2EDMA

Crystal structure of envelope protein vp26 from white spot syndrome virus (wssv)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
161
structure length
161
Chain Sequence
b'SVVANYDQMMRVPIQRRAKVMSIRGERSYNTPLGKVAMKNGLSDKDMKDVSADLVISTVTAPRTDPAGTGAENSNMTLKILNNTGVDLLINDITVRPTVIAGNIKGNTMSNTYFSSKDIKSSSSKITLIDVCSKFEDGAAFEATMNIGFTSKNVIDIKDEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 22kDa structural protein VP22
molecule tags Viral protein
source organism Shrimp white spot syndrome virus
publication title Crystal Structures of Major Envelope Proteins VP26 and VP28 from White Spot Syndrome Virus Shed Light on Their Evolutionary Relationship
pubmed doi rcsb
total genus 32
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2007-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2edmA00
2EDMA 2ED6A
chains in the Genus database with same CATH superfamily
1F4WL 5DWPA 2ZCLH 3BUDA 4GLRH 4X6CF 1L6XA 1W0VA 2NZ1A 2VABA 3EJCA 3UH8A 4APQD 5D1ZB 5JA9A 4XN4A 5H94A 2G5BB 3DVGB 3FH5A 4LESA 4L29B 3QQ4B 4JFTA 4AEFA 2GW5A 4F15C 1IAMA 2YPKA 1QWHA 2BO0A 1AG0A 3CSFA 1TNNA 4U1SA 4XCYB 2J7LA 2HKFH 2ZWSA 4LCCC 4HUCA 1F1DA 1I3RB 3L95A 3TCTA 2NY2D 2QVKA 4DGUA 3UAAA 3VI4B 2G5RA 4OLVH 4UNIA 4U7MA 5FGRA 1JXDA 3PPEA 1SLVA 1QYGH 4MA7H 2ZX6A 3SPHA 4JNXA 2AEPH 4KKAD 1BZQK 4Q0XL 4JY4A 4MCZA 3W56A 4FQXD 4PJXB 4S2SB 1RMFH 5KSAC 2DJMA 3MRQA 3MQIA 2BY3A 1BBJA 2QPEB 1UA6H 4NCC2 5F97E 5L2KD 1DVFC 3SGJA 1N59A 2LVEA 3PG2A 3KPSD 2VL5B 4NRZB 2WNKA 4MNGB 4AGLA 4FKKA 1EJFA 1XGPA 5CU9A 3VFWA 3GSUB 4F1ZA 2BIHA 5IHHA 2IH3A 2W9DL 3GLAA 4YDZA 1JWSA 4JHBA 2L7JA 4LSRL 4PBWD 5DQDL 4FNSA 3OKEB 5I1LA 3E1F1 4N8PA 1E6OL 4JFFB 3H9SB 2A6JA 2MEJB 3S35H 3PP3H 4XO4A 5J7CC 3F7RA 5I26A 1UA7A 3BSGA 3Q43A 4N1HB 2P8MA 3MV7A 4OBRA 1LL1A 4PJ5A 3F6JA 3M07A 3MV9D 4AW7A 4PLJD 5EBWB 3ZHDA 4ZO7A 4QD2E 2EC9T 3IDYC 4FAAB 4V2CB 4WWNA 1F3DJ 1CXEA 3OWEA 1E5UI 2D03L 4HWEH 1IQDB 3W9DB 5HHNB 2Y1ZA 1HVXA 1NMAH 1SZNA 2XN0A 3BXNB 3HZYB 2UY6A 3LQAL 1NMCC 5EORL 2C3VB 2YA1A 1H15A 4ISVB 4QYOB 4PJXF 3QXWA 4RZCB 4XBEL 4N6QA 5D7LB 2P28B 5CGMA 4NFCA 4RAHA 5TE6L 2EDQA 3FQ4A 1JZ5A 3VO0A 2V5MA 3GMOB 5I15L 2VN4A 3CFDB 1INEL 3ARXA 2E7LC 1F02I 4TQEL 3GGWA 3IK2A 3N43B 5SWQA 4PS3A 4D8PA 3D2UD 4JPIB 1FNLA 4QRAA 1PG7X 1EAJA 1X9UA 5GS0D 4OV5B 2FR4A 1WD9A 4G1MB 1JNLL 3RGBA 4AL8H 1K4DA 4L4TB 3B6SB 2KBGA 5C08D 1S7TA 2OR9L 4JRXA 4I13B 4U7SA 4LCUA 4WHYH 3UL4A 4Y4KD 2VN3A 4L4VA 4MQ7A 4JZNA 3GSVB 1NSNH 2BIPA 3ARBA 3HN3A 3ZMEA 1TR7A 1TPXB 5B39G 5T1DH 2LQRA 2YBRB 1C7TA 1M1XB 3PREA 1KFGA 3N0AA 5MEPB 3RUGA 5JXAH 4HPOL 1JZIA 1KENH 4OLWL 2FWSA 1FJ1B 3AMLA 2A6KB 4QLWA 1F4YL 4G9DB 2VQ1A 4K0OA 4C83B 1W2KT 4JN2A 3QI9D 4X9FA 5A2KH 3MUY1 5JYMA 5LJYH 3QIUD 1BQRA 3VVVA 2YLKA 5ADOL 4MNHA 2GEEA 3IJSA 4KVPA 4WNQB 3D4ZA 1AE6L 4L4VD 5EEWA 3QXTA 5AOMA 3FBQA 3ROOB 6FABH 2DQGH 5F0PB 5T3ZD 3FCTA 4BRVA 2JMRA 2I69A 2Y3NA 4OTXH 4Y5XA 2VQUA 4KXAA 1BZEA 4Y4FA 3UROR 1RQ5A 2VZUA 1TYJA 3QJQB 5JHAA 1GGBH 4XXWC 5IHUH 1E4XI 5C70A 3ULAB 4LKXA 5DLLA 5IZ7A 4FABH 2MH4A 5HPOA 4J6RH 3V6FB 3SDDD 3SE9H 4N2MA 1IARB 1KTLB 4JREC 1ZLSH 3LS4H 5LNDA 1MIML 3MBWA 2WO4A 4OLXH 5EU4B 3U2SA 4IBVA 5C9KA 1LMKA 2BVQA 2WKOA 4G7SB 2EEAA 4ZUVA 2FAUA 4H1LB 4M6NH 5IB5B 3B56A 4UIKL 3K71B 1FORL 1N8ZB 4UT6L 5FDYA 4YQXL 3FFDB 1YN7A 1NM4A 4OFKA 5HYJB 1XX9C 1HQRA 2APFA 1HQ4A 3UXFA 1KEGH 1F2XK 5D7IB 1AO7D 2XCMC 2OAAA 4OV6F 1GA2A 1NPJA 1NCDH 4BSVB 1BG1A 3GIZH 4O5LH 1X5GA 1I3RA 3AW5A 1RPUA 2ZOKA 5B1CA 3ZKMD 3X2QB 3S88H 3QUZA 1PEWA 4PJ9D 5JQ6L 4W70A 1R5WB 5I1DB 1AYRA 1XGRA 4JB9H 3PWVA 3RX9A 5B3NA 5BVJB 3KJ6H 4K9JA 3VWJC 4YGVB 5TQ2H 3WFZA 1TJIH 1XGUB 2C9UA 3LNHA 1YDPA 2O5YH 3NSCA 3QEQB 4P46D 4PVLA 5F6IC 3RNKB 4CSTA 5J9PA 1EPFA 3W11D 2ZUWA 2YRLA 2XFXA 5HYJE 2YOCA 3BPCB 2JSFA 1KBWA 1F6AB 5TH2B 3S7GA 2VWEC 4KTEL 5ESVA 2V5YA 1NCDL 4HFUH 1ETA1 3M7OA 2WBJB 2X4OB 1DVSA 4Z0BH 1M7IB 2F53A 4PR5B 2GTQA 1HHGB 3BT2L 1UFGA 2B1HH 3RIFK 3UG3A 3HS0A 5F7YC 3S36H 2DQDL 1QVOB 5JDSA 3WL9B 3D4YA 1Z9LA 3WJJA 4EDWL 1VGEH 4TOYL 1TZGL 5IGXH 6FABL 5IKCB 4NM4L 4Y19E 2FX9L 1IBFA 1I8UA 3PWLB 3U1SL 3QEQE 1C16B 4GW1A 1LNUA 1T6BX 2C9AA 3RUGB 5MEPA 4H26B 1SVCP 3H7BA 3AREC 2ZPKH 4FN0A 3W0WD 3RRQA 5D8JL 3L4CA 1YYCA 3ARFD 4WI8A 2Y7QB 3W57A 3MROA 1U8CA 1E40A 3NIDE 3OKLA 5I8OL 2EDTA 2VSDA 4J7RA 4N0UB 4WWKC 4PJBE 1O7DC 3QUXC 2NX5D 3TNNB 2FGZA 4PJEA 2XBZA 4JY5L 2K8MA 4FFYL 4PJFA 3MNVA 4N0YL 2WWNA 2E6PA 4P2QB 3WKML 3AG3B 2XWDA 1FZMB 1J8RA 1SDDB 2KL6A 2MQCA 3IBEA 1UZ8B 1WCBA 2E7CA 3G04B 5CHNB 1AD0A 2YPVH 4AQ1B 1KT2A 4ZRGA 1CICC 4Z3TA 4LFHD 4NWUH 1MCJA 2EC9U 5SWZB 1NBZA 3WIIL 2EVIA 2V0AA 3IGAB 4LLYB 3QPQD 4AEIL 2IGFL 4KJYB 1M9WA 4H8QA 4JFHE 1SPDA 1ZT1B 4HIHB 4WJG3 4XOEA 2MQ0A 3JV4A 1LMIA 3C5ZA 1DQQB 4P04A 1QW8A 5C1MB 4GG6B 2XACC 1AIZA 1UQSB 5I75B 1ONQA 4KI5C 1MLBA 1KPRB 4NZDA 5BMFL 1MEXH 1Z3GL 1ZKAA 4D9RE 3FQTB 4MQ7B 1CDGA 1SF5A 3C2AL 1A7RL 3UERA 4HWBA 1U58A 4IBZA 2VZVA 4GAJH 3ZTNH 2VC2L 1MWAH 1N3NB 1MWAA 3VXOA 1UB6B 5JNYA 2G75A 3SKJH 5IQOA 4EDXA 4Z95H 1G6RL 4LASL 2LLNA 1CUOA 3D51A 2N1TE 3CFBB 4I3GA 4Y19A 2F54A 5DI8B 4AMKH 4FTVB 4R5XA 4D0CA 4Z78A 3MV11 3U7WH 3GF8A 3JVFC 5EZLB 