3Q9QA

Hspb1 fragment second crystal form
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
82
structure length
77
Chain Sequence
SHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHAARYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock protein beta-1
publication title Three-Dimensional Structure of alpha-Crystallin Domain Dimers of Human Small Heat Shock Proteins HSPB1 and HSPB6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 11
structure length 77
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3q9qA00
4RZKA 4ZJ9A 4YLCA 3GT6A 2N0KA 3Q9PA 3VQMA 1WFIA 1RL1A 1WH0A 1X5MA 4YLBA 4FEIA 1GMEA 3L1EA 4PBDA 1WGVA 3Q9QA 3L1FA 4JUSA 2KMWA 3L1GA 2O30A 4M5SA 2Y1ZA 4M5TA 2Y22A 2N3JA 3GUFA 3QORC 5LUMA 2BOLA 2XCMC 2CG9X 2WJ5A 1EJFA 3VQLA 3QORA 3GLAA 3J07A 5DS1A 4YDZA 2Y1YA 3IGFA 4MJHA 2WJ7A 4JUTA 3AABA 3W1ZA 3QORD 3AACA 5DS2A 4PCKA 3QORB 1SHSA 2RH0A 4ELDA 2CR0A 4YE0A 4I88A 3EUDA 2K8QA 4YL9A 2MNWA 2KLRA 3N3EA 2JKIS
chains in the Genus database with same CATH superfamily
1IGIH 3RWDB 2QQLH 3HC2A 1XF4B 4WFFE 5I17B 5J8OA 3T0XA 1FPTL 3UMNA 5EIIA 1OALA 1IILE 1JRHL 1V3KA 3BWAA 1MDTA 3EGXB 5IBUG 1M7IA 2VDQB 2Q7YA 5HYJD 4FZEH 3K2MC 4JO1H 3GUFA 4AMXA 1XV8A 1UD4A 4U1HA 4HZLB 3WN6A 2OMXA 5E9DD 2UY6B 4JY5L 4L5FE 3D1MC 4TNEA 3U4EA 4F92B 2CQVA 4J3WA 4JM2F 3O2DH 2CBMA 4YSCA 3QA3B 2A6DB 5DZLA 4ZFZA 4ELMF 2PPCA 1SDDA 3T4YB 4GKNA 1F11B 5GGTH 5B8CA 4K3EH 1XD1A 3SGJC 4EI5C 4FJ6A 4NAMA 3NA4A 4JO8A 1MRDH 1O7DE 3ALPA 5EBWA 5D7JD 4BA0A 1C08B 4X7SL 5D1ZB 3D06A 3WSQH 1GGIH 5T5NF 2PXYC 4YNYB 1D5BA 2O6FA 4N0UB 2H32B 1ZA6A 2FEDC 1E3ZA 1W6WA 5D2NC 2GC4C 4JPVH 3MQIA 1XH1A 4QF1B 2W91A 4XP1H 3P0YH 4KY1H 4P3DA 4MD5B 4TN9A 5D2LB 5GSRA 5JIHA 3WN5C 4RISH 4XO3A 3W11D 4BUQA 1YNTB 3R4RA 5FHBL 4ATTA 1P0SE 2VLRD 3O2VL 4KJYB 2YPLE 1CN4A 5GQBA 5DF0A 2LV4A 1MELA 1LP9A 1NWPA 1TEFA 2OYKA 4AQ1A 2HT4C 4BSVB 4KMTH 5I30H 4JX0A 3L7EB 4FQXB 2JSFA 4QCIB 3REWB 3NCFB 2FGWH 2WQ8A 3IETB 4F7MA 3DX2A 1PG7X 4WNQB 4DPCX 2APFA 2VGLM 3CNKA 4APXA 3P11H 4KQ4H 2W8CA 3WTTA 5K9JH 2AMGA 3BFWA 3VXTB 3VGHA 2NY6B 2NY0B 4YSOA 4R2GD 3W9DA 5GIRB 3RL1A 4NENB 1K6QH 1LO5B 2X3AA 1GW0A 4CMHB 1JAEA 3QDMB 4N6QA 1E5CA 4OZGB 1I1CA 1WA2X 1YECL 4GSUA 1KXTB 1V27A 1XHHA 1NTDA 1UA6H 3G6AB 3HNTH 4FNQA 1PG7H 1A3LH 4LSSL 5AOIA 2YKKA 5KVGH 4P2OC 1X44A 3BUQA 4JHWH 4TNVF 5LCVA 3QHFH 2MQGA 2XWTB 2DV6A 4HK0A 4JQIL 3V52L 4ILDA 2HUEA 3ARBC 3QJOA 4BFOA 3PU7A 5TE7H 2YAQA 4GB9A 3V0JA 3RI5K 1J8KA 5JQ6H 2BP8A 4NC2B 4P07A 5HDOA 3ULAB 1E4JA 4U1GC 3PJNA 4GP8B 3SOBH 2DWDA 3MRKA 1G9MC 5CP7B 1P2CA 1DR9A 4X6CE 4QRAA 3S8GB 3RIFK 4R8WL 1KWKA 3HC4H 2Q7NA 4OZGE 4PJGE 4JM4L 4KC3B 2XWCA 4G8IA 3U1PA 1JXDA 3B1UA 3QI9B 4XNXL 2I24N 3QORB 2DQDH 2W92A 1XO8A 4LF3B 4YR6B 1FL5A 1AQ8A 1QFUL 3IMRA 3ZHKA 4FLHA 2E46A 1JK8B 1UUSA 3WY4A 4ZJ9A 2OBGA 5FYKL 1AHMA 1NCIA 4AE0A 1CLYL 2WQVA 1HNFA 5E2TL 2CHZA 2VXVH 5DJAA 2JNZA 5CEZE 5F1OB 2NY1C 3AG1B 4N90E 3R06B 5I6KA 4KQ0A 3MJGX 3KPLA 1MAJA 1U3HB 1M3JA 4EQ2A 4Z5RA 1QLEL 1N4XH 3Q6GL 1BBJB 1TETL 1TFPA 3H6AA 3S96A 2YD7A 3CBJB 1T6VN 1K2DB 4JN1H 1OZUA 4OLYH 5D5MA 3QS2A 3QH3B 2Q3XA 5LHDA 4HCIA 5L8JB 2GKIA 4JZJA 1I9IL 1QFWI 2FJHB 1QW9A 1XGUB 2YWZA 1GGCL 2GK0B 1RK7A 1KN2L 1U8QB 1KACB 4JUSA 4HZLA 3F6LA 3QUZC 3FTYA 1BAFL 1WTGT 1ZHLB 1KY6A 1CTNA 2YPLA 2EXWC 3GMMB 3BD4A 1DFXA 1B90A 4PJ8B 2A73B 1N10A 3DXAE 2O6EA 4Y19E 2LW3A 1QPXA 1GOGA 2W0KA 1KLFA 3H9YA 3QDJD 2XACC 1CFSB 3E1F1 5EN2A 5FF6B 3S36X 4DGIH 2YAHA 4RESB 5D5MF 3F7RA 4O2CB 3SCMB 5J11B 4U4IA 3AITA 3FPXA 2EXTA 4A7UA 2H32A 3JWNG 3ZTJH 2DD8H 1XR9A 3H7BA 3VFOB 1HWGB 5T5FA 4OZ4A 4Q0XH 4UYQA 2UZPA 3HS0B 5D8JH 1JZ4A 1G7QA 1HSAA 4X6FA 3WTVA 2DBLL 5SWQB 4KJYA 2GBTA 1SYSB 1XF1A 4L8SC 2ID5A 4MJIB 2A9AA 5CSZB 4EKJA 3MRCA 4MMXA 2DTSA 4Z3FA 5AWNL 3BEVB 5FA4A 2QPDB 4UV4L 4IDLA 2VW4A 1KEGH 1MHHA 2AVGA 2G4GA 1MW3A 3ME0B 1J1OL 1KZYA 4JM0A 1S78D 2AEOA 4X83A 2VB5A 1DUYB 1FFPA 2CCWA 3AY4A 5IG7B 3WY1A 1MF2H 1MY5A 3QR2A 5GRWA 3LH8A 3CFTA 1IBHA 2I69A 5F7KC 3VCLB 2EYTB 2ZUUA 2OSLA 5HGBB 2E7HA 1TJHL 1J8RA 4WCYH 4X6CA 4DW2H 2O61B 4IIQB 1FLTX 3DA0A 4MCZB 1EDQA 4F7TB 3QEQD 1FLRL 2YRPA 4PJGA 1EZLA 5HVWA 4OF6A 3FHEA 3G6AA 3QRBA 2B4CL 3ZRCC 4DFHA 4N2NA 3CZGA 1GIGL 1UFGA 2YMXH 5KVGE 1LWJA 1VACA 1L3WA 1WZ1H 3UGUA 3T0EE 2PP9A 3M45A 3EGDA 2ADJA 2DY2A 2WSKA 1MCBA 2VKWA 3QQ3A 3L4WA 4HUWA 4OCYH 3FTGB 3R4DA 1Q72L 2JKSA 4Y5XB 1CGYA 2W65B 2H4EA 4JK0D 1Q1PA 4JJ5B 5MEND 1JD7A 1KT2A 5IROC 2Y7QA 1I7TA 4RETB 3QIWD 3VGAC 2I27N 1RIVL 2V5YA 4PJGF 1YEDB 5FW6A 4HWBL 5DFTA 4KAQL 5CGMA 1PFOA 3VFSA 2YEQA 3ULUC 2GITB 1OB1A 1ZDQA 2X41A 1A4BA 2ITDB 5LBSL 4W4NA 2V2WB 5JOFA 3GM8A 2W9EL 5E1AA 1UACH 2QQQA 4KKLD 5C0FA 4PW9A 4AJWA 3O9WC 1CQKA 3A67H 1X5LA 5HD8C 2R0WL 1QVOB 2HX8A 4LCYA 1T7YA 1S7VA 3O2DA 4WDIA 5TE4L 3EFOB 4DQOH 2KZKA 3DXAA 4YBHA 4Y19A 3BVDB 3ECBA 1NMBL 4MRBA 4JY6A 5GGTA 4EXPX 4LIQH 4LL1A 3LKRB 5DFAA 2OK0H 4GSRA 4ZOAA 3NSXA 5B4MD 1BBJA 4NZUL 3D18A 1FFQA 4X4XB 4XB3A 2OZNA 1KPUA 4HOXA 5AKRA 3FQUB 2F54D 3IPBA 1F13A 2QBWA 4RGMC 1A1MA 3D0VA 3DV4B 5AW0B 3WDIA 2DKMA 3EJPA 4Y7OC 5TQ2L 4E41B 3O6FB 1S7QB 4BFBD 3P69A 5GXBB 3GMMA 1PZUB 4L3AA 