3Q9QA

Hspb1 fragment second crystal form
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
82
structure length
77
Chain Sequence
b'SHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHAARYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock protein beta-1
publication title Three-Dimensional Structure of alpha-Crystallin Domain Dimers of Human Small Heat Shock Proteins HSPB1 and HSPB6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 11
structure length 77
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3q9qA00
3W1ZA 3QORB 3QORC 1X5MA 4ELDA 4YLCA 4YL9A 4M5TA 2N0KA 2XCMC 4JUTA 3AACA 1RL1A 2KMWA 3EUDA 3Q9QA 1GMEA 2K8QA 4JUSA 5DS1A 2Y22A 4YE0A 3IGFA 2O30A 4FEIA 3Q9PA 4ZJ9A 2KLRA 3GUFA 3VQLA 1WH0A 5LUMA 3J07A 1SHSA 3N3EA 2CR0A 3VQMA 1WFIA 4I88A 2JKIS 2Y1YA 5DS2A 2WJ5A 2MNWA 3AABA 2Y1ZA 3GT6A 1WGVA 4RZKA 2BOLA 3L1FA 3L1EA 1EJFA 4PBDA 4MJHA 4YLBA 2RH0A 2N3JA 2CG9X 4PCKA 4YDZA 3QORA 3GLAA 3QORD 2WJ7A 4M5SA 3L1GA
chains in the Genus database with same CATH superfamily
3GQFA 4JPKL 3FQUB 2XTLA 1FYTD 4FOMA 2BZCA 4HWBH 4R96B 4LK4A 5CSGA 5CBEA 4E41E 1DDTA 2BSDA 1B4TA 1KXVA 4IKKA 1XGQB 4JFDE 2OZ4A 5JOFB 2BS9A 2C8NA 2JJWA 2IO5A 5B39G 2Y69B 4PJBE 1Q0EA 1I1AC 2XTJC 3FO1B 3DIDA 3QK0A 1AZNA 2QBWA 1VHPA 1XAUA 4FULA 1XH2A 3MQIA 6TAAA 4X5LA 4FHJA 1A6ZA 2VDOL 2I27N 5E6SB 2R1YB 3QQ9C 1JFQH 3LXAA 3UAJC 1N9PA 4HOXA 3CFCH 5AOIA 1G7PA 4XN8A 2CDGA 5MENA 3ZGIA 4ZFGH 1F1DA 5I0WA 4YWGL 1BAFL 4YQXH 1UM5H 2AJUL 1UWGL 5KVDH 1IE4A 2V7NA 1NAMB 4MMYB 4WWPA 3QO0B 1X9QA 4ORZC 4WFGD 3DYPA 3T2NL 1NMAH 5CKAA 2I9TB 3SE6A 5FYLE 1X6NA 2AGJH 1TTBA 3L45A 3AT0A 3U46B 2B14A 5IT2L 3ZHLA 1NMCB 4DFHA 2BFGA 4O2CA 3T9WA 3NSXA 5ETUA 3MA9L 4AEIH 4MS8C 5DQDH 3RFZB 5C0AB 3NJFA 3STBA 1PYWB 1TJXA 1IAOB 2BPBA 3GD1C 4GKNA 3UPRA 4JPIA 3UZVA 5E8DH 4BGDA 5TE7L 1V3JA 1R24B 1ZTXE 2DLIA 3MDJA 1L9MA 4XPTL 4NQDD 1DR9A 1UATA 4R8WH 4XMKL 4FGMA 3ZOAA 1OP3K 4UT9L 3RL2A 4BK4A 5DS2A 3UTQB 4OLEA 2B59B 2DD8H 2X2JA 5EU3A 1TZGH 1M7IB 1QSFD 2CR3A 5C0BA 3QDME 4U1SB 3FT3A 1OAQH 5I73C 3WFBH 3FKUS 1CICA 4XN5A 3HE6D 5DHDA 1NZRA 1DVFA 4P2RD 1MRFH 4GMSL 1IKFH 2B1OA 3QCUH 4WW1B 2OMNA 4I0PD 3UDWC 1SF3A 5D72L 1TTUA 2YUWA 5CGYD 1B88A 5IJKC 3NSJA 5BRZD 4DGIH 3AXHA 4NNYB 4YBQC 3HLAA 1YAZA 1D6VL 3E6HA 4IM8A 1A6ZB 3FT1A 3C6SB 2FX9H 1J5CA 1F0LA 1UT2A 2LGNA 2XNAA 1G7PB 5MENB 1J5DA 4ONFL 2EAEA 5FGBA 3VGDA 3NK4A 3EF4A 2NY7H 3D1MC 1MOEA 5C3IA 1JPSH 4IBSA 4N2FA 4JRYA 3BEWA 3H3KA 3O3AB 4OB5H 1JZ8A 3BKMH 1KJ2H 5T33H 1NA8A 1VZGA 1JK8A 4LLDA 1SZNA 4XP1H 3RGBA 3NIDE 4FYQA 1JZHA 2J1ZA 3MX0A 5D1QC 1IAKA 3UCRA 3D9AL 5DD0L 1DJGA 4O2CB 1A1OB 5ETUB 2B2XH 1NM9A 4F8QA 3IJYB 4K9EH 2PETA 4LVNC 5CLTA 5L8JB 4GKNB 2XY2A 4J12A 2Z8WC 3TBWA 3GXTA 4IGBC 1AQ8A 3HBGA 1MHEA 3UPRB 2R56H 3UZVB 1J8RA 2PNDA 2PTTA 2ZONA 4JW3A 5HVHB 3V4VA 3KBFA 5IIEA 3K6SA 2EC9U 1I8IB 5JUEL 3WHE0 4PJ9C 3D3VE 3KPMA 4RLDA 1TYJA 3O2DA 3RL2B 1NBYA 5ADPH 3BEVB 4HUKB 4U6YA 1O7SA 4ZNCD 2BOLA 2FVNA 4EDXB 3RPIA 2J56A 2UXVA 1CR9L 3LKNA 4EN3C 4FE9A 5C0BB 4F7KA 1JNLH 1SOXA 3PWPD 3ARDD 3FT3B 2Q7YB 3H1ZA 1GZQA 2ITDB 5L2KE 2QDVA 5GGSA 1DVFB 1ZD6A 3KJ6H 3DURA 1HWHB 5CD5D 1NDTA 1UACH 4XAKD 1VB9A 2J6EA 4KHTH 3P2DA 4OFIA 3NAAL 4I48A 1R3HB 4ZS7L 4HG4J 1CQKA 3VW3L 2BSCA 3U7WH 1JVOA 3N50A 4RFOL 4FMVA 1QBLL 3N44B 2EDTA 3KGSA 1UT9A 5EF0A 1G7LA 3QUKA 3AG2B 3GK8L 5DF0A 3TWCL 5DVLA 3RBSA 5F6IB 1EUUA 2XNAB 3MRNA 3LQZA 1U6AL 3LS5L 3IVKA 4PB9L 5IHHA 5IJDC 1KXQE 1G87A 4GLRI 4HFWA 4OIIL 5EC2A 3RDTC 4HT1L 1JK8B 3CVIL 2DQUH 4GLRH 4LLDB 3ILQC 2DPKA 1FG2B 3MX0B 2FZ3A 3VE0A 1KB5A 1EAOA 3WOVA 5MEPA 1YEDA 1QP1A 1SJEA 4L3ED 2YD4A 3KW8A 3OKMB 3ARFA 2OL3L 2KMWA 5KOVC 1MHEB 4Y4HA 4JRXE 2PTTB 2ATKA 3KPNB 5E5MA 4QLWA 5IIEB 5AVUB 2L0DA 4UV4H 1UCTA 2J1WA 4K7FA 3KPMB 3FU3A 2CJSA 4TVPL 1CD8A 3LEXA 3R8BB 2H0JA 1MN4A 3HJ0A 3CV5A 2NY4D 3P0YL 4MLIA 4U6YB 4K5LA 5FB8A 4P5KA 1KPVA 1IVLA 3DV4A 4MRCA 4WUKL 1BXVA 1CTNA 2OI9C 2YSTA 1SN0A 2F53B 1E6JL 3H53A 4OGZA 1GZQB 5GGSB 1DQJA 1LNUA 3SD2A 2DDQH 4PHZA 2A77H 1CTMA 4MQXD 3DURB 3IMRA 3DC0A 3J07A 3UYRH 2YWZA 2ZXBA 1FIGL 1YAIA 4I48B 4W6WB 1OE1A 3VFNA 2H3KA 1T03L 1QLEH 3S96B 2WWKO 1T0PB 4OY9A 2J5WA 1VGEH 1MAKA 2ZTBA 3LQAH 3NJLA 2XWRA 3MFGB 2BP0A 4GQ9H 3ZX1A 4JFED 5AVQB 3T08A 4ONOA 4MDIA 3IAPA 1U8HB 3MJGX 3QUKB 1BLNA 1MQKH 4OFPA 1S9VB 2AEWA 2R4SH 4M3KB 3MRNB 5F89B 3QEHB 5I71B 1PZSA 2P8PA 2VMDA 3IVKB 1PLGH 3WE6B 2YPKA 5B1JA 2BWQA 2YD0A 1EANA 3CVHH 2MNJB 1REIA 4OQTA 4YHZL 1JCVA 1OSYA 1Q8MA 4HFWB 5GS0L 1E6OH 1IFHH 3ZTCC 5EC2B 5BMFL 3ARVA 1VCBC 2XXGA 5DEGA 1WFJA 3FFCD 5CN3A 3VE0B 3L3KB 1KB5B 4FABL 5AAWC 4PJCE 5MEPB 4MQTB 1AXTL 1YEDB 1SJEB 1T5XA 1QWUA 2NY2D 1CFQA 3ARFB 3O6KL 4NJAH 1VGKA 4XI5C 5D1ZC 2OX5A 1OB1B 2J21A 4BEIA 3CX5J 4Y4KA 1KJVA 4Y4HB 5L8KB 4ADGA 4EAEA 5LBSH 2ATKB 3DBXA 1FNGA 4MA7L 5E5MB 1DVQA 4GMTL 5BZXA 4W9CC 3ORJA 2DQJL 3IMSA 1MCIA 1UOKA 2BIHA 3VD4A 1WT5C 1GKEA 3EJPA 4EI6A 5FB8B 3G6JE 4P5KB 1KPVB 4H7VA 2UZYA 3X11B 4BK5A 1WAAE 3II2A 4EBQL 4OZIF 4E68A 5I0ZA 1JDDA 5C0AD 1M71A 4LE8A 4HXBL 1DQJB 2E6PA 1LNUB 3LRHA 5D71H 4NUGH 4ZOCA 1KC5H 5EUKA 3QZWA 4EJ1C 4QRUA 1ZHBB 4HUVA 2LVEA 3ZO0A 