1H5BB

T cell receptor valpha11 (av11s5) domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
111
structure length
111
Chain Sequence
b'GDQVEQSPSALSLHEGTDSALRCNFTTTMRSVQWFRQNSRGSLISLFYLASGTKENGRLKSAFDSKERRYSTLHIRDAQLEDSGTYFCAAEASSGAWQLIFGSGTQLTVMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MURINE T CELL RECEPTOR (TCR) VALPHA DOMAIN
publication title Crystal Structure of a T Cell Receptor Valpha11 (Av11S5) Domain: New Canonical Forms for the First and Second Complementarity Determining Regions
pubmed doi rcsb
source organism Mus musculus
molecule tags T cell receptor
total genus 26
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h5bB00
1QOKA 2YRPA 3FQUA 5ALCH 3WIHA 2NY1C 3MV7E 4LVOC 2Y5TB 4ZO9A 5KSBA 1JFQH 1FAIH 1PKQE 3BHBB 3BIKA 3DVGA 3T0BA 3WN5A 5KVEL 4Y19A 3BJLA 4JANB 5T5FH 3MRCB 2GW5A 3O6MH 3BUYB 3PWVB 3B9KC 35C8H 4O5LH 3QUZD 3CXDL 4P48A 3ME0A 2D31B 1SEQL 3TBSA 2Q8AL 5DUPH 5MP6H 5BCAA 1M1SA 4EQ2A 5MEQA 1BJ8A 1IBGH 4LGRB 4RWYL 3PL6C 5E8DH 1BD2D 2OBGA 3QFJB 4AEFA 4BH8A 2ED7A 1V3LA 1A7NH 4QRRA 3O3AB 4NYLB 1SBSL 4HC1H 5ACZA 5TPWH 5JNYA 4LIQE 4E0RB 5EBLA 2HT4D 3KJ4C 1VDGA 4GKNB 1UKTA 1E4XL 1NMBL 1FE8L 4KTDL 4OZIF 1FNEB 3TLRA 4L8DB 5JQHC 3IU4L 3QG7H 1NEZG 2HTLC 3DURA 1BZ9A 3RTQB 2XI9A 2YUVA 3RZCD 4WEBL 4UILH 1HKLH 4H8WH 2HN7B 1G7JB 4F7MB 2GTWB 1U3HD 4NZTH 4FQIH 1MHEB 2BSTB 3MLRL 4YZFE 1TVDA 5FHBL 1AKJA 4PGDA 4XXCC 4XI5C 5D72H 5K59E 2DIJA 5EA0H 1L0QA 4C56E 4KUZL 3P4MB 1OAXL 2I9TB 1MFNA 3RX7A 1IT9H 2V5YA 5DUML 1RUKH 1WSST 4CW1A 2GK0A 2AJZB 2P43B 1LEGB 3EJZD 1ZVHA 4C4KT 3U9UB 4WW2C 2QQKH 3T2QA 4B50A 4NC1E 5I71B 5IOPA 4YR6B 3D85D 1YMME 2F53E 3NH7L 4AEHL 3VXMA 2VLKB 4L29B 2WUBH 1ZLVH 1NCBH 5E8EA 1WAAA 4F58H 5LBSH 3VXSE 1ZSDB 3U0WL 1LP9B 1IILE 3UYPA 4YHLL 2W92A 5GS1A 4YNYB 2XFXA 4GMSH 3HC3H 3RGVC 4EI5B 3ZKMD 1JPTH 1OAZH 3TNMB 1XGUB 1T83A 3WLWC 1ZHNA 3BN3B 4N5UA 4NKIL 5IHUH 2YUWA 1CXIA 4UTBL 2F54E 4GKSB 4C57C 4U1HA 4R0LC 5HHPA 4X5WA 3PG2A 2XA8L 5JHDE 3WE6B 1AJ7H 4Y16C 4P2OB 4I5BB 2D7MA 4KUCF 1JF1B 1F6AA 5MEOA 1TJGH 4Z7QF 4U6XB 2EIZB 1IGFL 3LQZB 1D5XA 5D7LE 3ARQA 4UBDC 1QFHA 4ODVH 4TTDD 3ZTNL 1INDH 5TH2A 1FH5L 1PYWA 3FO0H 4JO4L 1CQKA 4Y4KB 3A67L 2R2EA 3WS3B 2AS5M 1PLGH 1I8KB 3D39B 2J6EA 3IDUA 4X4XA 5TE6L 3L3JA 1FPTH 1B4JH 4W6WB 2BK8A 1CU4L 5DLML 5TE4H 3SKMB 3K80A 4XCNA 5J57B 2ICES 2ZCKL 1KFAL 1QEWA 5D1QB 3IDNB 4D0BB 4RGOH 5FM8A 2AI0H 2BNRB 1AI1H 1WIOA 4UNVA 1CR9L 3RL2B 3RVUC 2ADGA 3C2SA 1F4AA 5E8OA 5DGRA 3Q5TA 5IW6B 1ORQB 5SWSB 4BQCA 4CVXB 4OF8A 4LP5A 2DYPD 4MX7A 3C8KA 3H6JA 1N7MH 3ZT7A 3T8XB 4LBEB 4ELMB 4PLKC 3U83A 3BP7A 4N9OB 3FQWA 4M61B 3TBYB 3DVNA 4APQA 2ED9A 2OI9C 5FUOL 4JM2A 3SGDI 3WJLC 4FG6D 3SDYH 1YPZE 1CDHA 2CPCA 3TN0B 4PJBA 2NZ9C 4UV7H 4PJ8A 1I7UA 4LIQL 2BOBB 2R1XA 2PO6C 4RGNB 3SGJA 5I8KH 1N59B 1UWEH 5D2NB 5J3HC 1F4XH 4JREB 1NGPH 5I19H 1NLDL 5J11C 1QSFE 1RUQL 4KVNH 2Z31A 3TT3H 4N8PA 2IH3A 1QRNA 4ZS7H 1NANI 3OJDA 4RFNC 4GQPH 1O7VA 4Q0XL 5EOCJ 2MPAL 3R8BB 4G43B 1GOFA 4JFPA 2XTJD 1G9NL 3QEHB 3HG1E 4HLZH 2X6MA 2I24N 4NGHL 4Y5VC 5JIKA 2A6DB 2E27H 2I25N 2ZUUA 1V3JA 3L5XH 1JRHI 4ZOCA 4N9GA 3HS0B 2BRRL 3G6DL 5IVOA 4PJDE 1AO7A 5ESVA 1MLCB 5D9SB 2PW1B 4PJXB 3ZYIA 2HG5A 1JZ7A 5I1CH 3I2CL 4S11A 5DJYA 4OFKA 2PYEA 1JYNA 3BQUD 4LHUD 2DMCA 3VFVA 4TSBL 2VQ1A 5D2LE 5BRZB 3JBG7 5DVOA 3T3MF 4Z8FL 1K8IB 3H9SA 4YXKH 4GKZA 5FO9B 3ZT6A 3P30H 4R8WH 2VL4A 2AV7B 2HAZA 3VCLA 2EXYD 4FQLH 1R3JA 5I0DA 4EXPX 4YLQT 4M5YL 4XCYB 5D7JC 3QCTL 1IC5H 3BEVA 3SE9H 4L8BB 2X4NB 5DJ2A 2D7NA 4JPWL 1ES0B 4NO3A 3VWJC 1FZOB 3GIVA 1C12B 4POZC 5A3ID 5FDWA 1IL1B 1OP5H 3QAZB 5DFVC 5CEYA 3DXAA 3EDJA 4EZMA 3EO0A 3T08A 4IMKC 3OKKA 3EGSB 5KVEH 5GXBB 5I1HL 2VZTA 1AP2A 5E9DA 2BVUA 4PRID 3QCVL 2OZ4A 1VFBA 3D48R 3CXDH 4U1GC 4P4KD 5ABDE 3KPQB 3RY4A 5GJTL 1QHPA 1VSCA 4NSKA 3WO4B 1L6ZA 5HHQB 2Q8AH 3B2VH 2E3VA 2NX5B 4WVRA 3EYSH 3H2WA 3MC0A 1Z2KA 2Z92A 1XGYL 4QRQB 4RWYH 2IF7A 3V2AR 1VEPA 2VERN 1VKXB 2IEPA 2BSSB 4AT6A 5FM5M 5FKPB 1AE6L 2LE9A 1SBSH 4JRXA 4WUUA 2VH5L 4LLUA 1CE6B 5FV2A 1EVUA 1Y0LB 1AR2A 2KBGA 4ESKA 3QJFA 3F7VA 4GRWF 4MNGB 1FE8H 5ACMA 4KTDH 3HB3D 4JFDD 5BOZG 3F7RA 3UXFA 3BP4B 3C60C 4LASH 1MVUA 2NCMA 1NBYB 4WEBH 2NNAB 1V3MA 3DYMA 3NFPB 1T5XA 4YPGA 1HH6A 4IOFC 4ZUTB 3WUWA 5CJXC 1UA6L 4X6CE 4R2GB 3ARDC 5DEGA 4Z7NF 4JFHD 3STZA 1WJ3A 4W6YB 3SE4C 4ZUVA 3SDCC 1K8DA 2GSGA 3F65A 3MLRH 3VWKA 5JXEC 5FHBH 4YH6A 4PJGE 2DJSA 4ZUSB 4DN4L 1OY3B 1JGLL 1OAXH 4Z7VB 3EYFB 1JTTA 3O3EA 3VFTA 5DUMH 3BDBA 2KPNA 2G5BA 3D18A 1V8HA 2YEZA 2P47B 2DQCL 3AM8C 4N8CH 3GSXA 4MD0B 2P46B 3O4OB 1DR9A 2Q8BL 4X9IA 3KPOA 5HI4D 1ZHLB 5GGTL 5B8CC 3NH7H 4AEHH 1S7RB 2YXMA 4EEEA 1HCVA 4MA3A 2HTKD 3VXTA 1FL3B 5HI5D 4O2FB 2LAAA 1FLTX 3GMMB 4RGMB 3PGDB 3ZE0F 4YO0A 2WUCL 3DJ9A 1BQUA 1MCEA 3WYRA 3LKQB 4L3EB 3NVQA 3V6ZA 3BO8B 3T77A 4LSDA 5HYIA 3EUUA 4NKIH 1P6AB 4OGYL 1I75A 3SHSA 3FTGA 4NJAH 4UTBH 5HHOA 2OXGA 4XXCA 3A6CL 3HC0B 1YMHA 3AB0C 2GY5A 3BRGC 5A1AA 2VAAA 3KYNA 2R4SL 1MQKL 1FVDB 3ZSTA 5GRXG 3I6LD 3SO3C 5IB2A 4RX4D 3KS0H 4WTZA 3KYMB 3ZTNH 4Z7WE 5HGBB 1FH5H 3FO9A 4JO4H 3VXUD 1I3UA 3A67H 4WW2A 4OLZL 4QLRA 1OCWL 4XNUH 5TE6H 