3IJ9A 2CO7A 4K9EH 4NKQB 4PJEE 4A7TA 4HBCL 3BAIA 2ARWA 4DAGL 3TWYA 3W37A 3FU7B 4N28A 4Q9RH 1WF5A 5C9JB 3H9SE 1F1AA 2Z7ZA 3MVSA 5CHNA 3GTTA 4JKPH 4LBEA 5J1TC 1J8SA 5DQJA 4J2QA 1A7OH 2AERT 5FW7A 3MKGA 3OQ3B 4HDIA 1F5WA 3VAEA 3NA9H 1KWGA 2WLIB 4P9HH 5IHLB 4JDZA 2AF2A 5FUCE 1NEZG 1NGZA 3L5XL 3KCPA 4HULB 4E41E 1ZE3C 2A9BA 2I32A 1ZVYA 3V0WL 1NJ9A 2ICWI 2ERJB 1HIML 1KPRA 3QG7L 1TLMA 3JTBA 3HZYB 5H8DA 4XPBH 5E7BA 1HOCB 1Z66A 4HCFA 1L5GB 3VFVB 4PRPB 2IWFA 3MUJA 1ASQA 3RZCB 1JFQL 1ZGLB 5D71L 4EIZC 3VTMA 5DJDB 3KBHE 1NBVH 4UQEA 1FV1A 4TM9A 5AKVA 1TQTA 5FGCB 2W9DL 1LDSA 3T0EA 2FWUA 4G3YH 1KJ2L 1CGSL 3C5JB 1U36A 2A6IA 2D0FA 4C56D 5JHDD 4NWTL 1SOSA 3FQ1A 4HD9A 3GUTA 4IRJD 3QZLA 1LO4H 4JG9A 4BZ1L 4M5ZL 5KYXB 2X6BA 4GG6A 4M02A 3LZPA 2Y22A 1MVFA 4M8QA 1MRCH 1O9ZA 5EU7C 1J0ZA 3CZFA 1QTYT 3HZMA 1U58A 3LZRA 4OQTL 2WB7A 5BOJA 2GFBA 1BFOB 3QE5A 5AZ2H 5DURD 2QADD 5MP6L 1AGEB 4S11A 3W9EB 4PRPE 4UWQB 4NHUB 4QXGL 1OM3L 5ITFA 4PVBA 2WXQA 3V0DA 1W9XA 2K4WA 4W9CC 1YEKL 5FGCE 1G4MA 4PY7B 3W0WE 3GSNB 4RRPG 3SGKA 1NH6A 4IM8A 1PCXA 1DJXA 3TVMD 3D39D 4LDCA 4AYSA 3NIFB 4GG6F 3TURA 2ZOKB 3FO9B 2ZJSH 4R83A 2BY3A 1P7KB 3J2PA 2RGSA 4HOZA 4U0RB 5JHLA 2GIMA 2P52A 2OR9H 4B5EA 1ED3B 1MCRA 1IEHA 3SKJL 1KTCA 3OTTA 2H0EA 2LTQB 3SGDH 1UWFA 2ZCHL 1MW2A 5DQDL 1GKEA 3QO0B 1YEDA 2AJUH 1YLBB 4B3VA 3DIDA 1TQSA 4DGUA 1ZMYA 4KX7A 1PLAA 4H88L 3F04A 5BQ7A 4QRRB 2FIKB 3DC0A 4PBWD 1JP5A 1F18A 2V2WA 4CJ0A 2C7FA 3UAJA 1HH9A 4IJ3C 3WTUA 3TPUB 2RCSL 1W0VA 1OB0A 2DKSA 2V3EA 4PJAB 1HHHB 2VN3A 1RZJH 4G6KH 4NQVA 2WWOA 4KNSA 4JNXA 1TVBA 3LRHA 2WBJB 3AQZA 5E8DL 1MWAB 3A24A 1FZKA 1M1SA 1G7JB 1BZ7B 2NX5D 3EJUA 3KGRA 4PV1C 2XRAH 4PJEA 4TNWF 1NFDE 4OZIB 5DO8A 1V7ML 3GJEB 2A77L 2CRIA 3H9SA 1OAUH 4LIQE 2QMJA 2IJ0C 3WENA 4XMXA 1ICTA 4YSUA 3UADA 5D7IA 3GXPA 3SQBB 4X4YA 2HFEA 3TA3A 3RKDD 4X4XA 4QJ4B 4B6ZA 5ICXB 1Q0XL 3HAEB 4QRRE 2LFGA 3MSPA 1P6WA 4O00A 3KGSA 5I9QC 4UAOC 4KO6A 3CCHB 5FO9B 1O9WA 3FT2A 4E41A 2WQXA 1P4BH 3VX1A 4OFYD 2ODIA 1MLCA 4Z7UE 5KS9B 4PJAE 2BVUA 2DMKA 4HF5L 3TFKC 3WAKA 2YPVH 1KCKA 3KL3A 1GS6X 4P9ML 1M3IA 4ZOBA 3KJ4B 4RMRA 4OZIE 4KY2A 1C7TA 3FU7A 3DX4A 1DE4B 5D7IF 4Q2ZB 4KRLB 1KJVB 3UZQA 4G6AD 1NBYA 2AK4B 3GMLB 4TUJB 1KNOB 3DX6B 2WUBL 4L37A 1UB6B 3DX8B 1H19A 4QRSA 4H26B 3BVNB 1QA9B 1WT5C 3L5IA 1YZZA 4M56A 1YMME 5KN5A 2L8AA 2VAJA 1FFOB 4YZFF 5I6PA 1PZ3A 1NGQL 3C5ZC 3KPNB 4XPGH 4NP4L 4JEGB 1P7QB 3EADA 1FIGL 1OAJA 5B21A 2W07B 5F0PB 2XC8A 4M93C 4YEEA 2IDUA 1J0IA 4HS8L 1DBMH 2VXQL 4X5PA 2JV6A 1N5AB 1NGPH 3ARED 4NPJA 4B0MB 2VZOA 4FEIA 1M2VB 1HOCA 4Y4FC 3NCJH 4DOHB 4ZMOA 4MA1C 2G3NA 2DIJA 2E6PA 2EADA 4BHUA 1ZGLA 3KLKA 2H6OA 5CP3H 3MYZA 2ZP9A 3VMOA 2G5BA 2QLYA 1E90A 1WD9A 4M7LH 1OGSA 2YSSA 3C60D 5E8OB 2HFTA 4K3JL 2ZXCA 2YAMA 3MRGB 3BQVA 4I4WA 3MRRA 3QXTA 3MNWB 4Q6IC 1AGCA 3W0WA 3NBNA 2VDMB 4OI7A 4HGWB 3JWDC 1XX9C 5J12B 1ZT1A 3GBLA 3V4VL 2ESVE 3GQFA 4KI5F 1IAMA 4AMKL 5L4FA 5EOCL 2QQKL 4GQPH 3HZ3A 2ZG3A 4MWFB 2WBXA 4Y16C 3SQOL 4O58L 4F7CB 1H9DA 4Z78B 3A22A 2DQCL 1IGJB 3QQ4A 5C0BD 4PREA 2V5RA 4L4TB 5ESVA 1BVLB 1IM3B 3L1OL 3MCYA 2VXUL 2X5PA 2A74B 1YDPA 2V3DA 3W9EA 4TQEH 2YLHA 3ZTNH 1FL6A 2FJFB 4NB7A 4NOBA 4P4KA 5FO8B 3JV4A 3B7RL 2BHYA 4XN5A 2CALA 1NUNB 1EHAA 1TPXB 2BW5A 4N2EA 1CWVA 4Z3JA 2HKFL 3VWJC 2P26A 4Y5VB 2WXKA 4K2UL 1PBYA 1ORQB 1WCQA 4MA3A 5IT2H 3WFEL 1NFDA 2BY2A 1MREH 4MMZC 2V37A 3S2CA 1FHNA 1TTFA 4UQ2A 3WJLC 4AGOA 1IZJA 1DVFD 1B2YA 1W2KT 4FXTA 5IBLC 3QCUL 3UAEA 4PVLA 3IKCB 2AXJA 3KM1A 4JRXE 3O2WH 3MOAH 3K1KC 1XGPB 3KS0J 1LE5B 2E9IA 3EO0A 3POHA 4MNQE 2VM3A 5F7HA 1YEFL 3QJRB 3WFHB 4JB9L 2A4ZA 1OP9A 3AB0C 2YBRB 4PJ9D 4XVJH 4OD1L 5A2CA 1GJUA 1WBXA 4M6ML 3CK0L 5E4EC 5A6LA 1WEJL 2ORBL 4Z7UA 4YDLB 1CF1A 4PRHD 1E6OL 4DF9A 1NFDF 1KXVC 2XDHA 4O4YH 3B9KA 4TNVK 4GRWF 2AI0L 1IAIL 2IALA 3D69A 4L29B 3B2UD 5K59E 4F80A 4AEIL 4XCYA 3GJEA 3TCTA 4DGYL 3GF8A 4PJ5A 4F8LA 2Y06L 3QXUA 3OPZH 4QOKA 4QRTB 5M95B 1CL7L 3ARDD 5SWSD 4WU5B 3X17A 3KHQA 3JWOC 4MDJA 4WO4B 4HUVB 1YMMA 4ZMPA 1K8DB 5IQ7H 4L3EE 4APQC 3B5GA 2CIIB 5C0GA 3IDNA 3II1A 1NDTA 3HE6A 1T03L 4FOMA 4QRPE 4PJ7F 2UZIL 3BGMB 3SPJA 4LHQB 5AVWB 3BUYB 1MIMH 2F5AH 3KYOB 1QZNA 1BOYA 2OZ4L 2ZUWA 4G9FD 1NMCB 4RNRA 3SDDD 3U6RB 2H26B 4NKIL 1R0AL 3AUVA 4R0LA 1MEXH 2BSCA 1IGYA 4O51B 4P59H 3UC0H 1KCVH 4XMLL 5AB0A 4I5BA 1X5HA 3QUML 1DE4A 2NQ3A 3VFNA 4N3TA 3ZHFA 4UTBH 4UZGA 3A6CH 1QI3A 5AOZA 3TBVA 4JG0L 4I0PA 4LAJH 2FO1A 4XXWC 1RSFA 1EJ8A 4FHJA 3L3DB 4L1BA 3EG9A 2ESVA 4WHYG 2B77A 1U8CB 4QIRA 4PRIB 1E4KC 3BAXA 1QQDB 3B9VA 3NABH 4KVNL 4KXCA 2OSYA 4MQXD 2Z65C 3IS1X 3OF6D 1AZUA 3PUUA 5CJOL 5E08H 4HQQL 4U1IB 3NFSH 4BH7B 1VSCA 2BSDA 1CG9B 2R4RL 3G04B 2UYLB 5DZNA 2X1QA 2V2TA 4GAFB 3TC9A 2AEPH 5KJRL 2NLJB 5JUEL 3ZHNA 1JPEA 2D7OA 4OSUL 3EHBD 3MNWA 4YE4L 1F6LL 4ZAKC 4HGWA 4YL4A 2A38A 4CVXA 1LE9B 2ZYHA 2CDGA 4QRUA 1LVEA 5GZND 1QRKA 2FO4A 4X5XB 4N5ED 4PJDB 1ZT7A 3FUDA 5IOKA 2IPTH 5MEQA 1AH1A 1WFNA 3VH8G 1IGJA 3GMPA 1OEZW 3PYCA 2BNQE 2X4QB 4JRXA 4AGMA 4U6VH 4CW1B 2DYPB 1HCFX 4FFZL 1MHCA 5IMLB 4JREB 3ULVH 3UPAA 4EDXA 3DO4A 2OW7A 3NJFA 3OB0H 4MNQA 2BS8A 3SE9L 2XZAH 8FABB 1RZKH 2FSEB 3IAPA 4QWWD 1J9QA 