2EDMA

Crystal structure of envelope protein vp26 from white spot syndrome virus (wssv)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
161
structure length
161
Chain Sequence
SVVANYDQMMRVPIQRRAKVMSIRGERSYNTPLGKVAMKNGLSDKDMKDVSADLVISTVTAPRTDPAGTGAENSNMTLKILNNTGVDLLINDITVRPTVIAGNIKGNTMSNTYFSSKDIKSSSSKITLIDVCSKFEDGAAFEATMNIGFTSKNVIDIKDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords 22kDa structural protein VP22
publication title Crystal Structures of Major Envelope Proteins VP26 and VP28 from White Spot Syndrome Virus Shed Light on Their Evolutionary Relationship
pubmed doi rcsb
source organism Shrimp white spot syndrome virus
total genus 32
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2007-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2edmA00
2ED6A 2EDMA
chains in the Genus database with same CATH superfamily
3LSOB 3QDME 1UA6L 1GYWA 4TV3A 1E42A 3BC9A 5GGVY 5KVEL 1HC1A 4K7FB 4FA8A 4N0RA 1IL1A 3AUVA 1N4XL 5BS0A 1S78C 2MCPH 3JV5A 2YAQA 4UM9B 2DD8H 5D7JA 3TJHD 1MNUH 4BKLA 4IOSA 4URTB 3C9NA 3EYQD 5HI3D 3HG1B 1E4WH 1ETJA 2GTQA 2D3LA 4U6YB 1EXGA 1KCVH 1FFPA 2FBOJ 2XG4A 3FSOA 4JQVC 2VDOL 3OKLB 1GGTA 1DFBH 1QFUL 4HU2A 4YBHA 5JDSA 2CKBA 4AYSA 1NEPA 2C5DC 1ADWA 5K69A 4LO9A 4KI5F 3V6ZB 4K23L 4WJG3 3ZTJG 3FZUD 5EN3A 2K4WA 4MJ5B 3I50L 2LQRA 1EJ8A 2PYEA 3D2TA 5K59E 3TBCA 4I8DA 4MGXA 2WBWB 1UVQB 1F3DH 4R90L 4GG6E 1P6AB 3P11L 3TT1L 2X05A 2VDKH 1HDMA 3GSVB 5EC2B 4P06A 1SY6H 2AERT 1R1CA 3TPUA 4Q2ZA 3GBDA 4HKXB 1NTDA 4Y5VC 3U30B 4Z5RB 4JFEB 4K5PA 4EOWL 1FNEA 1RKRA 4UT9L 3MMEA 3BAEH 2NZIA 1KZQA 5IQOA 2KH2B 4NM8H 4Y4KB 1KXVA 5I1HL 3H7BA 4YMPA 1JTPA 5IJDC 2KZWA 1U8KB 3DX2A 5E1HB 1GPOL 1IAOA 2CRMA 1IE5A 2G75A 2B3RA 3TYFA 3L3DB 4NAJA 5J9PB 4GKOA 4Z7VF 2X6VA 1JGLH 1WFNA 5A6MA 3U82B 3WE6B 5B7EA 2HLFD 3RPIA 1A6VH 1QWNA 1KJMB 4M7ZB 2R29A 3BGMA 4DGYH 2VR6A 1EAPB 2E86A 1ZD6A 3A4FA 4LSRH 3V0HA 1T21B 4WDIB 3ZYJA 3L81A 3M7OA 4FMKA 1P4LB 1RVFH 2NX5B 3VTTA 3ILEA 3P0VL 2ITDB 1AXTL 2FSEB 4RFOH 1E30A 5GGTA 1AXSB 5D5ME 3U36A 4Y16C 2HJFA 1PSKH 3JV6A 4FNPA 5B1JC 3ZQ9A 2FR4B 3MJ7B 4XRCA 1VADB 1OQOA 2NRDA 2V3DA 4Q89A 4TPRH 2HFGH 4PLJC 1AC6A 3IKKA 3GI8L 1GSMA 4F7PB 1QBBA 2ZOWA 4NQCD 2EICA 3ARDD 4JFWA 4ZNEE 3I6KA 1OGSA 4I3RL 1SLXA 1GAFH 5T5NG 3V5DA 1DQML 4WI7A 1CT8A 5L4FA 2AV1B 1JZ7A 3MPCA 4JPKH 2EUWA 2XVGA 4P2OD 3PWVB 4NKMB 2OJZL 2WBJA 3H42H 4X8CA 4ZMYA 1SN0A 4WFFE 3MKKA 1TIUA 5KAQG 5I1AB 1WBXB 4BGDA 3MGTB 5EUOF 4F15B 1U21A 2WMPB 1M1XB 3QQNA 3M86A 4WNQB 1KDJA 4PLOB 1MREH 2OMVA 5I1LB 5D7IA 2WLIA 2QQNH 5EC1B 5JIPA 1G6RL 1T0NA 3TYGL 4MMXB 4PY8J 1O7DC 1P1VA 4I9WD 4KDTC 4UOJA 4UQBA 4YL4A 2WXJA 2AXGA 5ALBL 1MNNA 2N0MA 2IDUA 1DDTA 2DLFL 5L4MA 4F7CA 5CBEB 3RGVD 5D2LF 4NYLB 2VISA 3GEFA 3ZXAC 5I26A 2AKRB 3VFNA 4DVBA 2X4UA 1T20A 2NT1A 1AMXA 1U2HA 3SE8L 4HMCA 1XB3A 1KIQB 3QHTC 3UTPD 1N6QH 8FABA 2YBGA 2RTTA 3P0VH 4PN6A 3R7RA 1ZJBA 3IFPA 2CRZA 2C3GA 1KG0B 5BUAA 5BZZA 3IF1A 1N8OE 3ZUNC 4JRFA 3RHWK 3OKDB 4XBPA 1OD7A 3N1QC 1AIFB 1JNNL 3H0TB 3QWNA 1I3GH 4U3XA 3T0EE 1IQWH 2R1XB 3II2A 1ZXQA 5D1ZA 5F8QC 2HVJA 3TGXA 4LVOC 4K94H 2E47A 2EABA 2V9QA 4FG6D 2LT9A 1HVXA 1XIWB 1AG6A 3VE0A 5IHWA 4OFDA 3UZVB 2P5ED 1H5BC 3EH4B 5DHYA 4MAUL 3SKNB 1INEH 3QG6A 4FOMA 1BWWA 5B3NA 1XGYL 4HUVB 5KZCD 4POUB 3R7QA 1OM3L 5CGMA 5DRZB 4E41D 2DIAA 3D52A 4NKQB 2GJJA 5C07A 2AXHA 3O0RL 1ZT1A 1WLHA 3ARTA 5DS2A 2QKIA 1RIUH 3VWKD 1WIUA 1F45A 1PF3A 3O81A 1NGPL 3QISA 3DTXA 3D1MC 1R0AL 2WXRA 3MFFA 2NQCA 3MTXA 1CLZH 2XACC 4MD0B 1DBAL 2VMEA 3VMOA 1GW6A 3NN8B 5SWSD 2VM3A 4LARL 2NNRA 4KDVA 4F7EA 4Z7AA 3Q0HA 5H94B 2AJUH 3F7LA 5AKRA 1FZKB 3TEYA 3L3KA 2V2TB 2NXZB 4NCC1 1JV2A 2VL5B 4HXBL 3SO5A 5SWZA 2H0PA 2WBXA 2QVIA 4DW2L 4ONGL 3VFPB 4PJ9A 1S7TA 4A6YA 1JXKA 1PEZA 2GBAA 3BZ4A 4PVMA 1DQJA 2WZ5A 1UOKA 3MLRL 4HIHB 3LZLA 5TDPB 3LKRA 4N8VA 4M7LL 3SCMA 4HU8A 1UA3A 4H40A 4PIRF 1P7QA 2H0JA 1JG9A 5AOMA 2X88A 4HDIB 3ALXA 4ZDHB 3O6LL 1BVOA 1BF5A 1PL3A 2I07A 5BVJB 3MJ9A 1RXLA 4UINL 1TNMA 4JHWL 1G6RB 4OCMC 3MCLL 3KVQA 1DYZA 1RV6X 3WDIA 1YZZA 4RLDA 5AVSB 4M6NH 2A5UA 2EXWC 3HZMB 5IIEA 1OXYA 2BY0A 1AOHA 3OAZK 5CHNA 2UVEA 3SKOB 4H2AA 1PCSA 1OM3H 2YPKA 2R7EA 4G9DA 2YBRA 4IK6A 2WINA 1U6AL 2FEJA 2IPKB 1H9VA 1S9XA 3OGOE 4OLUH 3TURA 1D7FA 2FCBA 2VLJD 1NFAA 2LFGA 5J13B 1QBMH 2ICWA 2XFXA 4OLZL 1GKEA 3VXPB 3NSYA 5FYLL 2GSIA 4OCWL 5IJKA 2GTWA 2XOTA 4R26H 1Q0XL 1XGZA 3T8MA 3DK0A 3F7VB 3GWJA 3I9PA 4JDZB 4N0CC 1NCNA 4ODHH 4ZMZA 5KBPA 4R84A 4WU7A 2HRPH 4HJIA 1FJ1A 1IEHA 5INCA 4AIXA 3NCJL 3CDGA 4AM0A 2F8OA 5TFSL 4ENZA 2O5ZL 3R4RA 4UM8B 4XE0A 5D4JA 3EYSH 2OXHA 2YAMA 1LE5B 1UJ3B 3MC0A 4B9ZA 4ANKA 1WWAX 4J3XA 5C7XH 3ZQXA 5T1DL 3F7QA 1H0DB 5CCKH 3FFDB 1YN6A 1S4IA 1A3ZA 4MS8D 1QFPA 4KK5C 4PJFE 3LS5H 3T1FA 3TPKA 3DGCR 4QJ4B 4YOKA 4E5XA 2I69A 3DA0A 1RJZB 1NCGA 3AQDA 4U1GC 5E00A 3KPNB 2WLLB 4ZS7H 1JYNA 5FPIA 3R18A 1FZMA 4OF8A 3GB7A 4WO4B 4X2UA 2GJ6B 3EBAA 2ISDA 2L8AA 1DJIA 4R7LA 3KHQA 4TOYL 1FO0L 1FH5H 4PRIE 2OSYA 3B8YA 4PJAE 2MOQA 1B9ZA 3DI3B 1ZAGA 4FL4B 2B1HH 4G7RB 3LQZB 1MXDA 4OLWH 1XL6A 3EGDB 3HMXH 1NPJA 2VW4A 4JDVB 2EZ0C 3RY6C 1OPOA 1O6SA 3FB7B 5GRVL 3QJXA 3OV6A 4NERA 4XNYL 