3Q9QA

Hspb1 fragment second crystal form
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
82
structure length
77
Chain Sequence
SHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHAARYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Heat shock protein beta-1
publication title Three-Dimensional Structure of alpha-Crystallin Domain Dimers of Human Small Heat Shock Proteins HSPB1 and HSPB6
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 77
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3q9qA00
2Y1YA 3AACA 2XCMC 2WJ5A 5DS2A 3L1EA 4M5SA 1RL1A 1EJFA 3L1GA 4YLBA 3QORA 3Q9PA 4YL9A 3VQLA 2BOLA 2Y1ZA 2JKIS 3GUFA 4YDZA 1X5MA 3GLAA 3Q9QA 3AABA 3J07A 4JUSA 4YE0A 4FEIA 1WGVA 2RH0A 4PCKA 1SHSA 4JUTA 4YLCA 2N3JA 2KLRA 2O30A 3GT6A 2CR0A 3W1ZA 2WJ7A 2K8QA 4RZKA 3EUDA 1WFIA 2N0KA 2MNWA 4MJHA 3VQMA 3N3EA 2CG9X 4I88A 4PBDA 3QORB 4M5TA 1WH0A 5DS1A 3QORC 3QORD 4ZJ9A 1GMEA 4ELDA 5LUMA 2KMWA 2Y22A 3L1FA 3IGFA
chains in the Genus database with same CATH superfamily
3KGSA 5F96H 3WDIA 1NPJA 3BX7C 1HZHL 1A7OH 3HAEH 4KMTH 3GSVB 2DN7A 4XGZA 4NDMA 4R8WL 5BW7A 5ID0B 1OAQL 2ZUTA 1A02N 1XT5A 3ARSA 1H3UA 2RR3A 4Z7VA 2AXFA 2Q76A 5LBSA 2MNUA 5KYNA 2NXYB 4M8UA 5E94A 1PG7W 1EZUA 2HWZL 3GS0A 3RVUC 2IPUK 3DKHA 3LQZB 1J7VR 5JLZA 3EG9A 2ORBL 4L4JA 4XMXA 4AMWA 3B7SA 4P3DB 5I1AB 2XXMB 3IMBA 3S48A 1KWGA 1AC6A 1NCDH 3O81A 1F56A 1S7UB 3U9WA 5INDA 1NC2B 1X44A 2KLTA 3EJUA 4XVUC 3AUVA 2I60H 3MLWH 4EDWH 1Q1JH 4MFHA 3T4AC 4HK0A 4HUXB 2YRLA 5FECB 4PGZA 4PV8B 2P44B 5D93C 1Q90A 3CHRA 1GMIA 4X99A 2IPUG 3OBAA 2IG2H 4KZDL 2A6KA 3BWSA 3K81A 5IVXE 3MLSH 2VZ1A 3WLWC 1DQDH 1OZTG 3SDAD 1TNMA 4A7SA 1E6JH 1NWPA 1X5KA 4TTDC 3V4VA 7TAAA 2JKWA 4P57A 5C0CA 4I0CC 5GGVY 2WUCL 1BX2B 3RY6C 4ZUTA 1MFBH 3QJFA 1TEYA 1WFMA 3VQLA 2Z93B 2JKIS 5JNYB 2L8AA 2YS4A 1FVDB 3MOAL 4NZJA 4LFHG 4HEME 3FFDB 4ODTL 5B22A 5IEHA 1XO8A 4J4PA 3MTRA 4DOHB 1U4FA 3D0LA 3ALPA 1FHNA 5AW8B 4Y2NA 4OT1L 2VXTH 1DANU 1FFOA 2XWXA 1XF4B 2VNCA 4U2ZA 2K45A 2AKRA 2A99A 2APXA 4WGKA 4GW1A 4WHYH 3MLXL 1JRHH 4QR7A 1CXFA 3Q6GH 1MFAL 3A4DA 1ZLUH 1JZEA 1GH7A 2BNQB 1N3NB 4I0PC 1LD9A 1QNIA 5IQ7L 1ETA1 1OCRB 3EBHA 4ODHH 5IFJA 4ZS7H 4DWHA 3FT3A 4Z7OE 3DYMA 2A38A 1PNCA 5CCHE 3AADB 4CKVX 4YHYB 3NCBB 3EYVA 4HIEB 3R06A 4XNQA 5DR5H 4YEFA 1OV8A 3PE9A 4QYOB 4MMZB 1JZGA 3NCYP 4H13C 1SFHA 1IGFL 1YUHA 1M7UA 3JV5A 4FQXC 3RGVA 3UTZB 3RUGF 6TAAA 3HBQA 2I26N 5AAWC 4K71B 4NC0B 3KWVA 3ZT7A 1NCWL 4R7NB 3G6AA 1JN6A 4IIZA 1X7QA 3JQOB 3LHAA 4M8QB 1TJIH 4N2OA 5ALBL 4Z77B 3E0GA 1NSNL 2K6YA 2AAVA 3SE4C 4EUPG 4H25B 4R90L 4NZ8A 4HLEA 3QFJB 4F7CB 1T0NB 2YKKA 1OSZA 3ARTA 3UBXI 4PP2B 4KO9A 3HNTL 1Q9LA 3FTGA 1BECA 1NAML 4CMMA 5EU3B 1UYWH 5G55A 3O6ML 4J6RH 4YUEH 1F58H 2E47A 5BZDB 5H4ZA 2OJEB 2DM3A 2GABA 4KXAA 3O11A 4M6ML 1R34A 5CINH 2X4NB 1JPST 4JDEA 4V2BA 4XNMB 4XXCC 5DT1L 1JYWA 3OF6D 5ID1A 3KH3A 3QJHA 4FG6D 3EGSA 3PNRB 1GJUA 4R2GB 4XNYL 4AQAB 5KJ7E 3QUXD 2P5WA 5LLIC 1E5BA 3QUKB 5SWSA 5JXEC 1ETZB 3CZUB 2BRRL 4LK4A 4KUZH 2BMKB 1Y18A 1UWEH 4NO5B 5AW6B 2PXYA 4E9VA 4MRCA 3L9YA 5BQ7B 2CJ3A 4P48A 1AS6A 1RURH 2X70B 2FL5A 3GK8H 3RZCC 2ENSA 2RMNA 4EBQL 2A83B 2ICCA 1ITBB 1IUZA 1HZHH 3MCKA 1C5CL 5E08H 5EUOA 3BIKB 5BS0D 4R8WH 1XF2A 4P2OA 4APXA 3CN0A 2XPGB 1XB3A 1ADWA 1OAQH 4BQCA 4ETYA 3MCYA 3VXPA 2YD1A 3CFDB 4OZFA 2PWEA 3G5WA 4GO6B 4YSPA 3U48A 5LKNA 1BA9A 4YMPA 1I1AD 1N6UA 3KHOA 5HYFA 5FLUA 3UX9B 1BG9A 2HWZH 4FMVA 3F7KA 4Y9FA 1QSFD 5C0RL 5CLTA 2YAPA 5A7EA 4X8GA 5C0JB 4NWTL 1A22B 4OBRA 5F89A 2DIJA 5DMKB 2XX1A 5CP7A 5IFHL 3E9UA 2QV2A 2EZ0C 3VFWB 2PUQT 1UWYA 3FS9A 4JAMA 4GIAA 4LLUA 4DCQB 1RHHA 3PCYA 3QDGD 4G7QB 5DGRA 4A2LA 3L9BA 5IMMB 3BW9B 3QUMB 5JR1L 2YN3A 1DHKA 4LKCA 1O9ZA 4MA3A 4XE5B 3SDAA 2VXUL 2W0FA 3WN5B 4KZDH 1QSED 3BAJA 2OMVB 1TYRA 4P4KD 5DK0B 1IC0A 2L04A 3PF2A 1P84J 3U46B 5JOFA 1JF6A 1NBVH 3V5DB 4HS8L 1SMOA 3EH2A 3PU7A 3VGGA 1LEKA 4XMTA 3U4KA 2EXTA 4U6HA 4OKDA 4LF3B 4Q4EA 4QUOA 4EI5C 1R24A 2WCPA 1QFHA 4F7MA 3DROB 3V6BR 3IDNB 2VQ1A 4ZD3L 4YSEA 4MJIE 2K70A 3MOAH 4CJ0A 3GMOA 3PDDA 4PY8I 3LX9A 4ODTH 4JFFE 3UACA 1YEFH 3B56A 1BREA 4FNUA 1A1MA 2C9VA 3BXNA 4KTDL 1EIBA 3ZPDA 3UAEA 5SWZE 4OT1H 5E6IB 2IIJA 1F3JA 3WGUB 2WBJA 1DQKA 2LU4A 3NIGE 1NGWB 3V52L 2VISA 2YPVL 5JO5A 3BVTA 3MLXH 2JJSC 1TJGL 5DC0A 1MFAH 4QT5B 2EDBA 5KSBB 1YPZB 4G11A 5L2KB 4N1HB 2WQXA 2Y5TA 4DEUA 5D55A 5IQ7H 3NEEA 4OFPA 4N8VG 2WKOF 5GXBB 1YEEL 3STLA 1GIGL 5E5LA 1NUGA 1X5AA 3PL6B 3MRMB 1UASA 2YQBA 2VO8A 2APVA 1RUPL 5IJBC 4JCLA 1UA3A 2WZPD 4X8XA 2D7PA 1RIVL 4M7KL 5M95B 1FLRL 1NBYA 3C5JA 3S35L 1IGFH 1KGCD 1SLUA 3UGUA 2FX8L 4PJIA 5IEKB 1UZ6E 3GYRA 4I8DA 4X7EC 1TMCB 3HCVA 1NCWH 1MY5A 3ARGD 5IIEA 3DVFA 3D85B 3VFPA 2XSKA 5FUOL 5A6MA 4TS6A 1WT5A 3LKOB 4KY1L 2QADB 1ZT7B 4MQTB 2Q87A 3RL1A 3SQBA 3WNJA 1GYVA 4JHWL 3TN0B 4KKAC 4QXTB 5DJ2B 4Z23A 3L95A 1NUDA 4N3UA 1RFDH 4JFQA 4KKBD 4L3AA 1NSNH 3CN3A 2Q2LA 5FYJE 4EN2A 1CIUA 3HEIB 3CZSA 1LE9A 3NP4A 4R90H 1GTNA 3MRGB 2MRYA 5IBLC 1KIRA 5G4NA 3QISA 4BFGA 3HNTH 1NAMH 3WIHL 1FZMB 3O6MH 3OF6A 3KDMA 2WWMD 2Z65C 3VFNA 5J1AB 1D5XA 5FFOA 5DT1H 1GC1L 4KO7A 4N9OB 4UBDD 4HIJA 4UQBA 4XNYH 5CEZD 