4HVBA 5MHSD 4OGXH 4C83A 3KLHC 1QPPA 4MNGE 1HYSD 3II1A 3T8VA 4F33A 3CH8A 1EMTH 3EUUA 5FUZL 4U6XA 2IF7A 2ZOKB 4GG6E 1CC3A 4KJPD 4E9RA 5HHOB 3RWCB 1YMME 3L3KA 2YAMA 1L9MA 3BE1H 4ZW5A 3WDHA 5C0BB 4AH2B 4GO9A 4F27A 1RIHL 2NUTB 3RQ3A 3VFMB 3TV3H 2CRZA 4WHDA 5ACLA 1OD7A 3AWGA 4MAYB 2J8OA 4GAGL 3QZWG 3HC0A 1ZOXA 2BWIA 5IFJB 5DJZA 4K55A 1JXKA 1XZWA 3SCMC 4FI8A 2AEQH 2FSEA 3BLKA 4OZIB 5DRNA 3B7SA 4M3KB 4E9WA 4S10A 3OKOB 4M4RA 3HS0B 1HCYA 3TIEB 3JTTA 4TNVF 4AITA 1ID2A 3ESPA 5IVXB 4DIXA 1WFIA 4LHQB 1XFPA 2AEPL 1Z5LA 3CN4A 4DPCX 3A4DA 4MA7L 1DVFB 4BA0A 4IGBC 3GMLB 4JG9A 3SPIA 3H6AA 3WXWH 2C1OA 5GS0H 4GAGH 1NGXB 4GI6A 3TWYA 2GI7A 1R5IB 5T3ZH 4GKNB 5D1XB 3FUHA 4RAUA 3K4DA 4HF5L 4GNKB 2DZEA 5FFLA 5EMYA 1EV2E 1AZUA 4D0BB 4QJ5B 4LDLB 1JFHA 3UG5A 3UTSB 1JN6B 1W6LA 1Y18B 4XGZA 3CFIC 3KPLB 5I16B 1IAIH 3VQLA 1ZGLB 3U46B 1C7SA 3UPRA 1EWHA 5AW8B 4PV9B 1BCIA 3GBEA 5I0VA 1YYML 4XXWA 1J8KA 4JRYA 4KJWD 1E9QA 5CJ8A 3QO0A 1HSBB 4Z3EA 1SYSB 3F7QA 2BOBB 4JFFE 4GRMA 5DRXB 5B1JC 2ITDA 3VD5A 3HHMA 3ZKMC 4AL8C 4M1DL 3V4VA 3MPCA 4X6DB 1KGJA 1Z9NA 1QASA 3QYCA 3ULUC 4NJAH 3HNTL 4XBGA 4XNQB 4AQ1C 2GPZA 5KSAA 3QQXA 4J3OF 3TBWA 4NQDB 1L3NA 1RKRA 4RAVB 3A47A 5E56A 5ITFA 4C58B 3RILA 3O45A 1PX8A 3CQPA 3FOLB 4W4OC 2WB7A 5DJDB 1CCZA 3U7YL 4A68A 5JOFB 3AC0A 3RDTB 3UGEA 1MCOL 2FUQA 4OF6A 2Y36H 4B9JA 5KBKA 2VLRE 3WFDL 2NR6C 3H42L 4UWQB 4RWYH 1QFUL 8FABA 1NKGA 2VCOA 2IOIA 3RTQA 3QXAB 4C54A 4AYDC 4K5OA 1KGUA 3WFHA 1DJHA 1LE9B 4S1RH 3LXBA 5FWQA 1UM6L 5E6IB 5AKTA 1FDLH 2OKMA 4F7PA 3VACA 2X4QA 1JHTB 1YY9C 4KGLA 4FA7B 3EDDA 2AZUA 1XVSA 1JGVL 1UWEL 5DC9B 3RTLA 4IDJL 3P4MA 3ARTA 3DOHA 3WDIA 4BJLA 4AEHH 3VFUB 2FJFA 2WLLB 4BXSV 3PGFL 2Y7OA 4KRPD 5FYKH 2PF6A 3BGAA 2B59B 5GGSB 4FFYH 4KNTA 1HL5A 1IC5L 2OMBA 1OSYA 3B3IA 4H4NA 3CLFH 4U1JB 4PV8B 3T6WA 3VTMA 1S7WB 4LP8A 1JWSB 4EF3A 2LAGB 4TRPL 1ADQH 1PTZA 2XYCA 5CLWA 5TQ0L 4LDCA 1LQBC 2R0KL 1FL6B 1THCA 2C26A 4HJGA 4YHKH 3LEXB 3MREA 1D5ZA 1MI5B 2RFXB 3KZ8A 4S1DD 1XEUA 4HJ0C 3ECUA 4GW5A 3TN0A 1VF5C 2ADYA 3L3JA 4WZ9A 1OLZA 3DX8B 2FX7L 4GMTL 2NRDA 3B2MA 4WFEE 5BQ7A 2R2BA 2UX6A 3Q2CA 4NM8L 2WYZA 4L23A 1QEWA 4XN9A 3VXQA 4ZUSB 4FQHB 2FH6A 5TDOA 4EJ1C 2I24N 4QKXB 4XZUA 5TQ0H 2BNRB 2PWGA 5EIIA 4ABVA 2Q9OA 4N0FA 4WWKA 1JTTA 1IC1A 5DDHB 2YA0A 4GFXA 3ISRA 2CKBL 3BGFB 3BZDA 3FQ1A 5ANME 5AD0A 1OKEA 5B3JE 1DDHB 1OQXA 1CPUA 4V1DE 3MFGB 1NIAA 4JFEA 1JD7A 4F8QA 2E7DA 3VMNA 2P46B 3KH4A 5ID1A 3ZHFA 4P9ML 3MGAA 5JIKA 2PTVA 4XC3H 2OMWB 3T4YA 5HHME 3DC0A 2DQFB 1C12B 3VYOA 2IAND 4AIZB 1HXYA 2DTSA 2YMXH 2HKHH 4Z0XA 3ULSB 3VD4A 3LHPH 2VN5A 4WU5A 3QUGA 3P0GB 3U6XS 4V1DA 2XWBB 4JPSA 2ZUYA 2Q86A 2QQKH 1RK0A 5DYOA 2BVPA 2I26N 1FORH 4UT6H 4WK4B 4UIKH 2V2WB 4HFWA 3W39B 3BKYH 3B2VH 5CN1A 2Z31C 4FXGC 1BXAA 1AXTH 4DPRA 5SWZD 2I5YH 2FT8A 2JJTA 2IOMA 2JIXB 3X11B 3HZVB 1VPOH 4AQZA 2YK1H 2YAPA 3SKOA 4PJ8C 2ZQKA 3KYMB 1YECL 1TTFA 3CSYB 5EO9B 5I6XC 1AFVL 2I9LA 2G0LA 5GIRB 1G7PA 4PWIA 1IIIA 3QUML 4DN3L 1OZUA 4OTXL 5JORB 4IRJA 2Q8AH 2XKSA 4RGNB 4WUUD 1PG7L 3B7TA 2R8SL 1OTTD 1E5CA 4RQQA 3GKWH 1O5DT 1NUDA 4HHWA 1MREL 3MOAH 5FYLD 4Y16D 3LKRA 1CF8H 2YFOA 4H0LC 4OQTH 5E6IC 2IPUK 1FDLL 5T1LA 3MV7E 4NXSA 3ZTJH 5KEZA 4NUJB 4YDNA 3T8XA 5LWYH 2O61B 3TZVD 3IF1B 2GT9B 4XP6H 2B2XH 4QXUH 3CDGA 2R9HD 1T0NA 5K9JL 3WU1A 3CU7A 3EH5B 2QVTA 4MD5A 3MV7D 3RG1C 1S9XB 5G5DB 5IOPB 2ZOTA 1A3RL 1OT4A 3UABA 3R0NA 1S6NA 4OD3H 5E4EC 2X4SB 4FLSA 1QOKA 4NQCA 1D6VL 4KO5A 4ZFOB 3UBXB 1T7ZA 5IB1B 3FU3A 1MW0A 1ED3B 3IVKB 4QAWA 1RZIB 3ES6A 1S7SA 3ZL4L 3A6OA 2EYSA 1PDKB 5B3JF 3S34H 5DLMH 4QDGA 1FL6A 3RGVD 2YC1A 3WFEL 5I1JH 1TJHL 1ZE3H 5FV2A 1WICA 2VJ8A 4XBPB 1FNAA 1J05A 1XMEB 1GHFH 1KV7A 2XLLA 4AUJA 1HH6B 3IFNL 4DGIH 1ORSB 1SUJA 5E0QA 2QPDB 3W2DL 3AGVA 4GPVA 5CZVH 3RDTA 2BERA 2ADGA 1K8IA 1SXZA 2X05A 1GIGH 3QEQD 3CSTA 5TF0A 3TCLA 3ARBD 4BYHA 5E4OA 1RUMH 2IV8A 4N0RA 3CN1A 4XX1E 5GGUA 1OAQH 2YA2A 1U3HA 3EJUA 5IR1B 2BSTB 5FA3A 2I25N 1LGVA 2F9BT 5C0CB 4YGVA 2A9NL 5J6SA 2OX5B 3NDYE 3S5LB 1JV2A 1JHTA 5EUOA 4J8QA 3MV8B 1UWXH 4TSCL 1I9JL 2FO8A 2Q2EB 5KBPA 3KWUA 3TJPA 4PJCA 1IM3B 4LEOB 4UQAA 5ETUB 5I2IB 1UENA 2DLHA 3UGUA 3HBPA 3CD4A 2WWMD 3KL5A 2PP8A 2NW3B 3MA7A 3FS9A 4E9SA 4X6BA 1HZHH 3Q6FA 3QUMA 1I1YA 2PPFA 4U1JA 5E2TL 3NH7H 4P2RD 1PKOA 2AEIT 3PAUA 1RU9L 1YMHA 2ZKMX 1M2OA 4K94C 3ABKB 4GI9A 4B3EA 4R4FH 1PZ2A 1MWAL 2EIBA 1BG9A 4GQRA 2B3IA 4GQQA 4YL4A 1JV5B 2Y22A 5IBUB 1TU2A 2VLJB 1OM3L 5HYEA 1CICA 3QXVA 1EAQA 3HUJA 3GS7A 1FAIL 4TV3A 5I1AA 2ZAHA 3PABA 1BOGA 2IPTH 1QTYT 3LIZA 4G6KL 3QG6A 1L7IL 4B9ZA 4MB5A 2AXGB 4PJ7A 1WPCA 1F4XH 3OLIA 3RWGA 4OZIF 3HLAA 5C9JA 1RH8A 4Z7VA 4XCYA 4M7KL 3PXLA 1K5NB 3L3HB 1L0XA 4RSYA 5E2TH 4R6UA 3IXAA 4MMYB 1E2VA 1EMTL 1JWMB 3C5SB 3GXIA 3GJFH 3GKWL 4N0FB 3SJVB 3D6GA 5E2VL 1E9OA 2X0UA 1QUNB 4I0KA 4ALAL 4ZFZB 5HI3D 3IDYB 4WO4A 3TO2B 2VLJE 4B9KC 4RFOL 4HIPA 3SO3B 2XQYA 1SGKA 2XI9A 4N3UA 5ITBL 1PKQA 2DDQH 4JBSA 4OFPA 3UADA 5I8CB 1DSFL 1ZCRA 5AYQA 3CXHK 3MLXH 4FZEL 2VLKE 2XXMB 2OSLB 3MCLL 5IHLB 5D7JC 4U4IA 4H25A 3MO1B 2WJ5A 5C09A 1U8LA 2YWYA 3WSQL 4R90L 3QJZA 4ZUUB 2NQCA 4GG6A 4JQIL 4QTIH 2WZ5A 4CL7A 4Z7QF 3CDCA 4XPAH 1NLDL 5DJXA 1XGPB 1OGSA 2H1LM 2Z4TA 