1DFBH

Structure of a human monoclonal antibody fab fragment against gp41 of human immunodeficiency virus type i
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
EVQLVESGGGLVQPGRSLRLSCAASGFTFNDYAMHWVRQAPGKGLEWVSGISWDSSSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDMALYYCVKGRDYYDSGGYFTVAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA 3D6 FAB (LIGHT CHAIN)
publication title Structure of a human monoclonal antibody Fab fragment against gp41 of human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 40
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 1992-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dfbH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dfbH01
4TUJB 2BVOA 1MCEA 5LJYH 3GMNB 1X4YA 2HA1A 4OCNC 4BSJA 2AEQH 1NCBH 1N0XL 4IOFC 3ECBB 3BVNA 2V5MA 1ADQL 2CKBH 4QRSA 1CLZL 4PJ8B 4Z78A 4G6AD 5EU7C 3MRBB 1KIUA 4JHWL 2CKBB 1CWVA 2VRAA 1BIIB 3RWCA 1GAFH 3HRPA 3QIBA 4LCWA 2Z31B 5TPWL 1XZ0B 1RIHH 1JI1A 1XH3A 4N9OB 3PQYE 1U95A 4XAWL 4L29A 1E4KC 1AGCA 1T0NB 1FGNH 2NY2D 3KPPA 4M3KB 3N85L 4Y5XB 1JHTA 3QIWA 3E3QE 3T1FB 1T5WB 3OKDA 4N90D 2X4QA 3CMOH 3FHAA 1JGLH 4XX1E 5D93C 3GMLA 2VISB 4XNYL 3KPNB 4LLQA 4G6AC 1P7QD 3SPVB 3ZKMD 1FYTB 1UQSB 1U0QA 4I3SL 1TDQA 4UT6L 4MNGA 3WHE1 4CUCA 3WIIL 3K46A 2LV4A 4RBPK 3DGCR 1D9KD 2EYRB 4JJ5A 1JZ2A 5HI3D 3QUZD 4YFEA 3I75B 2BJMH 4JPVL 1RHHA 1ZMYA 1RZGB 4XCYA 3L5IA 1U8HA 3Q6FA 4GAGL 4MNQD 2P8MB 4OAWB 4XZUB 1VFBA 1ACYL 1CGVA 2OK0L 1UC6A 1MCOH 2NY2C 2EXWD 4YLQT 5FGBC 5F7KC 2DLEA 4ZTPL 1JV5A 3VXUB 5I1HH 5L8KB 1FZMB 3VXNA 1MFEL 1PGRB 3QB7C 2DAVA 1NAML 4KY1L 4U1SB 1YJDL 1MCWM 1W0VB 5I18L 1KLGA 4C54A 1MY7A 3ZKMC 1HCVA 1MRFL 5L9DL 5CJQL 2CO6B 4OM0L 3OKMB 3NFNB 1Q9LA 3NMEA 2DKMA 2VLKD 2CIIB 4ODSH 4QNPE 2R69H 3FAXA 1P4IL 4D9QD 4RWYH 5HI3C 3RTQD 4UQ3B 1NLBH 4NT6B 2NR6C 5DEFB 1LEIA 3OGCA 5C08B 3LPGA 3ULVD 5DHYA 3OR7A 2DF3A 1HILA 3EDDA 5E6YA 3IF1B 3WYRA 2J8UB 1UXSB 3RAJH 1WZMA 3MLWH 4QNPF 4QY8A 5HHOD 1S7RB 1NEZA 4D0BA 3L3HA 1DBBL 2FH6A 2Y7QA 5EOTB 3TNNA 5I71C 5DVLA 4OD3H 3U83A 3DWTA 3WIHA 3TWCH 4FQPA 4LPYA 2NQCA 5DHVB 4GAYA 1UH3A 2BNRA 2ZUQB 3MRDB 4OLUH 1FFRA 3IAQA 4JN1L 3I9GL 3RVVD 1V3JA 5HI5D 2YZ1A 4QGYA 4UI2A 3TYFB 3WO4B 3RWGA 2VDKL 2YK1L 4OCLC 3O6MH 1MCNA 1UZ6F 4G8IB 1MRCL 1IGML 1BGXH 4LCWE 3MOBL 2DLFL 3JUZA 4ETYA 2HG5A 4ORGA 4N0UB 4JKWA 3SO5A 5DFWH 2BOCA 2VDNH 4XMPL 1SYVA 1J1OH 1WFNA 1IM3B 1L9MA 2CDGB 4L3ED 4GH7B 1VEMA 3AS3A 3TPUB 3QDHA 5MEOA 3VG9C 2VR9A 1T2JA 2IH3A 2MCPL 5IEHB 1U36A 5BZWB 3OKNB 2QKIB 4OUOA 3MJ6A 3NIDF 1CT8A 4M7KL 1S9XB 4BQBA 4PJ5E 1OGTA 4CJ0A 1I9JL 1JTOA 1JF1B 3WIFB 2P49B 3ARZA 1BVLA 3U30B 4NN6C 5D96C 2CDEA 4MNGE 4F37K 5JDJA 1D9KB 1UENA 1WK0A 3MMEA 3QP3A 1E6OL 3QUZB 3QO0A 5DTFA 2J88H 2XTJC 5INDB 4OFVA 3ZZ1A 3R1GL 4YAQB 3CZFA 2OL3L 1R5VA 2R1YB 1TNNA 4MNQB 1FAIL 1GGIL 1AGBA 1HWHB 3H7BA 4HUXA 5DJAB 4DZ8B 4FN0A 5C71A 2E3VA 1MF2L 4KTDL 3ZDYE 4DEPC 4NQVB 2DIJA 4YK4B 3MLXL 3AB0C 2PW2A 3PJSA 4LRNL 3WEXB 5C0AA 4HBQA 1UEYA 4S1RH 4UIMB 2VZUA 4X5XB 1G7MB 1N8ZA 4TQEH 1B4JH 1EVTC 3ZDYF 4BFBD 2GJ6A 3O4OC 4J4PD 1YEKL 4EBQH 4Z95L 4KHTL 4L5FH 4JFEB 2VLKB 1JPTH 1A6ZB 4Q6IC 2LU4A 2WWMC 3RTQB 2GJZB 4XPAH 1I7TB 1EMTL 1R3JB 2A74B 4PRHA 2AJSH 3CK0L 5ABDE 4LAQL 1CFNA 1VA9A 2YUVA 3EO0B 5DWUH 5DLML 2IFGA 3T65A 4NQSB 5E5MA 3JUYA 3V5HB 4KQ3L 2OCFD 4FQIH 4JKPL 3UZQA 3LV3A 1Q9KA 1FRGH 1WWWX 1UB6B 4HXBL 2VLJB 3SDYL 2OR8A 3RIAF 3CVHH 3W9EA 3MOQA 5KSAB 1QFUL 3P3YA 3VMOA 3ULUF 1MWAH 5ICYB 4KI5D 4U2YA 5FK9A 3CVHB 1JNNL 1FO0A 4GW4B 1A9BA 4MB4A 3GM0A 4KJYA 2VQUA 3B3IA 3MNWB 3FHQA 2V5RA 4KK5C 2V2TA 2E7BA 2EXYC 3QQ4B 4OF0A 1OAYH 1F4YH 4X4XB 3L3KB 1JWSB 1T0MA 1F2QA 2DICA 2YUZA 4PB0L 4J7RA 2CKNA 2OX5A 5MEQA 1A21A 3QCUL 1XGUB 2C3VA 1RZJH 2EKSB 5FUOH 4WW1A 3KYKH 4FQHB 2I60L 5ITBL 4Y16D 3U0WL 4OCXH 3W9DB 5F97E 5A43C 1ZT7A 1PAMA 3OKKB 5DK2A 4GLRI 4HT1L 5DJ0B 1KCRL 1ORQB 1IAII 3IS1X 2G60L 4L3EB 3MQIA 2G75A 3ROLB 4KI5C 4LVOC 1NCDL 1S7VB 3X3GL 4OLWH 5H37G 4JRXA 1QQDA 4JO2H 4HUWA 2FLBT 4XPHL 3BHBA 1TNMA 3I84A 5IIEA 3CSYA 4GRLD 4ZUVA 3QXAB 3VFMB 1DQMH 4PPTA 3V8OA 4DN4H 3NGBB 1RZKH 3GSRB 4L9LC 5CJ8A 5JOFB 5E08H 1NUFA 2W59A 1I7ZA 3EYVA 3KLAA 2J5LB 4JM4H 5T3XE 4PRID 3LOWA 2P48B 4JFFB 2YXFA 4TSCH 3M45A 2R2BA 1INDH 3RNKB 2GKIA 4ZQKB 1G7PB 3NACH 2F58H 5I16B 2HRPH 5F9AC 2D7TH 2K7QA 1J18A 5MEPB 1R5WA 2BVQA 1QTYT 1G84A 2PXYA 5JIIA 4KGJA 5DFVC 2DQDH 2FGWL 4U6HB 3QXUA 2P42B 3KWWA 5C3TA 4ZD3H 1P6AB 4P9ML 5GRJL 4OIBA 3GSWB 1OPGL 1DEEA 4MD4A 1GGTA 1NMAL 1I3VA 4G7YL 2DWEB 4NNXA 3OGOE 3IDJA 5C0AE 1LE9A 1EERB 2DM2A 2DYPD 3UTTA 1HHHB 3U4EB 3E6HA 4KKNA 4TSBH 5IWLC 3IU4L 4ODXB 5IQ9B 1AXSB 3WDHA 3CNKA 2GJ6E 4PJ7A 1OM3H 5L6YH 1AQDA 4G5ZH 4MDIB 4N0CD 4HEPG 4PJCA 1A4JB 4HC1H 3BUTA 3X11A 4EOWL 5E6IC 1CFQA 1DL7H 2KPNA 2P4AB 4JRYA 3I6KA 4PRHE 3Q2CA 2CUHA 4DK6A 3HB3C 3SDAD 1NFDA 3ROOB 1IEAA 1JNHA 4OGYL 1IEBA 4QHMB 1UM5H 1I7UA 4WI5A 3OXSB 3G5YA 2VDQH 3BO8A 5BMFL 4PJHA 2H2SD 5JOPD 2YMXH 4UU9A 4S1SH 1T7XA 4OI9A 3RHWK 4PGBA 4LSVH 1YMMD 5A16B 2R1XB 1EZVY 2AV1A 3LQAL 3QWOA 4H0IA 2E6QA 2ZJSH 4KTYA 1KEML 3F12A 5D7LA 1WQVT 1KCVL 4NP4L 2X89A 2IQAB 5DK0A 4MCYB 