1H5BB

T cell receptor valpha11 (av11s5) domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
111
structure length
111
Chain Sequence
GDQVEQSPSALSLHEGTDSALRCNFTTTMRSVQWFRQNSRGSLISLFYLASGTKENGRLKSAFDSKERRYSTLHIRDAQLEDSGTYFCAAEASSGAWQLIFGSGTQLTVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags T cell receptor
molecule keywords MURINE T CELL RECEPTOR (TCR) VALPHA DOMAIN
publication title Crystal Structure of a T Cell Receptor Valpha11 (Av11S5) Domain: New Canonical Forms for the First and Second Complementarity Determining Regions
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h5bB00
1VENA 3ZT7A 1CICA 4LRNL 5DMJB 3WS3A 1ORQB 5F1KC 5C2BL 4QOKA 3B8SA 4UV4L 4Z7OE 3VXNA 2C3GA 3ZLQC 4UT6L 4XP1H 3MJ8A 2E6PA 3UYRL 3BH9B 1MJ7H 4RISH 2CDFB 3MLZL 3DHJA 4NKIL 1WCBA 3JUYA 5INCA 4EBQH 2Q1EA 5I75B 1WC7A 4KJWC 1AKJB 1F2XK 5FA4A 2IGFL 4F2MB 4XP6H 1AR1D 3RVXD 2Q20A 3REWA 3JTTA 2CR3A 1KB9K 3QQ3B 2EDYA 3HN3A 4OZIB 2OXGA 1FL3B 1N8ZA 1HSBA 1NBVH 3ZDZE 2VOTA 4MAYB 2FHBA 4HIXL 1NGXA 1WISA 1JHKH 5D70H 1VEMA 4MDJA 1CLOH 1CFQA 2CSPA 5C0DB 1H5BB 3SQOL 3DRTA 4CVXB 5D2LA 5GRJH 4OD3L 4PRAA 1ITBB 3KDMA 4RFOH 5ICYA 2X41A 1EFXA 1PKQA 2VWEC 5ERWB 3VXME 3D39A 2MHAB 2OYPA 4D9RE 1CN4A 3NTCL 3U46A 2VDPH 1BZ9A 4FOMA 3SCMA 2FD6H 1R3LA 4PRBA 2HT2D 1EH9A 4GAJL 2EDXA 2X70A 3CVHA 1ERNA 5AZ2L 5E9DA 3IDJA 1K5NB 1UWGH 3S37L 5AYUH 5FKAB 5D7LB 1C08B 2OI9C 3QXDA 1CL7I 1HNGA 1KLGA 5ILTL 2Q6WB 2ADJB 1OTSD 4ZNEA 1R0AL 3JTSA 1VB9A 1RUAL 1WV7T 5AUMB 1NBYB 2A83A 1X5IA 3HKFA 4JG1L 3I6KA 3LKPA 4P2RB 1T3FB 2YA1A 3MNWA 4BQ8A 2F8VA 4I18B 2GTZA 1I1FA 4KDTA 4H1LB 3DBXA 5DMIL 3QQ9C 1HCVA 1X4XA 1FFQA 2EKJA 2X1WL 4K23L 5HDBE 3TZVA 5JLZB 4Q9QL 2C7UB 2NXZC 3OAUH 4M7ZC 1HHHA 1YPZA 3PV7A 1A1MB 1VHPA 3OAZK 4G8FB 3VXMD 3FQXB 2MNUA 4KKLC 2X44D 4ODSH 2APVA 4FFYH 4PB9H 1E4XL 1PG7H 5BMFL 2H9GB 3SDXB 1G6RB 1GGBH 1MIEH 1JHTA 5DHXB 5C92A 4P9MH 3RKDC 4Q2ZA 1FFRA 3FFCA 2AJUH 1MPAH 4X9GA 1ES0B 3C60D 3O4OB 4ZFOL 1RUQH 1OP3H 2V2WA 2W0KA 4AENB 4G42A 4P9HC 4U6HA 3HPJA 4PLKC 1IC5H 4PY8I 1JNLH 2RFXB 1H3XA 4CAGA 4XVUC 3WL9A 2AXGB 4JRXE 1BIIA 4ODUA 4CN1A 3EOTH 1KCUL 5H35B 5IHUL 3MRIB 4NQDB 2WK2A 4U1IA 2IJ0C 4ZPVB 1HHJB 3MRBB 1IBGL 5L2KD 1X5AA 4ISVB 3FQNA 4YBQD 2VO5A 5BOZG 1N3NB 5HHPA 1QBBA 1IQWL 4GQ9L 1CE1H 2PN5A 5DUML 2QHRL 5MERB 5C0GA 3J8F7 4X7EC 3U4AA 1BPVA 1XCTB 1FNEB 3OJDB 1SVZA 4ZOBA 5I1DA 4WU5B 2QQKH 5DJXA 1YN7A 1EO5A 2NZIA 3M1BA 4D3CL 1IAIH 1KB5B 2CUMA 1IAOB 1OD7A 5BV7C 3KJ6L 3NCCB 4OUOA 2P5EA 3L5IA 5BW7A 1L6ZA 3HG1E 2XICA 4WWKA 4JPWH 5JOFB 1EBAA 4KTEH 3MNZB 1U8HA 5ID1A 5IR1B 4JFOA 4OD2B 5EG6C 1BBJB 4JRXD 5EOQL 1HNFA 3QPXL 4Y4FB 2N1KA 3MREB 1PBYA 4A6YH 4M6AA 5ELIA 1A4JB 3T3PE 5ADPL 5KW9L 3C2AL 2H1PH 1KPRB 4FP8H 1KG0B 4B5EA 5IEHB 1A02N 2I9LB 2R56H 4X6CE 1XIWD 2GKIA 4G43A 3FONB 4LEXL 2C3XA 5D6CB 4P57B 1YQVH 5IGXH 3BN9D 4OCRL 1YPZF 3ME0A 4JQVA 5LVEA 3HC0B 2CMRL 1YUHA 1H8OA 1ZT1A 4OFYA 1S7UA 5JPMB 3BKYH 3LS5L 1MFBH 3QIUC 3VFPB 3GDBA 3IDNA 1OWWA 2DS4A 4M02A 4CN4A 4LSVH 4U1GB 3F5WA 1YEDB 1I8IB 1JNNL 5E2WL 3HAEA 1N0XH 5EIIB 1ZGLP 4MXVE 1YEIL 8FABB 3V4VL 4BSWB 2E7CA 3ULVL 1TETH 5A16B 4HWUA 3KPLB 4LVEA 2ZSWB 1KNOA 1IARB 4IMKA 4JRYA 2HKHH 1AKJD 4UIKL 4XHJD 5GRWA 5GS0L 4F8QA 5JZ7C 3PF2A 1JL8A 2KKQA 4NPYA 3S98A 5D71L 2R2BA 4MZ3A 3NMEA 4MQ7B 3WXWH 2IQAB 3SDAA 4ZPTB 4ZG1A 4G8EA 1NCTA 1AGBA 1KTLB 4OLVL 1SJHA 1XGRB 1LNUB 3GMOB 2H32H 5FV2A 1XZ0B 3HPLB 3O6FC 2A74A 5F1IB 2A0LC 5JQ6L 3U83A 2FGZA 4H25A 4S10A 1UZ6F 2J88H 3F7YA 4Z95H 5T1DL 4JR9H 3LS4H 1GGIL 3KYKL 4PRPA 4WFED 4F7EA 4YHZH 5GSVB 2Q7NA 5JO5B 1I3RA 3IETA 3MC0A 4XNXH 2D4FA 3GMLA 3LEYL 1F45A 1A4KA 3IJSB 3UTSB 3MGTA 3PGFL 3WKMH 4KK9D 4H5SA 2JB6A 1IC7L 1I75A 1FE8L 3RL1B 4HH8A 4FQJL 4P59L 1OSPH 4HUXB 4HSQA 1LMKA 3O3EA 1AXTL 5EZLA 4M43H 3RTQC 3PV6B 1U8NB 3T1FB 4YXKL 5BO1L 4XVSL 4L9LB 5D7LD 4OIAA 3KG5A 5HHOB 1JUFB 3UYOD 5FYLH 1GH7A 4MJIB 2AK4B 1FO0L 1VERA 1FYTB 3NA9L 4PFEA 4O9HL 4P2RD 1DBMH 2OTPA 2YMXL 3GSQB 1NMAH 5SWQA 1F3JB 3QIWA 4AL8H 3PP4H 1X5KA 2DD8H 5CIPH 1U91A 1T7VA 2VZ1A 4XNQA 5EOCJ 1GGCL 4LU5H 4AG4L 5CUSL 2BK8A 1CE6A 4PP2B 3OR6B 1TCMA 5C9JA 3UX9B 3ARZA 5DRWA 5HI4C 2ZOKA 5DQ9A 3BGFC 1ZEAL 2QQLH 4JLRA 4OLYH 3RGVB 3C5JB 5CMAA 4KPHL 3U0WH 2ADGB 2B1HL 2XNAA 5FXCH 2V2TA 3PGCB 1BBDL 4BUHA 3QO1B 4KKCD 5CILH 1EEZA 2X4RB 3MA9L 4KRMB 1UYWH 1IT9L 4KXZI 4L4VA 3IU4L 3ZKNC 4PY7A 4XPFL 3DNKA 1QLRA 1JZ5A 5SWZE 1CG9B 2BY3A 4F7PA 2PETA 3UZEA 3MRRA 1MIML 3O9WB 4NQDD 1S7WB 5C70A 3MBEA 1HI6A 3VU2A 4H20H 4F7TA 4WFFE 2EH7L 3N1QC 2JJSC 5CZKA 2VISA 1I4FA 2W9LA 3PWLA 4RQQA 1S78C 2A2QT 3TA3A 3MYJA 4YFEA 1HEZA 4Y16A 1KIPB 5F7DA 4F7MA 2EXWC 4LK4A 1P7QA 3NFNB 1RK1A 3KGRA 2DQDL 5C71A 5FOBA 3G04A 2IAMC 3IDMB 1YY9D 5C08B 4MNGB 4N0UB 1MJ8L 2JCCB 3AB0C 3PQYB 3MXVL 3F58H 3MA7A 1QHPA 1K2DB 4GXVH 2XWTA 3E2HB 5FUZH 1W0WA 1O0VA 1CIUA 2BDNH 2FSEB 2DQUL 4JFZL 4GKSA 2X4QA 2ZKHL 5IBTH 4GG6E 4UAOC 2E27H 4XRCA 1RZKC 2BNQA 3S4SA 4YDIH 2WWKO 3WN5C 4N9GB 4QHUB 5DD5H 1J12A 1T0NA 4OCXL 1PG7X 4Y4FD 5D1QD 1MSPA 1NAKL 4KHTH 4O58L 1P2CA 1Q0YL 1LHZA 1FAIH 3IXAA 1MH5B 4WFFD 4JDVA 1OP5H 4LCCB 3N50A 4YBHA 5GGVH 3K1DA 