYH 4B5EA 2A9MH 3DRTB 2OCJA 4D0BA 5L2KA 2A9AA 4IKLA 2GITB 1ZLWK 1FNFA 1NCCH 4IDJL 1ZLVH 3D18A 3QG7L 4YFLF 4LLMB 5AWNH 1GTFA 1NJ9A 1RIUH 2Q3AA 4PJ9B 1X44A 2L04A 1XMWA 3F65A 2PWFA 3AXHA 4N2OA 3GSNH 1E50A 2AK1L 2VDMB 5F0LB 5SV4A 1CU4H 3C2AH 3LKSA 3ES6A 2ZWYA 3VXMD 1OAKH 2UY7B 3RVUD 5ESVB 3ZQ9A 4Q9RL 4ECNA 3RZCA 1DVUA 2WXIA 1XCWA 2VZTA 3PABB 5AYUL 4PRAA 1CWVA 2N1TE 2DN7A 5IROA 5IHHA 3QDGE 1KEML 1H8LA 4A55A 2FWOB 3O41B 4LSPH 4MHHI 4P4KB 2JTYA 1THAA 2KS0A 4F91B 2XRAH 1U0QA 1SY6A 3GMRA 4O02B 2AXHA 3QNYB 3PABA 4B96A 4U1SA 2C1OA 1HSAB 1SY6H 4JM4H 3U1QA 3ZTJH 4ELMA 2WCPA 4XX1G 3MHZA 1Q9WA 4P2RB 2P48B 2PW1B 1CE1L 1IAKA 3IDXL 1FO0L 1C08A 3VG9B 2K9FB 4W9JC 2Y07H 4JGMA 4R26H 1F13A 1TYRA 4I77H 5D4JA 4C83A 1BZ9A 3UTZB 1GKEA 4YDLB 4M02A 2QTVA 1WQVT 1U8JB 2UZXA 5E08H 2P80D 3QUGA 5BZWA 1EHLH 3POHA 1YVLA 3RTQB 3L1OH 4OJDH 3ZX1A 4M03A 3DX1A 4QUOA 3AAZA 3V0EA 1YNTF 2Y07L 4R26L 3DO7A 3MRBA 1JD7A 2HXAA 4P5MB 4QRRD 4O2FB 4P4RB 4XGZA 5GIRB 1NCBL 1QSVA 3CDGB 1X5FA 3L3KA 5DJYB 3GXIA 1JGLH 1FGVH 2FAUA 3H42L 5F71A 4I7ZC 4XMPH 4OD3H 5H2BA 4L05A 1KC5H 1UZ8B 2IIJA 5B3SB 3F83A 4Z95H 1W2KT 1G7PA 2Z93A 3QPKA 4F2EA 2VSCA 1GS6X 1I1RA 1FC1A 3TCTA 1LNUB 2FBJL 2WB1A 4XE0A 3DMMB 2LFGA 4N2KA 3UXFA 4U6VH 4Z7UE 1EO8H 2OX5B 5C3TA 3ZKXB 5ITBL 1A0QL 1DJWA 4AG4H 3FT2A 3TBWB 3X12A 1PVHA 3ZDXB 2ROXA 3V6ZB 4YR6B 2N56A 1MIEL 2MCPH 3CZLA 4OH2A 3V6OA 2WXJA 2AC0A 2JI2A 1ZS2A 2H2PD 2A38A 4LPYA 5K9KA 3OSVA 4NM4H 4FI6A 3C08H 3LZFH 4JZJC 3TBWA 3X12B 2GJRA 5C0CA 5E99L 2DH2A 3LN4B 3LPPA 3MRNA 1ZHLB 3OWRA 3IFPB 3WFCH 4FA6A 4TQ8A 4RMQA 3L3GA 4PWIA 1J5CA 2GJZB 2FATL 1MFCL 1KJ3L 2VDNB 1BQKA 2PKDA 3P02A 5EB9A 3TVMD 2PWDA 1FNAA 3UJIH 2VRQA 3P3RA 4Z8FH 3UGUA 2XZAL 3VXPA 5FO9B 5IEKA 1KXVA 3OHXC 1RP9A 3S0PA 4JREC 1KPUB 2DQFB 1LQBC 4LDOB 1E0OB 4MA3B 4Z7QB 4MXWL 4JRXD 3B2VL 1Z5LA 4ZX6A 2Y3NA 1MQKL 2ZX6A 1PDKA 3H42H 4U1JB 4AJVA 3ZR6A 4KKAC 5C9KA 1FYTD 2NY0C 2YSSB 3ZRSA 2OK0H 3T2OA 1BW8A 2ZCLH 1I7TA 3O6MH 2FH6A 4HS6B 4V33A 5HYJE 1M9WA 3H54A 2VISA 5ADOH 4C4BA 2YPVA 1KEMH 2N59A 1EO8L 3ARVA 3W9DB 2XLLA 4AEFA 2PW1A 3HFMH 4TQIA 1AXSA 4NQDE 3VWJA 3MLZH 1KF9B 4XXDB 1FFRA 3VSQA 2J56A 2XFXA 3W81A 1FZOB 3AT8A 4YHNA 2PCFA 4LOUC 1IBHA 4X8JA 3ZDYB 5KVDE 2EIJB 4OV5A 4ZSOA 4XP4H 3N40F 3ML8A 3TWCL 1UA7A 2P4AB 3KLSA 4UT7L 4ETQB 5F7AA 5J57B 1LP9E 1AH1A 4U1HA 3IJEA 2CBQA 4XNAA 15C8H 1YY9C 3L17A 4HZAA 2F5AL 2FUTA 3QXWA 4HEPG 3X3GL 4A7VA 4I3SL 4TSBL 4HGWB 2YUXA 3ES6B 1UWFA 3EYUH 2A6KB 4HJUA 3RWFA 5KSAC 4KXBA 4YSOA 2Z65C 5CEYA 1IGMH 4I13B 4DAGH 5E6YA 4FS0A 3K46A 1S5HA 4ZPTA 3KL3A 2I5YH 4M4RA 2ALAA 3PCYA 4UQ3A 5AOLA 2CIIB 2JKLA 2VN6A 4NNXB 1MIML 2Q6WB 3BAEH 1KLFB 1MNUL 1N0XL 1QQDA 4Y9EA 3HHSA 5FCSH 3ZL1A 5DVPA 4ZD3H 1URLA 5I1KH 4A6YL 1BQ5A 3BEVA 4PS7A 5TDNB 2ESVE 3LIZL 4WTXA 3FJTA 3GSUB 4KNSA 4U3SA 4X9IA 4M5ZH 4NP4L 1AGDA 2CA3A 4Q2ZB 5CINH 3WL9A 1JPFB 1RZGB 1SRDA 4QRRE 2WNWA 3MAWA 3OKMA 2QLYA 1GPOL 4NDMB 1KBWA 3NSYA 4X5WB 3FDWA 1FP5A 1W6WA 2NYYD 4X5LA 1WAEA 2R59A 2ATPA 2Z91B 3NSJA 3KPPA 2BSRA 5GGRB 5B1JA 2CCVA 3FBKA 3VNZA 1ZHBA 1MCNA 4BFRA 3S5LG 1P6WA 5JMOC 5M94B 2CJ3A 4CU8A 3QEGL 5B4MC 5A3IC 2I25N 3TZVB 4NFDA 4IHOA 2EUVA 1M2VA 1UUNA 1GZPB 5EOQL 4UT7H 1KCUH 1KIPA 4KVPA 2ZCHH 2DS4A 3GI9H 5SWQA 3WIIH 1YYMH 4RRPG 1PLCA 1IU1A 4P2OC 2BM3A 3AXLB 1GTNA 3DI3B 5HHXH 3WEXB 2BY3A 1E8ZA 2GHWB 1HHJA 3LNGA 4QRUA 4M1GL 5I18H 3JTSB 3C6EA 5BOPA 3EADA 3U0PB 3ROOA 3PHAA 1KJ2L 4HJ0D 3VSVA 4MQSB 4EI5C 3ZDYF 3IGKA 1FQ9C 3G3LA 4WEBL 2O6DA 2CIKA 1RPKA 1ESOA 4ZX3A 1RK7A 4Y5VC 1AZNA 5KVFH 1S46A 2IAMA 3DK0A 3DX0A 1T7YA 4S1DD 3SDYH 3KWVA 1S9XB 3KLAA 4MDIB 3RX9A 3NRFA 1OD7A 2M83A 3FT4B 2KERA 3ZRFC 5IMKB 2DYRB 5E6IB 2QSCL 4HULB 2NZ1A 4R8WL 2XXGA 5D7SL 1D6VH 4Y8DC 4GKSB 4U6XB 4M3HA 4QRFA 3NIDB 1HNFA 4OIIH 3Q01A 1HL8A 5BXFB 2XVBA 4QHNA 4XO9A 4Q4IA 1M57B 4FDWA 2R0KL 1OGTB 1MH5A 3D87B 5I71C 4XCNB 4ALAC 1SMOA 1VZIA 3PE9A 3QDAA 4G59C 4R0LB 3QUKA 4O2CA 1KZYA 3ZMRA 1E7VA 5DJ2A 4KUZH 2FX8L 4P5MA 1P4BL 4JFEA 4LLQA 1F11B 2B59A 3KPRE 4ZSOE 3L54A 3P2DA 4X6DA 2FEDC 3FMGL 3H7LA 5C0EB 3BPLC 4LOEA 1IC4L 1LDSA 3C5SA 1QBLH 2ZUSA 5AAMC 3ISYA 4XPGH 5FAAA 5KVDL 4MS8C 4JFPB 4JZNA 2Y22A 