2FX9H 3I6GA 3SQOL 1OLZA 4WI9A 1I3UA 1QFWL 5B39B 1MI5D 3NCYS 1QD0A 5GRUL 4LSPH 5IW6B 1OP5K 4HD9A 4E41A 5DJDB 4U4BA 2FCBA 3AREC 2IPKB 3ALWA 2NX5B 4WHYH 3IFOA 5ESVB 3SDAC 2P5WB 3TNMA 3B5GA 5FO8B 5C8JA 5FM8A 4Y16B 4TUJA 5DRWB 5CZXD 3PG2A 5JO5A 1A02N 3P0YL 2B20A 1XGTB 5HGHB 4JM2B 3TP4A 4U3CA 2VZOA 2HT2C 3SGDI 1YY8A 3ARFB 3ZT5A 2APTA 4YXKL 3ECBA 5HVFB 2BFVL 2R8SL 4P4KD 4UNUA 2VDLH 1JGUH 4JRXE 3VD9A 4ZXBC 1MH5B 4GRLB 3MRBA 2E8YA 4G7VH 1NGQH 2CKBA 3O2WL 5GGVL 3QYCA 3MRKB 5ETUB 1EUTA 1C7SA 5MHSE 5LXGH 3BD5A 3EJZC 3QXWA 2ZP0T 5EFIB 3TJHD 5FKPB 3GKWH 1TETH 2Z31A 2FL5B 1XZ0A 4QHNB 4PRIB 4DW2L 4YWGH 5FGSA 5C70A 3KJ6H 3A6OA 3DURB 4NO2B 3BPNB 1T0NA 4G6MH 1JHKL 3FO1B 4OM1L 4I0PC 5GS1B 3LDBB 4Y5VB 4Y4FD 1I1CA 1CDCA 1MOEA 2P24B 3T1FA 3MJ7B 4ZFGL 1CLCA 1EIBA 2WP3O 3TYGL 4HH9B 3CCHB 3BH8A 3KPNA 1QBLL 1DBMH 1KNOB 3C60B 3N1GC 2XACC 3ARGB 2B1AL 1MFDL 5HD8D 3OR6A 2WV3A 4HWNA 2A9NH 4CAGA 4NKOB 3KPRB 3IXTB 3UTTE 5TE7H 4LFHD 1GPOH 2R4SL 4U1KB 1FIGH 4PJ7E 1DCLA 3EYUH 4GLRH 1T1YA 1IAIH 1J0IA 1WZKA 5MP6L 3NCFB 3FZUC 4OAWA 4XZUA 4HK0B 4JZOB 5CD3B 4MLSA 2XZAL 4CKVX 1JUFA 1F4AA 3LQAC 1NFDE 4MD0B 4TRPH 2IG2H 3REVB 3RPKA 1QO3A 2FB4H 4X6CB 1HHKB 4PJCF 1CE1H 1BP3B 1W0VA 3IU3B 1Z3GH 2X9WA 1XCTB 2WQRA 4PJHE 1BOGA 1HSBB 1YMMB 3OKMA 4N8CH 3NFNA 1NFDF 1FLRH 1PG7L 2HKFH 4O51B 1MREH 4JVPA 1ZLSL 4XPTL 5GGUB 4ODVL 5JHDD 4UQ3A 4NT6A 5D7LE 5DEFA 3D85B 5C08A 4UDTB 1SMAA 3SDCD 1A1NB 5T1LD 4MXQD 4BQ6A 3IF1A 1GIGH 2J8UA 1UXSA 3UYRH 1AO7D 4G8EA 3TV3H 4YC2C 4HIIB 5BCAA 3VXRA 1S7RA 4FQ1H 4E41E 4LHQB 5IHZB 1RK1A 1HE7A 1VPOH 4JB9L 5IW3A 2XFXA 3WMSA 4AMKL 1E4KA 2W9EL 4MA7L 3S96B 4J12A 1BJMA 5KVDH 4RNRA 2PTUA 2EH7L 1W72H 3DRTB 3GSQB 5BS0D 5AD0B 2EYSB 1E28B 3DX8B 3ARPA 2AJXL 5DHVA 2YKLL 4P4KB 4I4WB 1J0KA 4U6YA 1ZANH 1LK3L 1B0GB 3MRDA 1QLFB 2R23B 5I2IB 4Q9QH 1E4WL 3BIKB 4RGNE 1BQHB 3FRPA 3A67H 2BDNH 3JWDH 4GAJL 4JPKH 4MXQC 4XT1C 3TT1H 3TYFA 4R4FL 4N8VA 5CBEB 4G8IA 1KSRA 3PP3H 3GUTA 4HWUA 5I30L 1U3ZA 4U05A 3BESR 4N0UA 1L7IL 3QO1B 4ZUUA 1IKFH 2Z8RA 1IM3A 2EEBA 1CGSL 3IGAB 3MNZB 3S35L 3TPUA 2HWZH 4Y4FB 5IB4B 4OZ4B 5IEHA 2EC9T 2GY5A 3OKEB 1X5KA 3OKNA 4PRAB 2QKIA 5J12C 1BVKB 4B7IA 1NQBA 1N5YH 3CDGA 3ZSTA 1S9XA 1A3LL 3RVWD 3P73B 1KB5L 5IFJA 5L7XH 1P7QA 3BPLC 4U6TA 4YXHH 4N1EA 5JNYB 1JF1A 3WIFA 1GHFH 5LCVH 4WU7B 3MYJB 2ICEB 1D5MB 2MQ0A 1OP9A 5DEGB 1D9KA 4Z6AT 2FECL 4GO6B 4YFDB 1GRWA 1KB9K 1LDSA 5EN2B 3QUZA 3JBG7 4NQCD 5E4IA 5INDA 1FP5A 1KB9J 3SE4A 4C59B 5KSBB 2R1YA 4MNQA 3SDDD 3PL6D 4DZ8A 5I1EH 1SQ2N 4JKKA 1Y6MR 4P2QD 4J3WA 4H8WL 1A8JH 1ADQA 4Y8DC 1CDGA 3WEXA 3RVWC 4NCDA 5J4MA 1TJIH 4LCCB 1ZLUK 1QP1A 3HA0A 4MQSB 2NY1C 2I5YH 1LHZA 5DRNB 4UB0H 2CUIA 4M1DH 1BX2A 2FJGB 2PYED 2F19H 5IHLB 2B4CL 1UG9A 2VLKA 2JLLA 4U1HB 1WFOA 5JHDB 5EU7E 2AEPL 3RTQA 1WICA 2GJZA 3GSXB 3MRJB 1I7TA 1R3JA 2A74A 4MWFB 2HRLA 3SDCB 3VFVB 1IC4H 5T1LB 4U31A 2XRAL 3EO0A 4WUUD 3NAAL 4NQSA 5IP4A 2M2DA 3V5HA 1PW3A 3SDDC 1AO7B 4C4KO 1NSNL 2J8UE 5HHOA 3F7RA 5CEZE 1R3KB 4YUEH 4LHUD 1UB6A 3VXRE 2HVJA 4ALAL 2FIRT 2QQKH 1AR1D 5ICYA 2XWTB 3BE1H 2Q6WB 3CVHA 4B0MM 4XI5C 2YPKB 1Q9OB 4GW4A 4JZJB 2J8UF 1FNEA 4J1UA 1T1WB 2CLRB 4K3DL 3MNWA 5KAQG 2K1MA 1RIUH 3SOBL 5D7SH 3QQ4A 2JELL 4OCYL 1G6VK 3L3GA 4KKAD 3VWJD 1T66D 4LSQH 4HFWB 3L3KA 4AL8L 2NZ9D 2VSDA 3BP7B 2NXYC 5BRZB 1I3GH 2I27N 1ZEAL 4XTRD 1BFVL 3U4AA 3W11D 1XGUA 3BIAX 5JW3H 2EKSA 3WLWD 4FQHA 2ZNWA 4IDJL 3IFNH 3O9WD 3W9DA 3MV8D 4OT1L 5I1LB 5KS9B 1U6AL 1EFXD 1P1ZB 3MXWH 3OJ2C 5FGCB 1P69B 1ORQA 4N0UE 4L3EA 3ROLA 1YEFL 3KHQA 2NY7L 1OL0A 1XIWD 5F7DB 2JKXA 1T7YA 5I8CB 1IFHL 3VFWB 3PNWB 1OAQH 3VGGA 3LN5A 4K2UL 4N90E 4XP4H 4O2CA 1J5OL 3VG0L 3QXAA 3ARSA 4L4JA 3K3QA 1MUJB 4KKAC 4X80H 3VWJC 3KXFD 4LSTH 3T4YA 1MHHA 3GSRA 1DR9A 3C87A 3S36L 5KG9A 3BQUB 4PYGA 3W11C 2J3SA 5KVGH 5FDWB 4D9LL 4PV8A 1KLFA 4H8WC 4AYFA 2BC4A 4ZQKA 5I16A 1RULH 4PD4K 4H0HB 5MEPA 4WEBL 1AIFB 2XIDA 2EDTA 4HKXB 3PL6B 1GAFL 2PCPA 4QTIH 1RU9H 4MNQE 3IJSB 4U6HA 6FABL 4PD4J 5F7MC 4XNMB 2AXFB 1MCIA 1E27B 2DS4A 3CX5J 4IMLB 4M43L 4E0RA 1FVDB 4M93C 5DQJB 4MD5B 3RPIB 3H9YA 2IANB 2B4CC 1BZ7B 3T04D 2NY4D 2DWEA 1DANU 2OZ4L 5IB5B 1NFKA 3INUL 7CGTA 1H15B 3B9AA 5A3IC 2DQTH 1HHHA 5F8QC 3U4EA 4J4PA 2VL4A 5LQBL 4UT7L 5IQ9A 3QDGD 4YJZL 2NYYC 2PYEB 3UEZA 2UYLB 3VGHA 5TGBB 3QI9C 4MDIA 2HLFD 4D8PB 2VLKE 1I8LC 1HK6A 1XGQB 4EXKA 4GG6B 4D9QE 2UY7A 2CSPA 2GSIB 2FYYB 4FQ2H 3ULVE 3ROOA 4LSSL 1U3HD 3ZE2E 1CE6A 2X6MA 1M7IB 1MCFA 3L95B 4MB5A 4QHMA 3VE0B 2BVUA 1SJVA 5HHOE 4NQXA 2H45A 2XN9D 2FBOJ 4P5KB 1EDQA 4PLJD 3ULVF 2BJML 2NY4C 5DVMA 1SBSH 3ZE2F 1G9EA 5A16A 1AGDB 2CLZB 4EIZC 2APFA 1A6PA 5DJXB 4Y2DB 3VGAC 5A1AA 4DQOL 5JIHA 2YZ8A 3FN0L 3GHEL 4HUVB 5EA0H 2X42A 3UBXG 2GITB 3CFIC 1WITA 2NLJB 3KPOB 5K59E 2CRMA 2OL3A 5F96H 4HG4K 3BZFB 4HPYH 3IJYB 4ODTH 5DJDA 3MV7B 4XP9H 1LO0H 1QVOA 1CR9H 5F6HJ 5ESVA 5FDYA 5MI0B 4A2MA 1UYWH 5FO8A 4HXAH 1FG9C 1F6AA 1U3HC 4Y16A 3O9WB 5DRWA 4HG4J 3QPXH 3DVFA 3MV8B 2HFEB 1EFXB 5K59F 1XGTA 1AY1L 1QBAA 2IADA 2AEIT 2R69L 1LO3H 1C5BL 3CFBB 1XIWB 4QRPB 3MOAH 4L3EE 2R0WH 4HZLB 4LOUD 4RRPA 3DX9B 2CH8A 2E9BA 1RJLB 4NZJA 1MH5A 4GRLA 4L8DB 4V2BA 1SJXA 1A6VL 1O0VA 