2BZDA 1OARL 1OP5K 1XF1A 5DLMH 2WAHA 2XV6B 4K7FA 4N0CC 4LK4A 1A4JB 5FYLE 2ZCKH 1KFAH 4BUGA 4YIQA 4L4TE 4H88L 4OIIH 5TDPB 2WBJC 5GRZA 1QO3A 4J1UB 5HDOA 1CR9H 2I60L 5FA4A 3BMWA 1FNHA 5MERA 4PJAF 1C1EL 4WU7A 3D25A 1IM9A 1YC7A 1IC4L 5GS0D 2F58L 5FYJD 1VACB 1TVBA 2EDJA 3ILQC 3RUGA 2LABA 4EUPG 4EOWL 5BVPL 1LE9B 3VDAA 1HN1A 4OFYA 5GPRA 4OM0H 5KSBE 1KJ2L 3FOMB 2IANA 1YY9D 2ATKB 2H6PB 3PDOA 2FSEA 5L2KA 3W5MA 2Y23A 3QO1A 1EEYB 5B3NA 3SE3A 1QBLL 1QLRA 2VLJD 1NFIB 4Y19E 4MDJA 1RUQH 4OCWH 3B2UC 2GCYA 1K9TA 1IKFL 3LV3A 2CXGA 3IXTB 5D5MA 2GJJA 3DIFB 4CNIB 1MHCA 1VENA 4Q0XH 4NOBA 1FCCA 2MPAH 4J12A 1S7UA 5INCA 3RWIB 1N5AA 3ILPA 4GRLB 2C26A 2VLLB 1RK1B 5K9JL 5CBAA 3AXLA 4NGHH 1YEHL 3QUYA 2PTVA 3MRHA 4OLYL 3FO1B 2AXFB 3SY0B 1KJMA 2BRRH 1V7ML 3G6DH 5D7IA 1A6WL 1B88A 4M02A 1I9EA 5FKAB 5F1KC 5HHXH 4JEGB 43CAB 2YXFA 4RA3A 1KEML 3LKOA 4QGYA 5IMOB 4TSBH 4X7EC 2PXYC 2B2XL 3LS5H 1HYSC 3UCRA 4Z8FH 5DD1L 3U48A 1MNUL 3G6JB 5CD5C 1L6XA 5LCVH 3V6OA 1RFDL 1MCWM 1J12A 4AQOA 3CCHA 4KWUA 4QTHB 5E1AA 1KB9K 3TCLA 3QI9D 3QCTH 1BFSA 3NZ8A 3U1SL 3UTPD 3B9VA 3BFOA 2UVEA 2NY3B 3WKNA 1B0RA 3LPFA 4MZ2A 1I4FB 5J7CC 4IEFB 5EBGA 4TPRH 1RD6A 1KT2B 2Z93B 5I1HH 4ONHA 2EDLA 1CD9B 4WGWB 4F7EA 1HIML 1KCKA 2V5MA 3VXME 3W9EB 3IRZA 3UPAA 4QHUA 1RK0A 3HZVA 1WAAE 1ZS8A 3U82B 1SQ2N 3GHBL 4FXGA 4PJ7A 4CVZA 3OJMB 3BSZL 1XGYH 4HX1A 4QHNB 4P9MH 3STBA 5FHAL 4XVUC 5FYLL 3O2WL 5T1KD 2H2PC 3MXVH 3RX5A 1MI5B 5HYSA 2G5RA 2CDGA 2X1XR 5FK9A 1F6FB 3OKOB 3QDJB 1DBBL 2WK2A 4IS6A 1HILA 5HI3C 3VXQA 2R29L 2E7LC 5T3ZE 4JAMB 3OAZH 2YN5A 5HHMD 4YAQA 3NIDF 4P5TC 5H2BA 3GGWB 4MMZC 2VIRB 5LKNA 2APVA 5ICYA 3FRUA 1UA6H 1S8DB 3BPCA 4NNYB 4OCYL 5I76B 3OJ2C 4DN4H 3WIHL 1G1YA 3BI9X 2DJUA 2D9CA 5C0ND 5BJTB 3OMZA 2CR3A 2YD8A 1KXTB 2VDRH 1T04A 4Y2DD 4LDOB 1NJ9B 1MHHA 1U3YA 5EUOB 4R4BA 4P4RB 3MFFB 1R5IB 5D1ZD 1RUAL 2Q8BH 4RMVA 2ESVB 3DHJA 3VGBA 5KW9H 1QD0A 1S3KL 3QIWB 1OSPL 1ADQA 1U8IB 4NN7C 4QOKA 4U7MA 1DVFB 1J11A 2J4WL 2XTLA 5IKCA 3B9AA 2OQJA 3IDJA 2Q87A 3RVTC 2E8ZA 1QNZL 4LCYB 3H7BA 1DEDA 2YD2A 4H20L 3G9AB 4PG9B 3GK8H 5EU5B 3O4LB 4O58L 1FQ9C 2DWDB 4LLWB 4WHYG 3DX6A 1T6WA 4N0YL 1A3LL 4BK5A 2WUCH 3JV4B 3SDAD 3ZT5A 1FFQA 3QXUA 4OZ4B 3T0EE 1DQJB 2VR4A 1FYTD 3RWHB 2DLIA 3S5LG 1I85C 2DBJA 2KH2B 2ZG2A 3QIUC 4PJBE 5IHBA 3TIEB 2XWTA 4JZNA 3I9GL 4NBYB 4KK8C 3SE4A 5C92A 3SDCA 1AH1A 1Z9LA 5C09A 2NY4D 1T2JA 3A6CH 4DAGL 5E5UB 1BBJA 2IPKA 3VFPB 2H8PB 1OTSD 5C07D 2CLRA 3NN8B 2UWEA 4TOYL 4ONFL 5IMMA 4KRPC 2R4SH 1QRNE 1M6OB 1MQKH 1A6TA 1Q8MA 1CDUA 4HCRA 5JTWA 3AM8A 2G75A 2J8HA 1JI2A 4OLZH 4LLYB 4ETYA 2RFXB 1KF9B 1JTOA 1OARH 1P2CA 3P9MA 1KJVA 4P23A 3EIFA 1YYLH 2X10A 1U8HA 4NQTA 3IJHB 1AO7E 3LS4L 4H88H 3PWPA 2X70B 3MV7D 4F15C 5DS8A 2I60H 1HH9A 3F12A 2PYEE 2W60B 1MCDA 3B8YA 1L7IL 1WICA 3U7WL 4XNMB 5HYEA 3NPSC 1RZFH 2OL3B 5GHWL 4OCSL 3H9SE 3GO1L 2YSSA 1ZKAA 4RZCB 2ADIB 3L5WB 4JN1L 1IC4H 1OM3L 1D5BA 4B0MM 5CZVL 4JFXA 4JFFB 4MNQB 5HBBA 4Q2ZB 5H35B 2NXYD 4O51A 4X98A 2ZOKB 3P9LB 2H1PH 4EOWH 4GBXB 4FXLA 4GXUM 1IQWL 4M6ML 1CFNB 4S0TD 1JNLL 1NCWL 1QQDA 4GAGH 4YHNB 2H32A 4D8PA 4YHPA 3HE6B 4U1KA 2VISA 2Y7QA 2BERA 3WFBL 3DXAE 5HPOA 1QBLH 1NGWA 1N5YL 4JFEA 4XPGL 2FIKB 5E9DE 4DZ8A 4ORZC 1ZHKB 4AEIH 5EFIA 3T4YB 5F7LB 3RKDD 4XPFL 5CEXB 4Z7OE 5KS9F 1IKFH 1MAML 3BGFC 4Y5YA 4LF3A 5F7YC 4QGTA 3OGCA 8FABA 3LN5B 4HPYL 1A1OB 1L7TL 5K9JH 1MCBA 2J6EL 4KK9C 4H26B 5EZOL 2XXMB 4OLYH 1U8KA 1DBKH 3RAJL 3QB7C 1LEIB 1AGEA 3MV8A 1F00I 3DROA 1XGRB 4K8RC 4C56D 3RWDB 4JRXE 1A6WH 1IGJA 4UOW1 5EG6C 5FCUL 3DETC 5DJ8B 3OJVC 1KEMH 4H25B 3TO4A 3RQ3A 2BMKA 4IMLA 1FN4B 1BQLL 1Q9OB 3OV6A 1ZT7B 4WFEE 1NFDF 1RU9H 5FDYA 3UYOD 4ZDHB 3RPIB 4L9LA 1RFDH 1YMMD 1A9EB 2F53D 1NBZB 4MGXA 4WW1A 4ENED 5FAAA 4WENB 5E08H 1NGXA 3O2DA 3VXSD 4M7LL 2EECA 2D7OA 3QSKB 1IAII 2MCPL 5B22A 4Y0GA 1KLUB 5K9KB 1LGVA 5F7MC 1IGTB 1I3RA 3C5ZB 4RAUA 1NAMH 2P5EA 3N1GC 5KOVC 4I0PD 2XN9B 2P24A 3CZFB 2B7DT 1VB9A 5CEZE 4ODXA 1HIMH 4FQXB 3DGCR 4X9HA 1LO2L 4P46D 4P0DA 5DK0A 4G8GB 3KXFB 5JHDD 4P2QB 4AENA 2EC9U 1J8HA 3GHBH 4Z7UA 2O93L 4ZXBA 1FGVL 2ZUYA 3QWOA 1FZMB 1YJDH 3F5WA 3P4OA 2ARJQ 5D7LD 3ZE1F 1DUYA 4MXWL 5J56B 1B2WL 4FTVA 5CJBA 2BSRA 3ZDXF 4ZAKB 3O2WH 3JWOL 4M6NL 5F7FA 3TNNA 1DDHB 2EYSA 2WINB 5C0AB 5ID1A 1NCAL 1T5WB 5EZJB 1ZT4B 4BFBD 2P49B 4EN3D 3KLSA 3V5DB 3GMPA 3LRHA 3B5TA 2A2QT 4NHUB 1DBBH 4XBGB 1UZ8B 5AEAA 5B4MD 2R29H 4F7CB 2JCCF 3MA7A 3T0WA 1BFOB 4PY8J 5EUKB 2X4PA 3D2UD 3MCKA 3S34L 2DQUL 4XCEB 3UP1A 3KR3L 1CL7H 3O45B 3OR6B 4JKPH 4ZFGH 4ELKA 3MRNB 2R39A 2C3WA 1FIGL 3GIZL 3WXVL 4OCYH 2X89D 4ZPTA 2A0LC 2E5EA 5EOTA 3QA3A 1MCJA 1TZHA 2HMID 1A3QA 3H3PL 3JTSA 3K4ZA 2VXVH 2WQRA 3V4VL 1X5XA 1A9BB 3RP1A 4PRNB 4RNRB 3U46A 3TESA 4QEGA 4LLMA 3VXPA 1SEBB 1A1NA 3W82A 5JXAL 1MF2L 2DLGA 2DIBA 3SDDB 3C5JA 4IRSB 2ZPKH 4GRWH 5LAXA 2BVTA 1RUAH 3LSOA 3BD4A 3F62A 5ALBL 4XPTL 3MJ9H 2QADB 3MTRA 3TBWA 4NRYA 4U1SA 1S3KH 2NXZD 2RCSL 4MZ3A 2VKXA 5ESAB 2BVPB 3TO2A 1CICA 2J4WH 5SV4A 1QSFD 4Z0BH 4IRJB 4R7DB 1QNZH 2ZUTA 2ZKHL 4H20H 3IF1A 2V2XB 2J5LC 2W0FA 4CJ1A 4N0YH 5EBMB 4ODBD 5D96B 5IGXL 3FQXB 2R0KL 3HG1D 4G8EB 2QLVB 5ERWB 3ELAT 4JDVA 2F19L 3FL7A 1RHHA 