2BVOB 4ANUA 3SE8H 1RULL 1UFGA 2CMRL 1I7ZA 3MRGB 1NIAA 4IMKC 5AOKA 1ZIBA 4TLUA 3RURA 4EUPB 2FWSA 2BP0B 3MN8A 4RRPM 3ZKND 2H26A 5AOMA 5FM4A 1BLNB 3HZKA 1KLFB 3Q8CA 5TPWL 2CAKA 3DHMA 4Q8BA 4UOZA 4WU7A 5EO1B 3TPKA 3VTTA 1DBMH 3P30H 3ULUC 1TCRA 4GI8A 4KUZL 3CQPA 3ESUF 2Z31A 4JQVC 1IEHA 1PZ5A 4CDHA 2AV7A 1F42A 1NUFA 5FW6A 5EDXA 1L0PA 1W6LA 5TQ0L 3C2AL 1ETA1 3FJTA 2FBRA 2G5UA 1HL8A 2PR4H 1YEEH 1JRHI 2F5AL 1XR9B 3H3BC 1DVYA 5DEGB 3RZCC 4F7CB 2CLZA 3O3BA 4HF5L 1QRNE 4I7ZC 2UX6A 5LXVA 5D4QA 3RVTC 4PS8A 4XB7A 1JRHH 5F2FA 4BWWA 3I9AA 3JV0A 1T5XB 5B1BB 5MEND 4BZ1L 1CFQB 4R90H 3WLBA 1VGKB 5F9WB 2IPTL 3MYJB 3VXNA 1U3YA 3Q3GB 3ARGA 3S4SG 4Y4KB 4J4PC 2CIKA 3W5MA 3FTVA 2AQ2A 1P4IH 3DBXB 3S8WA 3QYNA 1PMYA 1SQ2N 1SVZA 4UT9A 1IGFH 4F2MA 4M61A 5GGUA 3BLBA 1TT6A 4F8NA 5CNHA 3TA3A 3IDJB 2F1BA 4MJHA 4EI6B 2A7BA 1JV2B 3N0PB 1LE5A 3T3ME 4YVNA 1GRWA 1VJSA 5KANG 1JNHA 1PPIA 4LT7A 2NY1B 4R2GC 3MODH 4L23A 2E8YA 5I75C 1M71B 1JTPA 1MFVA 1PX3A 4BQ8A 3WIIH 4J1UA 3JYCA 4IKNA 4G8GA 4PAZA 4ERSH 4I3RL 3VTAA 5EUKB 5AW1B 3QZWB 1IBFA 2P24B 3DVNA 4HUVB 3IFNH 4L1LA 1HKLL 1NL0L 3AY2A 1OY3B 5GRVL 1A6VH 3KYNA 4PJ8A 4Z1PA 1YNTF 3M1OA 1I7ZB 1DSFL 1N5AA 2VMJA 5C0BD 5G4OA 3TN0D 1AKPA 1RIVH 2OLDA 4J3UA 1CICD 1WJ3A 4Y4FA 3T2OA 4G8IA 2W88A 1VEMA 1FO0A 5TH2B 2DWDA 3OKEA 4GI9A 1K8DA 4WU7B 1KLUA 4QHUA 3TVMB 1TCRB 5F1OB 1S7QA 1G9EA 5HHMB 1RHHB 2Z31B 2I5YH 5ANME 4IHBA 5I0YA 2VM4A 1TFPA 2AV7B 2VDRB 2MNWA 1RK1B 3GLDA 4XX1G 4ZI8A 2IFFL 5TJWK 2J57A 2QV2A 3O3BB 3D2UA 4M5ZH 1N2RA 4LFHG 2DOCA 3GUTA 4PS3A 4OIFA 4XH2B 1YO4A 1OQXA 3HN8A 4LVHC 5GGSY 4YX2H 1UYWL 3M7OA 4DVBA 4PJIF 1MAML 4AGOA 4JRYD 3WHE1 2W9LA 4UTAH 3ARGB 5KSAA 2CWRA 5CINL 2CIKB 3UO1H 1GGIH 2AABH 2LABA 3TT1L 3GC3A 4QHLA 3ZE2F 1TETH 3CN2A 4AMXA 1A5FH 2XIIA 5CFAA 4F2MB 5KSBF 2DQCH 4M61B 3CC1A 5GGUB 3DXAB 4TOYL 4PS4L 3TA3B 4LLAA 4KNSA 5M7QA 5JW4N 3V2AR 3VB9A 1LE5B 4AYMC 4XCFL 4FFWD 4F7MA 4FQLL 3ZRCC 3F7YA 4NC1C 5F7DB 1GJUA 5DFVD 3B8YA 4F27A 2ZAIA 2CQVA 1BG1A 2DI7A 2J2ZA 4U0QB 4HSCX 5FYLH 2NCEA 4XVUC 1CGWA 4J1UB 4IBZA 1OCWL 1TVHA 4X6CF 3GYRA 4G8GB 3G6AA 4KY1H 4P05A 4RMTA 1E8WA 1S4IA 3NFNA 1W8EA 5JPNB 3DVNB 1CS6A 2WHVA 3QPQD 3MV7A 4KROB 1U58B 5ISZE 2P49B 2Y7SA 3T0WA 1AHMA 3LZRA 4M6OH 4QOKA 3CSTA 4ZX3A 4U0RB 2EEDA 3KYKL 2BS8A 3LKRA 2E56A 4XE0A 3UJJL 3C09B 1DO6A 3PJLA 4M8QB 2WW8A 3B37A 3RG1C 4FN0A 1EHLL 1G0DA 5KN5A 1GZPB 4NCDA 3GTVA 1K8DB 1KN4L 3NJJA 3PGCA 5E56A 2BFVL 3SN6N 1OTTD 1S7QB 1AQKH 2ZUSA 1G9MC 3BC9A 1KV7A 1K4DA 2PWHA 3AY4C 5KYWA 4H8HA 3EBHA 4WWNA 3L6FB 2MTPA 5JXAL 1F58L 1SN5A 2X6UA 1FC1A 1KELH 2KUTA 1A2YA 5I82A 2WBJA 1YQ2A 2FRGP 3VXRE 2VDQH 3B3IB 1MRDH 2HFEA 3WFEL 3U9WA 3OL2A 5E94B 3D2UB 2FJHA 3OMIB 1N2RB 3C5SA 3SCMC 4ZOAA 2HVKA 4KI1A 3IJ7A 1PZDA 4N2AA 1QTPA 2OL3A 1MELA 2ZKYA 3WMQA 2D3NA 3LXBA 1L7IH 4TTDD 3NPSC 2DQIH 4DVBB 3W57A 5EBWB 3QHFH 3FSOA 4XOCA 3VWKA 5IOKA 3BWAA 2XWZA 2V2XA 4Q9QL 4URTB 4GSXA 2ZYSA 4WWKB 2YD9A 2WXKA 4QHLB 3BH8B 4N5UA 2FSEB 5IK3A 2QQKL 2Z1KA 2HA1A 1EJ6A 5FW7A 3T5WA 3S6CA 4G7SB 3CK0H 4P23C 5ENWB 5HYJA 5T1DH 4KXDA 2HT3D 4Z7NF 2DBLH 4O51A 4F7MB 4KUCD 2D0FA 3ARBB 1MW2A 3ARFD 2VCOA 3F7YB 4PJ5E 5E6IC 3LIZH 1CFSA 2ZAGA 2MRYA 3QJOA 2J2ZB 4YBLB 3U0TA 1EBPA 3VG9B 3ZT5A 5CGMA 2VR8A 1EO5A 1G1YA 2Z91A 5IBLC 1GYAA 4KQ4L 1TVHB 4ZMXA 3G6AB 4BFKA 4AG4L 2PYFA 3NFNB 1L6PA 4LQ1A 4PN6A 2BDNH 3OR7B 3ETTA 5B3NA 3MV7B 1RURL 5EBMA 2Q7NA 4LCCC 1PY9A 4X6FA 3DBSA 5IF0A 4YXLL 5BOJA 1DQKA 1MWAL 3AQXA 1ZLVH 4QOKB 4U3SA 5J3HC 5HI3C 3LKRB 3AWFA 4Q56A 2K6WA 2ICCA 2HT2C 3ZTDC 1QSEE 1BW8A 1JXJA 4OZIB 1RUMH 2G2RA 1BD2E 4HD5A 4C55A 3EJYC 2MH4A 5DYOA 3PGCB 4WU5A 2KYIA 3U48A 4WJ5A 2E3VA 1G5AA 4MAUL 2QDWA 1ZGLA 4FQJL 1E28A 4MMZA 4LSVL 4BH8B 3OJVC 3RNQA 1K4DB 4DK6A 5KYWB 3N5AA 3ZLQC 3UAJA 2NY5L 5L7XL 4R4FH 4Z78A 3STLA 2XN1A 3LHPL 3GXDA 5I1LA 2ISDA 1A2YB 1AO7A 4B27A 4OLYL 4ZO9A 5C0NC 1BLIA 1KCLA 3VGEA 5SWZE 5IUCA 2FJHB 1N6QL 5HYSA 5EWIH 3WKPA 2FQFA 5CEYA 3SY6A 4ECNA 4FYRA 2R8SH 1RUAH 2OL3B 7FABL 3AQDA 2XV3A 4TKWA 2DV6A 1SLWA 3VWKB 3BWAB 3WNPA 4TUOA 2V2XB 2AKRB 2WXIA 4AQ8A 1U8IA 5F7AA 1OD9A 3P2BA 3EJSA 4WWOA 4YNYA 1HFUA 4JM0A 1S7UA 2KBGA 5HGAA 5IK3B 5TDOB 2XIBA 3K0YA 4DP7X 1OD7A 4YC2C 2EH8L 5HYJB 2Q1EA 2ZPKH 3HAEH 4O51B 4B53A 2MCMA 3VCLA 3DETC 3VGAC 4JZJA 3ZGHA 4ZUSB 5F9OH 1CFSB 2DMGA 1NUGA 2Q7AA 1N64L 4NP4H 5D2LA 2Z91B 5FYKE 3QDJA 4D9RE 3OHXC 4RWYL 4M62L 1T0OA 1BEYL 3K4ZA 4PJIA 3I3DA 3K6NA 2PYFB 3RTQB 1TQTA 4DP5X 3QXVA 2Y2WA 1PG7H 4IRSC 4ZSOA 1RJZA 4I1PA 4XNQB 4AGMA 5CCKL 5L88L 4HD9A 1HN1A 3O6MH 4CSPA 8FABA 5KSBA 4Q9RL 1GZHC 4TQPA 4X6FB 5IF0B 2JCCF 4NGHH 2NY1D 2J55A 5KVGH 1JWSA 1H3XA 1CGXA 3HG5A 12E8L 3UDWA 3KPSA 3ZTNL 1T0MA 2UVFA 5FCSH 1TEYA 2G2RB 4G8EA 4HETA 1UD3A 1HINL 1TQBB 4XP4L 3GSOA 2KQMA 1WA0X 4K4KA 5DYOB 3LN9A 4N25A 3CDZA 4JKNA 1UCBL 2JI3A 4WU5B 5A2AA 5IJKA 5LAPA 3N6YA 3QPKA 1ZGLB 4X6CA 2W95A 1E28B 2WAHA 4MMZB 4ZQKA 3SBRA 4GUOA 1FA4A 5FM8A 3RNQB 4NHUA 3DGDA 4R26H 1IGTA 4ZXBC 4Z78B 4TV3A 3STLB 5I1LB 1EHKB 1GGTA 2ZWNA 3SBWC 2MPAL 3BOVA 5T1MA 1UD2A 1YNTB 3C6LB 1RD6A 1TU2B 3E1F1 5CEYB 1N3NA 2ALAA 3Q2WA 2RALA 2XG4A 1QFOA 5L0QC 2VAAA 4NZ8A 2Q3ZA 1KYUA 3F00A 