1DFBH

Structure of a human monoclonal antibody fab fragment against gp41 of human immunodeficiency virus type i
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
EVQLVESGGGLVQPGRSLRLSCAASGFTFNDYAMHWVRQAPGKGLEWVSGISWDSSSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDMALYYCVKGRDYYDSGGYFTVAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA 3D6 FAB (LIGHT CHAIN)
publication title Structure of a human monoclonal antibody Fab fragment against gp41 of human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 1992-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dfbH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dfbH01
4E41D 2WUBL 3MOBH 4M6ML 2DIBA 5C86A 4WFFD 3B2UC 4YHYB 2GIYA 3HMXL 5IFHH 4P9HH 5SWZA 4Q9QL 5ESAB 2WUBH 4M6MH 3FT3A 2K3TA 4G80B 4L3EE 3OKLA 3ZE1E 3DPBA 4RAVA 3HMXH 3LDBB 4OLEA 3F7VB 1UXWA 5ESVA 4Q74A 4NKDA 4XPHL 2EDXA 12E8L 5SWSA 2LE9A 1R3LB 2GW5A 3VXNB 3G5VB 5I76B 4LVOC 3UBXI 2DQUL 3U46B 3K0WA 1PQZB 2NY4D 5IFJB 4XPHH 12E8H 5F7FA 1HXMB 2GT9A 3MV01 3KPSA 3RVXC 4KMQA 1ZS8B 2DQUH 3DV6A 2EDDA 2EDQA 3VRJB 2BNRB 1OF2A 1FNLA 5FKAB 3QDME 2IJ0C 2LTQC 3PNWA 1NC2B 1H3UA 3U0PA 5DURB 1Z2KA 1UH4A 5DC9B 1JHTB 4W81A 3S4SB 2AV1B 2W9DL 4TNWK 4KKAD 3MLWH 4IMKA 4PJEE 1AXSA 4PTTB 2VZOA 3X3GL 1YPZA 3V5KB 3Q3GA 2W9DH 5EOQL 4PJ8B 3P4MA 2NY5L 1TQCB 5C09D 4WWKD 3X3GH 4Q9RL 2C4FU 3VI3E 3PV6B 4JM2A 5EOQH 1R5IB 2NY5H 5F9JB 3VFOB 4YE4L 3RA7L 3BQUA 1AHWB 5BOPA 4ZUVA 3ZYZA 1R5VA 4Q9RH 1NKRA 3FQTA 25C8L 3D0LB 2CLZA 4KKNA 5MI0C 3JV6B 2Q86A 4N9GA 1ETZA 5CP3A 3RA7H 5BS0E 4RGNB 2KZWA 3HE7D 1IAOB 25C8H 5L6YL 1HEZA 3L9RB 4GAYB 4PRNA 3EYSL 2VKXA 1J0ZA 4ONFL 1JN6B 2F5AL 1X4XA 3KYOB 2NTSP 4HKXB 3FO9A 1JUFB 5HYEA 4GXUN 5FK9A 1S5HA 2ED7A 3DRTA 5FYKD 5L6YH 4C4KT 3EYSH 5HHQA 2F5AH 1MIML 5FV1L 1HH6B 5ISZE 1QBAA 1HCVA 3UPAA 4PJCE 3GJEB 2WBJC 1JYNA 1MIMH 4KHTH 3AU1B 3FN9A 3AREA 5IV2A 5J13C 3O3EA 3BXNA 3CDGB 2DLTA 4YX2L 4YBHA 1ZT7A 1I7ZA 2LABA 4BZ1L 3FCTA 4ZAKC 4YX2H 2CXGA 1FJ1A 5EA0L 1BJ1H 4PP1C 2HFGL 2V9TA 2CPCA 4Y4FC 4BZ1H 4MQTB 2MWCA 3CXDL 3VXRD 5EA0H 2HFGH 4HMEA 2XZZA 4ZS7L 4M61A 3REVB 3CXDH 1B6UA 3SDAC 3NZHL 3GB7B 4ZS7H 5IBUB 2DM2A 5D1XB 3TO4C 4UQ2A 1NCUA 3NZHH 1MHHA 3ZE0E 4G7YH 5FYLL 5I66A 3BZFA 3VRIA 4OLUL 4YDVA 5GRYA 5GS2D 1T0NA 1MLCA 5IVZA 3ZSSA 3WBDA 5HHVL 1P4BL 2WWMC 2XZAL 4WU7A 5FYLH 4C59B 1JZ7A 4OLUH 5DJXA 2Q76A 2R1XA 5C9JB 4DEPC 1RZFL 1FPTL 5C0EB 3MBEC 2XQYK 5HHVH 1P4BH 4I5BA 2XZAH 1D9KB 3OAUL 4MQXD 4X7TA 5JUEL 4JFDB 1RZFH 5ERWA 1FPTH 4QO1A 1MJ7L 1QR1B 4JHAL 4YFDB 3U4BL 3MUGB 5F1NA 5I0DA 4MNQD 5JUEH 1AKJB 1MJ7H 2ARWA 4JHAH 3PL6C 3SBWC 3H3PL 3L3DB 3AS3A 3U4BH 4EN3B 4QXTB 5A43C 2BVOB 2FSEB 3BD5A 4JAMB 5AUMB 1WICA 2ZSWA 3T0EA 1UWGL 4ONHB 1I9EA 3ULUC 1QSEB 3H3PH 4I48B 3JTSB 2QHRL 3SDCB 1MJUL 4LHUD 5D1QD 4HBQA 1A6PA 5CD3A 1FZKA 1UWGH 3QIWD 1TVDA 5D7LA 4K9EC 4PJHE 1AGCA 2QHRH 1MJUH 3MJGX 4Z7VA 1CTNA 1BIIA 2VXQL 1HINL 2FCBA 1R5WB 4ZODA 1A02N 1RK0B 2VXQH 1VA9A 1ZHNB 2P45B 3BP7A 1HINH 4BFGA 4V1DE 4F7TB 1F97A 2VZ3A 1T1YA 1KTRL 3AS1A 1UJTA 3TZVC 4NZJA 4NFCA 4JCLA 5DHVB 1DDHB 1MRDL 1G1CA 3U7WL 1S9KC 4QRRA 3CDYA 2VLJB 4UDUA 1MHEA 4IM8A 1MRDH 1AY1L 3D18A 3U7WH 4B7IA 5I17A 2OXHA 3FO0L 3MRMA 4NBXB 2HN7B 3QXDB 2WLZA 3I02B 1GGCL 3N1PC 2XN9D 3RZCB 4JY4B 1AY1H 3NCCB 4C83A 3FO0H 1HDMA 1X5KA 5D7KE 4G6JL 1GGCH 3L3OA 5JNYA 2JCCA 5ICYB 5K9OB 1E27B 4UTAL 5HYQA 4M1DL 4G6JH 4PGEB 2BERA 1TQBB 4OUUA 5I30L 3MRBB 3UTSB 4UTAH 4JFPB 2CLVA 1CCZA 4M1DH 2BSRA 5TPWL 4PRHA 3WFHA 2J7LA 5M95B 2YRLA 5I30H 3ARFC 5IBLD 2OMNA 2EDLA 3HS0B 2D2OA 5TPWH 1CE6B 3KXFA 3QQNA 2APFA 4RAUA 4HKBB 1JNJA 5AD0A 4LCYA 1JZ4A 5IOPA 1D6VL 1BQSA 3BRDA 2P43B 5FGCB 5DEGA 2FL5B 3SKNB 2DWDA 2X9YA 2OQJB 2AGJL 2YA1A 4Y16A 5IHZB 1FIEA 5EZJB 3VJ6B 2OR8A 2P24A 1NAKL 3C5ZD 3MRHB 2FEDC 4NPYA 1ZLSL 1KJMB 1RUQL 3C6LC 3VGFA 2AGJH 4PGCA 3DVGA 4CDHA 2UYLA 2YEZA 3TA3D 4AQOA 1NAKH 4GAGL 1NGXA 1ZLSH 1RUQH 2Y23A 1EBPA 2F54B 2YZ8A 4K3DL 1W72L 1OB1B 4J3VA 4WFHE 4U1MB 3W39B 2EDOA 1I1FA 2NY6B 1IKNA 4NQEB 5B38G 2APBA 4OCYL 1FZMB 1CDCA 4K3DH 3P73B 1W72H 4N1EA 5D5MB 3O8XB 1LWRA 2LAGB 1HKFA 4OCYH 3LH2L 3O45B 3QIUD 1I1AA 4RIRA 1W0VB 4FMKA 2VQUA 3IDGB 3K81A 3LQAC 2XTJE 5DJDB 2Z92A 3VWKC 4F15C 3LEXA 2BVQA 4F7MB 1Z3GL 5C0FA 1IGFL 2BFVL 4JRYA 1RULL 4HGMA 2P8MA 3ES6B 2ICWJ 2Q1EA 3E3QE 2E9IA 1Z3GH 3SCMC 1IGFH 2BFVH 4Y19B 4W68A 1RULH 5EFIA 4NIKB 3LB6D 4PRPB 1AXIB 4NYLA 1CI5A 5HGDA 1KG0A 1QBML 3BN9D 3UTPE 3V8OA 1UGNA 1X4ZA 3CC5B 3I6GB 3IFOB 4AEHL 3LPFA 3K8LA 5K93A 1QBMH 1J8HB 3HUJF 2ITDB 1KPVA 1BFSA 4MNGA 1CLCA 3ZHDA 1FL3B 3C2AL 4Q6IA 1ODAA 3WE6B 1CS6A 4TN9A 5IG7B 5ENWA 1CICA 4AM0A 5C0AD 4UQ3A 2YPKA 4PJ5B 3QP3A 3LN4B 2A6JA 4P2OB 3C2AH 5C8JB 1RFDL 1H5BB 3G9VA 4KI5D 2CIIA 1MCLA 2XYCA 3HZVB 1F13A 3X17A 6CGTA 1T22A 5FYKL 4LNRB 3DVNB 4NCDA 4AH2B 2E6PA 4LSSH 2GITB 1G7HB 4DQOH 1GVIA 3OKDB 5FYKH 2BJML 3I3BA 1BFOA 1CT8B 2JJSA 2VR5A 1K4DB 5ESQB 1DQML 2GYSA 4N8VA 4Z6AT 4CMMB 4MHHI 2PTTB 3P3YA 2BJMH 3JV4B 4KUZL 1F4AA 5HHNB 4KJYB 5FKPB 5HI5D 1DQMH 2PXYC 3G04B 5DHYB 3U7YL 5I1GL 3CFIC 4MXVF 4XT1C 4QRPD 2DWEB 5CHNA 4KUZH 3FB7A 3WIHL 3O6LL 5CZVL 3U7YH 