5IJKA

Crystal structure of anti-gliadin 1002-1e03 fab fragment in complex of peptide plqpeqpfp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
224
structure length
213
Chain Sequence
EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWFNWVRQAPGKGLEWVGRIKTNTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTTGEPLVNHITILDYWGQGTLVTVSSASTKGPSVFPLAPGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords peptide PRO-LEU-GLN-PRO-GLU-GLN-PRO-PHE-PRO
publication title Stereotyped antibody responses target posttranslationally modified gluten in celiac disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 213
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ijkA02
5D70L 2A0LC 3OJVC 4ESKA 3MV11 3RWGB 4KV5F 1MNUH 1NL0L 5CJXC 5HJ3B 4YHMH 4N0YL 1ZEAH 5B21A 4LKCA 4DVRH 2G75B 3A6BL 5ISZB 5JXED 4GLRH 4HWEH 2D0HA 1QEWB 2ZSWB 3SDAC 4DOHE 4KUZH 4URTB 4QGTA 3HZKA 4DFHA 4ZAKA 3MJGX 1FJ1A 2BVQB 4PJGE 3PABA 4HX1A 3O2DL 2NR6C 5B38B 2GJZA 5C3TA 3RZCA 2XOTA 2WIIA 1KYOK 5ID0A 4ZAKB 2YD4A 3EUUA 4KTYA 2K7PA 4U6VH 4XMKL 4ZG1A 1IM9A 2VXQH 3PABB 4HX1B 4MDIA 5C07D 4HPYH 3D2UB 1IGJB 1WWWX 4OF8A 4OBSA 2A6IA 4FQQA 1U58A 3DVFA 1KEGH 35C8H 4MDIB 4YIQA 3C60C 3WNOA 4LSPL 3T2QA 1HHHA 2BNQA 5E24E 3O8XC 1AC0A 4ONGL 3H2WA 3VDAA 3VRJA 3N1QC 1CICA 1QSFE 1P4BH 2XG5A 4GKZA 1EFXD 5I2IB 3FN0L 1IAII 3LD8C 3V4UH 3VU2A 2BNQB 2EIBA 4R96A 5DUMH 3ARGA 5E08H 2RAMA 3I6LD 3RJDA 3VRJB 3EIFA 2HYMA 2XXCB 4I0CC 2PW1A 3IFOA 3U7WL 1QRKA 2Y7QA 4WUUA 4PB9L 4HS3A 4HGWB 4R96B 1GGBL 1HIML 3ARGB 1B4JH 1E4WL 1T83A 4ZXBD 2FCBA 4OFYD 5KVFL 1GVIA 4JFHE 1C5BL 4HHAA 4JDTH 3U46A 3ZYJA 3OKOA 1C12A 2Y7QB 3P9WB 1PDKA 2OQJA 2GTZA 5FA3A 4FZ8H 3CFKA 3BIKB 5EPMB 1AD0A 1J10A 1C16A 2EDDA 2QHLA 3MRPA 4M6NH 1C12B 2P7TB 3S36X 2ZUTA 4MNQA 3T0EB 3AMKA 3GBMH 3E8UL 2OQJB 3U6RA 3C6SA 1E4XL 4U0QB 3VG9C 2VLRA 4S10A 3MRPB 1O0VA 5LGJB 1KBGL 5GJTH 4RAUA 2QKIB 4MNQB 3C6SB 5J13B 1N0XL 2O5ZH 1FZMA 3MLWH 2ZUYA 3GJEB 2BOBA 2VLRB 3C9NA 3HG1B 5ESQB 4NCC2 5CP3A 5ISZD 1S9XA 3OGCB 1J0YA 2YMXL 3TIDA 5E03A 2MCG1 1MSPA 3F6IA 4HUWB 4NT6A 2VITA 5DXWA 5INCA 3MJ8A 2OTPA 5C2UB 3F12A 4OF6A 3RNKA 3MXVH 3MUY1 1GGYA 4OB5H 3TIDB 5E6IB 1R6VA 1AKJA 2VITB 5INCB 4BQCA 1NMCC 1MELA 3AAZB 1JPST 3PV6B 4ZAKD 5IVXE 2XQYG 1O5DT 3F12B 2B1HL 4KK6D 1QFWI 2EYTA 3BESR 5FYKU 3TC9A 4PRNA 1UC6A 5JW3H 2R0ZL 1J5OH 1AKJB 3BEVA 5EC2B 3I50H 3LKOB 2XYCA 1E6OL 3N1PC 1YEGH 3MLVH 3NIGF 2ARJB 4Z7UA 1IM9D 3FZUC 4PRNB 2JCCB 2ZPKH 1RJLA 4TVPE 5J7CC 4TVPL 4PGZA 4NM4L 5FYLH 2ZSVA 4HJ0D 3OB0H 2QQNL 5MP6H 2ERJC 3IB4A 2CRMA 4GKNB 4WW2B 1S78C 4W6WB 4LCWB 3GUTA 4FFWC 5GS0H 3L1OH 1IMHC 1EBAA 1KIRA 3IAGC 2ZSVB 1FVDB 4D9QE 2BNQD 4OZIA 3RY5A 4XC3H 5JPMA 3WXVH 3O6ML 5J9PA 1HWHB 4WEMB 4GG6A 15C8L 3BHBA 5TQ0L 1KIRB 1VERA 4OT1L 1WITA 1Q9KA 3ARGD 2J8HA 4IHOB 1J05B 3CZJA 3RY6C 5J9PB 1JPFB 2HKFH 1FP5A 1RQ5A 1J0ZA 5IK3A 3BHBB 5EOQL 3ROLB 4WUUD 5T3XH 1P7HL 4Z8FH 4A2LA 1Q9KB 3DUSA 4QTIL 4I9WE 1HEZA 4KKBC 4TQEH 1KLFA 2VWEC 2YD1A 4XWOD 1K5NA 5BVPH 3GEWB 3T0ED 4ZFFA 3GSRB 1CXLA 1HEZB 3D85A 1U9KA 1G9EA 3WNNA 2DWEA 5D7SL 3BDYL 4MNQD 4EI6B 1QSEA 2FX9H 3STZB 1CLYL 5IVXF 2AJUH 4Y5XA 4J12A 3DWTA 3BKCH 2VLRD 1G1CA 2YD2A 1QNZL 2OCFD 3HG1D 1YN6A 4OGZA 3ZO0A 1S5HA 3ZKXB 5IUSA 2EDLA 5E4EC 3FO0H 4PS4L 3IETA 3ABZA 2VL4A 1G7IA 3SJVA 5TDNB 1NCTA 2A1WH 4PJDE 4GKSB 3HAEH 1P4IL 5C8JB 5J1SC 2XY2A 3CVHH 3L7EB 1S5HB 5ITFB 4JFEB 2IWGA 1CFQB 4FHBD 3VI3F 2YN5A 3IETB 1J12A 5E6ID 1BIIA 4AM0A 5F72S 3VFRB 4H88H 3SJVB 3UO1L 2XA8H 3JWOH 1NMBH 3MRHB 3W39A 1KFAL 3SE3A 4AMKL 3IU4H 5H35B 3FMGL 1I1RA 3RUGA 1DQML 4AM0B 1JYXA 1JNHA 1AKJD 3UTZA 4WENB 2HTLD 3O6FC 2FLBT 4PPTA 5FIEA 3K8MA 3RUGB 3T4AB 5ADOH 4YC2B 2YPLE 1JNHB 5KOVC 1IVLA 1RJYB 2J5LC 2PUQT 2VLKB 3JV6A 3ZMRA 1LE5A 4CDGC 4JB9H 1IAOA 4P2QA 3MCG1 3VD3A 5I71C 5TQ2L 1ZLWH 4P3DB 3E3QC 3JV6B 4M00A 1P5VA 1FG2A 1VGKA 2O5XH 5HDOA 3VXTA 1ZHLA 4P2QB 4RISH 5F6HJ 5I0ZA 2JELH 1EPFA 4JM2B 2WMPA 1YEKH 4J3WA 1IKNA 4ZYKB 2R1WB 1H5BA 3ECBB 5IR1B 1FG2B 3PIQA 2CLRA 2X10A 2XY1A 3K7UA 4S1DD 1FL3B 4YHIB 4WGWB 3QEHB 1SY6L 3PIQB 4PGCB 1S7QA 1ZXQA 4N90E 5ELIA 4MQTB 4I18C 1KACB 4X4ME 4K8RC 4N8VB 3ULUC 1NFDB 1IL1A 1TETL 3DARA 4JFQA 5IQ7L 3SDXE 5E2WH 3S9DB 3TBSA 4KUCF 3FFDB 1JGLH 3JV0A 3MGTA 1QTYT 5DO2D 3WJJC 1Z9OA 3THMH 5GGTH 2I25N 2CUHA 4XWGL 1L7TL 2R1YB 1E6JH 4LEOA 1RUPL 3TBSB 4JJHA 2X1OA 1CFSA 3ZSSA 5T1MA 3RY4A 4OGYL 5F96H 2BVEA 2YUVA 1G9ML 1K3IA 4ZFZB 4LCUA 5D2LE 3X3FL 3TO4B 4KROC 1F13A 3X12A 2F5AL 1IEHA 4NNXB 5T1MB 3VWJB 3MFGB 3MRJA 2R4SL 2P5EB 1PG7H 4J3XA 2PTTA 4KJQD 4X5XA 2VSCA 2XKNB 4O00A 4XT1C 3X12B 5I1LA 5KSBF 1BFTA 1BJ1J 4H1LH 3SJVD 3MRJB 1FAIH 2AKRA 2FJGA 4PTUB 4FQ1H 4CAGA 2PTTB 5DC0A 2OK0H 3K3QA 4WW1B 1P9MA 1WTGT 5E8NB 3CXDH 4HKXB 2NX5E 4HH9A 3AS2A 8FABB 5L0QC 2FDBP 1MH5A 1Z2KA 2EIZB 3OF6A 5K9QG 3EJJX 4LVOB 2FNBA 4MA7L 2FB4L 1MHPL 5B8CC 4CGTA 2CPCA 4C4KO 4GSDL 5F97E 3LS4L 1KGCE 3LN9A 2VLKD 2F8VA 4MCYA 4OM0L 4GAJL 1X3DA 3KPQA 1DQJB 4PV8A 2EDKA 3HAEB 5LBSH 5SWZE 3EOBA 3O3AB 3IVKB 4MCYB 3S98A 4OFVA 3N50A 5FA4B 1WZMA 4P2QD 2ZG1A 4JM2D 4PV8B 1WCBA 3SDXF 5D7KD 5F3HA 3EOBB 4DKDC 3NIFF 1IAIM 5FB8A 