3P11H 4N9OB 1GL4B 1BD2A 5C08B 1A5FH 2YKLH 4PGCA 5IB4A 4AT6B 5AFAA 3R8QA 5JNYB 3WIIH 3D0LB 2IFGA 4E9XA 3GS0A 4LCWD 2OYKA 2ZUQB 4KKRA 2YD1A 4JDVB 2ODHA 3GSQB 2Z4QA 2VZTA 4Z0BL 2H26B 1M57B 2KQNA 1WH0A 1RPKA 1IILE 4OI8A 3KYMA 4BCXA 4TUOA 2B8OT 2NUPB 2YZ8A 1FYTD 3R1GL 5EEXA 4PRHD 1MG2C 4XMLH 3WLBA 4CA4A 5IEHA 4Z3IA 4FA6A 4H0GA 1QLRB 3MUGA 3GSNB 5EU7C 4HISA 3DJRA 4GXUM 4BUHA 4JZOB 5IIEA 1TDQA 3DTXA 4UNTA 3NJHA 4N2DA 5FOJA 3QI9A 5SV3A 1S9WA 4LCCB 5DFTA 3WHXB 4I88A 1AXIB 1EO5A 5F7AA 2AQTA 2NLJB 4F5CA 2R29A 2NXYD 5GHWL 3U1SH 3MJ7B 5H8DA 3S88L 2B2XL 5HP5A 4XP9L 3CDGB 2WO3B 1N2RB 1AIFA 1MZZA 1JBJA 2HLFD 3OWRA 2OYMA 4PJEE 5I1CL 2PO6D 4UQ9A 5IF0B 3IWUA 3MACL 4JY5H 3QIUA 4R7XA 4G8IB 3MRJA 4DH2A 3KM1A 4NNXB 1KIQA 2IH1B 3CZFB 4C4KO 2NX5A 3DKHA 3H9YA 3ZRCC 4ZMWA 4ZYKB 1OSZB 3BD3A 5HYSG 2IALA 2FWUA 1JK8A 4P5RA 4TPRH 1ZANL 5JZ7D 1NC4A 2ALAA 3LN5A 3G6JE 4FLOA 3RKPA 4BQBA 5J13C 4HEMA 4DAGL 4OUUB 2XU9A 3BFQG 4M6MH 4WUKL 1HEJC 4NZTH 3HZMB 2NXYC 3FFCA 3SGKA 4YPGB 1IM9A 2VRKA 2BW5A 2LR4A 2GJZB 3V0WL 5C0RL 3TVMD 2AEOA 2R0LH 1UXSB 4NENB 3DI2B 3SDDA 2X6UA 4U6YB 5DJ8B 4HS3A 3G7TA 1ZLUK 5HTSA 1K5NA 4M7LT 2ZKXA 3O2DL 2BSRA 3RU8H 4QTHA 5AOJA 1OP4A 4MX7A 4O5LL 4MAUL 1I9RL 2MRYA 4X4ME 4ZX4A 3ORJA 3CMOH 5TF1H 5AZEH 5DVKA 5HGBB 1S7UA 5D7SH 4AQAB 4KY1H 3TBYA 3MYJB 5CEYB 3TYFB 4MVBD 2QMKA 4I89A 1F0LA 3KLAA 1U21A 1S46A 3UEZA 4CADA 5JR1H 3L3GA 4WFGE 1IQWH 2UY7A 3TA3A 1XO8A 1X7SA 2VUYA 5IFHH 1E2ZA 1USQA 3IM1A 1TZAA 2YPKB 5C0FA 3VXUD 4P46A 2AERT 4LKXB 5F9WB 3GHEH 4OLXL 4YXLL 1ZXQA 3V6FA 3QIWB 1MIEH 1V7NL 1S8DA 3VI3A 3GSWB 1DN2A 5BZZA 4R26L 4FNLH 1NAML 5PAZA 4TF4A 3QJVB 2OMNA 3CMOL 3FU9A 1S9YA 2V17L 4ZS6D 4N28A 3VFRA 3EDJA 1N64L 3PJSB 4JHVA 1KEGL 1LE9A 5TK2A 1SMDA 3HS8A 5L2KA 4UDTA 3IFLH 1Q9KA 4N8VB 1R3KB 3FQYA 1OTUC 2Z8WC 3FRUA 4DEWA 2C9PA 5KYXA 2ESVB 1GPOL 2DTMH 4RBPK 5I9QB 4WW2A 5J8OA 4YPJA 4OLZL 5DJ0A 1TXKA 3FO2B 2X0VA 3MRGB 4PBDA 1UM5H 2R1YB 2COVD 1HXMA 1QFWI 3COOA 5DSCA 2IAMA 4UZGA 3OXRB 3I50H 2MOVA 1BD2D 2XWCA 1WZLA 5FECA 4GSXA 2K8QA 3W0WA 3VWKB 3P77B 1UH4A 1YQ2A 4XP4L 4A6YB 1FO0H 1NCNA 1P6FA 5SX4H 3SGDI 4EXKA 3RVTC 3BKJL 4MDRA 1CXIA 2CJ3A 2PW1B 4P2AA 4M9OA 4L9LB 4I2XA 3EYOA 4K8RD 1XB3A 3LZPA 2AJ3A 3CJJA 2CO6A 2RBLA 3MJ7A 3SDCB 5GQBA 4L8DB 3GMPA 3SOBL 1BIIA 2OSYA 4LQFH 4MJ5B 3MRHA 5IWLC 4LCYA 4UTBA 4OT1H 1IFGA 1T89C 4XP9H 1UD5A 5F7UA 2GAZA 3FSAA 3FNKA 2XVGA 5SX5H 3BGMA 4OM1H 5FO9A 1KB9J 4YL9A 3DX6A 1INDL 2J8UE 4F15B 1ZVSB 3X12B 4DP7X 4HWNA 2Q3ZA 3P1VA 3M7FB 3HZYA 3E9TA 3E7JA 4L3FA 4OAWA 1A9BA 4DK6A 3TV3L 3V4UH 1CDHA 3HI5L 2IWGA 4FG4A 3VFPB 4XCEB 5D7LA 3FN0L 3RVVD 3BSZH 3CPLA 5E94B 3QXDA 3RLSA 4FLRA 4M00A 3QQ3A 5EFIB 3WN5B 3QEHB 2LGNA 4EIBA 1JMXA 5FO2A 4EOWH 2VAAB 1THAA 3T77A 4NC2B 2YGQA 5I6MA 3O3EB 3BZEA 1I1AA 1QTSA 3BDYH 2MIZA 2EKSA 1RZKC 3WJMA 3CG8A 5IJKC 4OF5A 4X5XB 5FA4A 1ZS8A 3TM6A 4GW4B 3U7WL 3GC3A 3MRCA 4PP1C 1A3QA 3AY4C 3SKNA 1JTPA 2FYYB 4U05A 5F1IA 2XRAL 2YO3A 1EXGA 3BUIA 1YEFL 3QFDA 2K45A 9CGTA 4M48H 4JO1H 1NCOA 4ETQB 5CR8A 5EO1B 2MCAA 4OGYL 1GAFL 2BP8A 4YBLC 1IM9D 1OAYL 1A65A 1ORQA 2H5UA 4HBQA 5FHBL 1ZHLB 4YSQA 3INOA 1DSWA 3QR0A 3UZQA 3OQRA 4Z3JA 3QO1B 4AK1A 1MHEB 4ZX5A 3N41F 4ES8A 1YNTF 4IM8A 1GYCA 1JF1B 4K8RL 3QUXB 1FNHA 2CHDA 1EEYA 3QUKB 2EXWD 1M3IA 3EDKA 5DO2D 1ZTMA 1TT6A 3Q0HA 2YAQA 1EZSA 4Y7MA 3OAWA 3L3OC 4Q6IC 2VLME 3ZQXA 2A74A 4FJYA 2GBVA 2FJUB 3GXTA 3QWOA 2KHAA 3FUDA 3QAZC 4LLWB 4YDKL 4WFHD 4PGEB 3Q48A 3MRKA 3VFTA 1MWAB 4FHKA 5HHOE 2DDQL 2AK1L 5GSVB 1MCEA 2PXYD 2ATKA 1AOZA 2EE2A 5DURD 1PZSA 4G1EA 1XF5A 2HTKC 2PTTA 4ZI8A 4PWEA 2J8UF 4NPYA 3W5NA 2QLYA 4G7QB 1NUNB 3HRZB 2VO5A 4XCNB 2BVQB 2ZG3A 3VWKC 2CGYA 1T22A 3AU1B 4TLSA 4M8QA 3U9PL 4MSWB 3D50A 3OL2A 5HYSA 4LLMB 5BV7B 3TT1H 3RX7A 2R69L 3FFDA 3N55A 3ZE1F 2N0KA 3O81A 1QHPA 3T3ME 1NEUA 4DETA 3BHBA 1BEYL 4DWHA 4PEEA 5EV7A 4RGNC 3SQRA 4AJ0A 4MNQB 3HMXL 4A39A 1I1RA 3DXAE 1UD4A 4YS4A 4TM9A 1U8NB 1L9OA 2BK8A 1HJCA 1L3WA 4NQEE 3GUTA 2J56A 1DLFL 4KO9A 4ADJA 1P53A 5D1XE 4TLKA 4YNYB 2VC2H 1AR2A 2A9BA 3V4UL 3Q2LA 4HK0A 3W11C 3U0PA 5TQ2L 4ZXBA 1S7XA 2QL1A 7PCYA 2TSBA 3C6LA 4UT9L 5EH1A 5KG9B 3V6OE 3H56A 2YGOA 5GS1C 3U1PA 2GYSA 3BSZL 2R7EA 3QC5X 3AABA 3QDGD 1WBZA 1Y7VA 1WTGT 1ZWIA 6PAZA 3DURB 4R3SB 1WUZA 4G6JL 5F72S 3L1OH 4UTBH 3MLYL 1H3VA 1COBA 3KD4A 1VRSA 1JPSH 1TQBB 2VQ4A 2ZOUA 2X4PB 3L3DB 4KKCC 5FYLE 4XPFL 2X88A 3KPLA 5I16A 1ZGLA 2P8LA 3ZOAA 4X0KA 3BVDB 3SE4A 2DIJA 3FU0A 3HG1E 2DLFH 3FUNA 4XVJL 2YSSB 5FFGA 5K1VA 4YHML 2PO6C 4PY7B 4WK2B 1RULL 2M8XA 4G5ZH 1P84J 4ZSOA 4RETB 4MJ5A 1NA8A 1JNHB 3ARYA 2FX9H 3TBWB 4HUKB 3LRMA 1OANA 1U8CB 2L7UA 5DMJB 2Z0UA 2V8MA 4TNWF 1NEZG 3P4NA 3RWGB 4APXA 3FQWA 1EANA 2FBOJ 1QX1A 1LEKB 3R7RA 2E7BA 4PGBA 1TYRA 1A7QH 4G8AC 1QSVA 1N0XL 5DMKA 4GMSH 4Q9QL 3NSJA 2NNAB 2V17H 2FNBA 4NCDA 1XH1A 1HTYA 1EXUB 3LV3A 25C8L 1YNLH 3G6JA 4ZPTB 3RWFB 3T0VA 4F9LA 4LDOB 5DHYB 3EJYD 1GKEA 1NAKL 5D1ZC 2ZAGA 3RVXC 2HWZL 4JG1H 3WAKA 4I5BB 1RSYA 1PKQB 1BLIA 1VLXA 2WIIB 1DTUA 4BH7A 3GHEL 2OR8A 5ENWA 1OP5H 4BINA 4EI5C 3Q2VA 3NA9H 4QI3A 3F7VB 4HFUL 35C8L 2NSMA 1NZRA 1A9EA 1F4YH 4TVSa 3UYPB 4MD4B 4NN6B 4PG2C 3H2WA 1UQSA 4KX9A 1KGXA 2CLRA 4GY4A 