2ADGA 1FLTX 3RDTC 3DTXB 5GGSY 1HIML 3CSGA 1A7QL 4KRPD 4YBQD 3WIHH 1XIWA 3O6LH 4J1UB 5CZVH 2A6IB 2B5IB 2ZUTA 3NIGE 4JREC 3O3BA 3TH3T 2IAMA 2P8PA 1HIMH 3QUYD 1J7VR 1A7QH 4L4VD 4WIQA 2X4PB 5DDHB 3QIBC 4NKOA 4XNXL 3QXAB 32C2B 4GUPB 1HILB 4UZGA 4P3DA 3FAWA 4XH2B 1U8PB 1CFTA 2A6DA 3B9KA 4XP4L 4ZSOE 4XNXH 5KOVC 1MHPL 3NCYS 4K8RD 3RIFK 2NY2B 1MFAL 3KHOA 5E9DD 4XP4H 5ESAA 1OPGL 1MHPH 4G6FB 3T3ME 5D9SB 3U48A 1CXKA 4G80A 4C58B 1U3JA 1MFAH 2YA2A 3D0VB 3F7VA 1OPGH 4HIJB 1U42A 3FB6B 4R26L 4ODXB 1J88A 1R3LA 1QSFE 3G5VA 4YO0B 1NH6A 3VXNA 5I76A 5KAQF 3U46A 5HY9B 1QHPA 1PQZA 2YN5A 3QUZC 5T1LB 5IFJA 4R26H 1LO0L 1HXMA 1AGDB 2Y25A 1L0XA 1ZS8A 1TZGL 5C0BD 4PY8I 2YPLE 4NUGL 3VRJA 1LO0H 2BNRA 3DHMA 2X2YA 4YHPB 5FKAA 2YXFA 1TZGH 2I60H 1NC2A 2V9RA 1AQDB 3O6KL 4NUGH 1JHTA 5D6DC 1IGCL 4NC0B 3S4SA 3VXUB 4JO3H 5KSBB 4PRIB 1EHXA 2Q87A 2AV1A 4RX4A 3O6KH 3QQ9C 4PTTA 5M94B 2C3HA 1JPGB 1IGCH 1U58B 3V5KA 3P40A 4U7MA 4BSWB 4PJ8A 4H20L 1JZ2A 2X44D 3TPUB 1FLRL 5BRZD 4RMVA 3PV6A 4LARL 1A3RL 4Q0XL 5C0CE 1R5IA 4H20H 5F9JA 3SE8L 3VFOA 1AHWA 3ULVL 4UU9B 1HNFA 3D0LA 3I84A 4LARH 2EXYD 1A3RH 4Q0XH 3P30L 4QYOB 3JV6A 4Y8AA 1MFEL 3RL1B 3ULVH 4YXKL 1IAOA 2PW1B 3D2UB 3L9RA 2A38A 4GAYA 2BX5A 3V6OA 1JN6A 3P30H 3KYOA 4HKXA 1MFEH 1U0QA 1JUFA 4YXKH 2EDEA 5LBSL 5GZOC 3O4LD 4OFVA 4EOWH 1HH6A 2Z4QB 3R0MA 4KAQL 5LBSH 4AG4L 2NX5D 3GJEA 4F80A 1QOKA 5BO1L 2OZ4A 1QFWI 3AU1A 1RZKL 2CGRL 4D9QD 4KAQH 4BUHA 2F53E 5EOTB 4AG4H 3BKML 4OIIL 3RX7A 3CDGA 3ZKXB 5BO1H 5EUOE 3RWIB 1RZKH 4P4KC 2CGRH 3BKMH 4H8WL 4OIIH 2RB8A 2I9LB 2I27N 3JWNC 4HMCA 3VXQB 1ORSB 3L1OL 5AYQA 3OKMB 1OY3B 1A1NB 1CFVL 3JWDC 3R8QA 4DGVH 4H8WH 3MLTB 3W0WB 1D5ZB 3E2HB 1T04B 1NCTA 2KUTA 3L1OH 5DQJB 1CFVH 4GQ9L 4P5MB 2Z31C 3REVA 4HS8L 3DO3A 4K3GA 3BUYB 3GB7A 4AENB 3L3HB 2NY0D 4GQ9H 5IHUL 3ORJA 1JGUL 2WW8A 4HS8H 5D1XA 5F6IC 3ZO0A 3QSKB 3LS4L 5ICXB 1P6FA 3MRDB 2FJHB 1UFUA 1JWUB 4H1LH 3ZHKA 5HHMD 3LY6A 3MNZB 5IHUH 1JGUH 1H3TA 5F72S 2YD4A 4G6KL 3LS4H 3PJSB 4WTZG 3ZL4L 4G9FB 1QO3B 3ZE1F 3DXAE 1WGOA 3IDYB 5C9JA 1FZJB 1CE1L 1U6AL 4G6KH 5C0EA 2I9TB 2X1PA 3ZL4H 1HXYB 1PZ5B 1D9KA 5MEQB 2ZSVB 5IROC 3JWOL 5BMFL 3RX8A 4OM0L 4JFDA 1OAXL 1CE1H 1U6AH 1TJHL 1QR1A 4FQJL 4LPUA 1EERB 3GDBA 3JWOH 3MUGA 5BMFH 3ARVA 4W6WB 5DZLA 1AKJA 4OM0H 1BPVA 1OAXH 3WKNA 3ARGB 1CD0A 1TJHH 4W4NA 3WFZA 2HT4C 3L3DA 1NSNL 1VEPA 4EN3A 4QXTA 2BVOA 2FSEA 3WS3B 4JAMA 5AUMA 5JXEC 4RZCB 2OK0L 4ONHA 4CMHB 2FH6A 4JKWA 1QSEA 1T1XB 1NSNH 2YRZA 2VRAA 4I48A 3JTSA 3SDCA 4N5EC 1XF1A 5D7JC 2OK0H 1UM4H 5DT1L 2E6QA 3ME0A 4PJEF 4HKZB 1UCTA 4KH2A 5E8PB 4LKXB 5BV7L 1I7RB 2GUOB 5DT1H 3ARDB 3EHBC 2BVPB 4HWZB 1R5WA 5E5RB 1RK0A 5BV7H 4NJ9L 3SGJA 4UOW1 3T8XB 3VI3F 4J2XA 1ZHNA 2AQ2A 3UJJL 4EQ2A 4F7TA 5T3XE 3PHOB 1DFBL 3QDGE 1T5XB 1OP3K 4AMKL 4G8IB 4NJ9H 3QULB 5DUBB 2P8LB 5SWQB 4BZ2L 2BK8A 3GBNL 1DDHA 4MJ4A 5DHVA 3UJJH 1I8MB 1B0GB 1DFBH 1WQVT 4AMKH 2VLJA 5ANME 3S34L 4BZ2H 3GBNH 5FOJA 3QRGL 4M48L 1JNNL 4TOYL 2HN7A 3QXDA 4MAYC 4Z7WE 3D39B 3I02A 3S34H 2Y6SC 3RZCA 4JY4A 4CN4A 1NGZB 2OJEB 3QRGH 4AEFA 2VMFA 4M48H 1JNNH 4RRPG 4TOYH 5LGJB 4DK3A 4PJIE 5D1ZD 1CDJA 3B2VL 1T7WA 4PJCF 3QAZC 4GSDH 4JLRB 3V5DB 4P5TD 1BZ9B 1DUZB 5ICYA 1CXIA 2V2WB 5K9OA 1E27A 3JVGA 3CDFA 4OGAD 4PG2C 3D25B 4PGEA 3B2VH 2C5DC 5HYJB 1J0YA 2YK1L 1A5FL 2R0ZL 1WWBX 3MRBA 3UTSA 3RVUC 4G6AD 2WSKA 4JFPA 3RGVB 2JLLA 2DICA 3KDMB 2F58L 2YK1H 1CG9B 2R0ZH 5TGBB 3CLFL 3MJ8B 3G9AB 4RISL 1SYSB 1AR2A 1X5JA 3HS0A 1CE6A 2F58H 4HKBA 1YN7B 5FGBC 2OMBA 3B9AA 1LEKB 3CLFH 3PQYB 3CZFB 1OQOA 3TV3L 3THML 3NOIA 4RISH 5GHWL 2FL5A 3SKNA 2OQJA 2XTJC 3TV3H 3THMH 5IHZA 5EZJA 3VJ6A 3RIAF 2OR7A 3MV7D 5GHWH 4AK1A 2OZ4L 3MRHA 1S3KL 1KJMA 1T66C 4CADB 3ZE0F 4EXPX 4X6CE 4K8RL 4XHJD 4NZDA 1KULA 3WS6C 3QUKB 3E3QC 2OZ4H 3DLQR 1ZANL 1S3KH 4G8GD 3FFDB 2F54A 4K8RH 4YZFE 1OB1A 1G9EA 1CL7H 4U1MA 3W39A 3PDDA 1L4IA 1ZANH 3KVQA 4NQEA 5T3XL 4Y5YC 5F6HI 4KTDL 4P48A 2VN4A 1FZMA 3P73A 4OZFG 4QLRA 3HFML 3WIIL 5DVNA 4H5SB 5D5MA 3O8XA 3DX6B 1T5WB 4KTDH 5DQ9B 1OTUC 3O45A 1NCDL 3HFMH 3WLBB 3WIIH 1W0VA 1Q0XL 1F3JB 1AO7D 3IDGA 1Z9SA 5DJDA 1NCDH 4F7MA 1Q0XH 2P1YA 2EEDA 1A6ZB 5T1KD 5B8CC 1XCQB 3L7EB 3DMMB 5LGHH 3L3GA 1OAQL 3ES6A 1S7UB 2EH7L 1JZ6A 1BWWA 5D96C 4OKVB 4Y19A 5DMIL 3K4AA 5IJKA 4M3JA 2EKJA 1OAQH 1L0QA 1OTTD 4PJHF 4PRPA 5GS3A 3CMOH 2EH7H 3TIEB 4W6XB 5DMIH 1J12A 3QWRD 4LLYB 4WFEE 1EFQA 4YNYB 5DZOA 3CC5A 3I6GA 2JJWA 1Q9LB 3IFOA 5DJ8B 1J8HA 2ITDA 2ORBL 2VN7A 1FL3A 4CN6A 1NCAL 4QTIL 4GH7B 3WE6A 2ORBH 5IG7A 2X4NB 5I75C 1X6LA 4K71B 1GSMA 4PJ5A 5D2NB 1ZGLB 3LN4A 4P2OA 3QCUH 5MI0B 5C8JA 1NCAH 1IAMA 4F2MB 3SJVB 1H5BA 5DRWB 3HZVA 4NFDA 1MWAB 5KAQG 1ZVHA 4TNVF 4TQEL 4LNRA 4ZO9A 3OTTA 3DVNA 4NQUA 5GPRA 3TCLB 1H8SA 3VXSD 4AH2A 4UV4H 2AI0L 2GITA 4I3GA 1G7HA 1NUGA 2O93L 3OKDA 3H42L 2F8OA 3HA0A 5CSZB 1IT9L 1CT8A 2AI0H 1K4DA 5ESQA 2V5MA 2WBJB 3O0RL 2CRZA 1BX2B 4CMMA 2DQJL 2PTTA 3H42H 4D9LL 3JV4A 4N0UB 4PRDB 1IT9H 1DCLA 2OSLB 5HHNA 4APQC 4IDLA 5J12B 4KJYA 4WFFE 5FKPA 5DHYA 1KTLB 3G04A 5GZND 5CJBA 4O9HL 4PJGF 3O0RH 4PIRF 2DWEA 2DQJH 3HI1B 4D9LH 5BCAA 5IJVB 2X09A 4WUKL 5DHVH 4O9HH 5EZLB 1MY5A 1YN6B 3DRQB 4ZXBC 3DTXA 