2EDMA

Crystal structure of envelope protein vp26 from white spot syndrome virus (wssv)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
161
structure length
161
Chain Sequence
SVVANYDQMMRVPIQRRAKVMSIRGERSYNTPLGKVAMKNGLSDKDMKDVSADLVISTVTAPRTDPAGTGAENSNMTLKILNNTGVDLLINDITVRPTVIAGNIKGNTMSNTYFSSKDIKSSSSKITLIDVCSKFEDGAAFEATMNIGFTSKNVIDIKDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Major Envelope Proteins VP26 and VP28 from White Spot Syndrome Virus Shed Light on Their Evolutionary Relationship
pubmed doi rcsb
source organism Shrimp white spot syndrome virus
molecule tags Viral protein
molecule keywords 22kDa structural protein VP22
total genus 32
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2007-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2edmA00
2ED6A 2EDMA
chains in the Genus database with same CATH superfamily
3AWEA 4PWJA 3LZOA 4PJDB 2DWEA 5E2TH 2MIZA 3SPVB 1PFCA 3UYRL 5I6LA 1G4MA 2WCGA 4Z5RB 5D4JA 1HH9B 1PQZB 2F53B 1H15A 1NGWA 1SLWA 4K9EL 3VWJC 2EDMA 3FBKA 2NR6C 2X1PA 1FG2B 4YE4H 4PRHB 5E2VH 4KKRA 1I8UA 1FUNA 1YEFL 4LSUH 2Z64C 2CA3A 4GSUA 1FH5H 3UC2A 3B2VL 4PTUB 1S2EA 3SE9H 3OL2A 1CB4A 4XZUA 4N90E 2YD1A 1UCBH 2AK4B 2YXFA 5E56A 1M53A 2HT4D 3DX7B 1TTGA 5K39A 5BV7B 3HUJB 3MLTB 4M03A 2QTEA 1XGYL 2BWIA 2VLJE 2W65B 3ZL1A 1W8EA 3RWJA 4N25A 1GAFL 5J3HC 2DQEH 3UOAB 2XWCA 1BGXH 3AQDA 3Q9PA 4NZJA 4OZIB 3F01A 1MCEA 5GHWL 3MUY1 1S7RB 1OV8A 2E7CA 4WI0A 3KGSA 5HHVL 2FWSA 2JJSC 2K8MA 4KZCA 4EOWL 1ZA6B 4NPYA 4G6FB 1RP9A 2APTA 4P46C 1G7MB 3E6FB 5EU6A 2BVOA 3PP3K 5A2LH 4GUOA 1FE8L 2EDEA 4HQQH 1DZ0A 4J3OC 4U49A 5L7XH 3IJSB 1ASOA 4LHUD 4YGAB 1YMHB 2VDPB 5F89B 1IVTA 1ID5I 4WFFE 4YNYA 2BMKA 2V33A 1DBBL 3TP4A 4RFOL 1FAKT 2E47A 1ZANL 3KLAB 1WZ1H 4YE0A 4CVZA 3KGTA 4MCZB 3JV5A 1BQUA 3MJ9L 1MJ7H 5CIPB 2JE8A 3ZKQD 1H19A 4DWHA 1ACYL 4XP6H 1TQWA 2H0JA 4MNGB 5DFAA 2E9WA 5F44A 3HFFA 3WKQA 4DERA 5DJYB 3QC5X 3FT3B 3ARGD 1LK3H 2HTLC 3FTVA 3VSVA 2R1YA 4LLYA 3ZPDA 1YNTB 3NYKA 1CI5A 5B3NA 3GMQA 3QEQE 3O2WH 5I8EB 3VACA 4R26H 2QPDB 1UURA 2VLKA 4TLSA 3B3IB 4N0RA 1E4JA 5IFAL 1YPZB 3OKLB 1EZVY 4K07A 5D7KD 1DUZA 2H32A 1QPPA 3ATFA 4GOSA 3SQBB 3GUTB 4PJ7A 1FZMB 2OYMA 2R39A 1ZLDA 4P3CH 4B6ZA 1SQ2N 3C6EA 4QGYA 4KXZI 1R19A 2AERT 3IMRA 4G6AD 3TM6A 4YHLH 3TA3C 4PP1C 2CO2A 2HB0A 5DURB 1AC6A 2AJSH 5CINH 5T1KD 5B3SB 3A3YB 5D7IA 2OTUA 3BAJA 3TURA 5EUOA 3V6ZB 2FR4A 1QTYT 3D2TA 1WC7A 5FGRA 4OGXL 4HKBB 1SY6A 5EZLB 4LCWB 2MCPL 2O1AA 4WI7A 2FJGA 2VR6A 5J4MA 5I1IH 1UH3A 1A1OA 1WFJA 1F3JA 1THCA 1FZOA 2DIAA 1R5WA 3BUIA 2NX5E 4PJ9B 1E4XH 1BCIA 4K71B 3S88H 4XXCC 1MCJA 2VR5A 3MO1B 1JRHI 4H0LC 4AGLA 3APCA 3RZCC 5HYQA 3WTWA 4IS6B 4FC3E 5ENWA 4AYFA 3TBTA 2FX9L 1K5NA 5LAPA 3V5HB 3DPDA 4UBDD 4IRSB 1RK1A 3F7RA 1UJ3C 2K9FB 4KKCC 1A7QH 4BRJA 3VXRA 3CFEA 1OD9A 4Y4KB 5D1QB 1H6TA 1MFBL 1BIHA 4HWUA 2E4FA 4WFED 3RL1B 3LHPL 2KDGA 1NQBA 1I9IL 1KN2L 3WY3A 2QLYA 3MODL 4N22A 1G6VK 3VMOA 3MCG1 2FDBP 3UYPB 2ICEA 2Y3NA 2HX8A 4Z7UF 5FO2A 4HXBH 4TKWA 1TEYA 3G5XB 5E6IB 4KO9A 1OTTC 1INQA 3VXNA 1C8PA 1JSYA 1INEH 4BCXA 3WHE1 1THAA 1FNHA 4L4TD 3QQ9C 3VH8B 3SBPA 2JIXA 3UPRB 4QXUH 3X14B 1NUGA 1JF1B 2EE2A 5D9SB 5D96B 3MLVH 4XN8A 3UMTA 3FQ2A 4ETYA 5DF0A 3SY0A 2ZKWA 1U95A 4HGKC 3EFDL 4G6MH 2QSQA 2WIIA 5J6GB 4QHNA 5E4IA 5FHBL 3QJRB 2WAQA 2E75C 1G7HA 5B7EA 1GGIL 2FHBA 2CIIA 4N4YB 2GY7B 2YPKB 3CNKA 2OLDA 2A5UA 3KBHE 1QSFD 2R7EA 1GGCL 2XV2A 2BCKB 5JOEA 3KDPB 2C9PA 3X3GH 5I19L 1AY1H 3NIGF 5F9OL 3O81A 3RWDA 3RPIA 3LN5A 4HAFA 5HDRA 4JM2A 4ODHH 3NACH 1U9KA 5IB5A 3Q2LA 5DD3H 4RZCB 2TRHA 1YMMB 4KITB 4NQXB 4HS3A 4HPYH 1B4TA 1XWVA 4S2SB 2A3TA 3NZSA 2VL4A 1PSKL 1AJ7L 1WHPA 3WFDL 1M9SA 1CYWA 4A2EA 2ZUSA 2VDRL 2XX1A 3DETD 4Y5VA 5CU9A 2XQYK 5D1ZA 1L6PA 1XH2A 3SEPA 1CICA 3SE8H 3O41A 5T3ZH 3CMGA 2OULB 4MCMA 4F33A 4GKNB 2P5EE 1BAFL 1WEJL 3QRGL 4JRLA 1BVNP 5IB3A 3O3BA 4NIKB 5HGAA 1XGTB 2EE6A 3ARFD 4X5XA 3AU1B 4B41A 1QBAA 2DQTL 2FX7L 2X6MA 5TK2A 