3W2DH 3X3GH 3M17A 5GGVY 4EI6B 3ARDB 1HQ4A 2HRLA 2VQTA 5KTEL 2F58H 4YDVB 3W0WB 1FG2A 3CXDH 4G8GE 4APQB 4QYOA 2W91A 4J3WA 2ZCLL 3HLAB 5CJ8A 5DQJA 5GRZA 4BUGA 4KI5D 4U05A 1QLFB 4XP5H 4WU7A 2GSIB 4X0KB 3SPVB 5B8CA 4PJCB 1MFNA 3TFKD 2D03L 1U2HA 4WW2B 3TIEA 4YLQT 1TPXB 1QVOB 5GZOC 3PWPB 1DQQB 3NIGE 3TBVA 4XPBH 5DK0B 4RFNB 1G9MH 2DQJH 4MHHI 4EXPX 1T21A 2XFXB 3IB4A 1KC5L 3SHSA 1NGQL 3CVHL 1LGVA 1RQ5A 5T1KB 5EWIH 3X12B 4Q9RH 4MQTB 3BPLB 2WINB 1T7WA 4YPGB 1N2RB 1GCFA 1IQDB 4ALAL 1QUNA 5C0EB 3NFSH 4CADB 2HWZH 4DGYH 1P5VA 1AGCA 4UQ3A 4G8GD 4EDWL 1BQLH 1ZVSA 1QSFB 2AJXL 3K3QA 2V9RA 1ADQA 4F33A 4GUPA 1OAXL 5JXEC 2D7OA 1JGVH 5FHBH 3RZCC 4BSJA 1QR1B 4YEEA 4LVHB 2VDOL 5C0RL 3TYGH 5DRZA 1M7IB 4BKLA 1KXTB 3BPCB 2DWEA 4JGMA 3X14A 3I9GH 4MLSA 1J1XH 2NX5B 5BQ7A 1J1OL 4JHAH 4H8WH 2SEBA 5ADOH 2BSTB 3OR7B 3FOMB 5L88H 4JZOA 2GITA 4AIZA 2YEZA 3O6LL 5HHOD 4QNPF 4ZTOL 5T3XL 4N90E 1Z5LA 4MJID 3LB6D 4PRID 5DT1H 1FYTD 1EX0A 4J3XA 4HF5H 5ICZB 4QTIH 3ARRA 1A7NH 4GOSA 4TUKL 4I2XE 5EO0B 1UVQB 4XMLL 3G6JA 5EZIL 3DTXB 1ND0B 2DMKA 4HWEL 1DQTA 5D5MB 5TE7H 5I8OH 4LVOB 2YXFA 5IKCB 4R90L 3S3SA 5B3JF 5MEPB 2V5SA 4WO4B 1HZHH 4ZUUA 4KZEH 1K8DB 4N0FB 2KH2B 1X5YA 2YPKB 1MLCA 3EDEA 2FIKA 1MRDH 3QIBB 3B6SA 5CGYD 4YE4H 1I7TA 1PJ9A 3GRWL 2Z93B 4RGMB 1G7IB 1I9IL 3UPAA 4UT9H 3T65A 3CH1B 1A3RH 4Y5XC 1NCAL 3ZKXB 3FFDB 4FXGB 1NL0H 1L6XA 4Z5RA 2NNAB 3EO1A 5DF0A 4N68A 4JM4L 3U2SA 2DRUA 4N90D 3TIDA 4DGVL 4LEOA 1HSAB 2KUTA 1NGZB 2DQIH 3CFCL 5FK9B 1XF2B 2FJGA 2DBLL 4TNWK 4BSVA 3E8UH 2VLRE 5IK3B 3RDTC 4P3CH 2EKSA 5C0CB 4DUVA 4D94A 4HS8L 1MREH 1QFWM 2VZUA 5CZVL 2IEPA 5L9DH 4H88H 4NOBA 3C6LC 1VFBA 4FQXC 2X1QA 1L4IA 3EFFA 5B4MD 1YYMH 1QBAA 4MSWB 1FBIH 3OKKB 4NQEE 2Y7QA 4LCYA 4OT1H 4WTZA 2Q87A 2XZAL 3PQYD 3FQWA 4R7DA 4CW1B 3EDFA 1U8IB 4MXQC 5SWSB 5IB3A 5F7NC 4OLUL 1TQCB 4WUUB 2R0WL 3T77A 3V52H 4RBPK 3CDGB 5I8EB 1PZ5A 4XCFH 1ETZA 2Y36H 3IDYC 2YD6A 4YK4B 5DO2D 4ORZC 1EAPA 2P5WB 2P45B 1BWMA 5FM8A 4NJAL 1F3DH 1YEGL 4B41A 3QNYA 4PJXA 3CLFL 5F3HB 4X8JA 2NW2A 5HYJA 1C8PA 3WDHA 1BJ1H 3VXRB 3G6JF 1A7PH 1JPGA 3O8XC 2OR7A 3OXSB 1YEKL 5GZNC 4RNRB 2H41A 1ZT4A 1CL7L 3MLYH 2YD4A 4M5ZL 1HHKB 2GUOB 2FEDC 1RVFH 3R8QA 1T80A 1JN6A 1NEZA 2OTUA 1V7MH 2HN7B 5F9JB 4QHKJ 1YEEH 2QSCL 4NKDB 1YEJL 3QUZC 5T1LD 1MFDH 4OFVA 3O3AA 5KS9A 3EYUH 3V6OE 2AQ2A 4HUVB 1YMMA 5K9QG 3V4UL 4NCC1 3TJEH 1DVFB 3MLUL 5J1TC 1WBXB 2W92A 3PWPD 2YWZA 1GGYA 3PNWB 2XT1B 5FOJA 2I60L 2ITDB 3OJVC 2E7BA 4NQCE 3QIUA 3SDYH 1BFOB 5BVPL 5KANG 5KSVA 5TH2B 1JGDB 2G9HB 5HVGB 5T1KD 3FQUB 4HC1A 4ZAKB 1UH2A 4OZFA 3DJ9A 5DJ0A 5HHVL 1NGPH 1GAFL 3UTTE 3FO9B 3HI5L 3L7FA 4I0CC 1J10A 3HUJE 4XZUA 4BH8A 2MJWA 5LBSL 4NO5B 3RWGB 5IV2B 5DFVC 1CFTA 2IPUK 1KBGL 1XGQB 4N1EA 4Y19B 1QSFD 2BMKA 4DGIL 3ELAT 2AQ3A 4PJBA 5DMKB 1UXWA 4WW1A 2Z8VC 1PZUB 3UBXG 3QUXB 1LO0H 4WHTA 4ZFGH 2ZG1A 3SY0A 1IAIM 2DKSA 5DMGD 4I0PB 4ODXB 1G7LA 2X2YA 5TDNB 2R1WA 5JW3H 2DN7A 3VRJB 1L0QA 5E1HB 1K8IA 4PRHE 1JYWA 3O6FA 1HWHB 3JXAA 3ILQC 4NYLB 3GO1H 5AD0B 3L95B 3SDDB 1QYGH 2F9BT 2B0SL 5KSAD 4N8VA 1QO3A 4PJXF 4XVJL 3AMKA 1NBQA 2B4CH 5IHZA 5IVXB 1ONQA 4M8QB 1MAKA 4PJ7A 3HNSH 5CEXB 3N1PC 3HNTL 4LHUA 5E00B 3NVQA 2A6KB 1K4CB 3UAJD 3UTTD 3JSSA 4MA7L 3HC3L 3RPIB 3OX8B 3SJVB 3LVEA 3DO3A 4HBCH 4N0RA 3RTQA 2X89D 2VQ1B 4LP5A 2PTVA 4LCUA 4PV9B 4LSTL 5B39A 3TBWB 1AR1C 5E8EA 5KS9F 4R9HA 3JVGC 2F54B 1WAAE 4U2YA 1K6QH 3S5LA 4GBXD 4PJGB 3RVXC 3PUCA 4BQ6A 2V9QA 2DLFL 3H42H 3MO1A 4X6EA 2AV1B 3V95A 5B38A 2D2OA 5KVDH 1VGEH 4IMLB 2P1YA 4NQUA 5D7JB 4PRHD 2BRQA 3OHXA 2YBRB 3D9AH 3L5XL 3VW3H 4I3SH 1A7QL 3FT2B 3QG6A 1U58B 2RIKA 3M8OH 2W1NA 5J6HA 2IBBA 3IDGB 1TTFA 5I1AB 4Z6AT 1XF3B 1CR9H 2JB5H 5E95B 12E8L 2H8PB 4JHBA 1MCFA 3GM0A 5D7IA 1BQUA 2FECI 2MPAL 3CX5J 3PWJB 3G5VB 4PJAE 4OCLC 4NC1E 4Z9KB 4LLWB 3STLB 1CDUA 2HT2C 2ED9A 3MRMA 5TE4L 3RP1A 4PJBF 4NKOA 3BFOA 3HA0A 2RQ8A 4PGDA 2YZ8A 2Y4SA 4HUKB 1U6AH 3X3FH 3ZO0A 1T03L 5D8JL 4EUPB 3PHQA 5C0AE 2CUHA 4HKBA 3WFEL 2B1AL 2DI7A 3P9LB 1H3PH 3EYFB 4P4KB 4H0IA 1DQDL 5EU7C 4JAMB 4PTUB 3FRUB 2JJSA 4WUUD 1OAKL 3BKCH 1F6FB 3EAKA 1MLBA 3CFIC 4ZOAA 4P2QE 5J1SC 1IM9B 2EO9A 4HQQH 3GSVB 2V7HA 3KPRE 3RU8L 5HY9A 1SHMA 2G5BB 2X40A 3OF6D 3VI3F 4K3JH 5BS0E 1CZ8H 2IAMA 3MSPA 1MAML 1YN6A 3GIVB 4LPXA 3HE6B 3KR3H 4L5FL 4C56A 1R3IH 3BESR 1S5HA 2ZWLT 1HH9A 2NY5H 4ELKA 2Z8WC 4D8PB 1DBBH 1I1CA 3UJTL 4Z7WE 2YPLB 3NH7H 3L3JA 2W9DL 1RU9H 3D85A 1AIFA 1RZGB 3C60C 2GJ6A 3U7AA 4YUEL 4OZGA 1BLNB 4HV8A 5IMLB 5KZCB 2BNRA 5C0AD 3CMGA 4LMQE 4XT1C 3B2VL 3WN5A 1P4LB 2AK1L 1CDHA 3L1OL 2LTQC 3F6LA 1EA9C 3OKYA 4Q6IC 1T66D 4CDHA 3ZSTA 4DCQB 5IVNA 4YQXL 1JRHL 3EIFA 5DK2B 4K7PY 2KZWA 4JPVL 4I5BA 4PJEA 1I8MB 5DQDL 1NPUA 2W0PA 5H37G 4X4YB 2IFFL 1XF1A 2ZUSA 3HMXH 1D5XB 4P2QD 4YBQC 1ADQL 3EOAB 4BQCA 3QUYB 1CBVL 3KPRD 4R6UA 1CXIA 5JPNB 4NP4H 3ZDYE 4OLZL 2VXUH 3FT4A 4JCLA 3IRZA 4FMFA 5LAXB 1IILE 2I26N 3RY4A 2P43B 4JFDB 3EFDL 25C8L 2WWMD 3U0TB 2J6EL 1X7QA 3BP4A 3BMVA 2ATKA 1MRCL 5I16A 4U1KA 3HTLX 3I02B 1YY8A 4BQ9A 2EDBA 4HKXA 5MEOB 4UT7H 4P5TB 2NCMA 5IB5A 4K07A 2R2HB 4PLJD 4FTVB 1JWMA 1E4KC 3CIQA 2FH6A 5DEZA 4L4TA 4Y19D 5F3BA 4F37F 3KLAA 4G6FB 