3MUJA 1VKXB 4WUKH 1NLBL 3V0WL 5KW9L 4J1UA 2A6IA 1Q0YL 2X1WL 4R2GC 1NLBH 5E4IA 2X4PA 5DDHA 5KW9H 1P4IL 3QXAA 32C2A 3MJ7B 3SDAB 1S78C 3UTZB 1Q0YH 1HILA 3AY4C 3OKEB 4GUPA 4XH2A 1U8PA 1XF2B 1P4IH 3P9MB 3NAAL 2DL9A 2H8PB 4XCYB 2EH8L 5CJOL 3RVTC 5HD8C 1BJMA 3KAAA 3ZTJG 3N1MC 3NAAH 1HN1A 1W8OA 5D9SA 1F45A 5CJOH 3D0VA 4U1SB 4EI5D 1TITA 4DEPB 5I6XB 3UTTE 4HIJA 3FB6A 1UYWL 3TYFB 4DOHE 4ODXA 2ICWB 4LRIA 4LP4A 5DD1L 4YO0A 5HY9A 5C09E 5D6CB 5F7WC 3HUJB 5T1LA 1UYWH 4D94A 2GJJA 3I2CL 4C4KO 2PTVA 4DUWA 1AGDA 2DI8A 1C7TA 5DD1H 4XZUB 3BEVB 4GRWE 5IF0B 1U8JB 2J5LB 3SO5A 3WKML 3PL6B 3I2CH 4X7DC 2RIKA 4M7JL 4YHPA 2GJ6B 2QR0B 2VLKB 2NW3B 2F8VA 2XT1B 3WKMH 5HDBE 4WHTB 5E95B 4BUGA 1AQDA 3TH4T 2MQCA 3E8UL 2XZCL 4M7JH 3VXUA 5KSBA 4PRIA 3CSBA 4KJWD 2NXZB 3IJHB 1MREL 4LSQL 2YD5A 1JPGA 3E8UH 5EG6C 4NBZB 1U58A 2R2EB 4BSWA 3CU1A 1SEQL 1I1RA 4OZFB 3TPUA 1MREH 4KDVA 4LSQH 1MCPL 1YEHL 1UJ3B 3RNQB 1UEMA 3EJJX 3M07A 4NQSB 4Z7OE 1SEQH 4MZ2A 4DFIA 4JVUA 1MCPH 1OHQA 1UWXK 1YEHH 4Z77B 4UU9A 5KSAD 3NPSC 1XCTB 1XEDA 4WDIB 4QYOA 2X4TB 1MSPA 1T1WB 3RL1A 4CU6A 2PW1A 3D2UA 1PKQE 4OJFL 3FFCD 1AQKL 3IXAB 4NO5B 3NIFE 1YEJL 4FZ8L 4XBGB 4POZD 1JRHI 2PO6D 3VXRE 1ZLWH 1AQKH 2ARJB 4XB7A 2Z4QA 4FZ8H 3H7LA 2V9QA 5CSGA 1BFVL 1GOGA 1WIPA 5EOTA 3U4EB 5KANI 2QQKL 1BFVH 4X7CC 3RWIA 3BZEB 5GGTA 1PKOA 1FG2B 2EC9T 2QQKH 2I9LA 3VXQA 1ORSA 3QEQD 1UEYA 3MRPB 3OKMA 1A1NA 4LCWD 1BAFL 2GFBB 2YD6A 3NZ8B 1NDGB 2G60L 3MLTA 4KHXL 1IAIL 2FEEI 3W0WA 3W5NA 1D5ZA 1KSRA 1T04A 3KLAB 2B2XL 1PX3A 5DQJA 1BAFH 4P5MA 5LXGL 2G60H 2B4CL 2DLEA 1IAIH 4KHXH 3HC4L 5K59F 4MNQE 2B2XH 3BUYA 4AENA 3F7RA 3L3HA 4WJ5B 1WVZA 4LRNL 1JYWA 1N6QL 5LXGH 2F8XC 3O4OB 2B4CH 4PV9B 1PEWA 3HC4H 1FC1A 2OX5A 5GSVB 2HMID 5ICXA 3MRDA 1YA5A 3T09A 2FJHA 4U49A 1JWUA 3RKDD 4X83A 4R4ND 4LRNH 1X5ZA 3MNZA 1N6QH 5GIRB 2YMXL 1EFXD 4HT1H 3PJSA 3T3MF 4G9FA 1QO3A 3U4AA 2YMXH 1J87A 1FZJA 4JQVC 1UG9A 2I9TA 1MCOL 1OSZB 2P5EB 4M1CD 1HXYA 1PZ5A 5MEQA 2ZSVA 1ZLUK 1GXEA 2Z8WC 3SOBL 2R2HB 2HJLB 5ITFB 2XICA 2UY6A 1MCOH 4WGVB 1JGVL 4OKDA 1N0LA 1BVLB 3ULSB 3SOBH 4Z7UF 4O00A 5FCUL 1CYGA 4KKBC 1I75A 3ARGA 2C3GA 3GSQB 3OB0K 4F15B 4OZGE 1JGVH 3H9HB 5KSVB 4XBPB 4YC2C 6FABL 3WS3A 5FCUH 5HGHB 1KLUB 4RZCA 3EYQD 1FDLL 1T1XA 1A7NL 2EE9A 3TN0C 4AYFA 6FABH 4OFDA 3SCMB 4RBPK 2V2XB 1K8IB 1QR4A 4KKLC 4LSVL 4LVNC 1FDLH 4HKZA 4ELKB 5C2UB 1A7NH 5E8PA 3BZ4B 4LKXA 4NO0B 2XN9E 3MYJB 2BNUB 1I7RA 2GUOA 3QXVA 3ARDA 1A9BB 2BVPA 4HWZA 5E24E 3LKOB 2B39A 3ZT6A 2CKNA 3T8XA 5IWLC 5DK3A 5JMRA 5I1KL 4JDZB 5HVFB 1V3JA 3PHOA 2XWTB 1T5XA 3R8BB 3WHE0 5EOCJ 4KV5E 4G8IA 3RVXD 3QULA 3ZYOA 5DUBA 2P8LA 5SWQA 1EO5A 2O5YL 5I1KH 5TE6L 1CXHA 1I8MA 3N85L 1B0GA 5HVHC 4TYUA 5HDQL 1P9MA 1IC1A 4KDTA 5B22A 1PJ9A 2O5YH 4MD4B 1B9ZA 5TE6H 2ID5A 3N85H 1GIGL 4KVCH 4YIQB 1KIQB 5B39G 5HDQH 1U3HD 2VLRB 3D39A 1NGZA 2OJEA 2IEPA 5F7NC 1DVFC 4I18B 3T2PA 5LGJA 4JLRA 3V5DA 1BZ9A 5DJZB 1DUZA 2V2WA 2V7NB 5D2LE 4S0SD 2E27L 4M6NL 1W8NA 5JIHA 3D25A 5HYJA 4GFTB 5CILL 1RIHL 3RPKA 2E9BA 1KB9J 1EO8L 3RGVA 4XWGL 2E27H 2PXYB 2CMRL 3KDMA 1CDHA 1MJ8L 4LDLB 4M6NH 4P4RB 1ZLVK 1O5DT 5CILH 3QI9C 1CG9A 1RIHH 5TGBA 4LSUL 1WWAX 4TSBL 1EO8H 3MJ8A 4XWGH 1Q8MA 1SYSA 2CMRH 1MJ8H 5HSFA 4MGXA 1YN7A 2FIKB 1LEKA 4WW2F 4HCRL 4LSUH 3VDBA 3PQYA 4TSBH 3CZFA 4FQLL 1VGKB 1OT2A 5AZEL 1KOAA 4NC1C 5I2IB 2AK4D 3OAYK 4HCRH 1NBQA 4FQLH 4MHHG 5AZEH 1MVFA 3O6FC 3Q6FB 4PGBB 1I4FB 3VGEA 2BC4B 3WFEL 4CADA 3QDMB 2HVKB 3LHPL 1FAKT 2NR6D 3QUKA 3WFBL 2YS4A 4OT1L 2X4SB 1WIUA 3FFDA 5GGTL 3WFEH 3LHPH 5GGQL 5EU3B 3WFBH 4OT1H 4PJEB 4ZAKD 4NNPL 5GGTH 5EO1B 1X9QA 5T33L 3D85B 3KS0H 4NQCE 4KU1A 4Y4FD 4WTWA 5GGQH 4H5SA 1QA9B 1YJDL 1OQXA 3DX6A 1T5WA 4NNPH 3BIKB 5DQ9A 4OI7A 3MZTA 5T33H 4ZUSB 3WLBA 4P5KB 1F3JA 1YJDH 2MNUA 3MR9B 5GGRB 3WXVL 5F9AC 4O2FB 3PP3K 2JKXA 1BHGA 4XAKD 1A6ZA 5C0AE 3TO4D 1XCQA 3L7EA 4XPBL 4U1IB 3DMMA 1NGQL 1GOFA 1X5LA 4PR5B 1S7UA 1JHKL 3AC0A 2NQCA 4OKVA 3TVMD 3C87A 1NGQH 3PHSA 2UV3A 4MB4A 4RMRA 4WTZA 2OTWB 2VITB 4FFVC 4ETQB 1JHKH 3TIEA 3MBED 5E03A 4CVZB 3LKNB 3CH8A 4LLYA 3NIDF 4YNYA 4KK6C 4WEBL 1Q9LA 1LGVA 3KYMB 4PJCB 4Y2DC 5DJ8A 3I9GL 1L6XA 5CGYC 1KJ2L 4LLDB 4X8JB 4WEBH 4LEXH 1QYGL 3IAGC 4YHNB 5F1SA 4MJ6B 1MCHA 3GJFB 2X4NA 1LE9B 1KJ2H 4WRLA 4WWID 4NKMB 5D2NA 1ZGLA 3X12B 5A2FA 4N0FB 4F2MA 4HEME 2H1PL 2UUDK 3ULUD 3SJVA 4WNQB 5DRWA 5JPNB 1CXFA 5DR5L 1MWAA 3GJFK 4Z7WF 4PJDE 4NQDE 4U1GC 2H1PH 4WUUD 3TCLA 5FGSA 3SE9L 5CJ5A 4AY0A 4JY6B 1R3HB 4L4VE 3VFWB 3ARZA 3QUXC 4JHZA 1WBYB 1IEAB 1OP3H 3SGDH 3MUZ1 3EBAA 5CSZA 2MJWA 1GHFL 3SE9H 2YHGA 2W60B 3EFDL 3AROA 4D2NA 3O11B 1WEJL 2WBJA 5E6ZA 3S3SA 3EJYD 1BX2A 1G9MC 2BXYA 4N0UA 4PRDA 1GHFH 1GGIL 2OSLA 1J0JA 3EFDH 3VGHA 1KTLA 4R9HA 3TZVD 1WEJH 4FN0A 5E9DE 4QOKB 2BY3A 3HI1A 3RIAK 5IJVA 1GGIH 4G8FB 4JFED 3PE9A 5T1DL 4X4MA 5T1MB 2ADJB 3MGOB 5EZLA 1YN6A 3DRQA 2FHBA 3OKOB 1VKXA 4PJ9C 2AXFB 2HH0L 5T1DH 4E5XB 1MH5B 5EUKB 5B39B 4JG0L 1CFBA 2WBKA 3LS5L 4JDVB 2Z31B 5IB1B 2HH0H 4U0RC 1JJUA 1S7SB 3MJ7A 2OTUB 4JG0H 3RTQC 3SDAA 3UTZA 5ID1B 1RQ5A 3OKEA 3VH8G 3LS5H 3VFMB 1S9YB 2NW2B 2A0LC 4HV8B 4P23C 5JQHC 1XF2A 3W9DB 3P9MA 5LAXB 2H8PA 3AFLA 2V5TA 4XCYA 