4M6NL 3IVKA 2OXGA 1XAUA 3CU7A 1T22A 1XDTT 3BX7C 1QKZH 5CCKH 2IOOA 5IFHH 1OY3B 2VO8A 2ISDA 3EDKA 4LLDA 1WA1X 4YDIH 5IIEB 4KKAD 1G9NC 5DJ2B 4PGDB 2O93L 4AXWB 1A4JA 2F19H 2Q9OA 4ZMAT 1X7QB 2B15A 4ZQKB 5L2KA 5E56A 3KLQA 2ZSWB 1X9LA 4MNHA 1VDGA 2UZXA 3S88H 2NY5L 2EIBA 4MMYA 5BS0D 2YARA 5FFGA 5EPMA 4PB0H 1XGPA 1WFUA 3NSFA 4JBSA 5D6CB 5I1KL 4CSSA 2J1KA 2CM6A 3BE1H 4MAUL 1R3HB 4H8PA 4L3EA 3PP3K 2WZ0A 2W60A 2Z93B 3PJSB 1QPKA 3RJDA 4AEHH 5B38G 3BOVA 4OB5L 4QRPA 3FBQA 4BWTA 3P3SA 1UWGH 2QPEB 3PWUA 2M2DA 3WG7B 3LS5L 2QV4A 2YPVA 4TVPH 3IFPA 4D7PA 4XAKD 5F89B 3TBYA 4UILH 3HNSL 3NP4A 3A47A 1FYTE 2VOTA 1BYNA 3ETSA 4PJXB 2DL2A 5FGBA 4IOSA 3NCXA 3SYCA 3QDGB 4LVNB 5EO1A 4RMWA 1R3LA 4F15C 3TWCL 3F5WB 5EN3A 5BXFA 5INDB 2PR4L 2HT3D 3VG0L 2VZ3A 1GHFH 1UWEL 1RIUL 3Q5OA 4HUVA 3F7PC 3HE7B 4PTTB 4GI9A 5E23A 4PIRF 4ZYKB 4KTDH 2HH0L 1L9TA 4BFEA 3BZ4B 1IX2A 2HX7A 4JQXA 3ARGA 4C57C 1IIKA 1I3GH 3KYOA 4G8FA 2PPEA 3MI6A 1PEZA 3HBZA 4K5NA 5I1CH 1AYRA 1CDGA 3BDXA 5FFOA 5T1LD 3SZ6A 1X5YA 3BKYL 3OXSB 2IDSA 1U8KB 1CDCA 5CP3A 5IF0B 4HVBA 4HWEH 5KYYB 2W1NA 1E40A 1J8HD 1F58H 1ODAA 3GLEA 2OI9C 3RGBA 3PAYA 1DVTA 4G11A 4U6YB 2P24B 4Z7NF 2YO3A 5B8CC 5D1ZI 3WIHH 5JPNA 3GSQB 2BSSA 3P0VL 3QIBB 3F83A 1PZDA 4PG9B 5KOVC 3U9PL 4UNUA 4A6YH 3WOVA 3BSZL 2XVLA 1KFAL 1OANA 3NJKA 3OKNB 4GXVL 3RQ3A 3EH1A 5I5RA 5C7XL 1NM4A 2BNQA 3BT2L 1F97A 3CZUB 4OD3L 4HIIA 4J6RH 4D0BB 3QCTL 1HL4A 2N1KA 4E9WA 3RWGB 1ZHKB 5IKCA 2HRGA 4ZMZA 5DC2A 2CM5A 3G08B 1CG9A 3LS4H 2WIMA 3AC0A 5CN3A 4P5MA 3LZQA 1SHWA 1KBBA 4G1EB 3CPLB 3O3UN 3BP6A 4AQ1C 1QBMH 3OJ2C 1FFTB 2AEIT 3CN0A 4WV1B 5LXVA 1BZOA 3L3IB 2VNCA 3BKJL 5CM1A 3GMOB 4U31A 4J2XA 5IVOA 1X9UA 4LU5H 4XNUL 2NNCA 1WAPA 4TVSa 4R26L 1QYGL 5MEPB 2G3XA 3US0A 2KZ1B 3U48A 2GG1A 2R23A 3VRLE 1UZGA 2X4QA 1BIIB 1Q0YL 4NI6A 3ULVE 4IEFA 2WSDA 3B9DA 1DSFL 5JOPE 2V2XB 2Y69B 3TCXA 3W57A 4A2FA 1D5ZA 4JZNB 3HRZB 1E5ZA 5KVDL 3K8MA 3TJHD 4MB5A 1PTZA 1VPOH 5JXEA 2DWEB 2XG5A 3THML 1BM3H 1R33A 4JRYB 3OKDA 3BEWB 4XH2A 1AS8A 3BH9A 3D34A 3EFFB 4R5VA 1FYTA 1F42A 1RVFL 6PCYA 1DP0A 2V7HB 4G42B 5C0DB 1NA8A 4LVOC 3MMEB 4BSWA 2EUWA 2EE3A 2XBDA 3NQKA 4IKJA 3LDBB 5HI5C 5ID1B 4KU1A 4LE8A 1BQRA 1L9SA 3RGVA 2ADIA 5CNHA 3WHXB 4KKCC 1FCGA 3FO0L 2BOCB 5TDPA 2IFFH 2GTZA 4G72B 4X99B 1VIWA 2WO3B 3RNKA 4TPRH 1YO4A 5INCB 1WBYA 1DQKA 1X4XA 3O3DA 1YRKA 1OSZA 2VW7A 5F8QC 4EKXA 4Z76A 4JRYE 1XCQB 4TVPE 4UM9B 1QNZL 2Z91A 3O6MH 4I77H 2QQNL 5E1QA 4FG6D 3TL5A 1NAKL 3OLEA 3ZZQA 2YN3A 3KGUA 1OAZL 2VRKA 2XY2A 3R8QA 3N1GC 1JPSL 4ELKB 4UTBA 3DX3A 5DZAA 1WS7A 2ZUTA 4NUPA 3UG3A 2FX8H 1RMFL 1CK0L 1DFBH 1JV2A 1WLHA 1GCYA 3MJ9A 5IB1B 1N68A 3KLLA 3V7AG 1CFVH 3RLSA 3VD5A 2B3IA 2VQ1B 2QHRH 1O7DC 4H8VA 1S7XB 1BEYH 4R97B 4KTYA 4NOFA 3NIGF 1P4UA 3EBIA 3FN0L 5IOPB 5D7SL 1KLUB 1A7PH 3QJHB 4I3SH 3KXFB 4MSWA 1BXAA 1SBSH 3N43B 4LGPB 3FW6A 4YFLI 4PGJA 4YDKL 1J0HA 3F3HA 4RWYL 4GO8A 4JZJC 3WO4B 3L4CA 2A83A 4IKIA 2H2PD 1CU4H 3C8KA 2APTA 4HALA 4YSRA 2DAVA 3OXSA 4JFQA 2X4PB 3SBQA 5IHUL 5FHAH 4GRMA 4TNWK 1JPGA 5LBGA 2D73A 5GRUL 32C2B 1T6BX 3MBWA 4OFVA 4CGUB 3N41B 3PABA 1MRFL 4OF7A 3T65A 4EI0A 3ILQD 2CPCA 3W81A 3TIDB 4FI6A 4UTCA 1SN5A 4JDTH 4PG9A 4YHLL 2VRQA 3KXFE 1OPOA 4MS6A 4ABUA 2J6WA 4K23H 1MKFA 1MVYA 4LGSB 1A0QH 5GJTH 4KH2A 5HJ3B 2NDGA 1A6WL 4D0BA 3ZL4L 2VUKA 3RWGA 2WWMC 3ALXA 5DDHA 1Z3RA 4G7SB 3WUWB 1HZHH 2CWRA 5I1HH 2VC2L 1S5HB 3LNGA 1QFHA 1IKOP 4JW3A 5KYUB 3FT4B 3LXUX 3CFDA 3QFGA 4X4ZA 1IFHH 4PHZA 2APBA 4MMXC 1BCIA 3FU0A 2GABA 2HJFA 3T8XA 5DD1L 1D9KB 2Z35B 3N06B 1MFDL 3L3OA 4FLOA 4DKFH 1BGXL 5FYJL 5I8OH 2QVFB 4CSTA 4PLJD 1PY9A 3AY4C 2AJ3A 1UVQB 1QBLH 3FL7A 2BS71 4JE0A 4ABVA 1UD8A 4NQDA 3X1NA 1H3TA 2BRRH 1R3KA 4IMLB 2NY6C 2YC1B 4GUPB 4BH8A 1XGQB 2J2ZA 4U1LA 1OTTC 5E2JA 4YSEA 5FO2A 4KZDL 4CMHC 4LLWB 1I9JH 2FD6L 5GS0H 3NQIA 4C4KO 3WFDH 2JKTM 3FFCA 3U7WL 3PWJB 3F7QA 2WTRA 2F7OA 2WCSA 2P9RA 4OCXL 3UJIH 3BZFA 3MRDB 4MB1A 3Q06A 1VZGA 5FWQA 1RIHH 2WXIA 3EFFA 3F7LA 3D09A 5JIIA 1CXHA 1AOHA 1FE8L 3L1GA 4RQQA 5F21B 4L4VE 5FEBA 5IW6B 1MCLA 1I1FA 2GSMB 4AK1A 2YD1A 3SQRA 4G42A 3PNWB 5DD5L 2WKOA 5F88B 5F9DC 4CJ1A 1EFXA 3ZZ1A 1FORL 3ILPB 5L9DH 2MQ0A 4NBXB 3IK2A 5LGHH 3PE9A 4N26A 2VLLB 2AKRA 1XWVA 2XX1A 1UTDA 2FHCA 2Z92B 3GEFA 12E8H 2AV1B 4YMPA 3MREB 4GEJA 2LABA 3OPUA 3V6FA 3QORC 3VD3A 2X42A 3ML9A 4RMUA 5DA0B 3QYNA 4PFEA 4I85A 2YIHA 3N40P 4OD2B 3VXME 3QZWA 4WEEA 3BIKA 1G1YA 3SKOA 1JRHH 4M03A 5DJ8B 1B4RA 4RSYA 4D0DA 5DSCA 2PYEB 2WO4A 3COOA 4NQCB 3M17B 4IBSA 3WIHA 1ASOA 4WI8A 3V10A 3HA0A 2WZ5A 3OAYH 3BP4B 4A6YA 3MX0A 1YC8A 3MV7B 1KLUA 3FOLA 3U1QA 2LAAA 2MTPA 1PYWA 3KXFA 4QJ3B 3MLSH 4XN7A 1QFWL 2J5LC 2G2RA 4X7DC 4UQ3A 3EH3B 4NLHA 4XBGA 5GGUA 5CN2A 3LQAL 4NNXA 1RUQL 5PAZA 3PL6B 5I0DA 3MRHB 1FGNL 4F8PA 3WHE1 1AAJA 3CSTA 1JVLA 1VEMA 4GLRI 4X7SH 1HYSD 4NNYB 4UQAA 4R3SA 2DEWX 2H5UA 1KB5L 2E7CA 4PS4L 1L0YA 2PYEE 3LQMA 3IWUA 4BK4A 4QTFA 5D72L 4CN1A 1TVDA 5FHBH 5HGDA 3O2VH 1ONQB 4KXZH 5J89A 3MV7E 5D9SA 4MCYA 43C9B 1AR2A 1WCBA 4GW4A 5H2BB 3SB3A 4KRPB 4S0HA 2B20A 2KZWA 5JDSB 5JIMA 5HJ3A 3NZ8A 3RY6A 3P1VA 2OL3L 2E3VA 2QEJA 3WFCL 3WUWA 4Y1AA 2HFFB 2IH1B 2X0WA 5GRYA 1PEWA 1ASPA 