1CDGA 1LO3L 1MHCA 5I6MA 4AL8H 3PE9A 3QUGA 4BZ1L 1G1KA 2GSMB 1SEBB 3MNZA 3G08A 3NSDA 3CTTA 5FGBA 5J6SA 3UTTD 4MA8L 2WLZA 3O0LA 4G8IA 4AIZA 4JFUA 3NCEB 5G4OA 1HE7A 5GGQH 4ES9A 4NWTL 3BPNC 4OIIH 2YK1L 3WHXB 4WEBL 5CEZD 2VB5A 3V6OA 2KLRA 3IDXH 2HJLA 4GKNB 1MHEA 4WUUB 3QPXL 1J86A 3AY2A 2QDVA 3CN3A 5GIRA 1BLNA 3BRFA 3I2CL 3BH8B 1YQVL 2IC2A 1A2YA 2BVPB 5I5MA 3IBEA 3K2MC 3CX5K 4KQ3H 5CEXB 2X2IA 1FNAA 4HIIA 3ECVA 2Q7YB 4J28A 5D7KE 1SBSL 1MJ7L 3UMTA 2VXVH 1VFUA 3S3DB 3VI4A 2ENSA 4ISVB 4XBGA 3MHZA 1B3JA 1NCCL 4G70B 5GS2H 5FFLA 1YNTA 5HHXH 4KH2A 1EHLH 3B7UX 3PL6D 3F7YB 1HWWA 1NUGA 3IE9A 4PGBA 1TYJA 2EADA 3CVHA 5AFAA 2F2HA 3IEAA 3HI1B 3K5RA 4NUPA 1KGUA 3D69A 1A6PA 1HZHH 3WJLC 3MSPA 3G6JB 1IIKA 4L8DA 3U1SL 1TYEB 3K6OA 3T5WA 3D51A 5AG8A 2ZONA 3VX0A 1C9SA 4NGHH 1JJUA 1O6TA 4RWHA 1VFAA 1J9SA 3DV6B 4IRSA 4LAQH 1PJWA 2OMUA 5IVXF 3RIKA 4RFNC 4O2FA 4IMLB 2E6PA 4LKXA 4F8TA 4CN1A 3QUXD 4J3OC 3IGAB 5CJQL 5GJSL 3O6ML 1RJLB 4XMLL 1XQ4A 2WTOA 1FV1B 3OF6A 1R6VA 2V7NB 2VXTL 2QGDA 1O9ZA 5JZ7D 4JM4L 1NMAL 1HSBA 3SKJL 3HFML 2HUEA 1HKFA 3DUUB 4FI8A 5BZWA 1WZKA 4DVRH 4M1CD 2XPZA 4Y2DA 3HN8A 5KOVC 1L9MA 4JEGB 2EH7H 5FOBB 1R3LA 2WXOA 3F8UB 1ZS2A 1TMCB 4WTXA 4ZS6D 1KY6A 2EXYC 1S7VA 2C7FA 4PJGF 4S1SH 3IS1X 3Q1EA 1MJ7H 1MUJA 1TEGA 5I76A 3ULUD 2J4WL 3X12A 1WS8A 5FV1L 3SDYH 4ALAH 1TCRA 3FCBA 3MLSH 1PU0A 2E0PA 1JHTA 3STBA 1FF5A 1S3RA 1J5IA 4TF4A 1D5ZB 4MAYB 1YUHB 3MNVA 1BAFL 5H35A 3T2NH 1YYLH 5IB2B 1UWYA 5LDSA 3QGVA 4UQ3A 1LP9E 4ETQA 2K0RA 2XWTA 3OPUA 2DYPD 5HGHB 3F65A 5IJBC 2PXYA 4XMWA 1EJ6A 3BX7C 4L8CA 4OQ1A 2ZYIA 3QDMD 4XTRC 1M3JA 3L08A 5CIPA 2X6UA 3ILPA 1JHKH 4M5SA 4MCNA 4PWFA 2BVOB 4QEGA 2OX5B 1JNHA 4W6YB 3F62A 3P77B 2GCYA 4JB9H 4OFYA 1DEEB 5AL8A 2CIIB 4WI6A 4JJ5A 5H8DA 3TBSB 3IMRA 2R0LH 1FQ9C 2JI2A 5F7YC 1D7BA 3E0GA 4I4WA 1DN0B 4LLAA 5IQ9A 1IM9B 3B2UC 1OE1A 4GQQA 4XN5A 1QABA 1NAMA 3KNBA 4GEJA 4P5TD 3DVIA 3ROLB 1S9VA 5FA4A 2AEIT 3BJLA 4QTHA 3QXDA 3MCYA 3SJVA 2DQUL 2FX9H 3GDCA 3IMSA 2I85A 4IKKA 4NQVA 1BEYL 2A6IB 2OL3A 2H7WA 4RAVB 3N6YA 4FYRA 4BSJA 3S36X 2G3XA 4FDWA 2YD4A 5D9SA 4U6VH 5KBNC 4APQB 3EDEA 4HUKB 5T3ZL 1EHKB 1A4KA 3VUAA 3B9KC 3Q8BA 4NKOB 3UBHA 4D9LH 3GMMA 4HA1A 3OAUL 5KBLA 3APCA 1RL1A 3VWJA 1QVOB 4DN3L 3M46A 4WSGA 4A6YH 3RWIB 5D2NC 3A6BH 4BFJA 2X4TA 3F3HA 3Q2NA 1Q9LA 1KJ3L 2OLDA 5C0AB 4GT0A 1AZVA 4F80A 5FFOA 3KGUA 4JQIL 4TNVF 1QR1A 5DFVD 1KLUA 4X50A 5CCGE 4IRJC 3WNMA 3FPYA 1QA9A 3MUUA 2WKGA 4JVUA 1XF5B 3QIBC 4GSXA 4YK4B 4F7MA 2B9BA 5T1LB 2XA8H 1MFCH 2ATKA 3L5WB 4PPTA 5DHVH 1AE6L 2Y7SA 1GVIA 1YNLL 4KK9D 3K8KA 3VJ6B 1KLFA 5JIQA 2ZKYA 3AT8A 1JVLA 1ZVNA 1RQ5A 3NCYS 5LWYL 3KD4A 1R47A 2WUCH 3D3VB 1WJ3A 3IU3B 3QDAA 3PP4L 2H2PD 5E9DA 3LRHA 4YFLI 3MROB 3QZNA 4C4BA 4FQJL 4XC3H 4GKZB 1RP8A 3GLAA 3U46A 1M57B 3L95A 4GXVL 3RDTC 1WAAF 2OA9A 2IDFA 5HDQL 4L37A 1CGSL 1EVUA 2JXMB 43CAA 15C8L 5TQ0L 3HE6C 5FYKL 1I9JH 2ZKXA 5KYWB 1FE8L 2VZOA 1WYJA 4GRLC 4KRMB 1G7JB 3WEMA 3HKZA 2KLSA 4MXWL 4DERA 2BZDA 4WFFD 1OPGH 4KH9A 5AVZB 4IM8A 1OM9A 3SSGA 1THCA 5EDXA 1A7RH 3EYVB 3ARPA 3ZTEA 4J5VA 4TNFA 4QRSB 4WWKA 4EBQL 5KEZA 1M4KA 4FZEL 4PTTB 4RFEA 4ZRGA 3RPBA 2IFFL 2P8PA 1OLLA 4P23B 1DVFD 1SMAA 1W0YT 1MCOH 2VTFA 3FO2B 4OLXL 1TO4A 2Q3XA 1YG9A 4QHMA 4ZAKA 1DO6A 5HHOE 3IKCB 3IM1A 1QI3A 5FWRA 3WKMH 4ESKA 2FNBA 3MRHA 1ZTXL 3FQXA 1E3FA 2CCWA 2WQWA 3VXUA 5DD1L 3ABMB 2CXKA 3IJHA 2E7BA 4I18A 1PGRB 4PJ7E 1S7RA 1EVTC 3HUJF 3KBFA 3PWJB 4NZ8A 2EINB 3BSZL 2I26N 5B8CC 1BOGA 2WAQA 4JMXA 5FW6A 1DUYB 5T8IA 1E4HA 1G9NL 2EDMA 3K72B 4K3HA 4PR5A 1KWKA 4GMSL 3I3DA 5DUJA 2Y72A 1CR9L 1NDMB 4B7LA 2BZCA 4JE0A 2IPTL 4K3JL 4QRRB 4GO6B 5AW6B 3CSGA 1FVEB 1D6EB 4KC3B 4QO1A 3T0ED 3VXMB 1YY9D 4CBPA 4JBSA 2V5MA 2YXWA 2FWUA 3D85D 4R96B 2PP8A 5GSRB 1AANA 4G8FB 3VFMB 5FB8A 3WN5A 4D0CA 3R0MA 3UH8A 4DGVL 2F7QA 1T4KA 4U6HB 4F9PA 1QRNB 1QFWH 2V3FA 4YHIB 2NY3B 2BNUA 1UXLA 4PJBE 3L5IA 3TS8A 4HFWB 3T9WA 1U8PA 3MLZL 1I9RH 4ERSL 3FN3A 2HKHL 4NCDA 5FUZL 5IR1A 3ZMRA 5KANG 1NMCB 3FTWA 1UUSA 4R4BB 3P9LB 5HYSG 2P5WA 3UCQA 4FZEH 4N86A 1HAUA 5D1XE 3IETA 5BW7A 5IW3A 1XSKA 3D48R 5CM1A 3U9UA 1TJMA 1GIGH 4WI3A 3CU7A 3TVMD 1ZSDA 4PP2B 3LY6A 3ZKMD 4Y19B 4OGXH 1E9OB 3LNIA 1RUML 3RILA 4UQCA 2W0FA 3SPVA 4OF3A 1J9RA 3T77B 4PY7A 1IGFL 2K1MA 2C9UA 4Z3JA 4DP7X 4ZD3L 2GY5A 3PS6A 4WTWA 3A3YB 1JGVH 4UUJB 1RU9L 3DVNA 4IIQC 4WIQA 3V7AG 2AJ3B 3WV0A 3VI3F 1KB5A 4HH8A 1USQA 1MN4A 1MAJA 2NY6D 3CVHH 4G9FB 4HIJA 1E6JL 1MZYA 1PLCA 2ITFA 4BGLA 1M6OA 4PSPA 5GZOA 2XZQH 2FRGP 4KRPD 4B3VA 4N2EA 1JZ4A 4KMTH 5CJXC 1IBYA 3V0EA 3AREA 5EF0A 4KXAA 3FONB 5TK4A 3FU5A 2NTFA 5LLIC 3M88A 2C7UB 2ZUQB 1CICC 2YC1B 2KZBA 1IZJA 1TETL 1A7PH 1T7YA 1Z3GL 2P9RA 3A6OA 3P4NA 1JPFA 1DQQA 4FHJA 1QLEB 3AWGA 5IFJA 1D9KD 3N1PC 4ELKB 3R4DA 1EH9A 1YDPA 4ICWA 4PJ5B 3L6FB 1T83A 5FUZH 1PCXA 2WN2A 3D18A 4PCKA 4X5QA 4F37K 1WZ1L 4JN1H 5B7FA 3GT6A 3JTSB 2XG5A 3JWOL 4NP9A 1ID2A 3AROA 3L8QA 4Y2OA 3CZFB 2WWMC 4FJYA 4H8HA 1ZS8B 3P0YL 5KYYB 2AJSH 3DNKA 4HHWA 4HCRL 1FNSL 3ZE1E 1ECYA 5C2UB 4JR9L 2V0AA 4HBCH 4MCYB 3FFOA 1CD0A 1TQBC 1BX2B 2BRQA 3IYLW 3EGSA 4LF3A 5GRJH 4JKPL 2DRUA 2MCMA 4OLVL 4OBSA 1JHLL 4K7PX 1EBPA 4WV1C 4G6FB 4FLSA 2G2PA 2WXMA 4JPVH 