4JDTL 4EKXA 2EDKA 1SM3L 4JEGB 4JANB 4YZFF 3A0OA 1MF2L 1WTGT 4JDTH 3ARFD 3TWCL 4PJHB 4U1SA 3CFJB 1MI5D 1SM3H 3EDDA 5DC4B 2YRPA 2BDNL 4JE4B 1MF2H 4FG6D 3TYFA 2XKNB 3TWCH 4FS0A 1CGTA 1RZJL 2ICWA 3K46A 1V7ML 1BVZA 5D6CA 5BRZE 3HUJA 4OZ4B 2XI9A 2VNCA 4YWGL 4V1DB 1RZJH 1Y18B 1F4YL 4XZUA 2JJTA 1RUAL 3BEVA 1V7MH 5IF0A 1U9KA 1U8JA 3HC0B 4P3WA 3PL6A 3TBSB 2FEDD 4YWGH 3C6LD 5AEAA 1F4YH 1TVBB 5D93C 1LNUB 1RUAH 2GJ6A 2QR0A 4ZNEA 1MAML 2VLKA 3FQNB 2NW3A 3MMEB 4WHTA 2Z8RA 3HKFA 5D7JB 2CO7B 4JRXB 4P2QD 1JF5A 1URLA 5TE7H 3IJHA 4TULL 4WI6A 1D7FA 2DL2A 1P4LB 1N8ZB 2R2EA 4O2EB 3TJEL 5BVJB 4OZFA 1U3YA 2PUQT 2VDPL 1ADQA 4TULH 5GS0C 5D1XD 1UJ3A 4JM2F 4YHIB 5HGAB 3RNQA 4NQSA 4TNVK 3KLSA 5T3ZD 3TJEH 3KLHD 1CK0L 3NMEA 5E1HB 4D9QE 3VFVB 2VDPH 1MCEA 4Z77A 2QLVB 4MJID 1RUKH 5T5NG 3HZMB 1XCTA 4WDIA 5F7YC 1CK0H 2X4TA 1HWHB 3BP5B 4I4WB 1T1WA 3VA2C 3QG6B 2RBLA 1OD9A 3C8KB 4ZO7A 4A2LA 1KEGL 3DO7B 5BQ7B 3IXAA 4NO5A 1EAPB 4MQXC 3BGFC 1T89A 1IAIM 2BNQD 2FX8L 4XBGA 1NFDE 2AJSL 2ARJA 2FX8H 3E1F1 3EDJA 4X6BB 2AJSH 3QAZB 5FO8B 4UI2A 5GGSB 4PYGA 3PWPD 3NGBC 3MA7B 5DTFB 5CFHA 4RMQA 3S3JA 2NY1B 3U4EA 1DEDA 4MXQC 3OSKA 3KPLB 5HHME 1XFPA 3WJJC 3BZEA 5D1QC 1MCWW 3D6GA 3BI9X 1RY7B 4GBXD 1FG2A 2EDFA 3QIWC 1IGYB 4UNTA 3MRPA 2ZUWA 4CN1A 1PAMA 4HIEB 2GFBA 3FT2B 3NZ8A 1NDGA 3GBLA 5EN2B 5F88B 3PDGA 1VDGA 3KLAA 2DKSA 4PS4L 5E5UB 1B4RA 2E5EA 2V7HB 3NACL 2EO9A 4OAWB 2XTJB 1VSCA 1REIA 4NNXB 3HMWL 4WJ5A 4PS4H 3V79C 2Z35B 2BRRL 3NACH 3P9WB 4PV9A 1SQ2N 5GSVA 4OCLC 4Y5VB 3HMWH 1TNMA 5EBMB 4CKVX 3S36L 2BRRH 3AXLB 2HKFL 5GIRA 3UCRA 5FUZL 2JJVA 4IRJD 3NFPB 4K94C 4L3ED 5K9QG 4Y4KD 1NUFA 3KJ4C 5AG8A 3S36H 2HKFH 2QADB 4QCIB 3TM6A 5FUZH 3BUTA 1OSZA 2P5EA 1JCKA 3RDTD 1VFBB 5HDOA 2R2HA 3VGBA 2XWBB 2HJLA 3QFJE 1Z9LA 5ITFA 2WZPD 1S8DB 1BVLA 3ULSA 3QIBD 4RFOL 5MENB 3GSQA 2JIXD 3IDIB 3H9HA 5KSVA 4HMDA 4XBPA 2R9HC 3NN8B 4RFOH 3VH8B 5HGHA 5B8CB 1KLUA 4YGAB 5FB8B 2VAJA 5HDBF 4IBLT 5IBLC 1FV1B 1I9JL 3SCMA 1WISA 2V2XA 4EI6B 1K8IA 2K7QA 5CP7B 3O9WC 4LCCC 4LFHG 4ELKA 5DJ6B 5JOEA 3BZ4A 3S8WA 1A6UL 2NY3C 1I9JH 4NO0A 3HNTL 5DD0L 3MYJA 4LLMB 2BNUA 5FM5O 5IVNA 1JV5B 3EZ8A 1SJVA 4GMSL 1F4HA 1A9BA 5AZ2L 3IXTB 3LKOA 1I85A 3MLZL 2F9BT 1A6UH 1NKOA 3HNTH 5DD0H 1FC2D 2ZPKL 4KRNA 2XFXB 3QUZD 4MS8C 3C60D 4JDZA 2W0FB 4GMSH 5AZ2H 2JK5B 4Z7OF 4L9DA 3MLZH 3H8NA 2XWTA 3UJIL 3VWJB 2LU3A 3MRCB 4MB5A 3TA3C 1EZVX 2ZPKH 2RJMA 3ZMRA 2LU7A 5I75B 2XV6B 1F4WL 1JWSB 1WITA 4FQXC 5BS0D 4GRLD 5D70L 3ULUL 4U1JB 4MD4A 1KIRB 4K7PL 1FYTD 1F4WH 4YIQA 1KIQA 1FG9C 5D70H 5INDB 2VLRA 4M7ZC 1KCVL 4K9EL 4AIZB 1S7RB 2HVJB 1TZHB 1RUML 4ODSL 4HH8A 1J0KA 2APVA 3QQ9D 4ZNCD 4I18A 5D7IE 3MGTB 3WDJA 1KCVH 2PNDA 4K9EH 4XP6L 3G6JE 1BQUA 4HIIB 1RUMH 4ODSH 5DJZA 2V7NA 1UWXH 3MV7E 4IJ3C 3IETB 3CPLB 4LPXA 4OFKA 5A2IH 1CXEA 4L1DA 2VZ1A 4OZFH 5L2KE 5IB2B 2EZ0C 3INUL 3W11D 2HJKB 2X89D 1LP9E 2XKUA 2PXYA 4G8GE 4P4RA 4RWYL 2Y36L 3INUH 3MOAL 3LB6C 3J7HA 4P2YA 2J3SA 2KBGA 2VL4A 3BN9C 2BY2A 4J4PC 3F7PC 4RWYH 4F9PC 1UB5A 3A6CL 4ESKA 2Y36H 3MOAH 2FIKA 2E7MA 1VGKA 4UOJA 2EYRB 5DMYA 5GZOD 5EPMB 5I2IA 3A6CH 4RA0C 1BIHA 1P7HL 4R2GB 2K9UA 1AO7E 1H15B 3IKCB 3VDAA 4PGZA 3I6LD 3Q6FA 4PGBA 1I4FA 2GEEA 4FXKB 1IM9B 2YPLB 1DBKL 2BC4A 3QDMA 1JMXA 2HVKA 4U33A 2YBRB 1QRND 1IE5A 2X4SA 5GS1C 5IVXE 4P4KD 4NBYB 3DETC 5EU3A 2X10A 5TF1L 3VD5A 4F33B 4PJEA 5MEPB 5EO1A 5JIIA 5KTEL 3D85A 4I0PB 2PCPB 5FYJD 1ITBB 5TF1H 1PFCA 1QA9A 4O58L 4I2XE 3MRKB 2IPTL 2DQGL 5E8DH 3BIKA 5KTEH 3H6JA 4HAGA 5HHOB 4ZUSA 5DMJB 4H26B 5C0CB 4GG6E 4W70A 2A74B 3MR9A 3QR2A 4O58H 1MFNA 5GGRA 4TTGA 2IPTH 2DQGH 4LP5A 5F7KC 4OZGF 4O2FA 2R1WB 4Q7DA 4CAGA 5HI5C 1CN4A 5FF6B 5IHLB 3LIZH 4RMUA 1AIFB 1E28B 1QNZL 3BPOC 4U1IA 3T0DA 4PR5A 5H94B 1K2DB 3BYYA 2IWGA 5E6YA 1QNZH 4KRPC 5HI4C 1ZLUH 2J4WL 3C8DA 3HPJB 4KROC 5DZNA 5BJTB 4OZIF 5F3BB 1DUYB 2OTWA 2PYED 2VITA 4ETQA 3IU3B 3CVIL 1ZSDB 3VXSE 1GOHA 4HWEH 4CVZA 1A4KB 3LKNA 3KG5A 2J4WH 4Q2ZB 1NEZG 3KPSE 2ZUVA 1CFQB 3KYMA 4OF6A 4PJCA 3CVIH 1JWMB 1RU9L 2DLGA 1D5IL 1DJSA 4LLDA 4X8JA 3LQAL 2F53B 3H2WA 4KV5F 1ZAGA 4YHNA 4MJ6A 1OGAB 3GJFA 2IQAB 1RU9H 2HT4D 1LE9A 1D5IH 1FAIL 3QQ4B 4JB9L 4NKMA 3X12A 4U6XB 2D0FA 3DX9B 3LQAH 5HYSG 5I71C 5JXED 4N0FA 4YHML 5JW4R 5C70A 1ZWIB 2HTKC 5L8JB 4WNQA 5DWUL 2XOTA 4ZPTB 4JB9H 1J8KA 4GS7C 5JPNA 4S2SB 1YPZE 3HPLB 4YHMH 1VHPA 4OCXL 4WW2B 4TVPD 5TDNB 5DWUH 5EZIL 1LILA 5T1LD 4JY6A 4ZFGL 3RL2B 4U31A 3MRNB 1VADB 4RDQG 4OCXH 5E2TL 1MCQA 1R3HA 3ZTJH 3EHBD 3S97C 3VFWA 3O3UN 5DQDL 1WBYA 1IEAA 5EZIH 4LIQL 2W60A 3N0PB 4YR6B 4ZFGH 4DUVA 3O11A 5E2TH 2ITCB 4NN6C 3E6FB 4WY7L 4LIQH 5FUCC 4WO4B 5F93C 5GRVK 2FATL 4QOKA 2C1OB 4WY7H 3BOVA 4G8FA 5GGUB 1JFQL 4OLWL 1T6WA 5T1MA 2ADJA 3GMOB 2FATH 3MGOA 1ZVYA 4NOBA 3IAPA 3OKOA 2AXFA 1NBZB 4E5XA 4MAYD 4NZRL 1JFQH 1G0YR 1MH5A 5FYJU 4WI3A 2Y6SD 5EUKA 5B39A 4CNIB 4BK5A 4LVEA 1OL0A 5DJ0B 3VFTB 4JDVA 3GSVB 2Z31A 5IB1A 4WGWB 1T2QL 4NZRH 1S7SA 1DE4B 1I8LC 2OTUA 3ARTA 3SE3A 5ID1A 3I6KB 1T7ZA 3LSOB 3VFMA 1S9YA 2NW2A 1MPAL 3GIZL 3N1GC 4HV8A 1T2QH 3VMPA 5C92A 1YEKH 5EU7E 3W9DA 4OGYL 4UOW0 5LAXA 1HKLL 1MCKA 3X13A 2H6PB 1JP5A 3OX8B 1MPAH 3GIZH 3K4DA 4JANA 5FM8A 