1WCQA 4B7IA 2W9EL 1J1OL 3KPSA 4H8QA 5BZDA 2AITA 3O9WD 1ACCA 2VRKA 4UTCA 1N10A 1RK1A 1BYPA 1A1OA 4U7MA 4ODVL 5LG1A 3RWCA 4K0OA 4Q9RH 4HFWB 3PWLA 3RZWA 5D6DC 3O6LH 4DFIA 4JBSA 2FR4B 1U2CA 4PWKA 4L8SC 2FIKB 3UBXB 2IBZY 1JWUA 2DWDA 2DQTH 1NBYA 2H2PC 1SDDB 5EU3B 5ISZB 1OTSC 3WTYA 2R29A 2C7UB 1FL3B 3NSXA 4GP5B 2R56H 3V4UL 2VZUA 4OLEA 3QUZC 4X4ME 3HI6L 1BM3H 1JRHL 3BT0A 2NNRA 3D50A 5DHVB 2Q3ZA 1NWPA 3MA9H 3ZHDA 2X09A 1EEZA 1I1AC 3GDCA 4EN3D 4RFOH 3ZOAA 3O45B 3GNMH 1WGOA 4GH7B 1JGUH 3KLAB 2PYFA 1IBGL 2R0KH 3DVFA 3HRZA 3VA6A 3VU2A 3ZKNC 4F8QA 3LX9A 1IQDA 1I75A 1ZD6A 2BC4B 4KK8C 4MA1C 5AAPA 2VR6A 1JGVL 2MNWA 3WLBB 4E9RA 4EN3B 4ZZKA 3CPUA 4AZUA 4ZTOL 2IH3A 1RCYA 1N4XH 2DYPB 2QFPA 1AYOA 3QULB 2V2TA 1CF8L 3MRFA 3VFGH 4W6XB 3I74A 3ETBJ 4XODA 2B2XL 4IKKA 4L3FA 1JGLL 3Q0HA 4EN3C 1FH5H 1T1YA 2VT0A 4A38A 2XACC 1A3LL 1BF8A 2C4FT 4NZTL 3CFDB 4Z7UA 3PL6B 5HPMA 3P9MB 1CDCA 2Z1PA 3LNDA 4YE4L 3CBRA 4P99A 3QHZH 4U6VL 3CMOH 1MI5B 1WF5A 4M6ML 3EFOB 4DKEH 3AU1B 3V55A 1DN0B 4TULL 2BS71 1YEHL 4P8QA 1UT2A 4FQ2L 4CSPA 1BZ8A 1BJ1J 1JUFA 1PD1A 1FFOB 3BVTA 1SQ2N 3FTXA 2WLLB 2BP0A 5CR1A 3HAEH 4WTWA 3D30A 1S7WB 4JDTH 4A39A 4TNVK 5H8DA 5L2JA 5CLYA 5DZNA 3OXSA 2EE0A 3KXFE 3PPSA 5FCUH 4AY0A 4KHXL 3H3BC 3RIFF 2B14A 1X6LA 4NO0D 4PP1C 2XWXA 4DGVH 3RNKB 4EZJA 5EO1B 2BOCB 4BFGA 2Z31C 4N2MA 3MRKB 3V5DA 1G7JB 2B16A 2I7SA 4OZGE 5EBWA 1M1SA 3P9LB 1QRNB 1KBGL 1DSYA 4N6RA 4F20A 3G04A 4AIXA 4PEEA 4UMGA 3FZUC 5G4OA 5LDUA 3H85A 1J7VR 5IMOB 1P7QD 3F3HA 4BCXA 4YBLC 3BVVA 4Y5YC 1BDYA 4PJCF 2LOEA 3WIFA 4I2XA 1OV8A 3QG7H 1F58H 4PI0A 4QRAA 5D7JD 3RL2B 1JCKA 1JP5A 3VXMB 4RH4A 3UZQB 5I2IA 4RWHA 5EMYA 1MI5E 4JHAL 3KCPA 4OB5H 1TYJA 5AG9A 1JK9A 2AFNA 4X4YB 1LEIA 3UG3A 3RUGB 4ZS6C 5MENA 3NFSH 4KVNH 4ZXBC 1BGXH 1BFOA 3BEWA 3QCVH 3HBQA 1ZPUA 2BSBA 5JZ7C 2LLNA 3WUWG 5EU7C 1MCDA 4OLUH 4K7FA 1WH0A 2CE6A 4WEUD 4GKNA 3BWSA 2Z92B 1XB3A 4H8HA 1SFDA 2IALB 4NCC1 1MW3A 1VFMA 3MRHA 3HBGA 2EKSB 3JT2A 4JDTL 3VRJA 4NP9A 1MI5A 3KLKA 2R2HA 3LH2L 5C0AB 4Y1AA 4GT0A 3CVDA 1Q0YH 4P2OD 3ECBB 3FU8A 4KQ3L 1DTUA 4YPGA 3MRLB 2DLGA 2WTPA 3VX1A 4M4PA 5JZ7D 1K6QH 1OZUA 3TYFA 3DXAB 2UZPA 2FWLB 3HR6A 4DGYH 2E59A 5E00A 4XC1H 5C0RL 3SD2A 2DQFA 1OL0A 2DQEH 3OWEA 1IFGA 2KT6A 1OKEA 5D2NA 2ZOTA 3MNVB 1EJOH 1U8PB 3Q48A 4FN0A 3CXHK 2YPKB 3V0WL 4DP7X 5IEKB 2OR8A 4JPKL 3DXAD 5TE6H 4H5SB 5D4IA 1L0XA 1QASA 5K1VA 1FH5L 4PGCA 1FDLH 4K94L 4YSSA 1T4KB 4LRNL 4GG6A 4Q9CA 1HIML 1I3GH 1GIGH 3GSNA 4FI8A 1R5WA 1RUAH 3BYYA 4H8WL 3JV6A 4MZ2A 2ERJC 5JA9A 5LLIC 3LZLA 4LDCA 4MMZB 5E5UB 5KSUA 1NCNA 3HZ3A 4HUNB 3S9DB 3RWDB 3CLFH 3F6IA 1IGCH 3UDWC 2JCWA 1I31A 5CEXA 1BAFL 2B20A 1IGFL 3H56A 3BQUD 3EG9A 4OZFB 4HUVA 3IE9A 3L4WA 4QOKA 4WUUD 5DUPH 3PGFL 2DMKA 3VGHA 4A2FA 2FQDA 3GNML 4NKIL 2B0SL 4ZMOA 4G80A 1QFUH 3MACL 1JWMA 1HKFA 3BZ5A 3BO8A 3TIEB 1WUNT 5FV2A 4A63A 1RJYB 3L8QA 4JFWA 3VSTA 2EXWD 5IHBA 2Y72A 2K3HA 1M71B 2YUVA 3BUBA 5B38B 2AQ2A 4H20L 4JZOB 1GGIL 2X5PA 5KVMC 5DJZA 1RURH 1BXXA 3DRQA 4P5RA 3HNTH 1AHKA 4WV1A 3TO2A 1DJSA 1NEZG 3HLKA 1J9CT 2A9NL 3B3IA 3L08A 4QRSA 2IAMD 4MS8D 5KSAB 1LO5B 3L3HA 4AMXA 1LMKA 2Y7QB 3HHRB 3FB5A 1CG9A 5IJKC 4HHAB 3LNIA 3ARDD 4X6CB 4KKZA 1BD2B 2QBWA 1CIDA 4PRBB 1AMYA 2P5WB 2XZAH 1D5XA 1ZANH 2IGLA 2V5MA 1CUOA 3O3AA 3EW3B 4IMKA 1HDMA 1MAKA 3LKRB 1FYTB 4FOMA 2EO7A 3LOWA 1KLUB 4HZLB 2P5WA 1RXLA 4MNQB 5DUML 4UU9B 1U8JA 3MU3A 2CO7B 3BN9D 2OZ4A 3VXUE 4TYUA 4XMLL 1TG8A 4N22A 2GG1A 3WE6B 2DBLL 1BM7A 1UGKA 2UWEA 4NQED 5I74B 3VJ6B 3MTRA 1R17A 1A14L 3QPQC 5J1TC 3IFLL 3VFNA 4OLVH 4N0CC 4ZDHB 2GI0A 3BPNB 4N3TA 4AKOA 3PU7A 4PTTB 2NY0B 4Y7MA 3V8OA 5J89A 3N0PB 1DQDL 3U0WH 5IEHB 1LWJA 1BQLH 2R69H 1MFCH 1J0KA 4DK3A 2WN2A 5KSBA 3FU9A 1HE7A 2X41A 3LD8C 2D3JA 3MJGX 1XR9B 4ZS7H 1DBJH 3TURA 1YC8A 4KK9C 1J8RA 3INOA 3MRMB 5FYLL 5DO2C 1EQWA 2CAKA 2HTKC 3L7FA 2R2EA 5IEHA 1HC1A 3D7PA 3W0WE 1ZV2A 4X5XA 4QRPA 2X2IA 1PPIA 3KPOA 5JW3L 3NIGF 2H1LM 3NSDA 4XBEL 1I8AA 1YEJL 4F7CB 5C6TH 1IBYA 2DTMH 2GIMA 3C5ZD 1GA2A 3GRBA 4GRWF 1BVLB 5F44A 1OB1A 2APXA 3IRPX 1ZY9A 4UQ2A 4YFLI 3ARZA 4AMKL 1NJ9B 4ODVH 3V6FA 4KQ4L 4KZEL 1IGCL 3FT0A 1CR9H 4OSUH 3VG0L 4WFFD 5SWSE 4P5SA 5E2VH 