3GIVB 1N59A 1JWMB 5I76B 2DRUA 4BFEA 1AZCA 1ZS8A 4XGZB 5AG8A 4MJ5B 2YD4A 2VISB 3IDMA 3QCTL 3LNDA 3WEBA 4XPTH 3P02A 3O4LA 1I1FA 2HN7A 4HIHA 2X1XR 4P49A 1RZ8B 4YSUA 3BZEB 2LVCA 2Z3FA 4ZXBA 1J9TA 2Q8AH 4NQEA 3Q06A 4Y8AA 5DHDA 1OCWL 2DQCH 2YGNA 3NEXA 1AGBB 4J3SA 3NTCH 2EXTA 4KJPD 5E94B 1QRKA 1PEWA 1XGRA 5FKPA 2FZ3B 3KJ4B 4OIIL 4X9FA 4IGBB 3ARDA 5DJ0B 4PW3A 2IV9A 1MAMH 1D7DA 1FAIH 4LCIH 1DN2A 4JE0A 1NCGA 1VFAA 1JTTA 4M6MH 4U7MA 3KPSD 4HS8H 1XD1A 2B9AA 2IDSA 3JBG7 1N8OE 4AC4A 2EIEA 1KTLA 3MRJA 3FQXA 3V7AE 5IB4A 4LARH 1VIWA 4H20H 2JKXA 2Y6TE 5TF1H 2NY2D 1KTDA 2PPDA 3CZJA 2UYLB 3L3KA 1KNOA 4XPAH 1DUYA 3T0AA 3VGBA 3FFCB 3MV7B 3QA3B 3BSZL 1FFPB 3GXIA 2ENQA 4OF5A 2BWDA 2MMXA 1T03L 3D85A 3ZDWA 4HBCH 2IADA 2ZUUA 25C8H 3IKKA 4ODBD 4Y16D 4WCYH 1T21A 4P23B 5GRYA 3IMBA 5KVEE 3FQUA 4Y2DA 3PCYA 3H2PA 5JPMA 5HD8C 1TQTA 1B9KA 4XMWA 5ADOH 2BNQE 1NIDA 4LB8A 4FNLL 3P73A 4PJAB 4V1DA 4CSPA 3SE9L 5CWSA 2PO6D 4R0LC 5DC2A 3NFPB 5T5FA 1WISA 3PUCA 3IF1B 3OKKA 1KB3A 4NKDB 3MJ8B 4PJ8C 2FBOJ 3DA0A 4L48A 3B9EA 3MJ7B 3P11L 2YC1A 1GZQB 3X3FL 4I8DA 4JM2F 4M48H 4HJUA 2WXPA 3UH8A 1AZZC 3PUUA 3U7AA 3MVSA 3NSFA 2Y72A 1BFVL 1JGVH 3QIUC 4JAMB 2J21A 2QSVA 4N0FB 3V8OA 3VG0L 1EZSA 4OM1L 1RZGA 5EIVA 1M6UA 2C7UA 2KS0A 4FQ1H 4FN0A 5FYJU 2N7SA 3L2MA 1EK3A 5FCUH 2K1MA 1MFDH 3QUYA 3AACA 4HBQA 5GZNA 4Z7NB 2I9LB 4ONHB 1ZLVH 3ML8A 4JO2L 1M2VB 2HG5A 4YSQA 1B3JA 2ZCHH 1SBBA 1TJXA 3I6LE 3MNWB 3RQ3A 2NY5C 3FCSB 4XNZC 1JNHA 5HI4C 4HUMB 2P47B 3PHSA 1ZHNA 3MJ9H 3FO9B 4M8UA 2YAEA 1G7JB 1UZ6F 1BXVA 4OGAD 2FAUA 2FBJL 3AITA 3IJHA 2EXWC 3WY1A 5JZ7D 1PVHA 3CFJB 4MCYA 4PWFA 2FL5B 4OKVA 2N1TE 5I6MA 3HE7B 5DVMA 5INCA 3OPZH 2J72A 2QADC 1SFDA 1U58A 1VFBB 1YO4A 2VSMB 2LTQC 5E8PB 2GJ6A 1NFDE 1P9MC 1T0NB 2A4EA 2A9NL 3O2VL 4Y19D 4ZOEA 1I8LC 3S5LB 1J0HA 1XAKA 1TJMA 2TSBA 2XWTB 3CCHA 1FYTD 2A83B 3L2LA 3LN4A 5ILTL 5I8OL 1X5GA 1SEBA 5JW4Q 1X6LA 2DLIA 5IEKB 5FK9B 4IRSC 1RZ7H 4M7ZC 1IV8A 5G5DB 3P54A 5FO7B 2H3NA 4FEMA 3LKSB 4WNSA 2YQGA 3HC2A 1G1KA 3BJLA 4U6HB 4UUJA 4XRCB 5KYNA 1PLGH 1XFPA 3KXFE 3Q7JA 2GEQA 4RAVA 5C0CE 1CK0L 4XNMA 5BPPA 3L7EA 4WLCA 3BESR 1SYSB 4PJIA 5B21A 1YCSA 1E4KC 1MW2A 3MYJB 1BZDA 2JB6A 3N1QC 3HHSA 4JFPB 1C5CL 3FUHA 4XCFL 5KYUA 3BYTA 2X4UB 3N43B 1PZBA 3WFEL 3WIFA 4L4TA 5DHVA 1LQSR 4HUCA 4HOMA 3JV0A 2NY7H 5SWZD 2DLFL 3WJMB 2ODHA 5E1QA 1ZT4A 3SN6N 3UBXA 3Q8AA 3MRQA 1E4XL 4OZFB 3S4SG 1IM3A 5L4FA 5FCSH 3QH3A 3TEXA 4PY8J 4JFHE 4RQQA 1BOYA 1RZIB 4PJFF 2O61A 1Y1DA 5HGBA 4P2OC 3O9WB 4XOEA 5JO5A 5B1JC 5D7LE 4IOIA 3UP6A 2QGEA 4G80B 2EDLA 1PU0A 3IFNL 3T2NL 5LB1A 2UXFA 1NC4B 1P5UA 3BX7C 3MRHA 1BJMA 3V4UL 4JCLA 4EMZA 4FQQB 2IPKB 2PPCA 4QRSB 3W0WA 1UOLA 2C3HA 4IIQA 3UP1A 3UTSA 2JJUA 5HI5D 3U2JA 1Y0LB 1FC2D 2QR0B 1KGJA 1AD9A 3P2TA 2BSBA 2R69H 4XPFL 2NZ1A 3RBGA 1XR9B 2M8XA 2VABB 1WA1X 1D9KA 3FXIC 3MC0A 4HXBL 1J8KA 2XN0A 3O6FB 3P0GB 3BAXA 4QXGL 5MEOB 1UXWA 1E9QB 5CEYB 2QMJA 3SE3A 1INEL 1PBYA 3C6LB 4WWOA 3A23A 3HE6C 1U91A 3ML9A 4G83A 4QT5B 4ZD3L 2A7BA 5FKAA 3D2UA 4TSAL 4HISA 4BDVA 2ZG1A 3GZPA 4UQDA 4KWUA 5LUMA 3CSFA 2ICWI 4R97C 1ETJA 4FA8A 3Q01A 1L3NA 3QQDA 4IHBA 4PAZA 4UQIM 2ED7A 4L1SA 1AYRA 5IHWA 1WWWX 1CE6B 4HG4J 2WANA 3GHPA 3U46B 4LCUB 1ACCA 1J5DA 1WF5A 2CE6A 4N3UA 2F5BH 5F1IB 3RVTD 4CSTA 5L9DH 1JPSH 2ED8A 5KYXB 4X6BA 4JZJC 4HETA 3WLWC 1UUNA 4LDCA 1A65A 5KOVC 3WEMA 2JKJA 3AU0A 4A66A 4YZWA 5I16B 1FNEB 1HHIA 1T0PB 3KPRD 3QNYB 3UYRH 1CBVH 4P5MA 4G9FE 5C9KA 1GZPA 1CC3A 4LMQE 2KZKA 1FL3B 5EC2A 3OGCA 5T5FL 1N18A 4PLNC 3VI4B 3RX9A 4NQUA 1ZE3C 4FJZA 1NAMB 4U4IA 3A6CL 4WI2A 3RY6A 3TNNA 2GTZB 2WBWB 3WFDH 5C0AE 4FFTA 3WKML 5CEXA 1I8IB 3GBNH 1DQLH 1PG7W 2LU3A 3L45A 4MJ6B 2VE6B 5ANME 4TLKA 4D94A 1KCVH 1UM4H 1FNFA 1Z2KA 3S34H 3BD5A 3OKEA 2WLJA 3D52A 4IU3A 1SHSA 3ZW3A 3G5YB 1MG3C 3BZFA 5E9DE 3N42B 3ZTEA 1FJ1B 2AXGA 3TYFA 4JGJA 2WXOA 2YPVH 4OCMC 3SYPA 4S0SD 4I18B 4TXVB 5E51A 4RLDA 4IK6A 2XWRA 4L8SA 2XFXB 5F88B 4EIGB 1TYRA 4DUVA 1JFQL 4BEIA 5L0QC 1TZ8A 4JO3L 