3EXLA 2ED9A 3UGEA 1RUAH 1OT1A 3L3JA 4OI8A 4KI1A 3MZGB 2D9CA 4LSTH 3AB0B 1CMOA 5J11B 1JNLL 3U0TB 2ALAA 4AYDC 2V3EA 3L1EA 4L1DA 5SV3A 5BZDB 3RVTD 4GW4B 1GZHA 5DEGA 5DK0B 3ZYZA 2P24B 5CO1A 1WZLA 4HOMA 5HGBB 4NQTA 4J1UA 3OMIB 2OCCB 5IF0B 2YRLA 4KNTA 1T1ZA 2VJ8A 1LO5B 1P7KB 3QJRB 4K94C 1JMZA 3M07A 3QQ4A 5LKNA 4EUPA 4PRID 1BJMA 2DM3A 1RZKL 4HSQA 4W4OA 4LSQH 3LN5A 2GT9B 5C2BH 4RZKA 3IN2A 5I8CA 5I71B 4KXZH 1AACA 6TAAA 3D4GA 1ZPUA 1OD9A 1EO8H 5E8PB 4B6ZA 3VFGH 2F1AA 4WUKH 1JRHI 4DKEH 3LEXA 4OZHE 4YGVB 1IARB 5AOJA 2UXGA 4JRWA 4KAQH 3T4YA 1Z5YD 3EYFA 2F58L 3WJJC 4PRNA 4WHDA 2Z91A 3BIAX 1I1AB 4F92B 2RR3A 3MRMB 4HUXB 3RL2B 1IFHL 1T1YA 1DO5A 2WUBH 4MQXC 1JHLH 1QD0A 1VENA 4UYPA 5DZVA 4XNXH 5MEPB 4AQOA 1KGCE 1R3IL 1JNJA 5I28A 3ZHFA 1JSYA 5IEHB 2XWEA 4D7BA 4MCMA 3AS1A 3FUHA 1SGKA 4ZTOH 2BOLA 2DLEA 1U3HA 4UM9A 3IB4A 2JB5H 5B1AB 5IMKB 3MJ8B 4HAFA 2BIOA 1FG2B 4OZ4B 1G0DA 4AKOA 4EDWL 4NQQA 4CC4C 3HG1A 3WIFB 1YEDA 2J55A 4LBAA 4U6YA 4YUEH 5ICZB 2RH0A 2NY2C 1IKOP 3T65B 3OKLA 3ZDYF 2B39A 4P2QB 2IAMD 3PDOB 2YUVA 2PWGA 1L5GB 5GZND 3TN0C 1C5BH 1YY8B 5CN2A 2NZ1A 2DLHA 3IDNB 3WUWG 5DO2C 4F1SA 1PS3A 3UBGA 3DX9B 5EIIA 2ZCHL 5AYUH 4MJ5A 2Y1ZA 4ZFOL 3S2AA 1ACXA 2XTJC 4CU8A 1UVQA 4JZOA 4G5ZL 5ALCH 1A3RH 2YLKA 4U1HB 2FQDA 4OZFG 2IBZY 4JE4B 1V7NL 3BLPX 2AQ1A 3GSVA 4Z3EA 1JPGB 5KYNA 4LZKA 2N59A 3L4YA 5DSCA 4UIMA 3OLEA 4Z5RA 1D5IL 1AHWA 4GI8A 3WIIL 1A6AA 2DQIL 2CDEA 2CLVB 5JXED 5EUOA 2WXNA 3GBEA 1U8KA 5BO0D 4HALA 1BHGA 3B8SA 3C75A 3AQZA 3L3DA 1HWGB 3NFPB 3UXFA 4PD4K 4N2NA 1MHPL 3WE6A 1FNGB 4AC2A 1KJMA 1ILUA 1HL9A 4LHUB 1EAPA 4EDWH 2AITA 2DH2A 3D4ZA 1TZOA 4RX4D 3KPRE 3DRQA 1T21A 1V27A 4Q14A 4HIEB 2IALA 2ZXEB 4MFHA 2NX5A 4PGCA 2ITDA 4YDVB 4ONHB 4XP5H 4A2HA 3UAJA 4ZW8A 3INUL 4X6CE 4XO3A 2X4SB 1AXSA 4P9MH 2GKIA 3TV3H 2AGJL 2YPVH 3SY0B 1PJ9A 2FR4A 4DTGH 3MJ7A 1OY3B 1VADA 3N06B 4AENB 4PJ8D 2CIKB 1MRFL 4FD0A 2XWXA 3RVVD 4BEIA 4F7PA 2NNCA 2WWKT 1NGQL 3NZ8B 4FXGC 4PRHE 5ITBH 4OSUL 3BGFB 4FQIH 3CLWA 4L9LA 2JI3A 3HBQA 5GHWH 4Q9QL 3ARBC 2AV1A 3RDJA 3QNZB 1RIHH 4EZMA 3PWVA 5LBVA 3CNKA 3N3EA 4AL8C 5HHNB 1UZGA 5G5DB 4F57H 1WBXA 5I1AA 3MGTA 3U6XA 1MELA 3ZZQA 2Q1EA 4ICXA 5IBTL 1TLMA 4G7YH 3AU1B 2WMPA 1M1XA 1ORSA 1LVEA 1QFOA 4P4KD 2QZQA 1JGDB 3VU1A 4CSPA 2JIXD 4AYBA 5I1LA 1TR7A 5EC1A 3QUZB 1PZAA 4WO0A 4WTQA 5KJRL 2VN7A 3P0GB 4MMXA 1JZDC 2VUKA 2PWFA 2EO9A 3MLYL 4ZFOB 1C5CH 1NAKH 3NEEA 5IT2L 2WANA 1KPRB 1LDSA 2UV3A 3L4CA 5F0PB 5CBEA 2X6CA 4EE2A 5I1JH 4NYLA 4OTXH 4V2CB 5JPMB 5EA0H 5CSZB 1CD1B 3GXUB 4MZ3A 3SE6A 1CGTA 2O5XH 1OGAB 1VEMA 4DK5A 1HXKA 3INUH 2ZG3A 4PEEA 2G3NA 1G4RA 4KKCD 4UT9A 2UZIH 3S37H 1AIFA 1XDTT 3H0TA 1AY1H 1E5ZA 2Y4SA 4LIQH 4U1KB 1B4JL 4Z77A 4OLYH 4H0GA 4DZ8B 3S3BB 2H2SC 1OANA 5CINL 2O6DA 1GXEA 4FQHB 1RZPA 5E1GA 3S6CA 1KFGA 2X3BA 1QACA 3Q2CA 3G7TA 3SY6A 2BLFA 3UZVA 1XGTB 1NGQH 3SKNA 3FB6B 4KROD 5AB9A 1GOFA 3MXWL 4PBDA 4QDGA 1MIEL 4HUVA 4I0PC 4ZMQA 4WY7H 4MDIB 5DRZA 1A25A 4FXTA 1T0PB 5I74B 4X0KA 5L2KE 4JK0D 1FHGA 1JXFA 2J57A 4F8LA 3IDUA 3ECQA 3F85A 3HNTL 4G6ML 1N70A 2EIJB 4BK5A 4ZTEA 3UBFA 5D55A 2F19H 4MD0A 4V1DA 3NN8A 4QRTB 3FMGH 4TYUA 5KJRH 2YAOA 2PPCA 1U36A 5HYJE 2VZSA 1FZKA 4NM4L 4XPHH 1EZVX 4KVPA 3OJDB 3X11B 3U2JA 3ZT5A 3RFZB 2VL5A 1BXXA 3SKUD 2YGVA 3KJ6H 4BELD 2H1LM 1A0QL 5LXGL 4YSQA 1YYML 4G42B 4K71B 4LEXL 2R1WB 3AZUA 3GQFA 1XBDA 3REWB 4P46A 3VFPA 3ULVL 5I6XC 4HIHA 5MENE 3RWFB 2EDLA 5TDPA 5E8DH 1PKQE 2JKSA 2L4OA 2BX5A 4EIUA 4S1DD 1KTJA 1FIGL 4ALAC 3FXIC 1QKZH 4HDIA 5F89B 4ZDHA 4FXKC 4YC2B 4YDKL 5BVJA 3B7RL 5JHBA 4U4IA 4PRPB 3VH8G 2X6BA 1NCJA 4F33A 1E2VA 3O2VH 4C83B 5HHOD 2KUTA 4U1NB 1G6RA 2W88A 5IK3B 4CJ0A 4N8CH 5KVDE 4P2AA 3DVGB 2Z1KA 4NFBA 4Q0XL 4DFHA 1ZA6B 2QVTA 3HZMA 2ID5A 1KB3A 4HLZH 3VD2A 1F56A 4DOHE 5DWUL 1AZCA 4P04A 4FS0A 3SKOA 4ODWB 3Q1SL 3SBWC 4NWUL 5B22A 5J4MA 2LTQC 3KBHE 2VDQH 4PV8B 4KO9A 3UO1H 1AI1H 1OP9A 2IPKA 2P5PA 1QFHA 1L7IL 1NUNB 3NFSH 4XCEB 4X8XA 8PAZA 2VWEE 1JGUH 5EIIG 3VXPA 2EKJA 2FBJH 3O6KH 3BGAA 1DTUA 1W9XA 1B0GB 1NGZB 4FMFA 3UIZA 2ZOUA 1JWSB 3F7VA 3HC4H 4HSAC 4J6RH 4JDZA 1J5CA 5TK2A 1KUMA 5FUOL 1IIIA 3RURA 5DF0A 3DX6B 2HP4A 3AM8C 4K9JA 5BXFB 2QKIC 5ETUB 5L8JB 4KVCL 1MVFA 4NPJA 5T1MA 5CKGA 5GGVL 4UM8A 1N8ZB 3AUWB 5EF2A 1LE5A 4UOW1 3S48A 2G60H 3MLWL 4G6KH 4PREA 3Q5OA 4YVNA 3SOBH 1QYGH 1N5YL 4Z6AT 1MFAH 1LK3H 4O58H 2FIRT 3ZE2E 2XLLA 3GNML 5D1XD 5KS9B 1H0DA 4PJXB 3P3UA 3GXDA 4KFMA 5LO7A 4K9EL 5JQHC 3QNFA 5E6IC 2VZVA 3OQ3B 3E6HB 1S7XB 1RJZA 3KPNA 5IHLB 1M1SA 2WLLA 4HJJL 2NZ9C 2HX7A 1QBLL 4WO4A 4X6DF 3BO8A 5TPWH 2GJ6A 3MBEA 1CLOL 3NIGB 1K6QH 3QQXA 5E1AB 3WO3B 3EYUL 3L9EA 2J12B 3L4WA 4A37A 4UTAL 3ZDXF 1NLDL 1KXHA 1CZ8H 2R9HC 3VD1A 5F1OB 3RY4A 5EEYA 4Y4HB 3LQZA 2J7LA 2IG2H 2C3HA 2XX0A 3EGDA 1SJEA 4N0UB 1CF1A 4JDVA 5G2NA 2GSGB 3FB7A 5IJCC 3EOTL 1DJZA 1AQHA 3MQIA 2DI9A 5D1QB 4JANB 4YDMA 4D9QD 2B08A 3ULUL 2F9BT 3QIWB 4OF5A 2EIMB 3DC0A 5AYTA 1GS6X 1BDYA 5IMMA 2EEBA 1JF1B 1SEBA 3PGCB 4I3SH 1JZ6A 1AZNA 2Y36L 2ZPKH 2E7HA 4N8UA 3T4AB 4BQBA 1P5UB 3JZYA 2OKMA 3SB3A 1B2WL 3LZRA 3VXQB 5C0DB 3Q5TA 1UGNA 3HVNA 5DZNA 4M7LT 1W2KT 1EO5A 3CWGA 4X8GA 5C0JA 3QH3B 4N2GA 4LSSL 4GKNA 4JO3L 1BPLB 4WUUA 4FXLA 