2VDNL 1TVHB 1HILB 1E3FA 3O8XB 3BDYL 1A2YB 4FD0A 4JFHE 5IJCC 2Q6WA 3L45A 1U3NA 3CSYA 4AT6B 4BE5A 4H44C 2CUMA 2PP8A 2VR9A 3NFPA 1MWOA 3T0EC 3TBSA 1JBJA 1JZ2A 4DGWC 3LXAA 4L4VA 3P9LB 2MPVA 3MGOA 4XP9L 4YSTA 3TASA 3LRSB 1OPGL 4UDTA 4IYKA 1YECH 2R1YB 3WLBB 2GIYA 2WWKT 5DUJA 2FAUA 2FWSA 3OHXA 5TDOB 3FYIB 3CX5K 1KTLB 2LVCA 2FT6A 4E2OA 1JPTH 1W16A 4UOJA 3MNDA 4GG8A 4LSSH 2Z7YA 2YBGA 2WBKA 4JHZA 5FV2A 1GYVA 2IEPA 2YC1A 4GUPA 4Z95L 1JE6A 3SE8L 3BSGA 2B5IB 4JQIH 3V52H 4A63A 1G7IA 2CCVA 2WWNA 3PPEA 5IUCA 4X8JA 4JHAL 1REIA 3BLPX 3W1ZA 5IM7B 5EFIA 3GLDA 2L7EA 1DANT 1OKEA 3BO8A 1NSNH 4IU3A 2JCCB 3HI1B 5DQ9A 2ZP0T 3SGKC 5A3IC 4LOUC 5AEAA 4F24A 3VXMA 3ARXA 1DBKL 1HFUA 3MUGA 4JM4H 3NYKA 4L3CB 3PWNA 3OQRA 3X12B 1LEIA 1KCLA 4XNXH 1TIUA 3F05A 2X87A 3ARFA 3C6EA 2FEJA 3CH1A 3LVTA 4FNUA 4JFDE 3OR7A 8CGTA 2OXHA 1XH2A 1QFUH 4N2AA 2IOMA 1M7XA 5AYUL 4ISVB 4TL4A 5FYKH 4GKZB 3TV8A 5AW5B 4E42B 1CLYH 1S46A 4K5MA 3U0TB 4EN3D 5ALBL 5E2TH 4P46B 3D5OF 2NW3A 1DQJB 2YD6A 5TK4A 1HEZB 4LEEA 4ZXBB 3IJ8A 1UD3A 4WW2A 3UAJC 3VRJB 3KHOA 1JD9A 2XA8L 3Q6GH 4N2MA 1TETH 1ZJAA 3JYCA 3ZDXF 3C2SA 1ZANL 1UZ6F 2XTJB 1JZ5A 4X8GA 2ITFA 4L9LB 4WWOA 1I9IH 1NINA 4DGVL 3FQTA 3SODB 1MAKA 3KPRE 1TR7A 1KN2H 4UM8A 2ZP8A 3V5HA 3DJTA 1INEH 1ID2A 1BAFH 1F90L 4F7PB 3C6SA 1JWSB 4HLZH 4I0KA 3V5DA 3K71A 2UXVA 4G83A 2ZYIA 1OHZA 4HKBA 3TA3C 5DS8B 4OKVA 4WW2F 1AGDB 5DEGB 1S9KC 2BP0B 3MCKA 4X9BA 1QASA 2JB6A 3O4LE 4M5SA 2EDTA 3NK4A 5IHBA 1AD0A 4YPGA 2YD0A 1NEZA 4TUOB 2C3GA 5AKSA 3DBSA 4EI5D 3I3DA 4PP2A 2NTSP 5EZIL 1NGWB 2EH8L 1AC0A 5SV4A 1EHLL 3LPWA 2E8ZA 4NX0A 4YN3A 5I6XB 4NC1C 5AUMA 2IQ9L 2FEDD 2QGBA 2WO2B 4L8DA 1FVDB 4KNQA 3LV3A 1GGBL 2CBPA 1A3QA 2XWJA 1WH0A 3S4SB 2DBLH 1DBBL 4KUCF 4S1DC 1XZWA 3LEVL 2WYZA 4G5ZL 2VDLH 1YEEL 2Z64C 5E7FA 4WEBL 1AO7B 3IJYB 2UVEA 5AWNH 1T0MB 2HT4D 4UV4H 3LKPA 4XODA 2W0FA 3LRLA 2BSED 2G2NA 1DL7L 3GBEA 3OMAB 1QI5A 4Y1SA 3HNVL 3QIUA 2F58H 2XICA 1TENA 5GGQL 3WD5L 3DO7B 1J1OH 3D12B 2ERJC 3RZWA 2XFGB 5CLYA 4K3DL 5KJ7E 4MDIA 1KCSL 1HZKA 5GRVL 2AQ1A 2GAZA 2AJZA 3X1EA 3H8NA 1M6OB 3OAUL 1ZPLA 3A5VA 4LCWE 2WCPA 3EOTH 1TJHH 3Q0HA 1FVCB 4LPVA 2WUCL 4W9ZA 1OSYA 3DRTA 4RX4D 1FLRH 3ZHDA 3W5MA 2ZUSA 2CDEA 4KRNA 1AO7E 2B4CH 5A7EA 1YPZF 4GUQA 3DK2A 3SDAB 2FR4B 3C87A 4H8QA 5HHNA 4JFDA 4A2HA 2EYRA 1GMIA 1WFIA 3AXHA 4Z7WE 1I8IB 1IMHC 3ARBD 5C71A 3CV5A 1Q72H 4HWUA 4J8QA 3VD4A 4TYUA 4G8GB 4P4KC 4NO3B 4ZUSB 1M1XB 3ARZA 1RIVH 4BQ8A 2YXVA 4E5XA 2JK5B 1R5WB 2HTKC 4HWBH 1PIFA 4KAQH 3VFRB 1Q1JL 2ICEA 1JYWA 1D5IL 1VZIA 4FTVB 1CGVA 3G5VB 1AR1B 3GS7A 2ZZUT 4PV9B 2CGYA 2NUPA 1EAJA 1MCDA 5SV3A 3U25A 2W9EH 4YBLC 1MJJA 4I1PA 4U2YA 1E8ZA 2BVQB 1MCWM 3KPRA 3GJFH 1OHQA 5FYKE 3RTLA 3FFDA 2R0WH 3V79C 1VEPA 3DMMA 5DU7A 1WHOA 1TQCC 5C08E 1XGYL 1TCMA 3VI4E 1NAMH 2WMPB 4L8CA 3FUEA 1P6FA 4WFHD 3O4LA 2NY1D 3QJZA 3BH8A 2QSQA 5EOQL 3P02A 4UDUA 3LCYA 3N50A 4HGMA 1BLIA 3WIIL 1H15B 5BRZA 4BKLB 4TKWA 2FJGA 1I75A 1I7ZB 1HCYA 2CLZB 5KBLA 4NZUH 1DQMH 2YZ1A 4UQDA 2QPUA 5AW7B 1BZ8A 1UXWB 2LAGB 4LRNL 4GJTB 2NYYD 3JTSB 3PJLA 4K9EC 2R9HC 5J6GA 3DV6A 4YXKL 3WJMA 1D5XB 1WJ3A 2GT9A 2YA1A 5I0WA 1UJ3B 1WZLA 2ZKHL 3AG3B 5I6LA 3DVGB 1JN6B 4M43L 5TQ2H 5D7LA 1JGEA 1INQB 2VDLB 4JKNA 3NSDA 4YSPA 4Y0GA 2X6CA 4MDRA 4JMXA 2L3BA 3UG4A 2CMRL 2EXWD 3AW5A 3L6FB 1AGDA 5D1QA 5CBEA 5FGSA 2IDTA 4HBCH 4P9HC 4AM0B 4DAGH 5L4IA 1SOQA 3APNA 1WZMA 1BZ9B 2YEZA 3HE6C 4XCEB 4HEME 4TL5A 5I66A 1X5GA 3L5JA 5DVNA 3TIEB 4Z3GA 5K39B 3S98A 4TUOA 3FQYA 4L4JA 3D3VD 1NLDH 2O30A 1KPVA 4HKZA 4Q52A 5ETUA 5TH2A 5C09E 5C3TA 4C4KT 4N9GA 3OAWA 1NBQA 4R0LC 1MW1A 3MYJA 4LDEB 2IFGA 2V9QA 3KJ4C 1NKGA 4OGAC 4ZODA 2GI0A 2N0MA 1I8UA 1L7TL 1HDMB 1O75A 2YKLL 1L4IA 1T04A 3L5XH 4QAWA 3KLHD 3U46A 4LCWA 5AVTB 3GRBA 3V0WH 4PWIA 3RUGB 4K15A 2H47C 1HIMH 2BRQA 3VGFA 3CZJA 3QFDA 1YSOA 2FQDA 4TRPL 5CZRA 4XXCA 2A99A 5EF0A 1CZ8L 1T0MA 3WUZA 4FKEA 2HJLA 5IQLA 4C83A 3UGEA 2WIIB 1E9PB 2W9DH 3WJJA 1GH7A 4JQIA 1KJ2H 1RZ7L 5J13B 4HSQA 4LCUB 1JGDB 4Z7WA 1EZVY 5BV7L 1FFRA 1Q94A 2PO6A 3U6XA 2KBGA 4BZ1H 1KTKE 3NCMA 4M5ZH 3KDPB 4N6RA 2CA4A 5GS2D 1FO0L 3CFJA 4Z7VB 4QUOA 3RJOA 3U1SL 5C97A 1SJVA 4E9RA 1M6OA 2GHWB 2OR7A 5D1XE 5KJRH 3B3BA 3DDGA 2GSGB 5I0YA 4FXGB 2C9PA 2VJXA 5AOLA 4OQTH 3RUGE 2LVEA 2FE0A 3F84A 4NBYB 1JYNA 5MP6H 1EXUA 3NUKA 1S5IL 3Q3GB 5F9WC 1ETZB 2Y7NA 2WBJD 5F3HB 3ZE0E 1TEGA 2FO8A 4QXGH 1OM3H 4KITB 4PJBB 1L6ZA 2TAAA 3PWVB 2XUWA 3HPJB 3WIFA 2XA3A 2PPFA 4XWOC 1RU9L 3VFPB 1YEKH 1AXIB 5C2UB 1OGAD 3DI3B 4XOCA 5JW4M 2DTML 4Y2OA 5SWZB 4PTUB 1ET5A 1NAMB 2DQUL 1JZGA 5C08A 3VI4A 1T1WA 5FDWA 2KQNA 1X5MA 3DGCR 1A6ZB 4ZMXA 4Z7VE 2HJKB 3EJTA 2IGFL 1R3JA 2P80D 4V11A 2WLKA 3CVBA 3MRMB 2WXGA 2Y2YA 2XXFA 5FUOL 3SKJH 1LD9A 2ZCHH 2CGRH 2AXFA 5DQDH 1FRGL 3AG4B 5EORL 5CFHA 1RZJC 3O3EB 4U1KB 4UT6L 4ODVL 4NDMB 5F0MB 4YJZL 3MRLB 5HPOA 2CLRB 4H88H 3RHWF 1HHKA 3ULUD 5LWYL 2MKWA 4PW4A 1FNSL 2VDKL 1BOGA 4PJBE 4FNRA 3IU3B 2BNRB 1A65A 4JL2A 1P1VA 3OB0K 2RCSH 35C8H 4PW3A 3O9WD 4NRZA 4NI3A 1DLHA 5HD8D 4IBUA 3OJDB 5E8DH 4BWWA 4OZFG 4TV3A 1K9TA 2XN9A 1AKJD 4LPYA 4YHIA 1YJDL 5C07B 2WMPA 1BQHA 1Z9OA 3H0TA 3QFJD 4LCIL 5F6IB 2COQA 5LUMA 1V7MH 5H4YA 