2ZE0A 5HHVH 1SNRA 2C9AA 1RZKC 1T1ZA 2A1WH 1T7XA 4JW3A 3CLFL 3DYMA 1KJVB 1ZKAA 3G5VB 4DT2A 4LLAA 4OF6A 2MOQA 1JZ8A 4RETB 4IGBD 3IETB 4EI6B 4G6JH 1DVFB 3E3QC 3GKZA 4L8BA 4TUOA 4H7VA 3RA7H 2MCMA 4NSKB 3T2PA 3US9A 2DH3A 2R0ZH 3VXQA 5IEHA 2PP8A 2X4QA 4S0TD 4L8CA 1PFOA 3FB6A 3HE6B 3ARQA 4I0KA 4JFXA 1G7IB 3KD4A 2JSFA 1K8IB 4X98A 3WO4B 4J39A 1X4ZA 3RX5A 4ZSOA 3GSNA 4TNEA 1CDGA 4M6ML 4XO4A 2VQUA 1GC1L 1XF4B 3DUSB 3L3OC 1TEGA 1KJ2L 3V6FB 3FUDA 1I9JH 4YPJA 2E76C 4NUPA 3RIKA 4ZMAT 1ND0B 3ECQA 1IFHH 4QI3A 2VMCA 2VDRB 2EH7H 3DHMA 1UACL 4WWKB 4E0RA 3GSUB 4YSPA 4YHKL 1ZRUA 3BD3A 4P23D 2IH9A 2PR4H 5IF0A 2E8YA 2WWNA 3E38A 3M86A 4BH7A 2EZ0C 4RX4D 3E2HB 2BP8A 4YHZH 1DEDA 1JCVA 2E46A 4H0GA 1U3JA 2XHNA 4WU7B 4PTTB 4WTZG 5BO1L 4DP6X 4LOUD 2X10A 3L5XL 3DRQB 4YXLH 5CAYB 1GS7A 4IDJH 3MSPA 1CFSA 4GRWH 2XZQL 1XVSA 3WFHA 1QKZH 2NX5B 1QUPA 3OMNB 1YC7A 4FNLH 3ZTNL 4KUZH 4NQSA 1CXEA 3KPTA 2NY1B 3KL5A 1DLFH 4YHLL 5I5RA 3HRPA 2PCPB 2VLKE 3UTZA 4K8RH 3ARBB 1UM6H 5J57B 5CGBA 1CDIA 1ML0A 1QI3A 4NERA 4PRPE 2W88A 4N87A 4N20A 1HTYA 3P11H 9CGTA 1EA9C 4JL2A 3MRRB 1KPVA 1A4JB 4DK5A 1QBMH 4OV6F 1URLA 2A9DA 4PB9L 1K6QL 4W1TA 1RURH 5GJSL 4CC4C 2UZYA 3LOWA 4H8HA 5JLZB 3EYQC 1NFDF 4WW2F 4ZO8A 2ZOLB 2LU4A 1MFNA 3EYOA 4I88A 4P57A 3GMNB 1U92A 2P5WD 2ADJA 2EDYA 3ABKB 2Q7YB 4AXWA 3U2IA 1FL5A 3MV8B 2RH0A 4QPEA 1MFMA 5KJ4A 5HI5C 3NCMA 3RX8A 2O5YL 3QUZA 1A1NA 2OMWA 4P99A 1JPTH 2IQ9H 2YK1H 3NJVA 4WJ5B 4FP8L 2XBZA 1LEKB 4ONOA 1IT9L 3BQUA 4APXB 2W9EL 1FO0L 3FTXA 2CXKA 2P7TA 3BP5B 2G75B 4DKFH 5I1HL 1MCWW 5IHLB 4M02A 1FSKB 4RSYA 1B2WL 4DKEH 4M6OL 2FX8L 3G5WA 3REWB 4BBWA 1I9IH 5EEZA 5TK4A 4YLBA 2GAZB 1DBML 3CIAA 3AROA 4OLZH 3MPCA 1QW8A 2IWEA 3MBWB 1RUMH 1R0AH 5DFVD 4L9DA 5DJ6B 3STLB 2GI0A 2E3VA 4O58L 4PQXA 3H9SE 3BMVA 3MJGX 1QR1B 4FYQA 5IBUG 1FYTB 1GGUA 5L88H 2E7LC 4YBQC 4QOKE 2IPUG 3L4YA 3V0AC 1QEXA 3Q8FA 2Y36L 3OZKA 5EZOL 5IWLC 2Z31B 4ZTOL 4YPGB 3G9AB 4O5LL 3I3DA 3RWCB 5I18H 1ITBB 1X5JA 2IAMD 1N6UA 4KY1H 5FUCE 5IQLA 1T2QH 1IC0A 4YX2H 1A3LH 3V0WH 2WXRA 3DOSA 2P46B 1QA9B 1CDBA 4GG6B 1OQXA 1BVKA 3GB7B 4ZSOE 1E4XI 1IB5A 5F7NC 4MNHB 1T1XA 4CMMB 3R06B 3MACL 4Q2ZB 4KVNL 5FEBA 4AEIL 5IKCB 3LRSA 3SDDC 5JHMA 3VCLB 2OTWA 2QQLL 3UTTB 4B96A 3MZGB 4RFNB 3LKOB 1BIIA 1MHCA 2NY6D 2FWLB 4HPYL 5DJAB 3GM0A 1NL0H 3BAYA 3QDGB 4PP2A 3APNA 4AJVA 3MJWA 5HDLA 3VD5A 1TTRA 3S36X 1F1DA 1J0YA 1S78C 1IZKA 2ZX9A 5IW1B 1P7QA 2Z7YA 3KYNB 2VZ3A 1MWAB 4KRNA 5IBTH 1EHXA 5K5YA 4BZ1H 1HIML 5F1KC 3RU8H 3BGMB 4CJ1A 3ARFA 1I7UA 1RHFA 3CLEH 4KHXH 1WBZA 4KXBA 5I73B 1KMGA 2WSPA 1J8RA 4GBXD 3TN0B 5EIIA 1YN7A 2AJXH 3KPOB 4KOCA 5EOTB 4Z3HA 4DKAA 3CZSA 5AVSB 2FX7H 3DPBB 2KLSA 3AAZA 4AZ8A 2V3DA 4FMFA 4XB7A 2VCOA 1M3IA 2F54E 1C1EL 1U6AH 5J12B 3LRLA 1X44A 2BZDA 4X5RA 2G30A 1DBKL 4L4VB 3ZDZF 4QRQA 4TV3A 4PJ6A 4Y4HA 5HDBE 3RGVB 4BZYA 5T5NG 1U8PB 4RDQG 1G0XA 2O72A 2NT1A 4TNWF 2FNBA 4FA7B 4ZD3H 3EYUL 1MIEL 4I85A 1KWKA 2GJZB 3V0JA 3VFNA 1L7IL 1GTFA 2AEPL 1RJZB 4B0MB 1FAIL 1E3FA 2CJ3A 5ALCL 2BSTB 5FFOA 4IU2B 4TSBH 2CIKA 2FEDD 4GSQA 5DFTA 1E65A 1FHGA 4NN5C 5CCJA 1QO3A 4P2QB 4FQLL 4KC3B 4GXUM 4OLEA 4EVNA 5E2TL 2EDFA 4M7LT 4G71B 3UZVB 1J9CT 1PD0A 2UZXA 4MA3A 3CSPA 3BZDA 4JRXA 5EBMB 3T4AC 1M71B 5DT1H 5HJ3B 4Q56A 4QUOA 4NJ9L 3GMOB 3TONA 2WAHA 2VDML 5GGSA 2QHRH 4BSWB 1H8OA 4DGIH 1TU2B 2XPYA 3KL0A 4XXDB 3LNGA 5JHAA 1D5RA 3TEUA 4DPCX 4KGLA 4UQ3A 2EVHA 4BQ9A 2WPGA 4YGVA 3FTUA 3QAZB 2B9BA 3ILQC 3FT2B 3B5GA 3U0PA 1PCXA 3WTXA 5AD0A 2PPAA 2X28A 5KN5B 4HD9A 5DZLA 1VENA 3KPPA 4ZPVB 5JHDB 4GINA 1OZUA 3VYNA 4UTAL 2V5MA 1SVBA 3V0FA 2IFFH 1NMBH 3O3DA 4AZUA 4FTVE 4UYPA 2I24N 3T8VA 2VO5A 4KDVA 5AW5B 4KJWC 5GHWH 5GSVA 3ESOA 2R0KH 2WBKA 5I0VA 5FWRA 4F15B 2CKBL 1KGWA 2MHAB 1URZA 1XF3A 3I6GA 2NYYC 3OKOB 4EOWH 2ALWA 5DRZB 5F9JA 4XWGH 3VWJD 1F4WH 3TT1H 2G4GA 1G6RA 1LO4L 1TETH 5DRZA 4F57H 1MFDL 3MROA 1U8JB 1E4HA 3GSNL 3I6GB 3Q2WA 4NQDE 5GQBA 2ZOOA 2VN4A 4N2KA 4PRNB 4R4FL 5C07A 4NM8L 3Q3GA 3FB7A 4B9YA 