5HHMD 1ZXQA 1NC4A 3ECQA 3LRMA 5DZAA 1GC1H 1X5JA 3OB0K 1NWPA 3PHOA 4DQAA 3GSWA 1M56B 4YNYB 4YZWA 4PSPA 1S7UB 5E8OA 5HGAB 4CILA 1ZA6A 3ESPA 3VXQA 5K9QG 3TJEL 3EXLA 3QJUB 5I1HL 3LEVH 3WNKA 2BSBA 1YEKH 3BYYA 4YJZL 1V5JA 1WD8A 5F7YC 4LQFL 3RHWF 4OGQC 2MPVA 1X4XA 3CZFA 3T6WA 1YCSA 3LH2H 4JZJB 2ZCLH 4U1KA 4PJ9A 5DGRA 3QJZA 3EGSA 4X6DE 1QYGL 1G6VK 4IKIA 3PJSA 4OTXH 3X13A 1FLTX 4F9PA 1FYHB 1T1XA 4PJIB 2UXTA 3RJDA 4MJ4A 4LLQA 4ZAKA 3VWJA 1H5BB 2G4EA 4NCC2 1YEHH 4XX5A 2B15A 3HOGA 3ZE2B 4DGWC 2A6KA 1CLOL 8FABB 1ASPA 4G7YL 2R39A 4NZTL 2D0HA 2X3AA 1EZSA 1A7QH 3KPPA 3MU3A 4UDTA 2W07A 1GGBH 1YJDC 4CMMA 2M26A 1JWSB 1FAIH 1FFOA 4PYHA 4LAQL 5EA0L 1RVFH 4MD4B 4OZ4B 4PY7A 4G8GD 5DZOA 4KQ3H 4RMSA 4K3DL 1RH8A 1SXNA 1W72H 4LEOA 5J13B 3BH4A 1XF2A 3QWRA 1KV3A 1K85A 3R0MA 4PJ8D 4NHUB 4F58H 2C5DC 1IGTB 3PP4L 4P5TC 3NCYP 4JFHE 2YD5A 3AM8C 2ROXA 4G9DA 4DK3A 3MRFB 5T1MB 1ZXKA 2QQNH 3GKWH 4GRMB 4Y4FD 4YFLF 2L8AA 4NQEB 43C9A 4UAOC 4DGYL 2GJRA 3GBEA 4H8WC 4NS0A 1N3NB 2QR0A 1DBJL 3V5DB 4GBXC 4K15A 1GS8A 3GSNH 1OPGL 2ODHA 5F7HA 2M1KA 5C86A 3RVXC 2VAAB 4JPVL 1KACB 5I1CH 3HNTL 5IB3A 4Z7OF 2PPDA 1NC4B 3QJRB 2YUZA 1CG9A 3BRDA 4JDTH 3GSWB 1RIUL 3ZYIA 2HFTA 3SHSA 3U25A 4Z3IA 2ARWA 3IBEA 4JG0L 5AYQA 1ZLUH 3VXQB 4HLZH 3DJTA 4GAFB 3TF7C 4WVRA 1KB3A 4OJEH 5F7EL 1JWMA 1AH1A 1F6AA 3EYUL 5I0DA 2HFFA 3VFSA 3ZDWA 4Q9BA 3VFTA 4OQ1A 2W59A 3VXUA 2CJUL 3C08L 4JDZA 5IQ7H 3O4LE 4LSPL 1MG3C 1MZYA 5CLXA 5KSAD 2QKSA 3FHAA 3X13B 2MHAA 3NZSA 3WJMB 1T7ZA 5LLIC 1XSOA 1T1XB 3H7BA 4JE4B 4TLSA 2IGFH 2V17H 1MIEL 4C4UA 4ZAKB 4M7KL 3VWJB 5C0FA 4CL7A 1BXXA 2HTLD 2FLBT 3HNVH 4MYWB 2BCMA 4ODVH 2L7JA 1W80A 3FB7A 1Y07A 2CUAA 1JZ3A 4UDTB 1CTOA 5K9OB 2W07B 1J9TA 3UTTE 4G8AC 1MG2C 4TTGA 4Z7NB 4MMXB 4G6AC 2EE3A 5ELIA 4PY7B 3RY4A 4N0YL 4W9IC 4JO8A 1RU9H 5GS1B 2XVBA 3D05A 4MHHG 3IAGC 3WBDA 2FLMA 1XF2B 3NYKA 3V95A 3OKDA 2W0KA 3UC0L 3UG3A 3M8OH 4QOKD 4KNQA 4Z95H 4KO7A 3I50L 1INEL 4OZFG 1QNZL 3IDXH 1U33A 2N1KA 1P2CA 43C9B 4G3YH 4XXWC 2R1XA 1ZSHA 2MMXA 1OARL 2QR0B 1JXGA 2QPFA 1M3IA 3SGKC 5K1JA 1CG9B 1TJGH 1RUPH 2B20A 3MCKB 4QXVA 3KXFA 2ZXWB 4P49A 4NUQA 5AENA 4YHYB 1XD1A 1GTFA 2WBJD 1G7MA 4BQBA 2H32H 2X4SB 3O9WC 3GXPA 1HXYA 4YL9A 2YQGA 1JWMB 1F6AB 1KFAL 2VXSL 2NZ9C 3V6OA 3HG1E 1JJUA 1JMZA 4QYOA 4KRNA 3VXUB 3T6ZA 3NCEB 1KGUA 2N7AA 5T3ZL 2WUCL 2MHAB 1OAZL 5IM7A 3MRCB 3NSYA 4NRXB 3H7BB 4WFHE 5AD0A 3J8F7 1CDHA 3QCVL 5I9QC 3TZVB 1T3FB 4MA3B 5DD1H 5C0FB 2J1KA 3BH9A 3WLWC 1XV8A 4RFNC 3H6JA 3MOAH 2AEIT 3CZJA 4JMXA 3UTPD 3KVPA 2GTWB 3DNKA 4KTEL 4RFEA 1ONQA 4S1RH 2YS4A 4H25A 2CKBH 2NT1A 1EDQA 4NO2A 1KGCE 1MFEL 1GS7A 4BZ2L 4JMNA 2NSQA 2CCWA 4GSQA 4UZGA 5F70A 3QIWA 5HI4C 1EHAA 3K72A 4CADA 3CHXA 2IWGA 3ZE0E 1JHTB 3MLTA 3RY5A 1N5YL 4ODUB 1D7BA 4C56E 2R4RH 4JJ5A 1O6TA 4LKCA 1FP5A 5EN3A 3SJVB 2F7RA 4ANKA 3FQXA 1DTUA 4KV5F 1EXUA 2Y07L 2JCCB 3LN5A 3K4AA 3QZLA 5FKAB 5FO8A 1CFVH 4JQVA 3IJHB 4LP8A 3S3SA 2QLVB 2R1XB 1P4BH 1CJYA 5HDWA 2BP8B 4MAYC 1HSBA 1NQBA 5IB1A 3UFIA 3ARSA 4M9OA 2IPKA 3GI8L 5GS0D 4LSUH 3NABH 3QWNA 5C0CA 2BVQB 4ZPTA 4P0DA 2J73A 4UB0H 3KXFB 1O7VA 3QQ9D 3UAJD 2VN6A 4FFYL 2QLYA 3BZDA 1N59A 5I8EA 3QQ4A 4W93A 1AO7D 4WGVB 2IH8A 1G7MB 4P2CG 3RDJA 3CVDA 3V4UH 4DP1X 1HXYB 4HU8A 1U8MA 3L9BA 4BM7A 3D85A 3HZ3A 2XBTA 1MI5E 4ZX5A 4J4PA 4UINL 1MFBL 4DPRA 1EMTL 2XQYK 4PP1C 3IEAA 4QYOB 2J20A 4EKXA 3TO4C 1PNCA 5C71A 4FG4A 2R0KL 1V8HA 3K6OA 2B7DT 4FDWA 5LCVA 1J1PL 3WDJA 3L3HB 2W0FA 4GRWH 3Q6FA 1I3UA 1ZDQA 3BH9B 4MS8D 3OKLA 2VRAA 1MWAB 3OWEA 4TNEA 4CJ0A 4XX1E 3D8MA 4PRAA 4P5MB 4B9YA 5BJTA 5FA4A 1EO7A 1A64A 4Z7UF 1L0XA 4M7LL 2YKKA 1AI1H 4RFEB 1S7RB 1ONQB 3A4EA 5JHDE 2LAGB 4A2FA 1EEQA 4H25B 2F74B 3DWTA 3QDJD 3EG9B 4JM4H 4NO2B 3VFWA 4ADJA 1YMMA 4QF1B 2XBDA 1KIPA 3IMWA 3FUIA 3W9EA 4E5XA 5CEZE 4YK4B 3QIWB 4NM4L 3HEIB 1OGAA 4H88H 3RWGA 2P43B 4CADB 3L95B 4LLYA 4E9XA 1FBIH 3MLTB 4EMZA 4JJ5B 2DTML 4LKCB 2JJTC 3FQXB 4OM1L 2V5YA 3CLEH 3KPSD 4KHXH 3LN5B 3VXMA 2E7HA 5FO8B 4DUWA 1LD9A 1AC6A 1C12A 1MJ8H 2AEPH 2GBAA 4C4BA 3FO0L 3BZEA 5C0IA 4YBQD 4WZ9A 5IB1B 15C8L 2IPKB 2VLMD 5C0CB 4ZPTB 3PABA 1HCVA 4ODXA 3RVWC 1ADWA 2R51A 5JQ6L 1JYXA 1PW3A 3DTXA 3QQ4B 1CXEA 3B1UA 3D12B 4MLSA 2ESVE 3S35X 4QRBA 5H37H 4PGEB 1KENH 5IBUG 1DJXA 3T8MA 1U8MB 2J4WH 3D85B 3JWNH 3D4CA 2ZJSH 3DUUA 4G82A 1M2VA 4HSAC 1A6TB 2OQJA 2AITA 5LGKA 1MNNA 1E9QA 3F6LA 2QKIA 4KK6C 1DANU 1N7ML 2DWSA 1NIEA 3AG3B 3WSQH 4Z7OB 4JG1H 3H9SA 3W0WE 3H54A 3U7YH 1HXMA 2DEXX 4YPGA 3FXIC 1AZCA 1EO8H 3BAYA 3CU7A 1BQLL 4PRAB 4WF7A 1JF6A 3UP6A 2A73A 4OIBA 4OGXH 3REVA 1FWXA 5J1SC 2FEDC 3JVGC 4JN2A 4PJ9D 5ACLA 2DEWX 3DIFA 3SE9L 2W91A 1M3JA 1CLVA 1NCWH 2NT0A 3HI5H 5ICXA 3VFWB 3MRLA 3B8SA 3QH3A 3BKCH 4G42B 4LSDA 3ZZQA 4ZAKD 4E5XB 4XMZA 5BVPH 3VWJD 5AW3B 1LDPL 2NDFA 1NGQL 3RWGB 2VAJA 4LLYB 1J7VR 3FT4A 3KCPA 3WJLA 2NLJA 3OZ9L 1ACYH 1IU1A 3QIUB 43CAA 5D6CB 1W91A 3QORB 5LWYL 1GCFA 1U30A 3FZUC 3H42H 1BM3L 1LO4L 4U1JA 2YOAA 2XZCL 1HDMA 4ODTL 3V10A 1K8IB 4YE0A 1CBVH 1U8NA 3VXMB 4AK2A 1C12B 5CSZB 3AY4A 4X7CC 4EEEA 5DUPL 5C0RH 3BZEB 3V0DA 5C0IB 2DL2A 3SPHA 1N6VA 4WIQA 3PABB 3BAJA 3MLYL 4ODXB 2N7BA 1UWYA 4TPRH 5C8JA 3SCMA 3DTXB 4PLOB 