2GSIB 1UWGL 4Q6YA 3I9GH 4LVHC 2IANE 3VGAC 2COQA 5KN5A 2EC8A 4ZNEA 1OF2B 2E9BA 4N8VG 2GITA 5I74C 4N5EC 4Y5XA 5JMOC 4MA1B 1RIUL 2ZWLT 4TOYH 1Z9OA 2DRUA 1UADC 1X3DA 3LN9A 5D5ME 1K3ZA 2Q86A 1ZHBA 2GUOA 3VFSB 2O5YL 3MLPA 3EOAA 2VN4A 4PREA 5EULV 2YMXL 3OSKA 2B20A 5DRXA 5CZXC 3M07A 3L3HA 5DRNA 4JFYA 3QDGB 2C3VB 1GGTA 3FQRA 4ETQA 2FJHA 3ARRA 5BZDB 2LAGB 1CT8A 1UB5B 5D7IE 3LS4H 4EUPH 3L3IB 5KVDL 5DJXB 3ROOA 1EIBA 4X6FA 3VFMB 2Y06L 4OD2B 2DI9A 4LDLB 2ADJA 1JBJA 1U8OB 1FG2B 3FONA 1L7IH 3MLYH 4HKZB 3U7WH 4UDUA 4JDZB 3DX8A 2X4QA 3TCXA 5GHWH 3QHTC 1I85A 4OCSH 4NQCA 5CSZA 1AR1D 4F7TB 3O6FD 4PP1D 1LDPL 3GO1H 4M8VA 3B6SB 3BZ4B 3DX9B 4JN1H 3TZVA 3V6OE 1OM3H 3WIIL 1D5MA 1KTLA 1KNOA 1DBAL 5I1JL 5CIPH 4NNXB 3CMGA 3WMSA 4PTUB 5K9OA 1F3RB 5HGAB 5KAQF 5IB5A 1MCSA 1IQWH 1RZ8A 4M6MH 1JNLH 1LK2B 1NCWH 3SQOL 1J0KA 1G6RL 1WWBX 4M93B 4QRPA 4RMWA 5TJWK 5GQBA 4KDWA 3CFEA 3D3VB 4HEME 3WFZA 3TIDB 2W59A 3UTTB 3WFBH 2V6HA 3HE7A 3Q6FA 2AXGA 1RZJC 5EU4B 3RWCA 4XPGH 3HMXL 1CDCA 2BC4A 2VDPL 3KNBB 3CC5A 3QQ9C 4GW5B 4XPFH 1MAMH 4OF6A 5KZCD 4MVBD 3VFUA 1Q38A 4NKOB 2E6PA 4PJ7E 4HPYH 4KGJA 2OK0H 1L7TH 3QUMB 1F4YL 1MWAL 3ZHDA 5IV2B 3KHOA 4FRWA 1IKNA 3BAEL 5EZOH 2V5SA 3J7HA 3B4NA 3MLXL 3RAJH 3JV6B 3RTQC 4LSRL 2V2WB 5DD3L 3QPQD 5FCUH 5DJ6A 3EYQC 3LAFA 2R2BA 3U4BL 4OI7A 4R26L 5FO7B 5L9DL 4JPIB 3KLHD 5KAQG 1BQLH 2CUMA 1RZKC 1CDJA 1X5KA 2ATPA 5C0BA 4UTAL 4AIXA 5E94B 3QJHA 2AJSH 4Q58C 1TZIA 4RQQB 1K4DA 3ZKND 4N0UA 2D0FA 2IJ0C 5KSUA 5JW4Q 1ROWA 3NMEA 3QUZB 5FB8A 5GGSA 5I71C 3CLFL 4BZYA 1GIGH 1CD1B 3CMOH 4KTEH 3S37L 4S0SD 2YD1A 4HUUB 4DOHE 1F42A 5T3XE 2EEBA 2MCPH 5MEPA 4UNTA 4QF1B 1A1MA 5DJZA 3KYAA 3FB8A 3BP6B 1BD2B 3SBWA 5HPMB 1LO0H 1QR4A 4L1HA 3I6GA 4WI3A 4EI5C 4NKDA 2CJUL 2PW2B 3QH3B 4DVRH 4R90L 3GUTB 4QOKE 5HGHA 3I6KB 5DEFA 1YECH 4TUOA 3G5ZB 1UYWL 2BVOB 3NZHL 5JW4M 1AIFA 1FGVH 1XR8A 3PQYA 3P0VL 5F7NC 4FFVC 1Z9SA 3RZCB 4J3XA 3BKYH 1B2WH 4MXWH 4P2OC 2W0LA 3JWOH 4M6NH 4PJEA 2O61A 3P77A 1CLYH 1EA9C 1EAPA 4MXVF 1U3HB 1Q0XL 3IDMA 4R7NB 1N8ZA 3QR2A 3CFDB 5CS7A 3NCYS 5I66A 3LB6C 3FN0L 4Y4KC 5CP3A 5DK3A 4KU1A 2FIRT 5FYLD 5C09E 1EZVX 1FJ1B 4DWHA 4L4TD 3X12B 1TZGH 2WM0A 2UWEE 4P9HC 5JLZB 1F11B 1H5BB 4M8QB 2DWEA 3QEQA 5TFSL 1CFTB 3QIBA 2DQUH 3KR3H 1A6AB 4JO3L 3KHQA 5GSRA 5CILL 1QHOA 5D1QC 2OJZL 4JG0L 1FIGH 4D0DB 1PEWA 5IK3B 3GIZH 2YA1A 3WXVH 4D9QE 2DQFA 3D85B 5F1IB 1FFPB 4OD3L 5D8JL 1I9RL 3GDBA 3E6HA 3VRJB 3MV9A 3V4VH 4HWBL 3QXDA 4U49A 4TVPL 1JIBA 4BSJA 1BP3B 1NCCL 1NAMB 3CH1B 5HDQH 5I1IH 1JZ2A 3WDHA 4XC1L 4WHYH 1UQSB 1MCPH 5JXAH 1NCUA 3PWPE 1QBBA 2A38A 4YE4H 4MCZB 2HFFB 2X4OB 5SX4H 5ALBH 1NUNB 4KZEL 1ZVSB 3TFKC 5F70A 3TN0C 1J5OL 2FHCA 4HUNB 4C55A 5IW1A 4OUUA 4Y19D 1TQBB 4OZHF 1EK3A 3QFDA 4RGNC 4JVWA 4IBLT 2ZKHH 2OTWA 2ZG3A 5D2NC 2D9QB 4JREC 1BX2A 5KTEL 5DHVA 5IGXH 5DYOA 4UB0L 4U1NA 1OAYH 1GZPB 4HD9A 3DI3B 3X17A 1U41A 1EMTL 2F19H 1UWGH 3O3BB 5KSAD 3MUZ1 4GG6B 1GOHA 3PNWA 3LDBB 4L4VA 5DHYB 2A6KB 3PV6A 4KDTC 4QRRD 2OP4H 4JFEE 3Q48A 1RIUH 5DVMA 1TJHH 1G7MB 1LILA 4ZYKB 4M43L 1WF5A 4WIQA 3IJYA 1HHJA 3ECBA 2BNUA 3TA3A 1S9XB 3LKSB 4UDTA 5JDSA 4XXDB 2CKBA 3HZMA 5B39G 1UJ3B 2DIAA 3VW3L 4H1LB 2EYRB 4X8XA 4PJ9A 2YMXH 2Y25A 2W65B 1KUMA 2DYPB 5T3XL 2V2TB 3G6AA 3IYLW 4OLEA 3RWFA 1SMOA 3MA9L 1CLOL 4NQVB 5DQJB 2NPLX 3MV8E 4I3GA 1AKJD 3OTTA 4HIJB 4GRWB 1RJLA 1SJXA 2EXWD 4OKDA 2EDRA 1NMAH 5KVDH 3RVWD 3WEXB 5BXFB 2IBZX 2Y06H 4O2EB 4CMMA 5FGBA 1BQHB 3ROLA 2A74A 2NLJB 3MRGB 3PIQA 4KZDL 4HGKC 4TUKL 1LDPH 4M7KL 1WT5A 4R4FL 1A6PA 1F13A 2CIKB 3QAZC 1IAIM 2BY3A 4LRNL 2GAZB 5D6DA 3WIIH 1LE5A 2XY2A 3VXMD 2X4SB 5F6HJ 3WDIA 5I1JH 2B1HL 4JM4L 5D7SL 5DSCB 5F89A 1R3IL 4S1RL 4O00A 3TBVB 3SQOH 1G6RH 1S7VB 1GHFL 2X05A 3DVIA 3PJSA 2XTJB 3WO4C 4X80H 3MNVB 4EI6A 1JGUL 5GRUL 4M00A 1DQQB 4OKVB 3DRQA 1JZ4A 1HQ4B 3EJYC 3EZJB 2MHAA 3ULSA 3HMXH 3HUJF 4GW4B 2BOCB 2M26A 4X7SL 2VDPH 1XCTB 1WBXB 4RIRB 5IVXA 2V5RA 5JO5A 4RSVA 3WFDL 5T3ZD 3T1FB 4GS7B 4L4JA 3HLAB 1J8HE 3BQUB 3HZKA 4LHUB 4Z7UE 1JYVA 3AUVA 4YGAB 4NT6B 1OLZA 1F4YH 1MWAH 1KN4L 3Q3GA 5E2VL 3O11A 4NKMA 1DL7L 2R23B 3MLXH 5GZNC 2JB6A 2D7QA 2M2DA 2EDNA 4FTVE 1XGPB 4G5ZH 4EUPB 4CN6A 5KOMC 5DD3H 4GG8A 1S7XB 2DICA 4HGMA 4R2GC 5DJ0A 3C08L 1KXQE 1N2RB 5IG7B 4CRPA 3U4BH 4X6DA 4OUOA 4R26H 5IMKA 2GJZA 5L9DH 5DO2C 4S10A 3BUYA 3PWVA 3SJVA 4DKDC 4GXUN 3DSFL 1T0NA 4U1JA 3TEUA 4HKXB 5CIPB 3MGTB 4JLRB 1JWMB 3Q0HA 1BEYH 2C3HA 4PRIB 3KS0J 3BZDA 3MRMA 3O4OC 5FO8A 1XF4B 4XB8A 4APQD 5I1KL 2VUOA 1QLEL 4JM2D 2W1NA 4NZJA 5E6ZA 1RJZA 3EYUL 4N1EA 4HFWB 4RGMC 2W91A 4NFCA 4PJ8D 4PJFB 2JJVA 4NQSB 2VZUA 2AEIT 4MSWA 2CJUH 3O8XA 3RTQA 4R90H 3TBTB 1MIEL 2V9TA 3MJ7A 4JE4B 5E7FA 5FFLA 3NA9L 2Z31D 1UYWH 1UC6A 2Y6SD 3NZHH 3PHSA 1QRND 1D6EA 3P0VH 3O3DB 2AV1A 2PCPA 3PGFL 2G2RB 3FT3B 1YN6A 4HJGB 4UIMA 3H9HB 2JJTC 5E99L 1Q0XH 2YBRA 3QXWA 2A77L 4ZNEE 2R56L 3FN0H 1G7QB 4G8IB 2QSTA 5FIEA 1AO7D 4YR6A 1XH3B 2FX7L 2AK4A 2C1OA 3IDIA 4KKAD 4OTXH 4ZMAT 2PYED 3U0PA 5TFSH 4UT9L 4JO3H 1I8MB 1KBGL 1EGJL 4DZBB 4PLJC 1P7KA 3H9SD 3K2MC 4GOSA 3RY6C 3E8UH 3GSVB 4UU9B 4LGPB 4OLUH 4OD3H 5D8JH 3C8HA 3PP4L 4WFFE 1I9RH 4H0IA 4P5MB 2X09A 4HWBH 3TNMA 3BEWA 