4LRIA 3TJHC 2DTSA 4ZMVA 3PPSA 1NDTA 3O3DB 4BKSC 4D7PA 4HF5H 3QEUA 1VCBC 4JJ5B 5FR3A 3APFA 3LH8A 1J9RA 2CNYA 3C5JA 4L3CB 4OB5H 3QXAA 4XO9A 5EPMA 5F96L 2ARJB 4XAWL 4XP6L 2FBJH 4N1CA 4MD5B 2AABL 4ZMPA 1MHPH 3DNKA 1FVCB 3F5WA 4IRJB 3FT2A 3DXAA 3U0PB 5ICZA 2BNUA 4QHUA 3DTUB 1U4EA 1WFOA 4RNRB 5ES4B 3WG7B 4UQ3B 4LLQB 4QRUA 5DWUL 1WICA 2QT6A 2AJYH 4J3WA 2AXHA 1P1ZA 2K6WA 2X2JA 5TDOB 1QBLH 4H8WC 4F9PC 4UTBA 5GGSB 3ZX1A 2QQNH 1AQ8A 3VGEA 2XWJB 5CN2A 3IU3B 3JVGA 4N5UA 5FO8A 3L5XH 2PXYC 4MA3B 2UZXB 4ELDA 4NAQA 2C9VA 2VL5B 3VDAA 3ULUF 3FF8A 3BKYH 4G6FD 43CAA 3CFBA 5TE4H 5DURD 2Z7ZA 4IBLT 1NWPA 1WTLA 4EI5A 5GISH 1LTXA 1PLGL 1TQCB 3ZR5A 1CF8H 1OAKL 2BSTA 2NY6C 3F85A 3NABH 1MCDA 4FQ2H 3TWCH 3ZMNA 1OHQA 2IH8A 3WNJA 3DTXA 2X9YA 3L5JA 1VPOL 3AY4C 4PY8I 1S5IH 3G04A 1EDHA 5JR1L 1EXUA 2GJZA 4PS8A 4OGXH 1NCHA 1FI8C 1OKEA 2LR4A 3JV6B 3QYNA 1T7ZA 4E5XB 3UG3A 1Z0MA 3HC3H 1KULA 4H8VA 2NY7L 3AVEA 3MV8D 5IESL 4JN2A 1NC2D 2HTKC 4FFVD 3S8WA 4BZ1A 1ETB1 4GW5A 3HE7C 3T3PE 1BG9A 4QRQB 3QQ3B 4X7CC 2AK1L 2XZAH 1J1OL 5ACMA 3F3HA 3SPIA 5J13B 1YMME 2D9CA 2J12B 5TDPB 3VFGL 4P2CG 3GXPA 2XA8L 4JPWH 5E1GA 1IAIL 3POCA 4JBSA 2WZPD 3RDTC 3RJQB 1EEYB 1U8KB 4LP8A 4RAUA 2HWZL 4FQHB 3POHA 1JPTL 3AAZB 3DPBA 4AZ8B 2PR9A 3HFMH 1HKLL 2BRRH 4IOFC 4X6CE 5F7WC 2VXTH 3A6BH 3R18A 3IFNH 4KKBD 3VG9B 5DYOA 3VFSB 2OMTB 4YBHA 4N2AA 1AGFB 1ODAA 1JD7A 4OD2B 4WFEE 4HC1H 5KSBB 4QO1A 3N41F 1WBZB 3C9NB 4DP9X 3K6OA 4XCEB 3VB9A 3BGMA 1WCQA 1TITA 4WHDA 4UT7L 4FTVA 4PGCB 3GBMH 1MWAA 2A6IA 3KYNA 4DPRA 3DK2A 4C58B 3K4DA 4C8XA 1DBMH 3KVPA 4KMLB 1JV5B 4DCQA 5IUCA 1KCSL 4PP2B 3ILPA 3U4AA 5TPWH 4JKMA 1VAHA 4ESKA 5T1MB 1QFHA 4X8CA 2LU7A 3SJVD 1D5IL 3SE4C 5CBEB 2P43B 3NBNA 2WKLA 4NOBA 5H2BA 1Z1WA 4FTDA 1A6UL 3AW5A 3QPKA 3VD0A 3UTTA 3HZKB 3GXDA 3MV9D 5DHVH 3ROLA 4H26A 3VCLA 1U8IB 4HEPG 2C3VA 3OG4B 1DSYA 4UBDC 2V8MA 2ENSA 1T1XB 4CMMA 1TQBC 2XXCB 1PW3A 2OXHB 1UASA 4IKLA 3T4AA 1QA9A 1R5IB 2HKHH 3C87A 1RJYA 3DOSB 2IANB 4FLHA 5D5MF 4AUJA 3KPSB 5E9NA 4HUUB 3PHQB 3TN0C 2CO3A 1W72L 4XAKD 4HHAA 2YRLA 1A7PL 2VR4A 4FHBD 4WTWA 2JQAA 4OFKA 1MLCA 4TOYL 3PP4L 4I0PD 4ABUA 4OV5B 5LGHH 1UHVA 2H41A 4OT1L 4P2RE 5DTFB 4IKNA 2YLKA 3EH1A 3MDJA 2VZTA 1M7XA 4NZRL 3CVIH 4HUVB 1ILUA 4EBQL 4P2QE 1AD0A 4UU9B 4YDVA 3X12B 1ZT7A 4OIFA 1E6JL 5GGVY 3RTLA 4Y9GA 4WUUD 2WLHA 4NP4L 1AJ7H 1NL0L 4X9YA 3VVWA 3STLA 1NFIA 1DLHB 3DJ9A 1U41A 4U1SB 2VZ1A 1GVIA 5DVKA 1IGML 2E59A 2WXMA 2COVD 5I1EL 3V9CA 1ANUA 2FUQA 4JPKH 1Q38A 4LCWE 4YC2C 3MCKB 4PRIA 2QGDA 1YHPA 2WVVB 2XKSA 5DR5H 3ZO9A 5JA9A 5JYLA 4BK5A 1JWSA 2L7QA 5D1XE 3P4NA 4ODUB 4YHPA 2AC0A 2IO5A 2EYSA 3ES6A 5F2FA 4MJJA 2P7TB 1G6RL 4YH6A 3OF6D 2AQ3A 1GZHC 2X2HA 5GGQH 4APXA 3B1UA 2JKRM 2VDKB 4WJ5A 5CCHE 4MLIA 5H4ZA 2OMWB 1KTRL 3L13A 3WIIH 1OCZB 5IQ7L 2BY2A 1U6AL 5HDOA 3MV8A 1FL5B 4OCNC 3GGWB 3K8KA 3W11C 3WS3A 2EUZA 1HXKA 2Q7YA 2ADJB 3P77A 5EZIL 4A6YH 4P57B 5I73C 3VDBA 2F1EA 3QPQD 1NBVH 3EYOB 5F72S 5HDBB 3SYOA 4L4JA 4LCVA 3LRKA 4KNTA 2EXSA 3A4DA 3OQRA 3R1GL 1A4JA 1MIEH 4XC1L 3VGAC 5E2JA 3UZQB 1GCYA 2J73A 1N7ML 3DROB 4QHMB 1S9WB 4X7SL 3SCMC 1EVTC 2XX0A 4B60A 1I8MB 1NPJA 3GXFA 4YOKA 3ZO0A 5GZOA 5MHSE 2FT8A 4BFRA 1IAIM 2Q10A 1F8TL 2WLMA 1WK0A 2NX5A 3N85L 5TF1L 3O11A 1D5XB 1IFHL 1QHQA 3CDFA 2FQDA 3TBWA 3SZKC 3LS4H 1JYWA 5EO9B 4B7IA 2BDNH 4N0UA 4U1MB 4GP5B 1AKPA 3BN9C 2ZCZA 3AG3B 4NJ9H 4GG6E 3UGEA 2ZKHL 2ODIA 2XTSA 2K3TA 3OR6A 4W68A 1CDJA 4TQHA 1QABA 4M8RA 2QFRA 4YXLL 1O5DT 4IDJL 2DIEA 2H5UA 3KPNA 3M88A 2PPEA 5D2LB 1RPUA 1KGIA 2Q86A 5AEAA 4IMKA 3Q2NA 4H25A 1OK0A 3L4CA 4OVUA 3ZTNH 2ZUQC 2AJSL 1DVFC 1KEGH 2Y1YA 4QJ4B 4N86A 3TTSA 3GSNB 1IBDA 1K8IA 4X98B 1H9DA 2VLJB 2VDNB 3RVUD 4UTBH 2IFFL 3JWNE 3UABA 2EYTA 2VDMB 2A74C 1JMXA 4ZW7A 1AQKL 3F6JA 4YDIL 4KZDL 3GBEA 1YECL 4TUOB 2R0KL 2WVTA 3ELQA 4MS6A 4OZ4B 4PLJD 1OIOA 5IJVA 2VDLH 2CG9X 3UGUA 2ZOTA 1KJVA 4BCYA 1AZVA 2HLAB 1HSBA 4YR6A 3GHEH 5JXEA 2CCVA 2PCFB 1TCRB 1U8HA 1A25A 4R7LA 2OYPA 4Z95H 1O5PA 