1DN0A 5FS5A 2A77H 2CBOA 3D2UD 5FXCH 4OY9A 3MLZL 2R2BB 2BY1A 1P7QD 7CGTA 3FT3B 1EJOL 4KK9C 5TF1L 4YHZH 3B9EA 4NCC1 3HG1E 5C09A 3VXPB 4JFTA 2JI3A 1QRNB 3BD3A 3NP3A 4I88A 2K8QA 1CXKA 3QEUA 5FGBC 1KGYE 4AJVA 1QLRA 3BP5B 3MJWA 4Y2DA 1ZHBA 2BNRE 3FHQA 4H0LC 3RVUC 2J8OA 2F1BA 2DQ6A 5C0IB 3DVGA 4CVZA 3VSUA 1I4FB 2DMHA 2Q0ZX 3PWLB 4ZUTB 3BHBB 1V7NL 4PGCB 4GSDL 4HF5H 1RK0A 3L3HA 1IRAY 3PGDA 1QNIA 5FAAA 4O9HL 1AMYA 2F74B 3QZOA 2ILLA 2VDOB 4P9MH 4QYOB 3UZEA 2P5WE 3PHSA 5C07E 3MRQA 2PYFB 4I2XB 5CO1A 3TV3L 2WYHA 2ZWLT 2OFQA 1K5NB 5CUSL 4JQXC 1B3JA 3ARGC 4JFPB 1U8NA 4GW5B 2CO1A 3SE4A 1JV5B 2WUBH 3S0PA 1EPFA 4Y8DC 4HXAL 3QPQC 1A1OB 3UCQA 4L4TD 5J0BA 3LKSB 2EC9T 3SO5A 4KOBA 2AEQL 4DK3A 1CR9H 2K45A 1NGQH 1VGKA 5T1KD 4NP4H 6TAAA 4D8PA 4L8BB 4M61A 3S5LA 1FIGH 1HHGA 2I7SA 4DP1X 5D1XA 1JNNH 2QR0B 3X3FL 1SHMA 4HS8H 2J73A 3CZSA 4PJ7B 2EVHA 4KQ3L 3OKLB 3UTSB 1IGFL 5H37H 1H3XA 5JPNC 1ROCA 3FSOA 1E9OB 1IGCL 1R5VB 5EUKB 4RBPH 4RZCB 5L88L 1FAIL 4MXQC 3BAWA 1M57B 4K3JH 1CICA 1O9VA 3F7YB 2G5RA 3TO4D 2EXSA 1U8HA 3VH8A 4CC0A 1LWHA 1T5WA 3CX5J 3FULA 4XC1L 1JGDA 4B5ZA 3QEHB 2F7IA 2W80C 2KL6A 1TKWB 3V4VH 5EZJB 2L0DA 4AMKH 2WANA 4QAMB 3SDCA 5EOCH 3HRPA 1BBDL 3RIAF 3SQOH 2EDWA 5I73B 1J0YA 2DQCH 4K94L 3EO9L 4HWBA 1PNDA 4WTZG 1TCRA 3MN8A 1K4DB 2X0VA 2GIXA 4AW4A 4X6DB 4BZ2L 2VXUH 2Z34A 1O7SA 4UUJA 1T5XB 2X9ZA 3STLB 3Q3GA 3H53A 5LBSA 1JZJA 4PJBA 2BM3A 3K2KA 5K9QG 4HIQA 1WTLA 4AUYA 1MJ7H 3GJFA 1JZDC 4MXWL 1DO5A 1BJ8A 4P49A 3UYRH 2BP3A 3ZDZF 3DTXA 1FL3B 4FQQB 3FUMA 2HKFH 1CFTB 5A6IA 3CFEB 4K2UH 3MNZB 3ZSSA 2NY4C 5CD3B 1SRDA 1XF2A 1TJMA 1DLFL 1P5UA 3WFEH 1E9QA 1A6ZA 3QWRD 3CDCA 4WI6A 1BLNA 1TTAA 2V6HA 2JVUA 5B38A 3MRMA 3FAWA 1XIWB 4UCFA 2E27L 5JXEC 5CLXA 4EEEA 2NQCA 3OHMB 4DHLA 4LP5A 3WDHA 2EO1A 3HG1A 4GYBA 1DEDA 1XCTB 3LEYL 3EH5B 3IJ7A 4NRXA 4ZUWA 4NUMA 3WL9B 1YEFH 2JIXB 4JB9H 3N9GH 4NAJA 3F01A 5IB3B 5CLWA 1PJWA 4U6XA 4I9WE 3HZKA 4OD1H 3TEXA 4FXLA 2CO4A 1I7RB 3DPBA 4XMPL 4M6MH 3CK0H 5KVEH 4ALAL 1UCTA 1WEJH 2YQGA 4WGVB 3D08A 3RGVC 1E6OH 4DCQA 2N4IA 5HHPA 2FDBP 4DKAA 3K6SB 2WLHA 1MG3C 2AI0H 2RQEA 1IAIH 4G8AC 5ISZB 4CRPA 1NC2A 5SX5K 3KPSA 1T4WA 2P5WA 5EF3A 2J12B 3H55A 3C5XA 3VXRD 4AEIH 3DHPA 2ITCB 3F00A 3OLGA 2JKNA 4DGYH 2YJQA 4PRID 3IPFA 4JFOA 3SPVB 3T9WA 4JN2B 1CD1A 3GM0A 5B39G 1SLVA 3HI6L 4PJIE 3N55A 3ISRA 1CL7H 5JNYB 2BLFA 3BN9C 1NOLA 1AYOA 3VSTA 4F33B 3O6LL 4EUPB 2LOEA 3S97C 1HWWA 1QP1A 4WK4B 3QBTB 3UJTL 1T03H 4JZOA 2Z8VC 4NFBA 3VFGL 1G6RL 5C1MB 3HFMH 4DNLA 4HIJA 4JO3L 5FO7A 2BCKA 2OZ4H 3ISYA 4M1GL 4TUKL 3BESR 4LLMA 1WIUA 3T3PF 2J1YA 3GXMA 3TFKD 3EYQC 2F74A 4NKIH 2XKSA 2VDQL 5ES4B 1R0AH 2K6ZA 3I75B 5F0JB 5DTFA 4XMLH 4C59B 3EJYC 3QUXB 3H54A 2H0FA 3SJVB 3DO3A 1J11A 4OUUB 4JG0H 2O5YL 1KJ2A 4ANKA 3EYSL 1C5DA 2I07A 4GBXA 3D9AL 4ODUB 4TLSA 5DD6A 1UGKA 4HIEB 1N64L 1L0XA 1G7PA 3IJHA 4M9OA 4BZ1A 3NMEA 1OTSC 2WYTA 3QQ9D 4PP1C 2ZWZA 1CQYA 1JS4A 3C5ZD 4Z0XB 4HT1H 4KVNH 2HT2C 4OFPA 2ATAA 5C0JB 1ZEAL 1MFCL 1M53A 3RWIA 1MFAH 3WFZA 5F7UA 3IGAB 5CJOH 4H20H 4HQQH 2ENSA 4HS3A 5JOEA 3DOHA 3ZJAA 4Y4FD 5T3XL 2H6UA 3P9WB 4P2RD 3UROR 4NFDA 1F4YL 2F61A 1N8OE 3A4AA 4U1NB 3KVQA 4WFEE 4Y8AA 1HKLL 3D05A 4B96A 5JUEH 2BVTA 2VL5A 3F7YA 3CTTA 4KPHH 4OSUH 3U0PB 5C6WH 5HDBF 1ZT4B 2FGZA 4YE4H 4GRLB 2NOYA 4XCNB 4F93B 5I6NA 3ULVC 4U1SA 2OR8A 1C7SA 3L3JA 2X2UA 1RZKC 4YZWA 1HK6A 1RURL 2I26N 4AK2A 4Z77B 3SPHA 1WICA 1FVEB 1KN4L 2QDWA 1CBJA 1NANI 1UH3A 3IXAA 3PQYB 4N25A 2F6AA 4OCLC 5CLZA 2ZXQA 4KBPA 1NPJA 1J5OL 4ANXA 4ZG1A 4FFZH 5HVGB 4DZ8B 1SM3L 1LO2L 2X4NB 4LHJB 1WAEA 5LGYA 4R7LA 1E4WH 3D6GA 4ANWA 4EVNA 1T5XA 2XXGA 3SE9H 5HDLA 5I6MA 3L3OC 3L7FA 5B22A 4XN4A 4M6NH 2ZXEB 1HQRA 2DI8A 5EZPA 4OGQC 2J5WA 3QDGD 5AD0B 5DJZB 3VWKA 4NO0B 5DRXB 3MO1A 3CFEA 2ZKWA 3VWJD 4CL7A 3W5NA 2BXYA 4HJ0C 3QYMA 1OAKL 4WU7A 1B0WA 2VWEE 3JQOB 2X1PA 2DZEA 2YXFA 3VGGA 3EOBA 4UNIA 1GA2A 1MLBB 4U7SA 4CADA 1RULL 2EO9A 3IDJA 4HAGA 4O2FA 2NY5H 1MQKL 2XETA 3I6KB 5IBLD 4BQ6A 1NDGB 3KEHA 4XI5C 4PJIA 4ZMLA 4LPTA 1XGRA 2OQJA 3L2NA 5IVZB 2WZPA 1XH0A 5I1KH 4MAUH 4OTXL 3UYPA 5FKPA 1GW6A 2D3LA 3ARQA 2GTWB 4PHXA 4G80B 4KUZL 4HZAA 4N1HB 5J6SA 5CCJA 3KEDA 4OB5H 3EYFA 2DN7A 1A7QL 5KVEE 3B3IA 3PGCB 4ETQA 2CLVB 2CRZA 3LDBC 3MROB 3LS5H 1XSKA 1E30A 4L3FA 1IJNA 4DN4L 4DPBX 3HNSH 4Q4EA 3BKCL 4OFIA 4FZEL 1B88A 1SJEB 1U93B 4XPTL 1CE6A 3U9UA 3QQDA 3FAXA 3OMIB 1Y0LB 3VXNB 1QSEE 1BG1A 3V6ZB 4PJIF 2E9WA 1RJZA 4KJQC 4KKBC 1G94A 4QXTA 5L2JB 1TO5A 2PR4H 4M1DH 2AXGA 4KXAA 1UWEH 2WVVB 2XBZA 5JNYA 1RIUH 4G8EA 1C8PA 4LKCA 1S9WA 4RFEB 1E5YA 1RZGB 4APQD 1HQ4A 3BT0A 4URKA 1MRDL 2VXQA 3N1MC 3ZXAC 1MCQA 3SE6A 2WXHA 5FKAB 3RTQB 4AYFA 2D9QB 3HHSA 3PWPD 4G6FB 2VQ4A 4J4PA 3NCWA 4FL4C 1XXFC 3RWHB 1IE5A 3BKYH 2ZSVA 3Q5TA 4GIPD 5SX4H 4HZ1A 2WLYA 1F1DA 4R97C 1MH5B 4A2LA 1Y07A 4PBDA 5DMKB 4XP4H 5ICYA 3F6IA 3SKNB 5KSAB 1FH2A 2E9GA 4OUUA 2F53D 2C4FU 2X2HA 4KXDA 1WBZB 3VXOA 5HYJB 2ZOWA 3ES6B 5HI4D 3PXLA 3V4VA 5DCCA 4N0CC 3P0VH 4HK3N 2C1OA 3CQFA 2NTFA 1V3MA 1T1YB 3PV6A 3WNPA 2WNKA 2X4TA 3U9PH 2XWXA 3HBPA 4G7YL 5E9DB 3PHQA 4L1DA 2JTYA 3CHXA 4NS0A 1QLFA 2J8UB 3BSZH 1KLGA 1KFAH 4GXVH 4IS6B 4Y9EA 5C7XH 3OAYK 