3O8XA 4JHUA 5GRYA 3VX1A 4RMTA 3BH8A 5IHBA 4E9RA 2BVPA 3BQUB 4U33A 3QORB 3LH2L 1W72B 2Q2EB 5CEXA 4BFBD 2Q7YA 3AT0A 3QFJE 4LQFH 5DJ2B 1NC2D 1W8EA 4F8NA 2DWEB 5K9QG 4ISVA 4R2GB 4PJGA 1IQDA 3VDBA 4GBXB 2D7PA 4HEPG 3WTTA 2C9XA 1HIMH 5CS7A 2A6KB 2QSCH 3IDIB 4L4VE 1GGCL 1YMME 3PL6B 2K8QA 4L4TB 3EYUH 3F7YA 1NL0H 2R27A 2OYKA 3FU7B 5CCJA 4NNPL 3OZ9H 1JTOA 1IFGA 4S2SA 3SGKC 1K85A 2IH9A 3EJYC 3LPPA 2GEQA 3G6JA 3HW7A 3ECBB 4HZLB 1IAMA 2YAEA 3MA7B 1JOIA 5GJTL 3B2MA 3QB7C 2O6PA 4N1CA 3UTQB 1AS8A 3DV6A 1OTUD 1ZEAL 3GO1L 2NR6A 4CILA 3TH3T 3TF4A 4IMLA 1TQCB 4JJOA 3VD3A 1OTSC 4GFXA 4L3FA 1TTFA 4W9DC 4ZSOB 4WAFA 3P9MB 4FAAB 3NABL 1RJLA 2J21A 3PNRB 2Q8BH 3UIYA 1FV1A 4QHLB 2MNWA 2V7NA 1WWCA 1YPZB 4FTVE 3WFDH 4M9OA 5GS0D 1PAMA 2D7TL 3GHEH 2AJYH 5HVWA 2PCPB 2JKTM 3V6BR 1FO0A 4ZO6A 3JV4B 2BWIA 1J87A 2DWDB 2WQRA 2XBTA 3DUUA 3WNLA 3ZZSA 2EC9U 3B2DC 3CZJA 4FNLH 3QI9C 4ILDA 1AGBB 5ANMB 2PWDA 1SHMA 5FGBC 5FOBA 3AAZB 3LH2H 2HWZL 5E4EC 1C12B 4M6OH 1MCWM 4RWYL 5DJAA 3B5GA 1MG3C 1M56B 4PG9B 4BZ1A 1K5NA 4L3EE 4IEFB 3RUGE 3J2PA 4P3DB 3WS6C 3V4PL 4MNGE 3WKPA 2VXQH 1D5ZA 3N44B 3NA9H 3MRGA 1YUHA 2R2CA 3QJHB 3VGDA 4X7TB 1GGCH 5F21B 4DO6A 4U1JB 3S96B 3BE1H 4FABL 4XBMA 1T5WA 4WI9A 1KGCD 1MFEH 5KBMA 2M2DA 2VDLB 4EI5D 2A1WL 2V2WA 4Z78B 4XPGL 4TQEL 2ZXCA 5CP7B 5DJCB 1BJ1J 1RZ8A 2Q0ZX 4XN4A 5FGRA 4PWEA 4HG4K 1EFXD 5K9JH 3NSXA 3OB0H 2BVOA 4J4PC 4OCYH 4O4YL 1YEWA 2CO6A 5KG9B 4BUGA 4V11A 2N7AA 1DEEA 2CIIA 3BP6B 1LQBC 32C2B 4IBLT 3TBSA 1CU4H 4ZMXA 1E67A 1OHQA 4OD1L 1I85C 7FABH 1MI5E 5IOPA 3MUGA 2N56A 2OSXA 2H32H 3ASOB 3HA0A 2IIJA 3ERXA 1DN0A 1N7MH 1IM9A 2J8UE 4H1LB 4IBYA 4MXQD 1VB9A 4RMRA 2BCMA 4CJ1A 1S8DB 3UTOA 2ZXDA 4EN3A 4S1QL 1UM6L 4M1GL 3ROLA 4MB4A 3SYAA 2YGNA 4I5BB 2H26B 2DB8A 2UXFA 5E51A 5DMKB 1Q94B 1QUNA 1KB9K 1HINL 1MW0A 2A6IA 4RAVA 3EJRA 4HOWA 5E5MB 4UANA 4PGDA 3W2DH 4AQ8A 2H1PH 5EU6B 1KT2A 4M43L 2XFGB 3QARA 1Z9PA 1I3VA 3ES6B 4APQA 5F96L 1Q72L 4RMVA 2EACA 1IILE 1ZHLB 2O30A 5IQLA 4PJEB 3QXWA 3JTTA 1P1ZB 4MB3A 2RJMA 1E6OH 1XTLA 1IV8A 3KEDA 4ZX6A 1OTTD 2P80D 4Y2DC 5IBLC 1WFIA 4KJWD 4EMZA 5C8JB 4LCIL 3RWIA 3K3QA 3LB6D 4HOXA 4D7PA 4PRAA 1X5HA 3RZCC 3U7WH 5C0AA 2OXGB 5IUSA 2UXVA 2AJZB 4G3YL 2O1AA 1TZIA 2NY5L 2BSEA 2DQDH 4XVTL 4OFVA 4IHOB 3SDCB 3PFUA 1BQHB 2PTTB 1BD2B 4I2XE 3NZHL 4UT7H 3KYKL 1XF5A 2AJVL 3RE0A 3ZKXB 3MGOB 5LBSH 5T1LA 1ND0B 3S3JA 1GGIH 3L5WA 1N2RB 4JZJB 3FO0H 3QJFB 3KPRD 3N91A 2YWYA 3VJ6A 1XEDA 1A8ZA 2ITCB 1WK0A 3K91A 1S9YA 3GFUA 3NCMA 4KJPC 1F2XK 4HJGB 2J43A 4MRCA 4XP4L 3IU3A 3D3VA 3FL7A 1FL6B 1ZT4A 1JS4A 2C9SA 3IWUA 3OXSB 5F88B 3MROA 4AE1A 3BEVB 2CBOA 4GKZA 4XN9A 5DHDA 5K59F 4N5ED 1A5FL 5EDSA 1HJCA 2DQJL 1NBVH 4OU3A 4F5CE 4Z0BL 4GG6F 4YL9A 3PWLB 4G1MA 2JXMA 4PRHD 3LTVA 2V9TA 1MKFA 3C6SB 5IQNA 1KJVB 3BVNB 3ABKB 3DXAA 2AQSA 2QJDA 4O9HH 1PG7W 4H13C 4X98B 4YQXH 2BVQB 4PYHA 4NQSB 3ARGC 1G7JA 3IDGB 3GMLB 3RWJB 1OAYL 4YR6B 3EYVA 3GMQB 3GXPA 4YHLL 4U1LB 3WNKA 4TQ8A 3QCUH 1JD7A 4NB7A 4QRSA 3UYOD 4B9PA 1JPTL 2F7RA 3C09B 4PTTA 2B4CH 5I0XA 5I8EB 2ZCKL 4P23A 2Y06L 3V0VB 4Z7NE 4DETA 5LAPA 5I1EH 2Y24A 4GAFB 3IKCA 2DAVA 4MZIA 2PO6D 4M61B 2JCCB 1VKXB 4OZGE 1S7WB 1PLGL 5DT1L 4RCAA 1CTNA 5M95B 1BBJA 1Z5HA 4BK4A 3K6FA 3UAEA 2BS9A 1B6DA 4W68A 5FR3A 1AFVH 1HHJB 1BJ1H 2J5LC 1DUYA 3NPSB 3E9TA 5D5MF 3K72A 1CGYA 4AQAA 4KZEL 1T7VA 3TZVD 4JKLA 3LRKA 2X4RA 1NDTA 1SM3H 3B43A 1WP6A 2CE6A 1NDMA 3GZOA 3HB3C 4CA4A 4QRRA 4OLEA 5I66A 2P8MB 1FVEA 1D6EA 1Z9SB 4QHKJ 2F53E 3VXMA 3QXTA 5T5FL 3ZBMA 3ZYIA 3BAXA 3EBGA 5AZEL 1PG7L 5GSRA 4G8FA 3VFMA 3Q8CA 4FFYH 4I85A 4JQIA 4QXUH 4F2ME 5LNEA 9PCYA 4KHTH 4GRMB 4X4ZA 3LEVH 4XMTA 3QEUB 3IU4H 1ZLUH 1MY5A 1MWAL 2I24N 4HFWA 1IC4H 5DJ0B 2C9VA 1J18A 2WB1A 1A8JH 1JPSL 1NEZB 2BSDA 4GP8B 4QIRA 5A2FA 3L3HB 1Q0YL 3BP4B 1VEPA 5HVGB 3C6LB 5L2KD 2VLRE 3P9LA 4BWWA 4Y9CA 4OD3H 3W39B 3DETD 5JXAL 4IGBB 2YJQA 5C0ND 3DO7B 2GAZA 2Y07L 1KJ2B 4ATWA 2VT0A 2PTUA 3UGUA 1BZEA 4WJKB 1DBBL 1JFHA 2AXWA 4JGJA 1G7LA 4P5SA 3HR6A 2P43B 3QUKB 4NUGH 5CZVH 4U1IA 4PJDB 5EMYA 5KSBB 4IBQA 1R5IB 3O3DB 4TSAL 4XB7A 4PP2A 4N6QA 3SE4C 3TVMB 1OCZB 3MA9H 2FO4B 4Y19A 1E9OA 4NZJA 1EEQA 4B41A 5LJYH 2HUHA 4KY2A 1XH2A 1F4XL 4YSTA 4MWFB 3T77A 2EUXA 3CZUB 3N43F 4MA1C 5IQ7L 3QP3A 1KLGB 1H19A 3RTQA 3BSHA 2BW5A 3P4LA 4UUJA 3UTZB 2N01B 2QQQA 2BS8A 5MEND 1AR1B 4L0YA 1ADQH 3RX8A 1X6LA 3WL9B 3B56A 2AJ3A 2BP3A 3OSVA 4KV5E 4ZFFB 4YHYC 4P2OC 1IGML 4ZAKC 3UJJH 1T0OA 4G9FA 3Q48A 4YS4A 3CSPA 3RFRA 25C8H 2HTLD 4ELME 1T89A 1HOCB 1UZ8A 3J27A 1BG9A 2DZEA 2YA1A 3QVAA 3FFCE 1F11A 1QQDB 2ZWNA 2AANA 1TJHH 1Z7JA 3MNWA 4I18C 5B1CA 1BVNT 3GS7A 3WLWC 1SDYA 3FONA 2FTAA 1JGEB 4JDTH 5GGUB 4YFLF 4H0LC 2C7UA 1XXFC 3GZKA 2YC1A 1PIGA 1KTKE 5AW5B 3C2AH 4G8EB 1MWAH 1BAGA 3OKKB 4HQQH 4FJZA 3THMH 2IGTA 3LQAL 1D9KB 4ELKA 2YGOA 4PJ5A 4I87A 1IC1A 1ZDQA 3L6FA 3BAYA 3QZPA 1SJMA 3B1TA 3VW3H 2AI0H 4K15A 2CU9A 1OP4A 3QR1A 4LKCB 3BKMH 4JNXA 3CZFA 3ZRFC 4XI5C 2A73B 4XVUC 1ZS8A 3X1GA 5DD0L 2ZOTA 1E7VA 3MXVH 2NMSA 2IF7A 4KKRA 2HA1A 5C0BA 2X4NB 2EVHA 2NQDA 5C0FB 1ILSA 5AL0A 3V10A 1J10A 1GCYA 3DI2B 4MCYA 3W38A 1BX2A 3QUYA 4FG6C 2CUAA 3QWOB 5IROA 3ZL4H 1TDQA 2QVKA 3T8XB 4PG2C 4ZMPA 3E6FB 3VD5A 