3BJ91 4OGYH 5HHPB 3RAJH 1O7SA 5CMAB 1HKLH 3TEUA 3MBXL 1PY9A 1CFSB 3SDDD 2WM0A 4PJHA 1CD9B 4Z7QE 1QLEL 1KENL 3CFJA 4NJAL 4XTRC 1TNNA 1NC4B 3MREB 1MLBB 7FABL 2XKNA 3MBXH 2A6KB 3OAYH 2DJUA 4KMLB 4M62H 5IROA 5CKAA 3GMLB 4POYA 1QLEH 1KENH 1VFMA 3JV5A 4NJAH 3CSYB 4OZ4A 1NMCB 7FABH 4LGSB 2W38A 4V1DA 1EJ6A 1Y18A 3LQMA 4PUBL 2CKBB 3QDGB 1IZJA 2VZUA 4FQ2L 3HC0A 3DNKA 3TBSA 1NGPL 1E4XL 1T66D 1TVBA 4PUBH 1DBBL 1B0RB 1G7PB 1LNUA 4FQ2H 5ANMB 3FQNA 1KLGB 2GQHA 1H3PL 2QBWA 3MMEA 4NP4L 1NGPH 3HG1D 4KI5F 1TCMA 1E4XH 3TN0B 2UVEA 1DBBH 4P46B 5ADPL 3NA9L 4OV6F 2Z91B 5D7JA 4DK6A 4Z7WB 4JRXA 4LQ1A 3WNKA 1H3PH 1QKZL 4U3XA 4NP4H 5IMOB 2MFNA 5KSUB 5E99L 1DQTA 4FTVD 5I19L 4XX1G 1F8TL 5ADPH 1A2YB 3NA9H 1P4LA 1N8ZA 4O2EA 4GT7A 1QKZH 5BVJA 2BOBB 1OTUD 3ZE2F 5I19H 3QRFM 1F8TH 4YHIA 5HGAA 1LO2L 2Y5EA 4KJQD 2KL6A 2Y72A 4X9GA 3VFVA 1G6RL 3EOYG 2WNGA 1ZHBB 3DYOA 3TBTB 1LO2H 1CDUA 3HZMA 1WT5A 4G9FD 4IOIB 5C3LD 1E4KA 4OV5B 3U30C 3BP5A 2O5ZH 4I4WA 3PXJA 3QG6A 1G6RH 1W0YT 3WN5C 3C8KA 3QEGL 2EDWA 4LSTL 5KS9E 1I3RB 2DI7A 5C08B 3DVIA 4OD1H 4Q6YA 5F1KC 3DO7A 1T83C 5BQ7A 1EAPA 2X4RB 1OW0A 3QEGH 4LSTH 2I24N 5EB9A 3CLEL 3WJLC 1DVFB 1K3IA 4FQHB 2Q7YB 3CLEH 3ALPA 4X6BA 5FXCH 5FO8A 3ARRA 1SMAA 5GGSA 1YQ2A 3CX5J 4QRRE 5EIIB 5KJRL 3MA7A 4X6CB 5DTFA 3T3PF 3KPLA 1CLYL 2A9NL 2AV7B 3SE4C 1G7QB 3RUGE 5KJRH 1KCSL 3S37L 1UM5L 1IGYA 4N0YL 1CLYH 2A9NH 4PPTA 4R6UA 3RY6A 5JQ6L 1KCSH 3QWOB 3O3AB 4HIEA 4MB3A 3S37H 3FT2A 5E2UH 3ROLB 1UM5H 1YMMD 4QHKI 5FGBA 4WI4A 4LPVA 3T4AB 4N0YH 3H9SD 5EN2A 5F88A 4HUMB 5JQ6H 4ZOEA 3N50A 4GW1B 2V7HA 3GSUB 2X40A 3QHZL 2SEBB 4OAWA 1V7NL 3DJ9A 5J9PB 4NNXA 4JFQB 2Z35A 5F8RC 3O6FB 1LK3L 1NCBL 4PRHE 4E9LA 2AERT 4Y5VA 1V7NH 4YK4C 2P49B 5EBMA 4APQD 3ZDXE 4POUB 3AXLA 1ZA3B 3ABZA 1LK3H 1NCBH 3KXFE 3NFPA 3REWB 3QDJD 5ILTL 1A7OL 1L7IL 3MCKB 5EU6B 3DUHA 4QCIA 2H32B 3RX5A 3WXWL 2CR3A 4HC1A 1CGWA 3JWDL 2DB8A 4ZXBD 5F3HB 5L8KB 2ATKB 4FQIL 1VFBA 3K8KA 5ILTH 1A7OH 1L7IH 4HIXL 1U8IB 2D7QA 2XWBA 3WXWH 1S8DA 5TDPB 3JWDH 2C3WA 2J8HA 2YKLL 2YR3A 3BMVA 4JM2B 4HIXH 4TUKL 2QJDA 4ENED 4LLAA 2VWEC 1MCDA 4JG1L 5MENA 1S78D 1IZKA 4JQXA 3IDIA 2YKLH 2P5WB 4M43L 2DQHL 1N2RB 3NN8A 4TUKH 4DAGL 5JHDD 2YD7A 4Z18A 2E7BA 3VH8A 5B8CA 2P48B 4NN7C 1XR9B 4JG1H 4NM4L 5DA0B 5DD5H 4JPVL 5GRXG 5FB8A 4IMLB 3OF6D 4FQCH 4JZNB 4M43H 4Y7MA 2DQHH 1FV1A 4D0CB 4DAGH 4XRCB 4EI6A 4HAFA 4NM4H 4JPVH 5CP7A 2AS5M 5DJ6A 4LLMA 2YA0A 4J3OC 1JV5A 3LKRB 1OD7A 1A3LL 3IXTA 3K2MC 4RGOL 2XFXA 3PWNB 4HHAB 2W0FA 1A3LH 2JK5A 3D69B 3P4NB 4RMSA 5J89A 4E41B 4RGOH 3VWJA 3MRCA 4DKEL 4LHUG 4JGMA 4ZMAT 5DVMA 1JWSA 2R15A 5F97E 1RJCA 1W72B 4U1JA 1UWEL 3AAZB 3I75B 3GK8L 4DVBB 1KIRA 4JO1L 4UMGA 1FNGB 4NN5B 3VRLF 4TPRH 4KQ4H 5INDA 4Y1AD 1YEIL 4XNUL 1UWEH 3QA3B 3GK8H 4AIZA 1NFDF 4JO1H 1S7RA 2HVJA 3UO1L 1TZHA 4Q9CA 2CJUL 3IS0X 3V7AE 1S9XB 4BSVB 1MCSA 1Y6KR 2AK4E 2NY4B 1YEIH 3MGTA 4XNUH 1YNKL 3VFNB 1XAUA 3UO1H 3QISA 4WHYG 4HIIA 1U36A 2CJUH 3P2TA 4D8PB 4M7KL 3IETA 3CPLA 3U9UB 1I7TB 5B21A 1YNKH 1Q9OB 1QFUL 5F1OB 5IB2A 1P7QD 1UKQA 2HJKA 5DJCB 4NQTA 4M7KH 4KZEL 1AXTL 1QFUH 1N0XH 5SX4I 1OTTC 1KEML 1SY6A 4Y4HD 4DJMA 4X9FA 1KT2B 2PW2B 1CWVA 1RHHB 3S7GA 4KZEH 5IM7B 3VD7A 1AXTH 3V4VL 4KXZH 2BVUA 1KEMH 4JKPL 1V3MA 4HPYL 2EYRA 5C09B 5EPMA 4JJHA 4NWTL 4WWKB 5F7UA 1T7VA 4PBWD 3ZYJA 2DM4A 4JKPH 4OLYL 5FDYA 1H15A 3IKCA 4HPYH 5FO7B 4X4YB 3MXVL 3P0GB 4U3HA 2E7LA 4NWTH 4JQIL 4FXKA 1IM9A 1JHLL 1MCBA 2YPLA 4HK0B 5IMKB 4OLYH 1QFHA 1ZEAL 3MXVH 3PF2A 2YBRA 4JQIH 4C56D 1JHLH 3HE7B 3C2SA 4IIQB 1LEIB 3DBXB 3BESR 1ZEAH 3CJJA 3DXAD 4JFYB 3L5WB 4F33A 5MEPA 1HHGB 4I0PA 2ENSA 2PCPA 3SO3B 4MJ5B 1MCJA 4Z7NE 5D5MF 4H1LG 3WLWC 3MRKA 1HQ4B 1WTLA 2APTA 4CW1B 1CZ8L 5HHOA 5IQ7L 1RUPL 4H26A 1U8OB 5C0CA 4JY5L 2A74A 4MDJB 2CRYA 1T03L 2R1WA 1CZ8H 5IQ7H 1RUPH 5FF6A 4PB0L 5GZNC 4YHLL 5C0RL 2OJZL 1C5DB 4JY5H 1ND0B 5C07D 1AIFA 1E28A 4IMKC 1T03H 4QNPE 5GRWA 5H94A 1K2DA 4PB0H 4YHLH 3ULUE 1PKQB 5C0RH 1HSBB 3NCBB 5E6ID 5TH2B 2XG4A 3HPJA 5BJTA 1EGJA 5F3BA 1DUYA 3IU3A 4P2RD 3VXRB 1ZSDA 4WUUE 3QO1B 4RFNC 2EC9U 3MRQB 1A4KA 1FBIL 4Q2ZA 3BQUC 1PBYA 1EHAA 1CFQA 1E0OB 4Z5RB 2YN3A 1JWMA 3MLSL 1XGRB 2K1MA 5DF0A 2VDKL 3BWAB 5ACMA 1N26A 2F53A 1BQLL 2VDOL 4HXAL 2NXYD 4YFEA 1OGAA 2IQAA 3MLSH 1KJ3L 4M7LT 2VDKH 3QQ4A 4LCIL 3HMXA 2J2ZA 4LU5L 4U6XA 3DX9A 1BQLH 1E6JL 4YDLB 2VDOH 4HXAH 1ZWIA 5B4MD 2F15A 1KJ3H 4EI5C 3TBWB 5IB3B 3WO4C 4LCIH 1XR8B 3FO1B 4ZPTA 3TIDB 4LU5H 5F1IB 4S2SA 1E6JH 3RVWC 3HPLA 1MFDL 4L4TD 4WW2A 4ORGB 4U05A 4PFEA 5TDNA 2BSTB 4UT9L 1X5AA 4ORZC 3B9DA 5D7IF 3RL2A 1MFDH 1VADA 3MRNA 4RFEB 4MNQB 1T0MB 4LCUB 4JFFD 4UT9H 3OJMB 4YR6A 3CSPA 5EU7C 2ITCA 4L5FL 3E6FA 4YAQB 3NGBB 4RGNE 3L3IB 4NRYB 4WO4A 4L5FH 5D1QB 2C1OA 1MIEH 2C4FT 4KK5C 3HB3C 5GGUA 4X99B 4J12A 3QIWB 3KPPB 3GMOA 1MI5E 3MODL 3O2WL 1L6ZA 1NBZA 2B20A 4CNIA 3MODH 2M2DA 3O2WH 1UCBL 5DJ0A 3VFTA 3GSVA 5E2JA 1U2CA 1IC4L 3D1MC 1DE4A 1FFRA 4OZGB 3I6KA 3LSOA 5KSAC 1UCBH 3ESVF 2VABB 3LRSB 4DKAA 1IC4H 3T2OA 3GFUA 2H6PA 3B83A 3OX8A 4L8SC 2FYYB 2Y9RT 5LCVH 4RQQB 5HHPA 5CMAA 3QI9D 5J11C 2ZP0T 1CFSA 2YD2A 4WVRA 4P2QE 2WANA 4OZIB 3KJ4B 2R4RL 4POZC 2XN9B 1KUMA 2PO6C 1NC4A 