1XXFC 2OXHB 4ZX4A 2IDCA 1IAOA 1E2WA 2UZIL 5KTEL 2LV4A 2P8MB 3H2WA 4O2FA 5FUZH 2E7LC 4I0PA 3U83A 2FD6H 2ATPB 1D5IL 1SM3H 2IC2A 3GSOA 2XX1A 1CK0H 3HPJB 2F9BT 1BPVA 5C0AA 5F7DB 2VXTH 3HNVL 1P84K 4WENB 3UFIA 3VWJD 1WFJA 2V7NB 4BFIB 1PZDA 2GUYA 5GRWA 1JGEA 5E1QA 4QRQB 5F6IB 1LQSR 4JG5A 4WW2B 3QI9B 3DUUB 3IDGA 4U3SB 2DMCA 2BNQD 2PXYB 4NZUL 4M1DL 4OZIF 3QJHA 1UJTA 3FZUD 5DS8A 2EDTA 1QSFE 5DHEA 5TGBA 2PO6B 2X4OA 5J1AB 3VM5A 3WMPA 3II2A 1UQSB 1U93A 3PG2A 4GRLC 5HDLA 3DURB 3QJVB 3GD1C 3S8GB 4W4NA 1SY6L 4OQ1A 1PW3A 4EI5D 1V7NH 2XZCL 2VDOH 3PGCA 3NSFA 1OB0A 1HIMH 4YC2B 3KCPB 2ARJQ 3THMH 3QJZA 4YNYA 5IESH 2PWEA 1DZBA 3V7AG 2F53E 3CN4A 3OMIB 2DM2A 4UM9A 3VG9C 2DEWX 2DLHA 2I60H 1N6VA 3QVAA 4XP1L 4YDLC 4EE2A 3D1MC 1OAQL 1OT1A 4GNKB 5DC0A 1F4YL 3K7UA 1K85A 3IYLW 4EDWL 4A7TA 4QRTB 3TASA 1UD4A 2KHAA 5FB8B 3L7EA 3TPKA 3BCFA 3BUPA 1D9KC 5JR1L 2LABA 1YY8B 3N42B 4C8XA 3NQKA 4JY4B 2DMBA 3DXAE 1REIA 3K2IA 3MRPB 3D9AL 2WPGA 4KPHH 5HI4C 5IW6A 4PVLA 1RV6X 2FD6L 4MJID 4PGEB 5ID1A 5J0BA 5FYKL 1T0PB 5AB9A 1ZVNA 1CDBA 3UAJC 2FH8A 1BZEA 2XA8H 4MLSA 5C07E 1BVZA 4WNQA 2OSLA 1K2DA 2ZF9A 3VXSB 4FG0A 4O02H 3TYFB 3DX7B 1MFAL 1EH9A 1LD9B 2UWEE 2O6EA 3KPQB 1YRKA 2VTFA 1ASQA 1TVHB 3AJ7A 4LBEA 4PRIE 5E9DA 1R75A 2EYSA 3BUQA 4NO5B 3ZHFA 4X98B 1DEDA 1BG1A 4LPVA 4P2QA 5DZOA 3BZEA 3FQXA 1S9VB 4MJ5B 2E9BA 4JG0L 5ETUB 5ACMA 2FBRA 4NO2B 5GZOD 1MCOL 2Q76A 4N87A 4HK0A 3BZ4A 1CL7H 1JHTB 3QZBA 3DOHA 1WBYA 3IM1A 1OAYH 4QRRA 4QT5A 3K4DA 2FCBA 3VM7A 1IIKA 1DBAL 3CFKB 4EBQH 1OGAD 5B7FA 3QDME 1Q9LB 4G6AC 2IFGA 4AVIA 3WNMA 1MQ8A 1QPXA 1UM5H 3WFDH 2CCWA 1B6DA 2XTJE 1DFBL 3Q13A 3FO2A 3QZMA 2H0FA 4B0MB 2C9RA 4HEPA 2CDGB 4K3GA 3AG2B 4KKBD 3L3OC 5JOPE 3KEDA 4YJZL 2E3VA 2Y1VA 4FYTA 2ZOKB 4ONFH 5JLZA 4MA8H 1BMGA 1CGSL 1IAMA 1XR9A 4P5TB 4YDKH 5GZOC 1QR1B 3OLDA 3CHRA 1CJYA 4OZIB 4XPFH 4LKXA 4HD5A 3QYCA 1PS3A 2WLNA 4N86A 1NIEA 5ANMA 2Y25A 3B9KC 3ZZLA 3HZVB 3LKPB 2OR9L 3H9SD 2ZXQA 4XNMA 5DZJA 4ZBJA 4EIBA 5LCVH 3NABL 2Z34A 2DPKA 2PNDA 3VWKC 2UZYA 4U1IA 1KV3A 3TT1L 2DQHH 2LVEA 3ARDC 4PG9A 5CNHA 3UTPD 3ME0A 3HZKA 5F9JB 2CCLA 2NUPA 3EOYG 1QPKA 4C58B 2IPUK 2GTZB 5B1AB 4B9ZA 1NEPA 4AQ1C 4HFUL 3GINA 2JKXA 4RISL 5C08D 1JF1B 4IU3B 5EO0A 2P24B 3OM3B 4FERA 2NY7H 1DVFA 4PYGA 2ICWJ 4DKDC 4F57L 4Y8AA 4XBPA 7CGTA 3BVUA 3JTTA 3K0WA 5DEGB 2LTQB 3RYMA 3EFOA 3MLXH 5C0CE 4F5CA 2BHYA 2TSAA 3QDJD 4E9YA 5JW5A 1L9PA 4LCWB 4J3XA 2QHRL 1XF3B 2AQ1A 2JKTM 1CDYA 2V5TA 4YDJA 5BZDB 1H5BB 1R3HB 3A6BH 1J10A 1KUMA 2WZPA 1U4EA 1Z0MA 5C0FB 3RU8L 1LVEA 4B95C 1N64L 3CVHH 3MOAH 1ZAGA 1CD9B 2VR7A 3OHMB 3WKML 5B38A 3IBEA 3DIFA 4OLZH 3SDXE 1JZ7A 4QHMA 1NDGB 1NCWH 2IV9A 2QHRH 1IGJA 1R3JA 2W5PA 2IMNA 2VIRA 4BHUA 4ENZA 4IYKA 2BVPB 3MZTA 1QBLL 2WQUA 1V55B 3GRWA 1OWWA 4GQQA 3MN8A 4KO5A 4YH6A 5TE7H 3QUKB 2A5UA 5HHPA 4JDEB 2VDOB 2OMVA 4BH8B 3GKZA 1AR1D 3BP4A 2BS9A 3VTTA 3WFHB 5B3JE 4QJ4B 3GMPA 3OKOB 5TE6L 3CFJA 5DA4A 3BWZA 4K7PH 3WV0A 1E4WL 3HG4A 4PUBH 1LP9B 1JTOA 4QWWD 1P7QB 1KT2A 3ESOA 3IN2A 3SKOA 1ZT1A 2XWRA 4QXUH 4Z5RA 5IIEB 3MRDB 1WZMA 5B4MD 1I1AA 2OP4H 4WHTA 2WY3B 5DRXB 5G5DA 1D7DA 3EYFA 2R9HD 5DHDA 1CDIA 1JV2A 1UWYA 4UNUA 3CLFL 1KPRA 5CP7B 5H94A 5K1JA 2Z31A 4DOHE 2YXVA 1DBMH 4K7PL 2J2ZB 3HNSH 4KXZI 5D1XC 4KI5F 1XGRB 2KH2B 2MHAA 4XNYH 4E2OA 4F7PB 5E99H 1NAKH 5C0DA 2V2XA 2WBJA 4BCYA 4JFED 2G9HB 1WS8A 4TRPH 3MBXL 4GB9A 5SWQB 4HJ0C 2HKAA 2ESVB 2Q20A 4QAWA 2FX8H 1UCBL 2HT3D 3T6ZA 4DKFH 1OEZW 3EBGA 5GGVL 1QWNA 4FMKA 3L3JB 4IOFC 4GKZA 4XXCC 1SN2A 2AI0L 5EU6B 3O6FC 3FQTB 5BV7C 5LNDA 3NCJH 4QNPF 4HIPA 2LHAA 4LVHB 4P46C 4NN5B 4NQXB 3VFSB 2Y24A 2GQHA 4G9FD 1SZNA 4MJ5A 1R3LA 3MA7A 1GGCH 3LRKA 3TEUA 1HS6A 4KWUA 3TVMC 1UXSA 5GJSL 2WIIB 4PJIA 2DQ6A 4M7KH 1EEQA 5ANHA 4FP8H 4Z3GA 1VACA 1E4XL 3EBAA 1HYSD 3L13A 5JXEA 3KPNA 1CTMA 5FUOH 1A3ZA 1E65A 5IJVB 5IGXL 2B9BA 4RISH 3ULUH 4M61A 3BH4A 1SJHB 1Z3GH 4J6RL 4HVBA 2IGTA 5ICXB 5AW0B 1YEFH 4Y4KB 1KENH 5LJYH 4OY9A 5J13C 4ZUVB 5JDSA 5D7KD 1AKJD 4XP5H 4MNGB 2L7QA 2DI8A 4EZMA 2ITDB 4GQPH 4M6OH 3QEQD 1T5XA 2MJWA 2Z8VC 3GXUB 2Y5TA 4JR9H 1X5IA 2HYMA 2W92A 1QLRA 5TF0A 4HPOL 3EOBA 4P59H 5DGRA 2H8PB 3MLRL 2LW3A 2UYLB 3K2KA 3NIGB 