2AEPH

An epidemiologically significant epitope of a 1998 influenza virus neuraminidase forms a highly hydrated interface in the na-antibody complex.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
187
structure length
143
Chain Sequence
b'EVKLVESGGGLVQPGGSLSLSCATSGFTFIDYYMSWFRQPPGKALEWLGLIRNKGNGYTMEYSASLKGRFTISRDNSQSIVYLHMNTLTAEDSATYYCARVDYGTNYDYWGQGTTLTVSSAKTFPEPVTLTGVHTFPATLSSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords neuraminidase
publication title An Epidemiologically Significant Epitope of a 1998 Human Influenza Virus Neuraminidase Forms a Highly Hydrated Interface in the NA-Antibody Complex
pubmed doi rcsb
molecule tags Immune system
total genus 23
structure length 143
sequence length 187
ec nomenclature
pdb deposition date 2005-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aepH01
3V5HA 3T8XB 4I3GA 4KZEL 4BQBA 2WAHA 2QTEA 4UQ2A 3GSWA 1I7UA 4MWFA 5EU7C 4DW2H 3BPOC 2XWBB 4L8SB 1A21A 5DEFA 3MBEC 5BXFB 3QSKB 1EHLL 4XI5C 3ZT6A 5DMKA 2PXYC 3GMLB 5FF6B 5DJAA 1MF2H 4L8CB 5TH2B 1TQCC 2EE3A 1RZ7L 4G8EA 4GRLD 2NX5E 3OTTA 1T0NB 4JRYB 1IM3B 1P5UA 4XAWL 5FCSH 2DLIA 1UB5B 5JHLL 5MENB 4W6XB 2P46B 3KYMA 4PRID 4RFOH 1IGFH 3KPSD 4YXKL 3ULUF 25C8H 3CGTA 4RMVA 4FTVD 2F8VA 1CFTA 3MRKB 1A6TA 3QJHA 1XR9B 4Y5YB 4NP4L 1CXFA 2IEPA 2W0PA 3CH1A 1NC4A 3X14B 3D5OF 4CNIA 4WI3A 3TESA 5ISZE 1JGUL 3LDBB 2FGZA 4JRXA 5GIRA 1IM9B 3WDJA 5EULV 3QPQD 5DJCA 2WQ8A 1G1CA 3IDXH 1J88A 1JJUA 2VL5B 1OAUH 4XXCC 4OUOA 5T33H 5C6TH 1IAMA 4G6MH 3I02A 3S5LB 4ODWB 1II4E 4UDTB 2F58L 3MTRA 4LLVB 5GRXG 5SV3A 5J3HD 4IM8A 4U6VH 1JZ2A 5TJWK 5MI0B 3C5ZA 4I3RL 3QPQC 5IG7A 4K7PH 3SPVB 3LN5A 3VXTB 4K71C 1UH3A 5F7MC 2DYPD 1H5BA 3VFNB 3VXSD 3BQUD 5DVNA 1BGXH 2ZCLH 4QYOA 2XYCA 2NMSA 4Z0BH 1SY6A 4YDLC 1F6FB 1KIPA 1EGJL 1HXMB 2JKXA 3OHXA 3NCEB 5CWSA 5MEOA 4LIQL 2Z35B 4G80B 2HG5B 4F7CB 4E41A 5CHNB 2DTML 2H2SC 3LQAH 2CKBB 2ICES 4J3WA 1HHKA 1QUNA 4FMKA 1PKQE 3WL9A 4UT6H 1T80A 3OKLA 5LVEA 1B0GB 4RRPA 4ZSOA 3FB8B 3O3BA 4MA3A 1B3JA 1X5KA 3BP4B 2HVKA 4FNLL 4JKMA 5IBLD 3M17B 1GPOL 3ARDC 4JPKL 4MD4B 4UT7L 2C7UA 4QGYA 2JCCA 5F8QC 4ZUTB 1FQ9C 2WIMA 4Y5XB 1ZSDB 5FUCE 2WUBH 3OWEA 1DSFH 2X4QB 2ZCKH 4YX2L 1FP5A 4RIRB 2DWDB 4RAUA 2IANB 5IBLC 5EN2B 4Y89A 2DIBA 2GJJA 3KPLA 1S78D 2ZUSA 4GBXB 4P9MH 1M4KA 1N3NA 2R0ZH 5CJQL 3LB6C 1PEZA 1IBGL 5IR1A 1JNNL 3HC4H 1E4JA 1T20B 5E99H 1TZIA 4R96A 1GOGA 4GW4B 5IGXL 1RFDH 3FO9B 3MLXH 2VXUH 1D9KA 4QWWD 1ZMYA 4NT6B 1TPXC 2NW2B 2YD1A 4LNRB 3WXWL 5B3NA 2VLJE 3WNKA 3LV3B 5DD5L 2AK4A 1Q9WB 3GGWB 4U49A 3PABB 5BZDA 3E8UH 1OAKH 4HKXB 3FT3A 1DQQA 1R5VA 5HYSA 3CVHA 1UKTA 4X6EB 3P2TA 5GGRY 4DVBA 4ISVB 1A3LH 4ODTL 1MFEH 2WBJD 4L3CB 3Q6GL 4HJGB 1R24B 1YY9D 2H9GA 4GRLA 2IH3A 2QSQA 4JZJC 5GGQL 3GSXA 4OM1H 1ADQH 2AJSL 2DMKA 3SQOL 3CX5K 5IW6A 1HYSD 3GSNB 4PRIA 1NBVH 2ZG2A 4NQSA 2E9IA 1PBYA 4V2CB 4Y2DC 3RWJA 1Q94B 2ICWB 5HI4D 4FP8H 3KPSA 4Y5VC 4X4ME 1XGTA 4FTVA 4TNVF 3GHEL 3HZVB 2AJYH 3HMXA 5FA3A 3GO1L 1T66C 4D8PA 1X5YA 3MLVH 4LSRL 4YHLL 1AE6L 1DN2A 2D31A 4ETYA 3HKFA 1S5IL 3VFTA 3DRQA 2DD8H 2R29H 3FHAA 3CXDL 3FMGH 4KV5E 3F7YB 4XXDA 1W8NA 4XPGL 1F2XK 2Z4QB 4HPYL 2EYRA 4I0PB 3RVXD 3SDCB 4ZFGH 2BHZA 4XMLH 1F90H 3LZFL 2BC4A 1K8DB 3E2HB 3VXMB 5IB4B 4XC1L 1DBML 1SMAA 4KHXL 5DJXB 2GI7A 3SE8L 1OM3H 3GMOA 2DTSA 4QY8B 3BGMA 1AIFB 5CGYD 1MCWW 1T1XA 3MJ9A 2Q6WB 2VISB 5FGRA 5I17B 3VW3L 3DXAD 1UEYA 3GIZH 3MODL 2ZUXA 3GSOB 1U8NB 3IXTB 2VAAB 3RVXC 1KCUH 2VB5A 1ZLWH 4DN3L 3TN0B 2AXHA 1NCTA 5SX4H 1P9MC 3NCMA 4MNGA 2DYPA 4NO5B 3QH3B 3VXSA 4GW1B 3BQUA 4EDXB 3F62A 3TGXA 1GHFL 1XT5A 1SM3L 5BO1H 5ETUB 2F15A 1S7TB 1QLEL 4YR6B 1QPXA 4OFPA 5KAQG 2OL3B 5E70A 1QFHA 2CK0H 4J23A 5I1KL 4NKMA 1NEZA 2R0LL 4GAJH 3L3IB 3EDKA 3RWFA 2YZ1A 4KUCD 2XA8H 3K8KA 5FYJD 4U1IB 4DAGH 3C2AH 4K3DH 1DE4B 3TEUA 1EEUA 4X6CF 5IBUG 2EO9A 1CGXA 1MIML 4TQEL 1CLCA 2CLRA 4OCMC 4HUUA 3DBXA 1JYNA 1PYWB 1I85A 3ZYZA 3WXVH 5FB8B 3S9DB 2AJVH 4UT9H 5FUOH 4KH2A 3BWAB 5C8JA 2IFFH 3T0VA 1ZXQA 1H3WM 4KK6D 4YHML 2EEDA 5DK0B 5TF1L 3B9EA 3EHBD 4UB0H 3MR9B 4M6OL 1N5AA 4EI6A 3U0PA 3CC5A 2A6KB 2OMBA 4OLVL 1KC5H 5IMKA 5CEXB 4XNQB 4X9BA 1XF2A 1JBJA 1X5GA 4MD0B 2YC1B 3UZQA 1BF2A 2CO7B 1RULL 4O00A 4UOW1 3WIFB 3QCTH 5AWNH 3UC0L 4TOYL 2X89D 3IB4A 3QXTA 2OI9C 3T1WA 4DGVH 1OW0C 5L2KD 2E9WA 1P2CB 3EHBC 4WFHD 3F58H 3H9YA 1A7OL 4HK0B 1H3XA 1WTLA 4P3DB 4GAYA 2BY3A 4LCIH 3KPNA 5HGAB 5E08H 1XGRB 2XQBL 4PJGA 3AGVA 3R0NA 1SBSH 3CZFA 4PGEB 5GRZA 4KJWD 4ORZC 3IDGB 3QIBD 1V7NH 2EYSB 2VDNH 1JP5A 4N9GA 5DWUL 2Y06H 4OGXL 5JPNB 1MQKH 2GTWB 3WEXA 2HFEA 4X7EC 4ZD3H 3ULUL 1HILB 4FQ2L 2BVOA 1WVZA 2PYFA 2HJLA 2QEJA 4KJWC 2WBJA 3QIBC 3NTCL 5AG8A 1IT9L 5DVMA 1FDLH 4Q97A 1BOGB 1NDMB 2ZOKB 4X6DA 43C9B 2QBWA 1KLGB 2WWKO 3T0WA 1KENH 2DBLL 1G6RH 5HYSG 1PW3A 1OAQL 2F74B 4LFHD 4F9LA 2C3HA 4ORGA 4HQQL 3IDNA 4GW5B 3QQ9D 1PFCA 3SKOB 5HY9B 4BELD 4IRSD 1FZOA 2DQCH 5I8KH 4OF0A 3B4NA 3MRMB 5E9DD 2JJWA 3VD9A 2AGJL 3EO9L 1KXVC 2X2YA 2XN9D 3INUL 3QG6B 4JEGB 4YIQA 1QVOB 3MUGA 4R0LB 4WV1B 1RZJH 4A6YH 4M1CD 5IUSA 1S7QA 1NKOA 5CGTA 1HWHB 1WV7T 5F7KC 4K94L 1IC4L 1AHWA 3QQ9C 1HHJB 3IKCB 4MJ5A 4WO4B 3O11A 5TDPA 1CTOA 4E9LA 