4JQVA 3MREA 1MLBA 2CXKA 1SY6H 5LGKA 2A6KA 4AJ0A 1ZTXL 3GMLA 2R4RH 5HGGS 3CSYA 3BPLC 4O02L 4F9LA 3FL7A 1UQSB 4XP1L 3T65B 4GG6F 3KPMB 2G9HB 4K7PY 1I3GL 3T0EC 2CKBA 2E9JA 3QDGA 5T3ZE 2EICA 1WCBB 1EUUA 4O02H 2DLIA 5D72L 4LAJH 2EXWD 1I3GH 1K5NB 4MJIE 2CUMA 1B0RA 1D5BB 1G7PA 1JPFB 2R1YB 5ETUB 2XZQL 5ANMA 1KLGA 3FRUB 1JGDB 4KC3B 3TN0A 3O41B 4P46A 4BQ8A 4Z7WA 2Z91A 2XZQH 2QSVA 4L9LC 3PUCA 5IMOA 1M6OB 4IEFB 1NAML 4ZYKB 5KSUA 2BNQE 3ZDZE 1I9IL 1A2YA 4WFED 4QY8B 4F7PB 3ARBD 5B3JE 4X9BA 4X6EB 1NAMH 2BOBA 3LD8C 5D2LB 4H1LB 4KKCD 4NFBA 3C5ZB 5IWLA 3Q0HA 5HDLA 2CK2A 4YBLC 3PWPE 3RKDC 3NCEB 4R4NC 4YDKL 4OFYD 1Z5LB 1ZHBA 3TBTA 4IOIA 2E6JA 4OV5A 1BEYL 5CBAB 4YDKH 3OPZL 2ATPB 1M7DB 4MYWB 2N7BA 3QB7C 3LPGA 1I3RA 4DGIL 5C08A 2MHAB 4PREB 4YLQT 3MV11 1BEYH 2X4RA 3OPZH 1N3NB 1SMOA 4DGIH 2HP4A 1G0XA 5JW5B 2VISB 3TNMB 3WJJA 3QIUB 1DVFA 4FQHA 3MRGB 2Q7YA 4KK6D 5HTSA 3BWUC 4Y2DD 3OZ9L 4MLSA 2VYRE 4KRMB 5FGRA 4I9WD 5C3TA 3MTRA 2H9GB 4IJ3B 5EIIA 4X6CA 2XXMB 4MMZC 4M93C 3EYQC 3OZ9H 4C55A 2DAVA 2AV7A 1G7QA 1VFOA 4HF5L 4WI5A 2Q7NA 3UZEA 3L7FB 5INCB 4HK3N 4XCNB 4NO0D 4Q9QH 5BV7B 5IIEB 3QWOA 3O3AA 4HF5H 5IKCB 1NLDL 3ROLA 4Y16C 3T4AA 3KGRA 1E6OL 3VI4F 4XVTL 1NLDH 4GW1A 3GSUA 5GRVL 2SEBA 4GAFB 3OL2A 3QUXD 3QDHA 5J9PA 1E6OH 3V5HB 4JFQA 4TSCL 2JF1A 4XVTH 4HUWB 2AQ3A 3O6FA 5JPMB 5GXBB 3QUMB 4OZHF 5C0AB 3SDXE 4BFBD 1IKNC 5DRZB 5A3IC 1QBLL 3HHRB 1F4XL 2J8OA 5HPOA 4IHOB 1YQVL 4EDWL 4Y5XC 1ZA3A 3AM8C 3T0BA 1U3HC 4TTDD 1QBLH 3REWA 1YQVH 3MCKA 5EU6A 4EDWH 1ZGLP 2VXSL 2H32A 1LE5B 1I1AC 3FT4B 3UTTD 3ISWA 5F3HA 1Z9MA 2ATKA 2VO5A 4PJ9D 2OM5A 1U8IA 4KMTL 1LEGB 2VXSH 5FHBL 3NTCL 4ETYA 3ULVC 3GMRB 5TDPA 1CL7I 5CJ8A 1F42A 4FFZL 4KWUA 1MAKA 4KMTH 1U8LB 5FHBH 3NTCH 5JO5B 3RU8L 3RTQD 1RJZB 2Y7QB 4FFZH 3GMNB 2VDQL 2P5WA 4FZEL 4NO2B 2F54E 3CH1B 2A0LD 1N2RA 4ZUWB 4P23D 4QRPB 3CD4A 1XR9A 3WNNA 4YE4H 5JZ7C 3RU8H 3IF1B 2E7CA 4IMLA 1HI6B 3DYMA 2VDQH 4FZEH 4JZNA 4K3EL 4D0CA 2HT2D 3U0WL 1FYTE 2YXMA 4XRCA 5F8QC 4PJDB 3QXTA 4KRPB 4X7FC 2C26A 4IOFC 4ACPA 4ODHL 1KCLA 2ILLA 4K3EH 2CRIA 5FM5M 1QSZA 3U0WH 4ONFH 3LKRA 3T1WA 3KPNB 3QUYB 1H3GA 5E2WL 4L4VB 1RZKC 5TQ2L 2LQRA 4ODHH 1CICC 1BZ7B 4XNZC 4GAJL 4HEPG 4UNUA 4BSJA 5E2WH 3PWNA 4HHAA 4HK3J 4N9OB 4NQXB 1T7XA 2CKBL 3P4NA 3D69A 3QH3B 4IS6B 5TQ2H 4OF0A 4E41A 1C12B 3HE6D 3ESUF 2NR6C 1UXSB 4GAJH 3FHAA 1B2WL 1ITCA 5E9DB 2E9WA 5T3XH 2CKBH 2ICES 3NFNB 4YGVB 1D6EB 3K2UL 4R4BB 1W72A 3AAZA 4NDMB 3I75A 4YUEL 1B2WH 4DVBA 3VXMD 2XPGB 3OKYA 4H0GA 3Q6GL 1MUJB 3V7MA 1FNGA 1BF2A 2R29L 4GS7B 3K2UH 5I8OL 4NO3B 2BVTA 2EIZB 3QA3A 4YUEH 5CIPH 4HD9A 3EO1B 1J8HE 2EDJA 3U82B 1S9XA 3IAQA 3Q6GH 4BSVA 2R29H 3RWJB 1G0DA 4AIXA 2FZ3B 1ZT4B 2O61B 3T77B 3VFNA 2HA1A 3CX5K 4NRZB 4D8PA 1JZ5A 3I6LE 5GS0D 5C0BB 3U9UA 4N0RA 1I7TA 3FONB 1Q9OA 5FCSH 2IBZY 5IP4A 5DJCA 1QRNE 3CDCA 2AXGB 3TVMC 1XIWC 4JCMA 1DQLL 1I1CA 3BO8B 5DEFB 2B8OT 3QCTL 1KT2A 2PW2A 1RHHA 2VKWA 1HQRB 3N1QC 5IM7A 3MACL 4AZ8A 4XPAL 1DQLH 5FYJE 2BMKB 3QCTH 5BOZG 3FN3A 5C09A 5BRZB 3MACH 3B9KC 2R8SL 4WWKA 3OAUH 3B9VA 4XPAH 3VA6A 3GHBL 1T0PB 4XP9L 5FO7A 4X4YA 4YHYC 3S96B 4QXWA 1BBDL 2FO4B 2R8SH 5CLTA 4J3XA 1DQDL 4HK0A 4NCC2 3GHBH 5IMKA 2HFEB 4XP9H 2FECL 3ZDXF 1BBDH 1XGPB 4MXQD 3J8F7 1DQDH 3HE7A 4IIQA 1WWWX 1LEIA 3DBXA 3ZHLA 2A1WL 4JFYA 5GGRY 3L5WA 4PLJC 4M03A 4X6FB 2PYEE 1HHGA 4M8QB 1IGIL 4M7LL 2A1WH 3O4LB 4MJ5A 1JTTA 5CEZE 2OCFD 3SEPA 1HQ4A 2NX5B 4CW1A 2KH2B 4B41A 4M7LH 2E7HA 1U8OA 3EJYC 2DTSA 4ZQKB 1SJHB 5BVPL 3GI8L 2VLLB 2VZTA 4J3WA 4MDJA 3UZQA 3MFGB 5C6PB 3TCXA 1QFWM 4JFXB 5F9OL 1C5DA 3GI8H 5BVPH 1ND0A 1OLZA 4HUKB 2X05A 3P11L 3WIHA 1A7PL 1PKQA 3NCYP 5F9OH 5H2BB 1HSBA 4OD2B 4LBEB 4FFYL 4G6ML 5JOFB 4PJ7E 5TH2A 3P11H 1ULVA 1D5MB 1A7PH 2DF3A 3KLDA 4TVPE 1NFDB 3VXRA 4JVWA 4LDEB 3QO1A 4FFYH 5J1TC 1IKFL 3MRQA 1AHWC 1EEQA 1CVSC 2H32H 3TP4A 2VL5B 3V0VB 2FLRT 4Z5RA 1GGTA 4F57L 2H3NB 2HTLC 1XGRA 2NY0B 4XCEB 1IKFH 2VDML 3BWAA 2DM7A 4RGNC 4ZD3L 1AJ7L 4LAQL 4X4XB 4KPHL 5I1LB 5HHMB 3CFBB 4N8CL 4F57H 2VDMH 4DUXA 2R9HD 1H9VA 4JPIB 3LV3B 2VIRB 4ZD3H 1AJ7H 3OKNB 4PRIE 4BQBA 4LAQH 2HFFB 5KSBE 4AIOA 1NANH 4N8CH 1NFIB 3TBWA 5IB3A 3WN5B 1XR8A 3FO1A 1A6AB 5I73C 3TIDA 5F1IA 3TYGL 1YEDB 2DQDL 2K7PA 4FG6C 1S7TB 3O9WD 4GKZB 2G5BB 4ORGA 2BSTA 2NY3D 5C7XL 1V8HA 2FEEL 1A1OB 4MSWB 4PV8B 3T0VA 2DQDH 2A83B 4RFEA 4MNQA 1HK6A 1D6VH 1T0MA 4LCUA 5C7XH 1J1XL 4GKSB 4L29B 3HR5B 4MS8D 3BIBX 2XWJB 4YAQA 3ARXA 1YYLL 1J1XH 2ZNXA 1NBYB 3L3IA 1F11B 4NRYA 3LN9A 5D1QA 1YYLH 3BHBB 2RQ8A 4FQXD 5LJYH 2XY1A 4GAGH 4X99A 3QIWA 1JK8B 1G9NC 1CIUA 3KPPA 1EAJA 1KYOJ 3R4DA 1J1OL 3MFFB 5IGXL 4UTBL 2R2BB 5JR1L 1FE8L 1YC8A 3JXAA 3IFNL 5HJ3B 2VOTA 3T2QA 5D1XC 1J1OH 3PWLB 5IGXH 4UTBH 2HLFD 5JR1H 2FR4B 3KLHC 3IFLL 5JW3L 3IFNH 4HH9B 4G9DB 3LH2H 4OZGA 2VABA 3LRSA 3IFLH 5E0QA 5JW3H 4XWOD 2EZ0D 3L3GB 4YK4B 1LK2B 3S36X 3F7YB 2AXJA 2FYYA 3HG1E 1D9KC 2GKIA 4RQQA 3TFKC 5IEHB 5E08L 4MJ2A 4S1QL 3W0WE 4TSAL 3ZKSD 3MLRL 4L8DB 2FHCA 4OZIA 4HX1B 3WFCL 2XN9A 5KVDL 4NQCD 5E08H 1WAAF 1BWMA 4J4PD 4FTVE 4S1QH 4TSAH 3MLRH 4KK9D 3MLPA 5D1ZB 2GI7A 3WFCH 5KVDH 1J18A 4P5TB 2QQQA 1ZLWK 1UQSA 3T65A 3KPMA 2EEAA 2G9HA 1TPXB 