2VL5B 5I1JL 1I9EA 1DZ0A 4TVPD 3VD9A 5DD6A 3KWXA 3NSJA 2HRLA 2COVD 3GBDA 1A3ZA 2P8PB 3HR6A 1B4TA 1E2WA 1M1SA 1CT8B 5E8PB 5J4MA 5FOJA 2BRRH 1TTRA 1CI3M 3D09A 5F6HI 5C0BA 5HSFA 5HDLA 5L88L 4N26A 4EJ1C 4AIZB 4MGXA 3P4OA 1OQOA 4UNIA 5EOCL 5FR3A 1BDYA 3DTXA 2XNAA 3NESA 3DO7A 1W72B 1WFJA 1LWHA 1FCGA 2DQIL 3LRSA 4ZFOA 5KVDE 4GINA 4PRBA 3HE7D 4Z7NE 1H6UA 2IBZY 4EBQH 2XBTA 4ZBJA 3Q8EA 1I53A 4JFED 4KWUA 2WIIA 1AJ7H 4JZNA 4J8RA 2E27L 3T8MA 1C5CH 2BSTB 4AJYV 5DUJA 1NEZB 1E30A 4D9RE 1N10A 4G9DA 1B9KA 1VGKA 2CUHA 1QATA 4IRSB 1LJMA 4HC1A 5JMOC 1CFQB 4P5TC 3N06B 3HKZA 5C0RH 5BRZB 2BSSA 1GZHC 3QDJD 3OTTA 4NWTH 3UJJL 5HXMA 4MNHB 3GMQA 4GO8A 1A2YB 1JCVA 3QDGA 4NLHA 4JBSA 2BXZA 1OTUC 4N68A 1A6UL 5IFHH 3UTSB 3LRMA 4GQZA 4PW3A 1MCFA 1KY6A 1A1NB 3AG4B 3ZE2B 4QDGA 3WTWA 5E0FA 5E99L 3EOAA 2QDVA 2GK0B 5B39G 1HDMB 2CDGA 1AD9B 1QSEA 4I9XA 5JR1H 1FVEB 3MO1A 4P4KA 3MFFA 2R2BA 1UXMA 3TA3C 3ZN6A 4I48B 3EJTA 1EBPA 2K3HA 2VXUH 1XGRA 3KPMA 1J8HA 2HVKA 2E4FA 3AT9A 3BWAA 3E1F1 3QIUC 4MASA 2GCYB 5DRXA 4OJYA 3F84A 3KNBA 3GPSA 1C12A 4HS8H 4GT7A 5DJ8B 3HN5A 1FL3A 4OCSL 5BV7B 3S4SB 2Y2YA 4PYGA 5JOEA 4A6YB 2AJ3A 2ITEA 2IVFC 3EDJA 3UROR 1SDDA 4OLEA 4P23A 3G04A 5KBPA 1A4AA 4KZEL 3QEQD 4ZD3H 1AR1B 1ZHNA 3C9NA 4EZJA 1ED3B 3FTWA 4ELDA 2WLLB 2ZICA 1FNAA 1IC5L 2ADGA 3GINA 4KTDH 1A1OA 4YFLI 1TVDA 4GRLD 4HGWA 1CFSA 5E1HB 5J56B 1FP5A 4HYTB 2YPVH 3T3PB 3ZT6A 1TJGH 5D96C 1L5GB 1UJ3A 2ZKXA 3KLAA 1IARB 2MOVA 3FBQA 3P3YA 4FQPA 2AXGA 3BVUA 1UUNA 1GJWA 1OGAB 1XBDA 2WZPA 4MZIA 3OHMB 5HDBB 1YEEH 4FF9A 3RTQB 1L6XA 1GIGH 2IDCA 3WS6C 4CVZA 3MUZ1 3CXDL 1RUPH 4XP4L 3DV4B 3DWTA 1N12A 1AHWC 4UTCA 4U7MA 1S78C 3CX5J 3GIVB 1RIVH 3QCUL 4M7KH 1FLRH 3S35H 3WE6B 4EQ2A 4Y19D 1ADQL 1KXVC 1W80A 2EYSB 1PKQE 2FX8H 5IMLB 1MRCL 2VMFA 4LQFL 5DJCA 2FO4A 4J7RA 3ULVC 5FB8A 1P4LB 2EDEA 3U6XS 4CU6A 1S3RA 1ORSA 2DIEA 2A74A 4JHWH 5EBLB 2HX9A 5IW3A 1RPUA 2L7UA 4QO1A 4B50A 2PCYA 5CEZL 3VI4F 2VYRE 5HVFB 3VB9A 3LTVA 3QR2A 4GS7B 2GSIB 5E23A 3MJ6A 2IWFA 3ZYJA 2BC4A 4CL7A 4Y2DB 4JFHD 4PIBA 1MH5B 4R4ND 5F1IB 3WIHH 4N6RA 4LVOC 1JGLL 1E67A 2Z92A 3MLUL 3UBHA 3IPFA 2YA2A 4W9GC 1HQRB 3EHBC 4HFWB 3MREB 4ZPTA 1IGJB 1OTTD 5I19L 1EXUA 1CTMA 1KZQA 2MHAB 1A65A 4IRJD 1SHMA 5I0VA 5FCSH 2L7JA 4M93C 4KRPD 5AKRA 4LSRL 1EEYB 3REVA 2VDOB 3CMGA 3WY4A 2AI0H 1GOFA 3QIWB 4B27A 5BUPA 1EAQA 3M7OA 5C09A 3EDEA 3ZKXB 3JVGA 5C9JA 5L88H 1SMAA 5HPMA 2EDWA 5D7LE 2YPLD 4PUBL 5BXFB 1VAHA 3IDIA 2AJVL 4PHXA 1BD2A 3QPXL 5EOCH 4JFEA 5DO2D 3MRRB 4FQHA 2DQIH 4X6CA 2XU9A 3PQYD 1X5HA 4OSUL 1HK6A 4ERSH 1PU0A 4JRYD 4PS8A 1VZHA 4BQ9A 3GMLB 3PJSA 4O02B 5CSZA 1PDKA 2OMTB 1XL4A 3CSPA 3T77B 1MW1A 2E27H 5DJDB 3UG5A 1QACA 3V0FA 3PWPE 4WKXA 1N5AA 2ETWA 3UADA 3ECVA 4RGND 4BK8A 1VFAA 1TKWB 5CLXA 2R8SL 1KYOK 4OCYL 5CJBA 5KSBF 4ANXA 1YPZF 2I27N 2NUTA 4GUCA 2XN9B 5F93C 2JQAA 3MRLB 4LSSL 4GB9A 3DTUB 1P4UA 2BVQA 3VACA 3NPSC 2DIAA 3MRFA 5JUEL 4CN1A 4JFDE 5DEJA 3UJJH 3ZHKA 1GGIL 5IG7A 4DKEL 1C7TA 5BZZA 2LVEA 3FRUA 3IAPA 5C08D 1A6UH 5FDWA 1S7WA 5F88A 1MLCA 3FU9A 3H9SB 4ODWA 1U8QA 1AQDA 4L8DA 2GSMB 1HXYA 2F5AL 5E99H 2R29A 2G60L 3RPBA 3I3EA 4Q2ZA 5EU4A 1WS8A 4RGOL 4GO9A 4MCMA 1ZV2A 2VLLA 2OCCB 4DEPB 2P8LA 1NIAA 2HLFD 1KJMB 2NXYC 5EU6D 4M43L 1XZWA 5FWQA 4DGIL 2J56A 2NYZA 3DA0A 4HUUA 3LHPL 2XN0A 3FCUB 1GL4B 3SE9L 3VFGL 4OCSH 3FFCA 1N6QL 3QEQA 1QW9A 1WP6A 2PO6B 5EORH 5F7MC 1OAYL 3MX0B 1OAKL 3OKNB 1YUKB 4KZEH 2EXYC 5IMKA 3EGDA 1T21A 5E1QA 1WGVA 2BOCA 1UXWB 4JZJB 3TH3T 1UFGA 4LCWA 1WWAX 3EFFA 1IC5H 4YE4L 5IJKA 2QZQA 4HHGA 3RA7L 1BJ1H 2O5YL 1EDQA 1S7SB 4YXLL 1PZAA 2QEJA 3NOIA 1OGTB 4HOXA 3V5HB 2ZWSA 5DHEA 1S6NA 1E8WA 1WZAA 3QB7C 3UTPE 1E90A 3O45A 4N2FA 1ZA3A 2NYYD 2NQ3A 1NZRA 3LKQB 3BWZA 3VM7A 3KWWB 1KN4L 3A23A 4I89A 3M1OA 3MC0A 1HJCA 1TZIA 4WSJA 4JKLA 4JGJA 1IU1A 4FQQA 4Y19A 2WXQA 3KL5A 3L2MA 3P4LA 2PTTB 3CXDH 2MJWA 1HEHC 4XP4H 3CFNA 3ARZA 2AZUA 3HZMB 2Z8RA 1CYXA 1LP9E 2MPVA 1JDCA 2CO1A 2E7HA 4BGLA 2O5ZL 3PIQA 3UPAA 1ADQH 1LVEA 3H85A 5EBGA 4LQFH 3CQQA 2YGNA 4L5FE 4X4YA 5DZNA 2Y3NA 5JPNA 4P2RB 5E6RB 3L3HA 2BLFA 4EOWH 2VJ8A 4BQBA 1A6AA 5AVTB 1GZPA 1KB5B 1C8QA 4F7PB 1OF2B 3TTSA 3UYRL 5CEZH 4PRHE 2X0WA 5GGTL 3KPSE 1D7FA 1TQTA 2VT0A 2X2YA 2ESVE 3CVHB 4DZBA 4YHYC 3B2VL 4HAKA 2JIXA 4PAZA 4MMZC 1T6VN 3KL0A 4POZC 1RLWA 3VTAA 3FJTA 3BEWB 1JGLH 3E9TA 5IROA 3DVIA 3KVPA 3MLUH 3NMEA 5L4JA 4K71C 3LPGA 1A7BA 4WJ5A 3ZE2F 1Z9OA 1IJNA 1WJ3A 3FQWB 4FCAA 5AB0A 1O7DE 3OC5A 2Z35B 3E38A 4IRJA 1F86A 2P24A 2QQNL 3G7TA 4NFDA 4XB7A 4PVLA 5FM5O 5I19H 2X4UA 4PJAA 3HE6B 4LDEB 2ZSVB 4GRMB 4AYMC 1CJYA 4RRPG 2O6EA 4GRWE 4W9LC 2OTWB 4LSRH 2LHAA 4X9FA 1XZ0A 2JJTA 2IDSA 4RSYA 1U8IA 4XX1G 4Z7VE 2Y2WA 3PQYA 1UXSB 4JRXB 1BYPA 1R4XA 3CGTA 4PUBH 3SBWA 3QPXH 4IHOA 2EIJB 1AAJA 3DBXB 3GUTB 2GAZA 1CVRA 1M7DB 5G5DB 4EO5A 2R69A 4DT2A 2PP7A 2IV9A 5BUAA 2JJVA 4PJBA 4R2GC 2J8HA 2FJGA 2DLFL 2VW4A 3HBZA 1A9BB 1LQSR 3Q6FB 3VXSB 5E51A 5TQ0L 1M9WA 3DX0A 2Q3ZA 1XSJA 1TYJA 2IPKB 3A4FA 4JKKA 2ZOLB 1FGVL 2GY7B 3T3PF 1MCLA 3LNDA 5MEPB 2WCSA 3ZK0A 1AZUA 4HKJB 4U1MB 3SIKA 1PBYA 3HPJB 3RWDB 4YSSA 4E9WA 1BSIA 4TLKA 3Q5YA 5C08A 4HU8A 1UD8A 2Q7AA 5C2BL 3PWUA 1PG7X 