2NY2B 3MCYA 1RZFH 4W9KC 1R9FA 4QY8A 3CH1B 2ZCHL 1YEKL 4W4NA 3PWJA 4NM8H 5HHOD 1WS7A 2YD2A 1M05B 1YNLH 3SGDI 4BD4A 1BYPA 4Y16B 2XWBA 3BZFB 1BX2B 3NA4A 3MNVA 2JK5B 2GHWB 3Q8BA 5LAXA 1FNSL 3EOBA 3OKEB 4IU3B 2I07B 2FX8H 1RUAH 4CBPA 5BVPH 5CFHA 1ZGLM 1HINL 5DJ8A 4MJ6A 5C0EB 1SXAA 4I3RL 2VMEA 1BVLA 3VJ6A 5D96C 2QQKL 3BPOC 3IDNB 5CEXB 3SDDD 5DSCA 5B39G 4NRXA 4G8GB 1XB6A 1PX3A 2PO6B 5C0BB 4O58H 1JK8A 2R2BA 2R23B 1NDGB 2VZOA 4BFNA 3CHSA 2AJYL 2FVNA 4X7EC 4AQOA 4QXUL 1Z5YD 3R4RA 3OGCB 4JLRB 4NM4H 4XO3A 3FUIA 3NA9H 3KMDA 2N0KA 3CVHH 2VWEE 2Z34A 4HGWB 4WUKL 1G84A 4OLVH 2H1LM 4W9LC 3ARSA 5A16A 1FZJA 1HHIB 1FNEA 3L8QA 1RK7A 4KPHL 5HGHA 1BZ9A 4ZMQA 2C34A 1QSED 5D7JB 3BIKA 3L95B 4GBXC 4CU7A 3GJFB 4N8VB 1QRNA 1OAKH 5AW2B 1OAYL 1CE6A 4BFGA 4R7DA 3U7YH 4JQVC 3SO3B 4P2RB 4M6NL 4X7FC 3IJYB 2HFFA 3MACH 5D1ZC 1M7UA 5H4YA 2X09A 2CGZA 4ZFQA 4CBZA 1FN4A 3CQPA 5IG7A 2DJ4A 1OF0A 2FQFA 1RULH 4NQEE 1EHAA 1GYWA 3Q2VA 1ZHLB 5IFHH 4QT5A 1TZOA 4M9PA 5F3FA 2F54D 1IC7H 2MPAH 1CIUA 3SBWC 2PYFB 4RISH 3DVGB 1W15A 3FDWA 1E9QA 5CEYA 1SN5A 3H4FA 4LP5A 1VCAA 2R0WH 3IMSA 1DVQA 4J3UA 5DLMH 2EXYD 1J1OH 1CXFA 3U4BL 2E74C 5FYKH 4ZTPL 5D7LD 4XB3A 4W93A 5D5ME 2CA4A 1Q0YL 2QR0A 2V2XA 3F6IA 4N2GA 4UT9H 3HB3C 1ETA1 2XG4B 4EPSA 3HMXL 1SF3A 2WNGA 4FQQA 4PLOB 4QRSA 1WFNA 1EJOH 1NC4A 1P5UB 1GJIA 3QPQC 4OBRA 4LF3A 1D6EA 1WLHA 3EYFB 4HP5A 4G80A 4C59B 1NEZG 3KVQA 5BW7A 3CPLA 3O9WA 4G2AA 4R90L 4N9OB 4QF1A 3AY2A 4XPTL 5HGBB 3REVA 2HMID 1A8JH 2O61B 3D4ZA 1MCOH 1RZIA 1E7UA 4OJYA 3VYPA 3A22A 1CU4H 3FOMB 1IM3B 2HFEB 5BZXA 2WINB 2HP4A 2OMXA 3CV5A 2WXNA 1NFAA 4XPBH 3CBJB 3LNFA 5ANMB 5EEWA 1NBCA 1S5HA 3G5ZB 4OD1L 3ETTA 3EJZD 1U30A 4P2OD 3WU1A 3MYJA 3PABB 3D12B 5ACZA 4U1LB 5CJOL 3JT0A 4ENEC 2ZXDA 4DHLA 2BX5A 4NNXA 4FNSA 3DJSA 4W70A 2H6PB 3DARA 3GKWL 1Q9WB 4NQCD 2D7OA 4I0PB 3QXUA 4QRBA 4LCYA 1NEUA 4UUJB 3LKSA 3WOVA 1JZ5A 1W72H 3RB5A 2ZKYA 4FQLH 4UOW0 4DUXA 5C0BE 5JXEC 3FAXA 1CBVL 4WKZB 4HWBL 1SEBB 5C0AA 4ELMF 1AR1C 2EC9T 2DQJL 3KLHD 3DSFH 5HJDA 3LN4B 3SDAC 4YO0A 5B4MD 3CCHB 5K33A 1Q72L 1E5BA 2FTAA 4QRRB 5EIQA 1T0NA 2GJ6B 1UA3A 1VFBA 1U58B 3BVNB 1S9VB 4UDTB 4PGJA 4BXSV 4PJHB 3QT2A 4K9EC 2QPFA 3KYOB 4FE9A 5EG6C 4IEFB 4ONFL 2FGWH 4YHNB 3CFJA 2IALB 4BYHA 4FNUA 3SDXA 3QR2A 3TTYA 3E8UH 1L6XA 3VFOA 3EDDA 4EDWH 3HNSL 2XTJB 4OGZA 3TA3A 1CL7L 4L1DA 4FG0A 5FGSA 1R47A 3QNXA 4M48L 4MMYB 1UD4A 2PUQT 4IIQC 2B2XL 4NHUA 4R5TA 3ZIMA 1JFQH 3QORD 4K0OA 1FF5A 1MY5A 1NCBL 1M7DB 1SZNA 2I9LA 4U3HA 2HJKA 2KPWA 3MUGA 3QUYB 3AG1B 1E7VA 2V5YA 3HS0A 3RIFF 2I32A 5I6NA 4FQ1L 3D1MC 1IC4L 4UM8A 1BVNT 2P8LB 4JO1H 2C7UB 4NBXB 2AI0H 3N91A 2W1NA 1SN0A 5DMKA 5DYFA 3S5YA 4JAMA 4Y4FB 1ET7A 2OK0H 3GSNH 1A4AA 2DQGL 5MI0C 3LPPA 4KKLD 3U4EA 1NFKA 1L9SA 1CQYA 2VKWA 1FBIH 4JFZH 1NMAL 3NJMA 4P5TD 5GZOC 2WLNA 5CLZA 3U9UB 1IAOA 3KEDA 4OKDA 2YC1B 2ZCLH 3B6SB 4ATTA 4GI9A 1LEGA 2WXFA 4QRPD 5PAZA 1IBHA 1CMOA 3OKKB 3EHBC 3IF1A 1I1AB 2BW4A 3BH4A 3C6LC 3N1GC 4XN5A 5F96H 5KBMA 4EI5D 4KVCH 4L4TE 4ZW8A 1TO5A 1OPOA 3VXMB 5L8KB 3LXBA 2MNUA 3VXSD 5HBBA 4K3HA 4WV1B 4X6CF 3NESA 4NZ8A 4UQ9A 4W6XB 3ETBF 4Z6AT 2XJKA 5JPMB 3QIWC 4Y2DB 1LMIA 5KAQG 4JQXA 4KGJA 3B6SA 3IPFA 2O6FA 4FFVC 4YHZL 1QHPA 2YAOA 1IAOB 2KT6A 2IADB 1GW0A 3D85B 5C0CB 4Y7OC 1FFPA 4OIBA 3QA3A 3FFCA 3MV7A 1KNOB 2VDPH 4MAUL 4Y4FA 3VU1A 5IHZA 2NSMA 2N59A 4HZAA 2P8LA 3BT0A 2AXJA 4J8QA 4F37K 1CYGA 1WG3A 1JXDA 2DYPD 1UOWA 1PLBA 9PCYA 5CKAA 4JPSA 4PGBA 1IJNA 1KTBA 2UWEE 3A5VA 3ARDB 1C5CH 3Q48A 2OL3A 4G3YL 5FO9B 3ATDA 2FZ3A 2GUOA 3D2UD 2WQRA 1XGRB 4HV8A 5DQ9B 4LGPB 4DEPB 1X7QB 4MAYD 5C9JB 1YECH 4G8EA 1SLVA 3VFOB 4KK5C 5IESH 3ECUA 4OJFH 2E9JA 2PWFA 4WEEA 5BV7H 4FYRA 2IALA 1EUUA 4IEFA 4YHNA 3JT2A 1EJ8A 4HIHB 3DSNA 2JCCE 3O4LB 3TVMD 4AYID 4PJHA 2DM3A 2VISA 2XPZA 3ESPA 2G2RA 3IDMB 5CHNB 3D9AL 1HK6A 1S9VA 4HJ0D 2IOMA 4YSDA 4ZO7A 4NO5B 1IT9H 4QTHA 3GIVA 1JNLL 1QQDB 1HKLH 3TEYA 3AU1A 1TVDA 4X5XB 1XGTA 4HT1L 4PLKC 2WXLA 3BPCB 4XTRC 2J6EH 2N0MA 