4R7NA 5BJTB 1YCSA 4JFFB 2WWKO 2QVTA 3VB8A 4P9HH 2EVJA 5FGSA 2J25A 4IK6A 1QEXA 1SQMA 4GQ9L 3WKNA 1CFNB 1XH2A 3VRLF 3BPOB 4TTGA 2Y3AA 4JFFD 4HGWA 3OXSB 5J13B 2Z3FA 4NKIH 2YZ8A 4LLUA 3QXUA 2CKBH 3MX0B 4MMXB 2KQMA 2R2HB 4D3CH 4HG4J 3GYRA 5I1DA 2WXHA 3D25B 2HTLC 2IWEA 3FFCD 2IH8A 2XWTB 3ULUD 4PJGA 1UCTA 3E9UA 4EDXA 2ZZUT 4MDJB 5KSAD 1W9XA 4NQCD 1A4JB 4UV7L 4YXLH 2FK9A 5GJSH 3JTBA 1B3JA 3LZPA 3PREA 3OX8B 5DTFA 4N90E 4MQXC 5FO2A 4ZFZA 5I1DB 4R5VA 2O6CA 1CFBA 2JJWA 1KBPA 4Y5YB 5T1LB 3W9DA 3ZKND 2R7EB 3C6SA 2EDEA 3U4BH 1YAZA 5D1ZC 3OXRA 4HLZG 3NT0A 1QW8A 1TJIH 5BRZB 2H8PA 2K45A 1WICA 2R39A 2DRUA 1GGUA 2XVGA 1XGUA 2CA4A 4J3WA 2OXHA 5ESAB 5I15L 3IXTA 1SBBA 2FJGA 1HXKA 3D85D 4RMSA 3TA3B 3WO3B 3TBCA 5DS2A 1RJLB 2BVOB 4JRYA 5HI5D 4PRIB 1VGKA 4HKJB 4KROB 1M05A 3X14B 1HXMA 2HPOA 2OMWA 2IH3B 4NZJA 4EI5A 1Q0YL 5FX3A 3WIHL 3MNZB 1IEAA 4P23A 4OZGF 4PLKD 3A67H 1CFSB 3NJGA 1G0DA 4ZUVA 5JDSB 1SHSA 3A22A 3MCKB 1PZ5B 4PRDA 3G6DL 3FH7A 3MRNB 1LO2L 5BMFH 2CKBA 2JLLA 2IQ9H 4JDVA 1AS8A 3G7TA 4HCRL 2X4TA 5C09D 2CNYA 2CG9X 5HI5C 1MCCA 2X6AA 4IIQC 4KDVA 4HBCH 4RAVA 1KBKA 1KWKA 1L7TH 3QWRD 1OSPH 2MOQA 4QHUB 1SDDA 1KIRB 1CTNA 1O6VA 3FT3B 4G6FD 2C8NA 5GRUH 1GVIA 2DMHA 4G2AA 1N18A 3DHMA 1MCJA 2XN9E 3AWFA 4XPHH 1N3NA 4N8CL 4HJJH 5GHWL 4Z3TA 2VNCA 2AJVH 1DSFH 2G3MA 1WISA 2ZWNA 5CCGE 1OXYA 4N0FB 1PZ2A 3VI3B 4R7LA 3ASWA 2F58H 3FCUB 2YWYA 3TBSB 1KOAA 4OFYD 4XWOD 3AB0B 5JPNC 4N3UA 2AGJH 2ESVA 3QQ9D 1MFDL 5IQOA 4JN1H 3VXSE 4WWID 1NUDA 5ITFB 4NRYA 5A16A 2DYSB 2QVMA 5EOCL 3QHZL 5K5YA 5GISL 5IJKA 6TAAA 3AZUA 1MVUB 3CSTA 4LHUA 1Q94B 1UD5A 3HMXL 2IOMA 1TQBB 4DGWC 4ZG1A 2N01B 3DIVA 1YHPA 1Z9PA 1FGNL 1IC7H 3PPEA 5TE4L 5ILTL 3FW6A 3A67L 2JJUA 1SM3L 5IFAL 4G8GA 2OJEB 1FBIL 3VXPB 1A7RH 2X6UA 4OJFH 2J3SA 3GMLB 1OW0A 3OQ3B 2NTFB 3AREB 4CN6A 5I8OH 4JKKA 4E68A 1TOXA 3NRQA 1F3RB 1P5UB 2YA1A 3EH1A 4JDEA 4JPKH 2ALWA 4OIFA 1EDQA 4YPJA 3ARYA 2CHZA 3RWIA 3K8MA 5DEZA 3MGOB 3NIFE 1HHIA 1ZEAH 2X2UA 3CFJB 2DLIA 3O6LL 1E28A 3IJHA 3PF2A 3ZE2B 2BMKB 2IDSA 4F37K 4G6KH 3ARBB 3P4NA 4HGKC 1C5BL 2W1NA 1NAML 3X1GA 2GW5A 2KZBA 5IR1A 1BJ8A 1RZJC 4TLKA 4ZO7A 4MFHA 3HJ0A 4S1RH 3M07A 4RX4D 1W80A 1LM8V 2BOBA 4YSQA 3D07A 3HOGA 2R1WA 1XH3A 4HJJL 5IV2A 4FTVD 2HVKA 3CD4A 1E6JH 1AXTH 2JQZA 5DQDL 1BLNB 3VFMA 3TN0C 5JOPD 4LCWA 1NPNA 2YKLL 3SGKA 1A4KB 3V79C 2DKUA 5D2LB 4YS4A 5HDQL 1PX8A 1GYCA 4AVHA 3PNRB 2F19H 1X4ZA 2BZ7A 3K8KA 4YUEL 1NKRA 2Q8BH 1GGBH 1DVFB 1A2YB 1NC2A 3CZEA 4TS6A 1F2QA 2VJXA 3WAJA 1F3JB 4Z7WA 2ZWLT 5C0EA 5E8DH 3C09B 1S78D 1TJHL 2Y7MA 5D2NB 5EH1A 4EXPX 2BSEA 1ASOA 2DQHL 3QO1B 4N85A 1NCCL 4IDJH 1S3KH 4TVUA 3WI9A 3WS3B 5FPIA 5D4QA 1OTUC 5ITFA 2JIXA 3UZEC 4PG2A 1HJBC 4PJBB 3HC4L 4N6QA 3DECA 3OGCA 4AXWA 2YPKA 4JRXE 5TE7L 3HC3L 4U1IB 4XMKL 4TQPA 1ONQA 1IQWH 2JKNA 4GMSL 2R7EA 4M1CC 3VXRE 5T1KB 3BSZA 3ATAA 4JY5H 4XCNA 1IGIH 4NFCA 5I1HH 4R7VA 3L9EA 2VMDA 3SDDA 3U9UA 5FK9A 4GAJH 2W60A 3BFOA 4YHIB 5CP3H 2RTTA 2DQCH 3PRZA 3WMSA 3RZCD 3VUAA 4KRPB 3BAJA 5F89A 4LEOA 4Y5VB 5J1SC 3D2UD 4JJOA 2FVNA 3LB6C 3X1EA 1AAJA 2ITCA 5CAYB 2Y1YA 4GBXD 2C3XA 5CINL 3IJ9A 4PCYA 5F1OB 3NCCB 3CK0L 4J3OC 2X88A 4PREA 4F33B 4WUUE 1YEDA 4LCUB 3GO1H 1BIIA 1D2PA 3HE7B 4M00A 4R83A 4KKNA 4KXDA 3V4VA 5JOFA 2DQDL 3OKEA 1A3RL 2N4IA 3K5SA 5D5MF 4WJKB 4ICWA 1JZJA 2GYSA 5EN2B 4AV4A 4C57C 5BJTA 3SE3C 1T7ZA 4F7KA 2WNGA 3D48R 2UVEA 3ZKMD 2H41A 3BUYA 2AMUA 1DQLH 3MO1A 4ZFFA 5GS3A 3S37X 4B9KC 2XBDA 1OQOA 5HJBA 5I1AB 3V9EA 2AW2A 2AKRB 4IBSA 2HLEB 2R0ZL 3WIFB 2NLJA 3QRGL 5DMKB 3IMRA 1WC7A 3P4MA 4OCWH 4M62L 2OR9H 4G8AC 3SYQA 1BQHG 2F54D 4GO8A 4N0UB 4ZW7A 3ZN6A 1FSKB 2VAJA 1VACB 2FNWA 3CNKA 1NAMA 5IFHL 1WK0A 4NHUA 3C6SB 4YN3A 4F58L 3RY6A 2APWA 1Z9LA 2R0ZH 4WIQA 1NMCC 3BZFB 3O81A 5HGDA 4ANVA 4PWGA 3RJOA 4P04A 3FHQA 4P3DA 1TKWA 1JUFB 4OQTL 1XWVA 5DQ9A 2BNQA 3UERA 4F7TA 4Q6IA 4PJAE 3DARA 3LRHA 2VL5B 3JWDL 32C2A 4OGAD 5DO2D 3BH8B 4HWZA 3TNNB 3H0TA 2KZWA 3BP6A 2ITEA 4EO5A 4F8NA 1IZKA 1PEZA 1B3IA 4DTGL 3V0VB 4RMVA 3PL6A 1P4IH 5INDB 2WP3T 1JJUA 2X44D 4AITA 3PYCA 2OMTA 3E6HA 2N7SA 2JIXD 4M4RB 4N25A 5C0JA 5HVFB 1FV1B 2EYTA 3DDGA 3KE0A 2WLMA 4G83A 3A3YB 5EUOB 3QB7C 1XSKA 