3L7EB 2NY6C 5ETUA 2Z8SA 4LCIL 2RGSA 4QLRA 1R3HB 1IGIH 4LLMA 1CGTA 5H37H 4EKXA 4QHNA 4PRIA 2Z4QA 4HAGA 4H1LG 4XXCC 3TO4D 4W70A 3DURA 4NO2A 5CHNB 4BZYA 1CTOA 3HPLB 3FT2B 3L3JA 4LCYA 5EOCL 5GS1A 4Y5VA 5IOPA 2P24A 3MRIB 3D0VA 1C16A 1NCNA 3C5ZB 5J3HD 1BGXL 4Q97A 2F54D 2CMRH 3LD8B 4QOKD 1KNOA 3WJJA 3CIQA 2N1KA 2VXVL 3FFCD 3UTSD 2DYPA 2RBLA 5GIRB 2AW2A 3J8F7 4M5ZH 1RIVL 3QDGB 3HR6A 5I8EB 3P9WB 4U1KA 4IHOA 3U1SL 4GMTH 2CJUH 4K9EL 3BPCB 4U0RC 4QTHB 1J8HD 4JZOA 3L5XL 3SDAA 2FD6L 4NZRL 1PQZA 4NM8H 2DDQL 4MD0A 3CXDH 3IDYC 5DC4B 3REVA 3DETD 1MCWW 1Z9SA 4PGCA 1X4ZA 2XN9B 1HHKA 2BXYA 4YBLC 3X14A 2R0LH 2FX8L 1HSBA 2HLAB 1YMMA 4KI5E 3HZYB 4K23H 3UJTL 1BLNB 1L4IA 5KOVC 4JY6A 1OAXH 3G5VB 1QPXA 2FO4B 4RGOH 3MLPA 3V6OC 1W8OA 3KDMB 4JG0H 1DQLL 5FHBH 4UDTA 2D31B 1MI5A 1BBJA 1A1NA 4KI5F 5E2TL 3D2UB 3HCVB 3WNPA 4NBXB 1CVSC 1EO8H 1QKZH 4HIIA 4CVZA 4G43B 4EBQL 4HKBA 1MCRA 1FVCB 1UJ3C 4L5FL 1JYNA 1MIEH 5I8KL 1JPTL 3F8UB 4YGVB 5C6WH 4YO0B 2FSEB 4DGVH 1HDMB 2FR4B 3QUMH 3DRTA 3GSQA 3ILQC 4JFPB 4RAUB 5AD0A 1E28A 2YD9A 5JPNB 4WVRA 4YHPA 5GS0L 2ZUVA 3JXAA 3QQ3B 3QUMB 4LHJB 4P4KA 3H3PH 4I4WA 1XAUA 4XVSH 3HRZB 2CDFB 4FFVC 3VW3L 4FMKA 1QLFA 3T0DA 2R23A 5BW7A 4I77H 5I2IA 2P7TB 3F65A 3BIKA 1KACB 3UAJC 1A7RL 1BQHA 3O3DB 4O4YH 2VDRH 2ERJB 4WI3A 3QEUB 1MWAL 4KMLB 3QFJD 2FBJL 2D9QB 5TH2B 4X98B 1I1YA 1LGVA 3TO4B 3WXWL 3EO9H 3FQWA 1NCWL 1HOCB 4PRIE 1KEGH 3QO1A 1UM6H 4WCYL 3LCYA 2GFBA 3FMGH 3DECA 3IGAA 1F4YL 3QDMB 2BMKA 4Y4FA 5IB4A 3ZL4L 1PKQB 2X9YA 2DMCA 3IDIB 4YDLC 3VRJB 4QXUH 1BBDL 2I26N 1XR8B 4BA8A 4HIJA 4EN3C 3V7MA 2VXQH 5JNYA 1O5DT 4FQLH 5GGSY 3MYJA 2D7PA 3FFCB 3W5MA 4NC1C 3UTSB 1D5MA 4K9EC 2EDEA 3MRNB 4Y8AA 3MV9D 4ZNEA 5IVXB 1MHPH 3BWAB 4KZEL 1TJGL 5FAAA 1DFBL 1T03H 3O8XD 1K9TA 4BZ2H 5TDNB 1WBXA 3WKNA 3ZTJG 4JFQA 4DTGL 4EDXA 4MAYD 1RVFH 4HF5L 3AVEA 1C5CH 2B2XL 3QUXC 1CD1B 2D03L 1RZKL 4RFEA 1RJZB 5GS0D 5E1HB 4L8CB 3V4UL 4IIQC 2Y6SD 1QRNB 5DJ6B 4EDWL 3WKML 3VXOB 1NDMB 1BMGA 1A22B 1ZWIB 1J0HA 5HHPB 1X5FA 5DRNA 1N7MH 4EZMA 1YMME 1MQKL 2DM7A 5I0DA 5IR1B 5JHDA 3O8XC 4ZD3L 1QG3A 4P0DA 3GSXA 4X6CF 3VXTB 2YRPA 3MRJA 3GJFK 5I6XC 4MWFA 2V5YA 3M17B 1DP0A 3SDCA 5T1LA 3ARBC 3WL9B 5EH1A 5FYJH 4OGZA 1YEHH 1J86A 1MI5E 3WHXB 1AO7A 1S7TB 3ZKND 4L8SC 1JGEA 4DVBB 5GS0C 1R3KA 3ZYOA 1NAKH 4JO3L 2A1WH 1OARH 3CXHK 3G5ZB 2F8VA 4Y4HD 2VR5A 4CU8A 2Z91B 4KK9D 2WWKO 1SM3H 5BS0A 2E6PA 4P9HH 4OB5H 3L3IA 2D9CA 3LRSB 3CLFL 1WAAA 5LGJB 3GGWB 4HGKC 3FO0H 4GUPB 5JTWA 3DUHA 1NLDH 5FFLA 4F9PC 4JDZB 2DQGH 3FQRA 2V17H 1UJTA 3CFCL 3VDAA 3NPSC 1A5FH 1KIPB 4L4VD 4TNWF 5KJRL 4WJ5A 5HY9B 5BVJB 2NY3D 2EC9U 3QFJB 3BDXA 4EI6B 3CFJB 4OCWL 1NCCH 3SCMB 2LU3A 4K71C 4PY8J 2C4FU 1N3NB 2B0SL 2DWDB 5KS9A 2ZJSL 2VZTA 3TBTB 4HWBH 2P46B 1P1ZA 5CJXC 1D7FA 4XXDB 2DQIH 2DTMH 3EZJB 3ARDB 3OPZL 3DUUB 4V2CB 1C08B 1PFCA 3B9KC 3EGSB 5I8CA 1RZFL 5C7XH 2B5IC 3BDYL 1OSPH 3VFWA 4PJDA 5J11C 1GOGA 5ADPH 3MA9H 4NQUA 3B4NA 4AG4H 4QRUB 4MS8D 4HSQA 2EZ0C 2FHFA 2GCYA 1PLGL 2C3GA 4I48B 3HI1B 3BYYA 3MV9B 1VADB 2NY3C 4XVJL 1RZKC 5FDWA 3SO3B 1AKJD 5EUKB 3HPJB 3EDJA 4NQCA 5HPMB 1IGFL 4I1NB 4XPGH 2QQNH 1AIFA 4MAYB 3SDDA 3PL6A 3EDEA 1KXVC 4JHAL 5KANG 4XNMA 2AXFA 4P2QA 1E27A 3VFPA 1FVDA 5DQJA 1KPVB 1R5IA 1X5YA 3FB6B 4MD5A 4E9LA 3BGAA 1BZ7A 4N0FA 2G5BA 4QO1A 5IB5A 3WD5L 3QEHA 5I1IH 2Q7NA 5IMLB 5HYFA 4M48H 5IK3B 2ARWA 4CVXB 1JVKA 2PYEA 2VSCA 4X7DC 1CDUA 4C83B 3OAYK 3QRGH 3C8DA 1RFDL 4KAQL 1MAKA 4MAUH 4NKDB 4D8PA 1XGQA 1NCAL 5FF6B 4GG6A 2MJWA 5JHDE 1SY6L 4KKCC 2AJUH 4X0KB 4GW1B 5EZOL 5C0DB 5HYSG 4HFUH 1DBML 1KN4L 4WUUA 4YFLF 3QHZH 2GJJA 2D2OA 1MHCB 3O2DH 1IKNC 4U1GB 4KKBD 5FO7A 2DJUA 1AO7E 4LHUA 3VE0A 3TT3H 4YEEA 5TE7L 1DEDA 1KB5A 1J7VR 1OTSD 4P5KA 2V5SA 4Y4HB 5C92A 2PETA 2QQLL 3K1DA 1IAIL 1V05A 3AY4C 4KDTA 4G6JL 1WGOA 2VR4A 3MGTB 5DJ2B 4IRSB 1AGDA 5BXFB 5BS0E 2APWA 5AG8A 1S5IH 4IM8A 2AJZB 1ROWA 5TFSH 1JYVA 3BSZH 4XBEL 1WAAE 2ZCKH 4HUVA 4RFOL 4HS8H 3VWJA 4PGDB 3MCLH 4K94L 2NLJA 2DIBA 1PX3A 4OBSA 3O4LD 4YHZH 2EYTA 1Z3GL 3L6FA 3VD7A 4FQXD 3MRRA 1Y6NR 1WAAF 4N8CL 4AIZA 4I2XA 4KKBC 3O9WA 2HKFL 5DD5L 3MV8A 1DN0B 4AT6A 2YUWA 1EFXA 3MUJA 5B8CC 1II4E 2DQHL 4I3RH 5KS9E 5FV2A 2ATPB 3CFBA 1YYLH 4X5LA 1XIWA 3NZHH 5ILTH 4HZLA 3DX9A 5HYQB 2CD0A 3KR3L 2ICWI 1RJLA 5FYKL 4L8DA 4FFZH 4PJDE 5KS9F 5EBLA 3CU1A 5GGQH 4PLKC 4YBQD 3KXFA 1Q0YH 4KWUA 4ZOBA 5F6IB 3MLRH 1R3HA 2VC2L 1W72L 4D0DB 3UX9B 1PDKA 2B39A 2IBGA 2QSQA 4HMCA 4U1JB 1LVEA 4CDHA 4PJDF 4X5WB 1FLTX 1OWWA 4XX1G 4M00A 3STZB 4NC2B 4QT5B 5GJTL 1PX4A 5HYIA 5CHNA 1ZANL 3FT2A 3ETBF 4J6RH 1W0YT 4NQCE 2W91A 3CDCA 1FORL 4Y5YC 5FGRA 3BN3B 4ONGL 3ZE1F 1ZTXH 4Z76A 2BDNL 4P2OD 3T4AA 2XY2A 3LMJL 2DQEH 4P2QE 1J9CT 4XCCH 4C56B 1BD2B 4MSWB 3ZKXB 3BKCH 3BKML 1H9VA 4U2ZA 1N5AB 3JV5A 3VFGH 5DJ8B 3ELAT 3PE9A 3QDGA 5I8EA 3HTLX 2PO6D 1FNGB 4WW2B 3EYFA 5KVFL 2PYEE 1YEEL 1TPXC 1A9EB 4OZGA 1TJHH 2ZUXA 3BPCA 3KYMB 3OG6B 2P8PA 4NKIL 4QTHA 4AENB 5L7XL 3GHBL 4GG6E 5M7QA 1KG0B 3FONB 3D6GA 4KK6C 5TE6H 2KUTA 3PHOB 2ADIB 3LZFH 1U3HA 4WUUE 4M6NH 3TJEL 4UOJA 4P2OC 1JP5A 4M7JL 2XN9A 5TE4H 2VLLA 1DBKH 4GG6F 4PB9H 3QG7L 4UT9L 5KSVA 4K94C 1YEGH 4KVCL 4BSVB 3V6FA 2HLAA 4QRTA 