3W11C 5DD6B 1S78D 5HY9B 5F7AA 3FTZA 4Z8FH 3K6SB 2X5PA 2H4EA 4IRZA 4XT1C 4D8PB 5J8OA 4XN7A 4DQOH 1RUKH 1NIAA 4QTFA 1UD2A 2YN5A 4QRFA 4MMYA 2BP8A 2DQTL 1FNHA 3U0TA 4BXVA 2NXYB 5TE6H 2DS4A 2NW3A 1MDTA 2WZPD 5BZDA 5FKPB 2HFEB 5DK0A 2J5WA 3D33A 2P24A 3WELA 4M1DH 5HGBA 2CUHA 5IF0A 2JKNA 3GK8H 1NZRA 2EIBA 1RULH 1NC4B 1E4KA 1LO5A 1P7KA 1JRHL 2CO7A 5DS8B 1MAMH 5JOPE 3MYJB 1O75A 3VM7A 4GOSA 1ETZB 4PRIB 3L1OL 3B3BA 5GGSY 3AREC 3MAWA 4RMQA 2ZKHL 2OP4L 3ZU8A 1K3ZA 3TA3B 1EJOH 4S0SD 5HGDB 3I3BA 5E8PA 1J0ZA 1AGDA 3MRIB 4KO7A 3KR3H 3U4EA 1G43A 1ZDSA 4HSCX 4YGVA 4WW2F 3WHE0 3CIAA 1DUZB 5EZLB 5D2NE 4XAKE 3L4XA 4NOBA 3L45A 5FO8B 1I1AA 2XRAH 4NJ9H 3MRMA 4HUXA 3SYOA 3H53A 3RL2A 1Q1PA 4HJEA 5CF3A 3VA6A 4LSUL 4EZLA 2HT2D 4YGAB 2XN9B 5TF1L 1U3JA 4LCYB 1G5GA 3KYMA 3FN0H 4QXTB 4O02L 3ZO9A 5MEPA 2RIKA 1A66A 4B9IA 5AW0B 4FHBD 1FGNH 3OXRB 4QAWA 4X4KA 1HEHC 4NUJB 4UV4L 2MTPA 4ZFGH 4PJFF 5IEHA 1E9PA 5ITFB 5KANI 3UBXB 3ZKQD 2ZUYA 4AIOA 3R1GH 1L9OA 3QFJD 1SVCP 4WCYH 3P2TA 4QTIL 4AG4L 5IMKA 3MJ8A 4OZ4A 1X7QA 1FG2A 5ILTH 3D0VB 2G9HB 2MOGA 2VW7A 1HK6A 1QASA 4HCRA 1CFVH 3WIFA 2R4RH 1SRDA 4D3CL 5ICZA 5F7KC 3MBXL 3P4MB 5IG7B 3PV6B 4CMHB 4PJAF 3FH8A 2E3VA 1AHKA 4M8VA 4PLJD 3T65A 4L4VD 1YMMD 5DURB 2J25A 3ZL2A 4P2QA 2DWXA 3PDOA 1P5VB 2Q8AL 1L5GA 4Z7WB 1YY8A 4RGNC 4AH2B 1KN2L 1HZKA 3RG1C 1U8CA 3US1A 4Z3IA 3HC2A 1GZHC 3DX9A 4OIBA 1RZJH 4FQCH 4I3GA 1UTDA 4Z7VE 2X4QB 3OPZH 1SJXA 3CVBA 1I3UA 4Z76B 3ZE0E 4U1HA 2EEDA 4GMTL 4NUQA 4AZUA 1KFAL 1HL8A 1UATA 5DD5L 3WFCL 2PR4L 4HC1L 2ENJA 5CWSA 3VYOA 4FTVD 4K8RH 4F7TB 4ZTPH 4TTDC 1TJGL 4UQIM 2VQTA 9CGTA 3VU2A 3K2UL 1VHPA 4AMKH 1DE4A 2CLVA 3D39B 3JWNH 1HCVA 1JYVA 3D05A 3BFOA 3KMDA 2EDXA 4ANUA 1MCRA 1N67A 4MCZA 3CXDL 3NFPA 4NQUA 3MLXH 1FZOA 4Q52A 5C92A 5IMLB 2B5IC 2CR0A 1JPEA 1U8OB 1URZA 4L1LA 1CQYA 5B21A 3BPCB 3G5YA 4L3ED 2NY4C 3QG7L 4Y9BA 4LHUA 4MMZB 3T71A 3VD9A 2PCYA 2VJXA 1OCOB 3QEQB 3QXAB 1CBVL 2D7OA 1DL7L 3SDXB 3TU6A 2OZ4H 3L3GB 4YDVA 2R0WH 2FJFB 2X4SA 3SZ6A 1VZHA 4Q6IB 3SY0A 3PHSA 3BFWA 5IVZB 4O02B 4XVSL 4AENA 1QBAA 3RJOA 4K73A 2BNQB 2CIKA 5F0LB 4ONFH 4RMUA 5CKAA 4Y5YA 5T33L 1ACYH 4NQCA 4RDQF 3U1PA 4N0YH 2HFFB 3NZ8A 3ECUA 4X9GA 2FYYB 2HT4D 5A7EA 5E5RB 5BQ7B 5FYJU 3CFKB 4Z3TA 4DPCX 4D0BB 2Z7UA 4XMKH 5L0QB 3QNZA 2F0CA 1J8HE 2PR4H 5IUCA 4W9KC 1F3JB 1MI5D 3B7SA 4YDJB 1BXUA 3TBTB 5L9DL 3BT0A 1JXJA 5D72H 5GRUL 5HHNA 5G5DA 1A22B 5AKVA 2DLGA 4P5MB 5HDBE 5E2WH 2DQCL 3C08H 1NBZB 1KEMH 2F18A 1JGDA 1XB6A 1OSPH 4HVBA 5L88L 1DJWA 3FTGB 1HILB 4JFZH 1A64A 3P3RA 3QUZA 4MJ6B 4OCRL 5K93A 3T0DA 5K9KA 2XT1B 2VABA 3AXIA 4CADB 3DHMA 2BXZA 4NO0D 3DRTB 4AZ8B 3ZR6A 4K7PY 3I75B 4ZFOA 3U30C 2CXGA 2GK0B 1RP9A 2P4AB 2WJ5A 2UZYB 3T6ZA 3VSTA 1NMBH 1ULVA 1IC7H 3VXRE 5LVEA 4MDJB 5JPMA 3FYEB 4Y4KC 5CSZA 1CD1A 3WXWH 1SXSA 4WHYH 4DGIL 5J89A 1LP9F 3O11B 2C3VB 3GXIA 2KDGA 4JM2D 3VB9A 4KX8A 1OGAA 2B77A 1GGYA 3MV8B 2JJUA 4OH2A 1DSYA 3BPLC 4AJWA 5F7EH 1WWWX 1KF9B 2EXWD 3GRWH 1F6FB 4M6MH 3TEXA 2FJGB 4DZ8A 2B1AL 1VFOA 2X7LB 3OAYH 4FQHA 5ICXB 2H6PB 4PS4L 3K8LA 3T6WA 4NKIL 4HYTB 4BRJA 1XGTA 4XBEL 3ARFD 1A14H 4PJCE 4RGOH 3GSNL 3FB6A 5F6HI 3GUTB 3QJUB 1SXCA 2Q86B 2ZQKA 4XP6H 3RB5A 3IFOB 3BKYL 3P2DA 2V4LA 5LNDA 3FU8A 5I82A 5T3XH 3P30L 4E41A 3COOA 3K80A 4DKFL 3O3UN 3VO0A 2ZP0T 3NJIA 2ICES 1XCXA 4H2CA 1D5MB 4HBQA 4JY6B 1ZLSH 4LRIA 4N0CD 1LLAA 1QLEH 3VWKA 3EIFA 2C4XA 3UYRL 2Q9OA 1CFNA 1HXMA 3O4LE 4XN1A 2GHWB 5DMYA 1J1XL 3HN5A 3BP5B 1S7UA 4QRTA 4X99B 2VYRE 5SWSA 3KLSA 1FLRL 4FQXC 3UZEC 1A1MB 1PZ3A 1MSPA 4DP8X 1CS6A 2CGRL 4XB3A 3CZSA 1JZ5A 1P0SE 3H54A 3RFZA 1QPKA 4UB0L 3GSRA 3EFDH 1MJUH 3NPZB 4F15C 1XX9C 4G42A 2N7BA 4LOVA 2R1WA 3REWA 3V4UL 3ALWA 3D7PA 1FBIL 3RWFA 1LDPL 1BM7A 3X17A 4R5TA 3GI9H 1YEJL 4OAWA 4LPWA 2FX7H 4RISH 3EDJA 3GJFB 2QADB 5F89A 5BO1L 1QHQA 4L8SA 4IRZH 4E9TA 5DK2A 1A7QL 4PRPA 1IAII 4P3CH 2QQKL 1H6EA 4LSPL 1JTTA 4BK8A 4C83A 1MCPH 1R9FA 2W9EL 4U1NA 2BRRL 4XP1H 5IK3A 2C34A 2A9BA 5C70A 1M7XA 4HKJB 1CF8L 3ARZA 1FGVL 1ZA6A 4WNJA 3SGEI 1FRGH 2I5YH 3WFBH 1S3KH 2BIMA 5TH2A 1AO7B 4JGNA 4FQQB 4X6DA 1F58H 5A6LA 4P07A 3VNYA 1HJBC 1AJ7H 2XV2A 4UIKL 3E80A 3BP7B 1A6UL 3N42B 1U8MB 2YUXA 4AVIA 4AITA 4XCEA 4LLYB 1XIWC 4G72B 4XMVA 2MIZA 1FORH 2F53D 3F6IA 4HS6B 3TO4B 5DJ6B 1NGZA 2CA3A 5HDLA 4Y9GA 2Y69B 2NYYC 2R39A 4OY9A 1XGQA 4WKXA 3B7YA 5EF3A 1NUDA 3DX6A 2E6QA 5F2FA 3DYOA 5BXFA 5ETUA 3OKEB 2VE6B 1V05A 5AEAA 1N8ZA 5HPOA 1E5AA 4BK5C 2WKOA 1NA8A 3E9UA 2XQ0A 4PFEA 4Z3GA 3VD7A 1MEXH 4TSBH 1IGIH 2VLRD 1JAEA 1A9BA 3H3PH 4BQ8A 1AC0A 2AV7B 4E68A 1IAKB 2EDKA 4D2NA 3W81A 2CO2A 3OGCB 4L4JA 4PJXA 4PGJA 1X44A 3S5LG 1IM3B 3Q8EA 5F93C 2FLRT 3E6HA 2OTUA 3LIZH 1U3YA 1FSKB 4XPTL 4P4RB 5KUMA 4PJ7F 4HEMA 3UJTL 2QQLH 4Y2LA 2RACA 3PWNA 1KEGH 2VDML 2EVGA 5LNGA 1EERB 4KKZA 4QOKE 1T4WA 1S9WB 4M5TA 2XTJE 5C0RL 1QNZL 1LEKB 2DJSA 1YEKL 3DTDA 4J3OD 3GC3A 4IJTA 2CJUL 2HB0A 3MNDA 5CCHE 3E2HB 4N0UA 3N1MC 2GSGA 5D71H 4XGZB 2WYIA 3A6CH 4G8GB 1BFOB 5ESAB 4JANA 4IOIB 4XNAA 3QIWA 2ICEB 5FO7B 4LOEA 2Z1PA 4BA8A 1JF1A 1GOGA 3PGCA 3I6LE 1TFHA 2OMWB 2Z31C 2BK8A 3H55A 3UTTA 3FQUB 4PJBF 1WEJH 2Y7LA 4BFNA 1AZRA 1RZ7L 1HI6B 3HZKA 1ETB1 4IKJA 1MPAH 1RIVH 2R59A 2V8MA 