1GZQB 1J5OL 2LU7A 3G6AA 2Z7ZA 1EK3A 4Y4HA 4KO9A 4NN6B 2EIKB 4L4VE 5AVVB 3ZDZE 3ZY7A 2AHIA 4ALAH 1PBYA 3MOAL 3ARGD 5IHZA 4YNYB 5JPNB 2WTRA 3LZQA 4TUOA 1GAFL 1MCLA 3ILPB 1IBFA 4FLSA 4PB0L 4NUJA 3HG1B 5GS0C 3LJ3A 5B8CC 5IR1B 5KYWB 1MFBH 5EC1A 5ADPH 3BLBA 4DCQA 3S5ZA 3EFDL 4ZMLA 4ANWA 4N20A 1DUZB 2D3NA 1NDTA 3QI9A 3B6SB 4GUCA 2QTEA 5IREA 2WKOF 2OK0L 4Q0XL 3FO1B 3UBXI 4CN1A 1IM9B 2R2BB 1D5IH 4NBZB 4X9GA 4N2HA 2JKSA 4CC1A 2WXLA 2HX8A 3MCLH 2KPWA 3U30C 3IB4A 3NCBB 2ZXEB 4X9HA 3UZVB 4AG4L 4HHGA 5GGTL 3WDJA 5F3BA 3T65A 4L9LB 2NY1B 4PJ5D 3F7VA 1WITA 1OCWH 2VWEE 4Z7VF 4R4BA 1QD0A 1E5CA 2VMJA 5F97E 1FFNA 2WOYA 3GB7A 4OFDA 4HFWA 4FXKC 4KX8A 4N26A 1A7PH 3DO7B 5DA0B 2PYED 2DWYA 2IV8A 5KN5A 5FCUL 4NQEA 2FGWH 4N1CA 2H2SD 4HW6A 1LO0L 4JHWL 3JZ7A 3TBVA 1I9JL 3MUJA 4W93A 2E6JA 3VO0A 5FWQA 5JYLA 5D1XA 3L3OA 4X5XB 3Q06A 4TUKH 2ZD0A 3TA3C 3ZT5A 1NANH 3ULUE 2NY3D 4R9HA 2FECI 5CWSA 3T1FB 3IU3A 3HBPA 3LPOA 3IF1B 3V0DA 1GAFH 1K5WA 4HH8A 1RUKH 3SO3B 1WZLA 4LFHG 2H9GB 1D5BB 2JCCF 1VLXA 2X4QA 4QHUA 4QJ5B 1UJ3A 3JSSA 3COOA 2K7QA 1WO2A 4JMXA 4P2RE 3T0EA 3S8WA 3IJHB 5CFHA 3O6ML 4DZBB 4J3VA 2ZG3A 5HYQB 3G6JF 3FB8A 3U36A 2DBLH 1PFOA 4PBDA 5D1QD 4NQTA 12E8H 2NY3C 3C08L 3GBDA 3PQYD 4U7SA 4KV5E 1ETJA 4WSJA 4Z7QF 4FQQB 2X0WA 1MDTA 4LNRB 4R90H 1QSEB 4YZWA 3M7FB 3TO4D 2H45A 5AOKA 2JJSA 1VFBA 4ZX5A 4OCSH 1S7VB 1W72A 2BRRL 2GIYA 3FSOA 3BIKA 2VLJB 3D34A 5EOCH 2VKXA 2EDJA 4NBXB 3TBYB 2NX5A 5IVNA 1QEWA 2CIKB 5AUMB 2Y7NA 4EQ2A 3NABH 4LSUH 4TUJA 1DE4B 1GR7A 1KTLB 4WWNA 4FNPA 1PL3A 3FU5A 1VGEH 1J18A 1Z5HA 1WV7T 2H9GA 2VLJD 3K0YA 4YXHL 3V5KB 4DESA 4FXGA 4G6AD 3WGVB 4G42B 4HWBA 1S5IL 2GCYB 4UZSA 5DYOB 1YYLL 3UJJL 1ITBB 4K3HA 3N1QC 1D5XB 4GRWB 4NRYB 5A16B 3CVHA 1T7XA 2WQXA 1XF3A 3RDTC 5GRUL 4Z7IA 3HLAA 2UUDK 3FFCB 3NPSC 2RHEA 4BZ2H 2I32A 2HT4D 3ABKB 4QHLA 3T4YA 4A66A 1U8CA 1RSYA 3DROA 1UOKA 1DVZA 2R0LH 2WVUA 1EA9C 1R3KB 2Z4TA 1HH6A 3JZYA 4JE0A 5AYUH 1IAIL 2E7BA 4Z6AT 1GPOH 2A77H 1KNOB 1MWAA 3DRQB 5L6YH 2YFOA 4HIHA 3WTUA 1XB6A 5PAZA 5CS7A 4I9WD 3BQUB 5H37G 3GMRB 3CFUA 4ERSH 4X2UA 5DVOA 3BVDB 2GBVA 4QYOA 1O6SA 1IGTB 1ZJAA 2DWEA 2ZNXA 4W9GC 1KGCE 3ZDXF 4JG0H 4HWUA 5DD6B 2VM9A 1IFHH 2ICWA 2QR0B 4CBZA 2R8SL 1JWSA 4IU2B 5DC9B 4FQIH 1PYWA 3HMWL 1CLCA 5DK2A 1WG3A 5DJ8A 3AQDA 2WSKA 2E56A 1SBSL 3MNWB 1HAUA 2BNQE 3QA3B 1HCFX 4BGDA 4C47A 1QYGL 5E1HB 4X9BA 2NXYC 4DAGL 3SGJC 1A4BA 1MFUA 3ZDWA 3U6XA 2VITB 4H1LG 1B90A 5AZEH 4CAGA 4PJXA 3BEVB 5TDNA 2CDEB 3ZUNC 4FQCL 4E9XA 1QQDB 5HHXL 3V6BR 2XV2A 4LBAA 2GAZB 3CDZB 4Z76A 5TDOB 3ENEA 2R1XA 4PIBA 1D9KA 5I1EL 2ZSVA 3BDXA 4R4FH 3MNVA 5LVEA 1NBQA 2GBTA 3FUFA 3IBOA 2BY2A 4GXVH 4K8RH 4YFEA 3RIKA 4AVKA 3MUY1 4UV7H 3VGDA 1JBJA 4ZQTA 1NIBA 4J4PC 1WA2X 4MX7A 3FCBA 1A64A 3WKPA 4XPBH 4NRXA 1YO4A 2VN5A 3BUTA 3OB0K 1L9QA 1KMGA 5HI3C 4JO2H 5T1KD 4HJTA 2AQ3A 1BCIA 4PJ5A 1QHQA 4F3FA 1J05B 5F96L 3W9EA 3GXDA 3WNNA 3UC0H 5DLMH 2VB5A 3SGEI 4UTAA 4TRPL 4OV5B 2F5BL 2D0GA 3GK8L 3RFZC 3DROB 2Y36H 1T1XB 1ZS8A 4CVWA 4J2QA 2G9KA 1CLYH 2YZ1A 4BFIA 1DEEA 1UD2A 3LIUA 3L95A 1IL1A 3AG4B 3RP1A 4L4TE 2FT8A 3KHQA 1FLRH 2OSLB 4OVVA 1CXHA 5T8IA 2AK4E 3MR9B 5AW7B 4X42A 1U8OB 2WKOA 4Z0XB 1DQDH 2WSDA 3U0WL 3U1PA 2VDPL 2JI1A 1RUQL 1QFWL 1F4XH 1F56A 3X11B 3UAJD 1A4AA 1N6UA 1WC7B 3IE4A 2RQEA 1NL0L 4ODSL 5FEBA 1MCFA 2D03H 3CIQA 4AQOA 1BAGA 1WIPA 3FB6A 4Y4HD 5HHOD 1UB5A 4HXBH 4WWKC 5LWYL 1S7SB 5ICXA 2OTPA 3H55A 1R3IL 2ODHA 3N5AA 3QQ3B 4HEMA 1JGDA 1F6AB 1MQKH 4DP0X 4JQXA 1TETH 4F7CA 2WMPA 1H3VA 2ENYA 2F61A 2R0WH 4P2CG 3HC0B 3IXAB 2W81C 3QZPA 3KPOB 1KBVA 2PXYD 4X6BA 3RNQB 1RFDH 1V27A 3B9KA 4Y19A 2P5WE 2BOCA 2YAQA 4QKXB 5KBLA 1BVOA 2F54B 2PUQT 2J1ZA 1U8HB 2XWZA 1MXDA 3HFML 4V1DA 1L9OA 1X9RA 1DQQA 3B2PA 2HMIC 3PWNA 2WOBA 4J27A 2VE6B 3H3KA 1WBZA 2WBXA 1WWAX 1JRHH 1GZHC 4L8BA 1A5FL 1T5KA 4Q58C 2YAEA 5EU6A 2H2SC 35C8L 3GHPA 2G2PA 3UIZA 2JCCA 4GOSA 4FNLL 1CZ8L 4ZPVA 5CIPH 4U0RC 5FFLA 4YSCA 2YD7A 4HUCA 4P48A 1YN7B 2P5EB 3HR5B 5L4IA 2PCYA 1BQLL 2R69L 3ZHNA 3NJXA 1Y18B 4X7TB 3II1A 5HVGB 3T4YB 1JZFA 4UU9A 4UDTB 4WQOA 4JY6A 3KM1A 4AGOA 1XGZA 3ZE0F 2JIXB 4FFWD 4KKQA 1CE6B 4WI6A 1MCKA 1U8IB 4C56E 3IGLA 4KJYB 4OUUB 