2ZPKH 5SX4I 3HZYA 2J7LA 3R8BB 4F3FB 1WC7B 5I1EL 2DBLH 3G5VA 4X4MA 3SKJH 3AAZB 4U6VH 3KDMA 2O5XL 5HYEA 4NRXB 3MJ9H 5E95B 2NMSA 4HIHA 3HC3H 1IC7L 3EOTL 2D31A 4H5SB 4PG9B 3BEWB 1OAUL 25C8L 3E2HB 3O4LB 5DT1L 1U93B 1TJIL 4ENED 5E99H 4FQXB 5CP3A 1T3FA 1F00I 3VFRB 4PY7B 1J12A 2VAJA 3NN8B 4UB0L 1HEZA 4G43A 2FJFB 5GHWH 1FVCA 4S2SB 4XCEB 1PYWB 1S78D 2X4PA 1VACB 4I2XE 1GL4B 1U9KA 2OZ4A 4YO0A 3MV8E 2G9HB 1WLHA 4O2FB 4AEIL 1HDMA 4DWHA 2FR4A 4JFPA 4RAUA 3ILPA 1CLYH 3RDTB 3RWHB 3H7LA 4G8GD 4O9HH 1YDPB 2EDLA 3AFLA 3QNZB 3WFBH 2CDFA 4UDUB 2X2YA 4B7LA 4YUEL 1FC1A 1QFPA 4I5BB 2XA8H 2A6IB 4KJQC 4JGUA 1CL7H 5AWNH 3X3FH 1QSZA 3NCYP 3KXFE 4EUPH 4NJAH 5F1KC 4FXGB 3OMZA 4WUKL 3ARRA 1D5ZA 2ZOKB 3C8KA 4X98A 3D39B 4EUPB 2FATH 3TO4A 4XMLH 5IESL 4LKCB 1JTPA 3GNML 4Q9RL 5CUSL 1INQB 3QT2A 3THML 4YEFA 2VXTH 3P0GB 4X6BA 2EDXA 4KRPB 1A6TA 5AZ2H 1VERA 3TBVA 4NGHH 4H88H 2AJVL 1GZPB 3QWRD 1KCSH 1PKQA 4GQ9H 5GQBA 4YHOL 4QRQA 1I3GL 2EC8A 1TFHA 1Q1JH 3VRJA 1ZHNB 3MXVH 4ZFZB 4CW1B 1XR8A 2F54A 5CEYB 1U2CA 3O6LH 3KPLA 4QOKA 1YEJL 4BJLA 2KQNA 4TPRL 3FFCA 5GRZA 3UTSA 4P49A 1YNLH 2OSLB 4P3DB 4JN2A 3GBNL 1NMCC 3MRNA 1DLHB 2H41A 5IVXA 3V79C 1BM3L 1VEPA 2EIBA 2PO6B 3F7VA 3QDGE 2LE9A 5TDNA 4LQ1A 3S37H 4JDVA 1AQKL 5D5MB 1VEOA 3SY0B 5L8JB 4JQIL 4OZGE 1J8HA 4P4RB 3RU8L 1OGAE 2VXUL 5IMOB 1CD1A 1B0RB 5I9QB 1RJZA 3WFHB 2IGFL 1JI2A 3H2WA 4L3CB 4L8CA 2QADC 4WWKD 4JQXC 2ICWB 1UJ3A 3DUSB 3U0TB 2Q87A 1FGVH 2XXCB 2F8OA 3A6BH 5JR1L 2Q8BL 4RMQA 5I74B 5CD5C 2XN9E 1ZWIA 2C7UB 4LSDA 5H35B 3PIQB 1TLKA 3DTXB 4R6UA 5E2UL 1RULL 3PDDA 3WE6B 1G9NH 2IQ9H 2C1PB 3BP4B 4UOW0 4FZEL 3OBAA 5IR1A 1NEZG 4P48A 3VXTA 4X4ME 5EOQH 2V9TA 5FXCH 5TQ0L 4ORZC 4XCNB 3K8LA 5D7KD 1GYAA 3L5HA 5HDOA 3WHXA 4GKSA 4IMKA 1S7TA 2R2CA 3MGAA 4HUNB 1IM9D 3M1BA 4DVBA 3NBNA 1ITCA 5DJCB 5JW5B 1QHOA 3P9LB 5E8DL 4WWKC 4GS7B 5EORL 5TDOB 5D6DC 1BZQK 3MLVH 2LTQB 2Z91A 5IROC 1A1MB 4UAOC 4FFWC 1F3JB 7FABH 1UA6H 1T20B 5EWIH 1EXUB 1BWWA 1VDGA 2BY1A 2DI8A 5ID1B 4XP6L 5CGMA 5BV7H 1OAZH 4UIKH 2A6JA 3VH8B 4F7MB 2ZG3A 4LLVA 4HKJB 1GOFA 4Q0XL 4QYOA 1F4XL 1IGYB 1S9WB 1KIPA 1ZLWK 4X8XA 5HY9A 2AQ1A 4R0LC 1ZHLB 4PRDB 3QFJA 4F7TB 3FTGB 2JK5B 1UKSA 4GJTB 1S7WB 1DBJH 1H8OA 3F6LA 5KANI 1N3NA 2OR7A 4HMEA 2DWDA 4QWWC 3TBTA 4X99A 4XXDA 1Z2KA 3JZ7A 5JXAH 2EIDA 5SX4H 4X9FA 3U0PB 5DZNA 3DUUA 5L8LB 3OAUL 1MCQA 1C08A 3EGSA 3P0VH 4IIQA 5F96L 2Y06L 4HPYL 4KUZH 1NBZB 1I85C 1PKQE 1G6RH 1OAKH 1LO0L 1U92A 2GK0B 4W6YB 1UYWL 1OVZA 1D5IH 1N64L 4HJ0C 3OB0K 4QRUA 1K3IA 4JFXB 2BP3A 2F54E 2GEEA 3EZ8A 5DC0A 3HI6L 5JQ6L 4QOKE 5FYLL 3V5DA 3MV9A 3FFCE 2GT9B 4HCRH 5HHVH 1EJOH 3UTSE 2HVKA 3KPSD 4FABL 2WBJB 2YRZA 2R0KH 4XB7A 5ESQB 4LSRH 5IVXE 1QR1A 3O8XA 3F62A 4ZG1A 5EUKA 3HPJA 4GBXC 4KC3B 5HPMA 4MGXA 1FL3A 2OI9B 5F72S 1AH1A 3DGGA 5ACLA 4DVRH 4MAYA 3EYQC 2H32H 5E2VL 2WINB 4L8SA 1YA5A 3KJ4B 3UJJL 1RY7B 2DN7A 5IVXF 1J8HE 2MKWA 1KTKE 3RKPA 2H2PD 1BHGA 3HE6C 3O2VH 3FB6A 1G7HA 4FA8A 1JPFA 3BW9B 4YDIH 1GXEA 4NBYB 1XGYL 4G42B 3ARUA 2CLVB 3ZTJH 3JWOH 3QDJE 1C1EH 5IMLA 2UY6A 5IBTH 4K8RD 5IK3A 2ORBH 4FZ8H 1DVFD 4BFEA 4CVXA 3LSOB 1FVEB 1NGYA 4DKDC 4F9PA 1EEQA 3EHBC 3PV6B 3Q1SL 2IAMC 5C0BD 4C83A 1HQ4B 4NKDA 4OJFL 4K3JH 5I66B 1CZ8H 5FF6A 5FUCC 1TTFA 2BY3A 4TOYL 1P4LA 4GW1A 1NUNB 4HLZG 1MSPA 3CVIL 4JE4B 2DD8L 3BGFB 3IETB 2A77L 2XZZA 2NXZC 3RA7H 2H2PC 5CJXA 1NBVL 3UYOD 5B4MC 3TEUA 1QYGL 1S5HA 1YNTB 4Y4HA 3V7AE 2WWKT 3QHFL 2BERA 3NCCB 5CIPH 2BY0A 3QEGH 3GK8L 2Q86B 4UINL 4P46B 4OLZH 5CIPB 5BXFA 5DMJB 4R8WH 5DMGD 3RGVC 4LP5A 3QR2A 1IQWH 1CF8H 3CXDL 4PGDA 4M7LL 3RZCD 1TTUA 4YNYB 3GRWH 1RJYA 3T0EC 1KTDA 3EJJX 4KUCD 4G6KH 4L4VA 1I9IH 2HFGL 5CZKA 4NC1E 3IDXH 1IGCH 2QLVB 5F89A 1I1AC 3BZ4A 3QFJE 1JPSL 4JHZA 3DYOA 1G7QB 1DN0A 1OAXL 2O5YH 1CI5A 1F6LL 4MA1C 3PWPB 5E2WH 1J0YA 5E9DD 4HWZB 4S0SD 5I1KL 4MJ6A 3DI3B 4TVPH 2DI9A 2VLMD 3DMMD 3UTZB 3TN0C 3IFLL 2FEDC 4EI5D 5HYQA 3P11H 1FBIH 1HQRB 4NUGH 1N4XH 3HS0A 4O5LL 2DQFB 1QKZL 4IRJB 5C09D 1WBZB 4FFYL 1G7LB 5CSZB 1AI1L 4YE4L 1A3RH 2GTWA 2XTLA 3IRPX 5J1SC 4WY7L 1K2DA 3LKOB 3EYSH 3O11B 1CU4H 1LWRA 3LN4B 4D0DA 1KJVB 1KELH 4Z0XB 4U1JA 3HNVL 2E6JA 4LCUB 3MV9E 4R26H 3WJLC 1KYOJ 3STZA 4DK3A 1AKJA 5F9OL 4KK8C 3MCG1 4NYLB 4M5YL 4WFED 1CLOL 4G3YH 2E5EA 3QA3A 4FNLH 4I77L 1MCKA 1IKNA 1V3KA 2BRRH 4RMVA 3VGDA 4O4YL 1MHEA 4O58L 5DGQA 4Z8FH 5DA4A 3V0AC 3UTOA 1MJ7H 3TGXA 3IKCB 4ZO6A 5CJOH 1IJ9A 2X9XA 1Q9WA 3AY4A 2VDPL 4MSWA 2A2QT 1J88A 5EO9B 1CVRA 5DUPH 1SBBA 1N5AA 1TCRB 3FMGL 4F7EA 1GGBH 3UDWA 5DJ8A 1TQCC 1GVIA 4P57B 1DVFB 1UVQB 2W1NA 3RWDB 2W65B 2PF6A 3NA9L 4FXLA 1AHWB 1FNGA 4WW2A 5DR5H 1ZS8B 2VB5A 5C0BB 1SVZA 1C7TA 2VYRE 2EDHA 2OP4H 1L6ZA 1TZGH 4QXUL 2VL5B 4RMRA 5DEZA 4AENA 3A0OA 1KG0A 4XNZC 3FONA 4PGEB 2WW8A 4Y4KD 3PHOA 2ADIA 3OKOB 4JPIB 3B2VH 1ZAGA 5C0RL 2VWEC 2WBKA 4W4OA 5GRWA 2ARJB 4P3WA 3DBXB 1UEMA 2D0FA 3E1F1 4M6MH 4X9IA 4PS4H 4NWUL 3ARWA 5F9JA 5J7CC 3JTSB 4HBCL 4BSVA 5GGSB 5I19H 2X4OA 5KTEH 4PJ9D 3DYPA 1U8JB 1QEWA 3UJIH 2JJTC 1RVFL 4MXWH 4ESKA 1JZ4A 4F3FA 35C8L 1JE6A 4F8QA 1VENA 3AAZA 3MACH 4HX1B 4OGXH 4NRXA 4ZS7L 4POYA 1U8LA 5IFHH 1H3VA 3RZCB 4H5SA 4R97B 4PG9A 1WTGT 2D7OA 4UILH 5ADOH 