3CN4A 3BT2H 3L8QA 4OD3H 3GO1L 3QCTH 2OSXA 4JKWA 5DJYA 1KJMB 1E5AA 3HC3L 4D9QE 4A39A 1UA7A 3APDA 5BOPA 3F6JA 3L9RA 1IL1A 2DM2A 5D7JB 1KB3A 1FGVL 1JWUB 1KC5L 1ACYL 7PCYA 2IH9A 5HYJE 1R24B 3GNML 3WHE0 5L0QC 3HNTL 4LKXA 4ZAKD 3N42F 3RY6C 5HP5A 4OLXL 5CJBA 4N8VG 4XNUH 3MFFB 5DZVA 3X1BA 4UV7L 1WRFA 2AAVA 2MPAH 2F18A 5E9DE 4R26H 2VLRB 1OT4A 1QYGH 1Z2KA 4RSVA 1WK0A 4X5WB 2QLVB 1G7LA 5G5DA 5G4MA 1BXXA 5CD5C 3FQ4A 2Z31A 3IU4L 4KKQA 1IKNA 1Q0YH 3FB5A 3ARRA 3L48A 4MHHG 4V2CB 4F57L 2DKUA 4IDJL 1OV8A 3KYMA 4ZW8A 1DSFH 3ZMEA 5KSUA 3ELQA 1KY7A 1AHWB 2GJ6D 4L2LA 5DK2B 4XVTL 3LOWA 2CXGA 4MAYA 2I9LB 4NQED 3NJIA 4NAQA 3OHXC 3THMH 1MQ8A 2VXSL 3QRFM 3RWCB 3SY0B 1QD0A 2OMZB 3PHOB 3PCYA 4LLUB 4U7MA 4YGVA 4R2GB 4WW1B 5KYNA 5IVNA 1RZQA 3QJQB 1RVFH 1N9PA 3CN3A 2BIIA 3KPQB 1JXGA 4HJUA 2A2QT 1PQZA 2NR6A 1QSEA 2VLRE 4I3RL 4J1UB 4PJHA 4PRBB 2YD5A 3RDTA 4ZX3A 5I8CA 1XZ0B 2GJZA 3IEAA 1MFVA 4PBXA 3FO0H 3OKOB 5F3BA 3BJLA 4H0HB 4RIRB 5EZLB 3UZVA 3DJ9A 4JY4A 1EZVX 2HFGL 4AL8L 4MASA 2AQPA 3N44F 1OOAA 2J71A 3V55A 4KK5C 1KGUA 3UPRA 3ILDA 4LARL 2OZ4A 1QNZH 1UA3A 3ARFC 5HDWA 2R15A 4ZUUA 4H13C 1ERNA 2N3JA 2IXQB 2FLRT 1NAKH 3EDFA 4PJHF 5DFVD 5ANHA 4XXDB 1OAZH 2Q1EA 4RLDA 3SHSA 4DEPC 2ZCKL 3QUMA 1IM9A 1JPSH 4XP6L 5I1LA 1NCAL 4RGNE 5FECA 5EIIG 1RMFH 1C5BL 3T1WA 1KZQA 1NCDL 1PF3A 2CO2A 3O45B 4PAZA 5FR3A 1HNGA 1ZDSA 2H45A 3IGUA 3P9MA 4JM2D 1YUHA 4QMEA 4GMSL 2Y23A 4LMQE 3FN0H 4NN6B 5D7SH 3RHWK 2ARJA 1IQWL 3MJ8B 3BP7B 1JI1A 3P4NB 2XOTA 4F3FB 4D0CB 4RWYH 1T66C 4NPYA 3BRGC 2JB5L 4CBPA 2ZAIA 3MRIB 4LSDA 4HXBL 4G1MB 2EVGA 4L9DA 2IC2A 1BX2A 1CE1L 1MH5A 1M42A 3RU8L 4W93A 5GRUH 1NL0L 1UATA 1IV8A 1S9YA 3KYKL 1M05A 3HMXL 5EU5B 5D7KE 1MRFH 3A23A 4MQSB 1D7CA 1RUML 4LOFA 5EU4B 5HHQA 2V3FA 4FFYL 4N24A 3U0WL 2KS0A 3S37H 4YHLH 5E9DA 2PCPB 4DTGL 3GGWB 3LKOB 1PKQB 4X7CC 3RY4A 2N7SA 4NKDB 4KV5F 1AD9A 2JJUA 4FFZA 2QSVA 1JF5A 1A6WH 4GAAA 5HYEA 4N0FA 4POZD 3WIAA 2LQRA 3ZL4H 1INDL 4OJCA 3QDJB 1NEPA 2VC2H 1SDYA 2GB2A 3G5XA 1Q9OB 3V9EA 3ZKND 5D7JA 5E6UB 3QNXA 1CMOA 1BJMA 1DUZB 2XXCB 5I82A 3FSVA 2BC4A 3PAUA 4M7ZB 4Y5YB 3AMKA 2CPUA 2DMBA 3F12A 3MRNB 4HWZB 3QIUC 3EW3B 4ZPTB 2YMXL 1BGXH 5FYJH 3TCLB 4ZMVA 4LLYB 2SODB 2W9LA 2QKIA 5GS0C 3AT9A 1FF5A 4HJGB 3BFQG 3KPPB 1PKQE 2GBUA 5F1KC 3OR6A 4M1CC 5DGRA 3TNNA 3BW9A 1A9BB 5JW3H 4KVCL 4OLWL 3VTAA 2AJYL 4KZDH 3IFOA 3TBTA 5AW3B 3RWFB 1CI3M 4AIEA 2FD6H 4WIQA 3GDBA 3ZVVA 2RBLA 4Q6YA 2JKJA 3U7WH 1TU2B 4OCXH 2BHZA 4NN7B 2R69L 2WKLA 4LLUA 4H4NA 1RK1B 2V9UA 4P5RA 4FQCL 5C70A 3VFWA 1FE8H 1UACL 4CA4A 1HJBC 4XNYL 2XWRA 5CWSB 4X6BA 3ROOB 4J1UA 1IKFL 4LEXH 5DD5H 3GSNL 4J8RB 1DQIA 3WTWA 1IVLA 2G5UA 2YUXA 3P77B 4RWHA 4ZW5A 5HI5D 1FORH 3RIAK 3K74B 1OARL 4KKCD 4LSVL 4RIRA 5HYQA 2Y2TA 1UZ8A 4GAYB 1A47A 4OLZL 3CLWA 3PL6D 1RJCA 2ICEC 4ODHL 3I6SA 3QVAA 3RBSA 4G9DA 1BF8A 4WWKA 5JR1H 3EYVB 3TTYA 3CLEL 3NFNA 4PRNA 2OMUB 3V4PB 1A4KB 1JF1B 4Y4HB 5IMKA 3SOTA 2X89D 3D8MA 5MENB 4AQOA 1K72A 5BZZA 4LVHC 3EO1A 5JXAL 2VLJB 3KLAA 4Q56A 2XY1A 1XH3B 4YHPB 4UAHA 1SEBA 3DMMC 3EBAA 3HHMA 1G7MB 5B3NA 2X6VA 1XR8B 3QEQE 3VMNA 4OBRA 4OCRL 1VFBB 2PXYA 3LX9A 5C0EA 1MWAL 4KRPD 1MPAL 4PJCE 3ZIMA 2HMIC 1A14L 3FO2A 1GY2A 5ACLA 3B6SA 3NZHH 2VJ8A 3T1FB 3PP4L 3EFDL 5DYOB 4Q9RL 4XP5L 3DOIA 1WPCA 3EGSA 3WNJA 3I85A 2B7DT 2PMZA 3BSZA 2JF1A 2G9HB 3MJ8A 3GJFK 1QFWH 1SXZA 1WGOA 3AT8A 2R27A 3HPLB 2XSKA 4WI3A 3LQAH 4OR1A 1UT1A 2H9GB 5MENE 1TTCA 3GXTA 1FGNH 4HHGA 4WSJA 3R7QA 1P5VB 3CC5A 5K9KA 5EU6E 1A6TB 4XMKL 4EF3A 2ZXAA 1BREA 1KB5H 5D1QC 5EG6C 1LGVA 4IOIB 4PS4H 2F54B 5ESQA 1JIBA 3QP3A 2D4DA 1DJWA 2WB1A 2E6QA 2WGNB 1KYOK 5D72H 4X5RA 5EU4A 2D2OA 3MLUL 3FH5A 1MDAA 5HY9A 2IANA 3T2QA 2X7LB 4AGQA 1IFRA 4J28A 2EIZA 3AQDA 4TTGA 1DO6A 4PBVC 4PCYA 4XX1E 3VXUA 4X6EA 2FZ3B 5PCYA 5DHYA 1AZNA 1T1ZB 4QTHB 4LP4A 4NUJA 5E4AA 3A4FA 4NKMA 1HHJA 2OL3H 3T3MF 3WFCH 4EJ1C 1X9QA 2WWMD 4F7EA 3MLWL 4E9TA 3VACA 1KIRA 4Y1TA 2VDNH 1GZQB 4HKXB 3LEXA 3BDYH 4L0YA 1HI6B 4KROC 5CZVL 4XXCC 4RZKA 2B0SL 3JV0A 1KBWA 2ZQKA 4AKQA 3LN5B 5IFJB 3HB3D 1VERA 3EJSA 4FE9A 3CBKB 1PDKB 2EQDA 2L4OA 3WJJC 4YO0A 5FYJE 4KKRA 1J1PH 3KE0A 2PW2B 4JLRB 4KH9A 4XP9H 3S3CB 4U3SB 4GXUM 3GBNH 1OPGH 3T6QC 3EH2A 5T1MB 1BPVA 1RHHB 3FU3A 4Z3IA 5L8LB 4K0OA 3ZKSD 2CA3A 3I50L 5JW4Q 5FCSH 2VDML 3AM8A 1A3RL 4HWNA 3Q6FB 4P46D 1ECZA 4I8DA 4Z95H 3SE8H 3TS8A 3S8FB 4NM8L 1OTTD 4N2OA 5J1AA 3TM6A 1A6PA 5F7WC 1HTYA 3IDIA 4C56B 5JHDB 1EWHA 1TZHB 1U91B 5I1DB 1AGBA 2AJXL 2DH3A 4N86A 4X4KA 4IRJB 1SXNA 2D3VA 2EKSB 4A2DA 2GJPA 1GJWA 5CR8A 3CHRA 2YHGA 2P44B 5DD0H 1O6TA 1VCBC 2VKXA 3AXIA 5DMJB 1E7UA 4A7SA 3II3A 3O11B 4FZ8L 1DBKH 5FCUH 3WLWC 2H2SC 4G70B 5DURB 2XZZA 2QADB 2YQ2A 2DLEA 3QEQA 4G6KL 3X14B 4J8RA 2X88A 2P8PB 3HLAA 3IMWA 5DT1L 3TBWA 5CEZD 4PJCA 2UY7B 4N90D 1YPZB 1PL3A 1KDJA 3BZEB 4GAYA 1LEGB 3D25A 2Y36L 2DW5A 3FCTA 4P48A 1WC7B 1OD7A 2JELH 3TH2T 3QUYB 4FG2A 3VI3A 2FCBA 4C56E 1E3XA 3D39B 4LQFH 2C9QA 5JHDE 2B1HH 2GUOB 4F8OA 2XG4B 1UM4L 3VFTA 2HLAB 5TGBA 1L9OA 4ANUA 3DSNB 4H5SA 1PZBA 3SE3A 1PY0A 4GQZA 3L2LA 5I8EA 3GYRA 3QIWA 3RVVC 1HHIB 1MFUA 2XA8H 1F3JA 1XH3A 2CR0A 4FKHA 1BFVL 1YEJL 5EU6A 4ZK8A 1ZANH 1G7MA 4PJCF 4N8CL 