5JUEH 3RBGA 3NCFB 3LCYA 3SKOB 4DP0X 4OFDA 4G7RB 1GGIH 2ENYA 3I75B 3QG6B 1I31A 1TZHB 2AQ3A 3LD8B 5B7EA 4DKEH 2V9RA 1KPRA 3D9AL 1U8KA 4MXQD 2OL3A 5C0CE 3UPCA 4TTGA 5IREA 4AY0A 5IB4A 3BP6B 5E1AA 4H2AA 2R1XB 5I76B 4L05A 1QFWI 4XBGA 2F5AH 2HH0L 4WDIB 4Y2OB 3RDTB 1BEXA 1OP9A 1FNGA 2G60H 3LKPA 4RGOH 4L3ED 4TUJA 3ETBJ 2OX5A 4WTZA 2HT4C 4FG4A 1F4WH 3PWNA 3VGBA 4EI6A 5HPOA 4QRUA 1EV2E 4KOCA 2IH9A 3DUHA 4ZMVA 3W0WA 4WW1B 5CU5A 5D7IB 4FG2A 4DGIH 1KEML 5BVPL 4TSAL 3WJJA 1T1ZB 2ZAIA 5I1CL 1NCHA 5KVGH 1U8HA 3LHPH 4LEEA 3SE9H 3VFGH 5KS9A 1WO2A 4MA1B 1UOKA 4RAUB 1N6QH 1LO0L 1DQLL 5HYJA 2AMGA 4UQAA 5DD0L 1RI8A 2WINB 3GPEA 1OAYH 1UD6A 3TZVD 1OAKH 4POYA 1VJSA 3WLBA 5D72H 4YDVA 5J7CC 2O6CA 1UD4A 5GRXG 2C1OA 1J8RA 3FZUD 1A4JB 3Q43A 3FXIC 3VVVA 4K7FA 1N59A 4MMYB 1DN2A 3N41B 4F7EB 3ZYZA 4YE4H 4U1KA 3RA7H 3TIDA 1HILB 1YNKL 2O5YH 4Z76A 5I1DA 1HEZB 5EC2A 3WNOA 4ONOA 3ESOA 4YXLH 4QCIA 2H45A 5EO1B 4M6OL 1MUJB 5DYOA 5JORA 4KFZC 5AW4B 3MCG1 1BQHA 4PD4J 2O93L 3VGFA 2BP0B 3QZWG 4KDVA 4LKXB 3HB3B 1T6WA 2UZXB 1KN4H 3ET9F 4OKVB 4FQJL 3HKFA 2JKSA 5FKPB 3E8UL 3OZKA 5I74B 3EF4A 3DIVA 2HFEB 2ZUQB 1ZS8B 3BI9X 3J07A 3B1UA 2RHEA 3RVVD 1E65A 1FG9C 5KSUB 2O5ZH 5E6IC 1WFOA 3T09A 2G75A 2WTRB 1VACA 2WTOA 3FPYA 3QPKA 3L4ZA 4HCFA 4X5XB 3TL5A 4U1JA 4F37F 5CMAA 3BP4B 2PWGA 3RG1C 1B6DA 1ETJA 3JWOL 3SJVB 4YXHL 4X83A 4AYFB 4LHQB 4F8TA 2DWTA 3ZHLA 1Z9LA 1K5NB 1RJCA 1M2OA 2VC2B 2DLGA 3I9IA 2HJKB 3MDJA 4G5ZL 4HLZG 2NY6B 3QGVA 5G2NA 1ASOA 4OJCA 3AREC 3PL6C 3UTQA 4F9LA 5EFIB 2ICEA 4J39A 1DP0A 5EZOL 2FECI 1ES0B 5SWSE 1U3HB 5C7XL 4Z7WA 1FG2A 3FB8A 2HXAA 2NY0B 1RP9A 4NQED 2K8QA 3MUGA 2Z34A 2PLTA 2DI9A 4JFPB 5KYWB 4MAYB 1XCTA 1IKOP 5ENWB 4XTRC 1W15A 1KDJA 3P40A 4UYQA 5AVWB 3HI1A 1J05B 2YMOA 5KSVB 2DWEA 2AF2A 1CL7L 2VM4A 1UADC 3MNZA 1YMMB 1DVXA 2QADC 5D2NA 3GI8L 4TVSa 3RX5A 3IJ7A 1FL5B 2QQNH 3L1EA 3V5KB 3TN0C 2ROXA 5SX4H 3QI9C 5B38B 5FKAA 3V6FB 2OK0L 3V2AR 2EUXA 3V0IA 5D7JB 1BIHA 5KAQG 4Y1SA 5EUOE 5IB1A 3D39B 4BELD 1D5ZB 1J12A 4YSAA 3NBNA 1IMHC 2H8PB 5KG9A 4O9HL 2I24N 1GGCL 3OR6A 4HWUA 4WHDA 2X88A 1XHHA 1FO0B 1AGCB 4GLRI 4P04A 2UXVA 4ZUVA 3KDPB 2NX5B 4NXSA 3L5HA 2X4RA 2AQ1A 1QR1A 3T3ME 4HIHB 2DKSA 4LOUD 2DLFH 4NO0A 4GXVL 5ISZB 3EOTL 1GS8A 5TQ0H 3LJ3A 2VN4A 5JIPA 1NKGA 2WJ7A 2ZKYA 1FGVH 2X2HA 3FH7A 3PG2A 2OL3H 4JQIA 1K3IA 1O6SB 4L3CA 4ZXBC 3MROA 4JRFA 4XBPA 5FOBB 5I0DA 1BVKA 2V9QA 4PRPB 4I3RL 4PJ9D 3WTUA 1FI8C 4DKTA 5C2BH 4ALAL 2YXVA 2DMBA 5HGDA 5GS0C 3NJKA 4QHKI 1RK0A 4IEFB 3BHBA 4WW2A 3D9AH 3UG4A 4A2EA 1FV1B 3O4LA 1MFVA 2DAVA 4G7SB 5GIRA 3LKRB 3ARFA 5LN4A 5D1XA 4JRWA 1LWRA 4UYPA 4BK5A 2HH0H 3DMMB 1SNRA 1IAIL 2B08A 3K4AA 4S0TD 4BQ8A 2K9FB 3LV3B 5FX3A 2CQVA 3GBNL 1Z5YD 2H1PL 1UKSA 3GSWB 4U1IB 5I5JA 5KYUA 5LN8A 1BPLB 4P2QD 5J3HD 4G9FB 3ROLA 3CBKB 4I87A 5KVEL 2HJLB 5FFGA 3S3JA 2V37A 2DM2A 2HFTA 5BVPH 1KEMH 3UH8A 4TSAH 5FV1L 5EIIA 4L9LA 2VO5A 2UY6B 3PABA 3TZVA 4N2IA 5I1CH 4HH9B 1JF1A 2W5PA 5DTFB 1LO0H 1DQLH 4P8QA 4YHKL 4PJEA 4NQSA 5DD0H 4H8HA 4PGCB 2X6MA 1NFDB 3CHOA 3T8VA 4QXVA 2KKQA 1P4BL 1KGXA 4FJYA 3VH8G 4PWIA 3NFPB 3QVAA 4FXTA 4D7PA 2XQYK 4JG9A 4KC3B 1G1KA 3IGAA 1G7HA 3FSWA 3NJMA 5IVZB 1YNKH 2DQJL 4HX1A 5EF1A 3BESR 4XWGL 4PJIE 3ES6A 4M6OH 4MVBD 5SX5K 1U8PB 4W4OA 4JO2L 4H0LC 1H8NA 1JPGA 1XAUA 3VUAA 4Y4FD 1T04A 2Q86B 4CRPA 5DI8B 1S7RB 2JI3A 3B5TA 2IF7A 4JVWA 3W9DB 1KGWA 1J11A 2EC9U 2V9TA 5B3JF 2D2CC 2XTJD 2CKBA 2G3XA 3L3DB 3E8UH 1AR1C 4RMRA 4X42A 4DVBB 4RSVA 4Q56A 1KIUA 4N8UA 1IM3B 1LMIA 4G83A 4AGNA 1L9TA 1N7ML 3ISRA 3IN2A 1J9SA 4PJCA 1BAFL 1NH6A 4CKQA 1UJTA 2NZ1A 3SDCB 4F9PC 2P5PA 3EGXB 1BWWA 3K46A 2BSDA 2C5DC 2NZ9C 1I8AA 2N0MA 2VN7A 3DOSA 1FDLL 2NY1B 3SDDA 1A47A 1SLWA 4MWFB 2OW6A 5AVZB 1BVNP 4R26L 5LGHH 2JCCF 3WNNA 3JWOH 4JCWA 4CW1A 3QORC 2IADA 5I1HL 3A5VA 2NW2B 1MWAL 3UPRB 4G5ZH 3RTQC 1HCYA 3X14A 1FCCA 1L9MA 32C2B 4KI5F 5IW6A 1H15B 4J3OG 5EZOH 2X2JA 5DK3A 5C7XH 2GG1A 5C6TL 5EG6C 3B2UC 5F7DB 4HPOL 5C0BE 5J6HA 4IOIA 4LSTL 3S2CA 1IRAY 1JK9A 2WQ8A 3D69B 3D2TA 3QWOB 1CL7H 2E7CA 2CM5A 2R39A 1KTKE 3QNZA 3PGCA 1FFPA 3GI8H 2WNKA 3C5SA 2W9LA 2KZBA 4FFWC 3H3PL 3RWCA 2DYSB 1DVFC 3TVMB 1X9QA 1TZOA 3FO0L 4WEEA 2OK0H 4NQUA 3WTXA 5HYQA 1MDTA 4Z78B 4A7TA 3LSOA 5D7IF 1H5BA 3ZL1A 2GJRA 4GS7C 1CD1B 1R5IA 2H0JA 3QH3A 4CVXA 3AQXA 4HZ1A 1T03H 1JZHA 3EOBA 2Y25A 4MJ5A 4O9HH 5BZWA 3X11A 2ZYIA 3FO9A 3TF7C 3L5IA 2X4PB 1GGCH 3MJ9A 3S9DB 1IBGL 4RIRB 3REWA 1HH6B 1PVHA 2XI9A 3HR5A 3CPLA 3SHSA 3K72A 4AQEB 3N41F 3QDGE 4M5YL 2C26A 4MLIA 2ADFL 4XNZB 1ZVHA 1M2VB 4GXVH 4IK7A 1MCWW 3EKCA 3EOTH 3D51A 1NCJA 2P52A 5JHLA 1NCNA 2E7DA 1BMGA 4ODUB 5L4IA 2F08A 5F70A 4IU3A 5DHVH 1QSEE 3QIWC 3MNWA 4AI7A 4KTGA 4NKOA 1H3WM 4LIQL 2JFCA 4HSQA 4HWZB 4YSQA 5C97A 4I3RH 1I1YB 1RJYA 3V95A 4AW4A 5JDSB 1J8HE 3QUZD 5CN1A 5C8JB 4ALAH 5IR1A 4WJKB 1G7MB 3BGFB 2GSGB 1IQDA 3G9VA 2XFXB 4PLJC 3VI3E 1HKFA 1MVUA 4P2QA 1AGEA 1T5WA 5GJTL 3WL9B 2I85A 4NAMA 3RVTD 1N8OE 1T2XA 1IAIH 1Z3GL 1ZHLA 4PGEA 4IBVA 2P7TA 4YOKA 2EE0A 3WDHA 1AO7D 3GBNH 1YCSA 5HI3D 2D7TL 2DQCL 2HAZA 1H3TA 5DDHA 3MBEA 1DO5A 3VXRD 5HDQL 2WXGA 3WJLA 5KVEH 2R23B 2IOMA 3WO3B 4M03A 5ESVA 5I6PA 3MLPA 5E56A 1AKJB 