1VKXA 4J3TA 1R3HB 5HYFA 5D93B 3LEYL 4AIZA 1P9MA 5FO7A 4LEXH 1MI5D 1NFDF 1TZGL 4JQVC 4PJAA 4R3SB 2NCMA 4OKVB 5DI8A 5T3XE 2EC9T 2DJSA 4K3JH 2E6PA 3QXAB 4OZFA 1NGWB 4M1CC 3ZO0A 2CIIB 2FWOB 3UJJL 3DXAA 1J1OH 1U3HD 1KEGH 4WCYH 2CQVA 5FXCH 4Y19D 1PKOA 2V7HB 3EOYG 4YZFF 3VFRA 1TETL 4H1LB 1MHPL 4U3CA 5I71C 1AQKL 1QSEB 4R4FL 3EYOB 1FVCB 1OB1B 4Z18A 5HVWA 3WBDA 1TVBA 1FAIH 2D0HA 3QG7H 1CIUA 4FZEL 3LIZL 5IMLB 5F9JB 2Z92B 1F97A 4XT1C 4C57C 4NSKA 3O3AB 4QO1A 2BJMH 5E94B 1RMFH 2V2TA 3O3EA 4NZDA 3DO7B 1A2YA 3V52L 1VA9A 4QXUH 2CSPA 1XFPA 1XGYH 3I85A 3EJYD 4JVPA 3DI2B 2CKNA 4U0RB 2BK8A 4ODHH 4LP5A 4X7CC 4AH2A 1NC2D 1PVHA 2VTFA 2FR4A 5IB5A 8FABA 2AK1H 4X99A 4EUPA 5I2IA 1O0VA 4FQHB 2VZ3A 1KTKE 4WW2A 3OB0K 3RGHA 5IB2A 1A6WH 3V4PL 4KKCD 3KYKL 3HFMH 3VD4A 3O6FC 5KS9A 4BSVA 5KJRH 5T1DH 4ETQA 5IB1A 2OTPA 1BZQK 2D9CA 4XCCH 2JELL 3F8UB 1TITA 1B90A 2QL1A 4JGUA 2UWEE 2CUIA 3Q0HA 4GUPA 1RJYA 4Z7WF 4PJ5D 4U2ZA 2OR7A 2G5BB 3RNQB 2VDPH 5FUCC 4AQ1B 2Q86A 3RZCD 2G75A 5DMIH 4S1RL 2WWKT 2X89A 4ALAH 3ARED 3IJHA 2HTLD 4JY5L 5IOPB 4DN4H 1OQOA 5CJ5A 1OHQA 5I16B 1IC7H 4M4PA 2DWEB 3V4UL 2EKSA 4ERSH 5H94A 4OJFL 5FIEA 3KPRD 3TC9A 4RGNE 3PJSA 5CINL 1HK6A 1CTNA 3RZCC 1BLNB 1RD6A 1AGEA 3P4NB 1CU4L 1AR1C 2HTLC 1T21B 3WIHL 4PJHB 3ZDXF 1OPGH 1KIUA 4GXUM 5TFSH 4F2MB 4BSWA 3BP7B 1A3RL 1OGAB 3CDGB 4M93B 3UTTB 4U1NA 2P8LA 5E8NB 3DVNA 3D25A 2UVEA 4G5ZL 2LV4A 2P1YA 5GGUA 4M6NL 4ELKB 2VZUA 4HPOH 3NIGE 3MV8B 4P3CL 5DRZA 3VXUB 3VFMA 4LVNC 3MRLA 1EZVY 4G6KL 3QULA 1CR9L 1VADA 1A0QH 2BNQB 3MRPB 4YE4L 3G6DH 3BE1H 1MIEL 4BFGA 3QIWB 3OKDB 3L7EA 1JUFB 4HC1H 1MJ7L 1WT5C 5T3XH 5TDOA 4LGPB 4PGBA 5HHOB 2J8HA 4YGVB 3DUUA 2BVTA 4IRJD 4U6YB 3MRFB 1RUAH 4IRSA 1RAMA 4X8JA 4J12A 5ICXB 5E9DA 2X4SB 5E2VL 1CT8B 2UZYB 2XN9A 3FT4B 2ZNXA 4Z7VE 1X5LA 3KYNA 3UBXI 3EZJB 5L88H 5I1DA 4IS6B 4OAWA 3FONB 3QWOB 4N0UE 1S7SA 3MLYH 4I3SL 5C9JA 5I1GH 3EOTL 2BMKA 1FNEA 3OKEA 4HDIB 3ROLA 2ZOLA 3W0WE 1C8PA 2NY5L 3PHQA 1MI5A 5IKCA 3WFBL 1LK3L 3QUZD 4GKZA 2X4UA 3ECBB 1S7XB 3IRPX 2FX8L 4J2XA 5GGTA 4HIEA 3GM0A 3UDWA 2XZCH 5F9OH 3WJLA 4H0HB 4DFIA 1U3HA 1S9KC 2EIEA 5CBEA 1CICD 4XP1L 1EEYA 4C56D 4Y19A 2W07A 3N1PC 2GEEA 1IQDB 4OZFG 4X83A 3GMNA 5F7YC 2FD6L 1C16B 3QUZC 3HC3H 2YA2A 5ERWB 3BMWA 3QRGL 5D9SB 3RGVD 1ZHBA 5LGHL 1UM5H 1YN6A 4MJIB 4HXAH 1P4IH 3UPRB 1UYWH 5GSRB 4P3WA 4GAFB 1INQA 2IMMA 3SJVB 1BBDH 4KQ3H 2QQKL 5I74C 4W4OC 1PKQA 3KPOB 2OZ4L 4XNYL 1A5FL 5EU3A 2VLMD 3Q6FB 3AAZA 3HAEH 3D69B 2FIKA 2EIZB 1U91A 4WWID 2YKLH 3GNML 4JQIH 5CZXD 2J8UB 3RJQB 5AD0B 4LCCA 5K9JL 1NC2A 4KTYA 3U46A 4U1HA 5FFLA 2HN7B 2MKLC 3MPCA 4H20H 4XPBH 4HGWA 2MFNA 5C0GB 4X4XB 1A6AA 1KB5L 2VUYA 4MXQC 5MEPA 1ACZA 5HXMA 3T09A 5JDSA 4IIQC 4JFPB 1H15B 4X80H 4KK5D 3RI5F 1QLRA 3MJ8A 3VFUA 1RIUL 2LAAA 3FQWA 4PJFA 3I75A 4NJ9H 2BCKB 4EUPG 4JKPH 1AI1L 1DP0A 1EJOL 3GK8H 5HHNB 3KHOA 2GW5A 4PJ5A 5DYOA 4MA8L 1H3UA 4UTBH 4NQCD 1GZPA 3RZCA 1BVLB 2ID5A 3AREA 4G7YH 1ZTXH 3P0YL 4BZ1H 4ZFFB 3K2UL 4PUBH 5HHME 1R3KA 4KI5E 3V0WH 3S98A 1P1ZB 3VWKB 4GKOA 5D2NE 1I3UA 5I76B 3PHOA 2QHLA 1WSST 5F1OB 4ONHB 4YNYA 1GGIL 4HIXL 1U3JA 1ZLVK 4O02H 3KPRA 1QQDA 2K9UA 4QLRA 5T3ZL 4XH2A 1ONQB 1EXUB 4XBPA 5ESQA 2A9ML 4K3HA 3L5HA 1A1NA 2DJ4A 4YWGH 3BEWA 2XOTA 3ZKXC 1Q8MA 4GXVH 2ITCB 4Q9BA 3RA7L 1NDGA 5C0BE 4UU9B 4EI5B 4NQXA 1BD2B 4RQQA 3IAPA 4KMLB 2X4TA 5D7LB 2NTSP 1NFIA 2CR6A 2YPLB 3L3GA 3MOQA 4XVTL 5F7EL 1CXKA 3FZUD 2AV7B 3P73B 2IPKB 5E8DH 5C0FA 2YWYA 4LPVA 4X6FA 1IKNC 2HMID 4IRJA 1F58L 5EO9B 3KXFB 4XNZB 1T0PB 1J8HA 3L1OH 5K9OA 2YA1A 1P84K 4YQXH 4UAOC 3Q1SH 3T2NL 4I18A 3UTZB 3FZUC 3VFGH 1C12B 2YN3A 5BS0B 1A14H 4GG6E 4UQ3B 3ZKSD 2CRYA 3MRGA 2IJ0C 1BM3L 1GGCH 3C6SB 2VKXA 4MLIA 5BRZD 1BZ7A 3RUGA 3BUYB 2NW3A 1Q9OB 1F4XH 1OWRM 3KPMA 1QBML 2DI8A 3QUZA 4NWUL 2VL4A 2F19H 3ZYJA 2UYLB 3EDDA 3SBWC 1IQWH 3UX9B 1FZMB 4AENB 5J7CC 1U58A 2X5PA 1MCJA 4RFOL 1LO3L 5EIQA 3JSSA 3DYMA 1NCNA 1YEIL 1CICA 1ORQA 1ZEAH 2LU4A 25C8L 1L0XA 4ZAKC 4C56A 4XC3H 1FL5B 4S1SH 5F8RC 4KV5F 2BY1A 3AB0B 3HZKB 4NJAH 3MLPA 1YPZB 1NMCB 2QSCL 3NVQA 2EYTA 3RGVA 5I1HH 3DLQR 3C9NB 3TV3L 2VDLH 2Z91A 3OJDB 3IAQA 2V2WA 3RFZC 3OL2A 5EO1A 4TNVK 4YEFA 5A2IH 1ZOXA 3IDXL 3RTQB 1TVDA 1MAMH 2VDQL 5C6TL 5T33L 5EUOE 4HD9A 4IIQA 2D9QB 2ATKA 5INDB 2LVCA 4PV8A 3D18A 3B3IA 4UDUB 2EECA 1C5CH 1U8HA 4O2FB 5GS1C 4Y2OA 1JZ6A 1J0ZA 1G84A 3RX7A 2H32A 3ARSA 3IJSB 4PJ8B 1RK0B 5EU4A 2D7QA 1KTLA 4LASL 4UOJA 4JPIA 4K7PL 2HYMA 2IPUG 3QT2A 4PY8J 4NQEB 1QD0A 4CVZB 1A1OA 5ECJE 5F1IA 4XNUL 4YFLF 1MLCB 3B9DA 2ZSVA 2YRPA 5IB3B 1KJ2H 2ZCLL 3MLZH 4Z0BL 2V5MA 1HEZB 1PJ9A 4NQDB 1J86A 2XTJE 1RZ8B 2R9HC 4BQ8A 3VMNA 5DD3H 4NQCA 4P23B 3U7AA 5C08E 5I75B 2J88H 4EIGB 3R1GH 5I1LA 3WUWG 4LHQB 3RIFF 3LQAL 3O6MH 3VFWB 4R26L 2OQJB 1IEAB 3P4OB 1F3JB 4OD2A 3HG1E 3IDJB 4YBLB 4FQJH 2PW2A 1YN7A 2WIIB 3GI9H 5C0JB 4R4NC 4JAMB 5FA4A 1T03L 1CG9B 1N5YH 3GSQA 3NA9H 2QR0B 4Y1AE 2P5EB 5EC1B 3BXNB 2AV1B 3OPZH 4KVCL 3TPUB 5KVFH 2PO6B 1KG0A 5FKPB 4MA7H 2RB8A 5GJTL 1VCAA 3OZ9H 5INCB 3QI9D 1NUFA 3KPQA 3PGCA 4RGNC 2DAVA 2M8XA 3D85D 4Z8FH 4L4VD 1F2QA 3IDYB 1IAIH 3OXSB 4LLWB 4NCC2 4XNXH 2WUBL 5IVNA 4FG6D 2R23A 1LO0H 3EAKA 3VXRB 4NHUA 4GMTL 4JJ5B 