4U33A 3O4LA 2OQJA 3WNMA 1U93A 5IBUB 2GSGB 2M26A 3DX6B 2ADFL 4FQXA 1I9RH 4L4VE 3FT4B 3F7YB 4Y4KC 5L0QC 4PY7A 4MJ4A 3NN8A 2OM5A 4OFKA 1ZXQA 1PYWA 1VACA 1PJ9A 1KENH 1MNUH 3QQ9D 4LPXA 5F3HA 2V7NB 5ALBH 4U1NA 2G9HA 5E9DB 1CXEA 4O2FA 4HIXH 1EFQA 3MX0A 1LD9B 4JREB 3DMMB 2ITCB 4EI5B 4LP4A 3RWHA 5JORA 1YEHL 5EBMB 3B2UD 1YDPA 2APXA 3VWKC 4XBPB 3T77B 4UDUA 4QHUB 5C09B 4AM0A 5DC9B 5F9WB 3RZWA 1A7OL 4I5BA 2A6IA 5FKAA 1SY6A 2ZCHL 4WTWA 3NFSH 1N2RA 5EOCJ 4FXGA 3GBML 4RMWA 1SM3L 2YSSA 4U1MB 4KZDH 4HMDA 4LKCA 1T2QL 4CU6A 3U2SB 1F90L 3AMLA 3KLHD 1I1RA 4J2XA 3FO9A 1B88A 1EA9C 4Z7QE 3TIDB 2AQ2A 3EKCA 4P2OA 4UUJB 3L5JA 3T8XB 4ZFZA 4CW1A 4PTUB 5GZND 2XNAB 4JO4L 4LSUL 4Z7QF 2XQYG 1P2CB 3C6LB 5E00B 3RJDA 4PJ5D 5I1AB 2OSLA 5BVPL 1B6DA 3D5OF 3BDBA 1DLHA 3PUCA 1MJJB 2JTDA 2PO6A 4YPGA 1UWGH 4X4YB 1CN4A 1FE8H 3HMXH 4KQ4L 3D3VD 3MLUL 4RAVB 5D9SB 4ZS6C 3MODL 3MUHL 3SY0A 1GH7A 4AG4L 2HN7B 2HTLD 1FFQA 4P4RA 5IMOA 3KLHC 1B0RA 3SGEI 4NPYB 3WFHA 4NO3B 4WW2F 4HHAB 3DUSA 3U0TA 3K4AA 4PJEB 3AC0A 5HI4D 1G7IB 4XHQA 2HKHL 2C7UA 3WUWB 3MREA 3PIQA 3DTXA 4XPGL 5SX5K 2QQNL 3MRQB 1HI6A 4PJ9B 5JW4Q 1LP9B 3U7YH 1S7XB 2YPLD 5C6PB 2C1PA 3BP4A 3V0WH 1RMFL 4OLXH 1OQXA 1R3IH 4LIQL 1UGNA 4JCLA 4XCNA 4BKLA 5CAYB 5C07D 2ZKHH 5JHLL 1G0DA 4S1QH 4YQXH 3D25A 3LHPH 2JJWA 3O4LE 2A9MH 3LVEA 1T5XB 3GFUA 5DJCA 5JW5A 3HC4H 5J1AA 4JY5L 5J6HB 3FOLB 3V4VH 2F9BT 5C8JB 5TDOA 4NN5B 2AK1L 1ZT1A 1JFQL 1MPAL 1QBBA 1A1MA 1F3JA 2VUOA 1TVHA 1YEIL 4N8PA 1BQLH 2FZ3B 5CP7B 1EXUA 3FRPG 4HFUL 4G8GA 3WFDH 4N8VG 2DMBA 1X5AA 4D3CL 3VH8A 2XYCA 2MHAB 3QCVH 3VGBA 3G9AB 4Z0BH 3N1FC 4PP1D 1UACH 3BVNB 3MRMA 1IGYA 2X44D 3AMKA 4WI2A 4J3TA 5DS8B 3ZTNH 3BEVA 3LS4L 1BJ1J 2GY7B 3OTTA 4PRDA 2F15A 1LNUA 3P4OB 2NY5H 5AYUH 3S7GA 2JK5A 1S7WA 3V52L 3NOIA 4F9LA 1Q72H 4Y7MA 2X4UB 4LBEB 1VGKB 1LO4L 2AGJL 4PR5B 4YDKL 1TVBB 1HXMA 1S5IL 3QIBB 3VXSD 5TFSL 4LLUA 4ZFFA 3U0PA 3MCLL 3K2UH 3BJ91 4WGVB 3QWRA 4NZTL 1GC1L 4P2RD 1MFCH 4JQXA 1AGCB 2IFFL 3A6CL 2ED7A 4ONOA 2GK0A 4OD1H 4N5EC 4M8QA 4UNVA 3TZVD 2MMXA 2V9RA 5CLWA 3QIWB 3TH2T 2X4QB 4TVSa 1V7MH 4PJ5B 3FN3A 4LLQB 3DVNA 2GT9A 1YYLL 1RUAH 4L3AA 1K5NB 2E9JA 4HH8A 5ESQA 3LRGA 3SBWA 4MNGB 4XC1H 1MCJA 4DKFL 3LEYH 4K7PH 4WI8A 1TXKA 3UO1L 4HV8A 1IAMA 3N0PB 3BPOB 3BISA 1A6UH 5JW4N 4ONFH 1QNZH 3ARVA 1RHHB 1MCHA 4FQCH 5KSUB 1MQ8A 1U8HB 4IOSD 4WWKA 2E27L 3D0LB 1VFBB 1OP5H 5F88B 1WT5C 3BW9A 5D6DA 1OCWL 4JG1L 4G42A 3TZVC 4J3XA 2M1KA 1FNLA 2IMMA 2IBZX 2AABL 5D8JH 4S11A 1FL5A 4BFGA 1H3XA 5BOPA 4QXGL 4H20L 1JNLL 3LSOA 1FVEA 2YPLB 3SN6N 5HHXH 2JB6B 4YHIA 3WN5B 1C8PA 2EH8H 5I66A 1YY9D 5HGBA 4YXLH 3S4SA 1KT2B 5J9PB 1KF9B 1QFWM 5TQ2H 1JHLL 3L5WB 4R0LA 1KJ2L 4M6OL 1EEZB 1S7QB 3RY6A 2QHRL 1J1PL 1NEUA 2I9LB 1LEIB 3OGCB 1IM9A 3IETA 5K93A 3ZHLA 5H2BB 3MNVA 5DHYB 2DTSA 3VFGL 3OR7B 5FB8B 1YNTA 1X6LA 3EO1A 5C9JB 4QY8B 4D0BB 2PYFB 2Q86A 2VOTA 5DXWA 4KFZC 4OD2A 2O93L 1JYXA 1N26A 1FSKB 5CIPA 1I85A 2R9HC 2WUCL 3ZE0E 5CSBA 2EDBA 1V3LA 4YH6A 3G5XA 4G8GE 1W0WB 3CC5B 4OSUH 5DUBA 4J8RB 3B9VA 4HUMB 4ODWB 4XPBL 3TA3C 4KH2A 5HDLA 3SGEH 1CFBA 3ZE0F 1EAPA 3EBAA 3CD4A 3C09C 3BT2L 4GSDH 3L3OA 2NZIA 3KG5A 2ZPKL 5AZEL 1GC1C 3REWB 1HIMH 4JAMB 5TDPB 1G7QA 3MBXH 5FYKU 5T3ZL 2EKJA 3VXSB 3CFEB 3GKZA 3RWGB 5L88L 4KMTH 5B3JE 4HWEH 3BGMA 2CGRH 3OZ9H 4Y19D 2GW5A 5F7EH 3RIFF 3QPQC 2ZUTA 1KBGH 5D71H 3TIEA 4ACPA 5IGXH 1HQRA 4OLYL 1XF1A 5E99L 5I1CL 2DQFA 1YYMH 1HZHL 5B3JF 1A4KB 4ZO7A 1WBZA 1G7LA 1EV2E 2DL9A 5GHWL 3H9HA 1KPRA 3RL2B 2BVPB 2NNAB 1G9ML 4LVHC 2VN7A 3LKOA 2GIYA 1K8DB 3LN4A 1KJVA 3KPSA 3B6SA 4KHXH 5T3XH 2DQUL 2QHLA 4LCUA 1C12B 4QHLA 3WNLA 4PJXA 3PWVA 3VFNB 2CDEB 2BK8A 3ZSSA 1ULVA 4Q6YA 2NCMA 4W6WB 1EGJL 2P47B 3GMQB 1L0YA 1KJ3L 3UZVB 1FZJB 3CZFB 4OCRH 3WFEH 3B9EA 5ID0B 3DV6B 1AGBB 3N9GL 3H7BB 2FATL 5EO9A 3NTCL 3RRQA 3GSNL 2F5BH 4GMSL 2VXTL 2YD8A 2DQCL 1TCRA 3LY6A 4EIGB 4OCSL 4OZIA 3QUKB 4QHKI 3LS5L 1DVFA 1OTTD 1WZ1L 2W65A 4GG8B 1AHWA 3MLSH 4Q9BA 3V4PL 5C0BA 3UTTD 3CDYA 2A6KB 2GJ6B 5T3ZD 4MXVE 4R7NA 4P3CL 2VL5A 1TQBB 3O6LL 1M1SA 4XC3H 4YDVA 3FQXB 3PP4L 3ALPA 4O2EB 5D7KE 4PGEA 3OKOA 4JPIA 2R29H 2XKNB 4LARL 5GISH 8CGTA 2ARJA 3WFZA 4I18C 4MXVF 4NO0D 3DBXA 4PGZA 5E5MB 4X7TB 1ITBB 1MLCB 3P30H 4XMKL 3JTSA 2C3WA 5DO2C 5GGSA 5D72L 1U8JA 4HLZH 4ZO9A 2WZPD 1NCTA 3NH7H 1FO0H 5SWZD 1DBAH 2ADGB 5KN5A 4HX1A 2CXKA 1H3TA 4DKEL 1FO0B 1X5JA 1X7QB 3RZCA 4WHYG 1JRHL 3B3IB 4S1DC 1HHJA 2V2TB 1RK0B 2XZCH 2GSGA 2FEEI 3F7YA 5CBAB 4AEHH 1VHPA 4F15C 4JFOB 4RRPG 3Q48A 1N6QH 1I9EA 2IQ9L 3BZEB 2WIMA 3HUJB 3U7AA 2C3VB 5E9DA 1S9KC 4WW1B 2AXGB 5EOQL 4Y19B 4EVNB 1LD9A 2K7PA 2KBGA 1CBVL 1JGVH 3DMMA 3M8OH 2ITCA 5I15L 1G9MC 2VZSA 4EI5A 3G6DL 1CFVL 3CUPB 5DK2B 1K6QH 4Z7OE 3LH2H 5D2NB 3O6KH 5F6HI 1QRKA 3T77A 4QHUA 5C09A 1BQUA 3PABA 3PWUB 3GIZH 2IC2A 1RZ7L 1QQDB 4CMHB 1IAKB 4DGYL 1KJ2B 2W9DL 4RGND 3MLVL 4Z7OF 5D1ZD 5GGVY 4JHBA 5EWIL 4WV1C 5FM5M 3KPSE 5C86A 4RWHA 4NJ9L 5BV7L 1OAZL 4NSKA 2NY0C 4PJXE 3KLAB 4NQED 4BZ1H 3OJDB 4D9RD 5MEND 2Y07L 1J05B 1F58L 2R2BB 1NL0L 2DJ4A 2JB5H 1E4XI 5IHUL 1UCBH 4ZAKC 1KCKA 4PJGB 4PJXF 4FQJH 1ZVSB 1WFUA 4PP2B 4ZTOL 5DD0H 4Y0GA 4J3UA 5I1AA 2JJUA 3EOBB 1DEEB 2FX7L 