3JWDC 2ZQKA 3VFSB 4LGPB 1M7IA 3FOLA 3BZEB 1P5UB 4HQQL 4RA3A 4GG6E 2ZCKL 3MV8D 2ZIDA 4YHKH 2NY4D 2JB6A 3QHZL 4HOZA 2BWQA 2BOBA 1AYOA 2GKIA 1ETB1 3OKOB 3WTVA 1P4BH 3CZLA 4GYBA 4QXUL 1CLOL 1KGCE 1IM9D 5ADOL 3QJUB 2J2ZA 3K6DA 5ILTL 2A9CA 2AJSL 2E9IA 1E5AA 5E6ZA 4N2DA 4LLVA 2DQJH 4ZMZA 5GSRA 4L48A 3TYFB 4L8SA 5F1NB 1KBBA 4XWGH 1OZUA 1BVLA 4JO2H 5IB5B 1QBML 3HC0B 3HG0A 3L3GA 4N2EA 3E2HB 1UCTA 2W07B 3A47A 3L6FA 2PO6C 3PAUA 1GCYA 1H3XA 1I7TA 3CDZB 3VGEA 1ULVA 4OUUB 4B9JA 4E41B 4EN3C 3DV6A 3PWVB 4HA1A 3U6RB 3U36B 3RPKA 1OK0A 4EKXA 1JZ3A 2WGNB 4LFHD 1P1ZA 1YRKA 3V4UL 3WENA 2CRMA 4JZJC 2BCMA 2HG5B 4QHUA 3AU1B 4IOFD 3L3OA 3ZO0A 1WAAA 1N7MH 5B1JA 1XIWD 3DNKA 1BAFH 2NY2D 2FWOB 3NSXA 3CVDA 4OF7A 1T7YA 1HYSD 1IZKA 3QYMA 5AD0B 4KFMA 4WI4A 1N2RA 4YZFE 1DEDA 1FDLH 1DSYA 1J9RA 3CLEL 4ICXA 4R7XA 5IMOB 1DDHA 2EDJA 2Z7ZA 2CK2A 2EDRA 1IGTB 4TVPE 2HLEB 4U6XB 4P46C 5DS8B 1I85C 4FA7B 1JZ4A 2VM9A 4DVRL 2R4RL 2UX7A 2X2IA 3O6FC 1BFVL 5I1HH 1MWAH 4G3YH 4X6DA 5J12B 4XCEB 2J1XA 2OMNA 4I18B 3U1SL 2XX0A 2WQAA 2CO7A 2MOGA 4O58L 5C6TH 4F80A 3B3IB 4HPOH 3WIIL 3SPCA 3NT0A 1O6VA 4LSTH 2OMZA 5EN2B 1I9IL 3LEXA 3BKML 4IBTA 1YN6A 1RUQL 3K2KA 4JFEE 4QOKD 2GY5A 2WHVA 4X6CE 1YYCA 5CP3A 1AGDB 1XXFC 3SGKC 3I6LD 2E6QA 3FO0H 1M6OB 1Q9WB 5T1MA 2RCSH 4XOBA 2AJXL 1A7QL 2AQRA 2F5BL 2G9KA 4G80A 1NEUA 2N7BA 4JFYA 4HS6A 2ARWA 1GGUA 3K8MA 4W6XB 5I8EA 2HVJB 1D5MB 2XXCB 3QDJE 3UP6A 4RRPM 1A7PL 2J21A 2L3BA 2DY2A 1IBGH 3M88A 3P9MB 6CGTA 5M94B 2CAKA 3OAYH 1DEEB 3B7RL 1NLDL 3O2DA 3HJ0A 3V4PL 3DETD 4JM4L 4P4RA 2ZCZA 3ELAT 4M7LL 3UMNA 2IMMA 3IFOA 1AOHA 1I8KA 5GGSY 2NT0A 3WFHB 1ZT4B 5DJYB 1V7NL 2ADFH 3NFNB 2EYRB 4JQVC 4ETQA 2WZAA 3GJFA 1HKLL 5D1ZB 5GPRA 1QEWA 4DKAA 4MDIB 4PG2C 4JPVL 1AOZA 1FWXA 3G6JA 2WZ5A 3E3QE 4LDCA 4U0RB 2DH3A 3QUZA 4K8RD 1ZT1A 2OSXA 2UXTA 4NKIH 4CSSA 4D0CA 5EEUA 4NIYE 2XYCA 3NZ8B 2VITA 4Z3GA 3RIFK 4IGBB 5IB3A 4HWBL 4LIQH 3BJ91 2CBMA 2X1OA 2I9TB 4P9HL 3QYCA 2EEBA 3ZXAC 1EHLH 1K2DB 2HA1A 2LV4A 3BDXA 5DEZA 1NUNB 3ZRSA 2PR4L 3FFCE 3QEQE 1IEAB 3ZHDA 3FH8A 4B9CA 3VWKD 4GP5B 4AIEA 1AO7A 1HI6A 3FCBA 4ILDA 1C5DB 1ZVSA 5GJTH 1AXSA 1FFNB 1WWWX 4HMCA 5GRVK 3UTTB 5DFWH 3VXRA 1ZGLA 5KBNC 1Z3GH 4WU7B 2IO5A 2IWGA 1FAKT 1X7TA 3I6KB 1CICD 3VXNA 3WN6A 3WJMB 5BV7L 2D7TH 2DQCH 2H1LM 4LCWE 4PJ8B 5EZLB 5KVGE 3AT8A 4M1CC 4A6YL 2EE9A 3QARA 3ARDA 1NCOA 5HDQH 1JXFA 3UZQB 3V0GA 4KVNL 4YVUA 1KT2B 3SSGA 1RY7B 1LO5A 4WTQA 5IQNA 4GW5A 2D2OA 4HQQH 3FCGA 1ICTA 4JFXB 3ZIYA 3CK0L 4AH2B 3LD8C 3RVUD 2ZCKH 4UINH 3IF1B 2BERA 4XZ4A 4NHCL 1MAJA 2YD9A 2ATKB 1MCCA 4H8UA 1KFAL 2R0LL 2VGLM 4Y1AD 3RDTC 1CLOH 4X7CC 1T89C 4V2CB 4Q6IC 4XVUD 4Y19E 3TO4C 2MCG1 3HG1D 3L9RA 2AJSH 3QAZC 5ILTH 3MBWB 5HJBA 2QL1A 5HHOD 5T1KA 3MNVB 5LGKA 2JXMB 1JV5A 2IALB 4GSDL 1H6EA 2WLIA 5A2IH 2YPKA 5K59F 2Y7QB 2IGFL 3ZIMA 2BP8A 4HUVA 5TE7L 2YC1B 4XPHL 1EHKB 1TENA 4ZFZA 1TUPA 1QBMH 2V2WB 1UHVA 2FEEI 4OGYH 1XF5A 3H56A 4NPYB 4PW4A 1LE5A 1SOQA 4GY4A 2ENPA 1X9RA 1PZDA 2F54A 3WLWD 4J12A 4TTDD 5F3HB 2IOOA 4PWKA 3KPNB 1SUJA 3CCHA 3V4UH 4PMFA 3OL2A 1XIWA 4JFHE 5JA9A 3P9LB 3GSUA 3FSAA 5I8KL 3F7QA 4XE0A 1D9KB 2ZXCA 1H8LA 1LEGB 3G6DH 5D5MF 4PLNC 3IB4A 2Z4QB 5E03A 1J18A 2GJ6D 3LIZL 4NBYB 2ZX8A 1OP3H 1C5BL 5EOQL 2MNJB 4B7IA 1VZIA 5FYLD 2C9UA 2G3NA 1BXXA 5BQDA 3ULSA 3RNQB 1PQZA 43C9A 3HB3C 4PJ5B 3V9EA 2R4RH 5EA0L 3U0PA 1BFVH 1TXKA 2Y7NA 4HCRL 1OAUL 3UG3A 3P77B 4I0PD 1G4RA 2XPYA 5I74C 2P8MB 4L4VD 5T3ZE 2ICWJ 2YPLE 2CMRL 2ZUQC 3WNPA 1NGZA 4Z7OB 4RDQG 4O58H 4MCYA 2ZOKB 2XDHA 3IWVA 3PNWA 4QOKA 3WIIH 1BF5A 3RNKB 1F6FB 2G5BB 1OHQA 3PQYE 2CIKA 3BP7B 4AXWB 1I9IH 3CXHK 4HK3J 3BKMH 1RUQH 4FQXD 4U4BA 4BZ2L 1AYRA 2VDOL 2LTQB 2YUZA 3GSNA 1ZKAA 2IPTL 3FUEA 4PCTA 4PJBE 3G5YA 3BO8B 4RGNE 2A2QT 4JKNA 4XMLL 3W39B 5D4HA 1YG9A 4UF7C 5F97E 4JLRB 5T5NG 2NY6C 2CSPA 3L2NA 5D1ZI 1LQBC 4YHML 4UIMB 1G7IA 2AJXH 1A7QH 3VRLE 1UEMA 5EV7A 5CN3A 3WMPA 3KWTA 1U3HC 3WUWG 4Z9KB 3FUNA 2NY0C 1VCAA 1GPOL 3NJVA 3N6YA 1VERA 1A7PH 2ICWA 4XZUA 3ULUF 2WN2A 4MAYC 4YHPA 2MSPA 5AUMB 3D48R 5A2FA 4YR6B 5I16A 5L4MA 1NLDH 5C08E 3UIZA 2WOYA 3OGOE 5IKCB 3V4PH 2F9BT 1GOHA 4JM4H 4M7LH 1EAJA 1SJVA 2WXMA 3RVWC 3X12A 4K3HA 4DP1X 2F58L 2A6IB 2A4CA 4AKOA 4BBWA 1F4AA 1HKLH 3LZRA 2J57A 1BZQK 3JTSA 5D7JC 1VFBB 1M71A 3IJEB 3VQ2C 4MKTA 3UMTA 4RGMC 1UACL 2YR3A 2Y72A 3Q2NA 3WAJA 3GZPA 2QSVA 4HWBH 2PTUA 5D9SA 5TFSL 5JXED 4GBXC 4GUQA 1EX0A 3QDMD 4ZZKA 4P9HH 3O2WL 4AV0A 2Z8VC 2YOCA 3MUJA 4XMVA 3ZKSD 3VWKA 4FULA 1VIWA 1B4JL 2XUWA 4X6BB 4E5XG 5KS9E 2XQ0A 1MNUL 2PR4H 1CD8A 4PBXA 4JFZL 1UT1A 3RZCD 2COQA 1HL5A 3DGGB 4GSRA 5CILL 2C9QA 1G0DA 2AJUL 2W9EL 3WYRA 2CD0A 1NFIA 5F7FA 3ZRFC 4BH7A 4K7PL 4OGZA 5CLZA 1E5UI 3O9WB 3QZPA 4IU2A 4JFVA 2HPTA 5K9JL 4KVNH 1S7QB 1ZMYA 1JAEA 5ERWB 4KUCF 4QRPB 2QV4A 4RFOL 3FONB 4Q89A 6PCYA 1GSKA 2R2CA 4FYTA 3CK0H 1AGFA 2C3HA 2K6WA 2WMPA 5LHDA 1ZY9A 4R97B 2VDNB 4NHCH 2O72A 1USQA 4LGSB 3QXAA 3LIUA 4F3FB 1OAXL 1EXHA 5C0IA 3BE1L 1N67A 4MS8C 3T4AA 2EVIA 1KFAH 1HFUA 2R0LH 3CZEA 1EDYA 2WZ0A 4WK4B 5HHOA 1MLBA 4XOEA 2EZ0D 3QEUB 5K33A 3P3SA 4JJHA 3LZQA 3Q1SL 1VRSA 3KW8A 3MMEB 1BFTA 2NNAB 2DMCA 4KZ0A 3SGEH 3D4GA 4GSDH 5GRUL 3WKPA 