3K80A 4PJIA 1BSIA 3CLFL 5D1ZI 4GEIA 4JFPA 3VQ1C 1KLGA 3Q13A 1VHPA 3CGTA 2PXYB 1ZJBA 4FG6D 2O5YL 3FHQA 5JLZA 4TLUA 5IMMA 5GGQL 3KJ6L 5FM8A 2WQWA 4PJFF 1OE1A 1DN0B 3KHQA 1UKQA 4J4PC 1ZV5A 3BVNB 3VXUB 3SE3A 3MFFA 4X9HA 5E1AB 3SDXE 1DQIA 4EI0A 1MFAH 5K59E 3G5VA 3UJIL 1NIBA 3BP6A 2ZP0T 3BQUB 2DN7A 4LSVH 2HAZA 4DN4L 5GS0C 3QUKA 3LS5L 1VB9A 2XKUA 1GSKA 3MNWA 3MRFA 2JKTM 5F9OL 2R2BB 4M6ML 3U4AA 3L3KB 2CUAA 3CDYA 3E2HC 3A6CH 3N42B 2YRZA 3E2HB 3MRMB 3HI1A 3QH3B 1J5DA 1MCOH 2WVVA 1E6JH 1NPUA 1UD2A 2ZWKA 1NGPH 1I7ZB 2QHLA 3BAWA 4AH2A 1FH2A 2R0LL 3QJRB 3GI9L 1MCDA 4I1RA 3NSFA 4PRHA 3PP4H 3ZUCA 4N2IA 2EIZB 2AQQA 2ZX5A 2HKAA 4HIEA 1TVHB 1N6QH 3SQBA 3D25B 3QA3B 1DVYA 3BZ4A 3H0TB 4DPBX 3ABLB 3EKCA 4TTDC 3V5DA 2XG4A 2XWXA 3MR9B 5E7BA 4E9TA 5HVWA 4HXBL 1O7SA 1L4IA 2TSAA 4ODXA 4U1KB 2QSCL 4YUEL 3VX0A 3X13B 2GJ6E 4KUZH 4ODSH 1CIDA 4G1MA 1RP9A 4KH2A 5FKAA 3WDJA 5GS2H 1P5VA 5DRZA 5CEXB 5KVFL 2BSSB 1BQHA 4CVZA 1QFPA 1MFNA 3CC1A 4HCFA 4JFXB 5DQDH 5IBTL 2WLZA 3L45A 5I6LA 2XWBA 3JBG7 5DZNA 4QEGA 1CL7H 5K9OA 2HG5B 2FJHA 2OR7A 4X99B 2R0ZH 3WTUA 2XN2A 3CHQA 5F1NA 2FE0A 2KQMA 1ZEAH 1HAUA 2VITA 3AREB 3EW3B 3GZQA 2A6DA 2GEQA 4DQOH 4OF7A 1JWUB 2P43B 2DYPA 4Z8FL 2J2ZB 1IIKA 2JTDA 3DPBA 4G6FB 1AQKH 2C3XA 3JVGC 1OTTC 5FYLL 3EF4A 3T2NH 5AENA 1TKWB 5GZOA 2ITFA 3M17A 1PQZA 1FFOB 2V33A 1YY8A 5FYKL 1HNFA 3BP5A 5E2UL 4PVBA 5CFHA 4C8XA 4YJZL 1A5FL 2YKLL 3F12A 4P5TD 2QQNL 3I9IA 4YDKH 4XP1H 4G8FB 3P3RA 4ZG1A 1NLDH 1URZA 2AGJH 1YEDB 3NSXA 1F2QA 1QSFA 4AM0A 2FVNA 4LBEA 4H20L 4CILA 4E0RB 3QJOA 3O4LB 1OO2A 3TT3L 4OIBA 1CLVA 3DYOA 2JCCB 4D8PB 4XNDA 4BK8A 1KFAL 1E4JA 4M1CD 2Y23A 1PZCA 4YLCA 5F7NC 2O26U 3HVNA 2AJXH 2DJ4A 3AS1A 2DWSA 2UXVA 1FRGL 4AUUA 2WLHA 1XF4A 2EDKA 4CMMB 2ZUUA 4B7IA 1ZPUA 1CE6A 2E9IA 4MDIB 3I85A 3V52L 4KHTL 3RKDD 3U0WH 2DQUL 2PXYA 3A4EA 1ITBB 1LO3L 4FQ2H 4HGWB 5GRJL 3CHXA 4ZZFA 3NIFB 4C59B 1BQLL 4WGVB 2WD0A 1DO6A 1NFDE 1UYWL 3RPKA 4KKCD 1GZPA 2PWHA 5INDA 4AOFA 1H0DB 4OFYA 4RRPG 5F93C 1AGBB 2OCCB 1YN7B 2DM2A 1XEDA 5EPMB 4H13C 5IM7A 2XWJA 4QOKE 5M7QA 1JK9A 3ASOB 4H40A 3OAUL 2IPKA 1IEBB 3FBKA 4Y9BA 1UACL 2X1XR 3NP3A 5IMKB 3DXAD 3FO2A 3FSVA 3MRGA 4JLRA 1FAIH 2E6QA 4PJHF 1CI5A 1AZRA 3B9KB 2P24B 3SB3A 3PAZA 3JWNC 2AJZB 1B3JA 2A77H 1AQ8A 2YQ2A 2GFBB 3ILQC 1KEMH 3L08A 3K6DA 3NACL 1J8HE 3X3GL 5MP6L 3ULUE 4LRNH 1KB5H 3O9WB 3RJOA 1I8MB 1DVQA 2YJLA 1BW8A 2Z92A 1T0MB 2UZYA 1IKFL 2X2YA 4XPTL 4BH7B 3IFOB 3NCJL 1Z6JT 4Q2ZA 3ROLA 3AG4B 3IGFA 1AO7B 3UJJL 3V5DB 2CBQA 4QHNB 3RL2B 4NUQA 3SDCC 4LKCB 4NQEB 5TE7L 3PWJA 3D0VA 1PSKH 1RZJH 1DANT 2KZKA 3D69B 4G11A 4QRBA 4TLTA 2XQYK 1FYHB 4DFHA 3L8QA 2CDEB 3IMUA 2DICA 2Z31A 4FXGA 3CZKA 1HZHL 2AJYL 1QO3B 1I3UA 4FFZA 3BPOB 3NTCH 5IMMB 5E8NA 4NT6B 5EIIB 3N91A 2B20A 4OAWB 1MH5B 3BO8B 3LEVL 4OCRH 4N2BA 1FVCA 2ZXBA 4PJAB 4Q89A 3NFPA 1ECZA 5E2WH 3T0ED 2NW2B 3CVBA 1P7QB 3Q8BA 1G9MH 1E8YA 4IRZA 4CU6A 2J57A 3HCVB 3KBHE 2VLMD 5L2JA 4DVBB 4FHBD 1YY9D 5GISH 5IVXF 5LGJB 4JFQB 5CEZL 1IEHA 1UD8A 1AGDB 2EKSB 3C6LD 3GB7A 3ARFA 3QNZA 4XNMB 1RUML 3FB6A 1WFOA 3IKCB 4EIZC 4LIQL 5I66A 3LQZA 3HC4H 4Z95L 4YHYB 5C6PB 1XL4A 4JRFA 4X98B 1I7RA 2XBDA 2VLKB 3S2CA 2NR6D 1XSJA 5EEYA 3EOAB 2JF1A 1JS4A 1KGIA 4O02L 4JE0A 4A7UA 5BO1L 2M2DA 3WEXB 5BV7H 3ILPB 5LGYA 5F3BB 3G04A 4QWWC 1B2WL 3VJ6B 5IOKA 2JI1A 5K1JA 3LHAA 1XGZA 4E5XA 4UQBA 1M9SA 2ADJB 1FCGA 4RMRA 3EXJA 3IGAA 4NZFA 2NQDA 1CE1H 2GJJA 2VO8A 4W9GC 4HCRH 4HJ0D 3M6DA 2X28A 3N85L 1U9KA 4M7ZB 3BAEH 4FMKA 2IH8A 1NFIB 1SHMA 3MCKB 4UAHA 1O6SB 3I3EA 4L3CA 2I9LB 4I9WD 1ZSDB 4URKA 1CK0L 2J8HA 3ETSA 2AAVA 5DEFB 5DHVB 3MBXL 4NQXB 2Q8BH 2W91A 3OB0H 1PG7H 1UWXK 1VFBB 1YO4A 2MNWA 2DW5A 4QRRB 3CHPA 3OR6A 4JFOA 3I2CH 2FLMA 2ZZUT 3BH9A 4QWWD 2AAAA 4MA3B 4B0MB 4CVXB 3JQOB 1J8HA 3ESOA 2YPVA 1MCIA 2AXFA 2HVBA 4DP6X 2AQSA 3EYQC 1XL6A 2YD7A 1GYVA 2DQEH 3FCGA 5HHQB 4KUCF 4XXCC 2DD8L 2WSPA 2H0PA 2NNCA 1WTLA 1CFVL 3ZHKA 4Z7NE 2N1KA 3FQRB 5DWUL 1AGFB 1MHPL 2LW3A 4TNWK 2EE0A 3LSOA 3U1QA 3HRZA 2EDDA 1E0OB 2LABA 3I75A 1JCVA 5I1KL 2AMUA 3JXAA 3I3DA 1E5BA 5IJVB 2HUHA 2HPTA 1J1PL 2ZSVA 2X2IA 3D4GA 1KCSH 5L9DH 3CCHB 4OZHB 1XGQB 2MTAA 1XAUA 1NFDA 4JPVL 3U4BH 4DP1X 1EHNA 2XG5B 4U1NA 4A7GF 3GJFK 4PTTA 4LFHG 3BIKA 3BKCH 3F8UB 3DI3B 1HH6A 1XBDA 1WFUA 1H6UA 3Q44A 3RJDA 1K6QH 2QHRL 2VDQH 2OA9A 1A6AA 2Z8SA 2DQGL 4H2CA 1AIFB 4GAYA 4OIAA 4HIXH 4YFEA 3B1TA 2AJUH 3VD9A 2X9YA 2V7NA 3VI4A 3GO1H 4MDIA 2J6EH 1J5IA 4KC3B 4QHPA 1HHHA 3GZOA 3ZIYA 3O3DB 4MS8D 2ZXEB 3SBWC 5D7JB 4HIIA 3UBXG 4OJEH 5D96C 3IDUA 3JVGA 2DBJA 1GY2A 4PRPE 5J3HD 1EVUA 2CM6A 3ARVA 1WZ1L 4JFEE 2BHYA 4N20A 5HY9B 5I1IL 1FNSH 4WWID 3WY1A 4RGMB 1L9RA 3OZKA 3VNZA 4TS6A 3HPJA 1OSPL 5IHZA 4X9BA 2F8OA 1P69B 1CBJA 1T2XA 3HE7A 2DEXX 3CVIH 5TDPB 1F6FB 4R5TA 2KDYA 1E3XA 2XNAB 4HOXA 3QK0A 2VE6B 1FPTH 3RFZC 3NCWA 4X0KB 1JNLH 1ADQA 1AR1B 2A74C 1I8MA 4GRLD 2NY2B 3DUSA 2EVFA 5D93B 5AVRB 2MPAL 4JZJA 1I8IA 4JGUA 3ZYIA 3UTZB 1ZDSA 1N0LA 5FDWB 4TN9A 3BCDA 3QNYB 4PJGA 3QJTB 3TYFA 4L8SA 2CCLA 4HZLA 2X4NA 4PS4L 5GXBB 1R3LA 2CPUA 3W0WE 2EYRA 2F8VA 3KEHA 5G55A 3PE9A 3QNXB 3PAYA 1H6TA 1P2CA 3NN8B 4FL4B 2CGRH 5JOFA 1YJDH 2IIJA 3GSOA 3RA7H 3T6ZA 5C86A 1ULVA 1UCBH 2WK2A 