5G4OA 2NXZC 3QJVB 1S7UA 5HI3D 1N59A 5A7BA 4HAKA 1TTGA 3DXAD 4FADA 3B34A 4DGVH 4EZLA 5IFAH 5JORB 3VI3F 2VQTA 1ZVNA 3BJ91 1BG9A 3BMVA 3TZVA 4CMMB 4OQ1A 1Y6MR 4TQPA 1JNLL 4H7VA 1CLVA 1RZ8A 5IJVB 5DJ0A 2YPKA 3D39E 2NX5B 1BF2A 1BVZA 1JZEA 2BWQA 2FYYB 2ZX7A 4WI0B 1Z3GL 3FK3A 2A1WH 4Y2DC 4DP5X 1FG2A 5E6IB 3NPSB 3TTSA 2HRPH 2BVPB 4PLOB 3RWJA 5FX3A 3O3AB 5EZIH 2EH8H 2VDNB 1DBML 3D85A 4FNPA 1EHLH 5IUSA 3DUSA 1ILSA 2AQNA 2R1WB 1RJYB 4YIQA 3UZEC 2DJMA 5KG9A 2ZOTA 3V9CA 2XNAA 2IQ9H 1H5BB 1LYQA 1V10A 5BUGA 2I25N 1GGBH 3KWVA 4RCAA 2ZXGA 2VN5A 1U8JA 2P5EE 2VO5A 4HEPA 1DBBH 4XN1A 3SE4C 2EDBA 3LEVH 3CUPB 4G5ZH 1YEEH 4XWGL 1OT1A 1F6AA 2YQBA 3GPSA 3KJ6H 4WHTB 1HJCA 4WEBH 4M4PA 2PUQT 2Z7WA 3AXLB 4LLQB 2Z4QB 5F1NB 4N2IA 5D1XC 2F1AA 1DL7H 4B9KC 3HNVH 3VVVA 3MJ7B 5GGQH 4UZUA 3WD5H 1EEYB 2BNUB 4TUUA 4IU2B 4WKZA 3U36B 4QRQB 2CBTA 2NZIA 4HKXA 2HN7B 4FTVD 2B4CC 2G2PA 2VR8A 3Q1SL 1D5MB 1QFOA 2IBBA 2N7BA 2FX7L 3OAUH 1NCUA 4OV6F 4S0TD 1NFIB 1QR1A 5CJQL 2O1AA 1YYLL 3H9HB 2D7PA 1CICC 3T77B 5IB2A 3OZKA 2WUCH 4K5LA 1L9PA 4AYEC 2BHUA 3BUBA 3VYOA 1QHPA 2PTTB 1MCPL 3RB5A 1DSWA 3UEZA 1QABA 5HVHB 2BIHA 4HP5A 4N2LA 4ONOA 2ZWKA 3SDCC 1A5FL 1FNEB 1RUPL 4S2SA 4TLUA 1TTBA 4KJPC 5E8NB 3C60B 2ZNXA 3HI5L 3MA7B 5F3FA 4QHUA 3TBCA 3T09A 4RBPK 4XPAH 3K6FA 3ZRFC 4L18A 1DQDH 2FQGA 5I71C 4FQIH 3KDMB 1JYVA 5IP4A 1JCVA 1SFHA 2OP4L 2EE0A 4XMZA 4PVMA 4NQSB 3K7UA 3B4NA 4X9GA 4WJ5A 3QWOA 3ULSB 2MNJB 5C0BB 2JI2A 1Q1JH 3LZLA 4WI2A 1D5IH 3FQNB 5A3ID 4JMNA 3CDYA 4BV1A 1P5UC 4A66A 3JYBA 5IJKC 5LAPA 5JTWA 5F7FA 4IGBA 3WEXA 2XJKA 4R7NB 4IRSB 5F9JA 5FM5M 3DARA 5EC2B 4HH9B 3BYTA 3L95A 4HIHB 4LT7A 1EEZA 3TVMA 3OPZL 4DEWA 1F3DH 2A6JB 1XGYH 4PSRA 4MQTB 1FN4B 2GUOA 3G6JB 4HHAB 5IEKB 5TQ0L 3OB8A 2HLAA 1UB5B 3ZDYE 5ALCL 5EOQH 2WJ5A 3NJLA 3UTQB 3WIIH 2Q76B 1DVFB 3F2LA 3WNKA 2D31A 1QHQA 2F5BL 3L5HA 3I02A 2WINA 5HJBA 1KCBA 4HUXA 3G5YB 3FUFA 4AH2A 1KB5A 5ABDE 4YXKH 4WRLA 1SXCA 3LNHA 3DRQB 2MNWA 4PJ9B 2A0LD 4Q6KA 1JOIA 2ZKHH 3ZTJG 3QAZC 4CU8A 1MUJB 3H9SD 4M43H 2C34A 3B5HA 4M4RB 3SDXE 5BNXD 2P5EA 3ESNA 3ZKXB 1Z9NA 1MHEB 4MD4A 1FG9C 3CFBA 2CMRH 1T3FB 4ODSL 3TA3D 1LJMA 2FT7A 2UZYB 3DROA 3G6JE 4EQ3A 4NYLB 3C5SB 4JFSA 3IJEA 3GSUA 5AL0A 2OL3A 3WU1A 4YAQB 5C0RL 4NRYB 1HXYA 1S7SA 1JGVH 5DUBA 1R6VA 3OKMA 5JA9A 3SBWA 4DUVA 1SZNA 4FC3E 2D3JA 4W9LC 3ARDB 4X8CA 5SWSB 4DIXA 4FCAA 2A6KA 4YVNA 4O02B 5BOZG 5CILL 2APWA 5A1AA 3PNRB 3NFSL 1L7TH 1IGTA 2YKLH 4HX1A 3S2AA 3BGFB 1WWCA 1ZLWK 3RI5F 1ORSB 3BPLC 5B1JA 3KG5A 2AJVL 4MKTA 4OFYA 4GBXC 1X5IA 1Z5LA 3FRUA 4ES8A 4PRHE 3GDCA 1RLBA 1TITA 4QGTA 1X5KA 2LE9A 3SDDB 4Z3TA 4TRPH 3IF1B 5H94B 2GQHA 4H25B 5DZJA 3CC1A 4JFED 5EUOF 4L48A 4BCZA 2GTQA 2JWYA 3LIZL 4KI5D 1RZ7H 4WTZA 2K7QA 2Y24A 5HGAB 2YD3A 4Y4KD 4DO5A 2YD8A 2EKJA 2NW2B 5BV7H 1BSIA 2APVA 4QT5B 1NEUA 3MRFB 2NZ1A 2ZUQC 4ZFFA 2HN7A 5FWRA 1EHXA 2Y3NA 5E24E 3U1SH 3ULVL 1FFNA 1FO0H 2OMTB 3RKPA 1OP3H 7PAZA 3AZUA 2XI9A 4WGKA 2GEQA 3H9HA 4ENEC 1NCTA 3DSFL 2BWDA 4RMVA 1WAAE 5E2VL 3D51A 4LESA 3S35L 3UEQA 3W0WD 2Z0UA 5DMYA 4OIAA 1RUKL 5IMOA 3AREA 2X4SB 4G9FE 1CURA 1S5IH 5IFHL 2MIZA 2RQ8A 3PDGA 4YDIL 4GY4A 2I60L 5DZPA 2H6PA 5B7EA 1Q9WB 4JHVA 4PY8I 3ZR5A 3PDDA 4XGZA 3BSHA 3MGAA 5D93B 5KJ4A 1QO3B 3DECA 4M8RA 1IC1A 2G30A 1EERB 3EHBB 4WJG3 2X4RB 2EDRA 2ZE0A 5DGQA 5DS1A 2DTMH 3O41A 1H8SA 4S10A 2Y1YA 4L05A 4LSUL 4M62L 4AQAB 3ZN6A 3LSOA 2IGFH 5HGHB 5C92A 4P4KD 2WLJA 3EZ8A 5FUOH 1UFUA 3BC9A 3M7FB 1MCIA 1MI5E 3G5ZB 3ULSA 1FRGH 3VWKC 4RFNB 5EORH 1BV8A 2KYIA 4KZ0A 4UT6H 1UWGL 4ODVH 3D50A 2SEBB 3V6OA 1FNGB 4AIOA 4U0QB 5DK0A 5LWYH 1E8YA 2ZCLL 3DX0A 3KWTA 1PCSA 1OO2A 1F2QA 2K70A 5DWUL 1AIFB 1EO8L 2HG5B 3LN4A 1ZK9A 2BSRA 2CDFB 3ABMB 1OVZA 1KGWA 5E95B 1XF3A 1G43A 3HR5A 5E8EB 1L9QA 4MNGB 3SDXA 3TNMA 4E9QA 1O5PA 1B0RA 4HIHA 4OF8A 3QXAA 3ZDYF 5KUKA 1R3IL 1I7UB 3GWJA 1EBPA 1YJDH 4IBVA 4LCIH 3T0AA 1HNYA 1F86A 4FEMA 2PW1B 3TN0A 1E7VA 2CXKA 4LNRA 4ZMQA 2WBWB 4ZS7L 3MLZH 5CMAB 3GTNA 5EBGA 1JERA 2B59A 3SSGA 1EJOH 4KTDL 5TF1H 4AI7A 5D6DA 5BJTB 3FUJA 4QD2E 5BS0B 3GIVB 3P73B 3K91A 5J7CC 1Z1WA 5DR5L 1MFEL 4AQZA 1I3GL 3BPOB 4WO0A 3B9KD 3PHAA 1KTDA 2ATKA 3M07A 3UP1A 1WT5A 2R9HD 3HAEG 5IR1A 4JFWA 4YDJA 4MNGE 3H3PL 4PJ5D 3SYOA 5MI0C 4QOKD 1UXMA 1V7NH 2ZAHA 1AZZC 1FP5A 4YWGH 1F58L 4PRHA 3E6HB 1KB9K 4O9HH 1XF5A 5H35A 1UKSA 2VIRB 5I5JA 43CAA 1KYOJ 4YHYC 1BQSA 3PPSA 1NGXB 1YMMD 4NYLA 5IMMB 3UX9B 3TV3H 5JQHC 5EEVA 3JV6B 2ICWA 3HE6D 1DQQB 4OT1L 5CUSH 5EA0L 4YAQA 1A6AA 3IDMB 2FWLB 1QOKA 2COVD 2P7TA 3CBRA 4IK7A 1VAHA 5BS0E 4F5CE 1RJLB 5BV7B 4HXAH 2KH2B 5DD3L 2XQYA 4J4PC 3DTDA 3FQ2A 5GS1B 4KX9A 2AEQH 4MB4A 4J6RL 4J3UA 4WUUA 3W2DL 2DM7A 1X9RA 1SLXA 2KLRA 3EOAA 4OGAD 3VSQA 3WNLA 1S9XB 3FUNA 3AG2B 3OLIA 5CU9A 3CSFA 4A67A 1WAAA 3AAZA 4I0PD 1ZS8A 4KQ3H 2BO0A 1IGFH 1MHPL 1U8IB 4YPJA 2NSQA 1SUHA 3I9AA 1QBML 4FQHA 4G9FA 3P4MA 1NKRA 4OF3A 3OSVA 1HXMA 4AQEB 1P7HL 5IJBC 1IGCH 3T3PB 2ESVD 4JDVB 3ASWA 1W0WB 1PU0A 1YEWA 3QRGL 5FFLA 4AEFA 1J8HB 3QJFB 4N2GA 3M1BB 4JRWA 4P0DA 1MY7A 2AEWA 4XC1H 3WNOA 2WP3O 1EMTL 3QZBA 2HVJA 2XX0A 5KSVB 4LHUA 2JIXD 3BAEL 3JT0A 4HFWA 2B2XL 1WAAF 3P4OB 3GSRB 1BBDH 4HKJA 4MMZA 4PGBA 