1MJJA 2E7MA 2NPLX 5IJKC 1FIEA 5HGDA 5EC2A 2QSCL 1F8TH 3IDJB 5D1ZC 3PWNB 2XQBL 4YZFE 1LE9B 4OZIE 3I50H 1S8DA 5LBSH 4X4YA 2YA0A 3UTTB 2Q8AH 2ZSVB 1G6RL 3E6HB 1OAKL 4RAVA 5C0BE 3RVUC 3BJLA 1EK3A 4TUKH 1MIML 2E7HA 4PJ7B 3RJQB 2HN7A 2ZCLL 3K4DA 3WSQL 4CJ1A 3MC0A 1LO2L 4Y4KA 4PJIB 4N0YL 1UXWA 5FUZH 4OF8A 1UWEL 4G9DA 4YZFF 4OZIF 5LWYL 3H3KA 1CFQB 2VDOH 3GB7A 4NO3A 1HYSD 4ODHH 4HHAA 4PRPD 3HAEH 4NO0B 3I6KB 4PJEA 2ZUYA 1G7IA 2LFGA 3F5WA 5F9DC 1NFDB 4KU1A 1QZ1A 2R0ZL 3HAEB 1FN4B 5KZCD 4GKZB 1VFUA 3WUWA 4R90H 3OF6D 3MRQA 1GGUA 4XWGH 4PJ9A 5BO1H 1U41A 3G5YB 5FYLE 1LP9A 4M3JA 3DSFH 1S7XA 4PJHB 3H8NA 5F93C 5GGTL 5SWZB 3U9PH 4UU9B 3HE7C 4QRRD 4IOFD 2ZG2A 3UCRA 3R06B 3O2VL 4NNPL 2VKWA 2FH8A 2IBZY 3F12B 5I75B 2I25N 5DK0B 5D1XD 2BXZA 3H0TB 3I6GB 3QFDB 4RGMB 2IPTH 3KAAA 4P23C 1KC5H 1T5XA 4XGZA 3RWFA 5IBTL 3QBTB 5J6HA 2VZ1A 3FOLA 4ISVB 4E41B 5CEZD 6CGTA 4XVTH 2AI0H 2VQTA 3IFOB 3TNMB 4RDQF 4KUCF 3GSNB 3U4BL 2QTEA 5E9DE 2R1WB 1BQHG 2FZ3A 5CP7A 4HPOH 5JO5B 2EEAA 1WCQA 2VLME 1DQJB 4DN3L 1MFAH 4XVUC 3QIUD 5D70L 2MHAA 1YY8B 3QEQE 4A6YL 5BV7C 5C09E 1KFAH 2HH0H 4F37F 1A7QH 3MLTA 5I1GH 5DSCB 1RAMA 5DS8A 4XBGB 5SV3A 3T2NL 1BFOB 1I1FB 3P4OA 4RGNB 5IEKB 5D1XC 1L7TH 3ZLQC 1N0LA 2X4UA 1H5BC 2AVGA 2VE6A 3MTRA 4LBEA 4P59L 1VGKA 4PR5A 1JCKA 4POUB 1TVBA 3TVMC 4N9GA 1DQQA 1CD8A 4BFIA 1J8KA 1L6XA 3LKNB 3LIZL 2Y5TB 1FNSH 1R0AH 4WFEE 3AM8C 3W2DH 2ENSA 2DL2A 3HNSL 2F5AH 2R56H 4F57H 1IGCL 2W0LA 4YX2H 2CK2A 2NW3A 3Q6GL 4LFHG 3QIUC 2AAVA 2AJYL 4LU5L 5J1TC 4PJ5A 1E6JH 4F7PB 3QQNA 4ELKB 2BX5A 3BH8B 3HZKA 4TVPL 1UADC 1K5NA 1NANI 1HKLL 5F1SA 1A6WH 2Q76A 3Q5OA 4JQVA 5T5FH 3JSSA 2JJSC 3OR6B 4NUGL 4POZC 5GS2D 4OIIH 3D3VA 5FOJA 4HGWB 3I02B 2VZVA 2NR6D 5D7JD 2O26U 3HLAA 1ZHBB 5EC1B 1T1YB 5HVHC 5KSUA 5KVEL 4PV9B 4MJ2A 3EFFB 2XZQL 4PRPB 3MBED 3D0LA 1NKRA 5IQ7H 5F88A 4XRCA 1B4RA 2BZDA 1INEL 1JUFB 4PJEE 2DQJH 5KZCB 3FAWA 1S7SB 1H3PH 2H6PA 4G3YL 1WBYB 2H1PL 1QO3B 3GZKA 2PUQT 2X4TB 4ZSOB 5ALCL 2YPLA 4QRRB 2JB6A 1KIQB 1LP9E 3H42H 4YHLH 3WN5A 1S3KH 1NDGA 1FPTH 3MGOB 4LASL 1BOGB 4PJEF 5C0ND 1F4HA 3X12B 5CILL 1SEQL 1KT2A 1U8OA 1EJ6A 4FTVA 4ZUWB 5J9PA 1GGCL 1NMBL 3L5WA 1CD9B 2VERN 3Q5TA 5C07A 3SE8H 2H3NB 1EEZA 1S7QA 4WRLA 5DD3L 1E4XH 4P5TD 2I9LA 5D7JC 1LP9F 5H2BA 5CEZH 3GM8A 4DGIH 5FB8A 3D9AH 5F7FA 5LGHH 3MBEC 4BYHA 5DR5L 2XG4A 4G8EB 1RUQH 4M1GH 5C9JA 3DROA 2VH5L 4XPFH 3VFUB 3VXRB 1DLFH 3QAZC 2PYFA 3O6FD 2ADJB 1RK1B 4K3EH 2XFXB 2RAMA 4YHKH 5C2BL 4RNRB 1T04A 4HQQH 5DHVH 1W0WA 3CC5A 4YGAB 2W0FA 4J8RA 5C0NC 1OLLA 5D93B 4HS3B 4ODWA 4LPVA 4U6YB 3C5JB 3MROB 4P5TC 3B43A 2YPVH 4KXZI 3REWA 3UJIL 3PGDB 4XP1L 4J3OC 4JAMA 5TDPA 4RFNC 1AXTH 1PSKH 2X1QA 3NCJH 3VXSA 1EHAA 3CFEA 1OP3K 3MACL 4N8VB 4TSAH 1BAFL 2EDFA 3GUTB 2J8OA 4RQQB 2XTJD 5E4EC 1PY4A 3O6FC 5TF1H 4P2RA 4ZUUB 1SMOA 2OR9L 4M4RA 4OTXH 2WMPA 1MAML 1WT5A 5I1JL 2NY2B 1A4KA 3TZVA 4UTBH 1DSFL 1F02I 2DLTA 4PY8I 4O02L 3RL2A 2BVPA 3UPAA 2NNAA 3CDGB 1KENL 1X5ZA 5DD1H 5ALBL 5L2JB 4XNUH 5FHAH 5F1IA 1BIHA 1K8DA 2P43B 5IFJB 2WQ8A 1P7QB 3D87B 4W4NA 1C12A 4LQFH 3VFNA 5GGRY 3MFFB 5C0IB 1T83C 3HN3A 1RQ5A 4WEUD 1T7VA 5E5RB 3DO7A 4CADB 5IMKB 3VI3E 3D3VE 2WWMD 2KQMA 1OHQA 3GMQA 2MOVA 4PG2C 4TNVK 1EH9A 1Z5LB 1FZJA 3NFSL 1N0XH 1B90A 2B1HL 5ID0A 3DV6A 1F2XK 1ADQH 1CLZH 4Z5RB 3RHWF 4MQXC 1KPUA 5I71B 1AFVH 4JHWH 5K9OB 5ENWB 2FJHB 1T1ZB 3DNKA 3QUKA 1KTLB 1U8IB 2HYMA 1A47A 4GG8A 2EDYA 3BKYL 5TPWH 4NIKB 2YPLE 3QZWA 4ELMB 2A6KA 1RZ8B 4LHUG 1IL1A 5F7WC 4KK5D 1BX2B 2EIZA 2EXYD 3BAEL 3SGKA 1Q94B 2N56A 3FQXA 4LDEB 4NFBA 4FTVE 4O2EA 4XAWH 3ULVH 5JIPA 5C07E 4MDJB 1M4KA 1IILE 5BZDA 2XKNA 1H3WM 4FP8H 3N85H 5A2FA 1DANT 3T3ME 4HK3J 4KROC 5DMYA 5HYJD 4Q74A 5IKCA 4X7TA 5TF0A 1ZGLP 1MLCA 2I9TB 1FE8L 4XNYH 4IOIB 5HHOB 2HTKC 5FCUL 1NANH 2HVJB 4I3SH 3T3MF 1LILA 5D1QD 3WIIH 2MKLC 4WO4D 2ADGA 1JNJA 3HR5B 2BVYA 2NTSP 3VG9B 3RBSA 1MCPL 1MJ8L 1X7QA 1FNEB 5E0QA 4J1UB 3UC0L 1BEYL 5C6TL 3DVGA 3JTTB 1RK0A 3OAZK 3CLEL 3MV01 3FO2B 4GAGH 3L3GB 4OUUB 5CBAA 1ACYH 1AGEB 4JFOA 4NN6B 5D96B 1L9NA 2IH1B 2Z8VC 4ZTPH 4AIOA 2L4OA 3BZEA 4XCFL 1MFEH 3HUJA 3V0WL 4OLXL 4M1CC 3O3BB 3VXSE 2AXGA 1YQVL 4KY1H 1R3IL 1YJDH 4Y19A 4EVNA 2XTJB 3V2AR 5I18H 4H26B 3D69B 3K8MA 1NAMB 3MUY1 3CUPA 1MRFH 3QUYC 5CJQH 5L9DH 2AK4E 4OM0H 5D2NA 5D1QC 4P2RE 4W68A 2EE9A 4KVNL 4LMQE 5DFVD 4WO4C 2OJZL 3PWUA 4DEPB 3KHOA 3VFTA 1IAKA 1P4IH 1DQDH 4PREB 3AB0B 1KJ2A 4CBPA 4FS0A 3LN5B 1QHPA 4LIQE 4O2CB 2ZOLA 1H0DB 2AP2A 1X5LA 3O4OB 3T4YB 1MHHB 3T1WA 5DURD 3TPKA 4NO5A 3SKMB 4WIQA 5KG9B 1AD9B 1KLUB 1DBBH 4Q6IB 1QLEL 3OJDA 1JMXA 1F97A 5I17A 2DM3A 5LVEA 1J05A 4PV8B 5F1NB 1QBMH 3NABL 2BC4B 4IRZL 5E6ID 5DMIL 4ODUA 2CIKB 1TMCB 4JFZH 3GJFB 4PJGA 3HB3D 1ZKAA 2PCPB 5DD6B 1ZVSA 3RWEB 1FG2A 4PP2A 3E3QC 3WCYA 4NZUL 2GUOA 1H8SA 4HJJH 2YXMA 4E0RB 1RD6A 4KXZH 3S3JA 3QWQB 5T1DL 3EOBA 1RUML 4LRIC 5DZLA 1LDPL 2MNUA 3IDGB 5EU5B 3I9GH 3PWNA 3O3AA 1Z0MA 2VDKH 2YK1H 3EIFA 4RSVA 1MRCH 1IGMH 2ZSVA 3MOBH 2DLFH 2IALB 4XNXL 1FFNB 4XMPH 1N6UA 4PJIA 1SJEB 4HIEB 2VN4A 4JR9L 1A7NL 2IF7A 4NO0A 2MCPH 5HYJB 4IJ3C 1YEDB 3ARED 5I0ZA 3CH8A 4M7KH 1LK2B 2P44B 3HAEA 1CE6B 3CU7A 5CCKL 1FN4A 4GKZA 3IDMB 