1QRNA 4P0DA 3CZNA 1CURA 5DHVA 3GJFB 3WO4C 4M5TA 1WFMA 4R2GB 3TZVA 2VN7A 2ESVE 2QFPA 4N4YB 3O4LE 5HHMB 2ITCA 2NY3B 3FTYA 4TXVB 3VGHA 4QAMB 2Q76A 1DEEA 3D7PA 1YEJL 2H1XA 2ICWB 1MJ8H 2WQXA 4UT7L 5HXMA 4A2MA 2HFEB 3MLWH 1JXGA 4W6WB 4QY8B 3SN6N 1W16A 4FQQB 3SDAC 2PWDA 1EJOH 1KELH 2H45A 4X4ZA 5E6ID 4TUUA 2A6IA 4G3YH 4HJTA 5FLVA 2N56A 1SN0A 1D5XA 2G2RB 4NZRH 3AS0A 3NAAL 1Y07A 5DJXB 2VLKD 3MRLA 1A1OA 4JHAH 3GZPA 2AQ1A 1PIFA 5CSBA 1BEXA 1OTSD 4G5AA 1YEGH 3SDXA 1H5BC 2J6EA 3LOWA 4A6YA 4YK4C 1JZHA 1KBKA 2W80C 1PX3A 4MZ3A 4QPEA 5KSAB 1BDYA 2XIIA 5FUCC 5JHDB 3HNTH 1NPNA 3DUUA 5GGTA 3MFFB 3P02A 4I2XB 2KKQA 2ZOLA 2Y1AA 2WANA 1MQ8A 1SLWA 2BFVL 2FZ3A 4WKXA 3MBEC 2CA4A 3OJMB 3RTQC 1I82A 2HFFA 1DJSA 2WWMC 4EE2A 2YAOA 1HEZB 4KTDH 4HUVB 3VWJD 5DD3H 4HWBH 1PZBA 2ZXCA 3V4LA 2AKRA 3GSNH 2W07A 4U3CA 2WVVB 2DWTA 1DUYB 3BMWA 4YC2B 4HIIB 2YWZA 4IOIB 3HC3L 5D1QB 3MLXL 4QJ3B 4NC0B 2XV2A 5K59F 3DHJA 4NKMA 4EN2A 5ITBH 2VM9A 5CJ5A 3F58H 3V5HB 1PSKL 1RZJL 2VR9A 4EUPG 4R90H 5ICZB 4TQ8A 1OF2A 5L2KE 3EYUL 1FL3A 1WBXA 3DMMB 1KTLA 4DGIL 4DFIA 1J0JA 3NRFA 1EDQA 2GBUA 2LE9A 3ISYA 1H6FA 2E9GA 1ITCA 3MLTA 4R8WL 2HVJB 2E9JA 3FT0A 2GTWA 4JM2A 1NIFA 2PWEA 4LSRH 1D5BB 1QRNE 5F9JB 3OHMB 3P3SA 5I9QC 2QFRA 1W9XA 2Z35A 4BZ2L 2BY0A 1GZQA 1TEGA 3QORB 5F1SA 3DVFA 1XIWB 4LDEB 5F3HB 4OUUA 1KIUA 3OHXB 3TL5A 3CFTA 4JANA 3T08A 4OH2A 4UV4H 2GJZA 3RZCA 4GBXA 1F13A 3MJWA 4Z7UF 1RIHH 4IIQB 4AY0A 1IT9L 4OLUL 1YQVL 1UA3A 3MV8E 2HRPL 3LVTA 4YXKH 4ONHB 1F90L 3R0MA 2NOYA 3WJJC 2PMZA 4F7MB 3O3DA 1A6TB 1YNTB 4JM2D 1S3KL 4L37A 4UQ2B 1G6RB 3SQOL 4A6YL 2QQLH 1S5HA 1JD9A 4XXCA 4Z7WE 1FNGA 3TFKD 1SXCA 5AG8A 5GZOD 3F65A 1AXSA 3RTQD 4U1IA 3LQAC 5JXED 3QWOB 1RJZB 5DTFA 4DN3H 1WO2A 1ZVHA 2EEFA 3E3QE 3PHOB 3Q2WA 5CLXA 3QHFL 3V0VB 2YD8A 2R1WB 2YLHA 4OQ1A 4FLHA 3QG7L 4OGQC 2IDSA 5D7KE 1FUNA 5KAQG 5TTRA 1GJIA 3P3YA 3QDME 3MMEA 5I8EB 3WS6A 4E42B 5L0QB 1O7VA 5DEZA 4C4UA 3APCA 4MD5B 3TPKA 3FPYA 4NWTL 1D5XB 4B9FA 3BWSA 1XF4B 3MRBA 4Q58C 4W4NA 5F8RC 4CMMA 1N5AA 2V8LA 4LLQA 2Q7YA 1JPEA 4PJBF 4F58L 3O3AA 3MLUH 3OHXC 3ZJAA 3G5WA 1MFMA 2FEDD 3AVEA 2WUBH 1P7KA 3OVUB 4ZPVA 2CJUL 4K3EH 2QQKL 3VCLA 1HZLA 3WKMH 3QEUA 2F15A 4YR6A 1LNUB 1S7SB 4M62L 5E2UH 4J12A 1GZPB 3U4KA 4XNYH 1HI6B 2YMTA 2QTVA 1MRDH 1I8LC 1DQLL 2HP4A 3EJTA 3LNGA 5LAXA 5I1JL 1U3HD 3GNML 4AIEA 3CX5J 4GAAA 4JGJA 2K7PA 3K1DA 1JGDB 2AGJL 2UUDH 4ENZA 5IT2L 1MFDL 4KUCD 3OKLB 3SJVE 1OY3B 3H4FA 3CIQA 4IRSA 2Z64C 3W2DH 1A1NB 1D6EA 1MFBH 1U4FA 2A4EA 2QJDA 4O2FB 1FO0L 3ZHNA 4J3TA 4WEMB 1RIVL 2C9SA 4Y2OB 3RVXD 2D2CC 1Y6MR 1UH2A 4KHXH 4OF0A 5AUMB 3ZSTA 3NFNA 4WJ5B 1TJXA 4KOCA 5D2LF 3TZVB 1U8JA 2CGRL 5KSUB 4PGDA 2IV9A 4AZUA 3GUTB 3QZLA 2HG0A 2JKIS 2F74A 3J27A 1F1GA 4FL4C 2Z93B 2WINA 2O6EA 4XAWH 3GMQB 3RIKA 1H15B 4QYOA 2HA1A 3T3MF 1TTUA 1LD9A 4OQTL 2R0ZL 1IEAA 1KJ2B 5DU7A 4MMZC 5EWIH 5HVGB 4ZMXA 1I4FB 5ELIA 5ES4B 3POCA 4J3OC 4JX0A 3RZWA 4ODUB 3LZLA 1RZFH 5FYJE 1HCFX 1ZWIB 1EHLH 3PWPE 1PCSA 3GYRA 5J12B 4RMTA 2PCFB 3OR7B 3TYGL 2IJ0C 2PCPB 1BIHA 4AYEC 1HT6A 4WW2F 5I82A 2HRHA 5D4QA 2ESVD 4UILH 5DJ2A 1JGIA 2OI9B 3I6GA 5J5EA 1WAPA 1ASQA 4HU8A 5D1XD 4JM2B 5DQ9A 3MA9L 2WP3O 4XN7A 1U8MA 3VXRA 3GI9H 4NKOA 2F5AH 1YN6A 2VW7A 5B1BB 3S37X 4Z3HA 4PBXA 2JLLA 3BKYL 4AMWA 1TETH 2ISDA 3G5XB 2B1AH 2J73A 1A7NH 2XWRA 2GTZB 1WZ1H 1UB5B 1SBSL 4L1BA 2AV7B 1JTOA 1T1WA 1VPOL 4QRQA 4XI5D 2WO2B 3VRJB 4H8WH 4N90D 4PCYA 5ISZD 5C3LD 2IANB 1CLZL 1AGDA 1XT5A 1TVBA 1ETZB 2OJ1A 5IW3A 3MGTB 3RAJH 5JQ6H 3CSBA 1Z9PA 4DKEH 3SKNB 3GPSA 4AXWB 5DJAA 3TN0D 5FR3A 4GKSA 3ZYJA 1XCTA 4YDIL 5HGAA 3VW3L 3EBHA 2HRGA 5C0GB 1L9PA 2BOBA 5DMKB 4N0CC 4NHUB 1HESA 2CO3A 4MAYA 1NIDA 3HE7D 1HL9A 2AI0H 2BP8B 1Q90A 1XCQA 2OJZH 2WNXA 2V9QA 3DBSA 3L4UA 4UT6A 3UX9B 43CAB 3KLSA 3Q8CA 3VYNA 2PR4L 1JYXA 4CC0A 2ORBH 3IJYB 4TSBL 1A8ZA 3ATBA 5C0JB 1E4WH 4XCFH 5FPIA 5L9DL 5HYJD 4K9EC 1PY4A 3EJPA 1RL1A 3TGXA 5DO2C 3OMAB 4E42A 3QUXA 4Y9EA 1OCZB 5EU3B 4YFLI 1QNIA 2A5UA 2B4CL 3GJEB 3NJLA 2QLVB 3QUYD 1ZLSL 1KBBA 1EJ8A 3DTUB 1J48A 1O6SA 4L3CB 2IQAA 5HJ3A 2BP0B 3SE9L 3ZO9A 3MYZA 5KVEE 2ZF8A 2Y72A 1CD9B 4WKZB 1FYTA 3TIDB 3HZ3A 1UEMA 3U83A 5IB2A 2F8XC 3KPRE 1MPAL 3TX4A 4XO3A 2X09A 5D7IF 3PNRB 3KPNB 2H3XC 3UO8B 5KN5B 4MA3A 3EJQA 1FGNH 3MACH 2B5IB 4JDVA 3QT2A 1TENA 2GUOA 4AJVA 1FNEA 5FO7A 1F11B 1BLNB 4IMLB 5B38A 3FK3A 4X6CA 4G9DA 2W59A 1IBZA 2AXJA 5IVZA 2YEVB 5KSAD 4D9QE 1FZKB 2JI3A 3EAKA 4ETYA 5KVEL 1M2VA 5KYWA 1VZIA 5B39B 2R4RL 1JERA 3WKNA 1C5BL 5HDOA 3D4CA 1IGYB 3EYQD 3PGFH 1KG0A 3SJVA 3WXWL 1NCHA 1QEXA 3KGSA 3D18A 4B41A 3QI9B 3TH4T 1U8KA 3NYKA 1RULH 3WUWG 1YEIH 2WXJA 1M56B 1MCBA 4GO8A 5ITFB 1Q0YL 3GXDA 5JW4N 5KSVA 3AITA 4QRSA 2BVYA 1DJZA 2C9VA 3NABH 2ILLA 5EOCH 1S78D 5E7FA 1XGTB 4XPAL 3LKNA 4NX0A 3ZZQA 1I85C 1Z9SA 3DWTA 1EAOA 2APXA 3HC4L 4EAEA 1N5AB 1U8OA 2PYEB 1D2OA 4P5KB 1MJ7L 2DQTH 3VX1A 1OPGL 1VZHA 5I19L 4I1PA 3ZN6A 3KLKA 3FTZA 3AQXA 3QEUB 4LL9A 3RWJA 4GXFA 4Z5RB 1KPVA 4WENB 2FT6A 1MCLA 2O5XL 3KCWA 1FG2B 2GI0A 2CIIA 1KIRB 5AQ0A 3LD8B 3TN0C 3IS1X 4PRHE 4HCIA 3LAFA 1XR8A 3MUJA 1OP3K 5HGDA 3UOAB 5DHMC 3ETBF 4I3SL 2AQPA 2EABA 1VIWA 4JN1H 3DGDA 3ZTCC 5CZXD 5E8PA 4XVUC 1KCVH 2AQ3A 1NCCL 