1BF8A 2I27N 2NR6D 5J06A 4QCIB 3F65A 1T2QH 1MI5A 5DSCA 2OP4L 3LRHA 1KEGH 4YHML 3EW3B 2HA1A 3H6JA 3ZE0F 4HWZA 1T1YB 3L5WA 3BXNB 1Q0XL 4D9LH 1DFBH 1D7FA 1XIWC 1YYLL 3GGWA 3OXRA 5IB1B 1UZ8B 2H2PD 4U1HA 5IMMB 5C3LD 3BN9C 1WTLA 2XYCA 3GJFH 4HFUL 4L4JA 4J8RB 4XCCL 1Q9LB 1SY6A 1T0PB 1WBZA 1X5GA 2AEQL 3W11D 5BZWA 2EC9T 4F3FA 5EBLB 4BFIA 1IM3B 3W9DB 3RZCA 4HJJH 4U3XA 2XKUA 3IDUA 3TH4T 3IJYB 1H15B 4IDJL 4MJ5B 2OCFD 3EZJB 4YXLH 2EH8H 4JN2A 5E4EB 2DKMA 3MRNA 1CGSL 3D2UB 3P77A 4OBSA 5GGRA 4MCZB 5JA9A 4F7CA 4JFEB 1IJ9A 4G6ML 5FDWB 2KQMA 3MZGB 5DA4A 2XKNA 3ZKMD 5BVJA 1WZMA 1TZGH 4LMQI 4XHJC 3ISWA 3T08A 5ESVA 2F54D 2V17L 5D72H 4HBQA 4MDIA 4DUXA 2HYMA 4PJEF 3B83A 3TN0B 2N56A 1F3DJ 1ZV5A 2XQYK 2A77H 5D7JD 2VABB 1FAKT 3C5SB 4MAYC 3HZKA 1IAKA 5EU5B 1BJ1J 5I17B 3EBAA 2B2XH 4E5XA 4OUUA 4KJYB 1AGFB 2FBJH 3H7BA 1H5BC 4U1NA 3NACL 4MD4B 1VFAA 2CD0A 5FHAL 5ALCL 4ONGL 1RJYA 4H26A 5J8OA 4LRNH 4FA8A 1S7RA 5C9KA 3JV0A 3SGEH 5C2BH 4OZHA 3KLHD 3ETBF 3VFVA 1Q9WA 4UV4H 3BKJL 1I1AB 4G6AC 4UT6H 5F7UA 4KK9C 3BWUC 4LL9A 2WBKA 4HJGB 5IB2B 4LNRA 1M6OB 1EK3A 1F4WL 1NFDB 4P46B 4QRPB 3MLZH 4PBWD 5C0FA 4G9FA 4TSCL 4NKIH 3SE8L 3QULA 43CAA 5F6HJ 4U6YB 5BV7L 3ARUA 3GSWB 2FR4A 4RFEA 5JHDE 2E6JA 3S96B 2IGFH 4MMZC 4ELMA 4P4KD 3U9UA 1KCVL 3O11B 1AO7B 1AR2A 2CLVB 3RDTA 1GJIA 1I8LC 3FN9A 1W0YT 4I18C 3ZHDA 4HULB 4PJIF 4NUJA 1T22B 3O4LB 3C6LA 4FQXA 2PYFA 1HCFX 3IFOB 2EDWA 3QDJE 3SQOH 2Q8BL 4X7SL 3TYFA 1NC4D 1S3KL 4OD3H 3DYMA 3ROOA 4TVPL 4JDZA 3AREA 4TTDC 2W65A 4O2EB 1FZJB 2YPLD 1A6TB 5TQ0L 1M05B 1U8LA 1D6VH 3S4SG 3O4OC 2FYYA 4QT5A 1T6VN 3NTCH 1E27A 4NT6B 2JK5A 3F12B 5KZCD 2D4DA 1IAII 4HC1L 4YJZL 5EPMB 2R39A 1D3CA 1JPST 1A21A 3RJQB 5AZ2H 5HDQH 4MD5A 5EB9A 2XI9A 4KK5D 4XCEB 4NM8L 5J3HD 3CJJA 2XOTA 4TUOB 4GRWH 3U4BL 2M26A 5ILTH 3O8XA 3KPMB 1R0AH 4YC2B 3G5ZB 1RUAH 3MV8B 4LFHG 4LPVA 4JG1H 3U9PL 1OW0C 5FYLE 4HCRH 3K81A 5EO9B 1TTUA 4HMCA 4JM2D 5FEBA 1QG3A 4LDOB 2FJFB 3RWEA 5DMIH 4Z7NF 4JZJB 5ACZB 4ZODA 3UBXB 3QDJD 4K23H 2G75A 2GJZB 3PWUA 1ZKAA 4Q9QH 5MEQA 3WBDA 4M7LT 4OI9A 3ARWA 2C9AA 3LKOB 3L6FB 2DQCL 3QJFA 3QUZA 3DRTB 4PRAB 3LD8B 1S9VB 1JV5B 4P5TD 3D3VA 1PKQB 4F58L 2XN9B 1KLFA 5BMFH 3QFDA 2ITCB 4DKAA 3UCRA 2X4TA 1GC1C 2AXFA 2PW2A 2JJTC 3U36B 4WRLA 3LKNB 3MUZ1 3NZHL 3I84A 3NOIA 5E2VL 4WY7L 1MF2L 1DN0A 2BVQB 5FA3B 1G9NL 3IGAA 4Y4FC 2VE6B 4WDIA 4JKMA 3IDJB 2I5YL 4JO4H 4NQSB 3WHXB 1ZSDB 3ARGB 4JANB 3BZ4A 5JTWA 1T5WB 4YH6A 4ORGA 1SJXA 3QXDB 5IHUH 1D5IL 4U6VH 5FYLD 1G7JB 3MNWB 5E2UL 5I74C 1QSEB 1IQWH 3VD7A 3CMOH 4GQ9H 4MA3B 5DUMH 4HK0A 5EFIB 5GRXG 2QHRH 4YIQB 3B8YA 1F8TL 3CFDA 3E6HA 3UTQB 1EJOH 4OIIL 3QDME 2BOCA 3GJEA 2J8UE 3BKML 4U1GC 4PGEA 3BZEB 2X5PA 1LD9B 3BIBX 1L7IH 4KI5C 1MVUB 4XGZB 5FKPB 1LP9E 4NBYB 3QWOB 3V6ZA 3TNMA 4LPYA 1A9EA 3ZYIA 3KJ6H 5IW6B 1HINL 1QRNA 1EEYB 3LKQB 5MHSE 1J86A 3VXSE 5IHLB 5FUCE 3TESA 2ADIB 4PJ8D 4FMKA 4FZEL 4G42B 3TN0D 1F4YL 4QHKI 4KWUA 5EOQH 5DK3A 4L8CB 3FQTA 3QPXH 1ZHBA 1FNLA 1RZ8B 5DJ2A 3CH8A 2E9WA 3MFFB 4LDLB 5KW9H 4R0LB 5ADPH 5SX5H 3C2AH 1SBSL 2FIRT 2CQVA 3QDGE 2J4WL 4NHUA 5DYOA 4LEXH 3GMPA 1KELL 2NLJB 3U6RB 4OCRH 5J1AA 1U8OA 3JVGA 2CMRH 5D1ZB 2EIZB 4HUWA 2PYEE 3ECBA 4MQXD 3D18B 1ZAGA 1B4JL 3LS5H 3VE0A 3CZJA 1OGAA 4XBPA 3WIIL 4NZDA 1RUPL 5HYIA 1VADA 3KYNB 1JNNH 1U3HB 32C2A 3CC5B 4GSDH 3EHBD 4OIBA 5CSBA 1N7ML 1YEIH 1LEKB 3V4VH 3ULVH 5E24E 1MCLA 2MCPL 3VXSD 1JGLL 3Q3GB 3PG2A 1B88A 2ID5A 5IFAL 1MY5A 3WXVL 1U8HB 1VGKB 4UIMA 2J3SA 3U30B 1B0GB 3FB8A 4X7TA 3LB6C 1SJEA 3DUSA 5GS0H 4OGYL 3P11H 3OKEB 5C8JA 5D71H 3OKDB 1N4XH 2XIDA 2CXGA 3Q5YA 1S7QA 4XBGB 4QHNA 4N0YL 4MA8L 3HNVL 2QJDA 4OQ1A 1Z3GH 4AJ0A 4WTZG 1U93A 3FT3B 1T1WB 2WWKT 1V3JA 2YHGA 2W60A 4QRRB 1OT2A 4UMGA 5JQ6H 2F5BL 4Z7UE 5DJZB 1PD6A 4KHXL 2PYED 2YA2A 3BOVA 4NM4L 1G1YA 2AJZA 5T1DH 2AP2A 1GGIH 3KYKH 2WZPD 1MVFA 4M5YL 3TGXA 5ISZE 4E41B 4XX1E 4ZUTA 5DUBB 5EBMA 1AFVL 2X9YA 3NA4A 1P5UA 1SMOA 4JFFA 3LEYH 1F4AA 5EU6B 5TQ2L 1NQBA 4PR5B 1FN4B 1IC7H 4D2NA 1TNMA 1W72H 2XZCL 4PJDE 1U2CA 1FE8H 1ZGLB 4FQJH 4P59H 2ZP0T 3I6GB 2GSGB 2AJ3A 2YXMA 1KCSH 4IS6B 3CPLA 4X5XB 1Q1JH 4MNQE 4YXKH 5BO1H 4XVSH 3O9WC 3TVMB 2K9UA 4BZYA 4QTHA 3RA7H 4HGWA 4U0RB 5GJTL 5JNYB 2CGRL 1FO0H 5BCAA 1MRFL 2ICWA 1NEZG 3NA9H 3AAZA 4O9HH 4Z8FL 1ED3B 2YMXH 3C60A 1Z9MA 2Y9RT 4Y0GA 2B8OT 4D0BA 1HXMA 5LWYH 3BH8B 3W82A 2D7TL 2LABA 3TBSB 2IH1A 3DX8B 4N9OB 3THML 4OZ4B 1CTNA 3L3HA 2YUXA 2LAAA 5B4MC 1GGCH 4Q6IA 3QBTB 2EYTA 4AG4H 1VESA 5ISZD 1INQA 5CUSH 4OFKA 4F7EB 5CSGA 2X4SA 5SV4A 2Y72A 1SY6L 3LH2L 3BX7C 3E2HC 4PGCB 4OLWL 3S3PA 1OOAA 5L2KA 1A64A 1ZEAH 3GMLB 2I07A 4OF5A 1DQJA 5DTFA 4HIEB 1F11A 3P4OA 2XWBA 2B1HH 5DO2C 5K93A 1BBDH 2FECL 5MENE 1ZA3A 5C0IA 1JZ4A 1XGUB 3MA9H 4OGAD 3GI9L 4MNQD 3IU4H 3O3EB 3RWDA 4OZFG 4RWHA 2C3VB 3GSNA 1IGYB 3OPZL 2D7QA 4KRNA 3P0YL 5I15L 2XTLA 4QXUL 1YC8A 1TTGA 1R24B 3IAQA 3EKCA 4M9PA 4LCCC 3O3UN 1MIMH 4JY4A 1MJUL 3CSYB 3EJYD 2DMCA 5IEKA 2EH7H 1E4KA 2AJSL 4K3EH 4GXUM 4Z77B 1IFHH 1QSED 4K3GA 2QSQA 4NN5B 4I77L 1CFSA 3QIWB 4XNYL 2WQRA 2YK1L 2VL5A 4O51A 4CKVX 2DQDH 3E6FB 4HK3J 1F3RB 2UZIL 3WCYA 3VWKD 1NLBL 3UMTA 2CKBL 1TDQA 1RAMA 1RJLB 2VLKE 1KIQA 