2VDML 3UYPA 3UBXA 1I9JH 3MJ8A 4G9FE 4NQXB 2HT2D 5LGKA 2FNBA 5SWZA 4LVOB 4FQCL 1T7ZA 5JXEC 4EJ1C 4OQTL 4U6XB 3R06A 4RA0C 2P1YA 1E6OH 1BECA 4R2GD 4ZXBD 4PGJA 1EGJA 3GO1L 4BH7B 2GQHA 3H0TA 3QFDA 2OL3H 1FAIH 1GGIH 1QFWI 4APQC 4L9LB 4D94A 3QJHA 1HINH 1U91B 3EJZD 3RWIB 4YHML 2OL3B 1MF2H 1CK0L 1IQDB 4KTDH 4ISVA 4PUBL 4BSWB 1QVOB 3MLXH 3PWLB 3LN9A 2BHUA 3GSNA 4KMQA 1FV1A 2DI7A 1F6AB 4E5XB 2QBWA 3HUJE 2R1WA 3PV7A 1Y6KR 4Y19E 5CLTA 4NCC1 5IFAL 1R24B 2IADB 3DO3A 3ULUL 4RISL 4I0PD 4TTDC 2UVFA 1DQJA 3DARA 4MMXC 1NC4D 1CXIA 4Z95H 4N68A 4LEXL 1DQTA 5I8OL 1BPVA 3L1OL 5D2NE 3T2PA 4KHTH 3HUJF 5DSCA 4R2GC 4XBGA 1EEYA 1EMTH 1BFOA 1I1FA 1YPZA 3CK0H 2ID5A 3STBA 5D1ZA 5IEKA 5JZ7C 2OXHA 5DLMH 2XV6B 4JDTL 4KQ3H 4YFLI 3WIHL 5DJZB 4DFHA 4LLMB 5DURB 4X6FA 1M05B 4GXVL 4R96B 3ZHKA 1X5IA 5EULV 4PJBA 3LKNA 2Y5TA 4NQEA 1P4BL 4HXBH 2Z4QB 4UV4L 2KZWA 5MENA 1QFUH 2VUYA 4LVNC 5E6IB 1JNNH 3FZUD 3GMOA 3L3JB 3C08H 4LCYB 2RCSL 4OKVA 2BHZA 1WTLA 5CEXB 5IOPB 4Z7UB 4PJGE 5GSVB 3D0VB 4Z9KB 1C16B 4X7SL 2UZIL 4OGAD 2C1OB 1QSVA 4F7PA 4ELKA 4QGTA 2VMFA 3TC9A 2IMNA 4PB0H 2J6EL 3QCUH 1ZA6B 3LQZA 1QSFD 1YC8A 1NGPH 4JY4B 4PJGF 4ZNCD 2DYPB 4I3GA 4DUWA 4U49A 3VDBA 5ITBH 2I60H 3I2CL 3U0WH 1X3DA 3C2AL 4HGWA 4LKXA 2PNDA 3I02A 5T3ZE 5I1DB 4Z77A 4LLDB 4M4PA 4IHOB 4HT1H 5EG6C 1KCRH 1KN2L 1ZHBA 5EC1A 2YD6A 3QXVA 1CQKA 2P5ED 4PV9A 2WBWB 3ULUD 4PJIE 1NCDH 3RVTD 3X3GH 3EFFA 4PRPA 1U58A 3AREB 3SDAB 4XPHH 1PQZB 2LQRA 4LLYA 2FDBP 4PJ7F 1IAIM 2BCKB 4F58L 1S7SA 3OF6A 2OLDA 5IMMA 1WBYA 1YNKL 2MPAH 2X4TA 4OGAC 4PGCB 4PJIF 4ZSOA 3T2OA 5E8PB 3S88L 4QRRA 2H8PB 1KIQA 3X14B 4F80A 3MGOA 5SWZE 5B38B 1JF5A 3X12A 2RQ8A 4ZUWA 3V7AG 2BSRB 2P45B 3DV4B 4JY6B 4ZXBB 4XWOD 2H3NA 4JANA 2OMNA 1MEXL 5D1XA 1CYGA 5K33A 1XGRA 2LABA 3LKQB 15C8L 1P84K 4PJHF 1MI5B 1BBJB 4NOFA 3AS2A 2FGWH 1MCLA 3PF2A 3ULUC 3RVTC 1B3JA 4XAKD 2I07B 8FABA 4P9MH 5IT2H 5GRJH 1P84J 3OL2A 3AM8A 3VFUA 1OPGH 4CVZB 1WWAX 1NMAH 4HKBB 4G7YH 2ADJA 1T1XB 1F4WL 1RUPL 1J1XL 3TM6A 3WXVL 4AQOA 3TCXA 4I0PB 1EHLL 3JV0A 2I24N 1NC4B 3IU4H 3QIUA 4YHPB 3ISWA 2OYPA 2HJLA 4HS3A 5SWSD 3LAFA 3C5JA 3UPRB 2W60B 4XWOC 4EOWH 3KLSA 3MROA 3D18A 3RL1A 2IJ0C 1YPZE 5EBGA 2HT4D 3PGDA 3IKKA 1SEBB 2GI7A 2RIKA 2LU7A 3FT3A 4OBRA 1C5DA 1FNHA 3KPTA 1I1YB 4RQQA 3FQWB 4PJBE 4NQEE 3HFML 2NTFB 5BMFH 4D9RE 3UMTA 5MENE 4JKMA 1A0QL 1UKTA 2GFBB 1P7HL 5GGTA 3CJJA 3OG4B 3LQAH 2BMKB 5FGBA 3K2MC 3KYNA 1N6QL 1KCVH 4NP4H 4QEGA 3NPZB 3SQOH 1D6VL 5JPMB 4UBDD 5L2JA 5HXMA 1QFWH 4KTEH 2C4FT 4HIJB 3D48R 2EO9A 2NY1D 3LEVL 5GRUH 5EZIL 3MFFA 2HT4C 1EO5A 5C0IA 5DHXB 1AXIB 2FECI 4NQTA 5IMKA 4CADA 1KCUL 3P0YH 1KUMA 3Q3GA 2BVTA 4FOMA 4NHCL 5D7JA 5I73C 3GJEB 3P4NB 4NWTL 5GJSL 2Y72A 4HKZB 1WBXB 3P4MB 4N5UA 2P5EB 4WFHD 4YBHA 1Z5LA 4OLVL 5DUML 4YXKH 4JFQB 3MBEA 4EDXB 4KJPC 1M71A 2BFVH 2R8SH 1V5JA 3ARYA 4YC2B 3MPCA 4PRPE 4RFEB 4Z5RA 4A6YA 4BK4A 3WS6C 3B8YA 5CINL 2AJ3B 1NGXA 5K9OA 3O2WH 5ENWA 1PG7W 2FJHA 1T1ZA 5GGVH 43C9B 5JUEL 4UBDC 1UWXH 2J2ZA 1KTLA 1U8IA 1UM4L 2DLHA 5FA4B 4NUJB 1LO5A 4XI5D 4ZSOE 3VA2C 4RMUA 4PJAB 4RIRA 4ELMA 5K9KB 1RZ8A 4DW2H 4QRRE 2CK0L 1U42A 3BKJL 1Q94A 3VJ6B 1IZJA 4G8FB 2X4RB 4P5TA 4MDJA 1JWUB 1JHKH 4OM1H 3BP6B 5HJ3A 2NXYD 1S9VB 3MRPB 4XHJC 4ZFGH 3GI9L 4FXKB 4M7ZC 1JGEB 3TYGH 2I9TA 4U3HA 1BZ9B 4OFDA 4NN7C 5J13C 1WIPA 4IOIA 3WV0A 3O6FA 5EDXA 1HH9A 1FFOB 1QBLH 5IHBA 1MFDH 1XF3A 4I8DA 1E0OB 1G1CA 4CDGC 4UV7L 3TO2B 3HR5A 5BS0B 3O41A 5J12B 1YN6B 2R4SH 3KS0J 3L3IB 4ONHB 2PR4H 1I75A 4BQCA 5SWSB 3JTTA 3SJVD 4YHYC 3BPLB 3FQRB 3VI4E 2N7BA 3FO2A 5MP6H 4F9LC 4OUUA 1XF2B 1PVHA 1AGEA 1SYSA 3ET9F 5TJWK 1KV3A 2XZAH 4MA3B 5LAXB 4HUUB 3RKDC 2IH1A 4WJ5B 1RJCA 1UKQA 4JO1H 2J8HA 2G2RA 3EFDL 2RJMA 3O3BA 3VI4F 4ZYKA 1RZIB 5H94A 4PG2A 4H26A 3D69A 4MJID 1NAMA 3AROA 3LPFA 4M62H 2DM4A 3BN9C 2KL6A 2V2XB 2WUBL 1PG7H 4ZMAT 3DXAD 1ZLSH 3AUVA 4ODVH 4PJDB 4PREA 4M8VA 4RX4D 2ED8A 5J06A 5DA0B 1VGEL 3OXRB 1H0DA 3VU2A 2NY1B 3WBDA 5A3ID 3JV6B 2GCYB 4KPHH 2YN5A 3MSPA 3SKMA 2NYYD 1ONQA 1AD9A 1KLUA 4Q6IA 2AEQL 4JB9H 1NCBL 5ECJE 1HYRC 2BNUA 4AMKH 2W9EH 1CICD 1HSAA 3QI9D 4MA7H 1OB1A 2VTFA 3ESUF 1KFAL 2BSED 5F1NA 2Z35A 4NQCB 2CKBL 3GSVA 2E7LC 3K81A 2CIKA 3L3DA 4ZPVB 2AJXH 3GJFA 1L7TL 3VD5A 2A0LD 3SDDB 5DD6A 2YKLH 4RCAA 3SDXB 3RWEA 3WNOA 4BUHA 1LK3H 2PXYC 2YD1A 4R4ND 4RZCB 1ORSB 4P2QB 3KPQB 4Z7WA 2YD3A 3VFPB 1R5IB 1BFSA 1E4WH 1Y0LB 3GMMA 1RIHL 4N0FB 4XH2A 4IEFB 3IDGA 2G5BB 3W2DL 5EU5A 2RB8A 4GAJH 1ETZB 3QEHB 4R4FH 1MLBB 1K4CA 5HBBA 4B50A 1FGNL 2IALA 5I30H 5CWSB 1PZ5B 4ELME 2YC1B 1E4JA 3LEXB 1L7IH 1FFNA 3T0VA 1CICC 3CMOL 5IV2B 1CGSH 5HPOA 1A3QA 1JGLL 2FEEL 2X1WL 1SJEA 3S35H 4HIEA 1ZLVK 2LAGB 2NXYB 4NCC2 1OGAD 4MVBD 1ZLWH 3OKYA 1IRAY 5HYJA 4WUUB 1KIRB 1YEDA 3K0WA 4U7KA 4ELMF 4DOHE 2A0LC 1LK2A 1Z6JT 5FO7B 3UTQA 1KB5H 3IDMA 2EE3A 4LHUB 4R4NC 4A2LA 3QCTH 2Y25A 1KB5B 3T2QA 5D1QA 4JZNA 2BRQA 1CDYA 4MCZB 4WDIB 2Y5EA 4WO4A 4TTGA 1I8MB 2W9LA 4PJFB 3DX7B 4NRYA 4LDLB 4U6XA 4JFDD 1G0YR 1F11B 1MCOL 4PJ8D 4BH7A 9CGTA 5IUSA 1AC0A 5I1HL 2NY6D 3VWJB 3S6CA 4L9LA 3E6FB 1U91A 3RWIA 2JCCB 2VLRD 2DBJA 4MVBC 2EYTB 1IQDA 3FQNB 4EQ2A 3L6FB 2FGZA 4U1LA 4H8WH 1GJIA 4YHLL 3GMRA 3MRRB 