1PSKL 4AEHH 1M7XA 3QNZB 1WCBA 1RURL 1XF3B 1ZE3C 1BJ8A 4UNVA 2NZ9D 5CBEB 4PY7B 1K5NA 3S5LG 2DBJA 1PSKH 3LPWA 4GBXC 1D5BA 1JPFA 2R1YA 3KNBB 4G9FE 1RURH 4GRWH 4QNPF 4NN7B 5ETUA 1K85A 4UIKL 3SDYL 3T08A 3ULUF 3FRUA 1JGDA 1B4JL 5CAYB 3B9EA 3O41A 2EIDA 2WMPA 2OTPA 4U1LB 4UIKH 3SDYH 3DETD 4Z8FL 1RFDH 3SGJC 1M6OA 1B4JH 4ZYKA 4Y2OA 4DKDC 2EYSB 4TVSa 4PBXA 1U8MB 4NM8L 4QY8A 5D7IB 4F7PA 5CZKA 5I1CL 4Z8FH 5EH1A 4X6EA 2DM3A 3NPZB 5D2LA 4H1LA 2UWEF 3BDYL 3MV7B 3C5ZA 4NM8H 5I1CH 5J0BA 4DGYL 4BFEA 4PJAE 3BDYH 1LP9B 5C2BL 1Z5LA 4G8GB 4IRJC 4MZ3A 4XMPL 1DR9A 1V05A 4Y4KC 3RZCC 5CBAA 2D7PA 2ATPA 1M7DA 3MSPA 4U1HB 5C2BH 5I1GH 3KPRD 4O2CB 2MHAA 1MCIA 4PREA 2KPNA 2Q3AA 3FQXB 3BGMB 4XMPH 5E7BA 4NQDD 2NLJB 1GH7A 5LKNA 1YMME 5HI4D 1N3NA 4KROD 3H9SE 3B8SA 3EFFB 5JW5A 2VISA 3TNMA 3QIUA 43C9B 1AO7B 1C7SA 3MRGA 5BW7A 2QSCL 1R24B 2R39A 4FQQB 1OOAA 2WINB 4IDJL 1F00I 2H9GA 1ZGLM 2H2SC 2FD6L 3BPNB 5T1KB 2QSCH 1T4KB 2X70B 4IDJH 5DHXB 1IILE 5IVXB 2FD6H 2IAND 2ZOLB 1UADC 4HUXB 3V52L 4M00A 3T0WA 3L7FA 1OP9A 3D39E 5INCA 4BQCA 3JTTB 4XCNA 2HTKD 3QDJE 2UVFA 5GS2H 4R0LB 2FGWL 5IIEA 5IKCA 4F9PA 3EUUA 4QF1B 3TC9A 2ZWLT 3FB5B 5DK2B 2OI9B 3WUZA 4HG4K 2FGWH 3WSQL 1SYVB 3C60C 2ZZUT 4GG6B 2PN5A 4WEUD 3KPQB 4WENB 3V5HA 1ZK9A 5I1EL 1V5JA 4X5WB 2NMSA 4EUPH 4HUWA 2V5SA 5JPMA 5D71L 3QUMA 5I15L 5C0AA 3WFDL 1I8KB 1KELL 3E6HB 5JHDE 4GRLC 5DRZA 5I1EH 1JYVA 2PTUA 4IHOA 3MX0A 5D71H 5I15H 3WFDH 1KELH 3MJ9L 3MV8D 4U6TA 5F89B 1D3CA 1LE5A 3FT4A 3MJ9H 3VXSB 4K07A 5B38B 4ZTOL 3VCLB 4JM4L 4HS3B 4MX7B 1SEBB 1LEGA 3GMRA 4M02A 4EDXB 4ZTOH 4JM4H 3MV9D 1U8LA 4MA1C 1FLRH 3W11C 5JO5A 1RJZA 3QQ3B 2Y7QA 3GMNA 4NO2A 5LG1A 1QHOA 3CH1A 4ZUWA 5IJKC 1G7LB 3L6FB 4QRPA 1Q9WB 3SE8H 2QSTA 3OAZH 3IF1A 1HI6A 4WHYH 2ZCKL 2GTZB 1PW3A 1S9VB 2ZUUA 3F12B 3TLRA 4K94L 4PJDA 3FZUC 4Y1AE 2ZCKH 3ZDZF 4XTRD 4OFPA 2KZ1B 4K94H 3KPNA 4RFNB 3QUYA 1LMKA 4L4VA 2IH3B 1TTUA 3IDUA 4BQ9A 1BZ7A 1I1YB 4A2MA 4R7NB 5IVOA 4ONOA 4NQXA 3QH3A 1FSKB 4IS6A 5KZCD 1B6DA 1C5BL 3A6OA 1UB6B 1FGVL 1C12A 3MQIA 1UXSA 2BY1A 5E9DA 1C5BH 3NFNA 4YGVA 1D6EA 1FGVH 4R4BA 4NDMA 3S5LB 2VAAB 4U6YB 4EI5B 4NSKB 1JI1A 2XPGA 3LCYA 3PP4L 1TCRB 4U4BA 1MUJA 1T3FB 4NO3A 1ZHLB 2EIZA 5DJAB 3EO1A 5HHOD 3PP4H 2HWZL 3RWJA 3OGCB 2FZ3A 1ZT4A 2W0PA 2O61A 1A6WL 2ESVD 3T77A 4W6YB 2HWZH 1F6FB 4NRZA 4BELD 3RP1A 5C0BA 2YOCA 3ZSTA 4OZHB 3FONA 4MD0B 4ZFOB 1A6WH 4XI5D 1JGEB 2QEJA 4OGZA 3SJVE 2AXGA 2M8XA 4C56E 1NMBL 3JBG7 2B5IC 3BO8A 4UB0L 5DEFA 2AJXL 1T7YA 2BOCB 4HS6B 1GL4B 1BD2D 1NPUA 1DEEB 1NMBH 1HQRA 5F9WC 1PZUB 4UB0H 2AJXH 2BMKA 3M1BB 5DD3L 4XGZB 3PWUB 4JZJB 2HRPL 1H3XA 5BRZA 3U79A 3PWVB 3GSXB 1KJ2B 4X8XA 5DD3H 2DKUA 2HRPH 3UDWC 3S96A 4FQJH 2FO4A 3G5ZB 3LEVL 5KSAB 1G6VK 3D3VD 2AEPL 2NYYC 2HFEA 5C07E 1XGPA 4L8SB 2AEPH 5C0GB 4R97B 3FFCB 4XPGL 2P44B 4LRIC 3V7AG 5K9KB 2L7UA 1JPST 1FO0B 1IC7L 4X6FA 4P2RE 1P84J 2PO6B 4M8QA 1CVRA 4XPGH 4CDGC 3O4LA 3QFJD 3SGEH 1IC7H 3GM0A 1LO4L 1TENA 3IJYB 2NX5A 5F71A 3C8HA 5EC2B 4ZQKA 1SJHA 2VLLA 2W91A 1OVZA 1KBGL 3QUML 4QRTB 2ICEB 4JFXA 1KACB 1A8JH 3UX9B 1XF4B 4PJFE 4D3CL 1KBGH 5BZWB 3QUMH 3QEHB 5KS9B 4JPWL 3QEQB 1VEMA 5H2BA 4OD2A 4LBEA 2H41A 4LCWB 3BP6B 2B1AL 4QHNB 4D3CH 5JOFA 1MFBL 2EDNA 2CUIA 3ARUA 1D5MA 3C09B 4L4TE 4L9LB 3VU2A 3UC0L 4JPWH 1NFDA 4ALAL 3HUJE 4XVUC 2B1AH 3WHXB 1MFBH 1FCGA 5J57B 2AKRB 1EVTC 1UKSA 3UC0H 2VL5A 3V0VA 1FN4B 4ALAH 4JFFE 4DKFL 2H3NA 3TESA 4XCEA 1RAMA 3AMKA 4YBLB 4X4XA 4DKFH 4QEGA 3R06B 5I1LA 3CFBA 1MRCL 1DN2A 2XA3A 2DRUA 1KPUB 2QHLA 4I8DA 3RUGB 1EFXB 2AJ3B 4JPIA 3LV3A 2VIRA 3OKNA 4XCCL 1A5FH 2HFFA 5FIEA 3SDDC 4NNYB 1MRCH 5EC1B 1NFIA 3WN5A 3N06B 4PB9L 3VFUB 1A6AA 4IRSD 2Y07L 4XCCH 1C1EL 1YEDA 1S7TA 5DFWH 4GKZA 2UZYB 2G5BA 5GGVL 4PB9H 4RA3A 2Y07H 1GPOL 2RHEA 4S0TD 1A1OA 1CDBA 4MSWA 4PV8A 1C1EH 2A83A 4WFGE 5GGVH 4H88L 3ZKXC 4MLIA 1EO7A 3KPOB 4GKSA 4L29A 3HR5A 2CDEB 1XGQB 5EU5B 5JORB 3BZDA 1ED3B 1EJOL 4MXVE 5L2KD 2ZG3A 4MQSB 2XWJA 4H88H 4EQ3A 5HGBB 3JV0A 2BRQA 1YNTB 1NCNA 1NBYA 2AXHA 1F11A 3L95B 1OWWA 3BP4B 1Z9OA 3ARPA 5H35B 4FQPA 4HWNA 2DLFL 3IU4L 3BHBA 3E2HC 2FB4L 1JK8A 3EYFB 2DLFH 3IU4H 1EVUA 1WBZB 3MFFA 1OP5K 2R2BA 2FB4H 4OCMC 5HJ3A 1FNAA 1N4XL 3A67L 1R3IL 4LVOB 4M4RA 1OAYL 4FHBD 3PWLA 4NC1E 4KJQC 2FR4A 2VE6B 4ODTL 4UUJB 1I9RL 1N4XH 3A67H 3OXRB 1R3IH 4G9DA 4HH9A 1OAYH 3QJFB 4EEEA 2Y1VA 5SV3A 4ODTH 3MJ6A 3QO0B 4OF3A 1NJ9B 1LK2A 2LTQB 2LVCA 3BISA 3MCLL 5HBBA 3S88L 3F7YA 4Y5XB 4NWUL 5IEHA 2ZUQC 1KCUL 1U3HB 1QBBA 1Z0NA 4L8DA 3MCLH 4HX1A 3S88H 3BT2L 4NWUH 5K33A 2FDBP 1KCUH 5I9QC 3UBXG 2P42B 1KIPB 4N90D 5D1ZA 3ARGC 4W4OC 3DI3B 3AS0A 3BT2H 1PG7L 2ZCHL 4P5TA 3IFPB 4BA8A 3P4LA 4CMHC 3QNZA 2CO6B 1XF3A 1PG7H 2ZCHH 4YHZL 3TT1L 3RWCB 5SWZD 5CBEA 3CFDB 4DTGL 4PY7A 1VPOL 35C8L 3KNBA 4QTIH 1K9TA 4YHZH 3TT1H 2R23B 3K1KC 5FDWB 2DJ4A 4DTGH 1VPOH 2P5EE 35C8H 4LNVA 5SWSD 4U1LA 2MCG1 15C8L 2EYSA 1YYML 1U8MA 1N7ML 5D7IA 2AK4B 4XP5L 3KPSD 4OF5A 1FNFA 5CCKL 4TQEH 3WLWD 3PHQB 4Y88A 15C8H 4RAHA 3MV7A 1YYMH 4HIHB 1N7MH 4I9WE 1LHZA 4XP5H 1J0IA 5CCKH 2BZDA 3P4OB 5J13B 4KDTC 5J8OA 2VLMD 4HBCL 5EU4B 3BFOA 1LP9A 1TJIL 4G8GA 1CBVL 5L0QC 4U7SA 4HBCH 2ICWI 4U1HA 1TJIH 