5LAXB 4A2MA 3LRGA 2IGFH 4MB4A 4UQDA 4XPHH 3EDFA 1HHGA 1CFMA 3FRPB 2ADIB 2W94A 4LOEA 1T1WA 1U8LB 1RZ8B 2X44D 3RGVC 4WI8A 2BY3A 1OLZA 2E9JA 2M1KA 3FL7A 3V9FA 4FXKB 2YK1L 1B3IA 4OQ1A 5AL0A 4PM1A 2DV6A 2VQUA 1L9OA 3RB7A 4OZGF 2JKLA 4YDJA 1DVTA 3EJYC 2EACA 4EQ3A 4KDTC 3TBVA 1BZ7A 4G72B 1IGYB 1RZGB 4S2SB 5AL8A 2FT8A 4RFNB 4EI5D 4TOYL 3D8MA 5DZOA 3N5AA 5I8KH 4EZMA 2XVKA 4MNGB 2GIXA 4Y8DC 1PD0A 1SUHA 5F72S 3PPSA 4Z7WE 5LCVL 5GGRB 5CBAB 3JV0A 1N5YL 3NUKA 1DVUA 1HSBA 5K9KA 3LIZH 2VLRB 1C5BH 5EOQH 2VTFA 3FULA 3AS0A 4RWHA 2WKGA 4NUMA 5SWZB 2ISDA 4C55A 1UATA 3PJNA 1QRKA 4Q9BA 4ZAKB 4MJ2A 5D2NE 4I0PA 1C7SA 3V6ZB 1HHJA 2D4DA 5CIPA 5EA0H 5KWYC 5IY5B 3AG3B 4HCRH 1OAUH 1SHXA 1A4KB 4OLUL 3K0YA 3HZVB 2AV1B 4EUPH 4L4TB 3CDGB 1T7VA 3C09C 1FRGL 5MEOB 2VWEE 1EHXA 1EJ6A 3J7HA 1P6WA 2FJUB 1IEBB 4GUPA 4FQXA 2ZKWA 3SDCC 3JZ7A 3SODB 5DA0B 5CZRA 3RJQB 1B0GA 1TJXA 1QVOB 3MV7B 5ICXB 3BUYB 5I1KL 1E9OB 1JMXA 3QNXB 1QA9B 5F21B 2NY1C 8FABA 2UV3A 4BZ2H 1YN7A 2QQLL 3ZX1A 1NDMB 2Q1EA 1B3JA 3KYNA 4HS3A 3QJQB 2IPTH 3BH8A 4JHBA 1MCIA 4LPCA 3G9AB 3BAIA 4XMLH 1X4YA 5DUBB 1OL0A 3BIBX 4OCLC 5DZAA 5ELIA 1Q0YL 2VRAA 1ONQB 1AIFB 4I1RA 2L7QA 3N40F 1Y1UA 3G5ZB 3TBTA 2GJZA 3HRZB 3U7WL 4AZ8B 1JHLH 1UOWA 4L37A 3P0VL 4G43B 3G5XB 1G5AA 3GS4A 3IMVA 1GPOH 4ABQA 5IBLD 4K8RH 1S4IA 3C6LB 1A64A 1BJMA 2EXWD 5C86A 4FXGB 2ZWZA 5LG1A 3IMRA 5F7HA 1FZJA 1KYUA 1NBQA 3S7GA 2GBAA 4UT6L 4I9WD 4XP6L 3U2SB 3SY0B 4NM4L 3TVMC 1HL4A 2F58H 3K4DA 3O4LE 1TVBA 3T6XA 4L3EE 1PAZA 4OFIA 1J8KA 3QNFA 2Q6WB 1DVSA 3B9VA 3SBRA 5E5MA 4F15B 4M7LT 5D1XE 4QGYA 2VLJD 5JXEA 1UACH 2K8MA 2F61A 2XV2A 1DQQB 2AEIT 4NQXA 3U7AA 2J8UE 1SLVA 3KXFD 2DJSA 4UTAA 2E7MA 5IVXF 4XN4A 3IDJA 2MKLC 2B4CL 5TFSH 4B9PA 4RZKA 1KCVL 1MJUL 2PCPA 3O2WH 2QR0A 3N1GC 1YDPA 1FC1A 2LVCA 3K6NA 1B4JH 3RZCA 2AV7B 1G6RL 1IBZA 4AEFA 4BDVB 4KMLB 4G7YH 3TEWA 1MNUH 5DRWA 1SJHA 1CLCA 2DL2A 2X1PA 3QCTL 3CFEB 4YO0A 1M05A 3CHQA 4H26A 3KPPA 4PJEE 1BBJA 3FU7B 4JFZH 1A6WL 2EDXA 4S10A 4XC3L 4XNZC 1HYRC 3GLEA 1SN2A 2YD8A 4MD0A 1EA9C 3QBTB 5CILH 4PTTB 3RAJL 2ZUYA 1AQKL 4K3JL 2AJUH 2W9EH 3TT3L 1FYTB 3LXCA 4FFYL 3GXUB 1XF3B 5FGCE 3APCA 4K7PH 5K9JH 3ZDZB 5CAYB 2XXFA 3I02A 3EF7A 3UTOA 3QFDA 4CBZA 4RFOH 5ADPL 1MCNA 4PRDA 3VFRB 1TTAA 5IK3A 3RRQA 4N0RA 5HTSA 2BVYA 2QVFB 3V0HA 3WHE1 3DXAD 2IAND 4Z7OF 2W95A 1RJZB 4C4KT 2YRPA 1OAXH 2XLLA 4ORGA 3BE1H 3HS8A 2XVLA 1OTUD 2CXKA 2VQTA 2JTYA 3WHXB 2H3XC 2WYZA 1G7JB 2Y07L 3Q1SH 1E4HA 5DWPA 4JRLA 3FT2A 2GT9A 1NGPL 2EDMA 3E6HA 2PWDA 4PJCE 2EKSA 3RILA 4N0FB 1BZDA 4JVUA 3TA3D 1RK1A 2GHWB 4P5MA 1S9KC 4MD4B 3FB5B 3K4ZA 2WVTA 1P5UC 1FIGL 2BO0A 2CRIA 3CFJA 4XCNB 4CADA 2X5PA 2YK1H 2PMZA 4ONGL 4B6ZA 2LE9A 3LRHA 4EI5A 5I28A 3VW3H 3OLDA 3UO1L 5DUPH 1WZMA 1G7QA 3FUIA 3ME0A 5DJZB 2VUYA 4WKZA 2HJFA 1SXZA 1XGYL 3QXWA 4L1SA 4TOYH 1QRND 3ZZLA 3PAZA 4G6MH 3K71A 5FGSA 4Q9RL 1UB5A 2XKNB 5LCVH 1N5YH 1JDDA 4F2MB 5KW9H 2VC2L 3IAGC 2BVOB 3KVQA 1WRFA 3S5LB 4K9EL 1PLBA 2WK2A 2OSLA 3AACA 1TR7A 4NI3A 4AG4L 2VZ3A 1GRWA 5ETUB 1E5CA 3MRNB 3S6CA 3E2HC 1YJDL 3BGMA 1L7IL 3D08A 3GI9L 4A38A 5FA4A 3MA7B 2YQ2A 4M62L 2V5SA 3QRBA 1R5WA 4OB5L 4NRXB 2EDYA 1XCXA 2PYEB 4N87A 3ZKNC 3GMNA 2D0GA 3R0MA 4OLUH 2OTUB 1EH9A 1MNNA 1AGBA 3K8LA 1I8IA 2ZX9A 4PV9A 3MV9B 3RWGB 2X0UA 4CILA 5AZ2H 2XXGA 5ICZA 1E8ZA 3CU1A 4LLYA 5I1KH 4E9LA 2OFQA 2CZNA 3BZ5A 2OYKA 5JIQA 1PKQB 7FABL 4R7VA 3ZE0E 1URZA 3NSDA 3UGEA 4MQXC 2BDNL 1TJHL 3ULVD 1AR2A 1B90A 3QFGA 3SCMB 4YSUA 3QUYB 2DD8L 3KLHC 2ITCA 4BSWA 1Q0YH 3JWNC 4HKBA 2CIIA 3ESVF 4WO4B 4YC2B 1OPGL 3U7WH 1XH2A 4D8OA 4B0MM 4L8CA 2YLKA 3GXMA 2NRDA 1CWVA 5I6NA 3OMZA 5EHFA 5C0DA 3LN4B 2H26A 3V55A 2JF1A 5E4OA 5JZ7C 3P4MB 3GWJA 3RURA 4FI7A 4UTAH 2VMCA 4UT6H 4ZI8A 4PH8A 4XP6H 2O30A 2Q2EB 4NM4H 2GB2A 1CS6A 4XP1L 3EHBD 4OZFG 4BQ6A 1JV2A 2Z9TA 2CE6A 1FPTL 1OF0A 1QKZL 4FFVC 5JHDD 4P2QE 3EJPA 1P7QD 4IIQB 5CHNB 4BEIA 1ET7A 1UH2A 4L8BA 4KOBA 4HHWA 2B4CH 3VG9B 3QZOA 1EHNA 1F8TL 1CE6A 5DQJA 3HHSB 1KCVH 1MJUH 5DMIL 3S0PA 4LMQI 4TQ8A 4DTGH 1NGYB 4QY8B 3OJMB 2VSCA 4Z7UA 3H7LA 4L2LA 5GSVB 1G6RH 3TP4A 2J55A 5C0EA 4HJ0C 1Q4NX 1T22A 3HAEB 5DUML 1V8HA 1YEIL 4DP5X 4E42A 4QEGA 4XC3H 1A6WH 1N0LB 4NX0A 5D1ZC 5HDOA 3RAJH 1MCKA 1AQKH 2QFRA 3TT3H 2AERT 4I7ZC 4MB1A 3BKCH 3IMTA 4FFYH 2QZ5A 3BC9A 4U0RC 1XSIA 1RZPA 2AK4B 2H9GB 4P23C 5B8CB 3R19A 3R8QA 4IGBC 3VNZA 5GGUA 4WZ9A 2HFFB 1KTBA 5DGQA 4P5TA 5FO9B 3DXAA 1GZHA 3FU3A 1P84K 1Z0MA 5M7QA 5ADPH 1MHEB 1B9ZA 4F58H 1N9PA 1KGYE 1SPDA 2AQ2A 3W5NA 2YMXL 1ORQB 3ZZSA 1CU4L 5I30L 3VYOA 2XZZA 3HPLA 1UQSA 2XTJE 4TUKH 4PVBA 4JS7A 5K1NA 4ZMYA 1EFXB 1ZLWK 5DU7A 3SO3B 3RWEB 1SEQL 3MKGA 1HTYA 3T6QC 1TCRA 2WCGA 1MSPA 3UTTD 4XH2B 4P07A 5EBMB 3BVVA 5T8IA 4A39A 2Y07H 3ILPB 4PJ8C 2BCKA 4H1LA 1UZ6F 1MW3A 1ZA6B 2IBGA 2EDTA 3KCPB 4MSWA 4PG9B 3QIUA 3DI2B 2A6DB 4ZUWB 3VWJB 4ZX6A 1E40A 4NHUA 4AITA 1KJ3L 5FO8A 5GGSA 4UQ2B 4JM2B 5MEND 1MAKA 2NXYD 3GSXA 4Z0XA 5DJ0B 2H1XA 3KG5A 1F3DH 3ZSTA 3H9YA 5SWQA 3P11L 4M8VA 4ONGH 2Z7YA 1O7VA 1J9QA 1QRNA 1HXKA 4MX7B 2C1PB 3UO1H 4CMHB 3C8KB 1S7TA 4TKWA 1FNFA 3T65B 2VLKB 1CR9L 1NC2D 1XGYH 4GAYB 4X6DE 1MFUA 2A74C 1XGTB 4AE1A 1WBZB 4YBLB 5IHZB 3LKSB 