2CO2A 5D9SA 3GMRB 3D5OF 4UZSA 3PAVA 5IFHH 4RIRB 4ATWA 3DVGA 4G5ZH 2AJVH 3GRWL 3QS3A 1VFAA 2MKWA 4XNZC 2KLRA 3AGWA 3DUUB 4JCLA 5FM5M 4MNGA 2OQJB 4R4ND 2EINB 5GGQL 3ILQD 2F68X 3K4DA 5DZVA 2QKIB 2EO9A 5LN8A 1SDAB 5DU7A 4P23A 1P9MC 4QCIA 3H9SB 4NO0D 4RQQA 4YPGB 4Z7WB 2FR4A 4AY0A 4PGBA 3KW7A 3OKKA 1J8HA 1B2WL 2O5ZL 4LP4A 1KXTA 2X6BA 3TT3H 2V8LA 3FN0H 2VDKB 1JUFA 4Y2LA 1A6WH 5GRYA 3ECWA 4KGLA 5HGBA 2NXYB 3E2HB 3CD4A 3VXUD 2ENJA 3LZFH 3DIFB 1QSZA 1HNYA 2A9AA 2YQ3A 4PRPE 5T5NG 5ICXB 5ALBH 4XAWH 3QH3B 4XP6H 3NEXA 1QVOA 1QLFA 3TC9A 3KCPB 1WIPA 2NLJB 5E99H 4M93B 4W81A 43CAB 5K93A 2QHRL 4N9GA 2XCMC 3FQRA 5FGCE 1HH9B 1UH2A 4U1JB 1HDMB 1KN2H 4C59B 5E23A 5AWNH 1CWVA 4PRDA 1OKEA 1U8NB 5FFOA 1K6QL 4UQAA 1EEUA 1DL7H 2LU7A 3MUJA 5EU5A 5GGTL 1XH3A 1AACA 1TKWA 4PCTA 5T3XD 2JCWA 2ALWA 3LHAA 3OLDA 4HIQA 4ZYKB 4XNXH 1JF5A 1DJYA 3SDDC 1HJBC 2K9FB 1PKQA 3VB8A 2VLKE 2GIMA 4NKMA 5DRWB 3QZOA 4MFHA 1EAQA 5D9SB 1RZIA 4FFZH 3DVIA 1ZLSH 4NCC1 4OGYH 4AVJA 4OLVH 5SWSA 3DVGB 2C3WA 3BWSA 4TNFA 3JQOB 3BKYH 4ELMF 4JR9L 4N0UE 2DAVA 2JKSA 4IEFA 4MNGB 4FAAB 1TJMA 3MV9E 2VYRE 1D5MA 1T7WA 3BQUB 2ICES 1HHGA 4NPKA 1BQKA 2YMOA 2FJGA 1A6AA 3GHEH 4QCIB 3BP6B 4PGJA 4KO9A 1FZKB 4JHWL 4RQQB 4MWFA 4NKQB 1NKGA 4XI5D 1LYQA 3VI3E 3NJGA 2FR4B 1BM7A 4BE6A 2PR9A 3OKKB 4DGUA 3ETBF 4OCLC 1J8HB 1VSCA 4HWBL 2Y1AA 5HHOE 3T0XA 4MJ6A 1LMIA 1JUFB 3VVVA 2YD6A 3Q2CA 1FJ1A 4HFUH 5TDNB 5F6HJ 2VISA 1BAWA 3QWOB 2DQTH 3AXIA 2NY0C 3ABKB 4KH9A 2P26A 2I7OA 2Q87A 1U36A 4KJYA 4Z6AT 3IDNB 2Y7QB 2ZSWA 3NIFF 3QJQB 2D31A 3FQ4A 1QLFB 4DKTA 1JFQL 2VLJA 1LO3H 4HX1A 2XKNA 4BQ6A 3FB8A 3OKYA 2Y5QA 4ZFGL 4N9GB 4LCYA 1BGXH 3HBZA 5I1JL 5KVDL 3S3PA 4WSGA 5ESAA 7CGTA 2PPCA 1NMAL 2P45B 4Z7UB 1EJOL 4PP2A 4PRDB 5DFTA 4LXFA 4Y9BA 4PUBH 5EU5B 3BHBA 5DO8A 1XH3B 1TKWB 2XYCA 1HEZB 4Z3TA 3BWZA 1LE9A 1XGRB 3SBWA 4L8BA 4TN9A 2CPCA 5DJ0A 2ZKWA 4FC3E 2GI7A 1ZAGA 2OBGA 3EJUA 1PKQB 4AEIL 2R69A 2MOQA 5DVNA 1A3RH 5DQDL 4G43A 2E7LC 1X7QB 9PCYA 3ULUD 2AVFA 1AGCA 5B3JF 5E8DL 5BV7C 1EWHA 1TQUA 5SWSB 2DMHA 1MFMA 2C7UB 1D5ZA 1G5GA 2MWCA 4DKEH 4Q6KA 4JZNA 2P47B 4R8WL 4V2BA 4IEFB 5DEFA 3KHOA 4PRNA 3NACL 2RTTA 4FI6A 5C0CD 2DD8L 1D5MB 1H3TA 1HHGB 3GRBA 4ZS6C 1RPKA 3RVTD 1LJMA 2EYRA 2FJGB 5D93B 2CBQA 1Q9LB 1OAQL 4MWFB 3ZRFC 4JKMA 2JI1A 1HX0A 4EZJA 1PQZA 3D85D 1IKFL 2X05A 4ODSH 1FHNA 4HKBA 3QCUL 2AXGA 4J4PD 3TO2A 1F3RB 4MJ6B 2WVSA 4X0NA 3EYFA 3W5NA 1FJ1B 3IXAA 3CBRA 3CXDH 2B1AH 2B4CL 3GSRA 2VISB 4R97B 4U49A 5F7KC 3JUZA 1QR4A 3T8XA 2WJ5A 4GW4B 1BQHG 3TBTA 1CE1H 4BCXA 1LO0H 4DGIL 4AYDC 4WTXA 2Y5TA 1XIWC 4JAMA 5KJRH 4YDZA 3LRLA 3UEZA 1E2VA 2CO4A 4R2GD 2FX9L 4JRLA 5ESVA 4M48H 3WFHA 4XN4A 3QEQE 2VLJB 5TK2A 2RBLA 5E95B 1OP9A 1BYPA 2Y4SA 2BIOA 3FB8B 1ORQA 3UZEC 5HVWA 1M6UA 3PNWA 1X5LA 1JPSL 1ZT7A 5ESAB 1NICA 5BS0A 1MFNA 4R5TA 4OB5L 3V4PA 4Q14A 1C8QA 4Q7DA 4V11A 1KJ2L 4NOBA 3ZSSA 1YMMD 2DEYX 3HZYA 1TZIA 5T33L 4QYAA 1N12A 4HIIA 2HT4C 4CBPA 2P5WE 4XP1L 1OGAD 3AM8A 4OKVA 1L9SA 1IO4C 4PJAB 4LCWA 4QT5A 4N8VA 4L8BB 3DK2A 5FYKU 3KJ4C 4HUUB 3MNDA 2B2XL 3HNSH 4PY8J 3G9VA 1RK7A 2N4IA 2O4EA 4K9EL 4LSQH 3MLXH 1HNFA 4G43B 4PG2C 5C07E 4GBXA 2IANA 4JKPH 4YSSA 4ZMYA 2C9UA 2IG2H 4Q89A 3RA7H 2K8QA 1AGCB 2E9GA 2WP3T 4XMWA 1FC2D 2Q0ZX 3VXMD 3CZEA 4J3XA 4BKTC 3AQYA 4Y9EA 4JZNB 3I85A 4OD3H 5FO9B 4YHIA 2A0LC 2PXYA 5ADPL 5ANHA 3C2SA 5KVEE 2JKLA 4IK6A 5B1CA 1Q0YH 3GNML 4EF3A 1RZJH 2EYRB 1NCGA 4RAUA 2IOIA 3T0EE 4C8XA 4WENB 4ORGA 3VFPA 2A9NH 3LYRA 3SBPA 4AENA 4JL2A 1BJMA 2EC9T 1PQZB 3EUDA 5D7IF 1MJ7H 5AKSA 3FUMA 5FGRA 1ASOA 3WEAA 3HS8A 3KJ6L 4R84A 2HRPH 2HLAB 2H7WA 3DTDA 3EYFB 3CIQA 1UACL 2CO7A 3L3GA 4KHTL 5DC0A 3GSRB 2NNFA 4ELMA 2FTAA 1WYJA 1KB9J 5GS3A 3TBTB 2MQGA 4UT6L 3OKOB 4QMEA 3MJWA 2Y5TB 2BSSA 2BSRA 1OO2A 4PRIB 3H9SD 1OZUA 2OTUA 5HJ3A 1BZOA 1A4KB 2XV6B 5ESVB 3WFHB 2FJFB 3ZMEA 3KLSA 1J9QA 3A3YB 3IDIB 2Y9RT 2NNAA 3ATFA 4XVUD 2EUZA 2FH6A 3PNWB 1JL8A 5LB1A 2EIEA 2NXYD 1ZT7B 3QNXA 1MCQA 3NEOA 5DC9B 3UYOD 4LOUC 5TGBA 35C8L 1PDKA 3HZYB 1TZIB 4P46C 2YLKA 4ZNEE 2DQUL 4F8PA 1QHPA 2WLKA 3LQMA 4CC0A 4DETA 3O2WH 1OOWA 3D33A 5DHVH 4LCWB 2X88A 4QT5B 4N8VB 5SX5H 4ABVA 4XN1A 2D4FA 3H2WA 4NRZA 2NUTA 3SD5A 2IBZY 3QI9A 2BNRA 1S9XB 4XXWA 5CILH 5DD6B 2AHIA 4IJ3C 2DIJA 5FWQA 3LZLA 2IANB 3GRWA 1EHXA 2H1LM 4LPYA 4YFEA 2QSTA 4FI7A 4ZO6A 1FFNA 3RIFK 3NRFA 3WFCL 3ZKMD 2PYEA 4UV4L 4BELD 4HZAA 4ZW8A 4F7EA 5E0QA 4DVRH 2PXYB 2VRKA 3HRPA 3I2CL 1F86A 5L4JA 2VJ0A 1HZHH 3H9ZA 2N01B 3O9WA 3CH8A 5IVXE 2F54E 5EF1A 1FORH 2QPSA 1QR1A 4RAUB 3ULVH 2W1NA 3SCMD 3CSBA 2E5EA 3UTSA 4JY5H 1DN0A 4U1GC 4LO9A 2DQHL 1MF2L 2A77L 4P2OC 2XBZA 1EHNA 1FZMA 2EVJA 1U95A 4ZW7A 3UYRL 3FSAA 1IBHA 2CO7B 3L3GB 4YXKL 3OGOE 3BN9C 3JWOC 4ELMB 5AFAA 2P9RA 1BVLA 3MLVH 4JKWA 3RB5A 2V2WA 4IU3A 2EEBA 1PG7X 4N2HA 3R7QA 3GMOB 4P23D 1VGEL 3FQTA 3LQAL 4K7PY 4YO0B 5GQBA 3T4AA 2ZNXA 1AGEA 3WNOA 5E6RB 2L7QA 2R2EA 1MQKL 3RL1B 3TEWA 2WSKA 3INUH 4DCQB 4WLCA 1YN7A 5IBLD 1MSPA 3UXFA 2FQDA 1PLGL 3WS6C 2LFGA 3NH7H 3CVHL 4NKOA 5CIPA 1KDJA 3IDGA 3TYFA 3V6FA 3HE7A 4J8RA 3P4OA 5CGBA 2XICA 4FTVD 2E7BA 5TGBB 1PDKB 2DH2A 2ZCZA 3H0TB 4MQSB 3LTVA 4AGPA 1ICTA 1KTDA 1BVOA 5J3HD 5EU4A 