4TVPH 1I8IB 3ZDYF 1NCCH 4XC1H 5HGGS 3SGDH 3UJJL 4OZFG 3LKRA 4KV5F 5B3JE 4WGVB 2AKRA 1T2QL 4JHAH 3OKMA 1U2CA 1RJYA 4AIZA 3WE6A 4JKWA 3DBXA 4KZEH 3DXAD 3Q1SL 1QA9A 1WTLA 5FUCC 4LKXB 3IDGA 4LRIA 1S5HA 4U1LA 2JIXA 4NQCE 4BKLA 3OR7B 5E9DD 4OLVL 5A2FA 4TRPL 3D0LA 4F33A 3BXNB 4N90E 3IAQA 1R24A 5I17B 1MJJA 1J1PH 2F15A 5KTEH 3MYJA 2IG2H 3GSQB 5CGTA 1U8LB 4L8CB 5KSVB 4ODTL 4QRPE 3RI5F 1EMTH 3S3PA 4QRTA 2DM3A 2X5PA 5F1NB 2VO5A 3WIFA 5DMIH 3CDYA 4I2XB 3VXUB 3IDNA 5F7DB 3FB6A 3LRGA 3TH2T 4GRLC 3WNMA 1T0MA 4S1DC 5JZ7C 3G5XB 5I8OL 5C0IA 4JRXD 4WUUD 1KPRB 1AQDB 3ESUF 4M43H 4HUVB 1EO5A 3BN9C 3DUUB 2DQEL 3SPVB 1IM3A 1RZGA 3T2OA 2APXA 4JM2F 4UT7L 4ELMA 1P4BH 3DMMA 1QR1A 3VW3H 5IVZB 1QG3A 3S35X 4WFED 3KWWA 2WANA 5JORA 2V5TA 3LKPB 3HR5B 5C3TA 2IQ9L 5I16B 3VWKD 1ZWIA 2C5DC 4C83B 2FL5B 4NWTL 5LXGL 3MRBA 3S5LB 3S3JA 5JOFA 3S35L 3ARBA 1PZ5A 4UT6L 3JVGA 1E27B 4NO5B 2NTFA 2QKIA 2NY3C 1T21A 5C0BE 4R4FH 1R3KA 5FGCE 4XAWL 4LRNH 1Q9LA 5CEZD 3RWGA 1K4CB 2VC2L 2VLJB 4JHWL 4KI5C 4Z5RB 4HWNA 2P8LB 4M7ZB 4R3SB 3TPUA 4N0UE 2B1HH 4JM4H 2X4RA 5D7SH 3ULUE 4UMGA 2GQHA 1VADA 4YK4B 1R3IH 1HHHB 4MQXD 5IMLB 4Q9QL 1GHFH 5A2JH 4U6HB 3INUL 1JGUH 3GI8L 1MLCA 4XPHL 5GRUH 3KPPB 3DTXA 2IWGA 2R4RL 3BWAB 4HIXL 4X4YB 1NCNA 4X5XB 3O6LL 4ZS6C 5DMKA 5EOCL 4HSQA 2WLYA 2VL5B 2OJEB 3ET9F 2R2HB 4FQHA 5TDNA 1P84K 1HKFA 4HPOL 2LFGA 3IB4A 4X7SH 5AD0B 4MS8D 1IEAA 4WHTA 5EO1A 3IFPA 5HHOD 4EVNB 4JO2H 3WFDH 4H5SB 3U4EB 3EFFA 1KULA 1UEYA 3CU1A 1CLZL 4XCYA 4MQ7B 3UYRL 4PR5B 1DLFL 5E2VH 1DL7H 1H8SA 3KLAA 2A9MH 4PV9A 1FZOA 2IAMB 4PJEE 4KQ3H 1T3FB 4FFYL 1SBBA 5I1DA 1IL1A 1R5WB 5FECA 3QI9B 5DC4B 3MPCA 3EGSA 4HDIA 3QQ4A 2PYFA 2VDLL 3BVNA 3L7EA 4DFHA 2VR5A 3MACL 3PGCB 4HS6A 1RY7B 5B38B 1CXLA 4JZJA 2FR4B 4ZO6A 5JPNB 4PJHA 1MCNA 1R3LB 5C1MB 3QEQE 1CFVH 2DQGL 3OZ9H 1IM9D 3WLWD 2ITDB 3RNKA 5IB3B 3TV3L 3SN6N 2WQ8A 4HUXB 3CSYB 3QDHA 3EDEA 2NW3A 3VFRB 1CGSL 4YDKH 3MV9E 2DQTL 3QIWC 1QLEH 1YNLL 2IBBA 1L9NA 1DVFC 1Z5LA 3V5HA 1GJIA 1REIA 4OCNC 4I48B 1E4KC 4OFYD 5EC2A 3V5KB 3E2HB 4YFEA 2IAND 5T1KB 4EQ3A 2OTUA 4P3DB 4LLQB 3JSSA 5L2KD 3BP4A 3MRDB 1KPUA 4BZ2L 3PUCA 4AG4H 4CVUA 4NQDA 1MIEH 2CDFA 3WFEH 4NZRH 4OZGB 1DQMH 1G6VK 5BV7B 3VI3E 5HHMB 4RMSA 1NKRA 3C5SA 4ODSL 3QUXA 1FNLA 3BX7C 4G6ML 2GTZA 1A14L 3IU3A 2HLAB 3SCMB 5E99H 1S7WA 3QUYD 3QZWG 4I4WB 4UOW0 1FL5B 1JNHB 3MUHL 3UX9B 2A77H 3ARXA 4L4VE 1YUHB 2R56H 1WQVT 4AY0A 2HJLB 4LSQH 4MWFA 3ZHLA 2FX7H 4PLKD 3U7YL 2V17H 3EOBA 4Y2DB 3LRSA 3G08B 1QACA 3HCVA 3PDGA 3PWNB 5D1ZB 1KBGH 1EGJH 3D1MC 5JA9A 4L3CB 1YEDA 4FQCL 1GPOL 4HIHB 3LKQA 2A73B 3FB5A 3V6FB 5J3HD 1MJUL 2YPLA 3OXSA 1F4WH 1U8NA 2XA3A 2EIBA 4HC1A 4AZ8A 3MLSL 3WUWG 1N6VA 1URLA 3RWJA 1RAMA 1KLGB 3GSNL 2AJ3B 3PWJA 5E70A 3SDAB 2DKSA 3SDXA 4U7KA 5JW4N 4DTGH 1T2QH 1FYTB 4XNZB 4GBXC 2D7TL 2YRZA 1E0OB 1RZIA 1HHKA 3P2TA 4K8RL 2EYTB 4UAOB 4F2MB 3HE6C 2R9HC 1LP9F 2VWEE 2GK2A 5ECJE 4MAYA 2NY4B 4GLRH 3K2UL 3G5YA 5EU6A 3ZE2E 3BH9A 5CGMA 4RAHA 5AZEH 2XNAB 5ICZB 5C07B 1GGIL 5BMFL 3K8MA 5F9WB 5C0CA 4NBXB 2FECL 4CMHB 1CVRA 5I15L 3KAAA 1C7TA 3QEUA 3D6GA 5GIRB 4BELD 1KCRL 4XBEL 4OGAC 1ZLSL 4J1UA 5CBEB 2X4TA 4FXKB 1WWCA 3H3BC 4XBPA 5SX5K 5I8OH 3NCJL 1IQDA 4Z95L 1BVKB 1KEGL 5HD8C 1MUJB 1MFEL 3U36A 3UTSA 2DQEH 3RBSA 5KG9A 5IVXE 4FMFA 4OQTL 3RUGF 3UJTL 4PRHA 4F3FA 3MV7B 5IEHB 4BQ9A 3N1QC 1S9YB 4NN6B 1PKQB 2BHZA 4WEUD 2ZOLB 1YC8A 4E5XB 1JHTB 4ZOBA 3T0XA 2VUYA 3IETB 2OMNA 5F93C 3WJJC 1WZKA 4PRDA 2IADA 2EH8L 3CX5J 4J23A 2IQ9H 2CUHA 3NBNA 4ORGB 4NWTH 4WO4A 2W9DL 4Z18A 4DKEL 2CLZA 3DYOA 3VFOA 2FJFB 4JY4A 2NXYB 3RFZC 2HKHH 5T3XD 3LN4B 1I9JL 3S35H 4KROD 1PG7W 1CK0L 4NRXA 4J4PC 3SJVE 4UT6H 1P4LA 3RIAK 4KAQL 1LD9A 3DIFA 2EDKA 4XAWH 4WI5A 2HJKB 2PN5A 2VC2H 3C5ZC 4JHWH 4QRUA 4PGCB 5L2JB 1LMKA 3HRZA 3C9NA 4QOKD 1RK1A 1RHFA 3VFWA 3L5IA 2Z0BA 3LEVH 3UPCA 4FQXC 2K7PA 3NABL 1GSMA 3QFJE 4M3JA 4MD4B 2AXFA 4OIAA 4KY1L 3C6SB 4LSUL 3GI8H 4RMRA 4XPHH 4U2ZA 4OM1H 4JQXA 2R4RH 4P2YA 1YY8B 3HNVL 4HIXH 4O2CB 3O6LH 1UG9A 5EOCH 4YEEA 5DURD 4HKJB 4U1IA 5EZIL 4CN1A 4Z77A 4ONGL 1X9QA 1CDIA 4HPOH 4IOIB 3L5HA 2H26B 1LQSR 3MROA 4ZAKC 4C56B 2J7LA 3SDCD 5C09D 1PQZB 2BXYA 4LCWA 4TVSa 1TTGA 3MGOB 2OXHA 2NY7H 4EDWL 1CLZH 3UYRH 4D9RD 1J0ZA 4HS3A 1DLFH 2DQJH 4D9QD 5DQ9B 2Y4SA 1YMMB 2F53B 4NDMB 4PJXF 4MQSB 3O9WA 4WHDA 2FO4B 3I3BA 4G42A 5ANMB 1T20B 5CJ8A 3VXSB 3AY4A 3ES6A 4P23D 1I1FB 3V52H 2VDLH 1W0WA 3V4PL 1FO0B 3MACH 5E00B 2HT2D 1P53A 2AK4E 3PWPD 2DKUA 1BAFL 3DV6B 4PRAB 5F88B 2O26U 3E1F1 4I0PB 3SKJH 4X9GA 3SDDC 1GZQB 4IRSC 4NQXA 3TV3H 5EH1A 5IB1A 3OXRA 3BYTA 4P46B 4YUEL 1CGSH 3ZDZE 2P45B 2QADC 4KK6C 1XGTA 4R97B 2P8PA 1K5NB 5JHDB 4LNRA 3VRLF 2NYYC 5JW5A 5LQBL 3EYVB 4Y7MA 3MLWH 4IRJC 1WFOA 1QBAA 2YK1L 4R4ND 4XPAL 5D7LB 3N1PC 1M71A 4OSUL 1E6JH 2VTFA 4GRMB 1JGDB 5E8PB 5B21A 3CVIH 5D96C 5F7KC 1EJOL 4BZ2H 3S88H 4DN3L 2P5WA 4QT5A 2Z35A 4EN3B 2BSED 4FMKA 3BIAX 3UJIL 4JFED 4KKNA 4WFHE 4Y4HA 2IQAA 1RUPL 5T1MB 5CKAA 3QHFL 4PTTB 4K94L 1ZMYA 4JY6B 4YHIA 4WJ5B 4UQ3A 5I76A 4MA1C 5H94A 1WZ1L 5K9QG 1W72B 3D2UB 3ORJA 4M6AA 3NCFB 3NIGE 4PJ5A 2EDXA 4G6MH 2Q76A 4KKCD 1A14H 1YQVL 2A83B 3VJ6A 3CFKA 3BW9A 3O41A 5F7EL 1VHPA 