1MJ8H 2AW2A 2Q86A 4KMTL 3MXVH 2XWJB 5MI0C 1FORH 5DQ9B 3K8KA 1XIWA 5T1MA 4S11A 2X7LA 4N8VG 4WW2C 4Z7VE 5J6GB 1TPXC 3P2TA 5MEND 5DEGB 3MRQA 4JFZH 1HILB 3QEUB 3KHQA 2ZKHH 1H0DA 1ORQA 2AI0L 4RFNC 4YX2L 1Y18B 4OCXH 3WJJC 3BH9A 1NAKH 1D9KB 3MYZA 4HUNB 2CDFA 4O58H 4J3VA 3KPSB 1Q0YH 3BPLC 1VFOA 3WFDL 3MROB 3MPCA 4DVRL 1BIHA 3T4YB 2EDJA 5EOCL 3BUYB 1CGVA 1A6VL 4LARL 4LGPB 5B39G 3IXTB 2XQBL 4KK8D 3Q1SL 2UY6A 1AKJA 4F2MA 3U4EB 5KTEH 3FQRB 5D1ZD 1K4DB 5B38G 1FVCB 4KQ4L 5GGTA 4YDJA 4FFVD 4LPWA 3QQ3A 1EBPA 2VLKD 4LVHC 4OZIA 2ZCLH 1TXKA 3IYLW 7FABL 2F53B 1U3HD 1QOKA 3WNPA 4MAYA 3MXWL 4LCWB 1ULVA 1A22B 5C0DA 1NJ9B 1H5BA 2BY1A 4RMUA 2D03H 4CVXA 3GNML 4X6FB 3T0AA 3RY6C 2G60L 4RMVA 5ERWA 3U1SH 2XG4A 4P2CG 3AXLA 3QG7L 2MHAA 2Z31D 4XP1L 4QXTB 5F1NB 5I76B 3UAJC 1KC5H 4I48B 4BFEA 3IXAB 4H0HB 3CVHH 2PXYB 2DLTA 3VD5A 2ILLA 1A14H 4KMQA 3WO4C 1AXSB 3QXAB 4ALAH 4KROD 1K5NA 5JHLL 1CU4L 4LVOC 3WLWD 3GHEL 4MQSB 5FKAA 5D7LA 1C08A 4L3EB 4EDWH 4PD4K 1CLZL 3TNNB 1FG2B 2Q6WA 2ADJA 4WO4C 2IANB 5AUMA 3BQUB 1OAXH 1NBYA 2WUCH 5E1AB 3QIBC 1JPFB 4P2RA 1I8LA 1T3FA 2EE3A 3ZKQD 1XF5B 4I18A 4BQBA 1QFWL 5EU6D 4H1LA 4RGMC 4IRZL 2VDOH 5C0RH 5FYKD 4OCMC 4TRPL 5JLZA 1A6UL 1XH3B 3ZKXC 1FNFA 3WUZA 1CLOL 2C7UA 1Q9OB 1J1OH 1A1MA 4DK3A 4JN1L 4G8FA 2EDRA 3FQXA 3VXUB 1RZJH 5JW4R 3ULUD 4N0UE 1JGEB 4HH9B 3L3GB 3ILPB 1FZKB 4OCYL 4DKDC 3SDXA 3SOBL 4ZTOH 3TO4B 2GK0B 5JIHA 5F8RC 4DFHA 4GG8B 4HWBA 2VDPL 1ES0A 5KOVC 4OQTA 4TUKH 4AENA 1A7BA 4AEFA 4XMLH 4DEPB 5EZIH 3QXTA 3BN3B 1I7RB 4PREB 4U0QB 4NZTL 2RFXA 5F44A 4DOHB 1RUKL 3OMZA 4HWEH 1UWGL 1MELA 1HXYB 3KHOA 2AXGA 4R96B 4LLQA 1ZVSB 5H35A 3VFRB 3MRIA 4M7KL 4R90H 4NQDA 4M93B 1HHJA 5IOPB 5SV3A 1MCSA 3MRBA 1TQCC 2KBGA 4YDLB 3L5HA 4YZFE 4ISVA 4M7JL 3ARTA 1N3NA 5DS8B 1O7SA 2DB8A 3VGEA 1OW0A 3TC9A 3QUML 4BELD 4PBVC 2OBGA 4NFDA 5MERA 3SN6N 4YK4C 1ZLVH 1BJMA 1XCTA 1FNEA 3BSZL 4ZD3L 1I9IH 5TF1H 3OJDA 3OAUL 4WU5A 5DD1L 3WV0A 2SEBB 2JF1A 3BYYA 1BD2E 4PS4L 4ODSL 3QFJB 5F6HI 2FGWL 1W0VB 3HE7B 1KB5A 4AIZB 1IAOA 4X83A 4DGVH 1T20B 3DUUB 4TULL 3CFCH 4I4WA 4MJ6B 4NC1C 3PGDB 1JWUB 5HJ3B 1Q94B 3IFPB 1MPAL 2JJTA 2X6MA 1FPTL 2FJHB 5JOFA 2L7UA 3MNZA 3TT3L 4HS8H 5IR1A 3DVNB 4OD2A 2NTSP 1JZ6A 1IC5L 1BBJA 5KSBB 2C3WA 5C6TL 2YD9A 2DM7A 1EIBA 4Y4FA 5HYEA 1S7XB 3MREA 3D48R 1KJMA 3WEXB 1A4JA 2DI8A 4PG9A 4GW4B 2XZAH 1M7DB 1WZKA 2OI9B 2YKLL 2E5EA 1KPRA 1PW3A 1KG0A 5IEHA 1E6JL 4ZDHB 2NY1B 3FONA 5D6CA 4P57A 4OLUH 1DVFC 4PJFE 1BFVL 1XEDA 1KIRB 1D6EB 2ESVE 2R0WH 3HC0A 2WSKA 3N1FC 5C0BB 5JPMA 2W59A 1ROWA 1KPVB 5KAQF 1BD2D 2UWEE 2QQKL 3SDXF 3VFPA 4KDVA 3HAEH 4XB8A 1LEGB 1I8IA 3ZE1E 4NJAH 4XPHL 1IAIL 3ES6A 5EIIA 3KPSD 4K3HA 4ZAKC 8FABA 4BSWA 2QSTA 3CLFH 3EDKA 5A16A 3RWHB 2R2EA 2ZSWA 4GG6A 3NN8B 5CFHA 3H9SE 1YEKH 4KTEL 2W0FB 1L7TH 2QR0B 3KYMB 3FTGA 2VXQL 4M5ZH 2NR6C 1WZ1H 4X6DE 4X4MA 4ZO8A 3UEZA 3WFZA 5CWSB 4A6YL 4MLIA 4MQ7A 3AMLA 2IQAA 2QSCH 3QUXC 4ZPTA 4NN6B 2F53D 1NGYB 1A7OL 4U1SB 1AC0A 5HHME 1R5IB 1KTLA 2R56L 1XGRA 5HHNB 4LCWD 3GMOA 2ESVD 4K3DL 4RIRB 1XZ0A 3HPLA 3V4UH 5F1IA 2H2PC 1SBBA 3SDDC 5EIQA 4LDEB 1OP9A 3MLUH 5EA0L 3W11C 5GSVA 4RZCB 4DAGL 5JO5A 1XR8B 3I50L 5HD8D 1MFBL 2D9QB 2I60H 3LQZB 4ODWB 4EDXB 4L3CB 1A6ZA 5JW4Q 3BEWB 3IJSA 3UTSA 1WITA 5BVPH 3H0TA 2PXYD 2J5LB 3RL1A 1IKNA 3H9SD 4KKBC 3ORJA 3T2OA 4HUXA 1VSCA 1HN1A 3C5ZD 4DFIA 1GAFH 4WVRA 2FBOJ 3HI5H 3TP4A 1U8NA 5F7KC 3T1FA 5IHBA 1DEEB 5LBSH 3ZKMC 1WJ3A 3BW9B 1KCRH 4LOUD 1KBGH 5HHOA 1JUFA 1Q38A 4MWFB 4DGIH 4ODBD 2OTUB 3GUTA 4WWID 4MJIA 5DZNA 5J57B 2AK4A 3BQUD 4PRIA 4BZ1L 4PJ5E 1FYTA 5CINL 2GEEA 1IC4L 4RGNB 5ANMB 5HHMD 3GSQA 5EBWB 1F3JA 5D7JC 3MRDB 5DJ8B 3A67H 1MWAB 3O3AB 3EYSL 2FB4H 3OJMB 3NBNA 5F7YC 5IJVB 3QEQE 1EVUA 4NFBA 2C4FU 4W6XB 3BP7B 3GB7B 3IDIB 4IOSD 2P24B 3KJ4C 1L9NA 3OR6A 4PP2A 3WS6C 4KI5F 5AAMA 4XVJH 3Q5OA 4XNXL 4O02L 5SWSE 3C5JA 3KLHC 4UTBL 4XMKL 3DOSA 1D5BB 2ADGA 3LRGA 1Z9OA 4GG6F 2Y07H 1QD0A 3V7MA 2F8OA 3PGCA 3SKJL 2C1PB 3QA3B 3QO1A 4RCAA 2X4RA 4MA7H 3HC3H 3IVKB 5E2JA 1OSPL 3R1GH 4HLJA 4P2OB 2XTJB 4V1DB 5F72S 4XZUB 4N8PA 1OB1B 4TSBL 3ARSA 3W9EB 1CG9A 1UACL 1KJ2A 3B9KD 2KPNA 4GT7A 3ZE2F 4PJ5D 2Z35A 4XNZB 3O9WA 3EDDA 1S7WA 4IOFD 1FIEA 4P4KC 2BHZA 4YFDB 3ALPA 4AK1A 1TQBB 1DBML 2DLFH 3MV9B 4WW1B 1NMAL 3KPTA 1MHEB 1XGYL 4C59B 1KIPA 2KZ1B 3NFNA 5C07B 3N1GC 1UCTA 1JZ3A 3ALWA 2X4NB 3L5XH 3IDMA 3N85L 5C08A 1CVSC 1A7QH 5ITBL 4O2FB 2FO1A 3QFJD 4MNGA 3C09B 3HE6C 3QQNA 2JCCA 3PQYA 2OK0L 5EBGA 3DX9B 2DDQL 1QKZH 2YA0A 2QQLL 4OLYL 1K2DA 5IHZB 12E8H 5E8OB 2FSEA 1LO2L 4PG2A 4O00A 1PSKL 1WFOA 4L8BB 1MAJA 5EUOE 3G9AB 3FB6B 3AS3A 4XTRC 3HRPA 4NWUL 4QHUA 3V7AG 5TE4H 1ZHKB 3QT2A 1T03H 1MH5A 5D8JH 3JWDC 3AGVA 3WFEH 1KTDB 2B1AH 3MRHB 4NZUH 2RHEA 4LCCA 1J8HB 2EIBA 5IQ9B 2F74B 1LO3L 2NY1D 1DQDH 4EI6A 3QUYC 1Q72L 1OAKH 3OKNB 2VLLA 5GGTL 4LSDA 1CD1B 1FCGA 3W0WA 2APXA 1CDCA 1IGFH 3OHXB 3RU8H 3MLWH 2JJUA 3HLAA 5J0BA 1X44A 3DGCR 2AV7B 1MAMH 1YMHB 2RB8A 1QLFA 1NDGB 4L5FH 4JJHA 2X09A 4P5TC 2WAHA 2GSIA 4X0KA 4WGWB 5CJBA 3SPVA 4PJCA 2VLJE 5FUZL 2ZUUA 5IP4A 3QHZH 5E8PB 4WJ5A 4WW2A 2MQ0A 3UJTH 1QVOA 4PUBL 1AI1L 2W9DH 3PWPA 2E27L 3WUWG 1DQQA 2VR9A 5F96L 