3A47A 3O3BB 4Z7NE 5IB3B 3BW9A 5BVJA 3C8DA 4EJ1C 3RB7A 3VD2A 4YDJA 4QKTA 3ESMA 4WKZA 2AVFA 4GKNA 4YZFE 1FNLA 1FNSH 4F33B 4B9GA 5IZ7A 4J8RA 2KERA 4LPWA 1CICB 3F6LA 1SXZA 1XTMA 1PKOA 1TR7A 4MMXB 1S9KC 2DQIH 3K8LA 4LCYB 1M4KA 4I0PA 1YC8A 4NNXB 3TIDB 1KCSH 1KIRA 5HI4D 4UMSA 1CXHA 2DPKA 3ARBD 4R8WH 2XBDA 3O8XC 3KPSE 4RZCA 5AVXB 5HTSA 2BY1A 1JZ3A 2JKWA 1I9RL 5JPNC 3HLKA 3NG5A 3LN5B 4FS0A 1F11A 1ZHKB 4U2YA 1HESA 2W94A 3RWDB 2AJVH 1KCBA 1UWYA 3T6ZA 4PJAE 2OMXB 1GHFH 4HW6A 2WWMD 1IE4A 4F93B 1P6FA 1E4WH 2WINA 2BCKA 4DAGL 3K3QA 4GMSL 2QLVB 1JPSL 1VGEH 3FOMA 3DIDA 4RIRB 4KPHH 4JUTA 4Y7MA 3V0WL 3OXRA 4YLQT 4EQ2A 4RIRA 4P06A 3EF7A 3FQ4A 4XO5A 3Q5OA 4ZMTA 1NKGA 2F6AA 2ZUXA 4QHNB 1JXKA 3PP4H 1DJIA 1U95B 3I84A 5LGHL 3AGVA 4W4OA 3SY0B 3ECWA 1F11B 1ZHKA 3MLSH 4FG4A 3KG5A 1L6ZA 1XIWA 5D9SA 3GEWB 5DQDL 5F6IC 4BJLA 4NZRH 5T5FH 3UPRA 2JIXB 4LVHB 4XMPH 4HWEL 3VH8A 3DC0A 4JHBA 3NJFA 1OT1A 1T66D 2V2XB 3VD7A 5FLVA 2FWOB 4M6AA 5IREA 5E4OA 3C5SA 3TIDA 3V10A 1KXVA 2CJUH 4Q0XL 5B3JF 5AZ2L 2XY1A 4GS7B 3EH2A 3BPLC 4FZEH 4KH2A 4MMXA 1J11A 1IGMH 3UYPA 5I1EH 2BCMA 2JKLA 5FYKL 4J8RB 2PYFA 4G72B 1NCCH 5E4AA 4XP5H 1Q0YH 4YEEA 3TCXA 2A2QT 4YDJB 1F56A 1EPFA 3BPCA 3ZUCA 2BSDA 1QQDA 1ES0B 1I53A 4JJOA 4NO5A 4QTHB 5JQIB 3TF4A 3DGDA 4NCC1 1K5NB 1QRNB 4F5CA 2G2RB 5CHNA 5KOMC 3GJFA 1C1EH 2DN7A 4N8VA 4IS6A 3EJSA 4JKWA 3DSNB 4ZNEA 2FLRT 2BOBA 4HH8A 1XBRA 2XTJE 4BA8A 2HFGL 5HGHB 2OTPA 2DJMA 3NZHH 3MO1A 4Z7IA 1KFAL 3WNNA 1M56B 2VR3A 1FZJB 4Z1PA 1EX0A 2GSIA 1FZOB 2JLLA 2VJ8A 1T1YA 1X7QA 3Q13A 4XPBL 3WXWH 1JZ6A 4A1RA 4HV8B 4HGWA 4C4BA 3VX0A 4FYSA 3WMQA 2R4RH 4JLRA 2WCSA 2OL3B 1XT5A 2XZZA 1DQKA 1Q4NX 3DX4A 1V3KA 4NXSA 4J23A 1XL4A 5JORB 2HTLD 4OF7A 3VSUA 3S7GA 2EDXA 1PZCA 2R23A 4PGBB 4QRRE 3ULVH 5L8LB 2DLEA 3CZUB 1PNCA 4OCRL 4PSPA 4RGOL 1U36A 1J10A 3DMMD 3JTSA 4OY9A 4IBWA 3MUUA 4U3CA 3VJ6B 3IEAA 4HXAH 3P1VA 4DP4X 4KKQA 1IM9D 3GTVA 3PNWA 2V5RA 2I07A 1DUZB 1YPZA 3MNVB 3B3IA 2XWBB 3HJ0A 1NGZA 1M05A 5BUGA 3RX7A 1A02N 2K7QA 4GRWE 1NLDH 5F7EL 2CJSA 2ZKHH 4DOHB 1MCNA 5TFSH 3D05A 3EADA 1YNTA 4QY8B 4XVUD 5DU7A 4GAYA 3G08B 1UXLA 3S35H 1UD6A 1TCRA 3A4FA 2PCFA 3NJLA 1L0QA 4G7SB 2CMRH 1U3HD 3CHOA 1BEYL 3DOHA 3IFPB 1GGYA 4JKPH 1UFUA 1KEGL 4URKA 2XNAA 1P4IL 2AKRA 5CIPA 4CKVX 1KB9J 3P40A 4Y1TA 4EDWL 4ZMWA 4NCDA 1LEGB 3KPRE 2BIIA 4DKDC 2R69A 4YDNA 2CNZA 3MJ6A 3U9UA 4NZUH 2PWDA 3QUYD 2CO6B 5HVHC 2I26N 2RQEA 1KF9B 4F8QA 3S8FB 1FORH 3BDXA 4OZGE 2CZNA 2CK2A 2J1KA 3I6KB 3BUQA 3LKPA 2X9ZA 5DMKB 5T3XE 2BVOB 4H25B 4YJZL 1MCLA 1VLXA 3UIYA 1ZA6A 2HJKB 3OZ9H 1M7DA 3CGTA 1CFVL 2NOYA 4WI0B 1P2CB 2PP9A 4L3EB 5DUMH 4FG2A 3CDYA 5JIQA 3OR6B 3COOA 1HHGB 1MIML 4E41D 5HYIA 1YNLL 1WPCA 3LPGA 3RWJB 4LEEA 4M6OH 5EO9A 2W65A 4KKAC 3TBWB 4XNBA 3SGKA 2AEQH 4ZO9A 1OAUL 3NJGA 4G7VL 4YHOH 4IKJA 3DX7A 5LG1A 1WAAE 1E5YA 1JGLH 2EIBA 3CFCL 1JL8A 1MDTA 3KWVA 4GSRA 1UXMA 3SDXB 1R0AL 4GXVH 4G9FA 2H9GA 3HS9A 1UCTA 3IDXL 1SPDA 3KYOA 4Y4HC 1NANH 1RH8A 3BAIA 3KLKA 3SGJC 1JPFB 2EEAA 4TUKL 4UDTA 2DI9A 3H6JA 3FAWA 3BVNA 5L88L 4JHUA 4QHMA 1EQWA 4K7PH 3QCUL 3AUWB 3C09C 5AVYB 4YO0B 4AG4L 4PI0A 3CVHL 4WUKH 4YBLC 4R7VA 4MXQD 5HDQH 4Z5RA 2PMZA 3NH7L 1BZQK 2DWEB 3WXVH 4RMUA 1T2JA 1Q9LA 3NIDF 3PL6A 3VW3L 4AMKH 3VI4E 2ZXGA 1KBBA 3MRBA 3WS3B 1GGBH 5E8DL 1NC2B 1Q9WA 5EEYA 2H6PA 4HMDA 4BFJA 3HLAA 5EF3A 1A47A 2DQHL 5TE7L 4F8TA 1MXGA 4G8GE 3PABA 3DO7A 4MBRA 4OFDA 3HG0A 1G1YA 1QPXA 3G5ZA 1S5HB 3W0WD 2JIXD 3MLXL 3LDBB 3WTSA 5IT2H 2Q6WB 3P4NB 4ODUA 4YHPB 2J55A 1YPZE 4CAGA 3S8GB 5FFLA 2WVVA 4DVBB 4RISL 1XQ4A 2HFEA 3PWPA 2XZAL 4AQAA 4YDLC 4U1SA 1CE1L 2AJZB 4ANVA 1DLHA 4GP8B 1HVXA 3VFGH 5L8JB 1IAIH 2EC8A 1MPAL 2J6WA 4JDZB 3REVB 3B9KD 5CJXC 3LSOA 4UZSA 4NB7A 3KCPB 4BZ1L 5A6IA 2OJ1A 2E86A 3RU8L 3LIUA 3V0HA 1F2XK 3BVDB 1DBAL 5KTEL 4WFGD 1TVHB 3WHXB 1D6EB 1OWRM 1CGYA 4LF3B 3CFNA 3GTNA 3PDGA 5EOCH 1EJOL 4P3DA 2DIJA 2EE0A 2EDJA 2XG4A 1FLTX 2ZOUA 2VDKH 4XN2A 4OV5A 4ZMXA 2WZ6A 3ZT7A 3RVXC 2JF1A 1E6OL 