5MI0B 5KW9H 1IO4C 3PJSA 1KBWA 4JHBA 5DJXB 3VXQA 3LXUX 5C0DA 4IJ3C 4TNWF 1IKFL 2EXYD 2WNKA 3N85H 4Z7QE 2O6EA 3QH3A 3AMLA 5E7FA 4Z7OE 1UUNA 2AAVA 2W1NA 4R4FL 4NZTH 3ROOB 5DFWH 3D25A 4CUCA 4JGMA 3I9GL 5CGYC 3C8KB 3MRLB 2D8KA 3BQUA 3QORA 1JYWA 1W72A 4U3SB 1ZLUK 1E4JA 3HR5B 1AZUA 4MJIB 3RX7A 2XQBL 5DJ2A 3WTSA 2V9UA 5D7LE 3SZKC 2DWEA 3RVXD 3DUSB 5D93B 1TTRA 5LAXB 2F5AH 3HPJB 3PAVA 5BS0E 1YY9C 4GBXA 3IXAB 4HS8H 1UJ3C 3FSVA 5DI8B 2B4CC 5GS0H 4GG8B 3BLBA 4XTRD 2A6KA 2NQ3A 2VDMH 3IDIA 2VZ1A 3PL6A 5HYJB 2XVKA 4N24A 4FJ6A 4UOW0 4RGMB 1L3WA 3BDYL 5DTFB 4MZRA 3FU7A 3MOAH 3CLFL 2WO2B 5CFHA 3S5YA 1KPUA 1INDL 3ZDWA 1PKOA 4GKSB 5B39G 3SDDB 3ECBA 4HZLA 5TGBB 4OCSL 3MA7A 5KVGH 2CUMA 5HP5A 1EHXA 3ATBA 2MNUA 3UTQA 2TRYA 3VXNA 3TF7C 2H0FA 3HNVL 3QDGE 2ZXQA 3NMEA 4P2RB 4G59C 2ESVE 4Q4IA 2PYEE 2QGBA 5LGYA 2L7UA 4ZSOA 4K3EL 4WVRA 2DBLL 3P9MA 4IKLA 3EO1B 5CJOH 2ED8A 1QSVA 3CJJA 3IMWA 4QHLA 2A0LD 4FL4C 4NJAH 1VPOH 3C5ZD 4Y1TA 4A63A 5JOPD 4ADJA 2XV6B 1DBKH 3EH3B 4JFFE 1RMFH 3EG9B 4UTAA 4PUBL 4XC1L 3CHXA 5C6TL 3JV4A 4X9HA 2X9YA 2DWDA 1EZVY 3AMKA 2FD6L 3UDWC 4XNMB 1AGBA 5ANMA 2VAAB 3VFWB 3AAZA 3L3IA 1C12A 4XO4A 1YC8A 1Q1JH 2ZYHA 3ZE1F 1RY7B 3BPOB 3N55A 2CK0H 4PG9A 1NFDB 2CR3A 4GINA 4XAKD 1KBVA 2I9LB 4IEFA 5E2TL 2K9FB 1GHFH 4X5XB 4P3DA 5IW6A 1TVHA 2PPEA 4F58L 5T1KB 1EK3A 1XL4A 1YEHH 3QJHA 4X7TA 1TMQA 4YIQB 4U1JA 2VH5L 1INQB 3B2VH 2GG1A 1O0VA 1F00I 3FB8B 4IRJD 2WYHA 1CFSB 4M62H 3KW7A 4M7KL 4PSRA 4BUHA 5CZXC 2KC0A 3QIBD 3L2LA 4JKNA 1Q4NX 2DQGL 4FQ2L 3MUJA 3B9VA 4M48H 4R8WH 1BQLH 2XPGB 5DJCA 4DUXA 1ZLWK 2DMBA 2YHGA 1X6NA 2W9DL 3CE1A 3PDGA 3NIFB 5JIDA 3DMMB 2N7SA 2BJML 1G9EA 5KG9A 1JK9A 1NBYB 3X1FA 2WNXA 3CCHB 3ATDA 1A1OB 2MCG1 5F7LB 1I1YA 3PREA 1HHIB 4XCFH 4HD9A 2F5BL 4P57B 3ARWA 3LPOA 1H6UA 4JO2H 4YE4L 5KVMC 1E40A 2YGPA 4JLRB 3LKNB 1S8DA 3HE6D 3PHQB 4ODTL 4PUBH 4JREC 4TLUA 4H20L 4G1EB 4OB5L 2NR6C 4I5BA 2H26A 4GRLD 1Q94A 4AX3A 4E9VA 4CW1B 4OZHF 1JD9A 1NANH 1MJ8L 1OF2A 5D7JB 5I19L 1J7VR 4OBRA 5E5MA 2I32A 4FZ8H 4BKLB 2IPUK 5D7IE 4BZ2A 4UZGA 2FQEA 2CLZB 5EU6A 1TEFA 2NNXA 4GG6A 1A6TB 3HIZA 3ES6A 1FFPB 2XG4B 3ZTDC 4PJEA 4Y5XA 1P1ZA 3EOYG 2OM5A 4OZIB 2CKBB 2BP0B 5JHDE 3J07A 5DD3L 4XNBA 7PCYA 4HT1H 2H3NB 3WNOA 2ORBL 3D6GA 2WVVA 5I73C 5C8JA 3ARVA 2OMXB 5H37G 4ZODA 2VLLB 1F6LL 5C3IA 2WSDA 3WU1A 1L7TL 2A9NL 4RMBA 4QXGL 2R8SH 3U79A 4IHOA 2WY3B 2IVFC 5TE4H 4R4NC 2VDRL 1BQHA 2EC9T 1C1EL 2PTTA 1HDMB 2J56A 4MAYC 3MGOA 1N2RA 4EN2A 1ZV2A 4JZJA 4XE5B 2B3IA 3G6DH 2ITCA 1E2WA 1NCTA 5D6DC 1ZGLP 1LHZA 2FGWH 2DL2A 2ARJB 4FI7A 1A4JB 4HJGA 3PWPB 3FRPG 5GISH 2EVIA 3ILQC 1SHWA 5CMAB 5AVWB 3LX9A 3OXSA 5F88A 3BEVA 3H9ZA 5F9OL 1MXGA 1CTMA 1JMXA 1WGVA 2BVTA 4AEFA 5JUEL 3E3QE 4KTDL 3RPIB 4L1SA 4WHTB 2NY1D 3PWLA 2HMID 4U0RC 2VQ1A 3GINA 4AMXA 1KJVA 3NJHA 3E38A 4X98A 2UXTA 4YXLL 1J8HD 3HUJE 4LDCA 4WJ5B 2HPOA 4Y7OC 3IDGA 4EI6A 1N64L 4Y4FB 2QTEA 3AABA 4XWOC 1ESOA 3GMLA 3KPSB 4UNTA 3RWJA 1CDCA 2B1OA 3FUMA 4YR6A 3GMQA 4UI2A 3S7GA 3U36B 2HJFB 3JV6B 4U1LA 1KYUA 3DURB 4XRCB 3N40F 3V52H 4AWJC 2Y9RT 1B6UA 2IQAB 1AH1A 1HESA 4OV5B 5I8EA 3Q6GH 1EEYA 4OM1L 3V0VA 1FC1A 4HUUB 3EZ8A 4NQEE 4O5LH 2BPBA 1ZA3B 3V0WL 5JLZB 1UB6B 4BCYA 4HF5H 4M61A 5LQBL 4XMPL 3CLEL 3HI6L 1ZY9A 2JCCA 3AY4C 5DR5H 1VKXA 4FF9A 3U9PH 2AABL 3RAJL 5HHPB 5GRZA 3VXRD 3TH4T 4FEIA 1ERNA 2NUPB 4X6CF 1HHJA 2BM3A 1ITBB 3MRQB 4V2BA 5BVPL 3SE9L 3QWRA 4JFDB 6FABH 2WHVA 3HE7B 4LPYA 4ORZC 4RZCB 3REVB 2WO3B 3WO4B 4BFOA 5JIIA 1F4WH 2X0VA 4A7SA 4Z18A 1CICD 2UWEB 2W0LA 4UBDC 3VRIA 2P8MA 3U83A 1Z9SA 4X80L 2EDBA 4MXVE 1UASA 2RCSL 4YK4C 3ARYA 3LXBA 2AXGB 1FLTX 5E03A 5AYQA 5SWQB 4KTDH 2I7OA 5JXEC 1CDJA 3C60B 4WTZA 2XKUA 3VFNB 3TESA 5E1IA 4GRMA 2CHWA 2VDRB 1QPXA 1OV8A 3RY5A 3QEUA 2UYLB 2ERJB 4TNGA 5DJ0A 1KTLB 5JW3H 1MW1A 3LV3A 1RZJC 1NEZA 4KVNH 3HC3L 1J0JA 2KKQA 1JZJA 1BMZA 1KV3A 3IF1B 3RJQB 3L3HA 3MV9B 3A4DA 2YFOA 2JQAA 3BUTA 3BP4A 4IYKA 2W38A 3EDDA 3RX5A 1JZGA 3U1QA 3WY4A 5C09D 4MAZA 2ZXWB 4IGBA 1KJ2A 2LVCA 5FLVA 2O6FA 1HTYA 2VDNL 4NS0A 3O4LD 4YX2H 3GLEA 3HAEH 4K8RC 4PQXA 4NQDB 1P9MC 1X7SA 5D7SL 4LOUD 4NSKB 5KSBA 2X9XA 3QUKA 5KVDH 3BCDA 4TVPE 4NO5B 1R5IA 3O3DA 3TVMA 3UP6A 2Z93A 2BY3A 2ENQA 4FADA 3JWNC 3UZQB 1AQKL 1RPUA 4MWFA 1YNKL 2VZUA 1W6WA 3WFEH 1F4YL 3L4TA 4Z7UB 1RURL 5EU3B 2L7QA 3UTZA 3DTXB 1I82A 2EJ1A 2APFA 3BUQA 3LZFL 4N1HB 1U4FA 4HWBL 1GTNA 4ZFFA 4HGWA 2DPKA 1GC1H 3T3MB 3QJTB 1OARL 2AEPH 4HOZA 1HOCA 4P3WA 3KHOA 3FTXA 3FUFA 3ZDZB 1QQDA 3WSQL 5I8KH 1F02I 5CP3A 4P4KC 2FUQA 5SWZB 4G6AC 1JGEA 4R97B 5GGUA 3S35H 4PJ9B 4G8EA 5AAMA 2J1KA 3OKKA 1P2CB 2OW6A 3UACA 2XZAL 2BMKB 3O45B 5JPNB 1D9KA 3OAYK 4IBSA 2EIKB 4XWGL 1RUQH 1JP5A 2YLHA 1A7OH 1YEGH 5E1QA 1BVLA 3ZTNL 3D9AH 4DKTA 5L8KB 3F01A 5GS1B 2NCEA 2QR0B 2A73A 1CQKA 4G8AC 4MQXD 2NY3C 5T5FA 4IS6B 4KKCC 1N0XH 4PY8I 3QHZH 4O2EB 4XXCC 2X4NA 4C54A 4WW2A 4UCFA 5C0FA 4R5XA 2W91A 1EUUA 1NMCC 3VI4E 4LLVA 3CZKA 3LNEA 4IBTA 1BQSA 5K1JA 2O26U 3MOQA 2XZCH 1BIIB 2X70B 3E6FA 5DD6A 3OLIA 4OQTL 5HY9A 2YPLE 3K6SA 4KROC 4G7QB 4JM0A 5BRZB 3VFVA 2XFXB 4N2HA 3CN0A 2AQTA 3CFNA 4FNTA 4D8PA 2GSIB 4WW1B 5EZJB 1HKLL 2BOCB 2IEPA 4PI0A 3K0WA 2IH3A 1NEUA 5EZOH 3B5HA 3WI9A 2CHXA 