2EE2A 4YUEH 2LFGA 3LN9A 5DK0A 1BFSA 3MRMB 2XFXA 3B2VH 1RUML 4PGDB 2AK1H 3UPRB 1FAIL 3WJJA 1S7SB 4HKBB 4RGOH 4U1LB 5T1KA 3X12A 1T1ZA 2WINA 4YBLB 4XNUH 4YPGA 4YQXH 1JRHH 1N2RA 5H94B 1HDMA 4Z0XB 1IQDA 5C0EA 4CADA 5DQDH 5ENWB 1HKLH 2IFFH 4NQXB 1ADQH 4GRWE 1CBVH 1BVZA 1QSFA 5D1XB 4OLZH 4LVNB 3N0PB 1J5OL 4JFQA 4PJGE 5HVHB 25C8H 1QR1A 5ECJE 1OTTD 1M7IA 2VLJD 5DD6B 1MRCH 1S8DB 4XP5L 3BPCA 5E4EC 3UYPA 4C56B 1VEOA 4KXZH 5BXFB 1EXUB 2N4IA 3O3DB 4UILH 2NX5A 4TPRL 4LLMB 2HTKD 2VXVL 1U8QB 4WGVB 3KPOB 3SGEI 1G6RL 4TN9A 3OR7A 3FOMA 1F58L 3C2SA 2GJ6B 4ONHB 3RY6A 2BSRB 4HWBL 3WNLA 3L3OA 4M62L 4PJ8C 1CT8A 1GZQB 4OQTL 3TN0C 5SX4H 3WN5B 5ICZA 2OP4H 2VL4A 3QH3A 5EWIL 1FG9C 4YHMH 5EO0A 1UVQA 2WW8A 3ARYA 4HUMB 3UDWC 4MA1B 3DTXA 1ND0A 5IM7B 3RPKA 1RPQA 1S9XB 1Q0XH 5D5MA 4HG4J 4OTXL 1XAUA 4NO3A 4F15B 3CVIL 1MHCB 4L8SB 5BRZE 1UXSB 1P6FA 5IKCA 3QCUL 4HFUH 2V2XB 4XCCH 2AGJL 2VIRB 5MEPA 4WO4A 1K8DA 1NUGA 4N0FA 1MFCL 2ZOLB 4MQXC 5DJAB 4PV8B 3GI8L 4PJCF 3KWWB 2YPKA 2NY3B 3QIBA 4IRJB 3VGAB 3TJHD 3VI4E 2ATKB 4IDJH 1QNZL 4C54A 1FVDB 1G7IA 4NGHL 5BZDB 5A3ID 4QGTA 3EHBC 1R5WB 3CH1A 1J1XL 1N6VA 2DTSA 1CGSH 4P2OD 3FFDA 4H8WL 4FXGA 2XTJD 4HGMA 3MJ9A 4V1DD 4PYHA 4W6WB 5ADOL 2YOCA 5L88L 2FO4B 1HSAA 3GFUA 1GC1L 1NGZA 5FK9A 1XF2A 4C83B 3BRGC 4XC1H 2V17H 4QTIL 4GKNB 5IK3A 5CBEA 5C0CA 3MV9D 3MMEB 2GT9B 4J4PD 2X1XR 3K4DA 4NIKB 1RI8A 2VDLH 3GSRB 3KXFB 4NFCA 3SDCD 2A6IB 5TE7L 4MSWA 1VPOH 3OKKA 4TSAH 4Y2DB 4E0RB 3TBTB 5D93B 4PJIB 3NACH 3DURA 1CK0L 4CW1A 5FHAH 1U8IA 5ALCH 1RIHL 4BFIB 1YDPB 2FZ3B 4WUUA 3C8DA 4YHIA 4CDGC 2EZ0D 4Y7MA 1YZZA 3CDGA 5I8EA 2L7JA 5FM5M 1EVTC 5K9JL 4UT9L 3ZDXE 2DQHL 4YR6A 1QHOA 1E6OL 4PRNB 2P5WA 1F4WH 4NHCL 1P1ZB 2PUQT 1RURL 1NAMB 1GHFL 1NCWL 4TSCH 8CGTA 4MYWB 3SE8H 4M03A 4Y5YB 2E9BA 5IIEB 5BV7H 5F3HA 5JIKA 3ULVE 5E4IA 4QWWD 3HUJF 3LEVL 4HJ0D 2Z4QB 5C09B 3VXRA 1CXLA 3OXSA 1AD0B 1SYSB 2VR4A 3E8UL 1KCVH 3DXAE 4YC2C 4RNRA 2BVOB 5I30L 3QJHA 1KXVC 5D5MF 1CD0A 4YXHL 1NMBL 4ENED 1U8KB 1HHKA 2GUOA 4H88L 4Y1AD 1W8NA 4LAJH 4JZJC 2HN7A 1IAKB 3OGOE 4HWNA 1RMFL 4OT1L 4NKDA 4QHMB 3NCJH 2WM0A 1DUZB 3ZTNL 3LD8C 4X7SH 4HUVA 1S3KH 5HYSB 4TVPH 1AD9B 3O2DA 1DVFA 3R0NA 3LSOB 1WBXA 3W5MA 3PNWA 5KBNC 2X10A 2ITDA 2C3HA 4LNRB 1DBJH 4IJ3B 3ZMRA 4Y5XB 2YWYA 1O5DT 1DUYB 1B6DA 3FO0L 3ULVD 1NC2D 4HC1H 5TH2A 1JGDA 3MV7E 2G9HA 4OZFH 3FQUA 2FR4B 1J8KA 4ZAKA 3ARGC 3HB3D 4NM8H 3FO9A 3U4BH 3EJYC 2DM2A 1JMZA 4NO5A 3RWGA 5IV2A 4NRXB 1H3GA 2OQJB 3RDTB 1LE9B 1XGQA 3JWOC 4Y19A 2HRPH 3U9PH 5D1XD 3AS0A 4ODHL 1V7ML 3PDGA 5IF0B 43C9B 5GRYA 5DMKA 5ALBL 4U49A 4LIQE 3PE9A 1IKFL 4ZQKB 4FS0A 4P5KB 2PYFB 4J1UB 3QUXA 4HLZG 2Q8AL 2DQCH 1EGJA 5J13B 3ROOB 3BZDA 5TDNA 4G3YL 4LLUB 3VRJA 4DKEH 4F58H 3TJEL 4NYLA 5AD0A 1FRGH 3L95A 3SDDA 5DLMH 4YPJA 1NFIB 1E27B 5E2VH 1MCIA 2XXCB 1N64L 5IVXA 1MF2H 4M8QA 4ODVL 1I3VA 3OBAA 4WV1C 3IAPA 5CEXA 5JOEA 4PJAF 1NCBH 2A6KA 1K4CA 4KTDH 3PHOA 1X5ZA 2RAMA 2VTFA 4MD5B 2I5YH 2VN4A 4RMSA 3MR9B 3RPIA 1INEH 4IRSD 5JORB 4R0LC 1KN2L 5IFHL 3SJVA 4KKAC 4OF0A 1A6WL 1D5IH 3FB5B 5HI3C 5DMYA 1C5DB 1PKOA 3KS0H 5IG7B 1II4E 1LK3L 4O4YL 5HBBA 4KK8C 2YN3A 3UJIL 2VQ1A 2IPUG 1N5YL 4TQEL 4PV9A 5E2UH 3TBWA 4L1HA 1XR9A 3QRGL 2MCG1 5D1ZC 2F54A 3DGGB 3WDIA 4IDLA 3RWEB 4NDMB 2WIIB 3LQAC 1U95B 2ARJB 4H1LG 4IRJD 2AV1A 3VMOA 4EOWL 1KEML 3WIFB 4ZFGL 4GAGH 4HS3B 1GXEA 3BKMH 3QJFB 4IMLA 1ZGLM 1U3HC 5D7JA 3T0EE 3WYRA 2YBRA 3HRZB 2J12B 3FT2A 1U58A 1G7MB 5KAQG 1QYGL 4M00A 4AY0A 1HINH 3IDGA 5I1AA 1FLRH 3OB8A 1XF3A 3WS6A 3GMRB 1PEWA 3U30C 3U48A 4AEIL 3IDXL 3MLTA 1N6UA 2H8PA 3MUJA 4QOKE 1KXQE 4WI9A 2R15A 3PWJA 1F4YH 1OF2B 3G5VA 4QY8B 1DZBA 2MKLC 4LLWA 3STLA 4LKXB 1A2YB 4ORGB 1G0YR 3KXFD 5HGDB 1EMTL 2DQFB 4MGXA 3B3IB 1SBSH 4JFYB 4Y2DD 4EUPA 4KROC 1WK0A 3VGBA 1P84J 1KELH 3TCLB 1K6QL 4UU9B 1QPXA 4ZYKB 4P4KA 2DYPB 4I3RH 4JAMA 4PTUA 3FRUA 1VFMA 1FH5H 5L6YH 3ZDYF 2PO6B 3G5XB 1B4JH 4YHPB 5TPWH 3WIIH 1BEYL 2CO6B 1IM9A 3VDAA 1H3VA 3GSVA 4QEGA 3D9AL 1JF1B 4I3SL 1N7MH 3TNMB 1A9EB 1FYHB 5EC1B 3M8OL 2MCPH 1JGLH 1CICD 4WEMB 2ZPKL 3HE6A 2JB5L 3ULUC 1B4RA 2I9TB 5D2LE 3TVMC 5GISL 4GLRH 5IFAH 3P40A 3WXVH 1IGTB 4RMTA 5C09D 2GTWB 1PKQE 3RNQB 4B50A 3WUWB 3D39E 2YPLA 3G6DL 4M1CD 4OGYH 1RZKH 1RZGA 5GRUL 1BLNA 4N0YH 2E9IA 5IMLA 4MA8H 4N1CA 1KV3A 2M2DA 1P4LA 3T2PA 5E9DE 1CCZA 5DYOB 4DCQA 1JVKA 2BFVH 1H3PL 4XWOD 2F5BH 5DK2A 4YEFA 4KHXH 4NM4H 1U8OB 4NC0B 1I8MA 4WHYH 2H2SC 1U0QA 4M5YH 4HUWB 4LLVB 4X4YA 4ZNEE 1D5XA 3EOAA 1YJDC 1AFVH 3QUYA 3VE0B 1FFOB 3F6IA 5E99L 5JPNA 5ICXB 2HJFB 5EUKB 5LAXA 4S1QL 3Q6GL 4DZ8B 3GM8A 4JFDA 4K3JL 1TMCB 2XZCH 5DHVB 3U0TA 2WBJB 5F21B 4G8IA 1UG9A 4TVSa 3KYOB 1EFXD 1YPZE 3OAZH 1WCQA 3IS0X 3I02A 2Y6SD 1EHXA 3D39D 1MQKH 5MEOA 4P5TA 4OFPA 4KQ3H 1ZS8B 4AZ8A 2B4CC 3NH7L 2R2HA 4FTVA 4WEUD 1WEJL 2CGRH 5EULV 1MRFH 3SCMD 3K2UL 5KANI 3FFCE 4NN5C 4FZ8L 4K9EC 2OL3B 4POZC 4ZO7A 5E9DD 1MCOL 5K33A 1FNHA 4QCIA 4RA3A 4EN3B 3THMH 2H3NB 3DLQR 4LSRL 3CSPA 3BDBA 1T1YA 3DMMD 3FN3A 3BXNA 3HMXL 4X4XA 1ACZA 5IB1A 4G80B 1SY6H 1UZ8A 4AIXA 3S3JA 4OLWH 1S9WB 4HZLB 2J8HA 5CP3A 1JCKA 4J8RA 1Q9LA 3FZUD 3R06A 3U0PB 1ZHLB 5EBLA 1IM3A 2N7BA 2JELH 3W9DA 3P4MB 