5C0RH 1RJCA 2NY2B 4Y2OA 3R8BB 3WNLA 3HE7A 2OR7A 3QEGL 2UWEA 4FXGA 4WDIB 1ADQL 3QO1A 5FYLD 3HE7B 1KIPA 1UCTA 2X4UB 1QOKA 2UWEB 4YH6A 4FXGB 5CWSB 3HE6B 4YX2L 4ELME 3RIFF 3CDCA 4CW1A 3QO1B 3HFMH 4WI2A 3QIBB 5B3JE 5DD1H 4H0IA 2DMCA 3UJJL 1LGVA 1WVZA 2HP4A 3ZE1F 2Z93A 5HGGS 4L8SB 3QUML 3QO0B 1KB9J 3QXUA 1R3JA 2UZIH 4KVNL 1NC2A 3O4OC 2YD3A 3OZ9H 3N1MC 4ONOA 4K23L 4K71C 1RUQH 2DQJH 3TO4D 3LB6C 2Q8BH 5HYQA 1PW3A 2YSSA 4GXUN 3VWJD 5E8OA 3HB3C 5C70A 2VAJA 4NJ9H 4X9IA 1C5CH 2V2TA 1DSFH 3GMPA 3RIFK 1NUFA 1DQLH 4HJJL 1T1XA 2QADB 3HZVB 1RZIA 4X4YA 1PX3A 1ZHBB 4HWZA 3GMPB 4PRDA 3BZFA 1SQ2N 2B39A 1AGCA 3HMXH 3BQUA 3BKMH 5E2UH 1T1XB 1RZIB 4P5MA 2WNGA 3S97C 1OVZA 1T03H 4FQIL 4HWZB 5K9QI 4JZJA 3BPNB 3BZFB 1JTTA 4GUPB 5KSVA 2QSCL 3SQOL 5EU4A 2V17L 3BQUB 4TUKL 3WIHH 4UILL 4P5MB 4BQ9A 3MCLL 3T3ME 4OZHF 5I6XC 4JZJB 1OTSC 4K3JH 4NN6B 4U49A 5E6YA 5EU4B 4UIKL 2VTFA 5JHDB 3FFCA 1NC4A 3QQ9D 3QIWC 2EC9T 1PAMA 4H1LB 1YNLH 4L4VB 4UT7L 4DTGL 1ND0B 4K7FA 4LVNC 3IF1B 5JW5A 3UYPA 2R56L 2NY2D 5IFJB 5EBGA 4PLKC 2ZUUA 1MVUB 4S1RL 5DJAA 5EU5A 5FCUH 3QCVL 5KVDH 4HKZA 4FP8H 3UDWA 5GZNC 5JW5B 3VXME 3LEXB 3DOSA 4YEEA 1Z3GH 4QWWC 3K46A 2VRAA 4XVTL 3UTSE 5LCVL 5J0BA 4DZBA 3HE7D 5MENA 4HKJA 4L5FL 5BXFA 4HKZB 2OP4L 3HE6D 4PFEA 3TP4A 3KLHD 1GAFH 1Q94A 3BD3A 2PYFB 3CLFH 1J86A 1I9JH 2ICCA 2IPKA 3O41B 3QIBD 4DZBB 3TFKC 4HKJB 5BXFB 1WFUA 4UINL 1IEAA 4AG4H 1TJHL 3SPVB 1TJIL 1IILE 3VW3H 4NGHL 1S7VA 1DANU 1FL6B 1OGAB 4JY6A 2YRPA 1DQQB 4WI7A 5EA0H 5DD0H 3MA7A 2VDRH 2XKUA 4L4TE 4WWKC 4L8DB 2V5YA 4NRYB 4QXWA 3MV8E 3NFSH 4L3CA 2VIRB 1UWGL 4GW1A 2XFXA 2R29H 1NC2D 3G5XA 4PJIB 2Z31C 4LL9A 1GRWA 3A67H 3ZKMC 25C8L 3SE4C 5ANMA 2XFXB 2H2PC 4E9LA 5HHVH 2QADD 2WINB 3G5XB 2IQAA 2OXGA 2Y25A 5E5UB 4GAYB 2CR3A 5J6HB 1RZJC 1LVEA 4KHXH 2R0WL 4PJEF 1HSAA 4MLSA 1KG0B 5T1KB 4XC1L 1JHTA 3VMPA 3EO1B 2FATL 5ADPL 2LFGA 2XRAL 4XPTH 4MD0A 4I5BA 4JLRB 1F4XH 5EUOF 1Z6JT 3C5ZB 4HF5H 1KV3A 1RZ8A 3BQUD 1S9KC 1JHTB 3V6FA 1WT5C 5IB3A 5KAQG 2MHAB 4O58L 4EJ1C 2HVKB 3MOQA 1XGUA 4Y4HC 2Q8AL 2ILLA 4I5BB 2FYYA 1RZ8B 4JO4H 5D72H 5JHDD 3RPKA 1LO4L 1G0YR 1GIGH 2GEEA 4XP9H 4ORGB 3BP7A 4XCFL 2PR4H 3MJ9L 4PJ8A 4HPOH 5H94A 1WZKA 2FYYB 1YMHA 3Q5TA 4NUJA 4KZDH 1PSKH 2NW2A 1AP2B 4RRPA 1NC4D 4K94L 4POUB 6FABL 1SHMA 4D2NA 1NCAL 2Q7YB 3S3SA 1X9QA 3BP7B 1WJ3A 4PJ8B 3I2CL 5H94B 4M7LL 1ZLUH 5I76A 2DLTA 2P46B 2NW2B 2FJFA 5B22A 3DGGA 4Z77B 3HRZA 2DDQL 2ZNXA 3KPSE 2ZG3A 4ODXB 3DYPA 5I76B 1TZGL 3MJ7A 4MMZC 3TCLA 3CFJA 4M93C 3VH8B 1X5IA 3WFEH 4IRSB 3GSWA 3F5WB 1OCWH 1MEXL 1EHNA 5MEND 4LRIA 2SEBA 4XP5L 4WHDA 1JZ4A 1AE6L 2Y36H 4ZOBA 4XCEB 1CTOA 5C9JA 2HN7A 5DTFB 5DZOA 1KEML 3OAYH 4BK5A 2Q6WA 3GK8H 1NAML 4F9PA 5I73C 1BFOA 2AEPH 5CD5C 3SDCA 1P1ZB 1ZSDB 5C9JB 3TBYA 5D7IE 5BO1L 3W2DH 1DBKH 5SX5H 4LHJB 4LPVA 5D9SA 3ZE2E 3LVEA 3VXQA 5I1EL 4UT6H 4U6TA 1AR2A 1H0DA 3SDCB 1IC5H 4LSSH 4A6YA 2PYEE 3SE8L 2X1WL 1INQA 1RZ7L 4PJHA 2IFGA 5D9SB 1LK3L 4LSDA 1VCAA 3QNYA 2GFBB 2NY4B 1H0DB 2FSEA 3UTTA 4HLZG 4LAQL 3WS6A 3EYSH 4RFNB 5KSAA 1INQB 4P2RA 3OR6A 3ZYIA 1YYML 5T1KD 3P40A 4KTEL 3UTTB 2MNUA 3MLPA 5JUEL 3I84A 2F74A 4M62L 4P59L 5KSAB 3BH9A 4JRWA 3C5ZD 1O7VA 1OL0A 1CQKA 4G6AC 3VXUE 5I1AA 1E27A 3OL2A 3QUZA 1PKOA 5FYJL 1IE5A 3DX9B 1JGEA 3T1FB 1NGXA 2EIDA 1T89A 4PJ7E 4WHYH 2Q3AA 4MNGA 3HRPA 3KPNA 4RRPG 3MROA 5CJOL 1SEQH 1JGEB 2YA2A 4HUUA 1NGXB 4XBGB 4EBQH 3VI4E 4NC1C 2XN9A 1HCVA 3CFCH 4MNGB 1PJ9A 4N8CH 3KPNB 1Y0LA 1V3KA 4WY7L 3RKPA 1HSBA 4OD2A 3VH8G 3CAFA 4LU5L 3QHTC 2WBKA 4RFOL 3OHXA 4HUUB 1KTLB 1ZT7A 4PJ8D 4NWTL 5BW7C 1AHWC 1N2RB 1NLBL 5DRXA 3VMNA 1Y0LB 2W65A 1HSBB 2QJDA 3BE1L 4MJ4A 3BP6B 5D5MA 1MQKH 1QLEH 3IDMB 4OZIF 4OKVA 1N4XL 5J06A 3CSYA 3NH7L 1EEUA 5E8DH 5AZEL 2UV3A 3UX9B 1HNFA 4GG6F 4MJ2A 4WU5A 1FDLL 2YZ1A 1CXEA 2W65B 4MGXA 4NQVB 4L3EB 5BZDA 2F15A 2XTJC 3W0WA 2FBJH 4OGAD 4IRSD 5D5MB 5I8CA 3GI8L 4W6YB 2MKLC 2R0LH 1NLDL 4WU5B 5DRNB 4MDJA 1R3LB 4FQLH 4PJFE 4MJ6B 5BZDB 3W0WB 4XPBH 6CGTA 3ROOA 3VXPA 4ODSH 4RMQA 5GPRA 1ZA6A 3DIFA 1JYNA 1F11A 1PLGH 4JFZL 4MDJB 1AR1C 3G5YB 2GSIA 3VXPB 4B50A 4LSVH 3H0TB 1ZA6B 3DIFB 1WFTA 2C5DC 4HG4J 3IYLW 5IVZA 1PX4A 1EV2E 3ZL4L 4EEEA 4OZFH 3SDCD 3WIIH 4IJ3B 3OJ2C 2EDJA 2Z0BA 1XCQA 4IOIA 1HK6A 1KTKE 3H8NA 4JO3L 1T20B 3B9VA 4DAGH 3KPTA 2ZCLH 2V6HA 3S34H 2NY4D 3CDGA 1MHHB 4DQOL 1LE9A 4NN5B 2CSPA 3T8XA 2AK4A 4KDWA 12E8H 3FL7A 4HWNA 1FYTA 3VI4F 4HIXH 3CDGB 3UTTD 2GJ6B 3HC3L 1A9EB 4JFDE 5IHUH 2P8LA 1RK1B 5GS1A 4G6KH 5KSAD 2AK4B 4ZFOA 1A14L 4HXAL 4P2RD 1BMGA 2PO6B 1HZHH 3QXDA 4KDTC 5GRUL 4J8RB 1T4KB 3RPIB 3RA7L 5EB9A 1UB6A 4ZFOB 2LVEA 5I15L 3KR3H 3RFZC 3QG7L 3QUZD 4OCSH 5A3ID 1A6WL 4DGIL 4OLEA 1YJDC 1FSKB 3UAJD 3S4SB 4WFGE 5D7LA 1UB6B 2CGRH 2FHBA 4X6DE 2EXYD 4S1QL 5FHAH 1CL7H 5ILTL 1CXHA 2CO6B 4XB8A 3DRTB 5HYEA 4PYGA 1P7KB 1RUKH 1OARH 3LMJH 1RMFL 4ERSH 2XN9D 2VXTL 2BVPB 1ZLVK 4CU8A 1J8HE 5GJSH 4MB3A 3KPOB 1U8PB 5EC1A 3Q1SL 4LLAA 1FZOB 4EOWL 1DZBA 1A7PL 3A6BH 2YXMA 4OIIH 4M1GH 5E2TL 5TGBA 4Z5RB 4ZD3L 4PG2A 4L3ED 4HBCL 4X5WA 5ESVB 4PRIA 5DQJA 2EXWC 1F00I 3EHBC 2Y5TA 2NMSA 3QFDA 3EYQC 4BQ6A 3QUXB 4X5WB 3W0WD 1KCSL 4TSBH 5D6CB 3TYGL 1CFVL 1YA5A 5LGHL 1NGZA 1NKRA 