3WNNA 5EZJA 4NBXB 2ICEA 1LO2H 4I48A 4OCNC 4FFVC 4P9ML 2YD4A 2ENYA 1FRGL 1D6EA 4PJDB 3L3JB 1QHOA 1CD1A 2HFFB 2C3GA 4JE4B 2ICWJ 2WNGA 5CBAA 1OAXL 3HC4L 3DVFA 1JNJA 3ARXA 3QYCA 5DLML 2AJ3A 2YUZA 5E99L 4I0KA 4J3OC 5AAMA 1RFDL 2EDYA 3UJIH 2VXUL 4P4KC 1XH3A 4MDIA 5ELIA 1UT9A 1GYAA 3TBVA 1S9YB 1U9KA 2QSVA 4M3KB 3SGDH 1SQ2N 4P9HH 1MRCH 3E8UL 4TUOA 3N50A 3ZKQD 3B2UD 1BQHA 1OAKL 3OXRA 4GOSA 4LOUD 2VLRE 4OB5L 1O7SA 1MJ8H 4PPTA 1F8TL 4DZ8A 4FQXD 1A6UH 4PRDA 3MRRA 1MFEL 4R7DA 4QNPE 1C08B 5BRZA 2FSEB 4TSAH 3O4LE 2PN5A 4ZOBA 1ADQL 5GGSA 2HJFA 3QDGA 3SE9L 1RSFA 1S9XB 5HGGS 4X9HA 1FHGA 4U1GB 4FQXC 4DFHA 5CCKH 2DM2A 5J12B 2AJYL 5F9WC 3JWDL 2FIRT 3R0MA 2ESVD 3MLVL 3RKDC 3VRIA 4PB0H 2B2XH 4HKJB 2YEZA 5F96H 3Q5OA 2DD8L 1JZ7A 2R29L 1CFVH 5CLTA 4CMHC 3RHWK 4Q6IC 3EYFB 4CN4A 1K3IA 1ORSA 4ZFGL 5BV7H 4WRLA 1F3RB 1Z9LA 4N5UA 2W60A 3ARUA 4XWGH 4F37F 4CJ1A 4XZUB 2V2XB 2C4FT 5JW4M 3IKKA 1JVKA 1ZT1A 1JYWA 4L3EE 4LQ1A 2DDQH 1OM3L 2FO4A 3TPKA 2CIKB 1BBJB 1X5FA 1FSKB 1H0DA 4YHZH 3DROA 2YMXL 5HHQA 4OV5A 1BVZA 3GIZL 3UPAA 2YOCA 1FO0A 1PY4A 4IOIB 4UV7L 1U8IA 1A47A 5L2JA 1KCUL 2LAGB 3MLUL 1MHEA 1W2KT 1U92B 1V8HA 3RVUD 2Q3ZA 1GZQA 1AGCA 3HAEA 1KCSH 2ZP0T 4LBEA 4OIAA 3TBWB 5KZCB 3WNOA 5BO1L 4Q2ZB 3RWCA 3CX2A 3EDEA 1Y6MR 1A6VH 1AP2B 4JFXA 4LVHC 1ODAA 1G7LB 3S37H 5EWIH 4RNRB 3FQXA 2V7NB 1Z5LB 2CK0L 5HD8C 4GAJL 1T4KA 2D7TH 1GIGH 1I1CA 3L3DA 5D1QD 1CD9B 2XA8L 3KPTA 1SJHA 1SJEA 4XAKD 4DAGL 3C2AL 4CU6A 2FJFA 4HJJH 3ZHLA 2GT9B 2P8PA 3DHMA 2V5SA 3RWEA 4KI5C 3WXVL 2XQYG 4RA0C 5D2NC 4PJ7F 2AJVL 4K7PY 4BM7A 3BIKA 2IFFL 2UWEF 2QHRL 4HSQA 5D1QC 3MRNB 3QI9A 5TE4H 4Y4KD 1D6VH 2C1PA 2UZIL 1OVZA 3FFDA 2IFGA 3D85A 1QSVA 4L4VA 4OBRA 1Z9MA 4NC1E 3RWHB 4EZMA 5K9QG 2XZQH 5EPMA 2NY1D 4JANB 1FFOB 2Q76A 3QCTL 4HUVA 5AWNL 4L1DA 3RRQA 5EA0H 1MHHA 4PFEA 1HHIB 5LWYL 3OKMA 1CCZA 4MNQD 5JOFA 3C5SA 4YBQD 5IHZA 1JPFA 4KC3B 5DFTA 4LCIL 3VXOB 1QLFA 2NY1C 2BSTB 1A6ZB 4R8WL 3QIUB 5IVOA 1JWSA 4FXGA 1SBSL 5DD6A 1YEGL 1NEUA 1R5IA 1ITBB 2VDNL 3SDXE 4MQ7A 3MFGB 2Y06L 3L95A 1IGTB 4I77L 1SVZA 8CGTA 5E6IB 5J6HB 3NIGF 2W9DH 3TBSB 4APQB 4ZD3L 2DQDH 4D9RD 3QUKB 4E42A 4DWHA 2BVYA 1HSAB 1RZGA 4OZIB 3MLTA 5FHAH 4OT1L 4FQXA 1CXEA 2FH6A 4TVPL 4GRWF 1FDLL 4XNMB 1MWAL 2X9WA 4U3XA 4XCYB 1G6RL 5JW3H 3HI6H 4X4YA 4BA8A 2RCSH 5FGCE 3WNPA 1IGCL 1KLUB 3L7FA 1X6LA 4L9LB 3LQZA 2E7LA 4EOWH 4Z7VF 5I8KL 1MLBA 1Z6JT 5ALCH 5KAQF 2AJZB 2ESVA 3SGEI 4MGXA 1PLGH 2B39A 2MPAH 1MQ8A 1EA9C 2DB8A 4P9HC 1IL1B 1RZJL 4WFEE 3QHFH 3NIDE 4HUWA 3X12A 3C6LB 1TDQA 1W72H 3V5HB 3PQYE 2EDTA 3GSWB 4NZRL 3PGFH 4I13B 1YEEH 2Q3AA 2FECL 1NAMH 4U6TA 2VDRH 3MMEA 1JZ3A 5DT1L 5DEFB 4K3JL 3PE9A 1ZGLA 3BFOA 1NCWL 1WZ1L 2LTQB 5DJAB 4CKVX 1BZ9B 2VLLB 1J1OL 5BCAA 3QCUL 1I7RA 1KEGL 4WCYL 4G8EB 3NZ8B 3F7QA 4UIMB 3OG4B 3WHXA 3BSZH 1YEHH 4XB8A 3O2VH 1TZHA 3ZE1E 2Y07H 3AU1A 5FDWA 1DQLL 3LD8B 1PZ5A 4TUKH 2MQ3A 1YC7A 2W91A 2PYED 4PY7B 2V6HA 5BW7C 1OTTC 5JHDE 5DHXB 4UINL 1CFTB 2H26B 3OAZH 1A6TB 3QJHB 4HX1A 1TJHL 3SO3B 1JPGA 2BJML 1N2RA 1RZIA 2QQLL 3CH1B 5BV7C 3QB7C 2IQ9L 4RZCA 2XTJC 4JRXB 3ULSA 1XGYL 4WHYG 5D1QA 3T2OA 2Q7NA 1RIVL 3MRDA 5DJCB 1KCKA 4MX7A 1ZLSL 2BRQA 1MRFH 3A6OA 1JTPA 4ODHL 1WGOA 3OV6A 2DL9A 5CJOH 2YHGA 4PJBE 4AY0A 3I02B 3STBA 4M61A 3FN3A 3PG2A 1FFQA 2HT2D 1N7ML 1ZT4B 3GM8A 3HFML 2FCBA 3V8CA 1HHGA 1UZ8A 1E4WH 5F71A 3C5ZB 5KJRL 5IG7B 4Y4KA 2OS7A 2IALA 1GVIA 3V5KA 4NC0B 3BVNB 1H5BB 1NH6A 3T0AA 4JDTH 5MP6H 3ZE2E 2VDPL 4KI5F 3JUZA 4G9FA 5DMIL 2F53E 1RPQA 1KIPB 4ALAL 2O93L 4MVBD 5CWSB 1T2JA 3MXVH 4DN4L 4Z7QE 5CZVH 1ETZA 1IC7L 4MNQA 1OQXA 1UJ3C 2MNUA 4E41B 3GRWA 1ZLWK 5EOTB 3QUML 3UYRH 1HHKB 2R2HA 4XP9H 3WD5H 3B6SB 2R8SH 1D5MB 2ICWI 3OKLB 4MVBC 5HYIA 2DQHH 4JFDE 5C0AD 1OF2A 4FXLA 2A6DA 3MRJA 4MA3B 1LE5A 1PY9A 1N6QH 1N4XL 1S5HA 5TPWL 2ADGA 3O4LD 3QXWA 1QFUL 2X4RA 4M7LH 4PJEE 2JCCB 4HPOL 2QKIA 5DGRA 1U95A 4YK4C 4ZS6D 4Q9CA 3U83A 1FNAA 1MNUH 2JF1A 1CQYA 5CEYB 3G6DL 2AVGA 4RAUB 2BFVH 2DBJA 5EB9A 3KJ4B 2GJZA 2J2ZA 4M6AA 5T3XL 1N3NB 2BRRH 3B9KB 4JGMA 5FV2A 3QUXD 4IRZH 5IR1B 4S1DC 5GS0D 4Z7NE 3BPOB 3IF1B 3MNWA 5DC9B 4B7LA 2HRLA 1NMAH 3EUUA 4GG6F 2DQEL 5KOVC 3VFSB 2BOBA 4DKFH 5L88L 3TIDB 2PXYB 1LNUB 4OCRL 3JTSB 3U7WH 5ADPL 2YD3A 1TQCB 4Y4FC 3MLYL 4EKXA 5IQ9B 5I1GL 4JDZA 1U8KA 1L9MA 5BZDB 3AS2A 2DICA 3FT3B 1R5VB 4BFIB 1WZLA 4EBQL 2EDEA 1XR8B 3CVHB 2BNUB 4DVBB 4I2XE 5D2LE 1W8OA 4N90E 5HYJD 5CS7A 5F9OL 3S3PA 1YMME 4JM2C 2R4SH 2H9GB 4GRLB 2EDJA 2WANA 3O45A 5D7JC 3GSXB 1RU9H 3LSOA 5C0EA 4Z77B 1W0VA 3I9GH 5E5UB 3WHE1 4ZUSA 4NQSB 2PYEA 4GJTB 4W6YB 2VABA 1QRND 1UM5L 4YHKH 4CDHA 4HXAL 5E00A 1P4IL 4C58B 1XGTB 4FTVB 1UYWL 1MCCA 3MGOA 5EUOF 4WW1B 2R0KH 5FA3B 5FYKE 4R97C 4EDWH 4OCYH 1XF5A 1RK1B 3V6ZB 5KVEH 4OIIH 3P4LA 3VXNB 2IAMC 1KEMH 1T7WA 1YEKH 3D0VA 3CFDB 4M1DL 3H3PL 1MFDH 3G6JA 4P2RD 1M71A 1NMBH 1B6DA 2ZUQB 3GJFH 2YKLL 3DUSB 4JQIL 3NFSH 3MSPA 1NGYA 2BC4B 3S96A 4BZ2L 2EXYD 4K71B 2ADIA 3FCTA 5C1MB 1MELA 1UZ6E 4KJQC 4H20L 2UZXB 5JR1L 3GMOB 3BGMB 3BKMH 1E6OH 3TT3H 4UZGA 4X6CB 4YDLB 3ALWA 1KN4H 3PF2A 3B2VH 4M6MH 4J6RH 4ODBD 4OQ1A 4XPAH 1ZHLA 3IT8D 3VG0H 4HWBH 2XWJB 4Z78B 3GK8L 4LAJH 1G7JA 4U7SA 1UXWA 3VXSB 3BZFB 3BQUB 