2VIRA 5C97A 1DJSA 4PEEA 3LSOA 1A65A 2HT2D 4R7DB 3CZKA 1WFOA 4EDWH 1IM9A 2ICWA 4ZODA 3S3BB 2O5XH 3QI9B 4NJAL 3TFKC 5A6IA 5I18H 3EJYD 4IRZA 1Y6KR 3QT2A 4W9FC 1LHZA 2R1WA 4BA0A 3C12A 5LBSL 3MBXH 3GMPA 3X12B 4X9FA 4QHKJ 5D2NE 2C3XA 3GO1H 4HPYH 4I18A 4U6XB 5DJXA 2VLRE 3ROOA 1F90H 4KZDH 4FHKA 3DX1A 3CGTA 2PWDA 2QSQA 5JHMA 5ICZB 5C0ND 4JRWA 2WQWA 4QI3A 3R18A 5AAMA 4ADIA 4X7SH 4LDOB 4PD4K 1JHKL 3MUZ1 1N8OE 3EADA 5CWSB 3EHBC 3UTSB 4C83A 5K5YA 1DN0B 3GEWB 4JFSA 2CGRL 5D71L 3TO4A 1F3JA 2AI0H 1CIUA 2X89A 1KC5L 3IJ8A 2CR0A 2YD2A 4S1DD 1FZMB 1U95B 4DESA 1UJ3C 1OL0A 2MJWA 2J5LB 1BJ1J 5I9QB 4NFBA 1BVLB 4PU2A 5CN1A 1E27B 4XOAA 3FQTB 4H8PA 4HS6B 4K8RC 3T4AB 4UANA 5JA9A 3MV8A 1TR7A 3EH1A 1CK0H 2Q76A 5I15H 1C5BL 2R2EB 4R7NA 4HUCA 2PCPB 5DVKA 4L4VE 4N0FB 4P4KA 3VRLF 1YN7B 2PTUA 3S34L 4HOWA 1DBML 3P30L 3VVWA 2Z6FA 5D7IA 1ZK5A 3DJZA 4QWWC 3MKGA 5CIPB 3TYFB 3UG5A 3HE7B 4J8RB 3P4OB 4IRSD 3CE1A 1IAII 4YE4L 2LQRA 1EK3A 3LB6C 4H4NA 4CU8A 4F15C 4XWOD 5K1NA 2IAAC 2PR4L 1P7BA 2A3TA 1KTDB 1YEEL 4UM8B 4RMRA 1U91A 5C3TA 1HU8A 5TDPA 1ESOA 1IAIH 5EU4B 3VYNA 2VIRB 3D4YA 2O61A 4O9HH 2JJTA 2VLJD 5T5FA 1J0ZA 2VXQH 1SXSA 3LMJL 5F7MC 3VM5A 1JRHL 1M42A 5MEOA 1IRAY 1IM9B 2ICWB 4R90L 2Z7ZA 1OLZA 4DEPC 4WQOA 1S3RA 4JO3H 3IE9A 4QRRE 4MB3A 2EDRA 4O2EA 2H3XC 4YH6A 1DQDH 5EU7E 2AJSH 4LMQI 4BE5A 5A2FA 1P4IL 3B2VH 2EIKB 1NIFA 2E7CA 4YR6A 4FQ1H 3MROA 1IGFL 3JTBA 1YDPA 1VFMA 3CBJB 1H0DA 4I18B 4V1DA 5DJXB 5CP7A 3WMSA 3FCSA 4JFVA 4ACTA 1EBAA 1UXMA 1THAA 4JPKH 5D7JC 4ONHB 5E03A 2NY6C 4YVUA 4P4RA 5KUKA 3LY6A 1BP3B 3C9NA 3INOA 4LB8A 4AL8C 3HMWL 1FYTE 1RFDH 1JS4A 3WIIL 4CDGC 1A1NA 5EH1A 3HHSA 4ERSL 1I31A 2R0LH 2QQQA 1U8LB 4X6BB 2NQDA 5F3BA 2R2BB 1F6FB 2VDOH 4TUUA 3IFNL 5LJYH 4O5LL 5JPMA 1D7FA 3FU7B 4S1QH 1A6VL 5FYJU 5HYIA 2ATPA 4YZFE 5DRXA 5K39A 2ED8A 3V0HA 3V55A 1MCHA 4EIZC 2YXVA 2CCVA 1ROCA 4R4BA 1RIVL 4LSSH 3MV8B 3T0VA 2YAMA 4LCVA 5GRXG 4DSYA 3WTVA 4ACPA 4R7NB 3F62A 3N1MC 3JVGA 5SV4A 4P4KB 4KZEH 2X6AA 4JS7A 2HB0A 4GG6E 3F8UB 4WFGE 3UL4A 4GP4B 2JJSC 3BVUA 3OV6A 4Z0BH 4YSDA 1FDLH 2HUEA 5D7IB 1EX0A 1CQYA 3MJ6A 2FB4L 2I5YL 1KBKA 1OAUH 3FYIB 4NQQA 3CH1A 2AS5M 3MFFB 3L1FA 3WXWH 4Q97A 3MO1A 1ITCA 1OW0A 3CNKA 1MW3A 3DKHA 1U91B 3T0EC 3TBYB 3N55A 5JIDA 2JNZA 2MSPA 4M5ZL 3FTZA 5MEOB 1E43A 5HJGA 2RQ8A 1GSMA 1IJNA 4CUCA 4Y9GA 5AL8A 4U7MA 2EXTA 1KYOJ 3K8MA 3MRMA 5AW9B 3UAFA 1Y0LB 4YX2L 1J9CT 2ZE0A 1PS3A 2LHAA 2IWKA 5IESH 2UUDH 5BS0D 4UTAL 1I1FB 4O2EB 3D0VB 3GJFK 4NQDE 1E3ZA 4EN2A 1KWGA 1GGIL 2AABL 2V5MA 2YRZA 3P77A 1DYZA 4Y5YB 4W9DC 1TETL 4L05A 5F7NC 1NBZA 1A5FL 3MROB 2DQCL 1H0DB 1SN2A 4V1DB 1VENA 3BKJH 5CP7B 3FCSB 1E2ZA 2OMUA 2VXVH 4IOFC 1HHJA 4LCWD 2F7QA 5EZLA 3M1BA 2GKIA 4FXGC 4OGAC 1T04A 3HRZC 3MBWA 4P4RB 4L9LC 4P2RE 3WL9B 1JGEA 2EDLA 3ZO9A 1L9RA 3C9NB 4GBXD 4LARH 5FYLL 4L18A 1WCBA 5TE6H 3RVXD 3M46A 5ID0A 3D51A 2FBJL 1A1NB 4IIQA 5IFAL 4JNXA 4KY1L 4AK1A 3OR6A 5F3BB 1P9MA 4PJ7E 3AZUA 5HJDA 5BRZE 1WIOA 3EKCA 2D4DA 2PXYD 2WLZA 2YC1B 4FKHA 3QZBA 1KIUB 1H9VA 5HDRA 5CJ8A 5JPMB 5J6HA 4M1DL 1DZ0A 4M6OL 3IFOA 1IILE 3DMMC 1BOGA 4R4BB 5IW6B 1BVNT 2VQ1A 4PJDE 4XC3L 1ZTXL 1O5PA 3MXVL 2DJSA 1XCXA 1DEEA 5ADOH 4UM9A 2YD1A 2ZSVB 3NRQA 5LHDA 4YSTA 1FVDA 4WWID 2W94A 1AQKL 2EIMB 3FSWA 4HISA 1KJ2B 4HPHA 2R29A 1BWWA 4DUVA 3WTYA 3CH1B 5EV7A 3AFLA 3ZE1E 3S98A 4B9ZA 3HG3A 3OJ2C 1EA9C 1MCLA 2X4QB 1KELL 2VDQL 4AEHH 1MRDL 4U1MB 4LVOC 2BIIA 2E7MA 4X2UA 4DPBX 3CSYB 4AEEA 2XN0A 5BOZG 2I26N 4PJHE 4G6AD 1SOSA 3QZWG 5E00A 2OM5A 1ILUA 4L8CA 1YC8A 4X5PA 3CQFA 4OCXL 1L7IL 3MRBA 2DQIL 1PAZA 3TIEB 3HS0A 2FDBP 3DHUA 4F1ZA 1XSJA 3P77B 2KLSA 3OMZA 1NBZB 1XVSA 4DO4A 1A9BA 1IAIM 2DRUA 2OMUB 5HYQA 3CK0L 5C6TH 1ETZA 2WYZA 5EZLB 5T1DL 1SY6L 2DBLL 2WZ0A 3PWPE 5DVPA 1P6AB 1T04B 2CO1A 3MBWB 1EVTC 3O4OC 1YEJH 3QI9D 2YK1L 2BNRD 5JR1H 1JGEB 3LIZL 3CHRA 4UQ2B 2C7FA 3OX8A 1YPZA 3K3QA 4MKMA 4XPHH 3PWJB 1LK3H 1UASA 4XAKE 4IIQB 4O00A 1G7QB 1MCCA 5IR1A 1OSEA 2PYED 1KPUA 1EDYA 3QXDA 3V9FA 3KLKA 5B8CA 2BDNL 2GUOB 2UXFA 1PG7W 3TTYA 2VUOA 1QAWA 2MQ0A 5K9KB 1J5OH 1FL3A 3WI9A 5J6HB 3O9WD 3B6SA 3HB3B 3IFOB 2DJUA 3CXFA 1BOGB 4YS4A 1Z2KA 4HUNB 2NZ9D 3SQOH 1FZOB 1IX2A 2X3BA 4OIIH 1RUML 1S3KH 3PYCA 4UM9B 3TFBA 1GXEA 3GPSA 4Z9KB 4E9LA 5J1AB 2F8XC 2KPNA 3CVHA 4AIXA 4NERA 2ZF9A 2DQGH 3L4ZA 2FQEA 4GFXA 5KVEH 1QI4A 2WIMA 3VI4A 1E4KC 5FOJA 4UMSA 1PFCA 1QD0A 3KPRD 3PJNA 1R5VA 3AADB 4DAGL 4F8OA 4YLBA 1BOYA 4EIBA 4XZ4A 4JG9A 3RWEA 2DICA 2UZIH 1AR1B 4FG6D 4NWTH 4MQ7A 2I60L 2GJ6A 4L3EE 3C5ZC 5EWIL 3IN0A 4HK3J 4PVMA 1YEIL 2AANA 2R8SL 3U6XS 5E00B 3JWDH 4WRLA 3HCVB 5I24A 3MRBB 1TLMA 3HE7D 3P0YH 4AV4A 3HS0B 3O8XB 5HI4D 3BFWA 5J5EA 3DECA 4N2CA 2P52A 3KLAA 1XCTA 1DQMH 4OJCA 2C9XA 4RGNC 4CGUB 3TJPA 1E6JH 4TNVF 5D4HA 4AI7A 1MKFA 5CU5A 3SODB 3ZJAA 4EBQH 1RSYA 3FUKA 2LFEA 5HYQB 2W80C 2VR3A 1QA9A 2ZPKL 4YEFA 3RKDC 2DQEH 1IM9D 2IWFA 4JFQB 5HDBF 4JO5A 5HHPA 5G55A 5F9OL 4W68A 1UUNA 3O3UN 3SGEI 2VZVA 4NP4L 3WO3B 4HCGA 2HLEB 1U8JA 2F15A 1ZKAA 4MZRA 2XWTA 5HY9A 2BC4A 4A38A 2WKLA 1KPUB 3QXDB 3SGEH 5IR1B 5B8CB 4K94C 3D7PA 1PG7L 1NCAH 4KGJA 1QLEB 3OD3A 2VGLM 2SODB 4TNWK 2WQXA 3O6ML 1FL3B 4OM0H 4LLWA 2WVVA 