1DEDA 1EMTH 3MRRA 1KC5H 4LSUL 1DQDL 4M1DH 2VDOH 4BQBA 4LEXL 2R9HD 2VZ3A 2Q20A 2IH3A 1X4XA 4E5XA 3WD5L 4ALAL 2R23A 1IGYB 4LP5A 4OGXH 4D9LL 5KS9F 2HMIC 5F9JA 3ULVE 4EDWH 1FO0H 3WDHA 1H3PL 2BVTA 2GT9B 4GMTL 2M26A 2IADA 1VGEL 1WZ1H 1I1AC 3U36B 2HWZH 5F9JB 1FLRL 5HI3C 1OOAA 3TWCL 5GRJH 1ETZA 3H3PL 1WC7B 3KPRE 4L8BA 3ZKND 1U91B 3EYVA 1ZANH 1ORQA 3IFPA 5IT2L 4KJWC 3L3IA 2CUIA 3U7WH 3MACL 2I9LA 3S4SG 3WFCH 4PB9H 3ILQC 4G42B 2AK4D 2IAMA 3EYVB 1YMME 2PTVA 4EXKA 1G6VK 1FYTD 3IFPB 1Q9OB 1RUAL 1T04A 5DUBB 2F8XC 5BRZE 4YAQA 1M4KA 3U7YL 2I9LB 1Q0YH 3B2VL 3TN0C 1MIML 1ZT1B 3V4VH 5D1ZA 1MI5B 3FO9B 4I2XE 2ZOLB 4EDXB 3MNVA 1X5JA 5IBLD 4KDVA 1SMAA 5FK9A 3ZHDA 3GSXB 4ZFGL 4YAQB 1CR9L 3WE6B 4ENEC 5FO7A 5IWLC 4FQCH 2J8OA 2BJMH 3WHE1 3MV9A 4L29B 4KK5D 2EH8H 3ET9F 3S36H 1UM5H 3LV3A 2J4WL 1YDPB 5FO7B 1ED3A 3FOLB 2R69H 4KI5E 4YBQC 5J89A 3FONB 1UA6L 3LV3B 5F88B 3KAAA 4FNLL 3S5LA 3SKJH 4NHUA 4C55A 1W8OA 2V5RA 2X9XA 5TDPA 3C8HA 2FEDD 1JGUL 1JE6A 3NABL 3CIQA 4RNRA 3S5LB 1I4FB 4R6UA 2FR4B 4NHUB 1R24A 1DVFA 4F7MA 1FVCB 1YECL 4ZTOL 1GZQA 4Q9QL 2W0PA 4AIXA 5D1QA 2ZUQB 3HC0A 3VJ6A 1B88A 3ARWA 4PRID 1QG3A 1VPOH 2AJYH 1RIHL 3MRGA 2YK1L 3KYMA 4F7MB 2Z92A 2VH5L 3QNZA 2AJZB 4OIAA 4EIZC 4OF0A 3BZDA 4PJ5A 3D18A 1Q9WA 3G6JB 1GZQB 4JPIB 2R0ZH 5D1QB 1RIUL 4R7NA 43C9A 4I0PA 3QUYB 5BZWA 1E6OH 4LPCA 1BOGA 1CDIA 4XMPL 4DUXA 1OGTA 5ALBL 1KJ2A 4NPYB 3D18B 1Q9WB 4N1CA 4AEIH 3ARFA 1FL5B 1OT1A 5BZWB 2VL5A 2NTFA 4R90H 5IQ9A 5GISL 5ECJE 2WM0A 1OGTB 1X5ZA 4RGNE 3TLRA 5IM7A 5J11C 4DOHB 2EDQA 5KVGL 2JJSC 3UROR 4UAOB 1XGYH 3ARFB 3BIAX 3ARQA 3JTSA 1DJSA 1G7PB 2VL5B 4UB0H 2B4CL 3SY0B 5IM7B 3RTQC 5HGHA 4L9DA 4M6OH 3WO3B 1ORSB 1ZKAA 3JTSB 4TN9A 4GJTB 2XT1B 4QHKI 2CQVA 2IQ9H 5F89A 4J4PD 5LXGH 4R7DA 1WICA 3K2UL 3L5JA 1QVOB 4QO1A 2YEZB 4XXCA 5CJBA 4JANA 4YDJA 1YY9D 2IAMD 4F3FA 5JQ6H 3E6FA 1A7QH 3QRFM 2D7MA 2WV3A 4ZUVA 3GO1H 2A9NL 3MRQA 4X6CA 4Z0XB 3V5DA 4RZCB 1QSFB 4F8TA 5HHOA 5DI8A 4HFUH 3GBNL 3JV4B 4FFZH 4HC1A 1WAAE 4HCRH 3MRQB 2XZZA 3S5LG 4WEBL 3B9KC 4Y16B 3DO7A 1ZGLB 1HINL 1CIUA 4RQQA 2BY3A 3WHXA 3PHQA 3KYOA 2E8YA 4M43H 1KCRH 3QDME 4JFFE 4CMHB 3H9SA 3QUKB 2RGSA 3DO7B 4WFFD 5JOPD 2D9CA 2F53E 4KXZH 5DD5L 3PWUA 1HHGB 4JY5H 1SM3H 1KN2H 3PHQB 3KYOB 4U1GC 3TESA 4LNRA 4X6EB 1ZLSL 2FEEL 3T4YB 4R3SA 3QPXH 1U8QA 4QRPB 4XPFL 3UPCA 5LWYL 2CIIA 1OQXA 3UO1H 4S1SH 4HDIA 3CX5J 4U1MA 1DVFD 2A74A 2AK1H 3E0GA 1U8QB 5C08A 1BOYA 4L4JA 5SWQB 1MFDL 3OAUL 5D1QD 5FUOL 3QUYD 1QLFA 4U1MB 2CDEB 1OD7A 1EH9A 4N0UA 1YQVL 3WS3A 3VFUA 5B39A 4YEFA 5FFLA 2ZCHL 2LTQB 2VZ1A 3RVTC 5TE4H 1A1OB 4Q58C 4BSWB 4I0PD 1DLHB 5A2JH 2C3HA 2E9JA 3WS3B 3VFUB 3EJZC 1A47A 2V2XA 4LIQL 3CGTA 4Y19A 4Y5VC 5JDSA 3ARFD 3VFTB 3VXNB 3BO8B 1KCKA 3MRNA 3DECA 2FIKA 4YE4L 3WFDL 5EFIA 2WWKO 4QHUA 4YHYB 4HWUA 4QXTA 1W0WA 4Y19B 2QSVA 1J18A 5JDSB 2EEBA 2VOTA 4DGYL 5IP4A 3QQNA 3AGVA 1DEEA 3L5XH 4N5ED 2AI0H 1EX0A 4NZRH 5DMJB 5DJ8B 5GGSY 3VWKC 4KRPB 2X7LA 1HCFX 2C3GA 5EFIB 4QHUB 4QXTB 1W0WB 2CDFA 1TENA 1W72H 5I75C 4WTXA 4X9HA 3MLSL 3HUJA 4CN6A 5CEZH 4N9GA 2X7LB 5E1AB 1J7VR 1S7TB 1HYRC 1FCGA 1XZ0A 4OI7A 1HHJA 3BKYL 4OV6F 3J8F7 2VABA 2EO1A 2AV7A 2ZJSH 3NA9H 3RZCC 1K4DA 5ENWA 4WVRA 3CMOH 4MVBD 1HHJB 5I1KH 4OQTA 4MA8H 3LKPA 4G8IA 4ZSOA 2AV7B 5IOPA 1L7TH 4IRZH 1HN1A 3CPLA 5IBTL 2J6EL 5KG9A 4LQFH 4Y16D 1K4DB 2D03L 4N0CD 1E4KA 2NYYC 4ZUTB 3GRWA 5CGYC 1MY5A 4G8IB 9CGTA 1WWBX 4G6MH 5IOPB 3NGBB 1UM6L 3BN9C 3X3FH 1SJXA 1QRNB 3TVMB 1KSRA 4JG0L 4C56A 5C0CA 4P46B 1CICC 3EO0A 5DEGA 3LDBC 4M7ZB 1MFBL 5MI0C 1RIVH 2VAAB 3F7QA 4QRPD 4XBEL 4TUOB 4HD9A 1XGTA 2IPUG 4C56B 2AJXH 3DSNA 2GAZB 3EO0B 5DEGB 5HGAA 3BPOC 1JHKH 2IMMA 1P7QA 5B39G 5I8OH 3FCTA 4FXLA 1XGTB 1CD9B 2NNAA 3IXAB 5HGAB 4MJIB 1NCBL 3L3DA 3PNWA 4JM4L 4KJYB 1MHPH 1RZFH 2XQBL 4PRAB 3E2HB 1XGQA 3O3EA 4Z7VE 1KULA 1QUNA 3BUYB 3QAZC 1P6AB 3RVVC 4JFPB 1A7BA 3MR9A 2GUOB 4PRHE 3FN9A 3U9UA 1K9TA 1N0LA 4HGKC 1T3FA 4JE4B 2FHFA 4JRYE 1FV1A 1XGQB 3O3EB 4M48L 1GC1C 2A83B 1KTDA 4HBQA 2A2QT 3IJYB 5AYUH 4MXQD 3U9UB 3W9EA 1EHLL 3T04D 3P9LA 1T3FB 4Y19D 3GSNL 1FV1B 3BYYA 3WNPA 3GFUA 3BRDA 3DVGA 4LVHB 2N4IA 3VMOA 1A2YB 2GSGA 3P9LB 1D9KB 5CSZA 5FYKD 3FQWA 5DFTA 3DVGB 4PJCE 3VGEA 1KELL 2LE9A 5F1OB 2YPLB 3OWEA 2FECL 5CILL 4LPXA 2XZQL 3RDTC 5J12B 1OP5K 5T33L 3G6DH 3FRUA 3VFSA 2QR0B 3AS1A 3EBAA 4BKLA 1WIPA 4WI4A 1ZVYA 2D2OA 4LCYA 4YHZL 5EU3A 3T1WA 2ITDA 5IROC 1BLNA 2DQUH 3QUMH 1M05A 3VFSB 1NQBA 1N6QL 2BERA 5FAAA 4F37F 5CINL 4LCYB 4AIZB 2APVA 4YXKL 5EU3B 3CH8A 3MODH 4F15B 2D7NA 4V2BA 4RDQF 5MEOB 1M05B 1W72B 1S7WA 3LKSA 1OP3K 2JKXA 1QRND 3TVMD 4XNXL 4P46D 1TCMA 1U8LA 4OLUH 2C1PA 1EGJH 3PHSA 3SDAA 3LKSB 1VADB 3RWFA 2FO4B 4Y2DB 4HUKB 4C56D 3SDYH 3QDGA 4R2GC 1U8JB 4OZ4B 5C0CD 5LQBL 5L8KB 3S3JA 2RFXA 1MFCH 2HLAA 3SDAB 3RWFB 4F37K 2DOCA 4TTDC 3QDGB 5D2NC 1SJEB 4FS0A 2RFXB 4MJID 2HLAB 4PGBA 4QRQA 4GRWB 5F21B 4PLJC 1I75A 3QDJA 5K59F 3NZHL 5LAXA 3ZTNH 4UILH 3RX7A 1K2DA 5D2LB 1AXTL 1LP9B 3CK0L 1NUDA 5CUSL 1INDH 1OAXL 3C60A 3QDJB 2R15A 1BX2B 4PBVC 1Y6MR 1K2DB 2IBGA 2NXYC 3V5HA 4M5YL 4ELKA 3Q0HA 2J8UE 4KY1H 4H5SA 4LRNL 2BNRA 5I19L 3R06B 2VQ1B 3C60B 5DVMA 3UP1A 3O8XB 5C07E 