4ZAKB 4O2CA 1T1ZB 5KVFL 1CBVH 5DMKB 3FQXA 3BGMA 4XXCC 2XA8L 2NLJA 3QZWG 4Y4FB 3MRRB 3U36B 4NKQB 1X5YA 3F6LA 3SGKA 5KVFH 3EFFA 3TJHC 1RJLB 1C08B 4PY8J 4JM2D 2XQYG 2XA8H 5DK0B 43C9A 3V0WH 1AO7A 2Q8AL 4ENEC 3BQUD 1R24A 4FQQA 3RGVC 1CU4L 2EKSB 2E8ZA 2WINA 1GYAA 3GZKA 5T1KA 5DMGC 3TO4B 3WIFB 1T4KA 3G6AB 2X70A 5DVOA 4B50A 1CU4H 4MNHB 4X0KB 3EO0B 4AL8L 4HJGB 2ADIB 4ONGL 5IVXA 2D7NA 4WHDA 4EXKA 2ZOLA 4HUXA 1KYOK 3TVMB 3DWTA 1OARL 2EH8H 3JTTA 4MDIB 2VXVL 5IEKB 4ZUTB 4AL8H 4R0LA 4ONGH 3WHE1 5HHXL 3MBEB 3RVWD 1TVHB 4QF1A 4M6OL 3QWRA 2VXVH 3FB5A 2IPKB 5DK2A 1ERNA 1KF9B 4QRSB 5HHXH 1DANU 2B7DT 3MGAA 1SYVA 5KN5B 3ARED 2HT3D 1S7XB 4GG6A 4M6OH 4PLKC 4OLZL 3KPQA 3BD4A 4X5WA 1I8KA 4OLZH 4BZYA 4D0BB 3E6HA 4HULB 2PF6A 1H0DB 1UZ6E 1CGUA 4XCFL 5E00B 3LKPB 1MJJB 1EK3A 4ZS6D 4KK5D 3HB3D 5F89A 1IL1B 4AEIL 2W1NA 2V6HA 4YPJA 1VCAA 4XCFH 4WUUB 1R3JB 3BIAX 3VXSA 2XZCH 3U83A 5B38A 2CLRB 3VCLA 1IGJB 4L4JA 4HS3A 4MX7A 4AEIH 1SEBA 1CGVA 5TQ0L 3RVVC 2UWEB 4EDXA 3DMMC 4J8RB 3VW3L 4ELME 3MLWL 5TQ0H 3QQ3A 3TZVB 1RZIB 1G7LA 3L6FA 1Q9WA 2D03L 4KK8D 2EDYA 5DYOB 4M9PA 4ZO6A 3VW3H 2AJYL 2WP3T 4HJ0D 4JFEB 4Y4HC 3GSRB 4GG8B 2GTZA 3VXME 1AI1L 1S9VA 2D03H 3F12A 4AT6B 2AJYH 3VXTB 1BM3L 5IESL 5J6GB 1QLRB 4HCRA 3VGDA 2EYTB 2H2PD 3EKCA 4OJFH 1AI1H 4ZG1A 2IFGA 5I1AB 1BM3H 5IESH 1YEJH 4XNMB 2IH3A 3UBXB 4BH7B 1I1YA 4NCC1 4K71C 1S7QB 4R7NA 5D2NC 5B3NA 3MRFB 3BN3B 4UDTB 3T0ED 1UB6A 3CFEB 1CDGA 4PJAF 3ETBF 1NCCL 4URTB 2Q3ZA 5J3HD 4LLQB 5F70A 1YNLL 1A9EB 3P9LB 3OJDB 5D7LD 5E5MB 3ARFB 3S5LA 5IR1B 1NCCH 2VAAA 4U6YA 4EI5A 1MI5B 4NSKA 1TCRA 1HHKB 1YNLH 5I73B 3S6CA 4KHTL 1T3FA 3MUY1 4O51B 1ZHLA 4DZ8B 3NIGF 1U91B 5DJAA 3B3IB 1KGCE 3V4PL 4MQ7B 2DMKA 4N0CD 5TFSL 3OGCA 2OP4L 1HHIB 1XGTB 5J12C 4KGJA 3V4PH 2P4AB 1FIGL 1JPSL 5TFSH 3MZGB 4QRRD 2OP4H 1CF8L 2EIBA 3C6LB 4OZHA 3AB0C 4MD0A 2YZ1A 4ZFOA 1JGEA 1A6VL 4RGMC 5IK3B 4XAWL 1FIGH 5CJQL 1JPSH 5EORL 1CF8H 5E6IC 2RCSL 2CIKB 3FJTA 1A6VH 4NZUL 3C5SB 5T5NF 1EMTL 3HN3A 3OWEA 4P2QB 2BOCA 4XAWH 5CJQH 4HS6A 2P7TB 1CLOL 3U0TB 1DEEA 5EORH 1A1MB 2RCSH 4PJXE 1BQHG 4NZUH 4PBVC 1EMTH 1FNSL 3M1BA 3DROB 4G7YL 4XGZA 1CLOH 3PWUA 4JZJA 3QZWB 3DSFL 3H9ZA 2Z0BA 2YC1B 1QPXA 1HHJB 3DOSA 3OGOE 2G75B 3PWVA 1DQQB 3GSXA 5IMLB 1KJ2A 1FNSH 2NXYC 3DSFH 1NDMB 3VWKB 3G5ZA 2YWYA 1DZBA 5KSAA 4PRHD 4QOKE 4CRPA 4MJIB 2GCYB 2J88L 1OAUL 5B4MC 1CTOA 2ERJC 5I6XC 3B5TA 3KXFD 4L8SA 5C0GA 2VB5A 3ZZ1A 2J88H 1OAUH 3FFCA 3FN0L 1LDSA 2LVEA 5K9KA 2J6EA 5I1DB 1FO0A 2BNQB 3ZT7A 2PO6A 3MNWB 4BQ6A 4Y16D 4LMQI 4LSVH 3FN0H 4OQTA 2JJTC 3MUHL 2J5LC 3NCMA 3T1FB 3IJYA 4GJTB 1A47A 4MWFB 4ODWB 5EC2A 5J4MA 2HKHL 2R56L 3PWPB 3VFRB 4JVPA 1XT5A 5JW4Q 4QRTA 2ICEA 1PY4A 1XF4A 2HKHH 3DURB 2AQ1A 2R56H 3QXUA 4CBPA 1J10A 4GBXB 2NXZC 4QRQB 5A3ID 5BZWA 2DMBA 5D8JL 3QEHA 5KS9A 4I3SL 1QSVA 3QEQA 5FYKU 1RZ7L 1X5XA 4LCWA 3BP6A 4QHNA 2EE3A 2DQFB 2XY2A 2VQTA 1QPPA 4S11A 4L9LA 5D8JH 1EHLL 4I3SH 3Q5OA 1RZ7H 1UJ3C 1GIGH 1I1AD 3ZKNC 2MMXA 3K74B 3WHXA 5CGMA 4D9RE 4J7RA 2AKRA 1E4XI 2RGSA 1AR1D 1EHLH 3VFGL 1FN4A 3ULVD 3FO2B 1RK1B 2G2RB 3BH8B 4JRYD 1U93B 3VFGH 3LRHA 3R06A 5EUOF 4KGLA 5F6HJ 1KPUA 1TXKA 3RUGA 4PTUB 1EFXA 4X5XB 4IRJB 2AJ3A 1T89C 4X6DE 4JRXE 1GZPB 5JZ7D 2X7LB 4L3EB 4NNYA 4Y4KB 5EC1A 2XQBL 2BSSB 2I25N 3VFUA 1U41A 5FEBA 1KPRB 4JKMA 1K6QL 1UB5B 4KFZC 3RDTB 4L8CB 2XQBH 4PJBE 4IOFD 2WV3A 5I8KL 1UVQB 3M45A 2IADB 1DLHB 4JREB 1K6QH 5CGTA 4Y8DC 3QIBB 3VGGA 5I8KH 4GRMB 1CICD 1DBML 3KPOA 4CGTA 2GSGB 2JIXB 2CDEA 1XGQA 5EU5A 5JORA 2EXWC 4PJGE 1ED3A 3SDXB 5HGBA 2VJXA 1YNTA 1U8QB 1DBMH 2Z8SA 1UZ8B 3L95A 3BP4A 5H35A 5CP3H 1RZGB 3I3DA 3F6IA 3RY5A 2EDHA 1EEYB 2ZG2A 3EYFA 4MVBD 1J05B 5DEZA 1WBZA 3O81A 4PLNC 1KB5B 3ARBC 3GM8A 2MOVA 1IQWL 3O3DB 1X5HA 3WNOA 2MKLC 2HJFB 4R96B 3O4OC 1AFVL 4KKCC 1FGNL 1O0VA 1FHGA 3QUZB 3C60B 1IQWH 2VSDA 2VE6A 3U2SB 4UUJA 3OXRA 1AFVH 5C0JB 1FGNH 3QJFA 1G6RB 2MQ0A 4OB5L 5IW3A 3BKYL 4ZFOL 1I3VA 4FFWC 3WXVH 5BS0B 4GRLB 3QO0A 1FVEB 1NJ9A 4LSDA 4OB5H 3BKYH 4Y5XA 2NZIA 1FYTB 4XPBH 3SKMB 1XIWD 2GK2A 1RZ8B 3AM8A 1P84K 1U3HA 4EBQL 4HUVB 4PGDB 2IAMD 4KQ3L 4LK4A 3OR6B 2BSED 1KIPA 4C54A 4BK4A 2O5XL 5ISZB 1EUTA 3FAXA 3EDFA 4EBQH 1BQHB 1JF6A 5CEXB 4KQ3H 4LPWA 3B9KD 3IT8D 3HRZB 3IFPA 5FAAA 2O5XH 1SHMA 2FJFB 4EJ1C 5L2JB 2CK0L 2VDLL 3SQOL 4MA1B 1ACZA 4XB8A 3RWCA 3I9GH 2D4DA 5SX5H 5M7QA 1VESA 3CFDA 4PJFF 5A2JH 4UBDC 1QYGH 4X4ZA 2CK0H 2VDLH 3SQOH 1X44A 1Q38A 2D9CA 2R23A 1RSFA 4WI9A 5FDWA 5AG9A 5GISL 3KPRE 3W82A 4LKCB 1BOGB 1I85C 4ZDHB 3TPKA 2J6EL 4PLJD 1FO0L 1MCWM 4F7EB 5GISH 3TGXA 4S1DD 1UKTA 5DR5H 3FB8B 5IMMB 4OQTL 4PJIF 2AK4A 2J6EH 5JIKA 1FO0H 1WBXB 5MENE 3PHQA 3DGCR 2NNAB 1AGBB 1GC1L 4HIHA 4K2UL 4OQTH 2BNRD 5DO2D 4YJZL 4I3RL 4EZMA 3P4OA 4XVSL 4KDWA 1NC2D 1BP3B 1WWCA 5DURD 1GC1H 1QRNB 5EU4A 4K2UH 3UPRB 2BHUA 1GGYA 4LSSL 4I3RH 1NQBA 3W5MA 4XVSH 4P4KB 2IANE 4DQOL 1AP2B 4TTDC 1OWRM 3EIFA 4RX4D 4ZAKA 1TZIB 4I18C 1T1ZA 5DMKA 1UH3A 4PJ8D 4Y4FA 3MRRA 3U36A 3CGTA 2X5PA 1P5VA 2X1OA 4F58L 1R6VA 2M1KA 5SX4H 4HZAA 1RJLA 1C08A 3EAKA 2AW2A 4AEEA 3A6BL 3BX7C 5DK0A 3FQWB 2W9LA 4F58H 1CGYA 4RRPA 4JGUA 1GRWA 5I1IL 2EKSA 2HTLD 3A6BH 4HUUB 3EYUL 4FAB