1AQKL 4XVJL 2HFEB 3G04A 5BQ7A 3MV8D 5DRWB 2G9HA 3RPKA 2DBLL 3CVHB 4OCRL 3U7YH 3M17A 4PGEB 4OZFH 4G7YL 5BVJB 5FF6B 3TO4D 3GMLA 4QY8B 3GJEB 4ELME 4CL7A 4LCYA 1RZJL 4U6YA 1TXKA 2VOTA 1UXWB 3MMEA 1QSVA 1LO4L 2DWDA 1MFCH 1G7LB 2NXZB 4Z7VF 1GPOH 4YHKL 2JJSC 1QSFB 3RWHA 3ZSSA 5HDLA 3RIFK 5IF0A 5CJOL 4NQEA 4HHAB 4WWKA 3L3DA 3VGFA 3BDYL 3VFNB 1RMFL 5IJVB 3MRLA 3GSNH 3HNTH 4M1GL 5D2NE 1MCQA 1OTTC 4FNLL 2GHWB 4UIKL 2L4OA 3HG1B 2A6IB 3D69A 1CE1H 2D7TH 1TVHB 2LV4A 3GSWA 1XF2B 2P5ED 1G7PB 5HDBE 3QQ3A 4M93C 4MXQD 3GSUB 1HZHL 2FYYA 4P3WA 4ERSH 3GJFH 4LFHD 3K2UH 1I1YB 4KJYB 4PJDB 1JUFB 1DQLL 1A6UL 1GGIH 1VFOA 4OAWA 5BMFH 4HZAA 1NC2B 3FT4A 2A9NL 1RZKL 4HKBA 4D3CH 3V4UL 4PY7B 1J8HD 4S2SA 4U1MB 3TJEL 5IQ7L 1FDLL 4ZXBD 5I15H 5D2LB 1BOGB 3T3PF 3FQTA 1KOAA 1LNUB 3QNXB 4XMPL 4XBEH 4OCLC 4FTVD 4GSDL 2NR6C 2DTMH 5D70L 4KPHL 4ZFOA 4TNWK 2W60A 3NCJH 1NDMA 1KEGH 3JUZA 2VE6A 3FQNA 1U8QB 1KC5H 4GFTB 4XHQA 1MFEH 4WDIB 3W2DL 4QYOA 4OQTH 3DX7A 4PJIA 5MHSE 2KZ1B 3GB7B 1BF8A 4ZQKB 5TDOB 4WEMB 3W11C 1ZGLA 3L9RB 4K07A 2VNCA 4A6YB 5IFAH 4LLVB 3MBEA 2HWZL 3X14B 4J7RA 1WCBA 3W39B 2EH8H 4YHNA 1C5BH 1I7TA 2AJYL 1HXMA 3KG5A 1T22B 1MCFA 1MCIA 2W9DH 7CGTA 2ZZUT 4CU6A 3UZQA 5FOBB 4RCAA 5IBLD 4LEOA 1I9JH 4UUJB 1A22B 3AU1A 1CK0H 3QUZC 1DSFH 4KHXH 5F21B 3BGMB 5E6IA 2P8MA 3X13B 3RU8L 1K2DB 2W9EH 5HY9A 3QO0B 4XPBL 5HJ3A 3P73A 3HPLB 1TIUA 1QPPA 2KKQA 4J3UA 1CICD 1WLHA 3LKNA 1KIPB 2QQLL 4H26A 4P9HL 4MJ6B 1K3IA 1CGWA 2APTA 4KUCD 3ARFA 5CGYD 2EH7L 5KZCB 2DQHL 3NABH 4OGZA 1FFNB 4X9FA 3RDTA 5HYFA 5F96H 4KY1H 4LSUH 1YQ2A 4FFWD 3RWDA 2ITCB 2HT4C 3HNVH 3QT2A 3WSQH 4X6CB 4ZFZA 1D5ZA 2EDBA 4OLXL 4ONGH 3WJJA 3HAEG 1JYWA 3RZCC 2RJMA 4PJGB 4V2BA 1AD0B 4BSWB 4Z0XB 1NLBL 4M03A 4N0FB 4NQDE 3RPIA 4PJCA 2H9GA 1FVEB 5BW7A 4ODWA 4LARL 4UV4L 4EDWH 1BLNB 3U0TB 2J8UA 4D2NA 3ZKSD 1KIRB 4U3HA 2XPGB 4UOJA 4HV8A 2D3VA 4HWZB 1ZLUK 3N50A 4MHHG 1MCLA 4TUJB 4LPXA 1ZV5A 1H5BC 3K46A 4ZUWA 1J88A 3EJZC 5K9KA 3GBNL 4R9HA 5LGHL 1RSFA 3C5ZA 3BH8A 3D0VA 4M1CD 1ND0A 3RVTD 4ACPA 1Z0NA 1LEKB 4W70A 2OYPA 5F9JB 1KB5B 4RFEA 3G6JF 4W4OC 4KHTL 1KPVB 1BAFH 2BP3A 3OL2A 4NWUL 4QXUH 5C0JB 1SY6L 4QHKI 4K3JL 3U9PH 1FNGA 5EU3A 4XTRD 4NQCD 4EIZC 4G6AD 1M7IA 4QHMA 5C8JA 4FQ2L 4OGXL 3TZVD 5HSFA 5J9PA 2HJFB 2M1KA 2VSCA 4N90D 4YUEH 1WFNA 3MSPA 4X0KB 4QRSA 1Q72L 2J3SA 3ZKXC 2DL9A 2YPLE 3MJ8B 5LQBH 1DDHA 5F3HA 1GAFL 3VE0A 2DTSA 1R5VB 2QQQA 3B8SA 1BECA 1ZT4A 1TQBC 4KI5F 4PD4J 2AABL 2YK1H 2YD5A 3MRJA 5DI8A 3ZLQC 1YJDC 4QRPD 4XPAH 3IVKA 4OSUH 1Q94B 2GFBA 2XKNA 4YEFA 4ZO8A 1EUTA 4XBGA 4Z7WB 2ZUSA 4PB0L 3MLTB 1EJOH 5CJ5A 4XH2B 3V7AG 1YYML 32C2A 3WCYA 4DN3H 4WRLA 3HE7D 3MLUL 4OFVA 2DQDL 3UJIH 1EVTC 2AEQL 3ARSA 1R6VA 5CHNA 4CADA 4TTDC 1T1WB 2P7TA 3QHFH 2GJ6A 1X4YA 4NUJA 3LDBC 3QNZA 3NPZB 4JVPA 5C0CE 1WZ1H 1IGML 5ETUB 5IFJB 1MAJA 5IESL 3I02B 2OLDA 1JWSB 2F54A 5FV1L 3OG6B 4E42B 1YQVH 2BCKA 3HUJB 1EBPA 5F7EH 4XVJH 1UJ3C 1T7XA 3TWCL 3OKNB 1Q9WA 1UVQB 3PWLA 5SWQB 3ULVF 2UY7A 4M1DL 4OCRH 5EO0A 1H15A 4G9DB 3I84A 3UTSE 5ESAA 1NC4A 4G7YH 2J88L 3PHOB 3NACL 2PNDA 3FQUB 1BIIA 4PRHE 1NEZA 5KSBB 1I9IL 1HE7A 1FSKB 3BIKB 3DVGB 4FG6C 3T09A 4Y8DC 4KRMB 1G7IA 1X6NA 4GUPA 5F8RC 3WN5B 4PBXA 4YHKH 1IGYB 1GL4B 5D6CA 3ULUD 5GISL 5CJOH 2Y1VA 1BHGA 1A21A 1RMFH 4X7DC 2DD8L 3TBSB 3EHBD 4M1GH 4J2XA 2Z8VC 1P69B 1SYSA 4NCC2 2IPUG 5TQ0L 4JKLA 4WV1B 4RBPK 5MEQB 2WZPD 3DECA 3UDWC 1OT1A 3L3OA 1CTNA 5KSAB 2R0ZH 3VG9B 4XP1L 5F6IB 1HZHH 2XTJC 4BH8B 3VXRA 1HHGA 4QRRB 2JKXA 1DQLH 1A6UH 5JNYB 1JFQL 1FAIL 2ICCA 4K8RD 1RZKH 5EBLB 2F5BL 4JGJA 5I6XB 1C7SA 3TJEH 5IQ7H 2HLFD 1F58L 3PQYD 3QDGA 2C3VA 4LKCA 3DURB 3O6ML 4XMPH 4XCFL 1BZ9B 1FZJA 3BOVA 4X83A 4OZIA 4J6RH 4GS7C 4O5LL 1CG9A 5HTSA 4GSDH 5D70H 3L3GA 4KPHH 5GGTA 1FLRH 4ZTOL 1OVZA 5F1OB 1U8OA 2KZWA 3KVQA 1CGYA 2B5IB 1TCMA 5I73B 1AKJB 4PGDB 4XAKE 3W2DH 4KFZC 4X4ME 1U8PA 4LCWE 4MJIA 5ID0B 43C9A 4Y1AB 5C6TL 4CW1B 2GK0B 1KGCE 2YPKA 5CP7A 2QHLA 3QEQD 1A7NL 2MQ3A 3QIBD 2R0WH 3O2VL 4NPYB 1D9KA 5GGRA 5TPWL 1QSZA 5A3IC 1LK2A 2XQYG 4FZEL 3MRFA 4D0CB 3VXMB 4X7TA 3D3VA 3GMQA 1BF2A 1A3RL 5IFAL 4L5FL 3QG7L 3MV9D 5E8EB 1DUZA 4IIQA 5TGBB 3FHQA 4PLOB 4F9PC 1BBDH 1Q1JL 2ARJA 1KN2L 2XFXB 3KNBA 1JN6A 5HHVL 1J05A 2VZ3A 1PZUB 3GJFB 3RU8H 4HS8H 5C0DA 5EA0L 4XPBH 1ZHNB 2KQNA 4CJ0A 4Z9KB 2EDHA 2Q20A 4XX1E 1C16A 2ENYA 4OIBA 5AAWA 1GGYA 4YGVA 3AREA 3UPRA 1HI6A 1OP9A 4R96A 5FA3A 1U8JB 2EH7H 2DQHH 4U1HB 5HHPB 4X5WB 3WNLA 4DVBA 1S7QA 1MI5E 2DF3A 1TETL 4WU5A 5MEOB 1F6AB 4DUWA 5BS0A 2XWBA 1FBIL 1JF5A 3UTOA 3HB3C 1SJHA 1PG7X 1HQRA 5LBSL 5TH2B 5FO7A 1PYWB 4POUB 4WUKH 1VCAA 2R2EB 4L4VD 2P5WE 1AGDA 3CFBA 1NLBH 4X4XB 1MY5A 2A0LD 3L3JB 3CSGA 5J1SC 3W9DB 4RQQA 3ZL4L 1JPTL 4LARH 4UV4H 5ISZA 2IC2A 4PG2A 4XCNB 1T1ZA 4X8JA 3TA3D 1IAKA 1QEWB 4M6OH 1UENA 2CDEA 4TQEH 1T6VN 2XZQL 3HN3A 2RB8A 1DEEA 4NO2A 3LZFL 1H8NA 2ADGB 3GI9L 1U3ZA 1MIMH 4PJ5E 2Z8WC 1A5FL 4M62L 4PJ9D 3WFHA 5EU7E 4KKLD 5LGHH 4MX7B 3C8KB 1T89C 2VZ1A 5EUOE 5HI4C 4DK3A 5HPMA 4HK0A 3FQWB 3QPXH 2HTKC 3DVNB 4APQB 1DLHA 3K8KA 3BZFA 5EPMB 5GGVY 4JM2B 1INDL 3I75A 3QH3A 2QR0B 2DAVA 4KHTH 1PLGL 2HH0L 2W07A 3P3YA 1SY6H 4FZ8L 4PJBB 3RVXD 4PJ8B 