2OL3L 3V5HB 4OZGA 1UH4A 4ELKB 5C0EB 3TBVB 4H5SB 5DK2B 4Z7WE 2H1PL 5EOCL 1NMAL 4Q0XH 2NX5B 1G7HB 4NKMA 1J0HA 3LD8B 4YFEA 3S7GA 3MRCB 5B4MD 1YUHA 5DQDL 3OG6B 1TVHA 4S2SA 2KUTA 3RHWK 5DMKB 2X1PA 2NY5C 4NNPL 1JRHL 2UY6A 2OP4H 3O6LL 2APBA 1XF2A 3QB7C 1YUHB 4N0FA 4P3CL 5C0AA 1YPZB 1TVHB 5EU6A 5SWZB 3GHBH 3P0YL 3G04A 1EEZA 1FNLA 1A22B 4NQSB 3I6LE 4ZOEA 1D6EA 5E70A 1OT2A 3CU7A 5HDLA 5IW6A 5TE6L 1XF2B 1A5FL 3FO2A 4N0FB 4NQEA 1TJIH 2EDOA 1MLCB 3G04B 1FGVH 3M1BA 1IGCH 4Q6IB 3VXRB 1D6EB 4XB7A 5IFAH 1FNEB 5IW6B 1DANT 1SVCP 4LSRL 3FO2B 1MCQA 4PJBA 4MJ5B 3VG9B 4YHLL 7FABL 2A0LD 5DA0B 5CEZD 4BYHA 3TIEB 4PJBB 1I3RA 4YXHH 2X4PA 4U3HA 1LEKA 3WL9A 1S9WA 3H9ZA 4K2UH 4TSCH 4TNVK 4O5LL 1D5ZA 4X8JA 5E2VH 2QSQA 5SV4A 2FGWL 3OKMA 1H5BC 3SDAD 1LEKB 3WFBL 3LEYL 5FHBH 4NQUA 3L9RA 1S9WB 3AXLA 3PQYB 3I6KA 3QDGD 1D5ZB 2R2CA 4JPWH 1RZKC 2R0KH 4LPUA 4X8JB 4Y8AA 2XACC 3C08L 2NR6D 5ISZE 1NMCB 3TNNA 3L9RB 3WIFB 3GSUA 4U1LB 4M3JA 3OXSB 3BP5A 3CCHA 2VXUH 4HT1L 1NCCH 4O58H 4R4BA 3ULSB 1YEIH 3MFFB 2FX7H 2H6PA 3TNNB 2FZ3B 3QDJD 3GSUB 1VFBA 1LEGB 4HIEA 3RWDB 3BP5B 2AQ3A 3KPMB 4P0DA 5CBEA 4B41A 3C60D 1VFBB 5CHNA 4OCXH 2OYPA 2B8OT 1X5FA 2AEQL 2OZ4A 1A7NL 4LASH 4OJFH 5TH2A 4CMMA 2BNRD 1X6NA 1F58H 2DJ4A 1BJ8A 4I8DA 4X9FA 5IB1A 4JJ5A 2Q1EA 4K9EH 1BD2B 4TPRL 5CHNB 5FCSH 4ZUSA 3LHPH 2P45B 3QULB 2I9TB 1K8IB 1WFOA 3I9GH 4BSVA 3KGRA 1BM3L 1B2WL 1FGNH 4XI5C 3EDFA 2M2DA 3CFEA 1JWMA 4ZUSB 2EKJA 5DMYA 2DD8H 3BAEL 3NCCB 3OKEA 2H3NA 2BNQE 5F7KC 5IW1B 4U6YB 1U3JA 3CFEB 1JWMB 1R3KA 1IBGH 5M94B 5JIKA 4QCIB 1TTFA 4K7PY 3OJDA 5DGRA 1M1SA 4U1JA 3P4MA 5BVJA 3VXRD 2YA1A 1X7QB 4UTBL 1MAKA 1UYWH 4NQED 3OJDB 4ODBD 4WUUE 3V2AR 2OTUA 5EOCJ 3INUH 3CUPA 1MF2H 1ZHKB 3P4MB 3UXFA 3D3VA 5A16A 3G9VA 3MGAA 3ZE0E 1DBJL 3SGKA 4HIIA 3UTSB 4EUPA 3BDXA 4DCQA 3CUPB 3T0EE 4WI3A 3VD4A 5IIEB 5A16B 1BVKA 1IM3B 3GB7A 5CP7A 4I3SL 2NW3B 3IDXL 4E0RA 4EUPB 3MZGB 4ODWB 1YEDB 4UTAL 3RAJL 4DCQB 3IDIA 4MNQE 3BT2H 2DLFL 3ARDB 1BVKB 2ADFH 2ADJA 3PQYD 3ARBC 1JV5A 3GB7B 4CDHA 1GHFL 2VLRE 4LF3A 3ZDZE 1AGEA 3HG1E 1G7QA 1N59A 3KPLB 1MRFL 1BREA 4PJAF 2HT3C 4RMTA 1JV5B 4H20H 1QZ1A 4MS8C 2FJHB 1IT9H 2HKHL 2DM4A 1N59B 4ISVA 4RFEA 3IFLL 4TYUA 3A0OA 3VRLE 4Z7OE 3O6FB 5L9DL 4LHQB 5CJOH 2CKBA 3T77A 1WF5A 3S35L 5L6YH 3FZUD 3EO9H 2J5LB 3P4LA 4RGOL 5DFWH 3B9DA 4IOFC 1ZLVH 2CKBB 4M61A 3T77B 4HIJA 3P30H 4NO2A 5I71B 2ED9A 4OF3A 2H26A 1MNUL 3VFOA 2MPAH 2O93L 1MWAA 5CD3B 4YHML 2IBZY 1ZEAL 1HI6A 3DLQR 4KZEH 2W9EH 5IBUG 1BD2D 5TDOA 1T80A 2A9MH 1ACYH 2JCCE 4DVRL 4HIJB 5T1LA 4HWEL 3B9AA 1MWAB 4N9OB 5HGDA 1HI6B 1KXVC 3DBXB 3D48R 4KUZL 5DD6A 5TDOB 3GDBA 4LLDB 4FTVA 2XQYK 5DMGC 5E2JA 4I18A 3DROA 4JDVA 5T1LB 1A6ZA 2H32H 4Q9BA 5EWIH 5HGDB 4WRLA 3SKNB 1KIUA 5DD6B 3FHQA 4P9HC 3DO3A 4HEPG 1NJ9A 4U6VL 4KKBD 5DJYB 4JDVB 4YFDB 3WJJA 2VXQL 2C3WA 5ACZB 4NQCA 4X6CF 2RBLA 3G6AB 2IG2H 5MEPA 4QRTA 4A2MA 1FE8H 4EUPG 4CRPA 2AS5M 5F7HA 3ZDZF 5TJWK 35C8L 4ZDHB 3MBXH 4NQCB 4H26A 1MCPH 3QHFH 3T3PE 4I4WA 4MAYA 3AS3A 4PY8I 3TPUA 5MEPB 3U4BH 5MEQA 4B0MM 1XIWC 1NUNB 3GMNA 5J3HC 1F3JA 1I7TA 2YWZA 1EUTA 3D3VD 3U9PH 5DUPH 1P4BL 5HHPB 3V4UL 5ERWA 4KROB 3VXSA 4MXVE 5E08L 4AT6B 1DUYA 5F7FA 3GMNB 1MAMH 2X1QA 3CLEH 4HK3N 5CBAA 2XXMB 3JBG7 3HC3H 5FYJU 5ERWB 4YDIH 3VXSB 1B4JL 1B0GA 3EGSB 2CRIA 1CDHA 3BDBA 4JDTL 3PJSA 5CGTA 4HUNB 5D7JB 4NZTH 4FZ8L 5IHZA 2B4CC 2I07A 3DVIA 1J87A 1NDMA 5L0QB 3O6FD 4UUJB 4M6NL 4U31A 1NBVH 4WW2F 4NQDB 3SJVE 5B8CB 4UU9A 3GBML 1AGBB 3HNSH 4W81A 2I07B 3TH4T 2APFA 2G2RB 1NDMB 5FXCH 2JK5B 2AV1A 3PWNB 4GQ9H 2IGFH 5GJTL 3MLYH 4UU9B 4WFED 5DC9B 1DE4A 3QH3B 2HJLA 3MLWL 3IRZA 4LMQE 2AV1B 3RUGE 4NC0B 2VN4A 2V5MA 4HWBH 4PGEA 4PLNC 4JO2H 2VLKE 4L9LC 1DE4B 5L2KB 1K4CA 4ZO7A 3TV3H 1JIBA 1M7XA 1RUMH 4XNMA 2I5YH 3C8DA 2MJWA 4QXGH 5CS7A 4HBCH 4PJ7B 4L1HA 3EOTH 4W4NA 3MXVL 1CBVH 1EEQA 5T1LD 4JFOB 1VB9A 4P2QE 3ELAT 4XNMB 1KPRA 4XNUH 3HUJF 4NJAH 5D7KE 5EZIH 1U8KB 4K8RD 4H0GA 5C7XL 4LK4A 3ULUD 4U6XB 4G6FB 4MXVF 4EKXA 5JW3L 1II4E 1KPRB 1J5OL 1FNAA 3IDGB 1KCLA 2NPLX 1BZ7B 1YEGL 3O4LA 1LO5B 5L2JA 3MLVL 2WUCH 3QDAA 2ZPKL 3WD5H 4NQCD 3FT4A 3BZEA 5FYLE 5FYLL 3UMTA 5MP6L 4G8GA 2PN5A 3N0PB 3ULVH 1A6UH 1D5BA 1CXIA 3F8UB 1LNUA 1HXYA 4CU7A 4GOSA 5GS0L 3L1OL 5INDA 3FT4B 3BZEB 4K71B 1PQZB 3L3JA 3EOAA 4KROD 4XC3L 1UZ6F 1QBLH 3WXVL 1UXSB 4NFBA 1U8IA 2BY1A 4PGDB 3UZEA 4XNYH 3FQUA 5HDBF 2BXYA 3EOAB 3VXSD 3B5HA 3IGAA 5F93C 5K9OA 2HKFL 1A21A 1U8IB 3ZDYE 1ERNA 2EICA 2CK2A 4Z18A 3W5NA 1NDGA 4EVNA 4Z8FL 5K9OB 3SGDI 4TQEL 4NO3B 5AYQA 4HJGB 4W6XB 2UZYB 3V0VA 1DFBH 4LRIC 4AZ8A 5BVPL 4NQDD 1N64H 1NDGB 1Y6NR 3TBWA 1NSNH 3VE0A 5I6XB 3V0VB 1J0JA 2AXJA 2W0KA 5DQ9A 2ZUXA 2HT2C 1ZWIB 2BX5A 4X5LA 2YD7A 2AJSH 3MUGA 4MQXC 3PHOB 2FX9L 1MJJA 3QIWB 2AJUL 4Y4FA 3BKCL 3HPLA 3GZKA 1NUGA 5ICXB 4U1HB 5CCKH 1MJJB 3FO0L 5L2KD 4LVNB 1EHAA 3U4EA 4DZ8A 2A1WL 1JGUH 4S0TD 3CVHL 4BM7A 3KHQA 3LN5B 2CLVA 2BRRH 1M7DA 3VFPB 1NFDF 4H88L 4X7TA 4S11A 2XA8L 2HRPH 1NMBL 3JWOL 4ZTOH 4PJXA 4OCWH 4Q9QH 5SWSA 4MHHG 4CN1A 1GPOH 3IU4L 5HYJA 1SMOA 1RIHH 3BGAA 2CLVB 4G6FD 4X7TB 5J6GA 5HYIA 2OMNA 3WJLA 3PXJA 5SWSB 3QUZC 4PGJA 4XMPH 2XIDA 4WWKA 2OTWA 4KRNA 3VD7A 1NFIA 