1I7RA 4HWEL 4PJBF 2B15A 3OPZL 4H26B 1NCTA 4KXAA 1NCDL 1SJXA 3UTTE 4BELD 1URIA 4NUPA 2VUYA 4DP1X 4X6CA 1KXHA 3QFJA 4H0HB 3HG1D 4XMKH 1Q8MA 2AZAA 1T0OA 1NDMA 5KZCB 1LK2B 2NY0D 1ZGLM 1UXWB 3ETTA 5T5FL 2EINB 5K59E 5DHVA 2IANE 3KLQA 3ULSB 1EXUB 3QR1A 3EH5B 1QFOA 3VI3F 4EUPG 5KYXA 5C0BD 4C4UA 4NJ9L 1DUZA 2AK4B 1EHXA 5I8KH 3HS8A 5FHBH 5AVZB 4S1SL 4DEPB 3ZKXC 3GLAA 1KJMB 3CZKA 2G2RB 1SXBA 4X7FC 4XP6H 4LF3A 1RAMA 1NIDA 5JHDD 4F9LA 3RWJA 3S37H 5FYLD 1F3DH 1ADWA 3VD2A 2AK4A 2ZX9A 4UQCA 2KKQA 4NEHB 4ODWA 2A9ML 5TDPA 1MW2A 1KGCD 4A37A 2WINA 3QSKB 4S1QL 1TZHA 5MERB 4JFPA 4XHJD 2K8QA 3IFNH 4G7YL 4MMZA 1YY9D 5FECB 1KTBA 2FJHB 1FV1A 2EYTB 1BWMA 4JO8A 2DDQL 2BCKA 4ODXA 1MWOA 5BUGA 1B9KA 3RY5A 3AGVA 2H6PB 2YXWA 3D3VE 4O51B 1JF6A 2DQEL 1LK2A 3PFUA 4GO9A 4PU2A 2D7OA 1EFXD 2EDDA 4MSWA 1RUKL 5J12B 1AR1C 4PVBA 2FBJH 1KIQB 2EYSB 2DQUH 2E5EA 4FQXB 4JM2D 1W0VA 2W65A 5C07D 3STLB 4ZMXA 3WJLC 1I3UA 5E00B 1MCPH 2C7FA 3ZHLA 3ARFD 3QO0B 1CDUA 3UTPE 4GQZA 4FXLA 4PG9B 1JNLL 4JQIL 4Z18A 1PKQE 1NGPH 4JM4L 1JYXA 2IAAC 4U1GC 1QKZH 2V3DA 2I26N 3VXRB 2YXFA 3FO0H 3MNDA 4AQAA 2CK2A 3GRWH 4PG2C 2K70A 4KO6A 2J1KA 1PQZA 4WVRA 2VDQL 1NKGA 2PYEE 4IJ3C 4N0YL 4D9LH 3UPRB 1UH4A 1WGVA 1NBVH 4GUPA 1YEKL 1B0IA 3O4LA 1CT8A 3GZPA 1EHLL 2CMRL 4LLVB 1EGJL 5I6MA 1LEKA 3CDCA 2HRPH 1AHWA 1F02I 1VADA 3KBHE 2AP2A 3KL5A 1JZDC 2WLHA 5MHSD 5A3ID 1L9MA 4M5YL 5D7LA 2FYYA 4LOUD 2F8IA 2BRQA 1SXSA 4W9DC 4ZODA 3QDMD 3T71A 5CGYC 5CUSL 3MLYL 3KXFA 1N26A 1SLUA 5EN2A 4AOFA 3HG1A 4MCZB 1W8EA 4XVTL 1MJUH 4MB3A 4KJQD 3CPLA 1WPCA 4L4TD 5EPMA 2WYHA 1NLDH 1MUJB 2C26A 3ESMA 1RERA 5IOKA 2E76C 1BGXL 4ABUA 3W0WA 1DQVA 4YC2C 4FFYA 2FLMA 1ZA3B 3MLPA 4MBRA 3ARUA 1P1ZA 3SY0B 4OIIL 2QGCA 2YAMA 5B1CA 1TJIL 1YUHB 1T0NB 3TEZA 1HNYA 4I3RL 4YHKH 4KJPC 4M48H 3V9FA 3WTWA 4NP4H 4TSAL 4IRZL 1G7LA 3SYCA 1ADQH 1I1CA 1J8HE 4JKPH 1NPUA 3RAJL 1VCAA 4TXVB 1PG7L 5GS2D 1QRNE 4K3DH 4M8VA 3WJJC 2V5RA 3WHE1 3U7WH 1ZGLB 1VZHA 3WNLA 5H37A 4X6EB 4PJ7E 4YHPA 5LO7A 2CQVA 1R24A 2EDMA 4WHYG 5A2KH 3C75A 3RY6C 1OP5K 5E2WL 4V1DD 5IG7A 3VXNA 1TO4A 3QORC 4TNEA 3D4YA 3HUJF 3HNVH 2DWXA 2XWTA 1GC1C 3ARTA 1IGIL 4OFKA 3ZT7A 5D4HA 4I5BA 3NP3A 5KVGH 4MMXA 4APQC 2X28A 4Q6IC 2A4EA 5CEYB 3L1GA 4MCNA 1FNHA 3GMMA 2EIZA 4X0KB 1OHQA 4ONHB 4BSJA 3WNPA 1IILE 5F1NB 5DYFA 4FJ6A 4PWEA 4ZFOL 1MCSA 1M6OA 3M17B 3GTVA 4GS7C 1HCYA 4PRPA 4NN5C 3DOSA 3REVA 5I28A 1CXIA 4NS0A 3RVTC 4XE5B 1G9MH 4FYSA 4E42A 3EO0B 1AIFA 1JI1A 2YLHA 4ZJ9A 2WZ0A 4EEEA 3EDKA 4OFIA 3CN3A 4N0YH 1D7FA 1PY0A 2CDFB 3F6LA 1A47A 4FEIA 4HH9A 5A2BA 4OZIE 4GUPB 3QHFH 3L9YA 1I8IA 2AQRA 4ODUB 1CK0L 3RDJA 3G6JA 2ITCB 3V0IA 4EZKA 2FE0A 4ZS7L 4KRLB 1D5RA 2A4CA 4GO6B 1SOSA 3BPCB 4M5YH 3GJFH 3GMLA 4PJCE 1IMHC 1NCWL 1PYWB 3J07A 4KKAD 4NQEE 5C08B 3EO1A 1J0YA 1X3DA 4I0PB 3BDYH 2EDFA 4MYWB 1ZT7A 4CKVX 1KGJA 1KPVA 3CX2A 3TF7C 5BZZA 3OHXB 3RL1B 5IBTH 3E9TA 3I6LE 2JVUA 3J27A 3O3BB 4FQXA 1ANUA 2WVSA 5LGJB 2X2JA 5I8OL 1KB3A 3H4FA 2EDNA 5C8JA 2XKNA 3VFSA 1TNMA 3CHSA 3O3EA 4NQSB 4F2MA 4UQ2B 3KL0A 5JIMA 2NZ9D 4GKLA 4Y4KD 4C4KT 3T77B 4B3EA 1S5IH 2CR3A 2WUBL 3STZA 3P9MA 4OF8A 1L5GB 4AT6A 5D70H 3HE7C 3O0RH 1IGYA 5I8EA 4TQEL 2CNZA 4LVOB 4DPRA 2VO5A 1ZVHA 3UADA 3QDJE 1T03H 1KN2L 1ZLDA 1CGVA 3H2QA 5AAMA 2GJZA 1VRSA 2PO6C 3JWNG 5DK3A 5FA3B 1AACA 4BKTC 4IRZA 3FQ2A 4Y16D 1A21A 8PAZA 3MRFB 1WBXA 1C12B 1G9NL 3B5TA 3G6JE 3LQAC 4X7CC 4XN7A 4J1UB 4IOSD 3CZJA 3APFA 3QZWA 5TFSL 4AVJA 2P5EE 4PJGF 5ANME 3S35H 4HKBB 4GSRA 3OG6B 2YIHA 2WSPA 3OVUB 5DEFA 4G3YH 4UINH 5AWNL 1OSEA 3TV8A 3FONA 2MEJB 1UJ3C 1I1AB 5E51A 1NBCA 3WENA 3FUKA 3NIDE 4R2GD 2IDUA 3RIAF 4KX9A 2P52A 2VSKB 4Z7OB 1SN0A 4OVUA 2CKBB 3AREA 4W68A 1LO0H 4XXWC 1QSEA 4EI6B 5KVGL 4Y2LA 5K9QI 1W6LA 4KOCA 3ZMNA 2PR9A 5GZND 5IQLA 1UKQA 5CCKH 3RWIB 4YAQB 4LSRL 1RZ8A 3QCTH 2IPTH 1YA5A 1YNLL 2APVA 1S9XA 4MDIA 2VCOA 1KV7A 3NVQA 5I66B 5I6XB 1HL9A 3FFOA 4OJEH 5C0RH 3QFJE 4OQTH 3ZE1B 5A43C 4V2BA 5D96B 1UB5B 2VDLL 1R0AH 3EHBC 4L1TA 3UTTA 3ASNB 4OUUA 3VRLE 1NFDB 3GI8H 4TVPL 1NM4A 2GUOA 5BRZD 3K1KC 3NJLA 4K23L 4KKRA 4LMQE 5DD0H 5TQ0H 5C70A 4C56A 1NCIA 1OPOA 4EMZA 2ZWSA 1RUAL 3ZQXA 2VC2H 4L1LA 2AJUH 1T22B 4XPAH 