4QRRD 4UTBL 4MXVE 3T8XA 5HHVL 4FABL 3P9MA 5DUMH 3HUJA 4L8SA 3P0VH 4RBPH 1T89A 4BZ1L 3K81A 1FFPB 1FVEB 3QP3A 5BXFA 3V0WL 3QFDB 4OLWL 2XG5A 3RX8A 4NKMB 1NEZB 2OX5A 1CGSL 2WSKA 3OG6B 5EBLB 1T0NA 3K4ZA 3QQ4A 1IM3A 1QNZH 4QHNA 1UB5A 1T7ZA 1I8LC 4J1UA 5GHWH 4LP4A 2APWA 4O9HH 4LSUH 3WHE0 4WU5A 4HUUB 4OM0L 5C0AA 2OJZL 4V1DD 3QDJE 5J1TC 2FYYB 1ZS8B 3MACH 4GXVL 5JXEC 3MRKA 3S34H 3QDAA 4NNXB 4Y5YA 3UTSD 1JHLH 2F54E 5DMGD 3ROOA 1WAAE 3AXLA 4LF3B 3X14A 4HFUH 4L4TE 3TNMB 1FZKA 2HKHH 3MRQB 3QPXH 5IMKB 3O9WD 4I0PD 2GSGB 4YLQT 3SO5A 3VGAC 2QQNL 1F6AB 7FABH 4G43A 5D7KD 4WDIA 4XPTH 4TTDC 4ODWA 1TPXB 4NZTL 5I15H 4LLVA 1U2HA 3QUXA 4OI7A 2V17H 4H5SA 4DOHB 2VO5A 3L1OL 3O9WC 1ND0A 4YQXL 2CDFB 3KPNB 3V8OA 3Q1SL 5F7WC 3VXTA 2ZKHL 4PJGB 3VFGL 3IDUA 3N9GH 2CLVA 3CZFB 4QNPF 3ZDYE 1A14L 4BK4A 2DLFH 3HI5L 1FZJB 4N9GB 1YNKH 4ODSH 4NM4H 2HTKD 4JZJB 5FYKH 1HXMA 3MO1A 3MUJA 3WEXB 5L8KB 4NN6C 4XWOD 3O6LL 4ZOEA 3OX8B 2Z35A 4G80A 3L6FA 4N8CH 4Y2DB 2VXQH 3K2MC 3I6LD 3C8HA 4XVSH 3DHJA 2F19L 2B1HL 3T3ME 3RVWD 3RWDB 1XCTB 5HYJA 4RFNC 1TFHA 2K3TA 3SHSA 4X6DB 1ZEAL 3M45A 3DX6A 1W72A 4XC3L 1B0GA 4N5ED 4IJ3C 4G8FB 4NNPL 4ORGB 4UTAL 3FB8A 3TBYA 1NAMA 1QSFE 5I1HL 1QRNA 4URTB 3BP4A 3RVWC 2HFGH 4LMQI 2HJKB 4HZLB 5KTEL 2AEQL 1B4RA 1NCCH 5D7SH 4KDWA 4IOFC 4JM2F 4X5XB 5IESL 1C5DB 4Y5XA 1ZSDA 1MAML 4N5EC 2O5YH 1S7QB 5D7IE 1HINH 1Z0MA 2OTWB 4MJ5B 3F7VA 2DWDA 2YBRA 4P2RA 1X5JA 1TIUA 3CFBB 5J1SC 5DEZA 5EORH 5EN2A 4HV8B 1ZHNB 5FO7B 4PJAB 1OTSD 5FUZH 4PR5A 1J9CT 1J7VR 2FH8A 4P2CG 1UM4H 5CEZD 2XY2A 1CDHA 1MAJA 4QRPE 4FOMA 3MCKB 4OFYD 1F4WL 1TXKA 2ARJQ 1KJ2L 2J8OA 4ODUB 5JIIA 4P2QE 2DN7A 4NT6A 1DL7H 1M7XA 3CMGA 1WIUA 2F5BH 1Q9WA 4QRRA 1H3TA 2GUOB 2J88L 4WJ5B 3O6ML 4LAQH 4OGYH 2NY4D 4Z7WB 3FFCD 2UV3A 5FK9A 4HGMA 4F80A 1M6OA 2AP2A 4FQJL 4NSKB 3O0RL 1OGTA 4QOKE 3FAWA 5DZLA 3O3EB 3T0EE 3GI9L 1NUGA 1A2YB 2AAVA 2GITB 5DR5H 4HJGA 1MCNA 1JI1A 2Y25A 4WUKL 1LDPL 1FYTE 5HVGB 5E8OB 1QHPA 2Z8VC 3V0VB 1HQ4B 3OZ9L 3GSNA 4XX1G 5LQBH 2FR4B 2EDNA 2YWZA 1NCAH 5IB5B 4V1DA 1UFUA 5F7UA 3FOLB 5I2IB 4Z8FL 4Y8AA 4OZHE 5IB2B 1IAIL 2G2RA 5ALBH 4XNXL 4ZFOL 4WFFD 5L7XH 3HZVA 2BVUA 4DGIH 1LO0L 3UTSA 4XHJD 1OSZB 4ETQB 3BWUC 5C0DB 2X09A 4Z7UE 1LO2L 32C2B 3F7YA 3EBAA 4KTEL 3QEGL 1MREH 4GUPB 1EZVX 1RJYB 3U36B 2Z4QA 3N06B 1X4XA 3HMWH 1WF5A 4HULB 4I0PA 1WFOA 4HF5H 4WHYH 5C0CE 5SWQA 1MY7A 2Q86B 2G75B 3TJEH 3B8SA 3IJHB 5C3TA 1J12A 3U9UA 5L2KB 2BSSA 4B41A 4LARH 1AIFA 3ARGD 4WHDA 4RMSA 4MS8C 2Q6WA 5BZWB 5I17A 5E2JA 3STZA 4OV6F 4WUUD 2V9TA 2P5WD 3PJSB 2HVJA 4P9HL 3S5LG 3HB3C 5IJKA 3LY6A 3VD3A 4PJXE 1AGEB 1MJ8L 3B5TA 4GW1A 3QIBB 4HXBH 1CK0H 1OWWA 3CLEL 2XI9A 3C8DA 4L5FH 3CSYB 3ARGC 1SYVB 3CU1A 4BSWB 4XP6L 3BPLC 3EO0B 3QQNA 3V4VL 1S7TA 4U1NB 5B39B 3DVNB 1LILA 2I60L 4YR6A 1YMMD 1I9RL 5HDLA 3CVIH 2NX5B 2OL3A 5GGUB 4Q58C 5GS2H 1MCRA 3CK0H 1D5BA 3TH3T 4JG1H 5LAXA 4PJIF 1LP9E 3MRLB 2J6EH 3QULB 1VADB 4U1IA 1P7QD 3RKPA 1DE4A 1E4XI 5HYQA 1Q72H 2QV2A 3ZLQC 3QXDA 4PB0L 3L7EB 3NIDF 1JRHI 5TDOB 3GSUA 2BSRA 1UM6L 3BKJL 1VFMA 5FB8A 5KSVB 4PLKC 5GZOD 4PJCE 5DD0H 5ITBH 2FZ3A 3BWAA 4PB9L 5E9DB 5DK0A 5BV7L 3MR9A 3CLFH 1QOKA 4XWGL 3QXUA 5I1DB 4OAWB 2KQMA 5AG9A 1VENA 4QHUA 4XNQA 5CEXA 3NABL 1YA5A 5HDOA 4YHZL 1A9EB 3WIFA 3OAUH 1FNEB 4BUHA 4CVUA 4JKLA 2EH8H 1HE7A 1V5JA 3QDHA 1FORH 1MI5B 3KLSA 3ZE1F 2IWGA 2XFXB 4AJ0A 1LQSR 2D7NA 4JFFE 2IG2H 4GKZB 3RDTD 2X4UB 5DQDH 4HK0A 5I71B 3G5YB 1AXIB 5IHUH 4OFYA 2VUOA 1H8SA 2H2PC 4NNYA 3BZDA 5HGAA 1U3HB 2ED9A 1XGRA 4O4YL 2FBOJ 4CN6A 2E8YA 1AGFA 3UP1A 1QR1A 4MB4A 2KL6A 1IEHA 4B7IA 5EWIL 1RJZA 3D87B 3RDTC 1OGAD 1YN6B 4PG9B 4TVSa 2MTPA 1GIGL 4TUJB 3FFCA 1U93A 1SYSB 1HILA 1PKQB 4N1CA 4OZGA 3MV8D 1FBIH 3VXUD 5EU3B 5KN5A 1ITCA 3AAZB 3O6FB 1BOGA 2ZOKA 5DA0B 2WUCH 4RAVB 2FIKB 1KLGA 4JGJA 3PWUA 4U1MB 2OK0H 5I8EA 1B2WH 4TN9A 3QIWD 4LCCB 5I18H 1NC2B 3U46B 4U1HB 1CIDA 2HLFD 5HHOD 1UG9A 4GW5A 1FC1A 2KQNA 4G42A 3SKOA 3ZE2F 4HGWB 4L4TD 1A6AB 1LE9B 5MEPB 3G9AB 5K59E 5BMFL 2XZQL 5FGBC 3QG6A 3VDAA 4MQXC 4Z7QF 1QVOA 1QLRB 3VFUB 5IHBA 1V3JA 1FC2D 4MNHB 5EA0L 4WV1A 3LS4H 1A3QA 4NRZA 2R4RH 4PJ5B 3UTPE 4TRPH 1HHJA 5DYOB 2WM0A 4ODVL 1V3KA 3TBTB 4LNVA 3R8BB 1U8QA 1CYGA 3RZCB 4Q0XH 4R3SA 5J4MA 3AREB 3NN8A 2HWZH 1DQDL 4FQLH 3ARGA 3PHOB 1NGWA 2CIIA 1KSRA 1DUYA 3TVMD 2WBKA 1RZ7H 4WUUA 5FYJL 2P5WA 3GBNL 1S8DA 4PJEF 4XAWH 3TIEA 4XH2B 5JHLH 43CAB 4WNQB 2DQDL 2ZZUT 3QJFA 3NA4A 4XBPB 1JV5B 1QYGH 1A1NB 4U1SA 3BEWB 4MJID 4JHWH 3EYOA 5D2LA 1FVCA 4JPWL 3O3UN 3VMPA 3EYQD 1E6JL 3TVMC 1OAZH 3QA3B 3SGJC 3OQ3B 5F9JA 5IMLA 4NP4H 4M48L 3ARYA 1T7XA 4RQQB 3HI6L 1YNLH 1JK8B 4G7VL 1NFIB 2RCSL 5HYEA 1JGUH 3SKUD 2EE6A 3QFJE 3DETD 3L3GB 5F88A 1P7QA 4FFZH 2PW1B 2RFXA 2FJGB 4JY6B 1AO7E 3DGCR 5C0FB 2HLAB 1KTDB 5GS2D 3DWTA 1U2CA 1TLKA 1UB6A 1XGPB 4I3RH 5TQ0L 1JWMA 4I18B 1IEBA 2VH5H 1NBZB 3PGFL 4HCRA 3HC0A 4HMCA 2VDRL 3F6IA 2ZUUA 3MRGB 3RNQA 5EZOL 5IV2A 4D0DB 5L0QC 1X44A 1Z3GH 1KACB 1EGJH 1BZ7B 3RUGB 3X11B 3WCYA 2MOVA 3CD4A 1UH2A 3QUZB 2VQ1A 2YSSB 5CIPA 3RDTA 2DWEA 4TTGA 5FO8B 2VR9A 4PJ9C 1X5HA 4YUEL 4A6YB 4ELMA 1NGPL 2DI9A 4JRYE 4A2MA 1ORQB 5ICYA 1XF3A 5MENE 5TE7L 3JUYA 4C56B 2IGFL 4FS0A 3P4NA 2X40A 