3IJYA 1H15A 2BY2A 3GI9H 4MJ5A 4TUJB 1D9KC 4NRZB 1UZ6E 3VXMB 1KGCD 3MJ9L 5F7LB 4D0CB 5H8DA 1V3MA 3B2UD 1G0XA 3D2UA 4JY5H 3UO1H 5GGRY 3P0YH 5I15H 1CLCA 4JPKL 4QXUH 4MCZA 4MB5A 2V6HA 4JFEA 3H2WA 1QA9B 4QTHB 1EV2E 5FDWA 5T3XD 1UH3A 1MJUH 4FFZL 4NCDA 2P5EE 5ABDE 2AJSH 2Z0BA 1TZIB 5CHNB 2XRAL 1YC7A 4XNYH 4I77H 3D69B 1T2QL 2O5YL 2YK1H 2IH1B 5IBLD 3TN0A 1KEGL 1AQDB 5DJYB 3ZL4L 2UZIH 2ED7A 4EIGB 1NLBH 4I9WE 2VABA 3C5SA 2A9ML 3UDWA 4JM2F 4M61B 1MEXL 5EU5A 4FFWD 2X4SB 1CDYA 5I17A 4KJYA 1AGFA 4FNLL 4XBEL 5L2KB 4C55A 2IF7A 1DANU 5AAWA 4MD4A 5GGQH 3B5HA 3ZHKA 1ZTXL 1OCWL 1HYRC 3HZVB 4GFTB 2FATL 2AI0H 1X9QA 3C9NB 1I1AA 4YXLL 2E7LC 3S88L 2EH8L 3EUUA 2PCPB 4HJGA 4F9PC 5IB2A 1X5FA 1M6OA 2PXYC 4J6RH 1SQ2N 3WFDH 1NFDA 1URLA 1ZK9A 2P5ED 4QRPA 4DVRH 3C5ZC 4EEEA 1A6VH 4LARH 1F42A 2XQBH 3GSWA 2HT3D 3Q1SH 3S96A 4JRYE 1IL1B 1UKSA 4JO1L 1QBML 4JB9L 5FO9B 5D96B 1NLDH 4QRTA 3O11A 3BQUC 1AO7A 1CGUA 1G6VK 2CLVA 4I9WD 4JRXB 4KQ4H 2VDML 4XXDB 3GKZA 1YEHL 5A2FA 3ARFD 3O2VL 4HIJB 4ERSL 4LQ1A 5LXGH 3HFML 7FABH 4BYHA 1T22A 3I2CL 3O4LA 2HMID 5IFJB 2MWCA 3MXWH 3UC0L 5IMKA 4Z76B 1MCCA 2OX5A 3H3BC 1XMWA 3IFOA 2CDGB 1D5ZB 1JTPA 3NIFE 3O2DL 1MHHB 3G9VA 2KDGA 3GNMH 4PRPE 1BAFL 1H0DB 2G60H 3TO4C 2DIJA 4KJPD 1G7PB 3QG7H 1FZJA 4O2EA 1A6TA 4G7YL 1M05A 1QZ1A 2VH5H 3BAEL 4NT6A 1UEMA 2Y1VA 3F12A 3HG1B 4DEPC 2UVEA 4F37K 5EPMA 4DZBB 4X5WB 1X5JA 4JRYD 1CDBA 5DWUL 1JI1A 2AQ1A 1WTGT 5JHLH 1CU4H 4XCEA 1E28B 3GHEH 4TUOA 4UBDD 2O61B 2DQEL 4M93C 1ACYH 1CLZH 4F57H 3KPMA 4YDLC 3G5ZA 1ORSB 4YDJB 2A1WH 5GSRB 3STBA 5D9SB 3MV8A 4XHQA 5HI5D 2GJJA 2VZ3A 4E42B 5AZEH 5EO9A 3QEHB 4X6CB 1QFWH 2XZZA 2FJFA 4IRZH 1GZPA 4JZJA 5ACZA 2APWA 4TRPH 3UBXA 5FCUL 1A6UH 2QEJA 2GJZA 1INDL 3SE3C 2WBJD 1WIPA 1FC1A 4LHJB 3KS0J 3LKOA 3L6FA 4PRPD 1F4XL 4JN1H 3HE7C 1LP9F 2YZ1A 1VACB 1S9VA 1JV5A 1U8PA 5J89A 3B9VA 1Y0LB 2XN9A 2ITCA 4OCYH 3AXLB 3SOBH 1NFDF 3ZKSD 3WHE1 5F1OB 2ZUXA 1D6VL 3U36A 3LKNA 4HXAL 3G5YB 1CFBA 1UM5L 5CCKL 2BVQA 4HZAA 1WIOA 5FA3A 3HHRB 4EN3D 2VE6A 2WUBL 4HKJB 1BHGA 1XF4B 4L4VE 3STZB 5HDQL 3UTOA 4NZTH 2OJEB 1X4YA 1RUKH 3LMJL 4NQSA 1F5WA 3PXJA 3WHXA 1ZSDA 3ARGA 4JANA 1QFPA 1T5WA 2VDKL 4M9OA 2P8MB 4M7KH 3K46A 1G7JA 2NY1C 1CDIA 5CEZL 3S34L 1OLZA 3PIQB 4M7JH 4KFZC 2XY1A 4HCRL 1QSEA 2D0GA 4MA3A 3MV01 5JW4N 3QUMH 5EFIA 2CK0L 4YIQA 1HQRB 3UTQA 3BSZH 3CFJB 4ZD3H 2AJVL 1OY3B 5BJTB 4WI4A 3BZEA 1T2XA 5DD1H 5ETUB 1LD9A 2EDTA 4PS4H 2JJWA 5EZJB 1MVUA 4XGZA 2FGWH 5FKPA 3QWOA 2YSSB 4D9RD 4TULH 5JDJA 2DAVA 5IW6A 1JTOA 1EEYA 3LKQA 2RBLA 3H9ZA 2DTML 4Q9CA 1KB9J 3SKMB 2NW3A 1FPTH 4PGZA 2ADIA 3TT3H 1DDHA 4L4VD 3TV3H 5CD3B 4LPCA 5FGSA 4WV1A 5JDSB 2UUDK 4FQHB 2BNQE 1OGTB 5C6TH 2P48B 4JO4L 4L8CA 4G9DB 3V6BR 1C1EL 2NY0B 4NN6C 3N06B 2E9JA 1RZ8A 4K2UL 4LLQB 5KG9B 3D1MC 2XA8L 3MBED 3MFFA 3QR2A 3O0RL 4QNPE 4R0LA 2P8PB 4U6VL 2YKLH 3F62A 1BMGA 1E6JH 5KVGL 4Z7UF 4Y16D 3CNKA 5EC2B 2A6JB 5I18L 1TVBB 3PWNA 5KVEL 2NLJA 1BFVH 1P7QD 1DLFL 3CMOL 3U6RA 3V5KB 1HHGB 5D1ZA 4I13B 2EIZA 1P4BL 1PLGL 2WNGA 1EJOL 5TGBB 4BA8A 3D18A 2ZUWA 3ZYJA 1ZVYA 1OTTC 2YS4A 4R4ND 1L7IL 3KYNA 1BQHA 2A38A 1U3HA 2J5LC 4XPHH 3CC5A 4C58B 1EEQA 3L7EB 4KRLB 1LEKA 5B3JE 4Y5VC 1XGPB 4I4WB 3B5GA 1AHWB 3Q3GA 3G08B 3MLSL 3DETC 1KOAA 5ID0B 2CDEB 1VGKA 4OM0L 1B0GA 2VXQH 2VR5A 5I1IL 4J7RA 4RGNC 3OKEA 5D1QB 1K9TA 2F19L 3OKDA 2MSPA 2V5RA 1KJMB 4XBGA 2DWDB 4PG9B 3CD4A 5T5NF 2EYRA 1A7OH 3MRGB 1I9RH 3FT3A 1T1WA 2L4OA 2VZSA 3KPPB 1A0QL 3VXPB 4K3DH 4QRRA 1RHHB 1N0LA 5DJZA 5D2NE 5I74B 2G2RB 2AABH 1W2KT 3PP3K 2X1PA 4JG0L 1NBZB 5EA0H 4OF7A 4E41A 1U41A 4DAGH 5DUBA 3I50H 4ZXBB 5A2KH 4DTGL 4G5ZL 2CJUL 3UTZB 3TJHC 3VRIB 5EU6A 3ES6B 5TDPB 4GSDL 4PR5A 1FN4A 5GXBB 5HHQB 3HG1D 3DX7B 1ZGLA 4P2OC 2R2EB 5IMOB 2D7MA 2XTJC 3RL2B 3I6GA 1AH1A 2GSGA 4GG6B 5D7KE 3PWVB 4IS6A 3BD5A 4X5XA 4XNZC 3RIAF 1PAMA 3FTGB 3TVMA 5CJOH 1ZLUK 3LN5B 2VWEE 1TQBC 3P11L 5JNYA 3DVGB 4BZ1H 4GO6B 4LBEB 5CINH 1IC4H 1N4XL 2VDNL 4R4BB 1V7NL 1ED3A 4J4PC 4P5MB 1Z6JT 5B21A 3K80A 3BH8A 1Z3GL 3MLRL 5IB4B 1FFPB 4X98B 3TBSA 2YN5A 2ZG2A 3DX8A 3EYSH 3G6JE 4OZ4A 3V0VB 4M1GL 3REVB 3DO7B 1WT5C 3C09C 4G8GB 1R3HB 4Z7VF 4PGCA 1A6ZB 1DTUA 1BVKB 4O02H 4TOYL 5JIIA 4UTBH 4XMKH 4LQFH 1QQDB 4HIEA 3H0TB 1B6UA 1OAZL 5I1LB 1QRKA 4JFPB 1W72L 3SKJH 5K59F 3RVTC 5I1HL 1XGUA 5D7KD 2VMFA 3GSNH 1DBKL 4XCYA 1QLEH 1KCSL 2C3VA 4WI2A 1IGYA 1Q1JL 2BVTA 2VAAB 4TSBH 1A8JH 2BRRH 1UACH 4MB4A 1A5FH 1RFDL 4QWWC 1R24A 3UP1A 3RA7L 2ICCA 4HJ0C 1NEUA 2X9WA 5DR5L 3GUTB 1P7KB 1Q8MA 4PRIB 5E6ZA 3CSYA 2IADB 4LIQL 4Z77A 3FN0H 5LWYL 1FGNL 2HP4A 2J7LA 1XGYH 3FJTA 3MOBL 2D9CA 3CDFA 2YD8A 1KT2B 1S5IL 1JRHI 1OD9A 2YRPA 3E6FA 35C8L 4R97B 1NUNB 3N85H 5FYJU 3FRPA 4PGBB 5ITBH 1BOGB 1RJLA 3QXVA 4QRQB 2OK0H 2XWJA 2DDQH 3HCVB 2FWOB 5I8KL 3LKRB 5J6GA 1AQKL 3EOBB 5DEGA 4W4NA 2OSLB 4P48A 3GMQB 4Y8DC 1LO2H 5AWNL 5JUEH 4RBPH 1FL5B 1HILA 1PSKH 2B5IB 3QEUA 2VERN 5GGSY 2LE9A 2DJSA 3ULUF 3JV6B 3V8CA 2HVKA 1Y18A 5JR1H 1CYGA 4LCIL 2ZUTA 4NWUH 4KKLD 1BREA 1D5MB 2NY0D 3QYCA 1D9KA 1YNLL 1KJ2B 3KPSA 3VRLE 1MJJB 3SO3B 4YBLC 3MROA 2Z35B 4PJXE 3T4YA 3HB3C 4JKLA 3W39B 1UGNA 3BUYA 5HYJE 4YHNB 1LO3H 3IXTA 4K3EL 4I2XB 