2WQWA 4XPTL 2EXYD 4YN3A 4DH2A 3GTNA 4Q9RH 3U9UB 3WAKA 3VRIA 3FQNB 5EC1A 4X7DC 3OX8A 3STZA 5HGAA 2IXQA 1DLHA 2K4WA 4YHIA 4AG4H 4MHHI 2HB0A 3BWUC 3EO0B 4M7ZC 4RFEB 1QFWM 2OMXB 5ACZA 2GVYA 3VD1A 1YJDH 2KC0A 1L7IH 4J3UA 2I07A 5C71A 2FEDC 3GI9H 1EHAA 4FQCL 3WNIA 1JZ5A 5H37G 4M62H 2FQDA 4BKLB 2X3CA 3B9DA 4OB5H 4MS6A 4Y7OC 3RWIB 5TF0A 1U33A 3KPLA 2A6JA 1AHWA 1EQWA 2AEQL 1HHHA 3L13A 5JTWA 2HRGA 2BNUA 1I3GL 4ZSOB 1IE5A 2C7UB 2ZX7A 3VD4A 3GF8A 3KZ8A 3F65A 4WFGD 3ARUA 4Z7NF 5AFAA 2F19L 1W0VB 3DX8A 4AYEC 2K1MA 2IQAA 7FABH 3QYNA 4U1NA 4LBEB 1T66C 1UCBL 5HD8C 1FZKA 1TJHH 3UAAA 1IAOA 3ZDZF 1F6AB 3OJVC 2BS9A 3VFVB 4P5KB 4F7TB 2EEAA 5T1LB 2BNQD 3P30L 2EDLA 1BYNA 2R9HC 1TJMA 1OPGH 2V2XA 3BAEL 1X5GA 4UQ3B 1JNHA 4HUNB 3KL3A 2H0FA 1YEDB 2GFBB 3JWNG 3ILQC 2DQHH 3T8XA 4LDOB 1R5VA 1VPOL 3BLPX 4BRJA 3B6SB 4N0CC 4POZD 1DVQA 5EO9A 5A3IC 4G8GD 3DX6B 5TGBA 4PTUB 1F90L 4AMKH 3MJ7A 1BZ9A 4RNRB 3N40P 4LT7A 2FJFA 2VB5A 3MZGB 3L3KA 3PPEA 3DJRA 1MCOL 3NRPA 3DYPA 1P7QA 1EDHA 4HKZA 4XP1H 3PGFL 1U6AL 1U3JA 4FA6A 3D2UB 1I75A 1VFMA 1AO7E 5AWNL 1FPTH 1QKZH 2WXFA 4LEXL 4DGYL 2E76C 1C16A 5F71A 3VXRE 5BJTA 3TJPA 3F7YA 1ZCRA 1V5JA 5GS1B 1IE4A 1YEGL 4PJGA 5HJDA 3QFJD 1HCFX 2RGSA 1F8TH 1I4FA 1JE6A 1F00I 4Y2LA 3OHXB 5DMIH 3WKNA 2X6VA 1NIDA 2WO2B 2F53B 3IDGA 1XWVA 5AALA 2XN2A 2B2XH 4Q6YA 4J3SA 3IU3A 2XWCA 4U0QB 25C8L 5DUMH 1YEIH 1PFCA 2WWKT 4FC3E 4HSAC 2J4WL 3C60B 3GKZA 3SKMB 3TBYB 5HGHB 4XCYA 4S1RL 3EYQD 3K80A 1TLKA 3UBXA 2BPBA 1JNJA 2Z1PA 3F2LA 4R2GD 5KN5A 3LVTA 1MFCL 4WGWB 4N2CA 4N1CA 4OJFL 5A2KH 4M3HA 2OR9L 3UJIL 2VMEA 3BFOA 4PB0L 2TRYA 1P6AB 2P1YA 4HGMA 1XB8A 1HHIA 1GY1A 3RKPA 1V3MA 4PWJA 2YXMA 5F9WB 1A4BA 1FE8L 5JPMC 1JDAA 1YMHB 1LK2A 2YMXH 4M4PA 1YY8B 4X6EA 1CU4H 5I30H 5FGBC 3AXLB 4FXLA 1G9ML 3TNMA 3UTTA 3BPOB 3O6KL 2F54E 3BMVA 3D18B 1SEQH 3GSVA 3FB6B 5MERB 4BWTA 5F9DC 5ID0A 4KZCA 3VD7A 4HJIA 2V5YA 1L6PA 4FA8A 4CJ1A 4WHTB 4GXUM 3UXFA 4UANA 1KDIA 4Q8BA 4U3SA 3O9WC 1A3LL 4HDIB 4PJXB 5B1AB 2A4EA 1EZVX 3TLRA 2IAMD 3LQZA 2HT4D 1J0JA 1OW0A 1VADB 4RDQF 2QQKL 4NKDB 2V3FA 1JZ8A 4IBSA 5I1AA 1JPTL 3TC9A 1S7UA 1CZ8L 1MHPL 3P11H 4X5WB 1NC2A 3FOMB 5LNGA 2H0PA 3F7RA 4ABVA 4W9ZA 1P7KB 1CR9H 1ROWA 5FECA 4PV8A 5KJRH 4DESA 1BJ8A 2BZ7A 1LD9B 2WKLA 1GW0A 2PWHA 4N25A 3RI5K 2GIMA 4XPTH 1XMWA 1LTXA 5I1IL 2R1WB 4JPQA 1HINL 5DD5L 4HJSA 2BIQA 4QOKE 2LU5A 4B5EA 2XQBL 1V3LA 3CXFA 4S1QL 4AYSA 4QI3A 4J3VA 1GGYA 4FXKC 1OIOA 1BX2A 4HIXL 5IROC 4OGQC 3T2NL 4FQCH 5E1GA 4WK2B 2RFXB 2VZOA 2Z93A 3CFKB 3W56A 2X42A 5JNYA 1FVDA 3Q44A 3JV4B 5L8KB 1DQIA 4RFNC 1PCSA 3FFDA 4FL4B 5DJXB 5F9OL 4QHLB 2AXHA 2P80D 1HN1A 3VNYA 2FYYB 3AXHA 4KK5C 4W9KC 4QRRB 4M3JA 4HZAA 1I3GH 1XF4A 4P5RA 2K0RA 2F19H 1BPVA 4CVWA 2IMNA 1U8CB 1K9TA 4AVKA 1A6ZB 1UCBH 4ZAKC 3U2IA 2BNQA 1N3NA 3SBWC 4ZUSB 3L4VA 1HCVA 3C2AL 1HQ4B 2QFPA 2G9HB 3FO2B 4XR8C 5L2KD 3P30H 4MZ3A 1ZHBB 1IKNC 1NAMB 1SOKA 1X7SA 2NTFB 1SQ2N 4HIEA 4OIFA 5A40E 4IKJA 5DK2B 3BAEH 4QYOA 4MMZA 4NEHB 5IJVB 3ARED 1KJVA 1PS3A 3NTCL 3PL6D 1TNNA 3IGKA 3UTZA 3GEFA 1VPOH 4NC1E 2WXHA 4NKQB 4R7NA 4LVNB 4WUKL 3QULA 2YUWA 3RWHB 3KPQB 4ZUUB 4OR1A 2B59B 3BFWA 3B2XA 4M8QA 3G08B 2V8LA 4XTRD 1FJ1B 1CLZL 1MCOH 4LLWB 4PLKC 1WZ1L 3GRGA 3PGFH 4Z77A 1U6AH 5BOPA 4H25A 5AWNH 3QDHA 2APSA 4KU1A 3QFJA 4LEXH 3TN0D 3TOPA 4DGYH 4F7CA 1SXNA 1HNYA 1T0NA 3QI9D 1CMOA 4Y8AA 4PP2A 2EKJA 3E6FB 2J6EL 3L7EB 2IGLA 2LQRA 3EJZC 4K55A 5EU3A 1YEGH 3MRCB 1TFPA 4R4FL 5FO7B 1ZTXE 5BZDA 1R46A 4N2AA 4U33A 2OJEA 3C6LC 4YDLB 2X3BA 3X1EA 2X4NA 1CDUA 4XNMA 4CN4A 4PFEA 2CUMA 1M3IA 4NPJA 4PJ7B 2VDKL 1E28B 4X4MA 4FLOA 25C8H 4AQAA 4BSVB 3WJJC 5T5FA 2J4WH 3MRQB 4S1RH 4OW6A 1UWFA 2X12A 4DPCX 3QUKA 1LXMA 2Y6SC 4F15C 3GLZA 1RMFL 3CDFA 1MFCH 1ETZA 5EDXA 3H0TB 5HHOE 3KBHE 4FNRA 2BMKA 4OJFH 3D3VD 2DKUA 2OR9H 4NO5A 1NGXB 3ZOAA 3UJIH 4LVEA 1P2CB 3KYMB 3OXRB 4PB0H 4XMUA 3T1WA 5BQ7A 1EGJA 4K5PA 4ZXBD 1TQVA 3VFTB 4MXVE 2X70A 3MLTB 5D2LB 1KXTB 1FE8H 3UAJA 2G0LA 4XO3A 1VCBC 3DVNB 1RU9L 1ZVYA 1WBXB 3GXFA 4H20L 2NCMA 2A83A 1G9MH 5J06A 1REIA 2F8IA 5A6IA 3APFA 3DJTA 3U82B 2D73A 2YGVA 1LP9F 3LMJL 3BIKA 3CFCL 5FYJU 5TDPB 2XPGA 3WTYA 1E4KA 5GS3A 2DWXA 2V5MA 1VEPA 1NBCA 3CFDA 4F1SA 3FF7A 4JDZB 2OZNA 1A3LH 1ZD6A 2WNXA 3OZLA 5FYLE 2IDTA 4IQHA 5IQ9B 2QQKH 4KHTL 3DIDA 5C0JA 3JSSA 1SXSA 4YAQB 4ZW3A 1CZ8H 1MHPH 4GKSB 2H3KA 5DMKA 5C9KA 4Y88A 5BRZD 4PJ6A 3VFWA 4UOW1 3WO4B 4N5EC 4AT6B 4DCQA 1UOLA 1A8JH 2P42B 3RFRA 4FI8A 5IMMA 1F4XH 1FORL 4KKCC 3BW9A 2B1OA 1IFHL 3QZNA 3QUMA 4LU5L 4U1GB 3UTSD 4HOMA 2QQQA 3VXQB 4B5ZA 1S7XB 3Q2LA 5C07B 5LJYH 5I1IH 3WN5A 1HINH 2OMVA 2Z0UA 3DYOA 5DK0A 3U46A 2ICEC 3V5DA 2HPOA 3V6OA 2XQBH 1NCCL 3WHE0 2WXKA 4S1QH 1W8NA 1F1DA 2XQYA 3NZSA 3ZE1E 4LF3A 3T2NH 4EXKA 3FCSB 4GRWF 3DROA 4F8QA 4RAHA 1NGQL 4Q52A 3IDNA 2P80A 2WY3B 3WXWL 3TWYA 4OI8A 4LPWA 1K5WA 4PYHA 2LR4A 3O3UN 5F9OH 4HLZH 3S37L 5D6CB 1KELL 4Z7VF 2YBRB 3IKCB 1GOGA 1KGUA 1LE9B 5E6IA 2EVFA 2V3DA 4B41A 2J1WA 4AEHL 4L29B 5FYKD 2FX7L 2PP9A 4OF6A 2A1WL 1L3NA 2Z3FA 1NGWA 2FLBT 4X50A 5ITBL 4ZX3A 3AZUA 1XF1A 3CQPA 1CIDA 4QT5A 4S0HA 5KSBA 1MQ8A 1YPZA 3ROOB 3WEAA 5L2KA 3WIFB 1BAGA 2NZ9D 1R6VA 2Y1VA 3C2AH 5GZNA 