4FCHA 3GTNA 4JY6A 3TU6A 1CGWA 3DPBB 1RI8A 2AJVH 3MUHL 2FQFA 4MYWB 3BRGC 4CGTA 4Z0XB 5DQJB 1UJTA 3VXSE 2VLLA 4U6VL 2I9TA 3OKNB 2QPFA 3VXME 4K9EL 1JZ8A 1E27B 5KSBF 2Q8BL 4G6MH 2VZ1A 3Q05A 2H1PH 2R29H 4N87A 4HXAL 2HJFA 1IFHL 4LHUD 3ATDA 4NI3A 4NS0A 3H9SA 2V3EA 3EHBB 5E9DE 5GGTL 1AJ7H 4U0RC 2WLYA 3O41B 5CSGA 3GI8L 4NO0B 4WTXA 2BP5M 2UXFA 4WNJA 3NZHL 4KXZH 4G8GB 3JUYA 1WF5A 1X4YA 3A4FA 4BQCA 2C9XA 3U2JA 2JKRM 2HN7B 4JDZB 4QHUA 3DO7B 3V6OC 3WTVA 2IPTL 3FQWB 1BF8A 4APXB 2BXZA 1MFEL 2IBBA 2VDRH 2X89A 3KLQA 3M8OH 3O4OB 1NCAL 1KTJA 5C8JA 4KI1A 5I6XB 1B2WH 2VZ3A 3Q8AA 5J11C 2BP0A 2H6PB 3SGKC 4S1SH 1EXUA 4F5CE 1D3CA 3VD0A 5AKRA 5EZJA 1NJ9A 4LSQL 5HVHC 5L2KB 3QEGH 4I5BA 1FSKC 3ZE1E 4YPGA 4ZX6A 3GGWB 2O61A 4WFGD 5AZ2H 3RX5A 4Z7QB 2VLRA 1EAPB 3F7YA 2Q87A 3UPCA 1AOHA 2D0FA 4XVSH 5K93A 4BK4A 3H3PH 4HS3B 4DP5X 5I17A 5J89A 3V0GA 2A6IB 4KKQA 3SGJC 3EFOA 1AZNA 2DLTA 1Y6KR 1ES0B 3UTOA 1AI1H 3FULA 5C6WH 3ULVH 4K8RH 2I07B 3C09B 1LK3H 2ARWA 4FTVD 3VFWB 5HGBA 4JDTH 1A9VA 4GXUN 1ED3A 3IVKA 1DBAH 1NIEA 1A4JA 4RDQF 3CFCH 2YBGA 4LVHB 2J88L 1KXVC 5DD0L 2YC1B 2YFNA 3HG1A 4XPGH 4LMQE 1V7MH 3G6JF 1BIIB 5C0NC 2E7MA 4UOZA 4YHLL 5C7XH 5LVEA 4Y16A 4QHNA 4A7QA 4AKOA 1ERNA 4QRTA 3ZKXB 5JW5B 5C0AD 2BS9A 4G9FD 1LM8V 2AQRA 3FB8A 4MVBC 5DS8B 1QR1B 2F53E 4X4MA 1ET8A 5CUSH 5HI5D 2FIKB 4NUMA 3NCXA 3SPJA 5DMGC 4TTDD 5IJBC 5FYLH 5MHSE 1IC7H 3TA3C 3BP7B 1JE6A 3QPXL 1TSHA 1B9KA 1YAZA 1DQTA 3HPLA 1OK0A 2KPNA 4EQ2A 2ZYHA 3SE8L 4P46C 5HHXH 4KK9D 3BUBA 2WZPA 5HHMD 3T65B 5FGBC 3FN9A 2WXPA 5AOKA 1QSEB 4DTGL 1R47A 2B7DT 2F58L 3QEHA 4DSYA 4RA0C 5KWYC 2P5WA 2ESVA 3ARED 2WQ8A 3HI5H 4BSWA 4H8HA 4KBPA 3T77B 5D1XA 1AZVA 4B9IA 1TQCB 2EACA 4CSZA 3BZEB 4JQXA 1ZV2A 4LLUB 2VW4A 1ROWA 4YSEA 4PB9L 1DDTA 3GTVA 3FUMA 2WBJC 2CLZA 4Z7VE 5EOQL 2FHCA 1UOWA 4JPIA 4ODHL 3UTSA 5DRZB 3X1BA 4KXZI 5EF0A 3U46A 2ZG2A 1YJDL 4OZFB 3LNFA 4ODSL 4A37A 1IJ9A 1RAMA 2EYSB 2Q8AL 4KHTH 1A1MB 4XE5B 4KROC 1EX0A 4IBLT 4ZOAA 2CO6B 2VIRA 3BWAA 4RGND 3L9RA 4OB5L 4WDIA 4JM4H 3AREA 5CJOH 4M61B 1LHZA 3VMOA 1BJ8A 5GSRB 3O8XA 3QQ4A 3WGUB 4ONOA 4GUQA 3OAYK 3QPQC 3CXDL 1KCBA 2A6KA 5AWNL 2ICEA 3DTDA 3AXHA 4G6AD 4PHZA 1J5OH 1E6JL 4Z7VB 3BVXA 3LHPL 1X5YA 2DWXA 1NC2D 4X6FA 2OL3B 2ZT9C 1VKXB 1ADWA 4JRYE 4MMYA 1N64H 2YSTA 2FK9A 2F54E 1VCBC 3WG7B 5IWLA 4LAJH 4I48A 3EYVB 1GVIA 1Q72L 1W91A 2GCYA 4P2RA 2FECL 3PHSA 3NQKA 4K5PA 4Z7NB 4WO4B 3WIFA 1VFBA 5AYTA 1N4XH 3ZY7A 2ZJSH 2EINB 4FG0A 4Z7OB 4G7YL 2DF3A 3F3HA 3GZKA 2J5LB 3BW9B 5HDRA 3F01A 4EIUA 5HGGS 1V10A 4KKPA 2GSIA 4P9HL 3U9UA 3MOBL 4F7CB 2OZ4L 2XN1A 2VLJD 4IJ3C 1JN6A 1Y18A 5MENA 2X9XA 1NBYB 1FNSL 4CC1A 4I7ZC 5LNGA 3K6SA 1G0DA 1RURH 5D2NB 4YZWA 2NMSA 3B5TA 4PWJA 3OKNA 4KKAC 2DLEA 1OT2A 4OZIE 3C8HA 1IE4A 5IK3A 4B9CA 4E5XG 1YNLL 1EHLL 4PYGA 3DV6B 3IXTB 4HW6A 4YDJA 3HB3C 1OARH 4G80B 2G75B 2JCWA 3D2TA 4G7YH 2A0LC 3PL6D 2G0KA 1NAKH 3VRLE 1IRAY 1XGQA 3MXVL 1ZXKA 3KXFB 4JPVH 3U4BL 1MAKA 4KK5C 4L4VE 4UOQA 5AOLA 2ZNXA 3S3CB 4PJ5B 3MUZ1 3VFNB 3L95B 4PRNA 4BZ1L 4HKBB 3UTPE 4HJ1A 4M5YL 3OAZK 4F37F 5IG7B 3O2DH 4XRCA 5TPWL 1DQJB 3BSHA 1QZ1A 2FATH 1R3HA 4XAWL 4NDMA 1NGQL 1NWOA 4FXTA 1RD6A 5HPMB 2D3NA 2DMHA 1SY6A 5CR1A 3P0YL 4R7NA 5CGBA 1II4E 1AKJA 4J2QA 5FF6A 3BAJA 5C2BH 3PY9A 2WBKA 2BCKB 1KJ3L 2FDBP 1CVSC 1KC5L 3MRRB 5E70A 1T3FA 4KZCA 4MXVF 2PPDA 3KXFE 4N6RA 1ZAGA 3KWTA 3PS6A 4LP4A 4PJ8D 1SLXA 4ENED 1YRKA 4KI5E 3UJIH 1J12A 3D0VB 4P23D 3OXSB 1K4DB 4L4TA 1MVUA 4Y5VB 2ENYA 3PV6A 3FQTA 1CDIA 1X5XA 3BP4B 4DKDC 3ZDZF 5ADOH 2W0FB 3V4PB 3OB0K 5F6HI 4QXTA 2CBMA 1E5AA 5I1CH 4BHUA 3KCPA 4FXLA 1U6AL 2ZWZA 3OKDA 2UY6B 5T3XH 3HUJF 1CDBA 1E43A 4G9FB 2NW2A 2YKKA 2EICA 5TK4A 4D2NA 4QHKI 5I73B 4PSRA 3ZE2B 4CBPA 3HNSL 4OFVA 3BDXA 1YPZF 1DLHA 35C8H 5DMYA 3ARWA 4BE6A 3AWFA 4QRTB 1I7UB 4HZAA 2LV4A 2W8CA 2ZD0A 2FR4B 3QG7H 4KKNA 4KQ0A 2R23B 4N9GA 5HI4D 4HUWA 4G82A 1TSRA 2R1XB 5AW2B 1JNNH 1C1EH 3X11A 4DW2H 4F9PC 4CSSA 3LQZB 1BJ1H 1SJEB 4ZMYA 4M3JA 1A6UH 4X7SL 4U2ZA 1Q0XH 1ZLEA 5A2LH 2NUTA 4BGDA 2JE8A 4FZ8H 2IBZY 2ZKWA 2EDXA 5GIRA 3CZGA 1P5UC 1D5MA 1MLCA 3CZSA 2XFGB 4RZKA 3MYJA 4X6DA 1R24B 5I15H 1VEPA 2XJLA 3SKMB 4HUMB 2Y2YA 1K85A 2X2HA 4U3HA 3TA3B 4JCWA 1NBZB 4LNVA 3LNIA 4NQCD 4XVSL 1T04B 3FT9A 4UU9A 4UV4L 4DEPB 5IF0A 1JRHH 4Q9RH 1PF3A 2OXHB 3MX0A 1E30A 5GRVL 1TUPA 1KXVA 2JIXD 4HLZG 3F6LA 3FB7A 3JTTB 5L6YL 1W72B 3A6BH 4ZS6C 3C08H 3FUEA 1QBBA 3F05A 4CU8A 1YEEH 3UC0H 5T33L 5JIHA 1A1OB 1SVBA 4R97B 4MCYA 4GG8A 4JUTA 2FJSA 4W9DC 3UJJH 3QDJA 3I3BA 4BDVB 1DSFH 1F8TH 1UWGL 4JPQA 4Z77B 2XIDA 5BS0D 5FIEA 3TBCA 2RGSA 3W39A 3RHWK 3G5VB 4BKSC 3VGBA 4HX1B 2Y06L 2E6JA 1RFDL 3P4NB 3P30H 5T5FH 5AW7B 4U31A 4XGZB 5EC1B 4KROB 4LVEA 4MCNA 1NEZB 1SEBA 3L9EA 4MBRA 4FQLL 4P3DB 1I85A 3BE1L 2HTKD 3MNZA 4YSUA 1PAZA 3CH1B 4JCMA 1MWOA 1FV1B 3P2DA 5B8CA 2Q6WA 5T1MB 3QYMA 2FBJH 2YQ3A 3VD7A 4G6ML 5D6DC 3RUGE 2KLRA 2VDML 4OSUL 1G4RA 4A7VA 5IJVA 3I6KA 4FTVE 5DD1H 2IQ9L 2Z3FA 1DJWA 2M1KA 2P42B 4TNGA 3L2NA 2XG5A 4RMQA 4U1NB 1AJ7L 4F8LA 4PLJC 3G3LA 2QZ5A 3FTUA 4GW5B 3KLHD 3QFJD 3K6IA 3P73B 4YHOH 1BZOA 1M7DB 1HKLH 4H8PA 4PRID 5HDBB 3VXQB 1GYAA 4F9LC 1M71A 2ALWA 2DQ6A 1KTRL 4UYQA 3T09A 1GGIH 5F7FA 3WNIA 3KBEA 