5CBAA 1IFHL 5SX4I 1Q72H 3U4EA 5GGTH 5D1XC 1KN4L 3FQRA 4H0GA 1K4DA 5HHXL 1TJGL 1FVCA 4KTYA 4LVNC 4W6YB 5FIEA 3I3BA 3FO2B 5HVHC 1WFTA 4KUCD 5DURB 2F53A 4HLZH 3MCLL 4ZSOA 3H7LA 2IC2A 2E8ZA 4X9IA 5KS9E 1FORL 4LCWA 3QI9B 2ZCKL 1VA9A 1YMME 3OAYK 3S97C 1NJ9A 5I19L 4FXLA 2ADFL 3AU1A 4PUBH 4TVPE 1AI1H 5HPOA 4X6FA 3A6CL 1SEQL 5F96H 3K8MA 1FFNB 5SWZD 3GZKA 3JZ7A 2N7AA 4QXTA 2E7LA 5F1NA 1RUMH 5I76A 4F9PA 4I48A 5HYJD 1PY9A 5DJCB 2PXYA 2HTLD 3M45A 1A47A 4MA1C 1WFNA 4EUPG 4QRSA 3OB0K 2H26B 2VUOA 3C5ZA 3VH8G 1AXSA 4WEBL 1AXIB 3QXAA 1AJ7L 5F97E 3VFTB 4F15C 2Q76B 4L8SC 2VLLB 1CXEA 5FECB 2LAGB 4L3EA 3KPNB 3RBSA 3TNNA 4YZFF 2IANA 1F13A 3BQUA 3HR5B 4NQEB 3H8NA 4PJBE 2DOCA 4ZXBD 2NY3C 5E1AA 4H1LH 4IRJC 5INDB 1R5VB 1JPFA 3VGAC 1J5OH 2FX8H 1XF5A 3FMGL 5T1LB 1YMMD 2QV2A 2LVCA 1T04B 1XH3A 5MI0B 1Q9OA 3VDCA 4TPRH 3R0MA 2VXVH 4UOW0 3VFOB 4WJ5B 4X6BA 3VXUA 1G6RH 4HX1A 5F9OH 3U1SL 1JGEA 4HH9A 4DN3H 1F58H 3L3GA 3BHBB 3ILPA 1FZKA 1MCNA 3TO4A 2GK0A 4HWBH 4M62H 4CUCA 1BGXL 2B39A 3VI3E 5HYFA 4PJ7E 4OQTH 3ZTJG 4GG8A 4BFGA 4B7IA 2MKWA 2JIXB 5E6IB 3MRFB 2HH0L 2IWGA 4Y4HD 1T1ZB 1A14L 1T4KB 2P46B 3O6KL 1I7RA 1HDMB 2GFBA 4PREA 2LU7A 3DPBA 4Y2DC 1HXYA 5D93C 4R96A 4OTXH 2ZG3A 3CVIH 4ETQA 5JZ7D 4CVUA 2APTA 4CVWA 3RVUC 1YNKL 4MJ4A 3RIFK 3VFRA 3QCUH 5T3ZL 4K8RC 2WUCL 2AGJH 3JWOL 4YGVB 5IOPA 1JK8B 4PJFF 4JFQB 1MFCH 5DS8A 1NUFA 3AFLA 3GI8H 4F80A 2AEIT 2CPCA 4GRLD 3Q0HA 1QNZH 5I66A 2CLZB 4NGHH 2UWEF 3RWJB 1PFCA 4I1NB 3O6FD 2BC4B 2PF6A 2A0LD 1S9KC 3SE3A 3DV4A 4J23A 4QXGL 1KB5H 2QADB 4DN4H 4Y5YC 1RZJL 3QFJA 4FABL 1GGUA 1W0VA 3HE7A 4BJLA 3PL6B 4NQCB 3VXQB 5DGQA 5KSAB 1T20A 3DUUA 3D0VB 1GC1H 2GAZA 3L3OB 3S35L 1CT8B 4LHUD 1M1SA 4PYGA 4MJ6A 2HJLB 3PGDA 1JWUA 3CX2A 5HJ3A 1Q94A 4XI5D 3IFPA 5D7IE 2R29H 1CQKA 2FJHA 3QH3B 4J3UA 2X05A 1RZIB 3UTTB 3PABB 3HUJB 3DVNA 4NJ9L 4RWYH 3JUZA 3FHQA 4ZOEA 4ZUSB 4JFXB 3IFNH 5KSBA 4N0CD 3WO4B 1S7XA 1MCWW 3HI1B 2HFFB 3BEVB 4FHBD 4NO3B 3E3QC 3WEXA 4GW4A 4XWOC 1M7DA 1Z0NA 2NY6B 3VA6A 5IVZB 1CK0H 1UJ3B 2OR9L 5EO1B 4ZDHA 4GBXB 2BERA 1R3JB 1RIHH 1KIRA 1D6EA 2GY7B 5FO8B 1B3JA 3LQAL 2VDRL 1HIML 4DK6A 3MBXL 5EZOL 5C0BA 4IJ3C 5TF1L 5K9JH 4GMTH 4PRHB 1KPVA 2CKBB 2DQHH 1E6OH 3IU3B 3KNBB 4NHCH 1LEGA 1RURH 3RX8A 1RIUL 4NQTA 1GHFH 1NCWH 1A7RH 1I7UB 3HZMB 4C56E 1Z2KA 1JFQH 1LEIB 3RWHA 3LEVH 4PRDB 3TO2A 3D0LB 3NN8A 5E8DH 5CBEB 3KPQB 5I30H 2W0FA 1JPTL 2QR0A 4YXHH 3MRLB 1NMBH 3KYMA 3Q5TA 3RVVC 1XCQB 1RK0B 2GJ6E 3LOWA 4U6TA 2EXYD 4OFIA 4OZGE 3ZKND 1UWXK 3T0VA 1NKOA 5CWSA 2BNRE 4P4RB 1RMFH 5DURD 1NGYA 4U1SA 4FXKB 5J13C 3DMMC 3DURB 4IBLT 3MRCB 1R5IA 3ZTNH 5HHNA 1BX2B 2YC1A 3QI9D 2ICWJ 1S78D 4RIRA 1EAJA 3L9RB 4PJEE 3QNZB 1NMCB 4YHIB 4ZS6D 2UVFA 3EZ8A 4XWGH 4XPGH 4AH2B 3CFKB 5HGGS 2ZCHL 1VKXB 3FZUC 2MFNA 4RZCA 1XR8A 5DFWH 4YR6B 3LQZA 4ODWA 4EDXA 4L3CA 1S7VB 5FYKL 4U31A 5LQBL 5A2IH 3BEWA 2YR3A 1CFNB 3FO0H 3OL2A 4FQ1L 4MD0B 2FL5B 3QB7C 4XAWL 2VLRD 2VSCA 3OZ9L 4Y5VA 1FSKB 5HXMA 3T0XA 1HHIA 4PJAB 2HAZA 2BP3A 4X4ZA 5KSBF 3T2NL 5KN5B 1UB5B 1L0XA 1DEEA 3RY5A 3QJHB 1L7TL 3BW9A 4XB7A 1P69B 1WZ1L 5F7HA 2V5MA 4L4TE 4MWFA 3FCTB 2AEWA 4ODHH 4NQED 1SEBA 5C0AB 5IBLC 1DCLA 5ALBH 2EDDA 4OCNC 5ANMA 1MI5E 1KF9B 1IKFH 5EBWA 3QISA 3MRDA 5DJ8A 1MWAA 2BCKB 3LV3B 2Q8AH 4FFWC 5E5UB 5IJVA 5CD5D 3ARQA 4G3YH 4Y4KB 3BP7A 4P2QB 3GB7A 3IDIA 3KPRB 5T5FL 2P24A 4DJMA 2C1OB 5BS0B 5DZLA 4ZTPH 4OV5B 1N64H 4JQIH 1D5BA 4ODVH 3QSKB 4KUZL 2EDEA 2JIXD 5E6ID 2C1PA 3QA3A 2YPVL 4WNQB 3IVKA 4KRPB 4Z7WB 2K7QA 3O2WL 4P2OA 4GLRI 1KN2H 4MX7A 5IFHH 5D7SL 4V1DA 1A6WH 1OB1A 5AG9A 1KCRL 3W9EA 2HT3C 1LK3H 2DLIA 4O4YH 3ABZA 3UJIH 4UB0L 1N5YH 4OCWL 3X13B 4TQEH 4XCNB 1MI5D 3DSFL 3QRGH 5EIVA 3ALXA 3LAFA 2C4FT 4K9EL 2EYSB 3ARFC 2CRMA 3MV9A 2PO6C 2I24N 1MHEA 4MS8C 3RX7A 3GIZL 4EOWH 1KEMH 3QHTC 4J4PA 4NNPL 4XPAH 3A67L 3S8WA 2FB4L 5C07A 4C57C 2YD7A 4M6OH 2HMIC 2X4NA 3K4ZA 2QADD 3S9DB 1YECL 4O2FA 3TBYB 1WT5A 3N9GH 3OKOB 3PL6D 5DJ6A 4NQCD 1MCJA 3DX9A 3VGHA 3WJLC 4Z7NE 1OPGL 4AEIH 1ZVHA 4KJPC 3IDXH 5E8OA 3WFHB 4OFDA 6CGTA 2Y07L 3VFUB 3MNVB 4L8BA 4OZHE 5DDHB 1OHQA 3PHOB 2IG2L 3NGBB 5IBUG 3FB6A 4X9BA 3R1GL 3WFCL 3E1F1 4ZFZA 3LKSB 3DARA 1BOYA 3CUPB 1ZHKA 2BSED 2FEEI 4G9FE 1EMTH 1RD6A 2NY4D 4F8TA 1T7YA 5F1SA 1SJVA 5IW1B 1FNGB 2V7NA 3VFWA 2NY6D 1KTDA 3MRHA 1KENL 1X5LA 1XR9B 1J8HA 4YHOL 2F74A 5IQ9A 3MZTA 5T5NG 4ELME 2R69L 3OKNA 5HI5C 5DA0B 3LPFA 2GQHA 3GK8L 1CD1A 4S1DD 1BEYH 2HG5A 4Y1AA 1UEYA 3NIDE 4R26L 4JHWL 2WBJC 2H6PB 2D0HA 2AV7A 2HFTA 2ENYA 1YMHA 3ZYOA 1QKZL 3KJ4B 2ZPKH 3R8BB 1NDGA 1P9MC 2APBA 2Z8RA 3BWAB 3MGAA 4UUJB 5GISH 3MLTB 3W5NA 3NZ8B 3VXOB 5E8PA 1J1PH 3QXWA 3G6DH 3RQ3A 5F7FA 1JZ8A 3CSBA 5GRUH 2A73B 4BH7B 4EN3C 1NC2A 4HKZB 5HSFA 5ITFB 2VNCA 3UPRA 4GW5A 1S7SA 4U1LA 2ICES 5DC0A 3VH8B 4NZUL 5H94A 1OTSC 4Z0XA 2BXZA 2YUZA 5TE6H 5ENWA 4JZNB 3BVNA 4U6XB 1JGUL 4NQXA 4AQ1B 4AMKL 5E99H 5D1XA 3TPUB 4A6YB 1IGFL 3C6LD 3ZYZA 3MLWL 4S1QH 3Q6GH 1BQHG 5C1MB 3VWJD 4OLXL 3V5DB 2Z91A 5DD6A 1S8DA 3U7YL 1IGMH 2R4RL 1NC4B 4DUWA 5BXFA 1EXUA 3ARED 3O3DA 3QHZL 4LLMA 1HK6A 3D3VE 4HIIB 1JIBA 4XP4L 1G7QB 1U8QA 3KPOA 3LDBB 1KYOK 1WEJH 1M4KA 4ONHA 3K2UH 1EO7A 2BSRA 1MFEL 