3QUXB 3FTSA 1D7BA 4ZX4A 3CLFL 3PL6A 3TGXA 3MRMA 4WSGA 2C3VB 3VX1A 2V33A 3X13B 3VYPA 3ZDYB 2KZWA 5CM1A 1OGAD 1R1CA 3QORD 4LO9A 4XPFL 4AYID 4YSTA 2Y9RT 2D7OA 1ZK9A 3NABL 2F74B 3SDYL 5IEKA 1Z5LB 3NPZB 3M7FB 3QG7L 2X1QA 1MCSA 3B2UD 4WUKH 3D85A 3L5WB 3CG8A 1JIBA 3KS0H 4N8CL 2ZWNA 2XPZA 3LKOA 1ZT7A 3IE9A 3TN0A 5CU9A 2OXHB 2JNZA 4QXTA 3QI9A 1CLZH 4XNAA 5DJ2A 2N1TE 3LXAA 3SCMC 1WZ1H 4TLSA 1MI5D 4PS3A 5KTEL 3RYMA 1NBZB 3IGUA 4FFWD 5BS0B 1DVFD 1XTLA 1BBDL 4WO4C 1X5LA 1YEKL 2J6EH 3WELA 4EDXB 2G2RB 2X38A 5CBEB 1IX2A 1FZMA 4TNWK 4R4FH 2X4OB 1I1AB 3W5MA 2QPDB 3ARFC 2HFGL 3A4AA 1DLFL 3B5GA 3TS8A 5J1AA 3VXMB 1QSFB 2VKXA 1OY3B 1X4ZA 1WF5A 1U58B 2B7DT 3MLZL 4FFZA 3QHTC 4ZMOA 3IN0A 2M83A 3BDBA 2VDKH 4CBPA 1CFTB 2WVVB 3HFMH 3I6GB 4JR9L 4M4RB 4NCDA 1U8JB 4JNXA 3GSRB 2VL5A 3N85H 4GEJA 4WTZG 2W8CA 3KYOB 3VFOB 1FYHB 1VZGA 1KTLB 4AJWA 1NA8A 4NFCA 4W9HC 5H94A 3JUYA 1JI1A 3WEMA 4EI0A 3AAZB 2P8PA 1RMFH 1CT8A 5E8PA 4BH8B 4H0HB 1I7UB 3AFLA 4IIQC 3AQZA 4XVTL 3KWUA 5I5MA 5HJGA 2AK1L 2VAJA 2NNXA 1YNTB 4WIQA 5ABZA 3MLRL 3OM3B 2WXIA 1DJIA 4PI0A 2JKNA 3Q9PA 1V05A 3TIEB 3VG9C 4U1SB 1T20B 3H1ZA 4AIZA 3QIWD 3HUJB 2DOCA 2R2BB 1QPPA 4KH9A 3BQUB 1W72A 4OF3A 4QHNB 4ZMQA 2ROYA 1BZ8A 1RU9H 3IRPX 3KPMB 4JB9H 4PVNA 2HN7B 4FTVB 4MD5B 3TFBA 2N01B 3L8QA 2BSTA 1NEZA 3LMJH 5FFLA 2BHFA 3CFCH 3VI3B 3WFBL 4DO6A 3SZ6A 2VOTA 5EU5B 4M9PA 2FJSA 4P0DA 5B8CC 1MVFA 2W60B 5KOMC 4IRSA 1BQHG 3GRBA 1ZHNB 3FHAA 3C9NB 2HRHA 2C7FA 1S9XB 1CFQA 4NUGL 2WLZA 5IM7B 5BRZA 4YQXL 1SJXA 5HI4D 1OKEA 4KHTH 3CC5B 3VXUB 2MNWA 4MNHA 4MYWB 5F8RC 1A2YA 4HG4K 3UTSA 4GUOA 3BP5B 2ICWI 3JV6B 2AS5M 1A1NA 4LHUB 4ZTEA 3SO3C 2ZP0T 4GG6B 5LAPA 4GQ9H 1QEXA 1UJ3B 2GK0A 1I8LC 1FORH 1HDMA 4TUOB 1IFHH 1AD9A 3SYAA 4QTFA 1FVEA 2QPFA 2LGNA 3NGBC 3DUSB 2OS7A 4ELMB 2V7HB 1ACCA 5J5EA 3O3BB 2BH0A 3QXTA 4JJ5B 4ODVL 5SX5H 1IAMA 2GCYA 1YEHL 3VWJC 4LVHB 5FYKL 2ZCHL 3ARGB 4JM2C 2DQDL 4BFJA 5CJOL 4KTYA 3S4SA 2LFGA 4JFUA 4A6YA 2FB4L 4U3XA 5LNEA 2F8VA 1DUZB 5HYSB 1IEHA 5EUOF 1NGQH 1XGUB 2IGTA 4RMUA 1QFUL 1OD9A 2YAQA 4A67A 3WXWH 5EU7C 2PO6D 3TEZA 3QQ4B 1DBAL 4B96A 2B16A 1PY4A 3S37H 1ED3A 4EN3D 4Z0BH 1KELH 2G4EA 2WLLA 1ZLVK 4FOMA 4EVNB 4YBLC 4PJ7F 2WANA 1QLEL 2ZXDA 3CBJB 4J3OH 4JFOB 2F8XC 1Q72L 1NCGA 4RQQB 4AEHH 2LU3A 3KCWA 2IH3B 4DN3L 2Q8BL 2FX7H 4KKNA 2A1WH 4I9WE 5ITBH 4I3SL 1BAWA 1TQBB 1QX1A 3BAYA 1L5GA 2E9GA 5DFTA 4QJ4B 1TTGA 4YPGB 5HHMB 2PCFB 3I3DA 4LAQL 5A43C 4JN1L 1OGAA 1U92B 2VLJE 4TULH 3QO1B 3FQUA 5TH2B 5ACLA 1RCYA 3RTQA 3CLFH 3CBRA 3TPKA 4P46D 4FKKA 1MIEL 3AWFA 3DV4A 3O6FD 4P2AA 4Q74A 4D0DB 3ZR6A 1CG9B 4UDUB 3KMDA 3GIVA 1PGRB 5JA8B 3NABH 3SDYH 2EYSA 5IMLA 5D71L 5ABAA 1BV8A 3QG7H 1UVQB 1P4LA 2BRQA 4N8CH 3QXUA 4Z7UE 2P28B 3MSPA 4GMSL 1FH5H 4MHHG 5EBLA 3HE7B 1XH1A 2ATPB 2R0WL 2DICA 3MRKB 2I9LB 3KGTA 4P2RD 5KTEH 3L3JA 3ZLQC 3D4CA 3DC0A 1WQVT 4YNYB 3CLWA 1ZJBA 1BBDH 1WIPA 2GSIA 3X2QB 1YEKH 3ZMNA 1YC8A 4Y2DA 1TQCB 2DDQL 1MH5A 5F1IA 4JEGB 4BZ1L 4RLDA 2LLGA 4ZMPA 4GP4B 1N5AB 4Y9EA 5KVDL 3AS1A 2HFGH 3VXOB 1DLFH 4JO1L 1N70A 3MLZH 1HQRA 3DXAE 2DB8A 3QDJB 4OD2B 4BA8A 1WIOA 2ERJB 4I1PA 1KV3A 1CYWA 3MREA 1L0QA 3MBEC 3W3BA 3OWEA 3WJLC 1IGJA 4ZFFB 2GTWB 4JR9H 3D7PA 2MHAA 2WAHA 3IETB 1PNDA 2GITA 5CGYC 1S7WB 3FAXA 4Y0GA 1EEYA 4JW3A 3QIWA 4XVTH 2JK5B 2DBJA 2VMJA 4KK6C 5EIIG 2AK1H 2VXQL 2DLTA 3KEDA 3QRGL 1AQDB 4N0UB 1RZKL 1BM7A 3QXVA 3MLRH 4PJIF 5EUKB 1NDTA 4O5LL 4G8IB 5BXFA 2PN5A 5F7YC 3OHXC 2QBWA 2M2DA 4IYKA 1MCBA 2GTZB 2VLLB 3MRRA 2H5UA 3PWPD 1W0WB 2P26A 3VGAB 1YY9C 3GMLA 4DSYA 3FB7B 4O02A 4L8SC 2OMTA 5C2UB 3SPGA 4RX4D 4XNUL 5GRVL 3HRPA 3EO9L 1QRNE 3QNYB 5DJDA 3C60C 3T77A 1J8SA 4WWID 2R27A 4AYDC 3O3EB 1UWXH 1TKWA 2A73B 4JFDD 3WCYA 4PJHB 1QBLL 4J3WA 1SF5A 5HJ3B 2XN9A 4A2FA 4GRLB 1N8ZB 3MRLA 3I84A 4NUGH 1GA2A 1EERB 4YLBA 4M1CD 5T33L 4YQXH 5MI0B 2ITDB 3N1PC 5DLML 5F9WC 2P9RA 2UZIL 3QZLA 4GMTL 3GZOA 1WZKA 3D33A 4JE0A 1KYAA 2KPNA 3BPOC 4LZKA 3H9SA 3CFBB 4H44C 4MB3A 3QXDB 3PXJA 3O45B 2NW3B 2BHZA 1TIUA 5ALCL 2DM4A 2XIDA 5IHLB 4NNXB 4BFBD 1XV8A 2I32A 2PPCA 3B2MA 3RHWF 2V7NB 3RDTD 1KJMA 4ODVH 1IQWL 2AABL 3TO4D 2WQUA 3FQTB 3MGAA 3BAWA 3W2DL 4R5VA 1YEHH 2Y3AA 1M42A 5FYKH 1K72A 3ULVE 4PMEA 5CR1A 2DQDH 4XP5L 2QDWA 5CJOH 5K1JA 2WTPA 5DLLA 3TBCA 4JY4B 2PO6A 3MNMA 3VMNA 2FB4H 3MX0A 4YHNB 3OKNA 1IAKB 3N91A 1ECZA 1QFUH 3O41B 4HMDA 4JREB 4X7TB 1RSYA 3T0EB 2UWEB 4MBRA 1UXWA 4JZJA 1ZSHA 3JBG7 3RWFB 3WKML 4DPBX 1QLEH 1JVKA 1Q72H 2CJSA 3FCTB 4NO2B 4QXGL 1S7SA 2X0VA 4PGJA 1OGTA 2WIMA 2Q8BH 3V5HA 3ORJA 5HI5C 1E6OH 1JPSL 3EUUA 4FQLL 4I3SH 5DRNB 1FNEB 5IB2B 1JZ2A 3BEVA 3OAWA 4WHYG 3LKQA 5JHDE 4LAQH 4Y5XB 3KWWA 4NN5B 1YNTF 4JN1H 4YSOA 2YAFA 1FSKB 5K9QI 2WOBA 2R56L 4R96B 4X9YA 4IRJB 4WRLA 1MIEH 4XX1E 2PTTA 3FMGL 3HB3D 3LYRA 4AQOA 2CHNA 1XSKA 3GSQB 3HZMA 2BWDA 4G6AC 4CUCA 1XMEB 3ULAB 5E8OB 4PJGE 5F7EL 3D12B 5D71H 5C0ND 2XG5B 2YAMA 2YPLB 2BSCA 1P7BA 2V3EA 3L1OH 4UIKL 4PRHD 3UOAB 3KPSD 4P2RA 3VI3F 1W91A 4MAUL 4GMSH 2EH8L 4JRYB 3SGKA 1KG0B 1KB5A 1EPFA 4F7PA 1OF2A 4ZW6A 2H2PD 4E9XA 1UURA 4H8PA 4G8EA 3CAFA 1UTDA 3CVHA 4RGNB 4LPVA 2RALA 3BZFB 3RUGB 1FUNA 4NOFA 5I1LB 2MWCA 3EH3B 2DDQH 1XXDC 2NY6D 