5E4EB 5C0FA 1GOFA 4G7VH 2J71A 3V0HA 1RZIA 4ZMYA 2HG0A 3D9AH 4UB0H 1CO1A 4NPKA 4Y5YA 5T1LA 1TTUA 4PJ7A 2DIAA 3QHFL 5D1XB 3ZIYA 4ANKA 4K71B 2A7BA 1WD8A 4AQAB 1M53A 1YEGL 3I9PA 2JCCE 3OLEA 2O6FA 4HCGA 4OV6F 4B60A 1C5DB 1ID2A 1WBZB 4OF3A 4PRPE 1WIUA 3ZW3A 1MLCA 1HU8A 2VXUL 3CUPA 1O5PA 3DWTA 1XF1A 4DUVA 5BPPA 1YMMD 5IHLB 4BINA 3TJHD 3BDYL 1G5GA 2OQJB 5FYKU 1OCOB 3BPNC 4MD4A 1M71A 5T3ZE 2EXYC 1N6QL 3ATFA 3O4OB 5LUMA 3RFRA 3X3FL 3P3SA 3K2UH 4U7KA 4W9CC 2J57A 3UTTB 1CICB 3HNTL 1B2WH 4GW4A 4P9MH 3MV9B 5EUKB 3AADB 4PBWD 5EBLA 1HWGB 2A3TA 3I6KA 2ZKYA 3GSUA 3MGTB 3FRUB 3LMJL 3UTTD 2NNXA 4OZFH 1LWHA 4HFUH 2X4RB 4GIPD 2GJ6B 3OKDA 4L29A 5A2IH 1UD8A 3MFGB 3IDIB 4FLRA 4NPYA 3OAUL 1DFBH 3V5HB 3WIHA 1FL5A 4N6RB 1TT6A 5JLZB 2DY2A 1WE5A 4U4IA 5MEPB 3ARED 4PLJC 3P1VA 3LIZH 4HXAH 3ZL4H 4K3EL 3RVWD 2R0WL 3RX7A 1OT4A 5D7JA 2FJGB 1PG7W 2UY6A 2KI6A 2WXNA 5BQ7B 2QGBA 5AW5B 5I5MA 1GYAA 1T20A 2EC8A 4YSPA 3MV9A 2Z9TA 5FDWB 3CN0A 5HYFA 4RVBA 1BMWA 4R97B 3H9ZA 2B8OT 1CICA 3UBXG 4FKHA 3VRJB 3H8NA 5CCHE 2J8UA 4X6DE 1MLBB 2F7PA 3SOTA 1H6TA 4HOZA 4XCYB 3UO1L 3OZ9L 4Z0BH 3VFUB 1RMFH 3KMDA 1HINL 3WTXA 3QZLA 3D39D 3A21A 4LSRH 4IIZA 4MZRA 1NCAH 4MNQE 5FR3A 5I23A 1HH6B 3NA4A 2XKNB 4QNPE 1N9PA 3P3YA 4GXVL 4XCYA 3OBAA 4KH2A 1ZSDA 1AYRA 4HDIA 1UOVA 2EEDA 4ZTPH 2OMZB 3F04A 4HPYH 4HUWB 4NDMA 1NBZB 8FABB 2DYPD 3L3IB 3WEMA 2EIEA 1JPFA 2YRLA 4B53A 1CFVL 1GC1H 1UADC 3D3VA 5AD0A 1T20B 5FDWA 5L6YL 3BH9B 2GAZA 1OZTG 2NY4C 3O4LE 3ZZ1A 2X4UA 3V5KA 4ZI8A 5JMRA 2ZKXA 4RGND 3EOBB 5DJCB 3LQMA 1LO4H 5KAQF 4OCSL 4QRPE 4BDVA 5FYJD 1XAUA 1AGCB 4HX1A 4PSPA 5KSVB 3FU0A 4NM8H 4WWOA 3E3QC 2A73B 3IFLH 2CO3A 1NM9A 5C7XL 3VXME 3TBYA 4KNQA 3IS1X 1T83A 1K3IA 2CDFA 1AQDA 3GT6A 3S5YA 3H53A 4N2LA 4OF6A 4GLRH 5F0JB 3VGAC 2F5AH 3Q5OA 4LRIA 1MUJA 3MRGA 1G1KA 2A6KA 3DJSA 1XO8A 4X83A 3ORJA 2EDQA 4NUQA 5CLXA 3C60A 3BRDA 1HKLH 2WIIA 4PJIB 4RWYH 3V0AC 4XNUH 3QEUA 2VDKH 3CBKB 4L5FL 5FA4A 2ZX8A 4MYPA 2WQAA 1TJHH 4N2AA 3BQUC 4ORZC 5AVUB 4LOVA 4LCUA 1IAIH 3D33A 1A6WL 4LLYA 2DM7A 3BISA 4AE0A 1KFAH 3H3PH 3OKNA 3BWAA 3AT9A 2FR4A 1JOIA 3C87A 3QIBB 4Q56A 1XHHA 4NKMA 5CO1A 2WLLA 1WTGT 2XOTA 2ZX7A 3VFWA 1RZJL 1QFHA 1H0DA 3UMNA 3VMOA 4CMMA 1QVOA 4JM2F 5KBMA 4FXKA 4MJIA 4ZZFA 2AJUL 2UVFA 4XPAL 5GSVB 2GY7B 1GOGA 3NPSB 2P1YA 3MRCB 4MD5B 3FS9A 3KGRA 4L0ZA 1TTFA 3N40P 3GSWB 2O5XH 1TMQA 3QPXL 1D6EA 4PP1D 3ARSA 1LEGB 1SJVA 2Y5QA 1MF2L 3EYOA 2YQ2A 3Q1EA 4J3OG 3VX0A 3HZMA 5KS9B 1IO4C 1TSRA 3L3DA 5J6GB 4DUWA 1QFPA 3DX9B 3MRQB 4UT6A 5KW9H 1YZZA 4YEEA 1TLKA 1A7RL 5GXBB 5DJDB 3NN8B 3QXAA 3ZE0B 1E4KA 3GLZA 3WFHA 2DB8A 5E5MA 3SBWA 2WNKA 2XTLA 4U1SB 1LP9A 1EGJA 4AV0A 5E8OA 2QSVA 2ZKWA 1MRDH 4HH9B 2CJTA 2IJ0C 2WXFA 4OCXH 3UAAA 5JA8B 2XWEA 4ICXA 3GSQA 4WHDA 3U4EB 3LN5B 1JXGA 3I85A 4M3JA 5C2BH 4YE0A 3EDFA 1FL3A 3EYOB 3FT1A 1D5BA 4PV9B 3CSFA 3PHQB 1FJ1A 2P8PB 5DMIL 3FT9A 4CL7A 1LEGA 5BUPA 1KELH 4HPYL 4QIRA 1AGFB 2LT9A 3L9RB 4UNTA 5ESVA 5KBNC 5B1KA 5IWLA 4M7LT 2QKSA 1SOQA 4KK9D 4XC3L 4ZMAT 3TIDB 2ICCA 1L9NA 1Z6JT 4F9LC 2ROYA 3CFKA 2OYKA 1YJDC 1Z9NA 1NANI 1YN7A 2P5EA 3HR5A 3LXBA 2GC7C 4DQOL 1PLBA 2LU4A 4PN6A 5ELIA 4HCIA 4FXGC 3DRTA 3ULVF 3BGMB 2QADC 1H5BA 5EC2A 1S9VA 1V3LA 3DA0A 1UACH 4WK2B 3SDAA 5AW4B 4WWKD 4L3CA 2W91A 3BSGA 3SPHA 5I1IL 2Y5EA 5DJ2B 3M6DA 3PV6B 2VH5H 3MDJA 4P57B 1MN4A 1DE4A 5IVXE 4WO0A 1AR1B 4HHWA 4PCTA 4X6DB 5F8RC 4BQBA 4WCYL 3KDMA 4JFDB 3QJTB 3LSOB 5KVDH 4X6EA 1ADQL 4LPCA 3SBQA 4GP8B 3SYOA 4AUJA 3G6DH 2GBAA 5A2CA 2RAMA 1B2YA 5I66A 2UZYB 4L9LC 4OKVA 3T6XA 1QTYT 5I9QB 4ZOAA 2ENJA 1TTRA 1XFPA 3RJQB 4I0PC 2WC7A 3EAKA 3BKJH 1U8LB 4YGAB 2IWKA 4R97C 2F1AA 4H7VA 1NCOA 1HSAA 4ZPVB 3SQRA 4ZOBA 4JDZB 2VUKA 4HS8H 3FONB 2ICWI 3SYAA 2D2CC 1UWXH 2ARJA 2OTWA 2XN9D 3LS4L 1NLDL 4NNXA 5IMKA 3M8OL 1QI5A 3WFDL 3A4AA 4U3XA 4XVSL 1I82A 3U4KA 1ORQA 1OT2A 1L3NA 3VE0B 2XZCH 2O26U 4ZFFB 2HT4C 3FAWA 4V1DB 5LDSA 3GSRB 3WS6A 4MMYB 4G8GD 2D7PA 3JWOH 4LPWA 5CZVL 2LLLA 4OCLC 1DJYA 4FFWC 5J3HC 2WO3B 4NIYE 4LXFA 1KEGL 3QEGH 2D7NA 2Z35A 2FRGP 1HQRB 1UZ6E 2FX7H 3N1MC 4G9FB 3SIKA 2OTUA 1FA4A 1M2VB 2V3EA 1L0QA 2MMXA 2OSXA 3MJ9L 1TXKA 3OAYK 3UTSD 5SX5K 5KN5B 4J4PA 2YEQA 4TMPA 