4R90H 1MQ8A 4Y2NA 2GK0A 2OI9C 1FGNL 5DHXB 3VQ2C 3PHQA 1KWGA 3KLHC 2DQIL 3OHXB 1RJYB 2J56A 3ZZLA 3ECBA 2OXHA 3FSAA 4N2MA 1II4E 1H3PL 1XCXA 5ESVA 2WWOA 4PHZA 2IAMA 2C3VB 3GLEA 1ZHLA 5FFGA 3WFZA 2VR9A 4GI8A 1SDDA 1PAMA 2D4DA 1T04B 3BLPX 3N3EA 4MX7A 4X4MA 1FN4B 5H2BB 3IJYA 4P2RA 1DQQA 4R7DB 3KLLA 5GRUL 2E27H 1GHFL 4WFHE 5T1MA 3WJJC 3BHBB 1T6WA 1F42A 1UA6H 4FKHA 1JV5A 4DCQB 3L95A 1TFHA 3GKWH 3A24A 1GJUA 1QLRA 5E00A 1JXFA 3QUZC 1LWRA 1BZ9B 4TLTA 4AY0A 2A6IB 2RD0A 4S1DC 2C9RA 1KEML 3MFGB 1WAAA 4PGCA 5IJKC 1IGCL 1UM5L 4L5FL 5A16B 1W91A 4C4KO 3CX2A 4IBUA 3QBTB 4N24A 4O4YL 3FMGH 2BVUA 4TNVF 4HEME 1AIFA 5DYOB 1OSZA 1XEUA 3K71A 5EEUA 3FS9A 5F0JB 5FYJL 1L9TA 4E41A 2ZJSL 1NDGA 1U8KA 2PABA 4A7TA 1OL0A 1EEYA 2YMXL 1RIVL 3RURA 5C0BA 3S2AA 4KKLC 2P4AB 5TDPA 5DSCB 1QI4A 5FW7A 1TZIB 3IDNA 4HS6B 3NSJA 2RIKA 1N64L 4K5OA 1BVLB 1EFXD 1G7PB 4FZEL 4GW5B 4NNPL 4PRBB 5C0EA 2EACA 2P8PB 3L6FA 5C09E 5DJ8B 1KZQA 4JN2B 4UTAH 1A21A 1UXSB 3EOBB 5LAXB 3U0TA 3RBSA 2COQA 4JKKA 4PEEA 5B3JE 5MEND 1EH9A 4GXFA 3EO0B 3LV3B 1WFMA 3GNMH 5GGQL 1EXUB 3OWRA 2FLBT 4N2CA 3CH1A 1WZAA 1N6VA 2CPCA 3DTXB 4KRPB 3WELA 4Z23A 2VSDA 2X2UA 3ARGC 2Q0ZX 1U8HB 5F9WC 1F02I 4ZT1A 4OIAA 1HSBB 2YO3A 1IC4H 2GB2A 2HLAA 2DYSB 4YR6B 5D1XB 5DUPL 5IVXF 3VMNA 43CAB 4B5EA 5DD0H 1NZRA 2BH0A 3NZHL 4ADJA 4U6YB 1I3GH 5IJVB 4I87A 2BZCA 4OZ4A 4P5RA 2YQBA 3BSHA 1IBBA 2ROYA 3B56A 5DEZA 2RQ8A 1NCTA 1FBIL 2BRQA 2G3MA 1A7BA 2EYTB 4EN3D 4YXKH 5TDOA 4DW2L 1P1ZB 4J5VA 4HF5L 1T20A 4PJ7F 1N7MH 1AS6A 3EO1A 3B83A 4LDEB 3I85A 3K72A 1M1SA 4MD0B 4N0CC 4TVPD 4LLQA 1SYVB 4QRUB 4JM0A 1WZKA 2P5WE 1EXHA 4RX4A 1RI8A 1X9RA 4QHUB 5B22A 1F58H 2BNUB 3FQTA 4PRDA 1MHPL 2TAAA 5E6UB 7CGTA 2I5YL 4RMBA 1NSNH 2HUHA 4TULH 4MD5A 4K8RD 1CIDA 2CPUA 1B0GB 2CBPA 3MRFA 2C5DC 5HVHB 3BYYA 1U8OA 1E50A 2CK0L 2Q86B 4G8GD 5EPMB 3HI6H 3C5JB 3KPNB 4UOW1 4L3CA 4X0NA 4JJ5A 1N3NB 1SHMA 3QO1A 1OARH 1ZTXL 4LNVA 4P8QA 2IH1B 1SXBA 2DWSA 3FB7B 3PJSA 4N0UB 4AL8C 2QVTA 4WWKC 3OX8B 3QQ4B 5F70A 2NNFA 4U1GC 3FF7A 2VDPL 1D5XA 4X4ME 1RFDH 3M1BA 1G6RB 2J4WL 2AK4D 1BOGA 5GISL 5MEPB 4RMVA 2JELH 4DESA 3HZMB 5I15L 3DX3A 3FCGA 3OKOA 3QJOA 3AADB 1XF3B 1W9XA 2ZPKL 3K6FA 1CGSL 1I8MA 1WHOA 5JR1H 3DROA 4UTBL 5GSVB 2VQ4A 3LRGA 4G3YH 4PJAF 3SKUD 3EJYD 4WO4B 1V7NL 3RKDD 1PZUB 2NW3B 3VXUB 5A7BA 3LX9A 1J87A 1BQRA 1S3KH 3GRBA 5AD0B 1RQ5A 3P77B 4X6CB 3V55A 5MERB 3GGWA 3GHEL 2NY5L 4KQ3H 3P9LB 4MZIA 2NY0B 2AQPA 1QNZH 2HWZH 1F0LA 1P84J 2GIXA 5J11B 2BSEA 1PTZA 1NIAA 4HZLA 4Q58C 1W8OA 4BSWA 4R0LB 1Q9KA 3GMOA 4JRWA 4AKQA 4HT1H 1NAMH 2DQMA 3ES6B 2AEIT 1M71A 3FHEA 3MLYH 5HJ3A 3V6OC 4GKZB 4JRXB 1A7RL 1OE3A 5I6XC 4UIKL 1RMFH 3RIAK 2V4LA 3MCKA 1PG7H 4FQIH 4OI8A 5C71A 1OOAA 2VH5H 2OJZH 5BNXD 1QOKA 3T0DA 3CZEA 2P45B 1E5UI 1MCRA 3CD4A 5A2IH 4X5PA 5GRWA 1RU9H 1J8SA 1L7TH 1WA2X 4NI6A 2WTPA 2KDYA 1WAAF 5DD5L 4YDVB 3X12A 5HYJE 1B0IA 1ZEAL 3LZPA 1I9EA 2X4OB 2OS7A 1TZGH 4H1LA 4PI2A 3JV4B 1Z66A 5DTFA 3QI9A 1X3DA 5HDQL 1MLCB 1P5UC 3NZUA 5CEZD 1NCAL 2D2OA 3KYKL 4HHAB 3CG8A 4L4VA 4HUUA 2WQSA 3FO1B 1JPGB 3KPSA 2IANA 1ITCA 5FYKD 1ACZA 3HNTH 4B53A 5ECJE 4ZUUB 4YDKH 3JWOC 3C6SB 2FO1A 5E24E 1FFTB 3EUUA 3EH4B 5LO7A 3VFUB 3MRDA 5EOTA 1LO5B 1U8IA 2CHXA 1WSST 4H26B 4XBPB 5HGDB 4NQDB 2Q7NA 3IJ7A 4HX1B 2WLIA 1UKSA 1AGCB 3OHXC 3U36B 1I7UB 3ARFB 4AGPA 1E6JH 4NQED 3CWGA 1PF3A 3B9VA 1SBSL 4HFUL 4J3XA 2GQHA 5CBEA 3DV4B 3CN4A 2Y3AA 5IW1A 5GS0H 4BUQA 1IMHC 1A4BA 3UROR 2CJUL 4Q0XH 3DJTA 2NUTB 4NC1C 4TVSa 5D7LB 3ZE0E 4BE5A 1NMCB 3GHBH 1OE2A 5DR5L 3C08L 5EZJA 4FTVB 5JW4M 1BIIB 2GG1A 4X6DE 4AW4A 3BPNC 2EAEA 1HZHH 2EDQA 3IS1X 1BM3L 1D6VL 4XE0A 4XX5A 2CH8A 4HX1A 5JHDE 2CKNA 2OMTA 2OTWB 4WTZA 4XX1E 3LRSB 4UCFA 1LO5A 3H9ZA 4XBPA 5HGDA 3MRDB 1MCQA 4CADA 5IKCA 1HYSD 4Q2ZA 2Z1PA 5KVDH 4N0UE 2BXYA 3C6SA 3MZTA 3B2XA 4D8PB 4ZUUA 2V2TA 1S7SA 3CC5A 3TBCA 1TT6A 2F2HA 5C09D 2WXHA 3QSKB 4NC1E 3B2DC 1KY6A 4ZFGH 3ARXA 2PW2B 2CCLA 3BKCH 4DEUA 1Y18B 1VERA 1M1XB 5KSVB 2G3ZA 2OFQA 3FJTA 