3FU9A 4JFEE 4KMLB 1AIZA 3B6SB 4QRPA 3AG4B 3KBEA 4XCCH 3I9PA 4NGHL 5KVGL 2WXGA 4WFFD 5AQ0A 4LOVA 3IDYC 1U2HA 3BO8A 1GMIA 2EYSB 4PP1D 3BSZH 5AOJA 3SKOA 4OF8A 3TO4D 2JJVA 1HHHA 2X89D 2A1WH 3CVHB 4EXPX 3U82B 3FTGB 4NENA 5K1VA 1R5VB 4J3OH 2WTPA 1J0JA 2WO3B 3GZQA 3FFCE 5C6WH 3D50A 5AVRB 5DMKB 3QFGA 1UWXK 3P2TA 3UZEA 5JHBA 4F57H 2PCFA 4MQ7B 3MV8D 2GJ6B 2CHXA 3X14A 1F4XH 2WQVA 3Q0HA 4OLWH 2WINA 5EEZA 3FUNA 3T6QC 2B1HH 5E8PA 2X4PA 1ZVHA 2CJTA 4L29B 4UNUA 4P59L 4JGMA 4BKLA 3DRTA 4J6RH 4U33A 1GC1L 1JK9A 2WLHA 2OS7A 4PBDA 3ETBJ 2F8VA 4PJXE 1XB3A 2EIJB 3KLAB 5BZZA 4OCRH 4BWTA 4MBOA 1YMHB 1ZT4B 4R0LC 3LEVL 5H94A 3OXSA 5C0AE 1Z9PA 1QA9B 2NZIA 4H0LC 4OD2B 3SQBB 1AG6A 3HN3A 4KTDH 2GAZB 3LH2L 5HHPB 4ESKA 1BSIA 1YSOA 4FERA 5E5RB 2X4OB 4RGMB 4OTXL 5DMJB 4ZMQA 1CT8A 3IJ9A 4G6ML 4GOSA 4KNTA 3HC2A 5HY9B 4BFJA 3RVWD 4V1DD 5CP3H 1YEHL 2CXKA 1IKNA 2DLFL 5INDA 3D18B 1T2XA 2JIXA 3ES6B 3HC3H 1IQWH 4LLWB 2GJZA 4ZD3L 5D7LA 1A7QL 4PTTA 4QRPB 3ZQXA 1WBYA 1GGBL 4KUZH 2WZ5A 4CVWA 5HD8C 1CF1A 1FAIL 1UD4A 3PWLB 1S7SA 3F7VA 3BO8B 1XBDA 1A4BA 1RVFL 4AV0A 3QQDA 3ALPA 1HSAB 4PGDA 4W9EC 1GJWA 3SKOB 1HHHB 3KL0A 4KQ3L 4KK6D 1Q38A 4F2EA 3KDMB 5GZNC 1B6DA 4K07A 2K4AA 2FH8A 4DNLA 4Q9CA 1U92A 2C9SA 3T3PE 1B3JA 1W72L 1CZ8L 4NENB 5T8IA 4A6YH 3HG2A 3V6ZB 3ALWA 4KH2A 4NOFA 4BZ1H 3V6BR 2PCFB 3L5XH 3B9EA 4G6FB 2QQNL 1T2JA 3X14B 5MENE 2VMFA 2FEDD 1NEZA 1J0HA 4IKLA 1RMFH 1A9VA 5E8PB 1FL5A 2X4PB 1J05A 4LPCA 2NSMA 3GSNL 2DZEA 4UTAA 4Y2OA 5CGYC 4EVNA 5I1CL 4BKLB 1P84K 2Z1PA 4CVUA 3DDFA 5CF3A 5G4NA 4WEBH 5HP5A 3ECBA 4JDTL 4KRPC 3N1QC 3M86A 1VA9A 4TXVB 1P7HL 2Q10A 3CDFA 1TYEB 1CXLA 2GTZA 3QEUB 1G1OA 2K78A 1KPRB 1G4RA 1JOIA 4CBZA 3FZUD 2QVMA 1SVCP 1E7UA 2FHFA 3MBEC 3HUJF 4MTMA 5H94B 1G94A 4XMTA 3OXSB 4PCSA 2NPLX 1MCOH 4HJ1A 3V5KA 4ZJ9A 5C08B 5FCUH 3K80A 5FHBL 4K73A 3NCJH 2YRPA 5IQ7L 3QNZA 4MD0A 1EGJL 1PTZA 4PWFA 1DSFH 1CT8B 5GSRA 2IGFL 1C08B 2V17L 4Q2ZA 4BH7A 1SLVA 5CU9A 5L6YL 3MNZA 3FNKA 2E4FA 1RZKH 3WY1A 2WO4A 5C0BE 5HYSG 2JIXB 4ZUUA 3LV3B 2GJZB 5D7LB 1X5FA 4PTTB 2VXUH 1WBYB 2Z3FA 3KM1A 4P2OA 1D6EA 2O30A 2X4RA 5E1AA 1XGPB 3F7VB 1Z5LA 2CO6B 4PYGA 2FECI 3AB0C 5D1XA 3QQDB 1KULA 2H3NA 4N2MA 5B21A 5KOMC 3KLDA 2CE6A 4WV1B 1RU9L 2QVIA 3FU8A 3RQ3A 3LD8C 3S0PA 1WDAA 4LRIC 4DP0X 4ZT1A 5LN4A 2WKOA 4ZUVA 3UOAB 3M8OL 2GITA 2XA3A 2WV3A 5BRQA 4Z95L 4M6AA 1UYWH 1DDHA 2R0ZH 3IDXL 4E41B 2EUXA 5LAXA 4POUB 5T1KA 3ERXA 1NEZB 4G3YL 4XXDA 2CU9A 2E6QA 2HFGH 2YSSA 3G04A 1PZBA 3MJ9H 4JRYE 4OD1L 4QNPE 1FL5B 1J05B 4A2EA 2X1QA 3PFUA 4HVBA 4Y2DA 3L3DA 2R27A 4PJCF 1LWHA 2J72A 1P5UC 1B4RA 1TJGL 2DWEA 1RUPL 2HKHH 4MJIA 3L3OB 1OP5H 3W2DH 3U2JA 2OR7A 3E3QC 3CPLA 2ZWSA 2H6PA 5D4JA 5ECGA 3JBG7 5HVFB 1DCLA 4G1MA 4M7ZB 3WCYA 1OCWH 5BO0D 2AJ3B 3DX6A 1U0QA 5MI0C 3LIZA 5JZ7D 3EW3B 3FFOA 3KWXA 3V5KB 1T4WA 4D0BA 4DO5A 3T1FB 2Q8AH 2KLTA 1URIA 3FSVA 2V37A 3PAYA 1ZK9A 3NSCA 3WN5C 4MD0B 4N8UA 4W9HC 5GSRB 5DK2B 4Q2ZB 3ZR6A 2K4WA 4BH7B 5AVTB 5DD1L 1EQWA 4HS3B 3GIZL 5IMMA 5KAQF 3KPTA 1EHLH 2W9EH 4LSTH 2G3NA 3EOTH 3VD5A 1IM3A 5HJBA 4G1EA 4JUTA 3MOAL 2X2UA 1BF8A 3I9IA 4UNTA 3KBPA 4JFFD 1Z0MA 1B4JH 1UZ8A 1G7HA 2YBRB 3D3VA 1D6EB 5HGDB 4AYFA 4S1RL 5E1AB 2X4RB 1AS8A 1MVYA 1Z5LB 3DPBA 3AUWB 5HDBB 2ZX9A 3BMWA 5D1XB 1RERA 2WWOA 3WDHA 1OE2A 1J11A 2H3NB 5FF6B 2ZYHA 3REWA 1MFUA 1HILB 4U1IA 1L9NA 2X40A 1ZCRA 4NC0B 3A5VA 2WVTA 3QA3B 3EZJB 3QDMB 2BVYA 4RNRA 3DJSA 3LPPA 4LLUA 2R4RL 3VSUA 5JHAA 1P0SE 2GITB 2VDQB 4XHQA 5FYJD 4IDLA 3C60B 5JHLH 2VN5A 3LNDA 5CS7A 1DDHB 5I6KA 2FO4A 5J12B 4Q9QH 4XXDB 1CFVL 1SPDA 3RNKA 1P4BL 2NY0D 2YSSB 5CJQH 4Z3GA 2ZP8A 4WNJA 4ZQTA 2JK5A 1NBQA 3QFDA 3L3DB 4LRNH 4Y2DB 4Y16C 3NABL 3VRJB 5ERWA 1KG0B 2DWEB 4MJIB 4UB0L 5HTSA 3RIAK 5GZOC 4FQHA 4RAVA 1BBJA 3CPLB 4UOW0 2ADIA 3RUGF 1DSYA 1VADA 3F12A 3QXWA 4L1SA 5KVMC 4LIQE 3V4UL 3HAEA 4G1MB 1XGTA 1D3CA 1SNRA 1KXQA 4KQ4H 1DBBH 2DF3A 5I6PA 2ITEA 4LF3A 5K69A 4AG4H 2IJ0C 1XDTT 1NOFA 4D0BB 3KWVA 4Q74A 3T3MF 1RURH 2VW4A 2HRLA 1GVIA 1M9SA 2JSFA 4GUPA 4XMXA 5T1LB 4JG5A 1W2KT 1JNJA 3VQ1C 4ALAL 5EU6A 3IS1X 2WGNB 4PV8A 6PCYA 3GLAA 4XTRC 1ZMYA 2CA3A 2KC0A 3F2LA 3LRKA 1ZV2A 3COOA 1UM4L 2VH5H 4G1EB 4JRXA 3BISA 1SJXA 2Q8BH 2BY3A 3HUJA 5C09A 1CLCA 1AI1L 4FEIA 3QDGA 4N2KA 1G7HB 3D3VB 1D9KB 5A6LA 4X98A 1FNLA 2FGZA 3DPBB 3G5YA 5DJCA 4A2MA 4B3VA 4JM4L 1IGJA 5C70A 2GCYA 2IF7A 5A2KH 4J3SA 3R4DA 3REWB 1G6RH 3LHPH 1PSKL 3QSKB 4U1IB 2DN7A 1NMCC 2XWJB 1B9ZA 4ZS6D 4H88L 3NP3A 2WBKA 2A9MH 2VZTA 4X6EA 5DJ8A 2XX0A 1FBIL 2EACA 4ZUWB 4HPOH 4LLUB 5L2KB 3RFZC 4YLCA 1G1KA 4NAJA 6PAZA 3SYOA 3GBMH 5BQ7A 1BZDA 1DFBL 1ED3B 5DTFA 2JJSA 3CLEL 3QBTB 4KHXL 2GYSA 2FO4B 2ZX8A 1A47A 4HDIA 4AYBA 2X28A 3ZDZE 4WY7L 1FN4A 3RNKB 5CEXA 3LZQA 1MJ8L 2AEPL 2B0SH 3OAZK 5AW7B 3KVQA 2XC8A 2FBOJ 2JK5B 1MREH 5HDLA 3IU4H 4OFQA 4NN6B 4PREA 1PBYA 3C8KB 4N3UA 5ERWB 1Q9OA 4WI4A 3ETSA 4EQ2A 4UUJA 3WIFA 4FQHB 4RAVB 3KYOA 4UQ9A 4N87A 1OCZB 3ULSA 4P99A 2UY6B 4G6FD 1MUJA 4GS7B 4FNLH 1KENL 3HAEB 5D7SH 1XGTB 4DGVH 2J4WL 1JZEA 4XRCB 4X99B 5IW3A 3L5WA 1KXVC 1XGUA 1X5AA 1LLAA 3PV6B 4LF3B 4PMEA 5DXWA 2ZJSL 3KNBA 2WANA 5E1GA 2WQSA 3D08A 4Y5XA 2HT4D 1W0YT 4XZUA 2FUTA 4IHOA 