4ODTH 4PCSA 3QUMB 4AYMC 4LVOB 2EDNA 2X4SA 1RZ8A 2HKFL 3PL6A 1NCWL 3AT9A 4AV0A 1C9SA 2YJQA 5G4NA 1U41A 3X17A 1DZBA 2J55A 3GBNL 4KRPC 3WNMA 3K71A 4CVWA 1A7OH 2UZPA 2JQZA 3QJFB 3KGUA 4OLVL 3WENA 5E8OB 2ID5A 3VM5A 3TT3H 5BVPH 2VXQL 4YZFE 3IJEB 4ORGA 2YQBA 3QCUL 4P48A 4ZMTA 3QVAA 3DBXA 1UJ3B 3SKUD 5IQ7H 4AQEB 4EPSA 2IGFH 2FQEA 3WGVB 1NOLA 2CAKA 2AXGA 2PP9A 1VAHA 1Q0XL 3P77A 3G6DH 1MCRA 2X4UA 1JNNL 3P3UA 1IX2A 1OAZL 2EE3A 3SDAA 2XC8A 4X9IA 1HHIA 5L88H 1K2DB 1RJCA 4FP8L 5LAPA 4IGBD 5JW4Q 1JNJA 3SQBB 1WS8A 2CUMA 1G7JB 5D8JH 2UZIL 1KJ3H 1JHKH 1QSFB 1EGJL 1TZIB 3BPLB 1FFQA 5GGVY 4AM0B 2Y9RT 4U0RB 4KRMB 3TESA 4PVMA 1IAKB 4MJID 2XZAH 4OIIH 3NT0A 2NDGA 4E9QA 1JVKA 2QVFB 4IS6B 2F53B 2FLBT 4YC2C 3JWDC 3APMA 1Q9WA 4ODWB 3C5ZB 1QBML 5B1AB 3AJ7A 4D7PA 1WDAA 3VH8G 5IV2B 4BBWA 4F2MB 2VKXA 3PNWA 1HAWA 1P4BL 4LIQE 3X14B 1U92B 5E8EA 5MERB 2W5PA 4QCIA 1G7LB 3BQUC 3E1ZA 1KGWA 3ZXAC 4NQDE 3HFMH 1A6WL 5DEJA 1R46A 3JTBA 1LEIA 3F00A 4YVNA 1TU2B 1KUMA 2VLJA 3SPGA 4NO5B 4D3CH 2Q76B 5E6IA 2J2ZA 3B9AA 4WI4A 1QQDA 1NEPA 2F7OA 1BOGB 2FRGP 1I1AB 2KPWA 4KMTL 3FL7A 4G42B 2DQCL 3IF1A 2E27L 3F7PC 5D2NE 2VLRB 3F7YB 5F7EL 1ZHKB 1H3GA 4WHCA 1T5XA 1WZAA 5FKPA 1J87A 1R19A 3EGSB 4MXQD 4X4XB 4XI5C 2C3HA 4PJ7E 1G1OA 3ZYZA 4I87A 2GY5A 4YXLH 4F93B 3DARA 3K2KA 4MNGA 1UT1A 2QR0A 2RMNA 2H3KA 3FUJA 5DEGB 3ZW3A 2EO1A 3PWUB 3CHRA 2DQTL 3PWPB 4P2YA 2A9AA 5A43C 5I19H 4L3EE 2C7UB 4X80L 4PJ5E 3D39D 3KE0A 2ZXDA 3IFOA 1N10A 3EUDA 1RERA 3HMWL 1QA9A 4KMLB 1C08A 2RH0A 3H4HA 3VWJA 1I9IL 2YPLD 3GSRB 1P4UA 3IEAA 2EE6A 2EADA 2ZXWB 4AGQA 3T3MB 3SKOB 2F1EA 3M1BB 2VR5A 4GXVH 1QBAA 4OZ4B 1ZA6B 4PWFA 3FF8A 1FBIH 5IB3A 1QR1A 3BDBA 4DKFH 5I30L 2BSCA 5DWUH 3GUFA 3STLB 4YLQT 4DP2X 2OCFD 4GBXC 1TETL 4K23L 3BZFB 4MCYB 1UOLA 5EN2A 1UZ6F 4XP4H 1X6NA 2RQ8A 2X3CA 5DQ9B 3RWIA 2HJKA 4JJHA 4KX7A 4OFDA 5C09E 3MRQB 3TVMB 5KVDH 4ZT1A 4UI2A 4BFBD 2MPAH 3SDXF 4HS8H 3VDAA 4LSSH 1BVZA 4TPRL 3TA3D 4U33A 5JOPD 1FQ9C 3A5VA 3L17A 4NQQA 3VD1A 3MDJA 2QMJA 3CFDA 4GMTH 2A9MH 3DHMA 2VL5A 5J12C 3IB4A 3RWCA 3TONA 1OM9A 1TQWA 5HHPA 5DD5L 2V37A 3FQUA 2A73A 2GK0A 1BM3H 1I1YB 2MQ3A 4BQ6A 4MFHA 3SDYH 1J0KA 1TYEB 2DBLH 4X4YB 2GFBA 3I2CL 4HGMA 1H3WM 3HMXA 1UASA 2FEEL 2X4TB 3IJ9A 4F57H 4LCUB 3AFLA 3WS6C 4GQ9H 4LLVB 1GGTA 3JWDL 3RL1B 2E8ZA 4GINA 12E8L 4TL4A 4YSAA 3V55A 5GS1A 1Z0NA 4WIQA 2Q86B 5I73C 4OLWH 3U0TA 1KB5B 4ZW7A 2R39A 4NO2B 2ITEA 1QACA 2YARA 3BVTA 3GTTA 2NXYB 4KFMA 5DFVD 1BZ9A 5KVGH 5HGHB 5K39B 4AYFA 2ETWA 3JUZA 3O0LA 1U8NA 3I02B 5IT2H 1RZ7H 2ZONA 3F62A 1JCKA 1OPOA 2CDGB 2ZCKL 2D7OA 5JO5B 3CZEA 4AQ8A 8FABB 5EOQH 3CIAA 3D85B 3QDGB 4ZJ9A 1HJBC 3L7EB 4OM0H 5JXEC 4I85A 4WI0A 2HMID 4FNTA 1JV2B 1QHOA 3LN4A 1NM9A 1LEIB 3UJTH 3D9AH 3ZYOA 2ZOWA 2VR6A 3C6EA 1V7ML 3ECWA 3UAEA 3ESNA 4CVXA 4HDIB 5I8CA 2VR4A 1GS8A 4YBQD 4UQEA 1TO4A 5TGBA 5AWNH 1L0YA 3OB8A 4PS7A 1ZMYA 5CEZH 3CLEH 3MMEB 4XNUL 4ODBD 1FNEB 5GISL 3GT6A 4BFGA 4XNMA 2ZTBA 4N2HA 4XNZC 4RWYL 2J4WH 1GS7A 2L8AA 1T83A 1AQDA 2Q1EA 3QIWC 2YN5A 3ATEA 4UNVA 15C8H 5KVFE 5LXGH 1N8OE 1TQCC 3ALXA 3C12A 2YEZB 2MOQA 3W0WB 1IGMH 1P7KB 1TTGA 4F8NA 4PJ6A 1G7QA 4M7LH 1G7IA 3OG6B 4XX1G 2OQJA 3WFHB 1PZAA 2FQGA 1CYGA 5ESQB 4HOZA 4Q74A 3S5ZA 1RLWA 3UDWC 4NQDA 3D3VB 3HUJB 4HS6A 2BMKB 5I1AB 2HFGH 4QRFA 4IBUA 2FHFA 1IAII 3EO9H 1IJNA 1TZHA 2VUKA 3K1KC 3O0RH 4XNXH 1KGCD 5B38G 3DSFL 2CQVA 4LHUG 4JK0D 4AIXA 4JKLA 5I75C 3WHE1 3ZE0E 4PLNC 1T7VA 5C0DA 1S3KH 2WLMA 2IOOA 3NVQA 5GZND 1HNGA 1F90H 1DFBL 3OSKA 1SFHA 1KV3A 3LKNB 3SJVD 3B7UX 1OTUD 2JKLA 5KAQF 3C5SA 1I7ZA 1IGTA 2HTLC 5CP7A 3AACA 2JLPA 2X1OA 3WTTA 1B0GA 3DVNB 5FYJU 4JPWL 2X6VA 4WTZA 1WYJA 4OFYD 2A77L 3Q7JA 3QQ9C 4PJBA 3RWIB 1GCYA 5I0ZA 3WO3B 2LLLA 5HYIA 3QEGL 4GQPH 5FHAL 3SBRA 5F0MB 4TVUA 5BOJA 5L7XH 3VGGA 4BWUA 3VFVB 1RUPH 4NP4H 1MRCL 3S3JA 4HETA 1L5GA 2OMYB 2VM4A 3DSFH 3G5YB 3RHWF 1QFWL 5HYQB 3LRLA 3NBNA 1NDMA 3DMMC 1WK0A 3FU7A 5F7KC 3M46A 3ZE0B 2ICEC 3PYCA 1E9PB 3STZA 3NH7L 3L9YA 5CINL 3WUWB 3DX4A 1KYAA 1E8XA 4BELD 5JDSB 3C08L 4X6BB 4WCYL 3RWHA 1M42A 1JRHL 4Q9RL 3KW8A 3RUGF 3C2SA 1U8MB 3VXRB 4Q0XH 1LK3L 1N6UA 4OZHA 4YEEA 3X1EA 5HD8D 3NJKA 2K0RA 3K0YA 4OI9A 1AI1L 1DQVA 1FC1A 3OLGA 3DJ9A 4ETQA 3NCYS 1EERB 4Y8AA 3FQNB 4G71B 1BMZA 4I0PA 4WI5A 3N43F 1UGKA 4Q4EA 4L05A 1AG6A 5E2WL 1JPGA 2IG2H 4OGYH 3RIAK 1IGCL 4MJ6B 4WEBL 2CSPA 1X7QB 4ZTEA 3TV8A 1CD1A 1NLBH 5DGRA 3SBWA 4CAGA 5CD3A 1TVBB 4UUJA 3DMMD 4GKLA 3JWOH 4OY9A 1JPST 1QUPA 5DJ6A 3BYYA 5C2UB 1BMGA 2XV0A 2J8UB 3DJTA 3ESMA 3PHQA 4HK3N 3ZLQC 4G7VL 4S1SL 5E2VH 2H7WA 4K7FB 4ZFGH 3ZDZB 4OCLC 2QQNH 3DX7B 2DQHH 1HEHC 5GRUL 1P6WA 5FCSH 4M1GH 3NCJH 3EHBC 4EOWL 3T0EC 1MELA 2BS71 4P2OC 1PLCA 2B3RA 5D4JA 3WN5A 3LCYA 5DLML 4U1MB 2H0FA 1XV8A 3NIGB 2Q3AA 3S35X 3ZE0F 3RFZA 5DMIH 4FQQA 1EJOL 3O3EA 5GZNC 3N1PC 4ZAKB 2W60B 2VDOL 3QUYC 2FSDA 1NCBL 2EEXA 3CFJB 2WKOF 2VXTH 1AKPA 4PQXA 4MZRA 2VDKB 4HMCA 3K6NA 4UT7H 1ZS8B 3LTVA 1FIGL 4E36A 2IQAB 4ATTA 1MLBB 2ED8A 3SDCD 3R18A 4NN7B 4K94L 2IO5A 5I6PA 1A7BA 4AENB 2E7LA 3FT4B 4HV8B 2FWLB 2NY3C 3SPCA 3D06A 1ACYL 2VDNL 2N3JA 1BFVH 2Z1PA 4EN3A 3HE7C 3D2UB 4YK4B 1KC5H 5T1LB 1CFSB 3AT8A 4JFFA 2C3GA 1T21A 2ZP9A 4JO3L 5HBBA 1J18A 