5B4MD 4PTTB 3BYYA 3X3FH 4CJ0A 4F2MA 5IVXE 2EYTB 5DTFB 3RGVB 1OGAA 3CDGA 5JUEH 4FNLH 4NUJA 1JHTA 1GPOH 4JPKH 2NYYC 1N6UA 4UT7H 3KLHC 1MRFL 5D7LD 3MV8A 3VXUA 1M05B 2V5YA 4IIQB 1P84J 2YPLD 4YX2H 4PV8B 5D6DC 1F3DJ 3B3IB 2JJSA 1N8ZB 1U8HB 1G6VK 2UY6A 3QIWA 4X4ZA 1U36A 5DQJB 2ERJC 5EU4B 1JUFA 3FQTA 5HHOA 4YPGB 1IBGH 2R69H 2DLEA 4MXVF 4U6YA 3RY6C 1PG7X 3KXFD 4L4TA 4ZUWA 5F1IB 1JNNH 2B1AH 2VDMH 5ICXA 2GY7B 3U7YL 1AGDA 2X4SA 1YECH 2ZSVB 4JDTL 2OM5A 4YFLI 5MP6L 4U7KA 4FQIH 1OLZA 1J0KA 3VMOA 5C0CD 2FECI 4WTZG 4IS6A 1HH6B 3FONA 2EDLA 3QWOA 3MXVL 5DD5H 2BNRD 5CZVL 2WWMC 4P57B 5DUPH 5E2WL 1AFVL 4NQCB 4HFWB 4NKIH 5C9KA 1GL4B 3BIAX 5C0IA 4S1QL 5IWLA 2EDHA 3UYRL 4OD2B 1DBBL 2NY3C 1CFSB 1S7XA 3STLB 2PW2B 1P4BL 4YHYC 1YN7B 3ZKXB 3P30H 5FA4B 5KW9L 4C54A 2DQHL 1MCKA 3WKMH 3V7AG 3Q6GH 1HH9A 2DKSA 3BN9C 3RL1B 3TVMA 2DKMA 2I9TA 3DV6B 4EXPX 3ALPA 1KG0B 5GGQH 1WAAF 5B21A 3U0WL 3PIQB 2AJSH 2PCPB 1N6QL 3SQOH 1IQDA 4JR9L 3D39E 1J1PH 3HHRB 1LK2A 5CILL 3KPQB 3PGCB 4OTXH 1C16A 2VLKD 4NC2B 5D9SA 1FCGA 1J10A 4MJIA 2R0WL 3CFIC 3DSFL 3MUZ1 4KROD 3UPRA 5GSRA 5ESAB 3GHEH 2R23B 1LEGB 3NGBB 3GO1H 3RIAK 5IQ7L 4YHLH 1AE6H 2W59A 1HIML 4NHUB 4H1LG 2BFVL 4DEPB 4KKBC 2ICEB 3SDAC 3CXDH 5C2UB 4XPGH 2BRRL 1D6EB 4HWZA 4HPYH 2EIZA 3VRLF 4YEEA 4LLAA 2IANE 3U1SH 2J8UA 5AD0A 5CBAB 4KROC 3UO1H 4DUWA 3IS0X 2UY7A 3ES6A 4ZPVA 2GTZA 3ZDYF 1NMAL 4KHXH 3K4DA 4GO6B 4NQED 2Z8SA 3SE8H 5C0GA 4PLNC 1XH3B 1P69B 5F7HA 4WIQA 1H15A 3RVTD 5J13C 1TVHB 1P4LA 3IDIB 4DN3H 2CRZA 3T3MF 4F7EA 1BQHB 3OXRB 5HHNA 1J5OH 1M7IB 3BMVA 3TO4D 2OXGA 4JN2B 4JFFD 4OCSH 4P23D 3ABZA 1GHFH 5EC2B 1SM3H 2G5RA 3MRRB 1BJ1H 3TA3C 5C07E 1BVLA 5BRZB 3BPCA 4ZFFA 2Q1EA 1NPUA 2W9LA 3HR5B 1RU9L 2EXWD 5I1KH 4ONHA 3TO4C 1WWCA 3HLAA 4XBEL 2PO6D 3BP6B 4YHKL 1ONQA 4S11A 1EXUA 1MIMH 4TQEH 2R0KL 1OD9A 5D7IF 1FNHA 4EDWL 3VRIB 2YEZB 1F02I 5E1AA 3TYGH 2ITCA 2BVEA 1KEML 5GS1B 5EOQL 1DTUA 4UU9A 2E3VA 1YDPB 1MFDL 4YHMH 4CU8A 1CLOH 4NKDA 5D7LA 5FYJU 3SGEH 2A38A 1MCFA 3LKSB 1M1SA 4M3JA 4NIKB 4QXTA 2BSED 4C4KO 1ZT1B 4OLVH 2YPLA 5KSAD 5D5ME 1J0HA 2FO4B 3QEUA 3BKML 1F4YH 3TT3L 4HUNB 5GZNC 3BIBX 3DROB 2IPKA 2EC9U 2HT4C 2YS4A 5FM5O 3UC0H 3VXME 3DGGB 1KN4L 5I66B 1FO0B 3B2VL 1YEFL 4I9WE 3QDMD 1U8IB 4M6ML 4J6RL 4HKZA 2E6QA 1A7OH 1MHEB 3KXFA 3VG0L 3PNWB 2CKBH 2UWEB 3QUYC 2FX9H 5KSAC 1GZQB 4Y0GA 5GGRA 1AGCB 3HAEB 5F9AC 4HWEH 4N68A 4F7PA 1CDCA 3S36X 1RJLB 3P0VL 3DURA 4JFXB 4WI4A 4BH8A 4LPCA 4CADA 2BNRA 5A43C 5DWUH 3FQXB 3MV9D 4BYHA 1JNLH 3UYPA 5SWSD 1I7ZA 4OGXH 2LQRA 3BUYA 4FA8A 1IVLA 3PXJA 3L3DB 1Q9OA 1QNZL 1SJEB 2N7BA 1S7UA 4RGNB 5GHWL 4OZHF 4O9HL 3ZSTA 1FN4A 1G9MH 1FZMA 4AENA 1IT9H 5D1XC 4JFHE 2P8PB 3BISA 4KDTA 1KUMA 5C86A 3QZWB 3MACL 3OAZK 2DBLH 5I6XC 1FL5A 3S34L 3ULVE 5HHPB 3BIKB 1OAQH 5AZ2L 5TDNB 1JHLL 3QI9B 5DJYA 5AUMB 1VEPA 2VLKA 2BERA 2I25N 4HFUL 1NBYB 2AXFA 3OJDA 5C09D 3L3HA 1FGVL 2LE9A 3SGKC 4M7ZC 2DL2A 2UUDH 3INUH 3H9ZA 1HSBA 1WFTA 4HUVB 5HDBE 4JJHA 3QEQE 1KCRL 1RVFH 4K94H 1IC4H 4HS6A 5JOFB 3VU2A 3JWOL 5IHZB 1JPFB 1LD9A 2M1KA 2V17L 3LEYH 4PJXF 1TZGH 4AT6B 4NQEA 3W5MA 4ZODA 2DIAA 4K2UH 3ZT5A 3BH8A 4RGOL 2MWCA 4FXGB 4Z7VB 3N9GL 1SEBB 1MLCA 1R5IB 1T0MA 3UJJH 2XTLA 5CJBA 3ESVF 1YMHA 2AEPL 2AXGA 5KZCD 1GCFA 4N0UB 4PP2A 5D1ZC 3L95B 4JFOB 1FFRA 2NZ9C 5FYKL 4DQOL 1LP9F 1TETH 1I9JL 1RZ8A 4E42B 1RZGB 4N1EA 3TO4A 4XVSL 3QAZC 4P23A 3BZEA 1AQKH 3WIIL 4FQXB 2Y7QB 1K4CB 3BJLA 3P4OA 4FZEH 3QO1A 3IDJA 2B4CH 4RMWA 2WIIA 4YDIL 4X4YB 5F97E 4JAMA 4PJCF 3Q48A 2QR0A 5MHSE 3IFPB 4Q6IB 5EC1A 4JO4L 3L7FB 5JW4Q 3TPUA 2PO6A 5E1HB 3T04D 1DEDA 3LQZB 2HFGL 3O2DH 2NR6D 2NXZD 2ESVB 3SDDC 1VPOH 1UENA 1FNGB 4J4PD 1XMWA 3OXSA 4LLWA 2BVQB 2IBZY 3KYKH 3IJYA 3TYFA 4HUWB 4MXWL 4WEBL 4NN7C 2JELH 5EORL 1KJ3L 2NXZC 2V5RA 3L3JA 5KSAA 3MMEB 2HFFA 1P53A 2EDWA 1F5WA 4OF3A 3ILQD 1ZGLB 2VXTL 4ZTOL 4WFGE 4FQCL 1I7RB 4WHTA 4JY5H 4LVHB 3QDMA 5FCUH 3CFJA 1YEDA 1R6VA 1INDL 5IJVB 3EGSA 2A9NL 4KPHH 4Z6AT 1PZ5B 5DJ0A 2VKWA 5CINH 5E6ID 1TJIH 3GFUA 4LCWE 4LAQL 4APQD 3Q2CA 4XRCA 3LKOB 1EVTC 2B5IB 4HX1B 5FEBA 1JPGB 1N2RB 4R2GD 3WIHH 3MV9A 1QSEE 5D2NB 5SWSA 1NKRA 2FSEA 3FB7A 5D1QB 3LHPL 2CUMA 3MRDB 4M6NH 3M1BA 4S2SA 2YUWA 4GMSL 5FO9A 5K59F 1NCAL 4G6KH 4D9QD 4M61B 1CR9H 4R2GC 3WO4C 3W5NA 5ALBL 1A7QH 1UKQA 3NFNB 1MIEH 2FATH 5C0BB 3UAJC 1B0WA 1MJ7H 4Y4KB 3ULUD 3OJ2C 4LVOC 3V5KB 4EEEA 5C09A 3HMWL 1IAIM 1MCHA 3FB6A 2ZSWA 1OCWH 3HE6D 4ZO9A 5J1AA 4UNVA 4HF5L 9CGTA 5E2VH 2NY1B 2N1KA 1ZVSA 2V2XA 5DUBB 3TJEL 3W9DA 3VGHA 2WLYA 4LARL 2CIKA 5AZEH 1ETZB 2W92A 4MNQB 1JF1A 1A7RH 1G9MC 2FHBA 2NY5H 4ZFOB 3HE6C 4ZOAA 3BESR 4YDVB 1LK3H 1ZA3B 1A9BB 1U92A 4M02A 1T7VA 3PWNA 5FV1L 2FX7L 4HXBL 4F8QA 2A6DB 3MRJB 4RBPK 3H0TB 1CLYH 5DJDB 1AQDA 1V7MH 3B5HA 5CLWA 1S5HB 1G7LA 3FAXA 3AMLA 4XPFL 2FD6H 4PJHE 1Z5LA 1JFQL 3CK0L 2QKIB 3U2SB 3BRFA 4JG1L 3HPJA 2J6EL 3UTTE 4PRHE 4N0RA 3ZTNL 3AS3A 3S6CA 4K94C 2QQQA 2QQKH 5LXGH 2OZ4H 2GJZB 3K8MA 1EK3A 1Q72L 5KSBE 4JY4B 4XCEB 3TWCH 2BNQE 4YBHA 1F45A 4Y4HC 4K8RD 3GNMH 5C92A 2QSTA 4M7JH 5DHVH 3MNWB 1XZ0B 4UBDD 2PTTA 1AKJD 3ARFD 4K07A 3B8YA 4J4PA 2OP4L 5HGDB 5EUOB 4LK4A 4HEME 1JI2A 3OMZA 3DVGA 4D0BB 3TFKD 2A2QT 2AJUH 4JANA 1FFOA 