4R4BA 5IQOA 4K94H 1MI5A 3EO9H 4XB8A 4A55A 1SJHA 4IQHA 3OF6A 2KDYA 2YUZA 4BZ2H 5GS3A 4XNQA 2X12A 3MV9A 4FFWC 5DRZB 1U8OA 2VWEC 2C3VB 3MR9B 5IQ9B 1AQHA 2DQHH 3FB6B 3QULB 2Q7AA 5ISZD 5FYKU 2XWBB 3FH7A 3E6FA 2H8PA 3G7TA 1T6WA 2VMDA 3MCG1 3X1GA 1N6QL 2K3HA 4MXWH 4BK5C 4XWOD 1F4XH 1J8HE 1FZMA 3VGBA 2Z31C 1L7IL 2WLZA 5FB8A 1IKNC 5JHMA 1JHKL 4JRXD 4A38A 3GLZA 1G1CA 1D2OA 2F08A 2G60L 3MBEA 5HDBB 3BIBX 1BAGA 1DLFH 1WWWX 2NQDA 4MNQD 2KT6A 2CAKA 4MAYC 1WFOA 1WIOA 4MXVE 2OULB 4N5UA 1I1AA 4HUKB 2E27H 2HKHL 1N8ZB 4X80H 5E00B 3IMUA 1D6EB 4K71B 3WO3B 3AFLA 4YUEL 4X9FA 3IYLW 3LEYH 1QUNA 2D9CA 2N56A 3DBXA 3VD2A 4Y2LA 4XPFL 5GGRY 3ZE1F 1P4LB 2DLIA 4HMEA 4WNSA 1TZGL 3UERA 5MEOA 2JE8A 1KGCE 3K2IA 5K5YA 2NR6C 2HG5A 3VRIA 4OZHE 1MSPA 5I76B 1GTNA 2CDFA 2W0PA 4YHNA 3RDTC 4XMPH 5L2KD 2MEJB 4ALAH 4JFFD 3SJVD 5IESL 1ADQL 1IEAB 2CHDA 4G5AA 4LLVB 5DJXB 3FTWA 3QZMA 2WCGA 4ETYA 4PV8A 4L1HA 4QHLA 1ITBB 3L3KB 4E0RB 4GQRA 3R8BB 1OAXL 1KGJA 4JPKL 3SGEH 2VITB 3MGTA 2WLMA 4GW1B 4ZFGL 3CU1A 3BQUA 4P2QD 3N3EA 4MJ6B 1A7PL 4UBDC 5ELIA 5SX4I 2IH3A 3HI6H 4KK9D 3VFUB 3RFZA 4F5CA 4R4FL 1IAIM 2B8OT 3IN2A 3LZFL 4U3XA 3O6LH 3EZJB 2C26A 4W9DC 3UJTH 3TOPA 3GK8H 4HGKC 4R96A 3VFGH 2Q5BA 1OGPA 4JPWL 4MKMA 1G6RH 3DURA 5GHWL 1RKRA 1C16A 3F7VA 2BSTB 3IGFA 3QNZB 2WY3B 3HJ0A 4M1GH 3MRPB 4TUKH 1IT9L 5EMYA 5E4IA 1EAPA 2VDQH 2YUWA 4GRLD 5IW1B 2NRDA 5HYSB 3IBOA 2GCYA 3ATEA 3PQYD 2O5YH 3QXDB 4JDTL 3EYSH 4X98A 2ED7A 3D9AH 1L9NA 1T83A 1TLKA 1A0QL 1N64H 2A9ML 2FBRA 2P8LB 3J07A 1N12A 3UTTE 1FO0A 5DRWA 1Q8MA 5IEHB 4NN5C 1J05A 5B1BB 1SLUA 1T4KB 2MJWA 4NXSA 1HZHL 5DJCB 1ZEAH 1EGJL 1N3NB 2IQAB 5IW3A 1U8IA 3FTXA 2XQ0A 4NO2B 5GRJL 5IWLA 5T1LA 5T3XH 4LZKA 3EJRA 4AYBA 3P3RA 2IMMA 1BVOA 2FVNA 4JDVA 2UUDH 4IOFC 5ID0B 1F4YH 4XMTA 4DKFL 1HKLH 1B0GA 3VO0A 3FMGL 3GZKA 1R47A 2AGJL 1LEKB 4JFYB 5KAQG 4PLKC 4LCCB 4MVBD 3UAAA 5E1GA 2AQQA 1I8LA 1HINL 3LHAA 3H9ZA 3HUJE 3ZU8A 1F0LA 1RURH 4ZPVB 4B9GA 4Z7QE 1CYGA 1KN4H 3QC5X 4NQTA 3MLPA 5D7JC 4I48B 1J5OH 2CO6A 1A8ZA 5GS0L 4UT6A 4FYQA 4XRCA 1SM3H 2KI6A 2ZICA 4YHOL 4HUCA 5LGJA 3K4AA 3PGFL 3T2OA 3SN6N 3MV8E 4GKSB 3TYGH 3ZGHA 5ANME 1FJ1A 4HUUA 3C9NA 5I19H 1RIHL 4FJYA 3U2SB 3K4DA 2OAAA 5EOCJ 4DP7X 2QKIC 3DUUA 1NGYB 3LPPA 2YEVB 4OZHA 2NY5C 4PI2A 2IIJA 3F85A 3T08A 1NCBL 5BO0D 1YEGL 5I75C 2Y5TB 3KPMA 4YDVA 5DC9B 2R4SL 1OAKH 5IK3A 5C0AD 3NAAL 3W56A 3A4DA 4PJFE 3J7HA 3WFBL 1XGTA 4YK4B 4DP0X 1BD2D 1RULH 4JFXA 4LSQL 3TH4T 4IHOA 2BIOA 4OAWA 2OTWA 1ES0A 2CIKB 2O5XH 5TK2A 4L1LA 3WBDA 2FQEA 2XPZA 3IE9A 3ZBMA 2WM0A 2CJSA 3EIFA 3RTQD 4JAMA 1F2XK 1U4EA 2XFXB 4OTXH 1W6LA 4QJ5B 5BMFL 1GZPA 4DKEH 2N1TE 3GEWB 4KUZH 3PXJA 3UTZB 2PNDA 4LBAA 1A7QH 3EXLA 1Z9SB 4HSAC 1X5XA 4RGNC 4L2YA 3GSVB 5KSAD 3TF4A 4LNVA 2CNYA 4PRAB 5AOJA 5HPMB 3RGVD 4LEOA 4DN4H 1DQLH 2ALWA 1Z0MA 3BKCH 5BVJB 3CN2A 4UI2A 4F91B 4XPTH 3L3KA 2QVMA 1CD8A 4XTRC 4WF7A 4DWHA 3WI9A 4BCYA 1DEEB 4U1JA 5EDXA 2VITA 2CJ3A 2OMVA 1ACZA 4WWKC 1TJIH 2KUTA 1VFAA 1G5GA 4MJ6A 1KF9B 1UURA 1F02I 3REVB 3MLSL 4K4KA 5DJ6A 2DF3A 3O81A 3Q8CA 4HJIA 1FZOB 3MXWL 5BUAA 4ZD3H 3CDZA 1A1NB 3UTTA 1KIUA 4WI5A 2BSTA 3CSGA 1YMHA 1QSFA 2J72A 3HCVB 1Q9LB 4GUCA 4DSYA 1UH2A 3SO3B 2QSCL 3MA9L 1DDTA 3C6LB 3VDAA 4BCXA 5IW1A 3EYQD 1J87A 2E7LA 5CEYB 3U82B 1D6VL 1EA9C 4M6AA 5FA3A 4UIMA 2VQUA 3EJYD 3OGCA 4N9OB 3IJSA 4YXLL 1URZA 4XNZC 4G43B 3DOSA 1IC4L 3GSXB 3RA7L 1DVXA 1IAKB 3NJVA 1X5JA 2FATL 1HSBB 3BWUC 4DJMA 4PWGA 5ICYB 4LRIA 2NSXA 3W39B 2H1PL 3BPCA 3HUJA 2IWKA 1ZLVK 5LG6A 4G7YH 1OTSD 3NDZE 3RPIA 5HTSA 4B60A 5CU5A 4PP1D 5JLZB 3OKEB 3X3GL 1T7ZA 2HT2D 3ZYZA 1N3NA 3FB7B 3T2NL 3GO1H 4YC2B 3DIFA 5C0CB 3VG9C 4BZ2A 4N0UE 2OCJA 3HC3H 3V4UL 3MV8A 5T3XE 5ANMA 5D2LE 4QHMB 2WLLB 3AU1B 4LFHG 2FX9L 1FGVH 1LP9F 4E9SA 1KC5H 1JHLL 1ACYH 1P69B 1AQDA 2TSBA 2JJTA 4OIIL 3E8VA 3HUJF 3GNMH 2AV7B 4P4RB 2MCPL 4OLXH 1JPTL 4JDEA 1QEWB 1T0NB 2NUTB 3K6OA 4LFHD 1F3RB 4PJFA 4UV7H 5JOPD 2ETWA 1H8NA 1BWWA 3RURA 3RL2A 4A7VA 5IGXL 4DUXA 4BA8A 1P84K 2R2HB 3IU4H 4MD0B 5BZDB 2K0RA 4NFCA 4F57H 4IDJH 3AWFA 4Y5YC 4P23B 9CGTA 2X70B 2HAZA 3KNBA 1TZIB 1AZRA 4XVTH 5J3HD 2DQFB 1NSNL 1U8LA 4JVUA 3RRQA 1E42A 4ODXB 2JJSA 3EJCA 3QDME 4I89A 1JUFB 2EP6A 1OP5K 5EO0A 1YNKL 4DVBA 2VXSH 2PWHA 2C7UB 2EXYC 3AM8C 4I18A 4NQDD 3UPCA 3NJGA 4HJ0D 2HWZH 3ABZA 2PWGA 5GGSY 4AIZB 5LJYH 2FK9A 3NN8A 4I3RH 4ONHB 4NC0B 3RNQB 3VB9A 3ZOAA 2TSAA 1S78C 5EOTA 1IBZA 1F8TH 1WFTA 3FFCD 3BH4A 4P5TA 4NN7C 2DWSA 4XI5D 4TVPD 5JW5A 4R6UA 1ZIAA 1KIPA 1S9VB 1I3RB 5FYLD 3WDJA 4X7TA 1X4ZA 1K4CA 3AVEA 2HFGH 4AL8H 5GSVB 1E27A 1CGUA 1OW0C 2CJTA 5HHOD 4WFGD 1G6RA 2GK2A 2OX5A 3RWDA 3IDGB 5I0ZA 1XF4A 5I17A 3WKYA 4LARH 4JFZL 3GB7B 4AZUA 4O2EB 3U83A 3SPGA 4PRAA 3ARWA 4B27A 1PPIA 1EFXD 3EGXA 1OP4A 1UD5A 3GT6A 1UEMA 3JSSA 4PRDB 2ZCKH 4WI4A 2ICCA 3MOBL 4XP6H 4XMVA 2KMWA 1INEL 3S7GA 1KB9J 1NCAH 4I3GA 1UH4A 2UY6A 3QZWG 1C5BH 4KJQD 4DP4X 3VX0A 1NCDH 3I74A 5JIQA 1UOWA 3MLXL 3GLAA 3VFMB 5FM4A 3MJ6A 3QA3A 2A6DA 2XVKA 3SE3C 4F20A 4GMSH 3QIWC 3VGEA 3TU6A 1OF0A 3T4YA 1F11A 3C09B 5J5EA 1IQWH 3NOIA 4ELDA 4GAGL 4QRFA 2RB8A 2OLDA 3KYNB 4EN3B 1C08A 5D1ZA 2VUOA 1RL1A 4YNYA 2JB5H 4N0UA 4KKLC 4HXBH