3ESUF 5J6GB 4I48A 4JB9L 2UWEE 1I8KA 3O4LD 4QEGA 3AFLA 4JVWA 1D3CA 2OTWB 1NFIB 2EDNA 1TZHA 2ATKA 3ZHLA 2O5XL 3LB6D 1I8KB 4RISL 2JELL 4ZPTB 2Z31B 4V2CB 5A2IH 1YEKL 3M07A 3MV7B 3VGGA 2AJVH 3HB3D 1LO0H 3L3GA 1G0DA 2MQCA 3PWVA 4FFVC 4XVUC 1TZHB 3X17A 1KXTB 2RCSH 1NGWA 2EDFA 2PNDA 1P53A 3L3GB 5FO8A 5EBLA 2DLEA 1ZT4B 4P9MH 2Y1VA 3W5MA 5EO1B 3FRPG 4G8EA 1JPTH 2W38A 1NGWB 4U1SA 5FO8B 4QHNB 4GW5A 1KTRL 4Y4HA 2ITCB 2X09A 1MCOL 1KNOA 5E2WL 3MYZA 2ED7A 3G08B 1JGLL 2JJUA 2EE9A 4G5ZH 3THML 5GGTL 1OTSD 2Z9TA 4GW5B 4Y4HB 5I1IH 1EA9C 3K0WA 3QQ3A 1E6JL 3CMGA 4KJPC 4R8WH 3QIWD 2MOVA 4O2FA 5F96L 4XTRC 1CYGA 5FGCB 1YY8A 1T2QH 1U8OA 4XAKD 2AXGA 4Q97A 3QQ3B 4MQ7B 4QY8B 1FNSH 4NUGH 5BRZB 1KN4H 5JHDE 4UNVA 4PLKD 1OY3B 1CF8H 1YY8B 1PG7L 5IF0B 5I66B 3U2SB 2NY0C 3HCVA 5GZND 4PB0H 2FL5A 4QWWD 4B7IA 1FAIL 4MHHI 2ARWA 4FQ1L 1J8KA 3C8KA 3QYCA 4M93B 2VSDA 1KLGA 3GJFH 5GS1C 4HFWA 2XWBA 5H37H 3FB7B 4YFLF 5SWSD 3MRLB 3TT1H 5AAMA 1T0PB 2QBWA 2DLGA 3TFKD 3C8KB 4O2CB 3I75A 2XZAH 1XF1A 1UQSA 1DTUA 1G6RH 5E56A 5EOTA 3FO1A 3PG2A 5M95B 5HHNA 4HFWB 3QCUH 3O9WA 1S9YA 2D0FA 3P9MA 4J3SA 2DIBA 3HZYA 1CD1B 5I73B 1A9BA 3MNZA 3O2DA 3I75B 4WWKD 1I1YA 2BOCB 4JFXA 1UQSB 2NXZC 1KIQA 5MENE 1NCUA 1S9YB 4QYOA 3BP4A 3P9MB 4X4XB 4L8CA 3HZYB 1U8MA 5HD8C 2Z31D 3MNZB 3C5JA 4D94A 5HY9A 3MV7D 3WFDH 2UUDH 1G7MB 3ZKMD 1U42A 4WUKH 1KIQB 4IM8A 5ETUA 2XG4A 4QYOB 5C0RL 3IDJB 2H2PD 4L8CB 1T0NA 1YJDH 1CGYA 3MC0A 3QJFB 5HY9B 4YUEL 1N5YL 2V2WB 1IGTA 3D39A 5ETUB 4TNWF 1ZVSA 1T0NB 1OP5H 4POYA 4W70A 1K8DB 2E27H 3C5SA 1VKXB 1JUFA 5DJZA 2DQIH 2CKNA 5JORB 3D39B 3ARUA 1CLZH 1WBZA 3FHAA 1ZTXH 3VRIB 3LS5H 1ZVSB 3HFML 5HGBB 4BA8A 5IEHA 1I1FA 1TCRA 5DD1L 4Q2ZB 2D7QA 2P24B 1UCBH 1JUFB 3L3KB 5DJZB 4Y4HD 4YHNA 1HH9B 3CX5K 1WBZB 5MERB 3UEZA 4O9HH 3VA2C 5HHXH 1TCRB 4P23C 3F62A 3OZ9L 1OTTC 3U0WH 3WN5C 3T08A 4OI8A 4APQA 1OP3H 2ATPA 4TUJB 1RUQL 4HS8H 2DQJL 4TNWK 2YBRA 2Q8BL 2Q86A 1V3LA 3QXVA 4ZO8A 3OR7A 4NJ9L 1AHWB 1C5CL 2B0SH 1BBJA 1DSFL 1UG9A 4LLVA 5EUKB 5EO0A 5GS3A 5C6TH 4X0KB 2YBRB 1DQLL 4MWFA 4G9DB 4Z78B 3OGOE 4R26H 4G9FA 2WP3T 1H8NA 5F1NB 1PZ5A 1BBJB 3MUHL 5E8EB 4LLVB 1CFBA 3MBEA 5I0DA 3HMXL 4K3EH 3BKML 2DM2A 4MWFB 5E2UL 1CLCA 2PW2B 2XTJB 1R5VB 5DMIH 4G9FB 1S7SB 1UADC 1T03L 1OW0C 1F3DH 3DNKA 2YPKB 5AWNH 2A6KA 1I8MB 2IC2A 3WIHL 2CXGA 2FGZA 5FUCC 1XFPA 2BSTA 2NZ9C 5D1ZC 3UYOD 1EVUA 4K3JL 4MZ3A 3GMRB 4LLYA 1A7RH 5J1AB 1F2QA 4P2OA 2P47B 4PJIF 3IDYC 5CD5D 5IB5A 5DK0A 3TT3H 3EJYC 1TPXC 1NEZB 5IVXA 3PWPB 1UFUA 5D71H 4LLYB 5C0DA 4K7PH 4M48H 1YNLL 4MCZA 4JGUA 4WU7B 2XZCH 3FQNB 3BPCB 4ORZC 3QA3B 4AIOA 3GJFB 3VFMA 1G6RA 4DEPC 4F7CA 5KVDL 3LKRA 5LKNA 1JMXA 4FP8L 1YN7A 1Z3GL 1DL7H 2P5WA 2VLLB 1G6RB 4LKXA 3NZ8A 1KELH 3LKRB 1CQYA 2AERT 1PY4A 3F7VA 1GAFL 1C1EH 4OUUB 3D39D 3NFNA 5DJ0A 1KUMA 2CUMA 3CLFL 1I9JL 4G6AD 3KPPB 2Q7NA 3JSSA 4UOJA 3REVB 3F7VB 4AG4L 4PJHE 2Z35B 3D9AH 3MRBA 3VW3L 5DJ0B 5IFHH 1I8IB 4EN3C 2EYRB 3UTTE 2ADGB 5EA0L 5IG7B 3CFBA 5DD0L 4RMSA 3TBTB 4BFBD 1C7TA 2VDRL 5E7FA 4P2RE 3UJIH 3QWQB 3GSQA 3MRBB 3NFSL 5EDXA 4F2MA 1FZKB 1JF1A 1XF3A 1CU4H 4XHJC 2R29L 1UXWA 3DV6B 3QG6A 1IAIH 1KLUA 3A67L 3GSQB 1HDMA 1EZVX 1IFHH 1UXWB 3L6FA 5HHVL 1N6VA 4OCMC 4IIQC 3QG6B 2CK0H 3QNXB 4MNGE 5AEAA 3DURA 4LGPB 3TF7C 4KHXL 4WHCA 3NTCH 1PEWA 2DM7A 2XTJD 3QR2A 2XN9E 3PWLB 5TF0A 4G9FD 5FECB 3QBTB 3DJ9A 2WWMC 4XPTL 1F4XL 1HXMB 5BJTB 4HF5L 4XXCC 1T1ZA 2H41A 3SGEI 1I3GH 4HKBA 1J0IA 4DKEH 3CVIH 4L3EE 1JGVH 3GMQB 2EDTA 5D5ME 4XCCL 1AR1D 4JO4L 4MSWA 1RPQA 5D72L 5HDQH 1QKZH 2DL2A 1GIGL 5JW4N 4XP9L 1GOFA 2I24N 4QTHA 1DUZA 2PR4L 3PWPD 3NCEB 4PY7A 4U1NB 2VR5A 4HPOL 1JYWA 3BRFA 3W0WE 1F90H 2R2EA 1YNTA 1PSKL 1RULH 1I1AA 4XXDA 4QTHB 1DUZB 3VD5A 3ZHKA 5KSUB 1SYSB 3D25B 1I1AB 4WI8A 1CT8B 3MCKA 32C2B 3RWCA 3TJHC 1JMZA 3UBXA 4TVSa 4LLMA 5L8LB 5ICZB 3OQ3B 4Z7VB 3MCKB 3MRFB 3NIDE 3WFEL 3WEXA 1QFWH 2P5WD 4AH2A 3TN0A 5DJ2A 5KSBB 1UKSA 1MUJB 3O3BA 3AREA 1OCWL 5F7YC 4P3CH 4QOKA 4QRSA 4R97C 1OP9A 1DDHA 1RZGB 2Y36L 4UQ3A 4LAJH 1GZPB 2RQ8A 5IWLA 3TN0B 2O61A 3QEUB 3VCLB 3GK8L 4QOKB 5DRZA 5FV1L 1MCHA 2BC4A 2AEPL 2AK4E 2DB8A 5IV2A 5HPMA 4M02A 2E5EA 1SY6A 1FYTE 5IMOA 4HULB 1SBSH 1E28B 1UZ8A 1E4XI 1QFOA 4JQXA 4LSRH 3W2DL 1OPGL 1DBKL 1WWCA 5IMLA 5DRZB 3DX7A 4UT6L 5HPMB 4LSSL 4AQ1B 3U1SL 1AQKH 3SDXA 3WLBA 1UZ8B 1QHPA 3D69A 1N3NA 4FXKB 5IMLB 3RGHA 3CX2A 3FB6B 5FGBC 3DX7B 4TRPH 1EERB 3KG5A 5FDWB 5TPWH 1T7WA 1CXKA 3IAQA 5DWUH 3EYSL 4JHZA 3REWB 1N3NB 1U8HA 1MFNA 3DYOA 1OLZA 1GGIH 3STLB 1SVZA 2EXWD 1UACL 4CVUA 3EHBD 3O6KH 1T0MA 3O81A 4F57H 1U8HB 3EYQD 3IKCA 2EDHA 1CZ8H 2JJWA 1Q72H 3W11C 2MTPA 1I7UB 4ZPVB 4KWUA 3ARRA 3TEUA 5FM5O 1T0MB 1MCNA 4LFHG 4PJ9C 2VLJA 4ZS7H 1TZIA 3IKCB 2P8PA 5JPNA 3I02A 4UIMA 4IS6B 5DGQA 4KUCD 4JZOA 3WYRA 1FORH 1CN4A 3OKDA 4EBQL 1DBMH 3Q6GL 4Z7QF 3NIDF 4XH2A 3CFCL 1TZIB 2P8PB 4PRIE 5JPNB 1S7RA 4GRMB 4N8CL 2FH8A 2HMID 4WTZA 5C0NC 1NANI 4JZOB 4FA8A 4N1HB 2XTLA 2VISB 3RTQA 1T1WA 3UBXG 1TVBA 1E4KC 5J11B 1G7LB 1I1AD 1S7RB 2QQLH 1I7ZB 3NN8A 5HI3D 4UBDC 1A4KB 1NKOA 5FEBA 1MQKL 1QLEL 1S7UB 3LSOB 4JZNA 1TVBB 1Z9LA 5E8DL 5DF0A 4JFYA 4KJWD 2YHGA 1AGDA 2WUBH 5JDJA 2Z8SA 2FBJL 1QFUH 