1RIUH 1K8IA 4JDZB 1U8KB 3S3JA 1HNFA 1V05A 2EH8L 4H1LH 1AI1H 1HHIA 1BFTA 3ARFC 1GC1H 5GRVL 1BIHA 4MA8H 1YY8B 2IG2L 4JO2H 2Y23A 4F33A 3DARA 3SGDI 3C8KA 3P0YH 3TFKC 5E4EC 3K2UH 5LG1A 4ZXBC 4HMEA 3GMPA 3LKNA 3O45B 5C0EB 3WFHB 3T08A 1NCDL 3E2HC 3RBGA 1GGIH 3BDYL 4HIXH 4JN1L 4X8XA 3NBNA 2XTJB 1AD0A 1NCBL 3LN9A 1ACYL 2VABB 4QKXB 1IGTA 2EH7H 1BPVA 5E6IA 5C08B 5JZ7C 4M8VA 3TBSA 4HGKC 4APQA 5DRWA 2A9MH 3DMMD 4LCUB 1YNTA 5DJ2A 3TN0C 1FBIL 4PRAB 4P4RB 2FJHB 3RA7H 2B8OT 3D0VB 4XNMA 3DNKA 4Y1AB 3SJVE 2DM7A 2OK0L 4WGWB 3GUTA 2NLJB 2IF7A 3JVGA 2P45B 3F7PC 1NGYB 2WMPA 3NACL 3V6FA 5I18L 3U0TA 4ONOA 2X10A 3DMMC 1KB9K 2BX5A 4HBCH 1KLUA 3ARBC 4J3UA 2P44B 4XHQA 4XVTH 5F7EH 3L5WA 2P43B 4IMKC 5GGSY 1PG7W 1IZJA 5JOPE 3V6OA 3MBED 1NJ9B 1YJDH 4XI5D 2X1WL 3LEXA 1IL1A 2PXYD 4JM4H 4M4RA 1JTTA 3EZ8A 5D72H 1AC6A 1SHMA 4P5MB 5GRJH 3HE6A 3T2NH 4CN1A 4JHAL 1JGVH 1KT2B 3P9MB 3C09B 4Q0XL 5A16A 3HUJB 4OLYL 1INEL 2HWZL 1BQUA 4Y88A 5HVHC 3WMSA 1EPFA 1BM3H 4FQLL 4BQ6A 1BFVL 1J8KA 4OGAC 2I24N 4OZ4B 1BZ9A 2VLLA 2KKQA 3MFFB 5B8CC 3NZ8A 4UIMA 3QQ4B 1QBMH 4NOFA 4QHNB 4NWUH 1N64L 1IGYA 4J1UB 4NFCA 5IMMA 4YK4B 3UTOA 2VLRB 5I0DA 4WU5B 1QYGL 5C0AB 3MC0A 1LO3H 4PY7A 1YEIH 4JHWL 4F8TA 2H26A 5KVGH 1OAZL 1KULA 2QSCH 1RUML 3O4LB 3ROOB 1BJMA 1YNLL 3AXLB 2Z93B 1QBAA 3TV3H 4R7NB 1FZKB 3DECA 3K8LA 5EOCJ 5C0NC 3PDGA 2APXA 4JREB 1BD2E 4FFZL 1FL6B 5E0QA 4G43B 2VDQH 4KRPC 2O5XH 4WDIB 3JV4B 4ZO8A 3DTXB 1JYXA 2NY5C 1UA6L 3VGDA 4EN3C 4LL9A 4K9EL 4Y4FB 3QUXB 4PD4K 1ZT4A 5D70L 3DV4A 4KWUA 4H5SB 5GGVY 1Y6KR 1UCBL 4LASH 1ND0B 1AKJA 2GJ6D 3ARFA 2VH5L 3T0XA 3BVNA 4HEPG 3RY5A 3KR3L 4NGHL 4XNUH 3VCLB 2FHFA 2CLVB 4HLJA 2H2SD 4L3EB 2DQGH 1OT2A 2D3VA 4JM2B 4TYUA 5DQ9B 2X4PB 1J0IA 1Z3GL 1QA9B 2F8XC 4F57H 3KYAA 3MO1B 4LDLB 4PGDA 5H37G 1IC5L 4HLZH 2WZPD 4ZNEA 3L6FB 1WIPA 4KGJA 4R0LC 3MRHA 2DQUL 3FHQA 1JF5A 5EOTA 4MDJA 5HYJB 4R26H 3ARDD 3KDMA 4WO4C 4R97B 2I5YL 3DX6B 3B6SA 1W72B 1D5MA 5D93C 1G7HA 4LCWD 3TH2T 4YDJA 1T03H 2VAJA 1JZ5A 3X3FL 5C0RH 3TBYB 1NAMB 4XBGA 4KVCH 3DX8B 3LPWA 1QRNB 5JUEL 2AKRA 3FN9A 5GJTH 5FYLD 1YPZE 4EQ2A 3CFEA 3DMMA 1E4XH 3LB6D 3HTLX 5D5MF 1T5WB 3IETB 2X70A 4X6BB 1JRHH 3G5ZB 3BP5B 4IMKA 4G8GD 5ANMA 1GJIA 1GC1C 3F7VB 2YBRB 4XP5L 5CEYA 2HT3C 4P2RB 4GMTH 5T3ZD 1WBYB 1ZKAA 4LSPL 5DVOA 4F7MB 2D03H 4PG2C 1FRGH 2R1WB 4KVNH 3B9KA 4PR5B 2R69L 4KHTH 5E8PA 2M2DA 3B9AA 2B1AL 5CP7A 1CDJA 1OAXH 2VDML 1RZFL 4J3SA 1I1AD 3IF1A 5DLMH 1YECL 2XZZA 2EE9A 4FQIL 3CUPA 4YGAB 6FABL 5ACZA 3VFSA 3MBEA 1G9EA 4U0RC 4J8RA 4GKNA 3TIDA 1TQBB 2PXYA 1LNUA 3FTGA 3JTSA 2Z8RA 1QFWI 3WJJC 4QRRB 4JFED 5DUPL 5IQ9A 1EBAA 1OSPH 3HZYB 5KSUA 1X4YA 4QXGL 5LCVL 4NQDE 3S88L 1I1AC 1H3VA 4NKIL 4OB5H 1CFQB 4BFIA 5EH1A 5FK9B 5I8OH 1XR8A 4Y2DD 3RP1A 1F8TH 3VXPA 1M6OB 2BNUA 1EO5A 2BP3A 3VH8B 1OGTB 3P30L 4HT1H 3WKML 3ULVF 2DJUA 5CUSL 3U48A 1PQZA 3G6AA 1T66D 3SDXB 2OLDA 4Z77A 1N6VA 1J1PL 4ENED 3X13B 4LHUD 3SE9H 4OTXL 4M62L 2P5EE 4V1DB 1CWVA 1DQMH 4WI8A 4Q74A 1U8LB 2G2RB 1YJDC 3VGAB 3O41B 1AC0A 4XXCA 5HDBF 4UNTA 4NFBA 4WW1A 3JWDH 1I8KA 1L7TL 4PRHD 3UTSB 4KRNA 4O51B 4YDKL 1RK1A 3V6ZA 2VDKH 4ENEC 3VXNA 1ZANH 1T83C 1U0QA 1EFQA 1MCQA 3CFDA 3BHBB 5FGCB 4TVPE 3O9WB 3VXRE 2WINA 1G0DA 3DUSA 3U1SL 3UO1L 5SWQB 3ELAT 3CJJA 3P0GB 3P77A 4GS7C 4PJDE 3U9UB 2BSSB 1WICA 3ZKMC 1ZWIB 3HCVA 1JMZA 4X6CA 5IEKA 2YMXH 3OKYA 3FO0H 2J12B 3STZB 3HE7C 4OGZA 3PWPD 4NN6B 3VDCA 2IMNA 4UV7H 5CJXC 1C1EL 2GJ6A 2L7UA 4JB9L 4RWYL 2HVJB 3MLUH 4QCIB 5EU6D 4WWKC 2XWJA 3BKYL 3U4EB 3W9EB 1DN0B 4Z78A 4P46C 2OZ4A 5GPRA 1J5OL 4TULH 3BZFA 2VMFA 2NNAA 4RFNB 2OJEA 4BQCA 4OCSL 4M5ZL 2H3NB 5L6YH 2X4OA 3VA2C 2ZUVA 4IHOB 3RL2B 3BUTA 4IJ3B 1FFPA 3OKOA 2A6JA 1FVEA 1EMTH 2Q8AL 4JFQB 3QFDA 3EOAB 4RGMC 5CD3B 2OSLB 4PRNB 1D5BB 1BREA 5LAXB 3TLRA 4JLRA 1KB5A 5JO5A 1K5NA 2EDKA 4DKAA 1OTUD 1MCPL 3RY4A 5EBLA 1R0AL 1Y18A 3ARDA 4FQ1H 1JZ4A 2A83B 1CGUA 5HYQB 2XNAA 5C7XL 3QXDB 2ARJB 1CDYA 1UVQA 1W0YT 2FYYA 2BSRB 3GSUB 3I3BA 3TYGL 1ZS8A 5F93C 1RI8A 3U82B 1EO7A 3MJ7A 4PS4H 2FZ3B 2JB5H 1OTUC 4OLZH 4NNXA 2QHRH 4NRXA 3PDOB 4E0RA 4TRPL 4PG2A 1CLOL 2UZIH 4RRPG 1CXHA 3DPBA 4LF3A 2L0DA 3TNMA 4P59L 1I7TA 4R90H 3MRQA 1R3IL 4PJBB 4XPHL 1X5XA 2Q7YA 1DQJA 4QHUB 4G8GA 2GSGA 1F4YL 1F6AA 5J57B 2DLHA 2OXHA 2VZTA 1MJJB 3LQAC 3NCYS 1KCVL 2EDOA 5LWYH 1MJUH 3H7BA 3CU7A 1VFAA 2CKBL 3N1GC 4FFYL 2RAMA 2FX9L 1I1AA 4GQPH 1F42A 5F6HI 1EUTA 4NNYB 2CDFA 3QWRD 4OLUL 4HWEL 4NO3A 4LPUA 4XVJL 1KIQB 4KJYB 4R8WH 5EU5A 5ITFB 4LSQH 5ADOL 1HI6B 3T77A 1AGFB 1YEGH 1IZKA 2EEAA 1QR1B 2F53B 2ZPKH 1FVDB 1FZJA 1MCLA 1RJZB 4JFEA 3P11H 5T1LD 1JNLL 1BEYL 4JZJA 5KANG 4I77H 1U6AL 1NGQL 3T4YB 2NY4B 1WBXA 2NX5D 1CL7I 3OX8A 3FFCB 4M1GH 3E6HB 1U93B 2APTA 4JPVL 4QTIH 4Y2DA 4OZGB 4OT1H 4E5XB 1OLLA 1G9ML 4Y5VA 3RWDA 1XCTA 5KN5B 1NFDA 4TVPH 3U30C 5AAWA 3GB7A 4OD3H 5IP4A 3IGAB 4ZS7H 2WV3A 4FMFA 5DF0A 1MWAH 3PWUB 4KZDL 5I8EB 3L9RA 3QNXB 3RVVD 4G8FA 3VE0A 4LHUA 1RUQL 1OP3H 1IGCH 2BZDA 3FJTA 1FFNA 3VWKC 1G1YA 4G42B 1EVUA 4AQOA 3G08A 2X44D 5ISZD 4EIZC 4HW6A 4LSSH 2HJKA 2AS5M 1J1XL 1I4FA 4HZLA 5GJSL 3DJ9A 3CCHA 1QO3B 4PRHA 2CR3A 4K23H 4X5XA 4QRSA 1C5DA 5FOJA 3ARRA 3LH2H 4GKSA 3RVVC 5T1KB 5A40E 2VXSL 