5E9DB 4BZ1H 5IGXL 1GXEA 1WTGT 2A9DA 3BEWA 4IRZL 4QRQB 3ZDXE 3RGBA 5KVDH 2FVNA 3IRZA 4JL2A 4JPIB 4YGVB 2FECL 4K9JA 4C58B 4JO1H 4GG6F 1RZJL 4DP8X 2NY0D 4LVNC 3FQWA 5D1QB 3IVKB 3BUIA 2MTAA 2Z35A 4TMPA 2EVGA 1PLGL 3ARDC 3HBPA 5CXPA 1A8ZA 1TCMA 4LCUB 4MAYD 3WFEL 4B9YA 4ELMF 3B7UX 1THCA 1MREL 3HE6A 4ES9A 2ZSVA 5FF6B 3UTTE 1Z9SB 4GRMA 4PRIB 2R1YB 5IBUB 3Q1EA 2AVGA 5DJAB 4X7SH 5JIIA 4PG2A 1IBHA 2OTWA 2OL3B 1CDGA 3D6GA 3H3BC 4JMNA 4PRAB 3US1A 3QRGH 5D7JD 4JMXA 1RZKH 1R3HB 4DUWA 4O5LH 5E5UB 3IJHB 1UXSA 4JRXA 5EU6B 1I7ZB 1MQKL 2WW8A 5MENE 3MTXA 4OQTA 4UMGA 4YDLC 3FUDA 4X6FB 5FUCC 4ZS6C 3GUTA 3DBXA 4UM8B 4EI6B 1M7DA 1JXDA 5G5DA 4GBXD 4ZMLA 1F11B 1OB0A 2M26A 3CSYB 4OBSA 3T1FB 3DJSA 2EVJA 5BMFL 2XN1A 2OMWB 3IDXL 5AW1B 4XNUH 1A9BA 3Q6FA 3VXSA 5A2BA 4WWNA 1DDTA 2Z64C 2ZOUA 4KHXL 2VSKB 2IPKA 2ZOLA 2BFGA 4D0BB 3V0JA 5ISZD 1MFBL 1JXJA 5MEPA 4OV5B 2FDBP 5LXGL 1QBLH 4HKJA 4U1MA 2N0KA 4YZFF 3RWDA 2ADYA 3RDJA 5DMGC 3TBSB 3EYUL 3ASOB 1DN0A 4FI6A 5A2LH 5T33H 4AENB 3SKOA 4CC4C 3WNKA 3I75A 4GMTH 4Z76B 3QG6A 4I1NB 1TZHA 4H0IA 4QRSB 1K4CB 4QCIB 3PGDB 3W81A 4Z8FH 1KBVA 1KJ2L 2BIOA 4MNQB 3BP6A 5DVKA 5CKAA 4J2XA 5MEQB 2R1XA 3M1BB 5CEYB 4MAZA 5B3NA 5I76A 1OSPL 2W59A 3ZVVA 1D5IH 4Y2OA 4WDIA 4MQ7B 3RDTA 4PR5B 5ALCH 4DN4L 3HS0B 4E9RA 1T89A 4Q6IA 3US0A 2HTKC 4MS8D 1AKPA 1UWGL 3T04D 4DOHE 2R2EB 3BSZA 4WFGE 1QFWH 4HUCA 1EJOL 1IQWH 1JF5A 2AABH 4WW1A 3EADA 3H9ZA 3QS2A 1T1ZA 4X6CF 5DR5L 2P5EB 1AZVA 2VZSA 4HUMB 4TM9A 5AG8A 4XP5H 1E2ZA 1U8OB 4I5BB 4RAUA 4ODXB 1JGDB 4LLMB 3GMPA 2WINA 2BP3A 1Z66A 4QRTB 2BNQE 4NQDB 3FQ4A 4LCIL 3WO4C 3KE0A 2TSBA 3Q01A 3RGVD 5L6YL 4KKPA 4G8FB 1A4JA 1F3DJ 4I77L 5DC4B 2NUPB 3IWUA 5TJWK 1ZDSA 4MMYA 4U1GC 3EJYD 1TQUA 4F7EA 3WKMH 3F00A 4TNVF 1NC4B 3PV6B 4L5FL 3AJ7A 1HILA 2G4GA 4OF8A 4QXGH 1GHFL 1HEZA 4A7UA 5CF3A 3B5HA 4AK2A 5EO1A 1MUJA 4XCFL 2JCWA 3K6FA 4E0RB 1JPSH 4NCC2 5IBTL 4FQLH 2L7EA 4ANUA 4UOW0 4QMEA 1UA6L 1F58L 1E27B 2BP0A 2VLMD 4LKXA 4F27A 3GJFK 4D9QD 2UZXA 1ZHKB 4OKVA 3IDUA 3MNZB 2R56H 4WI0B 1ZAGA 5FKPA 1GYAA 3K8KA 3EOYG 3N44B 1EUUA 3BT2H 1YEJL 3FMGH 3QFJE 4UOQA 3SPIA 5L9DL 2FRGP 2HFEA 4KAQH 1ZS8A 1ZE3H 1J1PH 5KSUA 4LHJB 5F7EH 2WTRA 2AGJL 2HKHL 4LSUL 2P5WD 3APMA 1URLA 4X5XA 4UIKH 1ZLDA 4HPHA 3BP4A 3SDCD 4N1EA 1KLGB 3LS4L 2VR9A 1T83C 4AYFA 2EH8H 5I71B 1MFMA 4PJHF 4X4ME 1K5NA 2NY1D 3BOVA 3WD5L 1NMCC 1VSCA 1ZOXA 3IFLL 3NQIA 3QUXC 2HJKA 3DLQR 3BZ4B 1T80A 4XHJD 5LBSL 5DHMC 4NQTA 3NCEB 5EFIA 1ES0A 1NMAL 2X4TB 1U3HA 2WO4A 2XJKA 5IGXH 1JNLL 5E08L 4IRZH 4PVMA 1U93B 1U41A 5KYWA 4MAYA 3C6SB 1GC1C 1NIEA 1F4YL 4CSTA 1RZJH 2B8OT 3AUWB 3KD4A 3MROB 5KSVA 3C8HA 4M56A 3EXLA 2NZIA 1G9EA 1JERA 1RUAL 2X09A 1YMMA 1PLGH 3HMXA 2E9BA 3M45A 4P2OD 3V5KA 1FL5A 3WFEH 2H0EA 3MCLL 4LCVA 1WFUA 4Y1TA 1MREH 1GYCA 5B38A 3V6FA 2P4AB 1W0YT 4L2YA 1GZQB 5D7SL 5D7JA 5T1JA 2AVFA 5DHVB 1QWUA 3TVMD 1HH9B 4RZCB 2H8PA 2XCMC 4L3EB 3ZTDC 4OLVL 2NY3C 4GBXA 4WQOA 1MQKH 3V4VL 4Z95H 2J8UB 2ZP9A 2GUYA 2RD0A 3MGTB 1FO0A 4G7VL 1AGCA 4AM0Q 3UERA 2HYMA 5E00B 1ZEAL 2NX5A 2UWEF 1XR8B 2OXGB 4JZOB 2HT2C 5AVRB 2VERN 2W38A 3N55A 4N8PA 1NTDA 4QF1B 4NUPA 5BMFH 4HIHA 1XGZA 2FTAA 3IDXH 4GLRH 3VM5A 5F7WC 1FNHA 1NBVL 5HHPB 5ISZA 4WI6A 5J6SA 4AQZA 5DVLA 1VA9A 5AZUA 2EJ1A 4KHXH 2TSAA 2H32H 1O6SA 5FOBA 1FN4B 5LXGH 4GQPH 4PGBB 1JS4A 3GTTA 2KERA 4GAFB 2VJXA 2VABB 4GW4B 4ZYKB 4PRPA 4ABUA 1S46A 4ZFQA 1KF9B 2KBGA 1YEFL 3EYUH 5GGRY 2CLZB 3BQUC 2BXYA 3FT9A 1PJWA 1AP2B 4IEFA 2D3LA 3LN5B 1FA4A 1FV1A 4HF5L 3N2JA 1KJ2H 1KZYA 1YAZA 2VUKA 4R3SB 3LKRA 4UV4L 1OSPH 2CUAA 1ESOA 3DRTA 3ECQA 3DMMA 1A6VL 4DN4H 5EIQA 2XWTB 1OGSA 3LV3A 4FAAB 2WBJD 3HN8A 3GSWA 1QQDB 4U1IA 3P2TA 2QLYA 1UWGH 3HFFA 4G9FA 4NQCB 1ZVNA 3VDCA 4HUWB 1EJOH 2HJLA 4QAMB 2KZ1B 4HZLB 2UY6A 3RU8L 2QT6A 3VQMA 5JQIB 4HH9A 5DTFA 3IFNL 2G30A 1RVFL 4OZHB 1JNNL 3T2LA 5KSBE 1YPZE 5L2KE 4PGCA 1NFDA 2JJWA 4R7DB 2YQ3A 4KDTA 4LCIH 3VRLF 4NYLB 5L6YH 3GXNA 1CGYA 4I77H 2ALAA 4LXFA 3NFPA 1LGVA 2YZ1A 1RKRA 2ZUXA 4KJWD 4HXBH 1RFDL 3ZDWA 4L5FH 5E9NA 4NZDA 4NQEB 2ID5A 5IVZA 1GHFH 2JQZA 5I6LA 3LZOA 5CNHA 3WKQA 4XCFH 3QJSB 1U8PA 5IBTH 4LVHC 5GS2D 3CZKA 4JY6B 1A9EB 3BPCB 3ARGC 5B1KA 4N2GA 2Q86A 1UA6H 4ONFL 5DI8A 1S7RA 4CN6A 1YYML 2QELA 3TH4T 3W9DA 1MWAB 1Y6MR 5FEBA 3RPIB 5I8OL 3WFCL 3L3DA 2V2TB 2OSYA 2TRHA 2BJML 4DVBA 1YEJH 5L9DH 3MQIA 1IM3A 4LCCB 3ZKND 5IWLA 1IC7L 2HT3D 2BVUA 5B4MC 3SDCA 4GSXA 4NZFA 4PY7B 4YSCA 3EGXA 2AGJH 4HV8B 2ZOWA 4NP4L 1QTSA 2HKHH 4WWKB 1K4DB 2OZ4A 4I2XB 4LSUH 2I25N 3ZR5A 4G70B 1VGEL 4MWFA 1LO3L 4KROB 3LS4H 1NINA 3RX9A 4GRWH 3D07A 1Q94B 1U3YA 1IZJA 2BY1A 1S9VB 2IBZX 4FNPA 3WD5H 3IFLH 2OCJA 4IW4C 5C0BD 2NW2A 3UPRA 4MQXD 3UIYA 3D3VE 1YO4A 1AMXA 32C2A 2WLJA 5LBSH 1C08B 1H15A 5JW4Q 1NMAH 2DI8A 3GZKA 4MDJB 1ML0A 3KLHD 1KENL 1AJ7L 3OAUL 3ETBF 1SRDA 2GJJA 1QBBA 1JNLH 5F7DA 2B5IB 2APTA 3FTYA 2ALWA 2OTPA 3S96A 5KUKA 1NOFA 2VW7A 2Y22A 35C8H 3DGDA 4PJ9B 1DVZA 1F4YH 2W65B 3D69A 4X9IA 3DIFB 5KANI 4WU5B 4LNRB 1S8DB 3QWOA 2DQMA 1VFUA 1RUAH 4NT6B 4UI2A 1WPCA 4KVPA 3HE7C 3MCLH 3VI4B 4DAGL 5JZ7D 4M8RA 3JTTB 4ENEC 1IJ9A 3TVMA 1KEGL 1F6LL 1QHOA 2J7LA 3AABA 3OC8A 5D7SH 1V27A 4Z78A 4RDBA 1MIML