1D6VH 1A4JB 3ILQD 2G60H 4JZNB 2R0LL 1AGDB 2GITB 3VGDA 4FQLL 4XPBL 1NCDH 4ODSL 2AVGA 3TN0D 4XPAH 5JR1H 4KKAC 3HC4H 1PLGL 4QOKD 4OZHA 4NQXA 1NGPH 4JN1H 1OSPH 1ADQA 4ENED 1TITA 2JB6B 1HWGB 1MCCA 5EIVA 1P84J 3AVEA 4OZHB 4J1UA 4LPWA 2ICWA 1AC6A 1YEFH 3K80A 3WIIL 1D5IH 1NBZA 2LU3A 5DLMH 5SX5K 3B9KB 4XCYA 1UWEH 3NVQA 3PDOB 4YBQD 4MD5B 5HI5C 2G9HA 3TJEH 4J1UB 2MKWA 3BEWA 4P57A 4YHKH 3MSPA 2R2BA 3S34L 3R1GH 1NBZB 1FNGB 2EO9A 2ZOKA 3QPQC 3DX8A 4JKPH 5I8EB 2BMKA 3UCRA 4PRBA 1J1XH 12E8L 4P57B 4DKFH 2BFVH 4C4KT 3R0MA 4HIXL 2R2BB 1IKFH 4U1GB 1FCCA 5F7NC 2ZOKB 5IHUL 1M6OA 4G6KL 1GC1H 3QEQA 2B5IB 1FIEA 2OJEA 1HZHL 2DIJA 4W4OC 3DHJA 5GS0C 4WFFE 5JOPE 2HFEA 2I60H 4F7PB 1X5GA 1ZHNA 2EEAA 3EFDH 2O26U 3QEQB 2ZUSA 2OJEB 4KGJA 4OCSL 1N26A 5CP3H 4WTZG 1JWUA 5GSVB 2D9QB 2OSLB 5DEFA 4ZNCD 2NLJA 4NM8H 1ZHNB 4N8PA 2CGRL 2VLJD 4WO4A 3S35H 5FHAL 4Y5VA 1CL7L 3KJ6H 1VESA 4MNHA 1W0VA 3L5HA 1AXIB 4NP4H 1FC2D 1RUKL 3UBXI 3G6JE 3B6SA 1OARL 3LMJL 4ERSL 4M7LT 4Y5VB 5JOFA 2VZSA 4XP4H 2OR9H 1U3HA 5BQ7B 5GJSL 4RGMC 3OPZH 1RHHA 4MNHB 1T1YA 2EKSA 3VWKA 4KMLB 3V52H 3RTQD 4UDTA 4YPJA 4OIIL 4M1GL 5F7UA 4RAVA 4WIQA 3CH1A 3VFVA 4LPTA 4OM1H 2PCPA 4PJEA 5FM8A 4HUVA 1T1YB 2EKSB 4LKCB 3H9HA 1KB5A 3FN3A 1RFDL 4RAVB 3CH1B 5I75B 4LVOC 4Y88A 5EUOA 4OV5A 1OSZA 4PJEB 4HUVB 4PP2A 1A1MA 4TSBL 3IDNA 5A40E 3HZKB 5HXMA 1CDBA 1FJ1B 1KB5B 3BWUC 1EMTL 4NC2B 3OX8A 2DM3A 1KC5L 3VXMA 4M1DL 2VDOL 4OV5B 4X7SH 2PF6A 1A1MB 1U95A 2GJZB 2WP3O 3RZCB 3N1GC 1JP5A 2WIIB 5ID0B 2P42B 3OX8B 1IM9B 4KI1A 4OGXL 2Y06L 1KCUH 3JWOC 3ZT5A 1U95B 2HA1A 3B9KD 4EDWL 1TQCB 1FO0L 1T5WA 4MXWH 4HMDA 2A6IB 4FQQB 1U58B 1WZ1L 2HWZL 3GSOA 4F8QA 4AEHH 4YIQB 4HS6A 5GRJL 1WBYA 1HHHB 2AEWA 1ZANL 1LK2A 1Q0XH 1JBJA 4M6MH 1CICB 4Y1AA 3GSOB 3LDBB 4GKZB 5GIRA 4U6HA 4TULH 4HS6B 1WBYB 3WFCL 3OKLA 2DRUA 5F7DA 1FIGH 1A7OH 4NKQB 2Z4QA 1E0OB 4Y1AB 3ALPA 1F4YH 5DVNA 3RL1A 5GIRB 2PW1B 3L3OA 1CLOH 3IFOB 1NGQH 3BPOB 1NCWH 2R8SH 4WUUB 1Q0YL 3BGFC 4HS3B 3OKLB 3V4VL 3QEQD 1VACA 2X05A 4HW6A 3MGOA 2V7HA 4QRPE 3U46B 2YUWA 3L3OB 4HHAB 5BV7C 1HOCA 5GZOC 3OKOB 1QYGH 4FQCL 5J8OA 3RVTD 4QNPE 2GTZB 5FA3B 5I1CH 2BJML 3CFKB 3QAZB 2EH8L 1AD0B 3S36L 1UM5L 1C16B 4PJGF 2V7HB 2VYRE 1UGNA 3V79C 4KRMB 2J12B 5IB4A 3EJZD 1NGYA 3U6RB 2R69L 3FTGA 2Q3ZA 2CIKA 2IPTH 2X4RA 4HXBH 1F6AA 2HG5A 3SKJL 4V1DA 1TXKA 4RAUB 4FOMA 3T65A 5EZJA 3V6OC 1BECA 1FZMB 4X83A 1LO3L 1CE1H 3MJ9A 2BOBB 3M8OH 3VWKD 3C9NB 1F6AB 1BEYH 3RDTA 1S9XB 3WDIA 5FM5M 1A3QA 5E1HB 3BSZH 5CZVH 1LWRA 4NT6B 4LQ1A 1FVEA 3MJ8B 5DSCA 5IHBA 4Y19E 1MRDH 1JPSH 1VPOL 2G5RA 2QEJA 2AJYL 5TF1H 3VXOA 3ZLQC 2W9DH 5KOMC 3RNKB 4NWUH 2EZ0C 5C7XH 2ICWI 3PP4H 5IROA 5DHVA 4IDJH 5DSCB 3RZCD 5FYKE 1HKFA 2BP3A 3SO5A 2EYTB 5ITBH 4H0HB 4DK6A 5IKCA 4AEIL 1F8TH 2VDQH 4NRZA 3BEVB 4WJ5A 4R90L 2B2XH 4AQOA 1RZKH 4QLRA 2J3SA 2NYYD 4Z7UB 5IKCB 5CGYD 1TVDA 1RJLB 1XGYL 4UB0L 3BN9D 5CJ8A 1NAMA 2VLMD 1KJVA 3L95A 5DJDA 4M6OL 4PREA 3ARTA 3GUTB 5CMAA 4JKMA 1PG7W 1CICD 1W2KT 4MLIA 5KBNC 5CIPA 3AU1A 5BMFH 3S37H 4MX7A 4OQTL 4PRPA 1NAMB 2IQ9L 1T2JA 4ODTH 4OZIB 3K1DA 5JPMB 4NN7C 4R2GB 1D5XA 5D2NA 5CMAB 4ZNEE 5LXGL 1A1NA 4Y1AD 3VG0H 1TMCB 2CRYA 4GG6B 3O3UN 5CIPB 2R4RH 3AU1B 1QRNE 3T2OA 4PRPB 5JQ6L 1A7QL 4FFYL 5CJQH 5D2NB 1D5XB 4RMUA 4O4YH 3U0PA 3TH2T 3CNKA 3GO1L 5IK3B 2FWOA 5ALCH 4C56E 1ZMYA 5C0CE 3DUSB 4PV9A 1H9VA 4HFUL 3U0PB 4FFZL 3LY6A 3RVVD 4HCRL 2FWOB 1K5NB 4XP6L 4ZFFB 4LHUA 4ODVH 4PV9B 3OXRA 1REIA 4MJIE 1XF4A 3D85B 1L4IA 2P8MA 2NXYB 1QD0A 3ARVA 1CD0A 4QRUA 4CKVX 4ONHA 4P5TC 4M43L 1KCRL 1MPAH 2DWEB 3B8YA 5JXAH 5T5NF 5EU7C 3UC0H 1QSEB 1ZA3A 3SGKC 5IJKA 2W0LA 4Y5XB 3SOBH 4JY5L 1SM3L 2IPUK 1KN2L 3FT2A 4ONHB 1YN6B 4V1DD 4F7TA 3TYFA 3QPXL 1G7IB 3RNQA 4NIKB 4S1SL 1CI5A 4BZ1H 4ETQA 4F7TB 3RDTD 3C6LA 3TYFB 1MCJA 1XGPA 1DP0A 5F9OH 4B53A 2AK1L 3MLRH 1BIIB 1OAQH 3RNQB 1FPTH 5EN2A 3W39B 3ALXA 4ETQB 3IU3A 1XGPB 3LQZA 1F42A 3BGMA 5TE4L 3UTZB 2GCYA 5JHLH 3WFHA 3IU3B 3LQZB 4QF1A 4G43A 1WISA 5DFVC 4OLZH 4PJFA 2WW8A 2V9TA 1LE5B 1IAOB 1UM4H 4QF1B 2Y4SA 2A6JA 2EECA 3L5WA 3L5XL 4NZRL 2AI0L 3DVNA 1VGKB 1EAPA 4WFHD 1MQ8A 3VXTB 1ZHLB 3DSFH 3NPZB 5KN5A 4R2GD 1I85A 3FJTA 1W72L 1KXQE 1H5BB 5CEZE 3DVNB 5CEZL 1EAPB 4PRPD 3OG4B 4M9OA 2CLRB 4TTDD 2HT4C 5E95B 4S0SD 2ZJSL 1MCOH 4GH7B 3OJMB 3X11A 3NA9L 1S7QB 4PLJD 4PJDF 5GRWA 1MCKA 4WNQA 4LHUG 1OAZL 3RWIA 1F6LL 2IEPA 3CMOL 1Z0MA 3WKNA 5I1KL 4MA8L 1HILA 5E5MA 1IL1B 4JFQB 1KPVA 2VZUA 4IRZL 3QDGE 4Q9RL 5KS9A 2VQUA 4LQFL 3Q6FA 4H25A 3LZFH 3FQXA 3KLAA 3D85D 1MRCH 3MGTB 2NXYD 1HILB 4GRWE 5T3ZH 4G6ML 4P9HH 3RP1A 1KPVB 3GIVA 5KS9B 4LHUD 4LEOB 4MAYC 1QSED 4HV8A 5C0GA 5IESH 4U1IA 3QSKB 5FYJD 1LP9E 1CFSB 1MCDA 1B4RA 2WQ8A 1GOGA 2EH7H 4TSAH 1WTLA 3QDJE 3V4PH 4P2CG 1H3GA 1XCTA 3CC5A 1QBML 1RIVL 4LCUB 1CIDA 4JN2A 3C09C 5AG9A 3LQAH 4K3DH 1UH3A 1G9NC 4QRRA 2GI7A 2AJXL 4U7KA 2PTUA 3P0GB 4XRCA 1AI1H 3QWOA 1XCTB 2KZ1B 4OQ1A 1JHKL 4X5XB 3X13A 2VDKH 5I8OL 4KHTL 1J88A 4J6RH 3P2TA 5I1LB 2BNRE 4QRRB 1RU9H 3V9FA 2AKRB 2FJGB 3LN4A 2F58H 3SDDC 4OZGE 1RZFL 3SKMA 2QSTA 1X5XA 1IQDA 4HH9B 2I27N 3QI9C 3LN4B 1MH5B 3K4ZA 4QHLA 5ESAA 3SKMB 2Z91A 1YPZE 1SEBA 1IQDB 4OD1H 4MZ2A 3KPQB 1CK0H 