1I7UB 1J7VR 2BVOA 2R1XB 3O4LE 1KCUH 4FQ2H 1LK3H 3TJHC 4OGXH 1ZK9A 5IROC 1Q72H 4HMCA 3MRQB 1GAFH 4WNQA 2Z31B 1FORL 4YJZL 1H8OA 2IMMA 2IH3B 4NQUA 4NQEE 4R7NA 2AABH 1G7HA 1QRNB 1KLFA 1XMWA 4JFZH 3JZ7A 1N7ML 3N85H 4W6XB 4JFPB 4I18A 2VLRA 4PB0H 1CIUA 1TCRA 1YYMH 2J12B 1W8OA 3M1BB 5FYKU 4BQBA 1UB6A 3MLUH 2DQDH 5JHLL 4KK5D 2AEQH 4S1QL 4MDIA 4N9GB 3TVMA 2RGSA 2MTPA 1AO7B 5ESVB 1WEJH 1N3NA 2HG5B 4F9LC 5DJYB 2PYEB 5IESH 2VXTH 1UWEL 3VGHA 3SKOA 3VFVB 2VQ1B 3EO1A 3EO9L 3EAKA 2C4FT 3FFCB 4QNPE 1A2YA 5DDHA 4K7PX 1CFSB 3P9WB 1Y18A 4X6BA 3TT3L 4GKZB 3LEYH 5J6GA 2QSVA 3TWCH 3VCLB 3ABZA 1VESA 1R3JB 2X4OA 3EKCA 4M1DH 3BEVB 1OPGL 5DJ2B 4YPJA 4Q9CA 5DFTA 4NO3B 5GS0C 1CDBA 3NACH 3GIVB 5A2IH 3SJVD 4PJIE 1I9IH 5FDWB 5LGKA 4DGIL 5CEYB 2WP3O 4DCQA 3DXAB 4FHBD 3EO0B 3ETBF 3ARZA 3OKKB 3VRIA 2D7PA 4XHJD 1AP2B 3UEZA 5E9DB 2C3XA 1MAKA 1YY9C 1VFBB 4LSTH 3RKPA 5DJAA 4K7PY 4A2LA 1RUMH 4NSKB 2DD8H 3QQ9D 1OOAA 1RVFH 4M7ZC 5ITFA 3GM8A 1T4KA 5TQ0H 3P30L 1WBZA 4YK4C 1EJ6A 2Z92B 4G6KH 4JJHA 5E03A 3DARA 2FBJL 3OKLA 3K8LA 3SE9L 4ZOAA 2LVCA 4AT6B 3O8XD 5FYKH 1VGKA 4JRXB 3RTQD 4WUUB 4GO6B 3V7MA 1F4HA 4LLUB 4XP5L 2Q1EA 2FWOA 3QJFB 2F5BH 3F7VB 5HYJB 3QULA 5IJKA 1I7ZA 1F58H 3SKUD 4I0KA 2AEPL 1Q9KB 1MVUB 4YC2B 4XCFH 3T65A 3V95A 2PTUA 1T1XA 1T5XB 4PRBA 4YPGB 3MJ9A 1HH6B 3WUWB 5CWSA 1KTKE 4JN2A 4ZTOH 4WWID 3FRPA 5DEGB 1B0GA 1EEUA 3STZB 4ZUVB 5I30L 1K8DB 2GSGB 3B2VL 3VWKB 2ZUVA 4KJQD 4HIIA 3EYSL 1PFCA 2IFFH 5EWIH 2IAMC 2WIMA 4ODUA 2J2ZA 5EZLA 3GMOA 4XWOD 3REWA 3O3EB 4PJCE 3VFTB 3QI9C 2AK4D 5C6TH 2G5BB 3D18B 3FZUD 2YEZB 1XF3A 3FOLA 3BZEA 2J8UE 1NGYA 1XIWA 3O2VH 3N06B 1B3JA 4HFUH 3GSXB 1IFHL 3TBVA 4LLDA 2SEBB 4FZEH 5E4EB 3I50H 1HCFX 3MNVA 4MA3B 4ZUUA 1A3RH 4WFGE 4L5FH 2CK0L 1RIVH 3ARGA 4FQ1L 2F8OA 1WBYA 3S97C 4LASL 4XCCL 4YHOL 4HG4J 2XN9E 2OSLA 1A6ZA 1JCKA 1UM4H 1Q1JH 4U3XA 4YO0B 1KN2H 5HHVH 3EOYG 1WBXA 4RIRA 3MUGA 2XRAH 4FFVD 3DRTA 3ZKQD 3QP3A 3T77B 1E4XI 3T0VA 1E4JA 3HAEH 1WTGT 4I9WE 2JIXD 4MJ5A 2EKJA 1ZTXL 4WFHD 3FTGB 3E2HC 5HHOB 2R23A 3GBML 4OF5A 4N1CA 1QLFA 1LVEA 1YMHB 3KLDA 4N8CL 4EUPA 2VAAB 3RRQA 1TETH 3KYNB 4X6DF 1FBIH 4ZFOL 4HMDA 2QSQA 5IB2B 5BV7C 4CVWA 2OL3L 5GS2H 3FO9B 4WW2B 5I8EA 2I5YL 3H9ZA 3MV01 2E7BA 3D5OF 5CIPA 3SCMC 2WBWB 5BO1L 3ZL4H 3RWEA 2GJ6E 2E7HA 1FZKA 4YIQB 4F80A 2AGJL 2XZQH 1MELA 3KPMA 1QO3B 5F7HA 5FA4B 3LZFH 5C0NC 5GGVH 3DMMD 1E4WH 1ZLWK 4CGTA 3GI9H 4NJAL 4AM0A 5MERB 1A5FH 4M62H 4WU7B 4Y2DC 3O81A 3D25B 1IM9B 5D1ZC 4BFIA 1ETZB 4PJAA 3VD9A 4Q6IA 1TVBB 2VLME 1UCTA 3WBDA 2DLTA 2YA2A 3RUGB 3VI4E 1CBVL 4YHML 2X41A 2HH0H 1MFAL 4FZ8H 3ARBD 4XNUL 1S7SA 1PKOA 3SDAC 2Y9RT 2IANB 3PDOB 2FSEB 5L2KB 3QO1B 2MCG1 4PV8A 4XNZC 4JKKA 4NP4L 1QLRB 4TYUA 4OIIL 4MDJB 1DN0A 4UAOC 1FORH 3MJGX 1ONQA 2GCYB 5J13B 3LV3B 5GGSY 4ZOEA 5D5MB 1P1ZB 2NY4C 1MHCB 2MQ0A 1S7UB 1LDSA 4G8IA 3MR9A 5F9WC 3ILPB 3U2SA 4KJPC 2X7LA 1OGAA 4CMHC 5CBAB 3LPGA 2JK5A 3MRRA 3QUYB 3MRHB 3MQIA 2BVEA 4L3AA 5JHLH 3BKCL 5HVGB 4S1QH 3T0EA 1WK0A 1JZ8A 1KJMB 2ZCLH 3VXRE 1BM3L 4NM8L 4OM0L 5D7IB 5DD5H 3SKNA 1IJ9A 4Q9RL 2C4XA 2Q7NA 5JMRA 5MHSD 1MHPL 1W2KT 4LOUC 2WSKA 3EO9H 4F57L 3QDGE 1M7XA 3K1KC 3W0WA 4OCWL 4NHCL 3AMKA 1FGNL 4NN6C 4OZIE 3WUZA 5HHNA 2HVKA 1A4KA 3CCHB 1FFRA 3DUSB 5E1AB 3TCLB 3REVA 1FV1A 3NZ8B 1OPGH 3S4SG 2UZYB 3CXHJ 4K7PH 1QBMH 4MJIE 1G1CA 1B0RB 2NXYC 2IH1A 4MYWB 4HT1L 5I17A 4DGIH 2X4UA 1KIUA 4P99A 3WL9A 2RQ8A 4ONHB 3ALWA 2K9UA 5HHXL 4HIEA 2FZ3A 4F7EB 1MJ7L 5F1NA 1AC6A 1ZLVK 3D3VE 3Q5YA 3LEXA 3LS5L 3S96A 3VXUA 4QHUB 1RK0B 3HZVB 5DMYA 3BRDA 5GGUA 1ZS8B 3ULVH 3QHZH 4FXGB 4PJ7B 4CVZB 3PABB 1PSKL 3G5XA 3RKDC 5LCVL 4Q7DA 3JWDC 1A64A 2EE3A 3ZTJG 3FKUS 4HX1B 3L3KA 4AL8H 2FBJH 1FNAA 4YDVA 3B3IA 3G5VA 2EO9A 5HYSB 2CDGB 1B4RA 5FK9B 5HXMA 3MZGB 1YEGL 3WNNA 4NQDD 1KACB 4XP5H 4NUGL 3OF6A 4TPRL 4U0QB 4IS6B 4JFOA 1HILB 3VXQB 2AEPH 4GG6F 4YAQB 2FL5A 3QG6A 5H2BB 1YEIH 4EDXA 4LCCA 5BS0E 3QUXD 3S5LA 5BZWA 5I1AA 3HZYA 3OKYA 5ICYB 3FRUB 4WTWA 4IM8A 3BPCB 5I30H 1KCVH 4Z7QE 1UKQA 4NC1C 4ENEC 5DD0L 1ZAGA 4DOHB 4P9ML 1V05A 4HUWA 4KROB 5F3BA 1YNTA 3MXVL 1T04B 5ISZE 5SV3A 1MHHB 4R4BB 4MB4A 4LAQL 3C6LB 1BMGA 2JLLA 5I1GL 4G80A 1IFHH 4AK1A 2H2SC 5IMLA 3EYOA 4L8SA 5F9DC 3STLB 4QOKB 2CK0H 4FQ1H 4LSSL 5IKCB 4I0PC 4XCCH 2YPLD 2OQJB 3BWAA 3IDJB 3F58L 4JCLA 4YHOH 3H7BB 4KJWD 2NY2D 4QWWD 3LHPL 4P46C 4HGWA 3DX6B 1OAUL 2VITA 1VEOA 5AD0A 2QBWA 4R97C 2NQCA 4MNHB 1K6QL 4DJMA 3KDMA 1MFDH 5JIHA 2FHBA 3B9KA 5IW3A 3OB0H 2XWTB 5DURB 2O5XL 4JZNB 3M45A 1ZTXH 5JPMA 4PR5A 2VDRL 3QXAA 1YEJH 3GBMH 4MAYD 5C09B 3J8F7 2P1YA 5EU6D 1XZ0A 1BBJB 2IAMA 2IPKB 3H3KA 1IEBA 2WP3T 3UAJD 4EN3C 3PL6A 2UWEB 5C0CD 1T1YA 5ACLA 5IMMB 1CN4A 3QI9A 3NIFF 4ODHL 5KW9L 2B1AL 1A6TB 4JGMA 4KKBD 4H1LG 5B4MC 5I9QB 2OR8A 1H9VA 4PJHF 2VLRE 2OL3H 4UQ2A 1KELL 2BY1A 3LD8B 3PGCA 4ZTPL 3GK8L 3SGKC 2I5YH 2IPUK 1NUGA 1AHWC 1DE4A 1X7QA 3FAWA 3MO1A 1P2CB 1H0DB 1KJVB 5BO1H 4P23B 1I1AD 1U8HB 3UTSD 4BZ1L 3IFLL 3HHRB 1EHAA 2HMIC 2AGJH 3PWPB 3F6IA 1G6RA 4PRHD 3BESR 3SGEH 1HH9B 2FEEL 3F12B 4OFIA 1AXSB 1BQHG 3EFDH 2R1YA 2JB5L 5EOQL 5AG9A 4WI2A 4KTYA 4YBLB 4XC3L 5IBUG 4I48A 3HMXA 1MQ8A 1YA5A 5INDA 3T3ME 6FABH 4GAYB 