3THMH 4Q9RH 1B90A 1D5IH 1NINA 4PJCA 5EU6B 1NPUA 4JG1L 2N7SA 4HS8H 4M7JH 5IGXH 3U7YL 2OMBA 4PV8B 5T1JA 1WZ1H 1EO8L 1O9VA 4L9LA 3ZTNH 2PP8A 3EGDA 1I1RA 4POZC 1WBXA 4P8QA 5CZRA 1IL1A 4JRXB 3WEXA 3EOAA 4M1GH 5C09B 3CFEB 4AYID 3FCTA 1FFPA 1F13A 1PJWA 2QGBA 2TSAA 3ARYA 5DJCB 3TXAA 3G5YB 4L1BA 1IGJB 1NCWL 2GCYB 3HI5L 2C1OB 4JVWA 5AYUH 5JO5A 4XN7A 2VW6A 1U8PA 5ACZA 3K1DA 5BVPL 3WAJA 4ZFOA 2APFA 1W9XA 4IJTA 4XMPH 4W4NA 4X6EB 5DJ8B 4R3SA 5DSCA 2HZHA 1ACYL 1NLDH 3EDKA 4OF3A 4GQPH 4KMQA 1J8KA 5FYKL 2X41A 3H42L 5HVHC 5BQ7B 3TASA 5DTFB 2J44A 1CBVL 3OB8A 4NBZB 3GSNA 3I74A 3P4MA 4DP2X 2ADFH 5HHME 1FN4B 3SSGA 4A68A 5CEXB 2QVTA 1ZT1A 1J87A 2EADA 4HU2A 5FM5O 4GRWF 3TJEH 3EDDA 4RDQF 4PREB 3ESMA 5IEHA 3TH2T 3K8KA 3OTTA 1WE5A 1I9JL 2JQAA 4LQFH 4NYLB 5L2JA 2EDDA 4UUJB 4XNYH 3WIFB 2OR9H 3GHPA 4TPRL 3KYOB 1QKZL 3CSGA 2D7MA 2G3MA 1DVFC 3ULSB 4NZRH 3QAZB 1MUJB 3KH3A 1WISA 1JXKA 1HTYA 2GSMB 5IFHL 1RZGA 4G5ZL 1EERB 2GVYA 2YPLD 1G0YR 2JTYA 3ZT7A 3G5XA 4GP5B 4NNXA 1IEAB 2JB6B 3IRCA 1S5IH 1OHZA 4M4PA 3QQ3A 3ASWA 3S97C 4GEJA 5IMOA 3TBSB 2FJSA 2VNCA 2YJLA 4Y5XB 4F33B 4TQHA 4F2ME 4XBMA 4XZUB 5IG7A 2XVGA 1GYUA 2BSEA 2D73A 1QRNA 2ERJB 4IHOB 4NZTH 4Y9FA 2EVHA 4P57B 4PJCB 5IOPA 2VUYA 3QZMA 3B83A 3F85A 2FWLB 2VZSA 5F6IC 5J8OA 2YXMA 2Y2TA 1A7RH 5KG9A 3EGDB 5FGBC 1C5DB 5AG8A 1WBXB 1OQOA 3MRPA 2P4AB 3RUGA 4TUJB 3WEXB 4DKAA 3PWVA 3BPCB 3EOAB 3FN0L 2R9HC 1A6WL 2EIDA 1VZIA 3QFJA 4LPXA 4G8GE 2E9BA 3LZFL 4PLKC 5ES4B 3FPYA 3PP4H 4XAWL 3Q2VA 1KJ3L 5JO5B 4F91B 4XP6L 5ACZB 4RMUA 1W72B 4X0KA 4ZFOB 4DP6X 4DGYH 2ID5A 5E99L 3T04D 5DFVC 5DSCB 3GB7B 2QHLA 3S5LA 1A02N 4ZPVB 2J88H 4JM2B 2J12B 3BZFA 4JPVH 4PQXA 4P2OD 4H0GA 1KN2L 1KCSH 3QDAA 5I8KH 1CYGA 4MCMA 5AWNL 5I30H 3WTWA 3GSNB 2WXJA 1RIUH 1DL7L 3GS4A 3QPQC 1RUQH 4I5BA 1ZT1B 2NZ1A 4CRPA 4DP9X 4GT0A 4ZMZA 5IEHB 3APDA 4XNXL 3ZL2A 5F7EH 3KYAA 2ARJQ 3ZK0A 2H32A 4Z3EA 4NUMA 3HVDA 1E2WA 4NZDA 4FFZL 1ZLSL 4OGYL 5T1KD 4HCIA 5JIKA 4OLVL 4ZMVA 1I7UB 4BRVA 4U1HA 2OV0A 3ZKXB 5FK9A 3PL6B 4NNXB 3O45A 5C0GA 4E5XG 4I1NB 2IALA 3BPNB 2UWEF 3GMQA 3QQ3B 1O6SA 1BYOA 1N67A 5IB4B 1SBBA 2WLLA 1X5YA 4MA1B 5ICUA 4MJID 1QRNB 1OP3H 1FNHA 4OZHF 3GHEL 5IOPB 1H15B 4M5SA 2BOCA 3AREA 5KUMA 3T77A 2GB2A 4ZX6A 3HG0A 3EJQA 5KG9B 5F21B 3RFRA 5I71C 3MGOA 4KTYA 3MRPB 5D7KD 4BFGA 5FXCH 3RUGB 3ASOB 2NW2B 3ZKQD 1AFVH 3PWVB 2AXHA 4HFUL 2CKBA 2WNWA 4OCWH 3QFJB 3S36H 1GYCA 4G71B 3V9CA 3F6IA 2DQTL 4DPCX 3N2JA 1SXAA 5DR5L 4J27A 2Y1ZA 1A6PA 2LE9A 3UC0H 2QZ5A 4JFUA 3T3MB 1UQSA 2IXQB 1IBZA 1INEH 2CDFA 4MXQD 1OGTA 2BRRH 1R5IA 5EORH 5A40E 4QOKE 3DOIA 1ZTMA 2EVFA 4MJ5A 1LO3L 3U0WL 2EUWA 3ARFC 1IM3D 3EHBD 2K3HA 5AB1A 1BGXL 1A0QH 3EH3B 4Y4HC 1OGPA 2FIKB 1USZA 3VXTB 4FI8A 3G3LA 2PPFA 5ISZA 4HK0A 1KWKA 2NCMA 1TF4A 4UMGA 4QR7A 2JXMB 5FHAH 4I5BB 1NFAA 2QSCH 4UV7H 1YEWA 3EIFA 4N6RA 4N1CA 4MZ3A 4K8RD 1J1XH 5FDYA 4UOW1 4Y19A 1TDQA 4AW4A 5EBLA 2R23B 1XF4A 5B4MC 2R59A 3FQWA 3QULB 2EICA 3KYMA 3NJXA 2H32B 2OMWA 5E1QA 1A3RL 3BVNA 2FATH 3S2CA 4FF9A 1FGVH 3Q44A 4AYSA 4APQB 5DMYA 1VPOH 2EZ0C 1OAZH 4QWWD 5ANMB 4U1HB 1P4UA 5FK9B 2JKIS 4HKZB 2NW3A 4DKEL 3O45B 1KY6A 3JYBA 5FDWA 5C0GB 2WLIA 1YC7A 2BY0A 3W11D 3LB6D 3VXRA 2FQGA 4XP9L 4HZLA 5ALCH 2E59A 1HK6A 2G75A 1UD5A 2BX5A 1FRGH 4R0LA 3EJCA 4TVSa 3OAUH 5KVFH 5AOLA 5G5DA 4KTEH 2BOCB 3AREB 3BCFA 2IQAB 4QXWA 4X6DF 4ZTEA 3T77B 3UP1A 2QGCA 3MRIA 2J7LA 4S2SA 1UH4A 2ZG2A 3UTPE 1XB8A 1CGYA 4LL9A 3MGOB 1T7VA 4U1NA 2ATAA 5LNGA 1RI8A 4U05A 2VMEA 3E7JA 3MI6A 1I8MA 1FFTB 1MHHA 5JXEC 2ORBH 4Z7VA 2CKBB 2DJMA 4UAHA 3CXDL 2B1AL 1GHFH 4N2IA 1TQCB 1CE1L 1ML0A 3FOMA 3HKFA 1LO0L 4P5SA 3OMAB 2Z34A 2X3CA 3D0AA 4BINA 5F1IA 1UQSB 4GKZA 3SPGA 4HEPG 3HLKA 3QIBA 3P9WB 2APSA 4D94A 5KJRL 1OGTB 1R5IB 1J1OH 3IFPB 3U2IA 1RXLA 1AGBA 5LDUA 4M48L 4M8VA 1IQDB 2E46A 4MJ5B 4F37F 2Z65C 1BREA 4GO8A 5F9WC 1ZS8A 4JPWL 2JQZA 3P0VL 4JPSA 4W6XB 3V4VH 4RMQA 4JVPA 4NN5B 4XO8A 2HX8A 4Y4KC 2BMKA 4FA6A 5C09D 4RMWA 1G1CA 3QDGD 5GJTH 3GI8H 2ADGA 1H6FA 1D5BB 1YZZA 5ISZB 3VU2A 4KVCH 4ZRGA 2ZAHA 3HA0A 2IC2A 1HI6B 3APFA 4PI2A 4BK5C 1CUOA 1JE6A 5FR3A 5JOPD 4Y19B 1NC2A 1AO7E 2NY1C 4KX8A 4RGOH 5EBLB 4JFXA 3W1ZA 2DBJA 2VQ4A 3HR5B 3PQYA 3NZ8B 4GIAA 5AEAA 1BD2A 4GSDH 3HNSL 4K0OA 4AQAB 3KL3A 4LSQL 3BVNB 3MLXL 4JFWA 4JKPL 3OQRA 2MOVA 3A24A 3HHMA 2IG2L 3RA7L 3IBOA 2Y7NA 2LVCA 2OCJA 1U8KA 1JYVA 3MJ7B 3U4EA 1O7DC 2CALA 2APBA 2NW3B 4KDWA 4HIHA 1T83C 2WLIB 3QWQB 3VXRB 2DYPA 4E9TA 1Q0YL 2YAPA 4HZLB 4B96A 3FL7A 2G75B 1WAEA 4GRWB 3MBEA 4WCYH 1MQ8A 5G5DB 5EEWA 1G9NH 1YG9A 3SY0A 5HYFA 2B8OT 1AS7A 4PJFA 4S2SB 2ILLA 1Z66A 5KSVB 1AZBA 4PGCB 3H8NA 3TVMC 1WA1X 1WTGT 3BUQA 1PVHA 1U3ZA 2AAVA 1J12A 2HRPL 2Z31C 5D2LE 1I8MB 1MHHB 3QDJE 5DDHA 2ED7A 2BW5A 4PJIE 1ZHLB 4KK5C 2RCSH 5EUOA 5BUGA 1PLAA 2OMYA 2UWEA 3ALXA 4IOFD 3U1QA 4ZSOE 3ZKSD 1S7TA 1TZAA 5F1IB 1DN2A 4OGAD 1H8LA 3QIBB 4FCAA 4CMHB 5KSBE 4PJ5B 3QQNA 2WBXA 3CFJA 4OZHA 2KDGA 2MQCA 1NCNA 2IAMA 2AMUA 4L1HA 1ZS8B 3KPSE 3TA4D 3ARGC 4HUWA 4BKSC 2BMKB 4E0RB 4HH9A 4UTBA 4QGTA 1CLZH 1CD9B 1CDCA 5E2VH 2PO6C 3U6RB 4NM8H 5JQ6H 1EEYA 4LRIA 4X6CE 3TA3C 4KJPC 4YHKH 2VLME 1NBVL 2F2HA 5F3HA 1S9YB 2H0EA 5C7ZA 4Y1TA 1OXYA 