5L7XH 5I17A 5AYUL 4LCCA 5J56B 4FABL 2P44B 1SEBB 1S3KH 4HAGA 1FNHA 1TJGL 3VXRE 1HHKA 2P1YA 5I17B 4NQEE 3ARBA 1WCBB 4YUEH 1CGTA 1CFTA 4BUHA 1N5YH 4X6BA 5DJ6A 5F3HB 1QQDA 2AABH 1UEYA 5FB8B 4HQQL 2A73A 4KKLC 2KKQA 3ARBB 4PJBE 2RIKA 4OLXH 5D2LF 4X6BB 1QQDB 3G6DL 1P4LA 5GGVY 5I18H 1NAKH 2A77H 2NY6C 2Y07H 4P4RA 3DMMC 1KIPB 3ZTJG 1RSFA 4GXVH 2VUYA 3D0VA 1P4LB 4CW1B 2DQUL 3PQYE 1YMMA 4YNYA 4IJ3C 4NRXA 4BZ2H 3BWAA 5DT1H 1YEEH 3MODL 4NKOA 4YO0A 3D0VB 2EDXA 2Z93B 4R4NC 2I26N 4YNYB 1OD9A 4JPKH 3NACH 1R3JB 4HLZH 4WHTA 1C08A 1NC2B 5GSRA 4DN3H 4GBXC 4LGRB 4YHOH 4NKOB 3O2WH 1I9RL 3RJQB 4OLUL 1EGJL 3IKKA 3O3DA 4MAUH 1VA9A 1K85A 1XGRA 1C08B 4WHTB 5C09A 3V8OA 5HYQB 1JNLH 2YSSB 3W9DA 1AY1H 3SDYL 5E8OB 5I1JH 2PO6C 2V2TB 1MFEH 1MFCL 3O3DB 4XI5D 2GY5A 4RA0C 5C09B 1GOHA 1INEH 4FMKA 4QRRD 2X40A 4X4YB 2VXVH 4F7EA 3HMWH 1BD2E 1OB1A 4PRDB 4BELD 1AGCB 1FSKC 3LCYA 2W0FA 3QFJA 3ZTNL 1Z5LA 2IALA 3MMEA 4JCLA 4M1CC 3V7AG 4QGYA 3HPJA 4D3CH 4JQIH 3OF6D 5KSVB 1IQWH 5LVEA 3PXHA 2ARJQ 1INDL 3QFJB 4G6JH 2IALB 1XIWA 1I9IH 3TM6A 4ELMF 4KY1L 4JKLA 4XBPA 3TZVA 4HGMA 5FOBA 5FV2A 3FFCB 1NC4B 2VWEE 2BCKA 43CAA 5B3JF 2ICEA 2VC2H 4Y4FC 1UKQA 4M7JH 4Y5YC 5DVOA 1Y18A 2HLFC 5K9KA 4Q0XL 5CLTA 5L8JB 3D87B 4H8WH 4K7FB 43CAB 3HNVH 3MV01 1OTUC 5I1GH 3BD5A 3QUXC 3I6GA 3ARBD 2BHYA 5DJAB 5EU5B 1XF5A 1QSZA 2E6PA 3D3VE 4LSTL 3MRDA 2GKIA 3T0VA 4A6YH 3GHBL 2HT3D 4Q9CA 2ORBH 5MENB 3CD4A 1XF5B 4WV1A 4MS8D 5HI4C 1ONQA 3MRDB 1Q94B 3PP3K 3WJLC 1UKTA 2IPKB 1FGVL 1IGCL 1UJ3C 4HUXA 1IEAB 2K1MA 5IFAL 5E0QA 3DTXA 1IAMA 4AEFA 5D93C 2D7PA 2JJTA 1S7VB 4JY6B 2YA0A 3BW9A 4IOFD 1BVLA 4BSJA 5KVMC 4AENA 3MA7B 4HUXB 5F7MC 4L9LA 4G7YH 1XH3A 4L3CB 4YXHL 3T3MF 4GW1B 3BH8A 1BVLB 3BKJL 1MCSA 1L9NA 3T2NH 4AENB 4E41A 4K2UL 4TSCL 1QLRA 2ICWJ 3W82A 4L9LB 5E2VL 1T5XA 1XH3B 4JY4A 3VGAC 3TGXA 5ANMB 1BWMA 3EYUH 4WFEE 5EORH 5FHBL 4E41B 3ZYOA 5C09D 1AFVH 5KVEH 1BFVH 2IQAB 3WUZA 3BN3B 3E3QE 5DMGD 1KCVH 4JPWL 4Z95H 1DN0A 2R0KL 4OKDA 1VEMA 1KF9B 1BGXH 3P11H 5T3ZD 4PUBH 1HSAB 4RWHA 5FUZH 5JOEA 2MCPH 2VXUL 1NCCL 4ZS6C 1YEIL 4MD0B 1LMKA 1MVFA 4XCCH 2FX7L 1C8PA 3QFJD 3V6FB 5IB3B 3F58H 3KLDA 4U3CA 1XGUB 2DQDH 3EDDA 1JZ3A 1D5MA 2G5BA 2X70A 3FFCD 2RR3A 4OCXL 2R39A 3ULUE 3KNBA 2GHWB 1XIWD 4NZUH 3DYMA 4PR5A 5BOZG 4LASL 1LO2H 2YRLA 4OJFL 5J3HD 4NUJB 1ITBB 1YEHH 1YMHB 1F58L 2G5BB 2X70B 4K9EL 1T7XA 5CKGA 2YPVH 3LHPL 1AQDA 5JTWA 4OTXH 3I9GL 4NQCE 4F58H 3GBLA 2ZUQC 2IMNA 5F7EH 3KDMA 4B7LA 1FGNL 1TTGA 3TA3C 5T5FH 2FJFB 4G80A 3RRQA 3DGGB 3HRZB 3M17A 1OWWA 1FN4A 3GM0A 2LQRA 4O2EA 2DD8L 4FQXA 4PD4K 1BVZA 4CNIA 3KDMB 3MJ7B 4G80B 4BH7A 3TCLB 3CFJB 4DGVH 1FN4B 1IBGL 3F7RA 4O2EB 3GSWB 5D8JL 1FC1A 3VXSE 4CNIB 2DQFA 4DW2L 2SEBB 3HZMA 3LKNA 4BFEA 1UYWL 2HN7B 5IB2A 1DLFH 3IJHA 3HNTH 5C0FA 3O9WC 1E4JA 3INUL 1V05A 1FYHB 1MF2L 1OPGH 5E9DA 3V5KA 2Q6WB 2DQFB 5HHMB 1BFOB 5CLWA 4P48A 1JZ5A 3U1SH 2HFGH 2AQ2A 3TBYB 3IJHB 4NQDE 3RL2A 4NKDA 5E9DB 3V5KB 3LPWA 2BHZA 2Y6SC 3K4DA 3VXQB 2L0DA 1U2CA 4A6YB 4Z7NE 4M7KL 2J6EA 5FGSA 1RJZA 2DBLH 4NKDB 2KQNA 4E41D 4PJHB 3BT2L 4Z0BH 5D1XA 2ADFL 3QNYB 2FSEB 1UACH 3ZT7A 2ZCKH 2V5SA 4P2RB 2KQMA 3OR6B 2YUZA 5L2KE 2BSED 4H20L 3F7PC 4JPVH 2FLRT 4LPYA 2F74B 4OLVH 1IT9L 3HR5A 2GK2A 5DYOA 3BH9B 3T0BA 1A6TA 2WWKT 4NOBA 2EYSA 5I1AB 1E27B 3QUZB 5L6YL 4YWGH 1U3ZA 3DXAA 1YYLH 3EO9L 3Q6GH 5CEXA 2EDBA 2H9GA 4KKCC 3LQMA 2EYSB 1R3HA 4X7CC 1O7SA 3MROB 1LEIA 2F5BH 1HE7A 1IGMH 3P30L 4K07A 1OM3H 1TNNA 3PE9A 4APQC 2XN9B 5CEXB 2MPAL 3KJ4C 3MRKA 4KZEL 3KS0H 2W9EL 4ONFH 3RIAK 1LEIB 4OD2B 4ZUUA 2A9ML 1ACYL 5SX4I 3OHXB 4D0DA 1ZT7B 2CD0A 3KYKH 2ENSA 2GTWA 3MRKB 3O4LE 1S8DA 5DRXB 3VFGH 5D7IF 4X80H 3P0VL 3MRIA 3ZE2F 4OKVB 2VE6A 3CSYB 5LJYH 2GTWB 2VZTA 3GSNA 5EWIL 4U7SA 3MBEC 1CDGA 4WI6A 5I8CB 2VE6B 4ODHH 5C6PB 2EDYA 5ICYA 1KT2A 5BS0A 3AB0C 4MD4A 5HVFB 3UPRA 2Y5EA 2IG2L 3ROOB 3ZYZA 1FE8L 4O02H 4KFZC 2DI8A 3ISWA 1EK3A 1F11B 5ICYB 2HT2D 1OAKH 5BS0B 3MBXL 4GRLA 4LLUA 5HHMD 4P2OC 1MCPL 3QHFL 1TIUA 2GSIB 4MQXD 4RSVA 3U4BL 1EJ6A 5GS2H 1MCBA 1XEDA 1X4ZA 3MLTA 3S8WA 2L4OA 5E9DD 3U9PL 1IGFH 5I1HH 1J1PH 5DUPL 2IFFH 3H7BA 4KRPC 4PJ7F 5IVZB 1EFQA 2AJ3A 1BAFL 1MOEA 1XCQB 4IOIB 4XPGH 4R0LC 3EFFA 1MAML 2VKWA 5T1DH 3CLEL 4JVPA 2V7NA 2FEEI 2AJ3B 2D4FA 3N85H 2NY0B 1S9VA 4YDIL 2W91A 4BUGA 1LE9B 3T8XB 2EDEA 4XAKE 3I3BA 1FYTB 1IC7H 1SJHA 4PTTA 4AK1A 2C4FU 2DN7A 4M4RA 4K3HA 3WSQH 2P8LB 5GS1B 4NZTL 5GRVL 1WUNT 3B5TA 5IVNA 2LVCA 4RDQG 4UT9H 5F1IA 5IEKA 1JHLH 3QXDB 2DQTH 4PTTB 1NBVL 4YXLH 1BIHA 4W68A 2IBBA 3HNSL 5AG8A 2RHEA 5F1IB 1UVQA 3GI9H 2OS7A 4YHPA 3OB8A 1IAKA 4GQ9L 2IGFL 1AO7A 3MLYL 3U4AA 1U92A 3DXAD 4PJXE 4PJFF 5D7LB 5SWSE 2NXZB 5BOPA 4JHAH 5E99H 4HWBL 2OR8A 1PFCA 1AO7B 1U92B 4JO2L 1U93A 3MNWA 3TO2A 2F19H 4CVZA 2X4NA 4FFVD 3TV3L 1RUML 4XVUD 1U6AH 2I5YL 4QXGL 3P73A 3QISA 5EC1B 3BVNA 1BZQK 3EOTL 1CBVL 1KJ2H 3TO2B 1TQBC 2JJVA 2Q87A 3K4AA 1RFDH 1OAYH 4XNUL 5TGBB 1AGFA 3MV7E 4NJAL 4JQVC 3P73B 2OL3A 1TDQA 5K33A 5C07A 4GMSH 5EZIL 4PRIB 4KV5E 3P77A 4U2ZA 5DQJB 2IH1A 2Y5TB 4OAWA 3QFDB 1AGFB 2Y23A 1IRAY 2OL3B 3K74B 1VFOA 4P23A 2XNAA 3MRMA 4PLOB 3P77B 1JCKA 2WUCL 3WN5A 1NGZB 4LCIH 3NA4A 3QXTA 1D7FA 