1D5BB 3V5KA 5C0RL 4JFXB 4WO4D 2NXZC 4MCYA 5T1LA 4O51B 2BJMH 3QDAA 3IKCB 4X98B 3IS1X 3KYOA 1CBVH 4YHMH 3MRKA 1MFAH 3HAEB 3JTTA 1QQDB 4FFZH 3QXTA 5E2WL 4D8PB 1MWAA 4YHPB 3QUML 3QDMA 4U1KB 2VISB 2Y7QB 2LVEA 3SO3B 1YYLL 5DWUL 4NP4H 5I8CA 3RHWF 4JFEB 4BQ6A 3VFGL 4DZ8B 4U0RB 2CGRH 5EFIB 3SCMA 3RGVA 3RL1A 1GRWA 1RZFL 4Y5YB 4LHUG 4LF3B 4PJFF 5KS9A 3OGCB 8FABB 3ALPA 3N1MC 2HJLA 4LPUA 5HVWA 1AD9A 1J8KA 2IBGA 5EDXA 1N4XL 3IFNL 4R0LA 2XZCL 1U8KB 3BKCH 5FCSH 2F74A 2H1PL 4LHJB 1MCWW 4Y16A 1M05A 3SE8H 3MV8B 3C2AH 3CK0L 3DROB 1BM3H 1RZ7H 4GAGL 3P40A 1NAKL 3BDXA 5AYQA 4NM8H 4Q9RH 5IM7A 1S9VA 1CLCA 1UM5L 4LCWD 1Y6NR 1I7RA 1MHPH 2YPVL 3V6FA 1KGCD 3TO4B 4F57H 1P5VA 2BMKB 3GBLA 4IMLB 3SDXF 5J0BA 4GRWE 4AEIL 4NHCH 1FGNH 5DD6A 3QNYA 2YC1B 4QCIA 2NY3D 4RDQF 4L9LB 1TTUA 4TNVF 1BGXL 4JZOA 4F7PB 1RIHH 4XGZA 3O9WD 1BPVA 1NFDA 1AR1C 1EPFA 1SJEA 1XF5B 4PP1C 1NGXB 2UY6A 3OB0K 4Z7NE 4KMLB 1KCLA 3P11L 1DBKL 1QFWL 3IGAA 5EBWA 5IP4A 4XVSL 1X5ZA 3AS0A 2VJXA 4HT1H 2XNAA 4RAUB 1RJCA 2P5EB 4U7SA 5DTFA 2Y5EA 2P24B 4NC2B 4ZS6D 1WC7A 4NRZA 4V2CB 4ODXB 3WJLA 5GIRA 1MJ7H 4JQIH 2XTJE 5DK0B 5D7KE 4AENB 4XZUB 1Y6MR 4Z7UB 1RU9L 1PSKH 4ZXBB 5HGDA 3QWOB 2PO6A 1NGZA 1MUJA 4LVNB 4MVBC 3P4OB 1IEHA 1PX4A 1DUYB 3VH8G 2C1PA 3O0RL 4FTVB 5E08L 2BSRB 3VXOA 3ZE0E 2DLFH 3TNNB 5GS3A 2EYSB 2X44D 5ID1B 4I3SL 4MB3A 2D2OA 2P5WD 4ALAL 2FB4L 4BJLA 2ICWA 3GMPB 5IWLC 1YEGH 3X11A 1QFOA 4HWBA 4Y4HD 1INQA 4NUGH 4RDQG 4XNQA 5GSVA 1OTUD 1NAML 5FEBA 4Y5VA 3UC0H 3QPQC 2N1KA 2X4PB 3R06A 2YUZA 3MCKB 5F7UA 2HT3D 4PJ5D 2JCCA 4ELKB 4ZPTB 1ORSA 4N8VA 5EOTB 3QA3B 1JGEB 4G3YH 1TZHB 3SO5A 2EKSA 2GYSA 2Y72A 1YJDL 3GMRA 5DD0H 3ZKNC 5H37G 2GEEA 3IDXL 3GZKA 3CDGA 3U46B 1CXHA 4FQJL 4AQ1B 4LLMB 2Z4QA 3VXPB 2XACC 1A1NB 1IAOB 3C5JB 4LAQH 2CO7B 4PYGA 5I1GH 1ZGLM 3LSOB 1BFVL 5D7JA 1NDGB 1J0JA 3T2NH 3TBWB 4NRYB 3C6SA 1NUFA 3EDFA 3GSOA 3TO2B 4RMQA 1CICB 2L7JA 4LSSH 3VWJA 3PHQA 1B0WA 1YY8A 4PJAE 1C8PA 1HEZA 3F58H 3RVVD 2E6JA 3TP4A 4NQED 4WWKD 3IF1B 3LHPH 4HH9A 1CL7L 2W0FB 2E6QA 1HOCA 1OAUH 4IHOB 4JKPL 4ZFGL 2O5ZH 4RISL 4IMKA 4MA8L 2AXJA 3CFCL 1K6QH 2FH6A 2NW2A 3DNKA 4I3RL 2Q6WA 4BSVA 4CU8A 4LQFL 4GXVH 4JDVB 3IKKA 1OSZA 2VXVL 1RHHB 4LMQE 1P4IL 2O5XH 25C8L 3BKJL 3FMGH 4J8RA 3FCTA 5KN5B 1IE5A 2GITB 4Y5XB 1F8TL 1F45A 3FO2A 2ZPKL 1IVLA 5E4IA 1LWRA 4KRLB 3MJ9L 3ISWA 4ODHH 3FN3A 2AEWA 2B1AH 1J87A 3UTZA 2Q86B 1ZHBB 2GUOB 2JJUA 4Z0BL 3EOAB 2APWA 1KELH 1S78D 4PREB 1OGAE 3FB7B 4HBQA 4ZTPH 2PUQT 5DRXB 2XWJB 2CR6A 1ITBB 3K81A 3KPNA 3L3HB 4JFYB 4JQVC 3NCBB 4Y4FC 2FRGP 3C60A 3FQRB 4ETQB 2FJHB 1OQXA 4BZ1H 3IFLH 5J1TC 1GYAA 1CT8B 3ROOB 4X6FB 5DJDA 5CJXA 5DT1H 3ARDA 3DO7A 2ADJB 2JB5H 2X1WL 3FONB 5EOQH 5JXEA 1IC1A 2NY6C 4AIOA 4UDUB 2FJGA 3DX8B 2X4QB 3MBED 5CSZB 4NQCB 4XC3H 3W0WE 1QFUL 4HK3J 1S7TA 3TZVB 1FSKC 1D5MB 5C0RH 1KTLB 1KNOB 3LCYA 3PWUA 3D9AL 3WN5C 5K9OB 4AYFA 5LGJA 2HA1A 4PGBA 4JR9L 3U79A 1U58A 4QRPB 5E2WH 4Z78A 5B8CA 3QUMH 3DV4A 3CFEB 5E6ID 3SOBH 4AH2A 5AYUL 1E28A 2HVJA 3HE7B 4WV1C 1S9WA 5DWUH 3Q6FB 1ERNA 3SEPA 3RWCB 3EDDA 4LSVL 3VFGH 2WNGA 3THML 2BC4B 3FN9A 5KSAC 3VG9C 1AHWA 5D93B 5F6IC 3CC5B 3PV7A 3ARFD 3MLYL 4JJ5A 5E2TL 2R0LH 3OX8A 3VXUE 4GW1B 3VFUB 4UZGA 3U6RB 3RDTD 4JDTL 1ZA3A 1YN7A 5IEKA 5I6XC 1N4XH 3IFNH 3MNWA 1IZKA 2XZCH 3L6FA 3MRIB 4OZGF 2YUXA 2A6JA 3EW3B 4QY8A 4GMTL 3CK0H 1HSBA 4E41A 1NAKH 3H42H 1IZJA 3NCYP 3H0TA 1UM5H 1G7LA 2YWZA 4YXLL 2XOTA 5DJ6B 2YPVH 1KV3A 2B5IC 2R2BB 5I73C 5B38G 1MH5B 2EXWC 3OAZK 4X99A 3ZMRA 3X3GL 3RVWC 2ATPB 1YDPB 3QJHB 5FGCB 5GZOD 4KXZI 1HXYA 1TZIB 1BGXH 5DMGD 3NIDE 1MJ8L 5E2UL 4N0UB 3ZYOA 4WFGD 5KSUB 4EKXA 3C5ZD 2WBJA 4PGJA 4NM4H 3T04D 5EN2A 5FB8B 2OK0L 1K85A 5GGSB 1B6UA 3MZTA 4HWUA 4GKOA 3DWTA 3P11H 5MEPB 1H3WM 1I1YA 1QFWH 3R0MA 4XVSH 3V0VA 3ZTJH 4FA8A 1QPXA 3AROA 1NC2A 4OCXL 1A1MB 1XGQA 3FB8B 3L7FB 2ICEA 3R4DA 3I6GB 1SM3L 4NKDB 3C09B 1XR9A 1T83C 5HGHB 5DEFB 4QXWA 4TUOB 2AJSL 1AIFB 3V8CA 3MREA 1XR8B 3CFJA 3PQYB 1YEKL 4CKVX 5C9JA 5DZLA 3O0RH 1MRCL 1EGJA 4HH8A 1JNNL 4YDJB 3JXAA 1GIGL 3CMOL 4KTEL 5AWNL 3P77B 4I3SH 1EAPB 2O61B 1JJUA 1MSPA 1N8ZB 4ALAH 2FB4H 4QXTA 2EIDA 1EUUA 5I66B 3B9DA 2GJ6D 1XAUA 1LO0L 2EDFA 1UZ6F 2ZUXA 4QTIL 1L0XA 2DWEB 3QEQB 3QIBB 4DVRL 2F54D 4TTGA 5GSRB 1EDQA 1YECL 3RJDA 1J0HA 1UWXH 2DQFB 3DLQR 3GHEL 4JFQA 2BVQA 3E6HB 3CUPA 1FVCA 2VLMD 3WLBA 3MV9B 4P5KA 1AGFA 4JRYA 2JELL 3QO0A 3QEGL 2PXYA 3IDXH 3BKYL 1HSAA 1SYVA 4FQJH 4NO0B 1NC4D 1CLYL 1U91A 1KIPA 5C0GA 3MOBL 3T4AA 5B39A 5CD3A 4XP4L 3H7LA 4APQC 1UFUA 2H41A 2XZAL 1EEZA 4JM2C 3WHXA 1BFVH 4Z6AT 1F90L 3MNZA 4FN0A 2CK2A 5IW1B 1TZGL 4OUUB 4PJ8C 3MCG1 3GMNA 1P7HL 4PGZA 3QFDB 2GY7B 3SGJC 2OTWB 4OZHA 4RISH 1BX2B 4MA8H 4OB5H 2EZ0D 5DHVB 3CFCH 5DYOB 5IBTH 5F72S 2X1PA 5C9KA 4U1NB 2Z31C 3NCEB 5DRZA 4ZODA 2Y6SC 4I3RH 5ESQA 4H1LH 4LQFH 4TULH 2BRQA 2Y07L 1JTPA 3QDME 1P4IH 2CIIB 25C8H 3BKJH 5DC0A 5LVEA 5HDQL 3PNWB 5I1IL 4L4VB 2DS4A 1CFQA 2ZSVA 3PV6B 1UXSA 1MCPL 3VXRD 1VPOH 5FYJL 1F8TH 4YWGL 4YE4L 5HVFB 1HHJB 2BNUB 3GSRA 3TA3B 4UDTB 2MMXA 3QDGD 4LLAA 2CKBB 1V5JA 3HZMB 1S5IL 3E6FA 4YZFF 5DK2A 5KS9E 3ZZ1A 4KKAC 5K59F 4PJ9B 4MD5A 3G6AB 3RWFB 4FP8H 3OHXA 1H3XA 5C0JA 