5FK9B 3QCTH 4OCXL 5J56B 3TN0D 2HFEA 5ADPH 3FOLB 3O3EA 2AQRA 1H8SA 4CC1A 3KPLA 5DO2D 3BKJH 2AEQH 1NC4A 2ARWA 4K5MA 4XCCL 1PZBA 2OXHB 3B2PA 2KZKA 1ZTMA 4OUUB 5DS8A 4L23A 1SXBA 4AQZA 3QEGH 3MYJA 4QOKD 3NIDB 4PB9H 2DMCA 1ETZA 4QYAA 4PRIA 2XTJD 2AMUA 4PJAA 3U9WA 5JR1H 1NGXA 4G7SB 4J3VA 1T2QL 4QR7A 1BBDL 1K9TA 4TULH 1F90H 4H1LH 5HGDA 2MKWA 5AOIA 1FNLA 4KITB 4Y5VB 2G4GA 3MRIA 1TSHA 2D7QA 2EDRA 1F8TH 4EEEA 5JHLL 2CQVA 3TH2T 4S1DC 4Q9RL 3E8UL 3P73B 4NBXB 1DUZA 3I6LD 3U7YH 1I8LA 3CQPA 2VN5A 5FO8A 2IMMA 2OQJB 3KCWA 2YZ1A 1CYGA 3H9SE 5TE7L 2APBA 2ALWA 4CDHA 2XN9A 4K2UH 4LCYA 3ZE2F 3BVVA 4JG1L 4PJHB 4OKVB 4R0LC 5I1CL 2OK0H 1I31A 2XQYG 1CGWA 1M7IB 2JELH 3M45A 3NJLA 5IHUH 3C5SB 4B9KC 4NUJA 1MHCB 2EXSA 1T22B 1CI3M 1SF5A 2WQUA 5ITFA 4XN2A 2P28B 3UBXA 1WQVT 3CUPA 3WL9A 3MDJA 1N18A 2MOVA 5GSVB 2EP6A 3Q7JA 1L9NA 5D7LD 2LLNA 4AIZB 2W95A 2A77L 1N3NB 1WFMA 1Z5LA 2J2ZA 3D0VA 2G9HA 3EJJX 4Y16B 4KUZH 5HHME 3PGFL 5BS0D 3AG3B 4KMLB 3VRJA 5DUBB 4BKTC 4OI7A 1Z0NA 2D2OA 4U4BA 5IG7A 3NDZE 4IOSD 1KIPA 3MLVH 1P5VA 1GS8A 2IAMA 2UX6A 3L9RB 3G9AB 5AAWA 3WD5L 5GZNA 1EGJH 3AB0C 7TAAA 4AH2A 5J11C 5BCAA 5H2BB 2EDNA 3TIEB 2LR4A 3ARBD 5FCUL 4M6AA 5LCVL 4WENB 1QTYT 4FP8H 1UOVA 4UT6L 1QHPA 3TBBA 1Y18B 4WTZG 4H44C 2X4QA 1D2OA 1YN7B 3QDGD 1T03L 1H3XA 2BDNH 2ESVD 4Z76A 2PYED 3SO3B 5D1XC 3RNKB 1NCWL 4L3AA 4UAHA 1GYUA 3CQQA 2FX8H 1AQ8A 2FECL 5E95B 1T6BX 5L7XL 2OZNA 4F7TA 1JCKA 1KELH 4ZNCD 1HOEA 1NCHA 1P4BL 1ED3B 2YZ8A 5E2VL 1CG9B 1EDYA 5AB2A 4JFFD 3CFCL 1EIBA 4NNXB 4L8DB 3BZEB 4E9LA 4TSCH 1VGKB 5CFAA 5K9OB 3MLUH 1DFXA 3HS0A 1BGXL 2AQPA 2IXQB 4TVSa 3A47A 4PS8A 4ANXA 3EHBB 4IRSB 2GUOA 2OMUB 3FC8A 3X1NA 2E4TA 3VNZA 5IMLA 4YWGL 4R7DB 2RQEA 2YD9A 5C9KA 1SFDA 1MIMH 1OGTB 2QGCA 3BPCA 3CMOH 3HNSH 1XAUA 2YR3A 4R5VA 1SEQH 1URIA 4UILL 5KSUB 4N2BA 5GS2D 4U1SA 3QXAA 4RX4A 4LVOB 1NFIB 4J3TA 2Q76B 3SDXA 4GB9A 3RWGA 1HSBB 4FKHA 3L3GA 4A67A 5HYSB 2LU7A 2Z4QB 2FJFA 3BAKA 3W57A 3PDDA 1H5BB 5A2IH 2LAGB 4Q6IA 2VKWA 4GRWE 5F0JB 5IVZA 2IWGA 4O02A 2WZAA 4M9PA 2ZCLH 4GH7B 4HKBB 3KWTA 4N3TA 3M8OH 4CVXB 3DX4A 35C8L 1TSRA 3NEXA 2HKFH 2P26A 4KKBC 2FYYA 3CHSA 4PJIB 3KGSA 1KENH 3CFKA 4ZW5A 4D0BA 1KCSL 1UXSB 1DJXA 5L2JB 1PZUB 4JAMA 2QHRL 1F3JA 1R5VB 2MH4A 4JL2A 3TBTA 1FUNA 2Y2WA 3FBQA 1XVSA 1NGYA 2PCFB 4QRUB 2XWTB 1ODUA 1OAZL 2ZXBA 5SV4A 5D6CB 3HMWH 1NUFA 4P5MA 2EUZA 1CE1L 1NBZA 4L8CB 1ID5I 2J88H 5FECA 1T80A 1ET8A 3FTGA 3MBWA 4RNRB 4ZMWA 1HILA 1U8IA 3ILPB 4N9OB 4ANVA 1I9IL 3ME0B 1S6NA 5AZUA 1SQ2N 2GJZB 3IDMB 2LLLA 1KJ2H 3GBML 3SDAC 3QJSB 4CADA 5IFAH 3K74B 3UJIL 3DRTA 1J9TA 4XPFH 4AZ8A 3RUGF 3I75A 4D0DA 1J11A 3O6FB 2GK0A 2IOIA 2UZYA 3RA7L 3DBXB 2E9JA 4WU5A 4XAWL 4MDJA 3DSFH 3VXUE 3HRPA 2C3VA 3O11A 5FHBH 5JHDD 1XBRA 3MV8A 3CX5J 2HXAA 4HC1A 1UYWH 1BWMA 4QTHB 4YHKL 3SJVB 5DJ8B 1BFVH 1EX0A 4OJAA 4DAGH 1DEDA 3CD4A 2QMJA 2FJGA 4NQVB 5I0DA 2WK2A 5GS0C 4XMXA 3L3OA 3POCA 1A65A 2X7LA 2NY0B 2F68X 4FG0A 5CJ8A 1WO2A 5ICXA 2EKSB 5D9SB 4L0ZA 2FHBA 5D1ZD 3I9IA 2ZF8A 2MQ0A 3RU8H 4XH2B 3GUTA 3CC5A 3CN2A 1A4KB 3MACL 1DQDH 2Q86A 1VGEH 3S36L 4AW7A 2C9RA 3IFOA 2DDQL 3CSTA 1JI1A 1Q0EA 2J8UF 4QLRA 4NHCH 2I7SA 4F2EA 5IFHH 1G84A 5I18H 5BRPA 3OAZH 5FAAA 1D5MA 4WI0A 4JY6A 3ZR5A 3DTUB 3MODL 3BT2H 1BOYA 3HS8A 1MFUA 5A43C 4LSDA 3KYAA 2BNRB 1YEFH 1QR1B 3PY9A 3R8BB 2P5WE 4UQ2A 4YNYB 3BP5A 4X99A 2LOEA 2F15A 1MY7A 3TNNB 5EPMB 1AZZC 1A1MA 3IJ7A 3OHXB 2E7LA 2AS5M 4HZAA 4XVJH 3UJIH 3VG0L 4J8QA 1SHXA 3EO9H 2CA4A 2YOCA 1TJIH 4NCC2 4X9BA 4BWUA 1XV8A 2HT3D 4JM2F 5D8JH 4OJYA 5D7EA 3UPAA 4ABVA 1IAIL 5BUGA 2W92A 4YHZH 1ZANL 5EEXA 1JXDA 2G3MA 4HAKA 2B7DT 4WEMB 5E6ID 3K71B 5E9DB 3JXAA 1XZ0B 3QQ3B 3QUZC 5I15H 2V7HB 3QHFL 4ZG1A 2WLMA 3RNQB 1BF8A 4LIQE 1TT6A 3GJFA 2NZ9D 1UC6A 3FQRB 3L95B 3SCMD 2V5TA 1P69B 1HFUA 5FGSA 2NSQA 1P7QD 2OR9L 3D08A 5AB1A 3H3BC 4MXQC 2X28A 4NQED 4WGVB 4ELDA 2R9HD 3CDFA 3BISA 4WWNA 3D30A 1MVUB 4HKJA 3L2NA 3FTVA 3CXHJ 3IAQA 3LAFA 3JYCA 5DYOA 4N85A 3WFHB 4PJ7A 2IH8A 5MEQB 3APFA 2UZPA 3B1UA 4RQQA 3FQTB 1BA9A 1JWMB 3BP7A 4G7VH 5MHSE 1U8MA 1QFWI 5GGRY 3BUBA 4LLYA 3DOSB 1DLFL 1NSNL 2ZKMX 4X9FA 1M9SA 1BZ9B 4HPYL 4HS6A 4XNZB 3TO4A 1H8NA 5DJ6A 1UWGL 4FCHA 3BPNB 3LD8C 2DIBA 2IV9A 2FO1A 1KBPA 1ML0A 3MZTA 3GHPA 5I6PA 4RDQG 2ZX5A 3LHPH 1OWWA 4HK3N 1SYVA 5I74C 3H8NA 4JCWA 4BCZA 3ETBJ 5DRNB 3ZGHA 1OO2A 1XZWA 2ODIA 3OKEA 4PJBA 1KBBA 2VE6A 2Q6WB 2HH0H 1XFPA 2IQ9L 4MVBC 1WT5A 1BREA 2YKLL 1OAQL 3WUWB 5ADOL 3DUHA 4WEEA 1U8JB 1KACB 2AV7A 3L48A 1E8WA 1OALA 3FQWA 4JX0A 4OFPA 4Z7NF 3GMOB 1KWGA 1MQKH 3MV7B 3OGCA 1M05A 3W9DA 4CNIA 1EBAA 1IM3A 3S34L 1N59A 4M7JL 4K71C 1S46A 4TUUA 4W4NA 4OZGF 4TVPD 4RGNE 4IDJH 3OWEA 4HZ1A 4OZFB 4G43B 4P4RA 4BJLA 1UXMA 4QCIB 4X6EB 5C08E 3QJZA 2DW5A 1DBML 3IVKB 4NZUH 3VMNA 1BZOA 3A23A 5DEFA 3KG5A 1TFPA 2J6EH 4W9FC 1OTSD 1LEKA 3IMVA 2WQXA 1SQMA 1A6WL 4NRYA 1II4E 4XGZA 2NY7L 3V4VH 1BFOA 5ESAA 4IOIA 5KVFH 5FO7A 2ICEA 2AC0A 2YFNA 4JRYB 5EN2B 2OMWA 2XWJB 2YMXL 3HG5A 3FQUA 3L4ZA 3DOHA 5F7NC 1HI6A 1CUOA 2P1YA 3QI9D 5I6NA 5DJXA 2PO6C 4OVUA 1W15A 2HX9A 1WD8A 5CAYB 3VFRB 3LH8A 3O2DA 2R0ZH 3ROOA 3VDAA 3OAWA 4JFXB 3S0PA 1KCRL 3C8KA 4UAOB 2CGZA 3MRLA 4KY1L 1ZIAA 2K6YA 3QUML 4ODVH 