4FZ8H 1GZQA 1H3TA 1RIVH 3F8UB 1Q9KB 4X5LA 1MCOH 4HAFA 1LE5B 3I85A 5JHDB 2Q3AA 4DKFL 1JNHB 4RGOL 4XNUL 4LSRH 2PW1B 3MBEC 1MCEA 1T7ZA 3V7AE 1DLHB 1P4IL 1X6LA 5IM7A 1ZLWK 4Y4KD 1S9XA 1HKLL 1J05B 5I71B 5E2TL 1MHCA 4L8SA 4ETYA 4P3DB 4WHDA 4PBXA 1UXSA 1DJSA 3BP5B 2V2XA 3L3DB 4JM2B 5BS0D 2VIRA 1WICA 3DI3B 4YWGL 1LQSR 2ZOLA 5DJAA 4PV8A 2HLAA 3QDJB 3KWWA 2PTTB 4IRJA 2H32B 4G8IB 2AERT 3ZDXF 1MCRA 2BZDA 3QQ4B 1FVDA 3D3VD 5BZDA 2ICEB 1R5WA 3OKMB 3MJ9H 4UILL 1QEWB 4KRPD 2A9NL 3T3MF 4J3SA 3T09A 4JPKH 3ULVF 2CLRB 4NO0B 4FFZH 2FO4A 1OL0A 3GBLA 1QRNE 1CLYL 1RJZB 1QR4A 3QRFM 2XRAH 1MFAL 4JKWA 5D96C 4C83A 3VCLB 2R1XB 2CUIA 2O5YH 2OS7A 2WLZA 4GKNA 5GJSH 4DQOL 1EPFA 3MMEA 2QKIB 4CU7A 2GT9A 5JMOC 3OTTA 4ZUWB 5E6YA 3ZL4H 4W4OC 5T33L 3RWIB 4UDTB 3BMWA 3I6LE 1GIGL 2A9MH 3GSRA 3KXFA 4U33A 1MEXH 4N5UA 2A6IA 4X4XB 1OAYL 4RAUB 3ESVF 2DJUA 3MFGB 4MJ2A 4Y2DA 4FNLH 3TBTA 3MTRA 4E0RA 4XBEH 4PJIA 3TT1L 3A6BH 3R06B 1ZTXH 5D4QA 1QFWI 1OCWH 5JXEA 1YDPA 2FZ3A 2JTDA 5CIPB 4GS7B 1T7XA 4XPTL 2FATH 1PGRB 2Y5TB 3F7VB 1NDMB 4ZUVB 1OGAE 1J88A 3S88H 4X9HA 4PRNA 4KGLA 1P1ZA 1NAMA 4LASL 5TDOB 1I85C 4YAQB 4Y5YA 5IIEA 4MCYB 3RRQA 4Z78B 2IH3B 4BFBD 4PJHE 5GGSB 4XC1L 4YFLF 5C09A 2Z4QA 4JO1H 1QBMH 4PJ8B 1AD0A 1SYSA 4JB9H 5CJXC 2BVOA 3SGKC 4F9LC 2VDMH 3I6LD 1YEHH 4P9HL 3DHMA 1U8KA 1WLHA 3O2VH 4ONOA 3OGCB 4ERSH 5DRNB 3HFMH 2VDLL 1ZT7B 3FRPG 3I2CH 3T4AB 5D2NC 1CD9B 5EU4B 1VPOL 4NRYB 4TSAL 3Q6FA 3UC0H 4NQVB 4QHMA 4HFWB 4K55A 1DUZA 1NCDH 4IOIB 4QF1B 2R0LL 3O2DH 3QDMB 1TITA 5HYSA 2J8UB 1BAFH 1AD9A 1SM3L 1OGAD 3JBG7 1TNNA 4YNYB 1UB6B 4LSPH 5EU7E 1U8MB 2IMMA 3LSOA 1F6AB 4G7YH 1LP9B 1MCBA 4JFFE 2HLFD 3BAEH 3HI6L 2RCSL 1QTYT 4Y5XA 1DUYA 2EICA 4HPOL 3VXSB 1PQZA 4HS6B 4OSUL 1F4HA 5DWUH 2VXTH 2Q7YB 3QWRD 4IIQB 4L29B 4QRTB 2DQEH 1VFUA 4KDWA 3VD4A 4NRXA 2OQJA 3CFEB 1LE9A 3KLDA 5E0QA 1FZMB 1MCDA 3RWCA 2PTUA 3BO8A 5IF0A 3RUGA 43C9A 1BVLA 1OAUL 2H45A 3QDGB 2FX9H 4P23B 3JV4A 1JF6A 1MWAL 4ZQKA 5FCUH 5IMKB 1INDH 1EGJH 4P5KA 3NCJL 4J1UA 4Y2OA 3INUH 3HZYB 4NC2B 2AKRB 1F4XH 1BECA 2PYEB 3DMMA 5CP7B 3NCEB 1EHLH 4LLUA 3P4LA 3C8HA 4P3WA 4JFFD 1WBYB 3LEXB 2VZVA 5L2KE 3SEPA 2P4AB 1NFIA 4HXAH 1DBJL 5L8JB 2BSSB 1A9BB 4KKCC 1FGVL 1T5XB 4YGAB 4N8CH 1UM5H 4AT6B 5CCKH 2WMPA 2Y25A 5JHDD 3B43A 2NY0C 2WUBH 3L3KB 1V3LA 3MR9A 3LMJH 5JORA 1F97A 5TF0A 5F93C 2VYRE 2VDKH 3FB5A 4PGJA 1C5DA 4CMMB 5IG7A 1GOFA 3F7PC 2X4UB 5CEZH 1F90L 3S34H 2HRPL 5ESAB 3SBWC 3U7WL 3DGGA 3T0BA 4NDMA 2CK0H 1GZPB 4HAGA 2WIIA 3EYOB 1PDKA 1U95A 2ARJA 4Z7UB 4FRWA 1YY9C 3WIFA 2VAJA 3OG6B 4HS3A 2AJVH 5ISZB 3MJ7A 5BOPA 2ERJC 1N5AB 2QLVB 1U8PB 4S1RL 3RVWD 4DKEL 3HRZA 1AHWC 1FRGL 1G7MA 5DLML 4NO0D 5D2LF 3MRJB 4PJDB 5DGRA 2DTMH 4RMRA 5DRXA 3GMRA 4GAYB 3GRWA 5K9KB 4U2ZA 5F89B 4CBPA 3K4AA 5JW5B 1RHFA 4MNQB 5IBUB 1NCBL 4KTDL 5D1QC 1OF2A 5EOTB 4ZO6A 1Y6MR 4QY8A 3WLBB 1C1EH 1INEL 1NGWB 2HTLC 3MJ6A 4UV7L 4K2UH 4LKXA 1A2YA 2XA8H 2C5DC 4EUPH 3O0RH 5HGDA 3RUGF 2DQFA 4QXWA 5F6IC 3B3IA 5E70A 5LKNA 2BVYA 5DC4B 2ICWI 1G84A 4O5LL 4JFYA 1IZKA 4X99B 2HFGL 5KVGH 5I18H 2ARWA 5KVEH 3TCLA 1DLFH 4UU9A 1B2WL 3T04D 4ZYKA 3BDYL 2DYPA 4GKZB 2J2ZA 5I6XC 4ZXBC 1P4BH 1UM4L 1PLGH 5CAYB 3MX0A 4GAGL 3ARFA 1NCCL 2PO6A 3G5XA 3WHE0 4KV5F 4YHPA 3VWKB 3WDJA 4OZIE 1M71B 4WENB 3UXFA 1JF1A 3V4PL 3TFKC 1CGXA 5EC1A 2IBZY 1FLRL 5MENB 3MLSH 3BUTA 2I9TA 2NW3B 2VJXA 3WJLA 1IGTA 2GTWA 1DDHB 4OM0H 4WFEE 3RNQA 3WUWA 5HGAB 4WV1B 4S2SB 3FOLA 4ZS7L 5I1IH 1U42A 3ZTJH 2HFEB 4XMPL 5H2BB 2F19H 3TH3T 4JGUA 4Y4HC 2Z92B 3VFNB 2WV3A 4NWTL 3JWDH 1A0QH 1UKTA 1G7HB 4U1JB 1FP5A 3PWNB 3ZZ1A 4NUGL 4I3RL 3QDMD 5D7LE 1J87A 4JG0H 2OR8A 1MCWM 4UTAH 5I0DA 1FH5L 3BE1L 4LLVA 5L6YL 1FFOA 5TPWL 5E8NB 4DTGH 4G5ZH 1MY7A 2VLKB 2CJUH 2HJFA 2M8XA 1KJVB 5ICXA 4P2RE 4MVBD 5J11B 4MAYD 5EUKA 1BQHB 3RWFB 2BNUB 4GRLC 1CGWA 4DZ8A 4Z7VB 3PDOB 1PEZA 5MHSD 5DHVA 2WBJA 1OARL 4JKKA 4R8WL 3KYOA 3NCYP 5KSUB 1OAQH 1P9MA 1R3KB 1ZS8A 1C12B 2J1KA 3BZFB 3RAJH 1IEAB 2R23B 2GHWB 4G6AD 3SDXE 3DRQB 3QEGL 2Z31B 4XI5C 4D0DB 1RZKL 2JLLA 1G9NC 3CXHK 1UFUA 3P30H 2VDNH 1V7NH 3OSKA 4KJQD 2OL3A 5KOMC 2EYRB 1W8OA 5DFTA 3QDGD 1BWWA 3MLRH 4N0CC 4P23D 1HE7A 3L3IA 4EN3A 4R97C 3SKNB 2H3NA 4JPIB 4M1GH 4JDTL 2BFVL 4KROB 2W9EL 4CU6A 1LDPH 3DVFA 4LLAA 4U7MA 5CP3H 3QZWG 3X11A 4NQDE 1VCAA 3L5JA 4G80A 1S9WA 4HZLA 5CGYC 4I8DA 1JHLL 4LP4A 2ZJSL 4NZRL 4TOYH 4OM1H 2B5IC 3U0PA 1OAZH 1ZHLA 3GHBL 5C7XH 3P4MA 5TFSL 5IJKC 5I1HH 4LRIC 3LN4B 3SGDH 1DBKH 4TUJA 1H8NA 3WNNA 4NRZA 3VXMA 1KULA 3VJ6B 4D0CA 4K94C 1MQKL 4L1DA 3SO3C 1FVEB 3MOQA 4KQ3L 5D6DC 2FEEL 4YHYB 2FHFA 1RFDH 4TTDD 5F9DC 3VXTB 5LGHH 1QA9A 5DR5H 4R4FL 5C0ND 4OF8A 4LIQH 1TZIA 5FM4A 5CHNA 1FGNH 1N6QL 3EOYG 3CU1A 3D69A 2EXYC 3MOBH 2P44B 3VMPA 1AQDA 1GPOL 5I9QC 1S5IH 5DJYA 35C8H 5J9PA 1AGEB 15C8H 5HDLA 1C5CH 3DSNA 4J3OC 4RRPG 4M61A 3QI9C 4WHCA 5I8KH 4DVBB 4ZS6C 4K8RL 5GGUA 3NIFF 3CZFB 3VG0L 3MCKB 2ATPB 1AQKH 5I1JL 3O3BB 3CXHJ 5AWNH 3ARBB 4OJFL 2JELL 3HZVA 4U3CA 2OM5A 4Z7OF 3C9NA 4Q58C 4JO3L 4LCIH 4XCYB 3PJSB 4PTTB 2VXSL 2PCPA 1NAML 3UO1L 1RZFH 4JY5L 4XNMB 1YNLH 5FF6B 4KI5E 2AJYL 3VGDA 3P73B 4XVTH 1RV6X 2ZZUT 2QHLA 1S9YB 1OP3K 2R0KH 2DM4A