4BSWA 3PWLA 3EDKA 4DAGH 4AIZB 4I2XB 1JWMB 4E5XA 2AEWA 1DE4A 1JZ6A 4AT6B 4ODSL 2XTJE 1R24A 1E4XL 2ESVE 3V9FA 4RWYL 2APVA 1T80A 1NLBL 12E8H 4LGRB 4EUPG 3DXAB 2W92A 2BNQD 4M93B 5LGHL 2AEPH 3RAJL 3MLWL 4LRIA 3TFKC 4UZGA 3WFCH 4PJ8C 5EBLB 1YN7B 2XRAH 5A40E 4K3EL 1GCFA 1FYTD 3U9UB 3NAAH 3KXFB 4OD3L 4KRNA 4YHKL 3I85A 5GS3A 2EDWA 5DJZA 5IWLA 5D6CB 1M05A 1PEZA 1NSNH 2J4WH 4R96A 4HQQL 3E8UH 5C0FB 2IPUG 3TWCL 2Z31C 2X70A 4ALAH 3QI9B 1B0WA 3ME0A 2EIEA 1UB5B 2DB8A 5E6IA 5HDBE 2X41A 5FA3A 4MMZC 4OLUL 2XPGB 5EZJA 5CEXA 4Z7UA 4LLWB 5GSVA 2GTZB 2HT3D 2JELH 4Z76B 4Y5XC 4OCYH 3VXUD 3T4AB 3GI8H 2C1OA 3O6ML 5HDBF 4TSAL 4Z7WE 2FLRT 2NY4B 3MO1B 3SKUD 1ZA6A 4U3XA 4H25A 5EU6D 3CH1B 1BFVH 2VDNL 4JY4A 4OZFB 1J1OL 5CJBA 3VGAB 4IDJH 4OT1H 5I1DA 4LLDA 1U6AH 3BD3A 1T21B 3EYFB 4CN4A 2HJKB 3ZKSD 2YEZB 4OZGB 4M03A 4QCIB 2NY7H 1OGAB 5GPRA 3G04B 2P8PB 3HZMA 1IFHH 3AREA 3BIBX 4LQFL 3MA7A 5HYJE 4K2UH 1ODAA 1U3HB 1J5OH 2HT3C 3VG0H 2BCKA 3S5LA 1LEKB 4UTAH 5IBLC 3MRHB 3C6SA 5E8PA 1Z9OA 3QDJD 2VLLB 2KZ1B 5AUMA 3ILQD 2J88L 1FHGA 5ICXA 2H8PA 3S36H 5KSVB 3QXTA 3V6FB 2V2WB 5B38A 1MVUA 4QRTB 1JGDB 4PLOB 5GGRB 4D9LH 4JFDB 2BSRA 3DV4A 4ZXBA 4FFVD 1FQ9C 3CFDB 4MQTB 1F13A 1AFVL 2NY6B 4WEBH 4HIHB 3UAJD 3LKQA 3SGJC 3C5SB 2CR3A 1CFSB 1WVZA 3VGFA 2VLRB 5CP3H 6FABH 4S1RL 1G7JB 2I07A 1BVZA 4M43H 3F7QA 4TQEL 1B4JL 1IBGH 1T3FB 3VH8G 1CGUA 1HEZB 1T1XA 2OZ4H 1QSED 1QFHA 1U8NB 3INUH 1J10A 2X4PB 5FEBA 2R15A 2DKSA 3L9RB 4I0PA 5HVWA 3ULVL 1NC4A 4XPAL 1B9ZA 4JRWA 5LQBH 4UT7H 4FP8L 5HTSA 2AJSL 2Z92B 3ILPB 2BNQB 5DWUL 1ZVHA 1U8MB 3SEPA 5KOMC 4FQIL 4EN3D 3UPRA 2W60A 1AP2A 4GOSA 2ZUQC 4FMFA 2ICES 4I0CC 1FRGL 3CVHL 1SEBA 5HGAA 2VITB 4LSSH 3OB8A 3VFSB 4M6AA 4K3GA 1D5ZB 3HC0B 3C8KB 3WO4C 2NTFA 3O3EB 3MZGB 4U0RB 3NIFE 2FRGP 4X6BB 1OAYL 1A6TB 3TBVB 3QUXD 1HXYA 2OS7A 4OQTA 4DQOH 1EZVX 1OD7A 4QRQB 3IDYB 3FN0H 3GHEH 1M6OB 1BF8A 4Z7UE 3OX8B 1GZQB 5JPMA 4QKXB 4WFFE 2VXSH 1RZJL 3NIFF 3RI5K 3AU1B 4YBLB 5FUOL 3KYKL 2F54B 1FZKA 3KPLB 4OCXL 5ITFA 4QOKB 3WS3B 5EU6B 4OFIA 1QSFA 1NBQA 2AXJA 5C3LD 4JN2B 4Z7UF 3PDOA 3U30C 3EYOB 3Q5YA 1D9KC 1SJHB 4KRMB 4JFED 3F7VB 4OLWL 32C2A 1AY1H 2BSTB 4JO2L 2D7MA 1DQDL 3GJEA 1C5BH 3P4NA 5A2KH 4HKZA 4JDVB 3QUZC 3U48A 3BZDA 3P4MA 3ARBD 2P5EA 1ES0B 2AERT 1DQML 1J8HB 3SE4C 4WENB 4DN4L 3UROR 3TH3T 5E08L 1FJ1B 2EXWC 2AJ3A 1UJ3B 3S4SG 1A6VH 1ED3B 4JM4L 43C9A 2VLJD 4YK4C 4LCIH 5J8OA 1P53A 4TSCL 4M02A 5KSAD 3QDJB 5FA4A 4NUJA 1INDL 1CG9A 1QBML 2E7CA 4PJAA 3QH3B 2OTWA 3NACL 2F58L 4LEOA 5K9KA 2HRPL 2D7TL 5F7UA 4JFZL 3MRCB 4P2CG 3VJ6A 3I3EA 2DQDL 4G8FA 1UZ6E 3L7FB 2X4RA 4HJJL 1OF2B 1JWUA 5EOCH 3BP6A 3FB7B 5E56A 1QR4A 2E9WA 3RTQC 1S9VA 3MRPA 1U2HA 3WDJA 3ULVC 3OV6A 4FXKA 4GKSB 2D0GA 4JFYB 1TENA 1U8PB 3M1BB 1BZ9A 3V6ZB 4TSBL 4LPCA 1FFOA 1QSEB 5A2IH 1OM3L 5L6YL 3NIDE 2VXVH 4G5ZL 1KTRL 2J6EA 3O0RH 1I3RB 3TO2A 5KSAC 3U46B 1RIVH 4HC1L 3B9KD 1DL7L 1YN6A 3CXHJ 1CCZA 4ONHA 1F42A 4YDLB 5HHNB 3U1SH 1HNFA 5DVOA 5SWSA 4EN3B 2A6JB 4K9EH 3W0WD 2JIXD 2EZ0D 3EAKA 4LLVB 1UM5L 1XF2A 4QYOB 3L5XH 4MA3A 5LAXA 4HUUA 1A2YA 1LE5B 4L4TD 2FD6H 4NZRH 2VDQL 1X44A 3FL7A 2DDQH 3RY4A 2YMXL 4S1SL 3RVVC 4OV5B 5HI5C 4LSVL 3KYAA 4JFFD 1RZIA 1I4FA 4NKMB 5J56B 1RUKH 4X99B 1DJSA 1RZJC 3MUZ1 2FX8H 43CAB 4JVWA 1YJDC 1AJ7H 2FX9L 3FQTB 1VFAB 2V2XA 1TVDA 3QUXB 3UJTH 4MYWB 1OWRM 3WS6A 1HINL 4H0GA 4WTZA 4IIQB 4LSPL 1OSZA 1Y18B 1DQLH 3NZ8B 3VCLB 1U92B 3MR9B 5M95B 4J23A 5E2TH 3OXRA 3JV6A 2HMID 5SX5H 3NGBC 3V5DB 2YR3A 1QSFE 4WU5B 2HVKB 2VQ1A 4JJHA 1QR1B 2J5LC 5I8KH 3O8XB 3DVIA 1KCLA 5I6XB 2VDLL 3NVQA 1KJMB 4KKCD 1JGUL 1YUHB 3ARBB 1FL3B 3OWEA 4G7VL 4ZUTB 4ZPVA 3DGGB 1NGQL 5IJVB 3PGCA 5GS0H 2P5EE 2EE6A 2XT1B 4HDIB 3ULUE 4L8SB 3SDXA 4FG6D 5L2KD 5LXGL 5ACZB 3G6AA 4RZCA 5DRXA 1ORSA 3VW3H 3KPQA 3GKWL 1TETL 3QXDA 3DI2B 1Y0LA 1G7HB 1JPFB 1A7RH 4YWGL 5EBWA 3KJ6L 1IMHC 5DVNA 1ETZA 2FBJH 4ETQB 1MLBA 2HMIC 3VRIA 1MWAB 1X4XA 3C08L 4OZHB 5INCA 4G6ML 1SVCP 3WXWH 4PJAE 3DRQB 5CWSA 1NCWH 1PZ5A 4J4PC 1NGYB 2YC1A 3EOYG 3X13B 2V7HA 3LEXA 1BJ1H 3IAPA 4WCYH 2BNRE 5IV2A 1F6FB 4PBWD 5F7LB 4XNQA 3NPSB 3LQMA 2UUDK 3ZL4H 3BP5B 1P4LB 4PJAF 1KIRA 4P2YA 1CL7I 1NGPL 3AXLA 3I3DA 1BBDH 2NX5D 4FG6C 1A6AA 4K71B 4XAKE 2P5WD 2A9NL 1S7UB 4RDQG 1GPOL 4OFYD 1IEHA 1FIGL 5IBUG 1S5HB 2ICCA 4MCZA 4JM2D 3EYUL 4WDIA 2J1KA 3J7HA 1MAJA 1I8MA 3IXAB 4PJFA 3DX7A 4KZEH 1FCGA 1TJGH 3ARFD 3B9KB 3FRUB 1DFBH 4MNHA 2B5IB 1XR9B 2PW1B 1JPGA 5J11B 1PD6A 1F11A 1QPPA 1XGPA 5H8DA 5FECB 4K7FA 3SJVA 1ZGLM 3W0WB 2JIXB 5D7IB 5SWSE 4PLKD 4AJ0A 2OTPA 1EVUA 4TRPL 2IG2L 4DTGH 4HF5H 3NFPA 3QDAA 3E6FA 3O81A 2MPAL 1RJYB 1D6EB 2B2XH 1FAKT 1KTDB 2D03H 2FB4L 5E6ZA 2JCCA 1CE1L 4L4TB 4L4VB 3FQNA 1HN1A 1ZE3C 4AH2B 4Z7VA 2NY3B 3V4UH 5F89B 1DUYB 4EDWH 3WKMH 3BZ4B 4I9WD 1JWMA 1FLRL 2FWOB 2E7LA 5BJTB 3DYMA 4MJIA 1MREL 4Y16C 5F8RC 5ACMA 1BWMA 4MJ6B 4JM2C 3HZVB 3DXAA 1MQKH 3BMWA 4WEMB 3ARFC 2EO1A 1T6WA 1GIGL 4BELD 5KVMC 3UYRL 4RX4A 5IT2L 3HS0B 3TV3L 1RPQA 1CFTB 3ALXA 4FQ1L 3QRFM 1YN7A 4GRLC 2GTWB 3ULSB 2ZZUT 1VPOL 3C60D 3U9UA 3ARGD 2YRLA 1K2DB 2Z93B 5D6CA 5KVDL 4KRLB 5C0FA 4JO3H 3KPRD 2CQVA 4KV5E 1CICA 3QI9A 2K9UA 1I8LA 1AKJB 2BOBB 2Y9RT