2HG0A 4JN2B 4U3SA 3OZKA 5HTSA 3IGKA 2A6JA 1CD8A 3DROA 3HR5A 4MJIA 2NTFB 1ZT7A 4M56A 4YHMH 2QZ5A 3DUSA 3T0AA 2Y3NA 1HQRA 5LAXA 2DTML 3HPJA 1FPTL 1JPFB 2LVEA 3IXAA 1NLBH 4MNQB 4WK4B 5DI8A 1F3DJ 1IZKA 3QEHA 1T5KA 3NQKA 5HYJA 4DJMA 2WB7A 3HG1E 5ID0B 2R1YB 4J3OF 5DTFA 4KV5F 2YPLD 3IJYA 1XD1A 1WVZA 3CFJA 2A74A 3ML9A 3T0WA 3KEHA 4Y2OB 4ELMF 4TRPH 4O00A 4GKSA 3SDDA 4YHOH 1AKJD 5TGBA 5BRQA 2A6DA 5AVVB 5E94A 4PLNC 3Q06A 1D7DA 3F58L 3ESOA 3W56A 3W1ZA 3DETC 4P2RA 1TZAA 2MWCA 4HPOH 4HUMB 2VDPB 3GIVB 2BSTB 4KXZI 2LW3A 3T04D 3ULAB 3TT3L 3JVGC 3EO1A 4LGSB 3DV4B 4XZUB 3ILDA 1KCUL 3MJWA 4KTEH 1O7VA 2B0SL 4Y4HC 5HI4C 3R06B 4WHYG 1F4HA 5AZ2L 1E4XH 3OF6D 3EG9A 2V5SA 3N41F 4KKNA 5D1QC 4JFEE 4JPIA 3JBG7 4K7PL 3QIWC 1CPUA 2Y5EA 3PFQA 2FB4L 3AG2B 1IGCH 1K4CB 4HMEA 3VFWA 2VAAA 2MCPL 2ED7A 1E5BA 3B9KB 2DD8L 5DEGB 5I8OH 3T4AC 4Y2DD 1P5UC 4EKJA 5F3BB 1E4WL 1NFDA 3MR9B 4X7DC 3IPFA 1T1ZB 5DLMH 2I9LA 1KCVL 1UEYA 1IU1A 2AJXH 2G2NA 4X5XA 3RZCD 1RJYB 4GKLA 4LU5H 1DFBL 3QZWA 2EIDA 3WEXA 1IBFA 2Z0UA 3H9SD 4JZNB 1BM3H 4YIQA 1H3UA 1INQA 3LN5B 2NDGA 1SLUA 3FB8A 3HI5H 4IRJB 1CFSA 3AU0A 4OJDH 5I8CB 2J8HA 3BQUC 4DH2A 2NX5E 3QIBB 2WWOA 1X3DA 2AVGA 4EI5A 5E08H 4S11A 4NAQA 2XPGA 2RB8A 3ESMA 3VRLE 2PXYD 3BZFB 4TLTA 3EYFB 3DMMA 3HG2A 3QUMB 4KJPD 2VDKL 4Y1AB 3RBGA 4X8JA 1NBYA 5EOCJ 1UB5A 1SY6L 3G5XB 3BN3B 2VWEC 5HPMA 1WCBA 1GC1C 3M1CA 2VOTA 1A1OA 5HHMD 3UPCA 1DVYA 3O9WB 3OVUB 3GKWH 3F12B 1HHIA 4P57A 4KNSA 1XGRA 3BAEL 3QRBA 2JJTC 4NM8L 3AFLA 2EC8A 5DC0A 3V0IA 1UCTA 5ACMA 4ODSH 1PDKA 4NT6B 3Q43A 5AZ2H 3RDTB 5IB3B 2J71A 2VITA 4JLRA 5JIHA 1PY4A 2HVBA 3PHQA 4J3SA 5JNYB 4G1EA 6CGTA 1WBYB 1AYOA 4AGQA 2FB4H 4GRLB 3ARGD 1JGLL 1G1OA 3ULSB 4CW1A 3VH8B 3QR2A 5FYJH 1CLYH 1U3HB 5LBGA 1A6VL 1I7TA 4IBWA 1KN4H 4Z7VB 4DGYL 3VXTB 1ZIBA 2CLZA 3O4OB 4HJ1A 1O9VA 3SQOH 1YEDB 4LSRL 2D3VA 1A6TA 2Z8WC 4NC2B 2GQHA 1RVFL 1XGUA 3TA4D 5CLZA 1E7UA 3OKYA 4OZIA 2EEFA 4RFOL 2BP0A 2EE3A 4W70A 1UM5H 2H3NA 1PSKL 1HEZB 3AXLA 3CFMA 1UACH 2OMXA 4K55A 4D94A 4Y8DC 4TPRL 2PPFA 2HFGL 2VLLA 3DDGA 4NX0A 5EIIB 1M53A 5KTEH 3VWJD 2K7QA 3QQ9C 2IADB 1EEZB 1L4IA 1P84J 3H85A 4X5PA 4B3EA 3ETBF 4G82A 5B8CB 1GY1A 1TTCA 2NOYA 5B3SB 4JZOB 1GAFL 3AXHA 1TQTA 1F13A 4AT6B 4JPKL 1GJWA 1I8AA 5TJWK 2BXYA 3VGFA 1FAIH 2WO4A 3H42L 5DSCB 3HB3D 4UIMB 3I84A 1B4LA 4N5UA 3APNA 1T7WA 4OUOA 4XXWC 2OR8A 3RIFK 5I1GH 1AHWB 4N68A 1AOZA 1A6AB 1CGXA 3RKDC 2CDEB 4KRLB 4OJFL 5EUOB 2ARJA 1A4JA 3PWPA 1WE5A 5CMAA 1MREL 4ATTA 4BUQA 4EF3A 2QQNL 5ABDE 2J1YA 3H7LA 3CQFA 1D6VH 1P6FA 4FFZH 3TJEH 2HT2C 1ODAA 3EH5B 2LU3A 1PX3A 3C6EA 3GSUB 3BVDB 4J39A 5DZPA 1UZ6E 4MA7H 2BHYA 4ZUVB 3ZE0F 4WHTA 3S4SG 2YD1A 1C16A 2QFPA 4NN6C 4PRHA 2YQ2A 4AVHA 4H7VA 2FWLB 4H88H 5F7FA 3D5OF 1M71B 2VDKB 3DRQB 3O2WH 3MRKB 1OKEA 3NJXA 2FWOA 2IALB 5D2LB 1N6QL 4FA6A 2JB6B 4WJ5A 4PGCB 3FHEA 4XN8A 4Y4FA 4AQ1A 3KPSA 3NRFA 4MHHG 1D5XB 2Y1AA 3SIKA 4ZOCA 3RGHA 4JY4A 3TTSA 1RZQA 4MKTA 1S5IH 4YHPB 1I3GL 3LNFA 1IQWL 3DURA 4QRPB 2JQZA 1AP2B 1IKNA 2YAHA 4EJ1C 2IQAA 4K94L 3QRGH 1J1PH 4HJ0D 5CNHA 4OV5A 3H6JA 1A9VA 4QGTA 2RD0A 2GI0A 1DVZA 4WWKD 5JHAA 4HUUA 3ZTJH 5JLZA 1ZA3A 1UB6A 2Z3FA 1INEL 2QGEA 4L9LB 3V2AR 4BDVB 4IIQB 4LLDA 3UC0H 1W0WB 3AS2A 3WIHA 1CK0H 3WXVH 2X0WA 5F9JB 4X4MA 1OF0A 4ZAKD 4FYQA 5D70H 1BMWA 4YXHH 1JE6A 5HHPA 4KQ4H 3MRDA 5PCYA 2WCPA 3H4HA 4ZOBA 3V5HB 2W60B 2DYRB 1RIUL 3I02A 4LGRB 1BYPA 2N3JA 2NUPA 4MD4A 3VXUD 3MRQA 2VDOB 1AGCB 3QUHA 4JFDA 1ORSB 4GLRH 4S0TD 4OJFH 4OV6F 3WLWD 1WRFA 3HE7A 4RZCA 3REVA 3HFFA 3PQYD 1CLZL 5DZOA 4Z95H 5FV2A 1F1AA 2UWEA 2YIHA 3QFDA 3SDCC 5EOCH 3TOPA 2AJUL 2DQEH 3S35X 2F7OA 4C56B 1G7MB 5C0CB 3BYTA 5EZIL 2FJUB 4GIOA 3U6RB 2DM2A 5SWQA 1J0KA 3K8MA 3QAZC 2A7BA 1FFOB 3LKPB 4DP2X 4JZJC 3C60A 4XPBH 2BC4B 4XMZA 2PCXA 1ROCA 2BSSA 2Y23A 1A4BA 2VR8A 4XI5D 2UYLA 2VUYA 4DKAA 2Y7OA 1KTLA 3QIUB 4WRLA 6PCYA 4XVUD 1C08B 4HWEH 5HDBF 4KTYA 1NINA 4YSUA 3MV9A 1JV5A 1E28B 3AWFA 1A1NB 3S88L 1HN1A 4UV7H 4YSAA 4Z77B 4X5RA 5F7MC 5C09B 3VXOB 3PYCA 4FQLH 4M3JA 5BV7H 3CV5A 3O2DH 4RAHA 1NCDH 1I7UB 5IHHA 2P5WD 4NQDA 3W11D 1WS7A 1UD8A 4M6NL 4NSKA 1LE9B 2Y6SC 3BDBA 3C8DA 1BZQK 4NO5A 3IAGC 3G9VA 3TP4A 2FJHB 2V8LA 1P7BA 5AVQB 3Q44A 3UZQA 3NACH 1JDDA 1OW0C 3QZWG 3OKOA 2HRLA 1J5OH 2LLGA 5JOFA 1X5KA 4X0KB 4Z7UA 2XSKA 3F6JA 3C09C 5ISZE 2JWYA 2B2XH 5EU3A 2QDWA 1Z0MA 4OLUL 1RHHB 2GIMA 2HT4C 2MFNA 4GSRA 5MENA 1QBML 2GJ6E 2ADFH 2GTZB 3QCVH 4EVNB 4PD4J 4J27A 1ECZA 2RGSA 2CO3A 1KBGH 4ABWA 4V1DB 3B9EA 1NKRA 4R26L 4GQ9H 4KHXH 1AQDB 4ODHL 5EZIH 3LS4H 5GZOD 4PJCF 2HRPL 1VCBC 3W82A 1U58B 3WTUA 5LN8A 4OIFA 3ARED 4P46B 1FN4B 1TKWB 1DVTA 5C7ZA 1TENA 5B38G 3QS3A 3EYSL 2FO8A 3UTSB 3PF2A 1P2CA 3TCLB 3U4BH 4A68A 2BMKA 3O45A 5JPNA 1IBHA 2FWSA 1AVAA 3STZB 2WWKO 1LGVA 1IT9H 4FQPA 3T0BA 1K4DB 4DPAX 2BIQA 3HRZC 3SODB 3UO8B 4W9HC 4Y89A 5C7XL 5MHSD 3GSQB 3S88H 1M6UA 2YA2A 1E8XA 4HUWB 5CCKL 3DJRA 4XNQB 1WBZA 4HUCA 4JM2C 5GS1A 2QR0A 3DX3A 3LS5L 3N50A 4TNEA 4WUUE 4F33B 1OK8A 1P4IH 5T1JA 2DMHA 3L7FA 1C5DA 3U2SB 3K1DA 4E0RA 4IS6A 4M93B 4ZS7L 2R15A 3BUDA 3F04A 4O2EA 5ACZA 4IU3B 1MDAA 4DN4H 4GQPH 4FKKA 2HTKC 2D73A 3C6LC 1FH5L 1WAEA 5F44A 1KGIA 3PJNA 4ODXB 2Z34A 1RH8A 4IGBC