2B3IA 3MUGB 4M8RA 2JKWA 3O2WL 3QZPA 2WXQA 5IMLA 1BD2B 2DKMA 1SDYA 1XF1A 5CILL 1XAKA 3FB5A 1UOVA 4QTHA 4DN3H 3MZTA 4U4IA 2JE8A 4HCRL 2W65B 1U8KB 2BXYA 1JI2A 1QHOA 2IGLA 5JPNC 4NN7B 3S3CB 4Y1AD 4ZZFA 4PV9A 2A9DA 1KBVA 4KROC 5HHNA 3ULAB 5KZCB 1CDBA 4HIHB 1DUZA 4YBHA 5AW5B 2GUYA 2D2OA 4DVRL 4A7SA 2DYPB 5F1NA 4QKTA 1BQLH 4U0RC 1BFSA 1HZHL 3B5TA 2B16A 3C09C 1FORL 1OWRM 4QJ5B 4GQQA 4KK8C 4HC1A 3SKJH 1GGUA 2WXRA 4CSZA 4KZCA 4XPAH 4JY5L 1F1AA 2EEFA 2ZIDA 4ENEC 3SZ6A 1MRCH 1ET7A 1BF2A 1K72A 1NGQH 3P3YA 3Q8BA 4YDKL 4QJ4B 3RAJH 1W15A 2Z35A 3ZTJH 3VMOA 4Y8DC 2BSED 4DT2A 1R3KB 2OMYB 4QKXB 2IQ9L 2HP4A 2HVJA 3SPIA 3GMNB 4XMLH 4M29A 3BRFA 2B5IB 3ARQA 1BM3H 1CPUA 4YGAB 3CFJB 4OZHB 4WHTA 3INUL 4X6DA 2IAMB 4X9HA 1CE6B 1BJ8A 4KZ0A 4Z7NE 1KZQA 1EXGA 1KJMA 3IT8D 4HUWB 3P4NB 1I3RA 3NH7L 3QFJD 4HH9B 4WO0A 4YGVA 4GT7A 4ZMWA 2YO3A 1OSZA 4MNHB 1XR8A 4WWKC 3UYPA 2XVKA 1M4KA 3L3JA 1BQHA 4A67A 1B4LA 3O11A 3WKQA 2Z93A 3OAWA 1RZQA 4TQIA 1ES0B 3LRGA 4YHPA 1ND0A 3PHSA 5I1DA 1KCBA 1SHXA 3Q1SH 2WYIA 3ARBC 1UXWB 2IBGA 1E8XA 3GWJA 3OF6A 3NIGE 1P1ZB 4YBLC 3VG9C 4ZBJA 4EDWL 2W81C 2VQUA 4FFZA 5I18L 4L2LA 4B0MM 3FB5B 3L4TA 3GDBA 3D39A 2CM6A 3J27A 3BD4A 5KYNA 3KLQA 3OHMB 4U31A 2G5BB 4Y16A 1EFXA 2WWNA 4Z5RB 2YXFA 4I0KA 5HGHA 5HHNB 4HPYL 2WWMD 3E38A 5GZOA 4DOHE 4KZDL 1MIMH 1N18A 1DUZB 1ZA3A 5GRJH 4NO5A 1OLLA 1CU4H 4JO2H 5GIRB 4LCIH 4L4TA 1B2WH 1R34A 1VLXA 1IGMH 2JJUA 3JV6B 4X7SL 3WV0A 2CJ3A 4B95C 1GKOA 2P80A 4ZTPH 3GDCA 5FUCE 5I74B 4KTGA 1JPGB 4RMVA 3SO3B 4Z77A 3TV3H 1KTBA 4R5XA 2AI0L 4LL1A 1LO2H 1M9WA 2IDCA 2IOOA 2HCZX 3VXUE 4NUJB 4HIXH 1K3ZA 4YUEH 1VFBA 4NBYB 4RGND 3RWHA 1ZE3H 3GGWA 2Z35B 4N8VG 3R4RA 1IC5H 4IBYA 4WTZA 4AZUA 2VSKB 4XO4A 4HWZA 2QHRH 4NJ9H 2HVJB 3PWUA 2DWYA 2BIQA 1T20B 2FEEI 4OCSH 4WO4A 3ARED 2GG1A 4MMYA 5E4AA 4U6TA 4Z18A 2ZZUT 3G5WA 3WTSA 5DCCA 1E4XI 5I15L 1I4FA 2I9TA 3GS7A 4PJ6A 4GP8B 4X6DB 3DI2B 4MNQA 2PLTA 4XMVA 3VWKC 3UTOA 5DJYA 2F1AA 4YGVB 4X4KA 2VDLH 5I0VA 5JW4M 1OSZB 2CHNA 3L3JB 1DUYB 4X5QA 3MC0A 5DWUH 5T3XE 2Z93B 2A74A 2WYTA 2AQPA 1N0LA 3ULVF 1IAOA 4YHPB 1ND0B 3U4BL 4PR5B 1IAIL 1Y1DA 2DS4A 5BZWB 5I1DB 1QPXA 2D3LA 1S46A 4JR9H 1HC1A 2H2SD 2ITFA 5F3FA 1CFMA 2G60L 5A3IC 1XMWA 1VZHA 4JO3L 3K5RA 4Q0XH 2VN4A 1DQDL 4MYPA 2AJSL 1R3LB 3RTQC 3B2VL 1NLBH 5DUBA 1X4ZA 1NKRA 4FQ1L 4NAMA 5F0MB 3N9GH 4U1SA 1G0XA 1L5GB 4JHWH 3SEPA 1AR2A 4NO5B 2DM3A 5FA3A 4PVBA 1BZEA 4Y19D 1FO0H 4L4TB 3SDCC 4WW1A 3GJFB 1W6WA 4UBDD 1SXZA 1NIBA 1N10A 4ABWA 1TQBC 5HDQL 1RFDL 4Z77B 1DVXA 3V6OE 5DJZB 3JZYA 4NNYA 2H45A 1CD0A 2R0LL 3B2DC 4NO3A 3O81A 3CJJA 3ZL4H 4MMZC 5GS0C 3GI9H 3VX0A 1VFBB 1MH5B 3C6SA 5BCAA 5I1KH 3RWHB 1FI8C 4S1QL 3GGWB 4F24A 4OVVA 2X6MA 1BZ8A 3MYZA 4HWZB 3PWUB 1JTTA 1OF2B 3C6LC 5D6DA 5I1JH 1JSYA 4WO4B 4LSSL 4N0CC 4A66A 4B6ZA 3O3AA 1I4FB 1EJOH 2OSLB 5HHVH 5DHYB 1EFQA 4KZEL 2PP7A 2GW5A 4MNQB 4MX7B 3OLIA 3ASNB 3EO1B 4Z0BL 1FDLL 2N0MA 3HR6A 4TM9A 4CKQA 5DJYB 4AQ8C 3IYLW 2WXNA 1OAUL 1MZZA 4AQ1A 2K3TA 1EIBA 3LDBB 1J0IA 1A1OA 4O58H 4OJYA 5AVWB 5PCYA 2ZG1A 3WXWL 1OTSD 2MCPH 2A74B 3IJYA 1TO5A 1N0LB 3QIBD 3EDFA 4LLVA 2N59A 3UTTB 3CCHA 2ZUQB 1HE7A 2MQ3A 4X8CA 3M6DA 5HD8D 4N24A 2X87A 3Q9QA 2IDFA 4JZJC 1JZ7A 1I8IA 3ULUE 3KL5A 2F7IA 1M7XA 2ZKHH 3MMEA 3BEVA 3NACH 5IESL 1E9OA 4JBSA 5GZND 4BJLA 2HVBA 1MXGA 3PS6A 4EDXA 2KPWA 1NCOA 3FAXA 3GT6A 1H5BC 3MSPA 4HIEA 4MDJB 5DUBB 3U7AA 1UG9A 3AMLA 5C2UB 4C56A 5I1GH 5C0CE 5I1IH 1RPUA 2Q7YA 1O6VA 3BKJL 2XPZA 4QO1A 2ITDA 2VXVL 5FA3B 5GGRA 4WI2A 3BUYB 4JZOB 1NC2D 1I7RB 4M03A 3CIAA 4FLRA 4CC4C 3PQYD 4PRHA 3D25A 4JRFA 4RAHA 4LESA 2B4CH 3JUYA 4LARL 1R3HA 5TE6L 3KLHC 1E42A 3OMNB 3DV6B 3EBGA 3ZHKA 1IIIA 2Y06H 5KZCD 4NO3B 3P4LA 1IGCL 4KRPD 5J13C 4AUYA 4LLMA 1QNIA 2DYPD 4AT6B 3BX7C 4NZUH 1G43A 3ARUA 3MBED 3AUVA 4MB5A 1MI5A 2WO2B 1MJUL 5CJXA 1F3DH 4GXFA 3HG1B 2Y22A 3RI5K 1E8ZA 5ADOL 5DMGC 2CRMA 4Y1SA 1R1CA 2F8IA 2PWGA 1FG2A 1OAXL 1YMME 3Q43A 2R2HA 5DUJA 4ZZKA 2EO7A 5IEKB 4AQ1B 2O5YL 2E74C 4Q4EA 1BZ9A 1OGAE 3GINA 1E5ZA 3OKMA 5D70H 1DVSA 3ENEA 4AEHL 5DHVA 4JFPB 4LLVB 1Z7JA 3BXNA 2ZWZA 4PPTA 3CCHB 3PLYA 5FEBA 1IKOP 2CHZA 3KPNA 1BQSA 4FNPA 1YRKA 3FDWA 4S1SH 2IAMD 3NG5A 5CCGE 5AW2B 1OGSA 3VXME 4MSWB 3MMEB 3CXHK 4AEFA 3BI9X 3NSFA 4F9PC 1E9OB 1JZ4A 3GNMH 2JLPA 1R4XA 3FTXA 3K7UA 4LP5A 4ZTOH 2XKSA 4ZAKC 5C0JA 5CJOH 3VWJC 4HIEB 4LDLB 4IBWA 1KGIA 3CQQA 3E80A 3LKSA 4C56B 2F53A 2AQ1A 4M4RA 2HJKA 4QO1B 3VG0H 4GRLA 2CA4A 5E1IA 1ZWIA 5GGRB 4Y88A 5C6TL 2E6JA 2ADYA 1SFHA 4QAMB 5GXBB 3NA9H 4PRHB 1PD1A 4MMXC 1YEJL 5JR1L 3D25B 3LAFA 4R83A 1QTSA 2WPGA 2XPYA 4ABUA 3NJVA 4P9HC 1AANA 1WS7A 4PJGF 4XPHL 3FOLA 3S96A 2O93L 1LK3L 1OVZA 4UT6H 3EFOA 3LJ3A 2XI9A 3LXCA 3OM3B 5GS1C 1JNNH 3VDCA 4FNTA 3VI3F 5B1KA 4LLMB 4KFMA 2BP3A 4QXGL 1U8HA 3DO4A 4EZLA 1S9VA 2ESVA 3H9SE 1J5OL 3CFMA 5ICYA 4WJG3 5F89A 2VR7A 3QEHA 2VW7A 3GZKA 3S48A 4GAGL 4NC1E 5AL0A 3WE6A 1MI5B 5A2LH 5AVYB 4XHJC 1FV1A 3QC5X 3SQOL 1DVTA 1S3KL 2CPUA 3BT2L 4GKSA 35C8H 5DRZB 1NCCH 3ISRA 3TPUA 4R4NC 2DQGL 2G30A 4HUMB 2WNXA 5KVEL 4LBEA 1WGVA 2GC4C 2R2HB 1XX9C 1UADC 3L3KA 2X4NA 4PJEF 3WTTA 4YHYC 3S35H 4JFYB 1BZ9B 4NKIH 4HHGA 1E90A 5J0BA 2BVPB 2UZIL