4I3SH 4TSBH 3AS1A 5B1BB 2XJLA 5J5EA 4IEFB 3GB7B 5C09E 2ED9A 4MZIA 2KQNA 1PD6A 3O4LB 1YN6A 2R1YB 1UYWH 1LWRA 4PJIF 5EULV 2NY6B 5J4MA 3E6FA 3K2UL 1JDCA 2E74C 1X5JA 4KDTC 3UACA 2ICES 3D4GA 4KMQA 5T3XH 1TCRB 4Y89A 3R06B 1FVCB 4L4JA 4N8VB 3F7RA 4HG4K 2BWIA 3AUWB 4X9FA 4YLQT 1YPZB 1U2YA 4IDLA 4ZFGL 1Z5LB 3HPLB 2VMEA 1S6NA 2OP4L 5F96H 3QRLA 2WQVA 2ZXGA 3VWKA 4TSCL 4ELKB 1J5IA 5L4MA 3G5ZA 3MRHB 3QNZA 5F3HB 5FKAA 3MLWH 5DRNA 4QOKD 4CDHA 2HLFD 1VJSA 5EWIH 3FO0L 2XZQH 2C1PB 3I2CL 3LPFA 5KVFE 5FHAL 3E8UH 1L7IH 4A7UA 4EVNB 5EC1B 2BVTA 1BREA 1KLFA 1DCLA 1FZKA 4TUOB 1XD0A 2Y2TA 15C8L 3AM8A 2R4RH 2YD2A 3WO4C 2VXVL 1RUPH 1QBML 1CCZA 1PMYA 3LRSB 3V4VL 1KEGH 4BZ1H 1M7IA 5IM7B 1MELA 4RCAA 2ZAIA 4PJDF 1XD1A 5DHYB 2P9RA 1ACYH 5IHWA 9CGTA 4PJFA 2CPCA 1MDAA 3GSRA 3WN5C 4ANUA 3E2HC 4G7SB 1DJZA 3MLTB 4Z7WE 3RVVD 3SDXA 3PGCB 4Z78A 4KKBC 3DYOA 3FU3A 4JZJB 3DUHA 4PUBL 4B9FA 3C60D 3N55A 2YEVB 3LMJH 4PW4A 2JNZA 3WTVA 3PJLA 4OM0L 4HPHA 3F58L 2OSWA 3VXNB 4ELKA 2XTJB 1DANU 4IW4C 4L18A 4BHUI 4JY5L 1TEYA 3CGTA 3LRMA 3FTSA 1NGPL 4LCWE 1MHCB 3CIAA 4WI3A 1RJZB 5E1AA 3JV5A 4N0UE 4UQDA 4ZK8A 4MHHG 3ISWA 5HHOA 1TTGA 1HZHL 5GRVL 2COVD 1A0QH 2JJVA 2YUZA 5SWZE 4PRID 2BSTA 4X99A 1ZANL 4MMXC 3VWJC 1KENL 4AUUA 5MHSE 2YK1L 1MFDH 2WVTA 5EU4A 4WU7A 3OMZA 3EOTH 1KN2H 4UMSA 3AAZB 5ALCH 4TN9A 4AGQA 1UCBH 4OFQA 2EDYA 3MCG1 1JDDA 2IDTA 4JUTA 4CJ1A 1WTLA 2ZIDA 1QPPA 2IQAA 3D05A 4FQIL 4KBPA 1VFBB 4TKWA 4WJ5B 4M93C 3QUZB 1FRGH 3WNOA 2Y7QA 3B1TA 3Q8AA 4PJHA 3QNFA 4AEIH 3P3TA 1GW0A 2B4CH 2ERJB 4S2SA 4HAKA 4AZ8B 1JZ6A 2XG4A 4MNQD 1E3ZA 3QEQA 4KGLA 4L1SA 1XEUA 1HHKB 4XVJH 2AV7B 4PY8I 4F24A 4FXGB 4AYID 5E6ID 1XGRA 3UDWA 2CJUL 1G7QB 1Z9SB 4BQCA 2W59A 3OLIA 4N2EA 2DMGA 3V6ZA 3EJCA 2H3NA 1DQKA 4RA3A 4ZO9A 1YNLH 3HB3B 3GXPA 3FOMB 4OBSA 4XXCA 1QEWB 1WSST 3ECVA 3U4EA 1WZ1H 3WUWB 1D9KD 3FTGA 3I02B 3MC0A 1W72B 4TQEH 3N43F 3OGOE 3HRZB 1D3CA 4ZAKC 4FQPA 2K6ZA 5FGBA 3SDCC 3KYOA 1XGQA 2J1YA 1ORSA 1RK0B 4JHBA 1QUPA 1WWBX 1NWOA 4P07A 2TRHA 3ULVC 3QGVA 3AREC 3RWEB 5JW4N 5IROD 5MEOB 1OLLA 4GG8A 5E03A 3AXIA 3ASOB 4MMZC 2E8YA 1O7VA 2ICWB 3QXTA 1NOLA 3IDJA 4O5LL 5F8QC 4PRIA 5DZPA 3QW9A 3KPRD 5LBSA 3BX7C 3GMNA 3UBXA 1OLZA 4LLWA 4NC1C 2BOLA 2P47B 5GIRA 2VXVH 3MREB 1PLGL 3N2JA 5K59F 1G6RL 2DAVA 2BNRE 2CWRA 3MROB 2I9LB 5FM8A 1U4FA 4AEIL 5E2TL 3SGDH 5L2KD 1XB8A 5AW8B 1U3HA 4P5TD 2HWZL 5I8CB 5D71H 1Y18A 3AB0C 4PD4J 1CLZL 1SLXA 4O4YH 1A6ZB 2B77A 1RJZA 2J7LA 2NR6A 3Q6GL 4MNHB 4NRZB 2R2BA 4WU5B 1LYQA 1E2VA 3FB5B 4XX5A 3EJJX 4ACPA 4TLSA 3W39A 3IDNB 4JRYE 3WY3A 4EDXB 2DKMA 3POCA 4P4KA 1NQBA 1A6UL 43CAB 4AYBA 3D25A 5FDYA 5GQBA 4PV9A 4YHLL 3QNYA 4RZKA 3QIBA 3ESVF 3GMOA 4WGKA 4E41A 4PR5A 3GMNB 5IHZB 2ZE0A 3VH8A 1MH5B 3J8F7 3P2TA 5EG6C 1ULVA 1FG9C 4B41A 1FN4A 2KMWA 2VLJA 1SYVB 5DJXA 1JK9B 4HBQA 5DZ9A 2AXFB 1EMTL 2X70A 2CLRB 2QMKA 3AFLA 4OLUL 1OP3K 5JHLA 3S3PA 4OF5A 1H9DA 4S1DC 3G5YA 3ARFC 1IM9A 3F64A 3VWKD 2VDKB 2AXJA 4EI6A 4EXKA 4U6YB 4IQHA 7PCYA 1T7WA 5FW6A 3Q2WA 3TO4A 2VN4A 4RIRA 2FJUB 3HAEG 4K3JH 3SJVD 3NEXA 4G43A 5CBAB 1P1VA 1J0HA 4XNZC 4DCQB 1B0GB 4U1MB 2Y7LA 3MLYH 1XGPA 3EFFA 5HY9A 3SD5A 4CDGC 3HI1A 3HJEA 3LKOB 1KTJA 3MGAA 3HG5A 3NFPA 4KROC 3HHMA 1I7ZA 5IUCA 5DD0L 4IBYA 3SO5A 4RFNC 4LRIC 1E5ZA 4DPBX 5FC9A 3FCSA 4KHTL 1GOHA 4M6MH 4XNQA 4D3CL 3CFNA 2JELL 1NIFA 2ENPA 1SEBB 4YHOH 1IJNA 1OALA 2HLFC 4BBWA 5CD5C 4CVZB 4IOIB 4R2GC 5E6ZA 5IOPB 3NFSL 2OZ4H 1AD0B 1BZOA 3CSYB 3P69A 1BFOB 3BEWB 3Q7JA 3JYCA 4K9EC 3NEEA 1SEBA 4CGUB 1AXTL 4R4BB 1CL7L 3H4HA 3KLDA 3JYBA 1OTTC 2J8UB 2WN3A 1RVFH 1P4IL 4LHUG 4UTBL 1ROCA 1I1YB 1RZ7H 2ICEB 3VVVA 3CDFA 1E40A 2KBGA 3QQDB 3TEWA 2DICA 1JPEA 3KPRB 3HTLX 4HUUB 4N28A 4DWHA 3MV7D 2YUWA 1KDIA 1AQMA 1J8SA 5D7JB 1GGBL 1EAPA 1DL7H 1TPXB 2X2YA 3HCVA 1OAJA 2R23A 4YHML 5B39B 1CPUA 5T1MA 3PGDB 4OZHF 5H94B 1AQDB 3V52L 5DR5L 2Q6WA 3TBTB 5EEZA 3G5VA 4FL4B 3WNIA 5GGSB 4Y9BA 1G7JA 4KI1A 4UUJB 4XBGB 2OI9B 2QZ5A 3CHPA 3HCVB 2ZTBA 3QJQB 3KPMA 2XQYA 4HIXL 1WZ1L 3G04B 5E4EC 2ZYRA 5GZOA 4J3UA 3QORD 4JFZH 5CM1A 1G6RB 2YD1A 3AQXA 2EE3A 4OGZA 2FEJA 2EIMB 5DK2B 3IU4H 3VTAA 1E5UI 5I6XC 1XXDC 2YAFA 1MPAL 3L4UA 1JWSB 1V8HA 4KTEH