2LTQC 3T8XB 3TBBA 4B5EA 1BVLA 5I8OH 4CDGC 2NY0D 5JHMA 1LE5B 5KANI 2DYSB 3WY2A 4I77L 1G7PB 3F5WA 3WUZA 1UCBL 3RI5K 1F4HA 3HZKA 3CH1A 2PXYC 4Q8BA 3RA7L 3I50L 3G9VA 3NJNA 4FULA 4YN3A 5LGHL 1GY1A 1SDDA 3AY2A 4YO0A 3K2IA 2IADA 3CFKA 3S96A 1A6VL 3GRWH 3HRPA 3BP7A 1HL8A 1VGEL 2NY3D 1HILB 1DUZB 3EYFB 3SE3C 3BN9D 3LKPB 4S2SA 5D6CB 5CJQL 1G7HB 4KRLB 1Z5YD 2WXHA 5LQBL 1TPXC 3MKKA 3MA7B 1IC4L 4HKJB 3EGXB 3FC8A 2DPKA 4M9PA 4PIBA 3O3BA 5DF0A 3VI3B 3MLTB 4BFOA 4NKDB 5B1KA 2HB0A 1P4IL 5INCB 3P9MB 1ZVSA 1YVLA 5A6MA 1YMHB 2YGPA 5E6RB 3MOBH 1WAAA 3VFRB 3PUUA 2F1BA 4OD3L 5E51A 1VFAA 4L48A 3AQZA 5I1LB 4X42A 3KPQA 2BVOA 4Z6AT 3FQNA 1A1MA 4I0PB 4P5MA 1EEZA 2JCCF 3VRIB 3B3BA 5CGTA 3S2AA 1OGAD 5CS7A 4DEUA 2W9EL 3VXNA 1MF2L 1U95B 2CO7B 2VXSL 2HRLA 4PJEF 4E9YA 5JXEA 4ZFFB 1F00I 3EHBD 1C5DB 4JLRB 1WD8A 4JAMA 1H5BB 4FGMA 4D0BA 4IDLA 1QATA 1XQ4A 1EUTA 1H6EA 4WFFE 3REVB 3W38A 4LE8A 1YLBB 3AY4A 3DX9A 2P48B 3FT1A 3RYMA 3VUAA 5CEZD 1GTNA 3QR2A 5FK9A 4HC1H 4XMKH 3FFOA 3FFCE 1J1PH 3HKFA 3JT0A 4PY8I 4APQA 5BRZE 4NYLB 1KXQA 1B9ZA 1K2DA 3L4VA 3MBEA 3QUMH 4AGMA 1TEFA 1OK8A 2OTUA 3CVHL 1QW9A 3ECBB 3VFOA 5IFJA 1JXJA 4N86A 3EFDL 4DAGH 5CXPA 3TBYB 3MRNB 2R0KH 5B21A 4BD4A 4KWUA 3UZQB 2WSKA 4IQHA 2Y1YA 4J6RL 4LZKA 1EO8H 5DUML 1YUKB 4N5EC 4W6YB 2EYTA 2NYZA 4ZUTB 3UPAA 3AZUA 4PGZA 3V0WH 5IFAL 3BWUC 4LAQH 1LDSA 1S2EA 3QCVL 4XVTL 2H9GA 3PU7A 1DBJH 3U9UB 3UZVA 2PNDA 4QF1A 3IGKA 1A0QL 2VDKH 5JUEL 2XHNA 4PJIB 3F83A 4B97A 4RFEA 4M6OH 3A24A 4ODHH 1B4TA 1DQDH 4FQXA 4L4VB 1G1KA 5IMOA 4CN1A 3FONB 2F5BL 4RX4D 3VW3H 1ASOA 3TBTB 43C9B 1M7UA 4J3OG 2FO4A 1P4LB 5LHDA 3D0LA 3RB7A 4P23A 4IBSA 4H1LA 2F58H 2X4QB 2VERN 3WE6A 4PRAA 6PCYA 1PFOA 2DQJH 1TFHA 4JM2C 4G1EB 1DBMH 2V6HA 3BFOA 3UAFA 5C9JB 2OMZA 3NK3A 3R06B 2P7TA 1A25A 3VH8A 1R3IH 3ZDXF 5GHWH 2FJFB 2ROXA 1RIUL 1YNTA 4L37B 4XVUD 1A3ZA 4MNHB 5IEHB 3OAYH 1UVQA 1LO5B 1DQKA 5CAYB 4BXVA 1NGWA 2B08A 4JQXC 2FJGA 2QKIB 3GBNH 3SYQA 3QZOA 5F3BA 3HG1D 3Q01A 2UV3A 4MSWA 5AL0A 1PVHA 1JG9A 4H88L 2KZ1B 5DZJA 4YHLH 1IKNC 2HPOA 4OKDA 4Y5XB 4AT6A 3L5HA 4G7VH 1N4XL 3QRFM 3QEQA 5J9PB 1IBDA 3DX3A 4XPGL 3EG9B 3JTSA 1R0AH 2HCZX 2H4EA 4NM8H 1ZSHA 4FG6C 5F9DC 5EULV 1VSCA 3L3JB 4X8XA 4OGAD 5ESVB 3H9HB 4Z7IA 5KYUA 2OMTB 4KZ0A 3RJQB 3RGVA 2WLIA 3TNMB 1PD6A 2BC4B 3HRZC 1JDCA 4WUUB 2XTJD 1CU4L 4NWTH 5FKAB 4OFQA 3HG3A 3NFSL 2V2TA 2ICCA 3DX6B 5JIIA 3OX8B 4LLWA 5EORH 3GIVB 1NOFA 3B7RL 1TJGL 1PEZA 4L9LC 2MFNA 4I0CC 5EHFA 4HPYL 4NQED 1MN4A 3LD8C 4XO9A 2HG5A 4LOUC 1IAIM 2NY6B 4I9WE 4AEHL 5ID0B 4JRXD 3FOMB 4A67A 1MFDH 2Z7YA 2Y06H 2CO2A 4WCYH 3MRFB 3HE7B 3V0DA 3QDJD 1AS6A 4R7VA 2BP3A 3FO9B 4ELMB 3IPFA 3TWCL 5I76A 4RGOH 1PQZB 4XCCL 4JRYD 2F19H 3B9KD 3HUJE 4EKJA 4M4PA 5JZ7C 3MBXH 3BEVA 1N12A 3LPFA 3CHOA 3VXSD 2Y7SA 3QA3A 3BVVA 4WAFA 4AMXA 1IBGL 1E6OH 5DYOB 1UC6A 3EJZC 4OJCA 5F7WC 3BPCA 3WTWA 2W0KA 4YDLB 4JRLA 4HKJA 4KI5D 2G5BA 4HU2A 3AXLA 4ZTOL 3TEUA 5CCJA 3QO1A 4PG9B 1G9MC 1M7IA 2QGDA 2QTEA 3KDMB 4PR5A 3QHZH 5EU6A 4RGOL 4XCCH 1WVZA 4GH7B 5EEVA 2E5EA 3F64A 4EUPA 3L3IA 3T8MA 4QRUA 4DZBB 4YHYC 4HOMA 5KJ7E 3DOIA 1YUHB 2BNRA 5DYFA 2VM3A 5KBMA 1OM3H 1U33A 4MX7B 2VYRE 1PGRB 4HXAH 2JJWA 3FT3A 4GAJL 3SPVA 1CGYA 4HGWA 4KK6C 4RQQB 3UC0L 1DDHA 3VRIA 2E7HA 3KPRA 1MRFL 3ARSA 5DD0H 4TSCH 3I9PA 5T5NF 1CXHA 1HOCB 3P0VH 4NKQB 3SIKA 5ABAA 2CHNA 4UANA 4Z78B 5JMOC 4XTRD 1CR9H 1YHPA 3B6SA 3ZZLA 3NCEB 4E9LA 4I3RL 3PDOA 4MAYC 4YSRA 5J4MA 3HAEH 4OI7A 5FUOL 5IBUG 3BUYB 2XQBL 1CGSL 3L7FA 4WU7A 4JZNB 3RPBA 2H0JA 2SODB 3WAJA 1ML0A 1BREA 3GMNA 3KWWB 1XR9A 2G4GA 3DV6A 1QRND 1H3TA 1VJSA 2Y6TE 3DJSA 2QQQA 3G6AB 1OXYA 4PREA 5CILH 5BZWB 2OQJB 5A2IH 2P3YA 5C0AA 1UWFA 4LF3B 4ZSOB 4LGRB 4H20H 1LXMA 2OXGB 4UIMA 5I5JA 2HVKA 3BI9X 4GQZA 4GRLC 2R27A 3B8YA 3D9AL 3HJ0A 3H3BC 4Z7UB 3PGDB 1F45A 1YEWA 1BYNA 5JHDE 2VMJA 2NSQA 2O5ZH 3IFNH 5LBGA 1E90A 4XAKD 5ECGA 3GJEA 1B4RA 2XPGA 5I8KL 4WNQA 1OZTG 3CXFA 1CO1A 3TCLB 2K3TA 5AVSB 1DHKA 3B9KC 3B1UA 1Q1PA 3HN5A 3QAQA 2VJXA 5FS5A 3ROOA 4WI7A 4K7PH 2NZ9C 1Q9LB 3G9AB 3GBML 4PJIF 1IQDA 4W9CC 3OX8A 1YMMA 3BH8B 4XMWA 1FG2A 3RI5F 4FFWD 3EJJX 3BMVA 1S7XB 1OAYH 2XFXB 2CWRA 2UWEB 1MREH 1AGCB 1P7QA 4W9HC 2F1AA 5CMAA 1ZA3B 4A2EA 4KUZL 4Z7UE 5EIVA 3OAUH 2X7LA 1QSFD 2QSCH 5C97A 1EA9C 1YPZE 5ICUA 4B3VA 3MRCB 2OYLA 1T20A 4BFKA 1F41A 1ZVNA 5CGYC 2W0FA 3V4PA 3EXLA 3MRPA 2VAJA 2V3DA 4DPAX 2VNCA 2J5LC 3RVWD 5ICYB 1KCVL 4MQSB 2VDPB 5KJ4A 1N5YL 1MCWW 3IE9A 4Y1TA 2EUWA 5JHLH 3ULUD 1ZTXE 2R8SH 4KPHH 3VXPA 1ZIAA 3V0IA 3ZE2F 1S7VB 2ATPA 1SLUA 4NN6C 4RLDA 3WXVL 2I7OA 1T1YB 3JT2A 3NEOA 3DX2A 5EG6C 4C57C 4P2OA 3ATAA 4W9EC 2GHZA 3WN5C 2DKSA 2AI0L 2OJZL 4MZ2A 3UCQA 4KY1L 2XYBA 4LSVL 4DN4H 4Q52A 4JJ5A 3LS5H 4P99A 5KBLA 4FXKA 4PTUB 1IGIH 4PP1D 1MJ7H 4IIQC 5CD3B 3HHSA 1U8PA 4N3TA 1YPZB 4HC1L 3D69A 4XMKL 1R5WA 3I84A 5D2LB 3D52A 2ENPA 1Q94A 2HKHL 4I4WA 4I18A 4NGHL 5EOTB 5HHNA 1KB9K 4UV7H 4ZO6A 1Z9MA 3VSVA 2YPLA 2F5BH 4KVCH 1OARL 1FNGB 1U92A 4PJ9B 1CN4A 3KS0J 4L3ED 1NMBL 4Z3FA 5JW3L 4Q56A 4YIQA 2WQUA 3RTQB 4UMSA 3CBKB 4A2FA 3UDWA 5I1IH 4XNBA 1NFAA 4MRBA 1FSKB 3N44F 3DRTB 3DVGA 5D6DA 1PLBA 4BK5A 2EDMA 1T5WA 5CCHE 2BOLA 5KVGL 3H9SE 4U1SB 1J1OH 2L04A 2Q10A 2J20A