5BS0D 2VO5A 3MRRB 3NPSC 1WCQA 1L7IH 2Y06H 4KJPD 2Q76A 2IH3B 3MRMB 3ULVL 1A6UL 1FFPA 3WN5B 4E5XB 1HYSC 4FG6C 4XTRD 4JRXA 4LVHC 2R23B 1R5WA 4OCNC 3LPFA 3KXFA 4D0CA 3KHOA 1PVHA 2IF7A 1Q9LA 1D9KC 1QBLL 1LDSA 1FFPB 2LAAA 2LU7A 4JRXB 2J88H 4ZXBA 1JZ6A 4XNYL 4X6DF 2IADB 1R5WB 4I0KA 2X4SA 4FQHA 1YEJH 4D0CB 4YBHA 2NY0D 5IW3A 4D8PA 3GGWA 1Q9LB 1ETZB 4L8BB 5FGCE 4HC1H 2CRZA 1OW0A 1EBPA 1ORQB 3MREA 5I30H 5DR5H 1LDPH 3RU8H 4FQHB 5TE7H 3L3IB 2IANA 3GGWB 1MIEL 1F45A 2IAMB 4P4KC 1A0QH 4L3AA 1GCFA 3AREC 1K6QL 1DFBL 1T04B 3V0WH 1N5AA 2YWYA 2V5TA 5GRVK 1BQLH 1N64L 4BJLA 1EO7A 3RWGA 1QO3A 1NSNL 5D1ZB 5HJ3A 1V7NH 3MNVB 4G3YH 5FK9B 3IDYB 2AJSL 2G75A 5D7LD 5ISZA 1X5KA 3WO4C 1TPXB 2NXZD 1QO3B 1QEWA 4JQXC 3HI5H 3MV9B 2ZSWA 2DQEH 4U0RC 2DMKA 5I16A 4I77H 5HD8D 1AO7D 3WNKA 4Y2DC 5CCKL 4JKKA 1ED3B 1IGIL 4Q6YA 1RD6A 2BVQA 4ZTPH 1LO3H 5I16B 4DEPB 5B38A 1T66C 7CGTA 4B5EA 4NFCA 1T6WA 2BRRL 2VZVA 3ULVF 4GQPH 5TDPB 2HRPL 4N1EA 4OCWL 4YGAB 3QXAA 3D2UA 4BFIA 5CJ5A 1GPOL 2FECI 2PETA 4PJAA 1G9MC 4RNRB 1IGJA 5DC4B 1FHGA 3DETC 1R24B 1DVFB 1CCZA 2GQHA 5KW9H 1MCLA 1DBAH 3QXWA 4DKAA 4EN3A 3QXAB 1BQSA 3HC0B 4BFIB 3VJ6B 4PYHA 2OJZH 2B1AH 1GGCH 4PJAB 3MRGB 5FYKH 3KYMB 4JR9H 2Z92B 1X5AA 2QHRH 3QNZB 4L1DA 4PJ5B 4EN3B 3CDFA 5GGVH 5GGQH 5I2IA 4P23D 4R7NB 3RGVC 43C9B 4I0PB 4JG1H 3D39E 1BOGB 1OTTD 1R5IA 1L6XA 1KJ2B 1JF5A 2DICA 2CDGA 2NY1C 5AD0A 2NTFB 5IQ9B 1MJUH 4IIQA 4HGWA 2AJVL 3IS1X 3OV6A 1XR9A 5HBBA 1LO0L 4HEME 4JRXD 2PKDA 1R5IB 3KXFD 2CDGB 3NIGE 5AD0B 4NC1E 4IIQB 2WBJC 2RCSL 4OQTH 4NOFA 1XR9B 5AZ2H 5HGHB 3BIKA 5EPMA 4UZGA 4UOW0 3AC0A 5F3BA 4P9ML 4KI5F 3ZSTA 2P7TA 3T0EA 1JPTL 3GRWH 5F89B 4YDVA 5GS2D 3RI5F 2BVOA 4FFYH 4HMEA 4F80A 1Z9MA 4R7DB 3UZQA 5F3BB 5LGJA 2IAND 4JANB 4Q6IC 1HQRA 2QKIA 5F9WC 1MJ8H 4YDJB 3PGDA 4F3FB 2NZ9D 4G5ZL 3E6FB 3BI9X 5D1ZD 4LLQA 4YDVB 2BVOB 1V8HA 2D7TH 5I1IL 2GIYA 3GJEA 2XTJE 4ZUVB 1JZ7A 2BSRA 1KENH 3BD4A 4G9FE 3HG1A 5ESQA 1MJ7H 4X6CB 3EJYD 4R8WL 1HQRB 4XP6H 3V5DB 3PGDB 3OGCA 1J11A 4LLQB 5HHOB 4CVWA 3MV9D 5DI8B 1NH6A 4KVCH 4HUWA 2BSRB 1GGTA 1T2QL 5B38G 4WTWA 1FNSL 1CGVA 4NUGL 5E6IA 1KN4L 4RQQB 1CF8L 3WHXB 3RI5K 3IAPA 3AAZA 3PV6A 1WIOA 3PWPE 1RVFH 3H9SB 1ROWA 4PB0L 2BZDA 2AAVA 3QRGH 3WNMA 2MFNA 3PWUB 2P49B 2VNCA 5EC2A 3LKOA 2DWDA 1BQUA 4LNRB 5F9AC 5D6DA 1VENA 4R3SB 2BRQA 1JRHI 2ARJA 4C54A 2JCCA 3JWDH 3KWWA 2CIIB 3TT1L 3D2UD 3PL6C 2DWDB 4HDIB 1VFAA 4R97B 3PF2A 2A74B 2XZAL 1X6LA 4GKNA 4JVUA 4WW2A 1G6RL 3B43A 4LCWA 5C08B 5K9JH 4PJ5D 4EN3D 3KWWB 1HQ4A 2CJUH 3QCUL 4N68A 4YZFE 3VI3E 1QLFB 1FVDA 1VFAB 2P5WE 2M1KA 4N0UB 5B39B 4WO4C 1HQ4B 4XHJD 1WV7T 5C92A 5FGBA 2ESVA 4IOSD 1R3IH 1ZVHA 4IHOA 4KMTH 1J05A 4WUKL 1L0QA 3LPGA 1JPFA 2V2XB 4NSKA 1SBBA 1U3HC 3O2VH 1YJDL 3ROLA 2ESVB 3MRNB 1WAAF 2C26A 2FIKB 2YOCA 3QIUC 1T22A 1MREH 4NSKB 1CWVA 3RX8A 1DEEB 4FRWA 4TOYH 1WGOA 1H3WM 2UVFA 3GSRA 2E27L 1JYVA 1T22B 2WWMD 2DQIL 4PJ9A 3K8KA 2CDFB 3PUCA 1CLZL 1ZTXL 4IDLA 3LS5L 1P2CA 3HUJB 4N9GB 4EI6A 3STZA 1UCBL 1OAZH 4JKWA 3HTLX 4PJ9B 1XZ0B 4JO1L 2VABB 4C59B 2GY7B 1P2CB 4O9HL 5HHXL 4XAWH 4Q9RH 5ENWB 5HHOD 3U0WL 1IC4H 1J9CT 1R0AH 2OX5A 5TDNA 4G7VH 3LKPB 4GRWH 4GKSA 4ZSOB 4HS8L 4R9HA 5C8JA 3L7EA 5ITFA 4JFEA 3CPLB 5KG9B 1CFQA 1NPUA 2LV4A 4U05A 3VFRA 2B0SL 3MRHA 3ARDC 5C6TL 5L88L 1NBQA 3H9SD 4YZFF 1QBMH 5H35A 4R26L 1CFNA 3TJHD 1EJOH 2X42A 1ITCA 1RI8A 1QR1A 5C0CB 5GGRA 4GXUM 4K3EL 3L5IA 4CN4A 1XT5A 2M8XA 5DMIL 3T4AA 1CFNB 2W59A 4KHTH 5IMMA 1RJYA 1JNNH 2VLKA 1QR1B 4XP1L 2DYPA 3GJFK 5LG1A 4HZLA 5GGRB 5AWNL 1YNKH 1B9ZA 1DQTA 2OM5A 3WXWH 1P7QB 4OCRH 5C08D 3FCTB 3WKML 5IMMB 5JIIA 4P3DA 2YKLH 2DYPB 1A7RL 1A3RH 4HZLB 2NNAB 2VMFA 4XVSL 3PNWB 3L3DB 4RMVA 3TT3L 5KSBE 1BQHA 2XV6B 4JM2A 5C2BH 4LCWD 4OF7A 3BUTA 3WLWC 5D71L 4OCYH 2R1WA 4K7PL 3ECBA 4ZYKA 5IR1A 5F1KC 2CMRH 1J1OH 3MR9B 2XZCL 1BQHB 1UT9A 1VEPA 3EYOA 2YS4A 4FABH 4QOKE 1FL3A 4YHIA 3CXHJ 5BV7H 3QEHA 1HKLH 2HJFA 4OLYH 1TJGH 5CFHA 2ESVD 2UUDK 4PGCA 3DHMA 4NQTA 4M9PA 1KTDB 3WUWA 3W9EB 3EYOB 1OF2A 4HIHA 4N8VA 5I9QC 1DL7L 1JNJA 1NFDA 2HJFB 4CADA 4W4OA 4HQQH 2GSGB 3FFDA 3WUWB 2X6MA 1OF2B 4K94C 1C1EL 4HIHB 5CSZB 3FQWB 2EDRA 1MFAH 4CADB 3W11D 4OD3H 2R1YA 2WZPD 3PP3H 3NIFE 3D9AL 4K9EC 3QHZH 4PJ9D 5IFHL 4RBPH 3MUZ1 1Q1JH 4JDZA 4Q7DA 3FRUB 4ZFZA 4BKLB 3TO4A 4BQ8A 1C7SA 3MLZH 3MOBH 3UJIL 4NNXA 3VWJA 2ITDB 2E9IA 4FN0A 4JDZB 1BLNB 1CU4L 5D96C 5KJRH 2P5EA 2YD6A 5C0ND 4DK3A 2XKNA 1IAIL 1BWWA 2W60A 4RWYH 4NNYA 5SV3A 3UTPD 1JPGA 4KK8C 4M5ZH 3HI6H 1I9RH 4PTUA 1IFHL 2EC8A 4Z7VF 4RGMB 4UBDD 4JFED 2VLJE 1S7WB 3ZE1E 2CK0L 2W60B 4NNYB 4QKXB 4WW1A 5E8NA 1JPGB 4HKXA 2EDWA 3NTCL 4GLRI 2DLIA 8FABA 1U8LB 3MOAH 3PGFH 2EIZA 2C1PB 3CJJA 3Q5OA 5FF6A 5DHYA 4UNTA 4OI9A 4I3RH 5D7JC 3N9GH 4F9LA 3O0RH 4X8XA 3DPBA 1DQJA 5FF6B 5DHYB 2Z8RA 1BQHG 2R2HA 1P7QD 5D4QA 1CGSH 2NY7H 3MA9H 2OZ4H 3HAEA 1I3GL 4DKEL 3CVHA 4KKAD 3CVIL 3H42H 3O3AA 3V95A 1JGVL 3IVKA 2DYPD 2DQHH 3RHWF 1YQ2A 1NEUA 2BDNH 5FA4A 3PDGA 5HDQL 1QKZL 2R2HB 4PGBB 4QRQB 4PJCF 2MMXA 5LAXB 2DTMH 3CVHB 1QHOA 3JVGA 1F90L 5CSGA 4WI5A 1RULL 2ZUWA 5DA4A 3WUWG 4N8VG 1RV6X 4WDIA 1KB9K 5HI5D 1BF2A 3IFNH 2BNRB 3QPQD 4OZHE 2C3VA 2X4UA 5CWSA 3HE6A 1FRGL