1RVFL 4NRZB 2OTWA 1UXSA 3MV7E 2PETA 1DEEA 3CFBA 1WISA 4FHBD 3BI9X 4UOW0 2Z31D 1JNHA 4HV8A 1U8QB 3FB5A 4XMPH 1ZHNA 4KQ4H 4NZRH 4KJPC 4EI5C 3NN8B 5E8EB 4FN0A 2I07B 5DT1H 4K2UL 5A3IC 5I1AB 3P9LA 1IE5A 1GAFH 3ARGB 3MCKA 1NCWH 2MQ0A 3U9PH 1WZ1H 1DUYB 4DVRH 4MD5A 4NBZB 3ZT7A 1HQRA 3QCUH 3PWPA 4WUUB 2P5WB 4ODUA 1S8DB 2GCYB 2MCPL 3TJHD 4L29A 3C5JA 4PJHF 3TIEB 2Z31C 5EU6A 3OGCB 1Q1JL 2NY7H 3QJFB 5KBNC 3JWDC 1DQLH 5EUKB 2GUOA 4U1SB 5I1EL 1RIHH 3G5VA 4WJ5A 5T5NG 1MFNA 4I2XB 5C3LD 5D2LB 2NY2C 3WLBB 4KY1L 4UINH 4Z7WA 3PL6D 5KSBF 4MMXC 3WKNA 1TJHH 1YMMB 4QRQA 3TJHC 4OZIE 5TQ2H 2Q87A 2B4CL 2QQLH 2IQ9H 1CGWA 2GITA 1LEIA 1GXEA 3VI3E 1I8IA 2X42A 1RURH 3O6FD 1WTGT 1RIVH 4LEOA 5E8OA 5F88B 5D96C 1ZLSH 1P7QB 1OP5H 1A8JH 3V0VA 1HQ4A 3BH9A 2RFXB 4GSDL 5EO0A 2C9AA 1VEOA 3PL6C 3O2DL 1O5DT 2XICA 4LRIC 3FOLA 1NEZG 1VPOL 3CIQA 3H9SE 1N7MH 4D9LH 5A2JH 2VSDA 4GLRH 1UB6B 3DRTA 1JPTH 2NY0D 1DBAH 1OSZA 5K93A 3PWVB 1OW0A 5C0DA 1JWMB 4PJ7E 1OY3B 1IEBB 32C2A 1JGLH 3AB0C 3O4OC 3HC0B 4NQVA 3U36A 1NMCC 5F1NA 2NY6D 1XEDA 2P47B 3FO1B 5JIHA 5IV2B 4RCAA 1AGBB 3S35X 2NY0C 1AR1D 5L2KA 1I9IL 5FCUL 4UNUA 4AEIL 1NAKL 2VQ1B 5CIPB 3RDTB 1CN4A 1CZ8H 5BZWA 3DSNA 4MA1C 1E4KC 3MJGX 5K9QI 2VLJD 4KPHL 2NY6C 3V7MA 4N8VA 3PHSA 4ELMB 3QWRA 1YUHB 3QUMH 1BOYA 5ICYB 1TJIL 3ULVL 1U8PB 1XF3B 1BWMA 1MCOL 2K1MA 4PJ8C 4OLXH 3QIBA 3VA6A 1CE1H 3ZDZF 3CSYA 1SYVA 4NYLA 3UBXB 3UTQA 5T1LA 1GGBH 3EO0A 1N4XH 4NUJB 1JHTB 5B39A 5TPWH 2B0SH 5C70A 2NX5A 1T3FB 1QFUH 3P40A 3M8OL 4HIIB 1MCSA 1IFHH 4JRXE 5F7DA 2APBA 4J3VA 1CVRA 4HS8H 3EOBB 1A7QL 1WCBB 2FEEL 4GRWE 4HBQA 2FATL 3FQTB 4NZJA 5CEZL 5KSVA 5HGHB 1FYHB 2DMBA 3IYLW 4L4TB 3DX9B 2DLGA 4ZUWB 5ISZA 3SDYL 1AGDB 3KVQA 4JQVA 1OCWL 1X6NA 2CD0A 2DQEH 1IGIL 5MERA 1ADQA 4NRYB 3U4BH 4OCRH 4W6WB 3OR6A 5ADPH 1N26A 5AZEL 3UROR 1A7RL 1K6QH 1A9EA 2ARWA 3WFDL 1H8OA 2IADA 4N1HB 1I8MA 2XFXA 1KYOK 5C0IB 3J8F7 5F44A 4EBQH 5HI3C 2ED7A 3G5YA 3CPLA 3MV11 4KRMB 4KI1A 4E41E 1BP3B 1HH9B 1T5XA 4ZNCD 3T2PA 3TVMB 3RWIA 2I9TB 5ABDE 3JV6B 1ERNA 1KF9B 4X9FA 1CLYL 1V7ML 1FPTL 4OUUB 3NAAL 1SEQL 4LRNL 1LK2B 1AXTL 4ZSOE 2BHUA 4ZPTB 3EJZD 4PG9A 1MFBH 1X9QA 1CLZL 4TUJA 1RZJC 3ZL4L 3PL6A 1XF4A 3IFLL 1JE6A 2FEDC 1SYSA 5LXGL 1EJ6A 2JCCE 4M8QA 4POUB 4MXQD 4U6HA 5DRXB 3O6FA 2XV6B 3TWCL 3HZMB 1ZE3C 4M1DH 4RAVA 1MHCA 3H3PH 4HWZB 3SKJH 4HIHB 4U1MA 5IF0B 15C8H 5LBSL 3EJZC 3G04A 2PNDA 4ZYKA 3ZTJG 4M7JL 4BZ2H 3ZE0E 3C08H 3ES6B 2GTZB 4ZPVB 5JR1H 3BPNC 1LE9A 3FQUA 2ZWLT 5D4QA 4X5WB 2DQFA 2UUDK 3P3YA 5EU7E 5L0QB 3PWJA 1PG7L 5F6IB 4MB3A 5D7IB 4F9PC 5EZLB 1D5ZA 2AJUL 1P4LB 4MNHA 4WHCA 3I6KB 3MOBH 2Z9TA 3NH7L 4F7EB 1KPRA 4MJ4A 3UYOD 2NXYD 1GC1L 2AK4E 5I1JL 3I2CL 3EFFA 3VFVA 1GH7A 4JO2L 3TBTA 5HHVH 4QRPB 4FABH 3VFPA 3TCLB 3BPCB 2FL5B 3K1KC 1WJ3A 4LGSB 1G0YR 5CD5D 4OLWH 2CDEB 4P2QB 2NXYC 3TZVD 2VLJA 4ONFL 1CGSH 1BQSA 1YPZF 3HLAB 2EH7L 43CAA 4IMLA 4GRWH 4JKWA 4RISL 4WNQA 3SE3C 1JV5A 4PRIE 4OM0H 2OJZH 2KH2B 3HS0A 3K4AA 5CD5C 5E1AB 3ZHDA 3HNSL 3KPSE 4QOKB 1EUUA 3AUVA 4NBYB 4FTVE 4JHBA 3TZVC 3QA3A 5BVJA 3JV0A 3F7RA 4LLYA 1WT5A 1BMGA 4KK8C 3D2UD 4NKDB 2AEWA 1JK8A 1AY1H 2CH8A 2DQJH 2FLBT 2V5TA 4HCRL 4P2OC 4QXTB 4HBCL 5LJYH 5B39G 5DMYA 35C8L 1SY6H 2PW1A 2QQNH 3QEUB 4OZHB 1C5BH 2FJGA 4X4MA 4JY6A 4FXKB 4HH9A 1QTYT 4TSCL 5L8JB 2HLAA 1IAOA 4NZTH 4HS3B 3K74B 3GEWB 1YJDL 4HKZB 1KTDA 4Z7UB 2G9HA 3L5IA 4JM4L 1XGPA 4P5TD 5I30L 1K9TA 4PGJA 5D72L 5GRJL 5GGRB 4JCMA 3IU3B 1DVFD 4LFHG 1JGVL 1MWAA 2ZKHH 5C0CB 4F7PB 1NBZA 1IARB 2PTUA 3WSQL 1G6RA 4OI9A 3JBG7 4MNGE 4YHYB 3DURB 5J9PA 2C3VA 5FKAB 4BH8B 4N0CD 3HI5H 4CADB 2BNRB 5IVZB 2DMCA 5T3XD 3CZJA 3LKPB 4D0DA 1I7ZB 4ZAKD 4P5TC 5E7BA 1KJVB 1EEZA 3X11A 5L9DH 3O6LH 2BXYA 2JJTC 1DVFC 1S7UB 2YSSA 1BX2B 4L8DB 2B1HH 1FN4B 1BVKB 5FO8A 5EIIB 5ENWB 4A6YA 4N0CC 1N0LA 4RFEA 5CP3H 4W4OA 5DJ6A 3MCLL 3X3GL 5IW1A 5KVGL 5BVPL 3ARWA 1X7QA 4PTTA 4NNPH 5DJYB 4UTAH 2VLKB 4YHNB 5M95B 5DTFA 1G7IA 2PR4H 2AXFB 4KROB 3S4SA 2J5LC 3L3HB 5KTEH 2AEQH 4BJLA 4PJDF 5T5FH 1G7PB 5IESH 1HSBB 2Z8WC 3H6JA 1M05A 2O5XL 1B6UA 1FG2B 5I1CL 1T22A 2P24B 3WFEL 5J13B 4HS6B 5H35B 3MLRL 2ZUTA 1N8ZA 1HWGB 2BVPB 2C1OB 1LD9B 5KVDL 1JPSH 4MQSB 5DQJA 4XCNA 3WFCH 1BJ8A 4UV4H 3CVHH 3T1FA 2R9HD 4YPGA 2GY5A 4UUJA 3BH8B 3UXFA 2IBZX 2EEBA 1DQTA 1F4WH 4DOHE 1T0MB 4Q9QH 1YMHB 2DQGL 3T0DA 2AXGB 4L9LC 4PP2B 5E03A 1HH6A 2GIYA 4F57L 2ADFL 4R4ND 2Y5EA 1T6VN 3S36L 3ZZ1A 3TO4B 4AEFA 4P57A 4JFFB 3BZEB 4M00A 4HFWA 4QTHA 3HMXH 3TT1H 4YJZL 1ULVA 1FV1A 3MRCB 3LS5L 2GK0A 4MAUH 5BQ7B 1WZKA 2CGRH 3QISA 5IEHB 4RGND 3QO1B 1HHHB 1CFSA 3STLA 3I6GA 5DHYA 3O0RH 3SN6N 5DZNA 4I4WA 5ILTH 1I9EA 3RL1A 3TZVA 5C0RL 4WUKH 3DV6A 3QCVL 4X6DE 1LDPH 2EDFA 5ID0A 2X9XA 2XWTB 3PIQA 4AEHH 2PCPA 2VOTA 3NZHH 3N0PB 4FFVD 4M9PA 4QEGA 4ZUUA 1E4XL 3BGAA 1KGCE 2JB6A 2AI0H 1NC4D 1JRHL 2VZVA 4GG8B 4LGRB 3IJYB 5ESAA 1LEGA 3TYFB 4XMKL 3D2UA 1IKNA 2YD9A 1VGEH 4P4KD 1ZT7A 4KTEH 5C71A 3QEGH 2D03L 3CSBA 1UACH 4KVNL 3SO3C 2A77H 3QUYB 3AY4C 2ORBL 1FAKT 4KHTL 5KSAB 4JZOA 5K9KA 3OJVC 5DZOA 4AM0A 4O2EA 1UQSA 1REIA 1S9VB 5B3JE 3OF6D 4PJAE 3Q5YA 4WHTB 4ACPA 1IAKA 3QDMB 3CFJB 1YEDB 4OQTL 2X1OA 5JIKA 3EGSB 2YR3A 3KJ6H 5FECA 3DXAE 1TVHA 5DJ0B 