2E7LA 1J10A 1OAYL 5SX4I 4P5TA 5A43C 1RJLB 5D1XD 3UO1L 1JK8B 4MJID 4ONOA 2XY1A 1PX3A 1ZEAL 1JPFA 4CMMB 1C5DA 3ROLB 2A74B 1F2XK 1R5VA 5SWZA 2OP4L 3PIQB 1D9KD 1TJHL 1QFUH 1EHLH 5EO9A 2F8XC 1EFXA 4BH7A 1LE5B 4M4PA 1NMCB 3D3VD 2W0KA 2GT9A 4RWHA 1KIQA 3D9AH 1TTFA 3HNSL 1NFDE 5A40E 5F89B 5C86A 4JR9H 4HJ0C 1JPGA 2F5AL 2VXQL 5FUZL 1T1WA 2FNBA 3QXVA 3VG0L 1DQDL 3PJSB 4EI6B 3DRQB 5AYUH 2MHAB 3ULSB 1NMAL 4LSVH 3THMH 1Z3GH 1NBQA 5MI0B 1PY9A 1F3DJ 1U8MA 3ARED 5E2TH 4Y4FA 3HUJA 5E1HB 5IVXB 5JO5B 5DEZA 1UWXK 3HPJA 3QIUA 1P7QA 3HZKB 4JDTH 1WZMA 2Z9TA 5BS0D 3Q3GB 1A6VL 3VXNA 3CX5K 3O11B 4NKMB 4X6EA 5T33L 1VFAA 3QCUL 2V7HA 5KVMC 2HKFL 2FX9L 1RULH 1KG0A 2CD0A 4OBSA 1T7WA 4YC2C 5J1AA 4GMTH 1XEDA 3ZE1E 3ZDXE 3K74B 4Z76A 4GG8B 4X80L 1AXIB 5DJ0B 4OF0A 4YXLH 1PY4A 4TVPE 4DKAA 3VWKC 3PP3H 1O7SA 4JVUA 1IGYA 3LPWA 4X6DB 5ISZD 5IMKB 2GJZB 1GVIA 3SJVB 1PBYA 1T0NB 2RR3A 3X3GH 1MRDH 3UTQA 4U1JB 3CH8A 4HXBL 1G9MC 2EDEA 2JCCE 1ZGLP 1OQOA 1MJ8H 5E2UH 2KDGA 4WV1A 3GKWL 4WY7H 1ZT1A 2I07A 5CFHA 3IXAA 3MRMB 1YPZF 1GGUA 1T03L 5FO8B 5CUSH 5KSAA 3LQMA 2BY2A 4N68A 5E4EC 5L7XL 2J1KA 4LU5L 3AGVA 5BV7L 1KCSL 1RJZB 1MPAH 4G5ZL 1A02N 4OCXH 4G6JL 4MQXC 1VEMA 3AAZA 2HRLA 5EC1A 2ADFH 1SM3H 4MSWB 5AUMA 3O8XB 3NFNA 5L0QB 1CTOA 1GCFA 3MJ7B 3PXJA 3OKEA 4MS8C 4OZFA 3ARYA 1D6EB 1ED3A 1JVKA 1BEYL 1LO5A 1YEKH 1EHNA 2AV1B 3GKZA 2PCPB 3KPTA 5IR1A 1MRCH 3NTCL 2VLRD 3IJSA 1JNNH 1YN6B 3NA4A 4UIMB 4PJDF 5ID0A 5AWNH 4Y1AA 5FYJU 1QVOA 3S4SB 2BNQA 2YBRB 1QSEA 2VKWA 1EXUA 4NPYA 1L9MA 5D2LF 3TVMD 1A7OH 5H37H 1U93A 4NZUL 4D0CA 1IAMA 2AK4B 3GSNA 2C1OB 2PTTA 3IDIB 1CGTA 2DI7A 5C08A 4QTIH 5TE7L 4BM7A 3U0PB 4NN5B 5ANME 4DK6A 5C7XH 5TGBA 2KQMA 5IT2H 2CLVA 1P7KB 3CSBA 3GHEH 5C0EA 4P57A 5I2IA 4MA7L 4G9FA 3GJFA 4QHLA 4C59B 3KPLB 1C5CH 2K7QA 2JELH 3BEWB 3HI1A 3QEGH 4LNVA 1GGBH 3LKRB 2R69H 2LU4A 2I9LA 3MOBH 1BWWA 4XP4H 1U8JA 2AKRB 2BDNH 2XZAH 1MLBA 3OKMB 1RJYB 4AIZB 4ZFFA 1F90H 2H3NA 3DBXB 4RAVA 1QA9B 2DM7A 3IDGB 3KPRA 1S5HB 1AGBA 4U1LB 2JIXB 4BKLB 1V7NL 2CMRH 3D0LB 4OTXL 3HC4H 4F33B 5GGQL 1R24B 5L6YL 4XNYH 3SE3C 4XP9L 1AGCA 1MJJB 4OQTA 3MYJB 1F3JA 3E8UL 5MENA 4OLUL 3RY5A 3ZO0A 3BKML 3W9DA 5J13C 1HHIB 2Y07H 1XCQA 4QRTB 4BUHA 5ENWA 3RHWK 3WIFB 3PP3K 2OR7A 1W0VA 2WIIA 3FB6B 4R6UA 1A0QL 1CGUA 1T0MB 4YBQC 5FYJH 3UBXA 5GS0H 4YWGH 1MCOL 3OAUH 5C0IB 3QUYC 4RRPG 4V1DA 4JHAL 3LY6A 1IM3B 1RZGB 2DN7A 4P3CH 2V7NA 4X6CF 4P49A 5C0FA 2ICWI 1S5IH 3DMMB 1QR1B 1DJSA 1CS6A 1U9KA 4PJGF 5EPMA 3KWWB 5JORB 2QR0A 1EX0A 1J1PL 3V8OA 3DGGA 3F7QA 2IG2L 1ZWIB 2AW2A 2I26N 2XG5A 4PP2A 4E41E 3V6OC 2X1QA 3JWDL 3MRBB 4WCYL 5DR5L 3UO1H 1MCCA 3I3EA 4MLIA 5DMIL 2VABB 4D94A 5JOFB 4NNPL 4IDLA 1ZEAH 2HFTA 1FFOA 3MRQA 3ARBB 1JRHL 1P9MC 1TDQA 1PZ5B 1I8LC 4TNVK 4B53A 1XIWD 2NTFB 2QKIB 2VZVA 1T21B 4NFBA 1BVLA 1R3KB 5BOPA 1Q9LB 3RWGB 3TPUB 4FQQA 5D7KD 3CLEL 1P4BL 2X4RB 1JV5A 3ARGD 3HNSH 4XRCB 1VADB 5IIEA 1VGEL 3M1BA 5HYQA 2OX5A 1CYGA 1BOYA 2F5AH 2VXQH 4XMLL 5FUZH 4OFDA 4ZSOA 1FL6A 3VG0H 5J6HA 1DQDH 2YKLH 1R3HA 3DTXB 1Z0MA 2E9IA 4K3GA 1JWUA 5IVNA 3F7YA 5DMKB 3KJ6L 1OGTA 1JF6A 2FDBP 1MVFA 4FQHB 4PRPA 5TDNB 2FGWL 3FFCA 5IHZA 4LGSB 1CFSA 1IEAB 1NH6A 4G8FA 4WHTB 5CMAA 5EO1B 1WIUA 3IFPB 4POYA 5E8NA 3CU7A 5E24E 1EERB 4LCUA 4Z7WF 3EFFB 1ZANL 1FO0L 5IBUB 2N7AA 5DJCA 1OL0A 1OB1B 1A6VH 1KENL 5I75B 1BQSA 5T33H 3QCUH 4RMUA 2Z91A 2APBA 2HKFH 2FX9H 1U92A 3KLAB 4PV9B 1RV6X 5I1DB 4LPYA 4C54A 5FECB 4HZLA 4O4YL 2C7UA 4ZPVA 4HDIB 2RHEA 3QQ4B 4MXVE 1T66C 2UYLA 2PYFB 4P2RA 3BVNB 3L7EB 1A7BA 2VQUA 4HS6B 4JZJB 4HUMB 4LQ1A 4PJHB 3IFOA 1SEQH 5A16A 4CAGA 4KROC 4HXBH 4JO2L 2AVGA 3DSNA 3QZWA 3GKWH 3L95A 5I1LA 3C6LC 3FT2A 3RNKB 1PW3A 1VERA 3KPSA 2I27N 4WHCA 1T03H 4E9LA 4YHYB 2VZSA 4HMEA 3RNQA 2NW3B 8CGTA 5L7XH 2MKLC 1BJ1J 4LU5H 5KSBF 4JRYE 5DUBA 5BV7H 1Z5LB 2A9ML 1MRFL 3VGDA 3V5HB 5KJRL 1KCSH 4HXAL 1W72L 4KQ3L 2Y5TA 1BWMA 4A2MA 4YDIL 3BHBA 2WBKA 4G6JH 5EC2B 3NAAL 5HYJA 1E4XH 1NMBH 1EO8L 5DZOA 3IU4H 2OTUB 3DYPA 4JANA 1Q9KA 1KPUB 3MRCA 4U6VL 5FGSA 4M48L 4NQDB 2ENSA 4DEPB 2FEDD 1VFMA 1UH4A 3L1OL 2CKNA 2D31A 3CVHL 2CDFB 3MLVL 3QWQB 4OZHE 1CFVL 3OZ9L 2NY0D 3C5SB 4KUZH 2XG4A 3NTCH 3QUXB 4M5ZL 1ACYL 4P4KB 3CDFA 1OGAD 2GTZB 4YDKL 2A1WL 3IU3B 4HW6A 3QFJA 1S7WB 4X9BA 3P4LA 1II4E 1HYRC 1NBVL 3IDYB 5I9QC 3O3AA 4NYLA 4BK4A 3T0ED 3LD8C 4NZUH 2SEBA 4E0RA 4MWFB 1JYXA 3OKDB 5J8OA 4GKNA 1FNEA 2BX5A 3EOBB 4L8DA 5A2KH 5TE7H 4P23C 3LRSB 2R1WB 3AMLA 3HCVB 4AG4L 3U0WH 2HT2C 2HN7A 3W0WD 1CWVA 1G7JA 4YHLH 4F7MA 2GTWA 2W0PA 1HNFA 4NZRL 3WFEL 2RBLA 1YEDB 4JFDB 4MA7H 4J3VA 1DQML 1MHEA 2BSTA 3FB5B 5TF0A 1OAKL 3TJHD 4PD4K 2YPLB 3OXSB 4YBLC 1U8NB 5DVKA 4RFOL 3P4MA 2I9TA 1YNKL 1U2HA 2NY2B 1X5IA 3VH8B 1Q0YL 3FRPG 3RWJB 2DLHA 3PWJB 4PPTA 2AJZA 3SDXB 1LEGA 2X9YA 3VD3A 1PEZA 2XA8H 3U9UA 1RZIB 3Q6GL 1HHKB 5SWZE 4LSQL 1FCGA 1O0VA 4R4NC 2VXSL 1WAAF 2NTSP 5GGRY 1V7NH 2V17L 2VLKA 4L29A 1IGFH 4KMTL 4MAYB 1GC1C 5GGQH 3G5YB 5EU6B 5L6YH 3BH9B 4J3SA 2OCFD 4XP9H 4RMTA 1ZSDA 1LP9A 5C0CB 4OBRA 4YNYA 4U0RC 1A8JH 3BKMH 1CU4H 3QEUB 4EI5A 4A6YL 1F4WL 1XGUA 4Y5YC 3BE1L 1U6AL 5E5MB 2E7CA 2X4TB 1A0QH 4KKCC 4XBPB 1MCOH 4MMXC 1IQDB 5JR1L 2WWMD 4GKSA </