4AL8H 1LO4L 2D2OA 4B0MM 3IDIA 2VYRE 1OSPL 3W0WD 5DURD 4PRPE 3SBWA 1M7IA 4XRCB 1IGMH 5I8OL 5D1XB 4JN2A 3CLEH 4HC1A 5EC2A 3MV9B 4XP6H 4HT1L 4PGCA 5SWSB 1H5BC 4ZAKA 4F7TB 5I6XB 3V4VH 3FB7B 2I60H 1RHFA 3RKDD 1I9RH 2VDOL 3HR5A 4WI6A 3VGFA 3M1BB 4S2SB 1J05A 5EBWB 4NO2A 4F15C 5E2UH 5BOZG 4HH8A 4N0FB 5FO9B 4DZBB 1DQML 3BD3A 4X0KB 1HDMA 3BP6A 5IIEA 4M7ZB 5F3HB 5FYJE 4W68A 5ID1B 1S7VA 5JDJA 4RDQG 3QHZH 3C2SA 2VDKL 1UM6H 3BKJH 4ZUVA 5GRWA 1CE6A 4OCLC 3AFLA 4WENB 1ZANL 2EE2A 5GS1A 2A1WH 4NUGH 2OCFD 4PB9H 4Z95H 5C09B 5KS9E 3WO3B 1I1YB 3QFJB 1YDPA 3FB6B 2ZSWB 5J1AB 4QHKJ 1ZVSB 1BFSA 2GAZB 3UZVB 3LKSA 4NKOA 1AO7B 3W9DB 2BDNL 3A6BL 3BAEL 2DM3A 3MUHL 3NABH 2JTDA 1JF1B 1JN6B 3LQMA 5L8LB 1A7BA 2ZUYA 3FO0L 1VFUA 3DGGA 2W1NA 2VZ1A 5I66A 1FNSH 4YHPA 4CAGA 3ZMRA 4CVXA 4PJ7A 4WFHE 3QAZB 2G60H 1RUKL 3PNWA 1MFCH 5HD8D 2UWEA 1H3PL 4MMZC 4AG4L 3PWNB 3ORJA 4TULL 1CXLA 3FL7A 2FBJH 4OZIF 4ZFZA 4O4YH 3REVA 5L6YL 1RJLA 2X05A 1AQDB 3VI3F 5JQHC 5DD1L 1EMTL 5DK2B 5HHMD 4HAFA 4KI5D 1D9KC 3HPJB 3ZHKA 5F7LB 5F1KC 4NWTL 3SCMD 3LPFA 4FQ1L 3SDDB 5C2BL 2MHAB 1OD7A 1JWUA 4JO1H 2ED8A 4LSTL 2R56L 3QZWA 2DQTH 4NN7B 5IVXB 4PS4L 2JB5L 4OLZL 5HHPA 1I1FA 4AMKH 5C0BD 5AUMA 5TDNA 2NXZB 2PTTB 4GRLC 3SCMC 3HRZA 1A7PL 4PBXA 5B38B 3AY4A 4OZFH 3PP4H 1X3DA 1NBYA 1DFBH 2B20A 4R90L 4JDVA 3U79A 5HDQL 5JXAH 1DBKL 5BMFH 5E9DE 1VSCA 1NGXA 3DVGB 1J11A 2XN9E 5DEGA 5M7QA 1YEJH 5CSBA 3WE6B 1K8IB 4P4KA 2AQ3A 1K2DA 3IDMB 1DLHB 1MJUL 2V9QA 3LRHA 4YFEA 2CXGA 4ODVH 3S7GA 4F33B 2D7OA 1CFNA 1A4JB 2KZ1B 3OF6A 1MI5E 3C8KB 3ZTJH 4AT6A 4DKEL 1A64A 3VDBA 1XGUB 3GMPB 2ZUQC 3LKNB 3QNZA 3GKWH 1DQDH 2ITDA 4LSQL 3O8XD 4LLUA 4Z7VA 1SEBA 2ZPKL 3ZSSA 1AD0B 5GQBA 4EXKA 4JRWA 3GBNH 4N0UA 5FYJH 3P11L 4P5KA 5J3HC 4WU7B 4NM8H 4JFOA 1MVUB 1ZHKA 2APVA 3W0WA 4Y19E 2VITB 2NQCA 5DRWB 4EUPH 4M1GL 4QTIL 1CBVH 2CLZB 3F5WA 1YNTB 3O8XC 4R2GB 5DJ2B 2R2EB 5IFJB 3WO4B 1NL0L 1QEWA 1ED3A 2Y7QA 4JPWH 1K4CA 1UWEL 3FT2A 4QHLB 1E6JH 4OD3L 4ZS7L 3BQUC 1BQHG 4M5YH 4N0YH 4M48H 3HNVH 2VZOA 3GUTB 2W65A 2YD8A 4WVRA 1GGUA 4LVOB 3K7UA 4G7VH 3V6FB 3IS1X 3U0TB 3D39B 3IFPA 4Q6IA 4X7FC 3VFOB 2Y9RT 1G7MA 3BX7C 3L5WB 4LSSL 4PJIE 1LEKB 3KPPB 1JPST 1BFOA 4PBVC 2Y6SD 4OF5A 4K23L 1D5XA 1FNGA 2JK5B 3O6KH 3LH2L 2BVQA 3LEXB 1WBZA 1I85C 1OP9A 5ACLA 3LN4A 4OCWL 3HE6B 5TQ0H 1S7WA 5CP3A 4PJFE 3V0AC 4XMPL 2CMRH 4KQ4L 4LDOB 5A16B 2Y6SC 1KJMB 4PJ5E 1TNMA 3L3OA 1X5ZA 2D7PA 3K3QA 5DS8B 1GAFL 4X98B 5EZOH 1QFWH 1FJ1A 4QT5B 3U9PL 1OTTD 1TJGH 4DVRL 5EFIA 1Y0LA 5DVLA 3A6CL 1IGYB 3FRUB 1MEXL 3H42L 2NY7L 5IJVA 2Y72A 4OF7A 5IMMB 1S78C 2XTJD 4YUEH 3KPRE 2QADD 3BEVA 3A0OA 1NGPH 1CXIA 1RIHL 4PLJD 5C08D 2JCCF 4PY8I 2F9BT 5TE7H 1QBLL 3MRBB 2IGFH 5C07B 1KB9J 3I3DA 4XVUD 5IFHL 3LKOA 4AZ8A 5TQ2L 3HG1D 4CW1A 2XKUA 5A2FA 5TF0A 5D2NA 4Y4HB 4QWWC 3HAEG 1RURL 4YXHL 3ZE0F 4Y1AD 2QADC 5SWZE 2X1PA 3SCMA 4PLJC 1KJ2A 1NANH 1T04B 2AXJA 2VR4A 5JPMB 4XVUC 4X7TA 4ZQKB 5GRUH 3I84A 1KGCD 4YC2B 1TTFA 4D9LL 3DV4B 1FCCA 2IBBA 2WBJC 3NFNA 1JPTL 1DBAL 1IRAY 3I3EA 5C0BA 1TCMA 4RA3A 1YY9C 3W2DH 1AKJB 3NMEA 4Q9RL 3ARFB 1JF6A 1RZKH 1FIEA 4H88L 4CUCA 5GGTH 1JGLL 3UJTH 3ZYOA 2H45A 2CRMA 5E2TL 1HYSC 3QZWG 4F9LC 1J8HE 3U7YH 5IFAH 1F11A 5I73C 2E7MA 5D5MB 4RSVA 5E4EB 4ZXBB 3RI5K 5F9DC 5HI4C 2YD5A 5DUBA 1B0RA 5EG6C 4PGDB 3EYUL 2VIRA 3GI8L 5CSZA 3NFPA 4KUZH 5E2WH 5KOMC 5JTWA 1AFVH 1CZ8L 1NLDH 3MRHB 1DANU 3DIFA 1R5WA 3RUGE 4ZFOA 4MDJB 1AHWC 4S1QH 3KDMB 4YDVA 2IQAB 1F4HA 1ZA3A 5FAAA 1A9BA 1DBBH 1K85A 1KELL 1S7RA 3O8XA 1P4BH 1G7HB 4YDJB 4PRPD 3U6RA 2VLRD 5KW9H 4OLXL 4QRUB 1CE1L 4GG6A 4XBGB 1GGBL 1VGKB 3H0TA 5CGYC 5DJDA 3U0WH 2AKRB 2YD6A 4TSBL 4C56E 3RZWA 1VFBB 2JE8A 4JR9H 3CDCA 2B0SL 5CILH 5GSVB 3CFEB 3DMMB 1XCQB 1T2QL 3ARBB 4PD4J 3UEZA 5J11C 3U2SA 2X70B 2R0WH 4S1DD 2RIKA 3DSFH 3GHBH 4J3XA 1IFHL 2BHYA 5JORB 3GSVA 1T1WB 5IQ7H 1AXSB 1U8JA 5ANMB 4HS8L 1HIMH 1ZVYA 5JNYB 4Z76A 3AM8C 2SEBB 1R3LB 4ZDHB 1WZMA 3OR7A 2VLME 3DYPA 1DR9A 4JY4A 4XCEA 4IDJH 2AW2A 1GOHA 3P4MB 4Y4FD 5T5NF 3WLWD 5E8PB 5CP7B 3BT2L 1XZ0A 3OSKA 1HXYA 3KG5A 3CUPB 5ACZB 1SJXA 1FNLA 2XKNA 3MBEB 1U3ZA 2CRIA 5HVHB 5ICZB 4J8RB 4GKNB 5HGDA 3U4BL 3EO1B 5EUOA 3QEQB 5IHLB 3FTGB 4L3ED 5MEQB 4FFWD 1KBGH 2ZCHL 4D0BA 2XZAH 4JM2D 5B8CB 3WLWC 4WW2C 3PGDB 1K6QL 5D7JD 5KSUB 1CD0A 4QF1B 4HK3J 5I19H 3HR6A 4P48A 4KK6C 1YY8A 2XRAH 3VXPB 5E6YA 4EQ3A 4NQCE 4QHKI 3L3KA 5BW7A 4U1KA 2C3WA 4FFWC 1PQZB 3G6AB 5FM8A 2H6PA 2O61B 3WFHA 1CL7H 3DUHA 2XXCB 2IAMD 2CXKA 3IRZA 3EYSL 5DJ8B 3MGTA 4XBEH 3ILPA 3W39A 5C08A 1MFBL 1AD9B 4LLQB 4PTUA 4H0IA 4KRPB 3EDJA 4GFTB 1FIGH 1I8KB 4KJQD 3HG1A 4KMTL 4LCUA 4EN3B 4OSUL 4PRAA 6CGTA 4P4RA 2FJHA 1DUZB 5EOQH 1L0YA 2FEEI 4IOSD 4Y1AA 3SKJL 2B7DT 3C87A 15C8L 2WINB 2NLJA 1OP3K 5LKNA 3C08L 1N0XL 3P77B 2I27N 2E7BA 1CDUA 3HCVB 4NHCL 4PJGF 5AYQA 3RHWF 5IEKB 1KXQE 5ESVA 4ZTPH 2F5AH 1DBJL 1YEFH 2VE6B 3VI4E 2GJ6B 1LO5A 1NJ9A 4FQQA 3MOBL 5EOCH 3R8QA 1UJ3A 1U3YA 1L6ZA 3HRPA 4P5MA 4NFDA 2NNAB 2OJEB 3HNTL 3ISWA 1KT2A 1MPAL 2C5DC 3BW9A 3CX5J 3BO8B 2X4OB 4IRSC 3S3SA 3BGFC 5J8OA 4FZ8H 4NC1C 3MNZA 4DJMA 1HKFA 2A6JB 3OKOB 5DHVB 3LEVH 4I0CC 3GKZA 4X6DF 4MJ6B 2ATPB 3RX5A 4OZ4A 5JXED 4JLRB 1KB5B 5JO5B 4GT7A