3JV4A 2VN3A 5T5NF 1NIBA 3FFCD 1ZVHA 3MV7D 4H1LB 4QRTA 3F83A 5GS1C 4DGWC 4KHTL 1LO2H 2WKOF 2R4RL 4AQ8C 2QBWA 4S1SL 4XP9H 3BC9A 1UB6A 4FI8A 3VGFA 3FRUA 2ZONA 3FHQA 4NKMB 2GJ6D 1NIFA 4EI5B 2NXYC 3BI9X 1E3ZA 2HCZX 3CFBB 2YWZA 1GKEA 1Z9LA 4JM4L 2GAZA 3QUYC 5A40E 5PCYA 5EBGA 2VL5A 1ROCA 1AFVL 2BDNL 3D39D 4GKZA 1XB3A 2WIMA 2VXQH 2YMTA 3CX5K 3WGUB 5FO8B 3BRDA 2HXAA 4QRAA 3ESVF 1JIBA 3LQAL 4R2GB 5E6IC 2WJ5A 1DFBH 4P5TA 1HCYA 4HZLB 3D3VE 5E0FA 1GL4B 3F7PC 3S0PA 5AW0B 1CXKA 3UJIH 4N5ED 2AQTA 5C0RL 2YMXH 3P9LA 4Q6IC 2VLRD 5K59F 3DXAB 3F5WB 1FVCA 3QFJD 4IRJA 4ONFH 4X6CA 1M42A 1KN4L 4OCWH 2OV0A 3KH3A 5D2LF 1N64H 1AXTL 1XGQB 1KC5H 4BSJA 3QXAB 4M1DH 2NW3A 3ARRA 2UZYB 4FYTA 4FQJL 4ELMB 2AFNA 2AP2A 3TFKC 1AS7A 2V17L 4TUUA 1JRHH 2EXWD 1GMIA 3L9EA 4EIZC 1EBPA 5JPMC 1TYJA 2Z7WA 1AQKH 1UJ3B 1MJUL 4LBEA 4HOZA 4JFDB 1WAEA 4MAYB 1U8JA 3MROB 3O0LA 4Y2LA 2B1AL 2WYZA 3VFRB 1E2VA 3HZMA 3C8KA 1PZSA 1BOGB 1HL5A 3MKKA 3SPGA 1PZ3A 2YAFA 5F9JB 2NCEA 2IDFA 1N4XH 4OGYL 4DIXA 4XBEH 1EJFA 5HVFB 3QQ4A 4OLYL 4X5LA 3JWDL 4FQXC 1KDIA 2IBZX 4RGNE 1JI2A 4DTGL 2BM3A 2XICA 4PTTA 2ITDA 5HVGB 3QDGE 3WI9A 2IH1A 4HC1A 3CSTA 5JA8B 5F9WB 4BH7B 4YXKL 3W3BA 2LV4A 1N3NA 4QHPA 3LPOA 2YOAA 3PFQA 3ZGIA 4KXCA 3GSUA 1L3WA 4GO6B 1U8OB 3KPPB 4ZPVA 3D85D 5I1JL 5JHDA 3AGWA 3MRFB 2QQKH 2QSCH 5I1GL 4GXVL 4ABWA 5GJTL 2I5YH 4PRDB 4JREB 1XF4A 3DUSA 1LL1A 3EH3B 2EDOA 3KHQA 3NCBB 4K71C 3QK0A 4ZSOB 5DMGD 5LDUA 4MD0A 4ZNCD 2WV3A 1EZVX 1K4DB 4LCCA 1G7IA 2IAMC 1T20B 2VM3A 4NM4L 5IEHB 1F86A 4L8CB 4N3TA 3VXQB 1H5BC 3H9SB 4U05A 3DWTA 1P7KB 1XEDA 1MAJA 5IJDC 2R9HD 1DVFA 2YEVB 1SFHA 4EI6A 1X5MA 3IETA 1Y6KR 1X6NA 4JPVL 1F1AA 4JVPA 3UZVA 4F24A 3Q0HA 4EVNB 1WWBX 1QO3B 4XI5D 3EKCA 1Q1JL 5D1XA 1T1ZB 5IVNA 2Z1KA 3FK3A 4LT7A 2X87A 1PX8A 1HNGA 1C5BH 2CGYA 2H7WA 2NYKA 1MJ7L 3QP3A 1EEUA 2OAAA 4IBVA 3IJ8A 1CLCA 1ZLVK 1BVOA 1RJZA 5F88A 3S3CB 4AV0A 3G9VA 2AQSA 4R3SB 3VFNB 2FATL 1CUOA 1RULL 3TYFB 2Q8BH 3EO0A 3U83A 4CN4A 5CJXA 1UKQA 3MLXH 2ZKMX 3QS2A 5AOZA 3FU8A 2LLGA 4ZFZA 3U0TB 5GGRB 3U82B 5I8KL 3S36H 1NGXB 2VE6A 5AOKA 1DQDL 1R3IL 4Y4HB 3IGUA 1FA4A 2EUVA 2Y06L 5FYKE 3ROOA 3NSCA 1I8IA 1TZIA 4HS6A 1A3ZA 3VH8G 3ZJAA 2WQWA 4NJAH 3TNNB 1ET8A 1GJWA 4XVJL 1C12A 2BNRD 3BFWA 4JS7A 5ACLA 4P3CL 3QHZL 5CD5C 4V33A 5AYUL 3HMXH 3FCTB 1EHNA 1OSZB 4P2YA 3LIZL 3UC0L 1YN7B 3KPOA 3K7UA 3K71B 4J28A 5IBLC 3MJ9A 2Z8RA 1AIFB 2J6EL 3O4OB 4AGOA 1G4RA 1NAML 5CP3A 1UKTA 2Y2TA 1FRGH 3OKNA 2VDKL 5I16A 3PV7A 3I50L 2W92A 3P0YL 1P7QB 3KBPA 2R29A 2G3XA 3CTTA 5E00B 3NIDE 3WV0A 4HVBA 1TZAA 5FUCC 3SQRA 1PD1A 3VDCA 2PYED 5F1IA 4WHCA 3BHBA 3V9FA 4LCUA 1HL4A 3U46A 3LH2H 1NA8A 3ELAT 4TTGA 5DJAA 1F4XL 2NLJA 4HDIA 5A2CA 1H3PH 4L3EE 3QJXA 15C8L 3AT9A 5CJBA 5DD5H 4M5YH 4BK5C 1KYDA 1E5AA 2W9LA 1T04A 5EA0L 2VZVA 1SDDB 1JZ2A 3D2UB 2FX9H 3GM8A 5FKAB 5A2JH 4TQEH 5ESVB 3R06A 1BPLB 2FNWA 1JN6B 4B5ZA 4MNHA 4DSYA 1ID2A 2Y1AA 4DAGH 4PV1C 5C8JB 1NAKH 1MFEH 2VDOH 3KR3L 3OHXA 4Y19E 2LHAA 3ZTJH 1IJ9A 1D9KB 2WTRB 3BE1L 2VABA 4NKIH 4KNQA 1AAJA 1XR9A 1NCIA 3HAEB 3GLAA 1AD9B 4NQTA 1Y0LA 3SDCD 4YPGA 4DO4A 3UTSB 5F7MC 2BFVH 4IIQB 4WWNA 3D4CA 4GAGH 2IPKA 1KENH 3W81A 3BVTA 1UWGH 3WIAA 4KO6A 3C60C 5BV7C 4LSSH 1JP5A 3TBSA 1A6VL 5SX5K 4ZTEA 3KCPA 5JO5B 1RD6A 5AVTB 3HN5A 5D7HA 3QHFH 3MNMA 4AI7A 4AGNA 5DJ6A 2AJZA 2Q2LA 2VJXA 3QDMD 4HU8A 5KSBE 3ZKXC 4BH8B 3MOAL 3NFSH 3HNVH 2MRYA 1VESA 2WWMC 4XN4A 3S48A 5D6DA 4XP5L 2HUEA 1JF5A 4DVBA 2WNWA 3REWA 4E9VA 1NKRA 4E41E 4JPQA 5CZVL 4ILDA 4DVRH 2B15A 1FGVH 2LE9A 2H4EA 2G75A 2DM2A 3UMNA 1GGCH 3AMLA 2JB6B 4JFPA 3O0RH 5TQ2L 2EXYC 3UCQA 2F7RA 5ICUA 1AQMA 1LEKA 3BAWA 2A9BA 4PJXF 4AX3A 4Z7UB 4GRWB 1A1NB 4K55A 3HLAB 1BECA 3L7EB 4IYKA 4XNMB 5JIIA 2Z7UA 4RAVB 1NC2A 4FLSA 3IYLW 4XRCA 3ZYOA 3WTTA 5DCCA 4HZ1A 3GMNA 2H3NB 5I74C 3PL6B 1Q9LB 1IKNA 2F54A 3O2DH 4IRZA 1PAZA 1U8MA 5FV1L 5E99L 2PYEE 1QZ1A 1HL8A 1PSKH 2BJMH 5AB0A 2MQCA 1DHKA 3WXWL 5DC0A 1RKRA 2B1OA 2VDRH 1NMAH 4XT1C 2FSEA 3MRRA 1M7IA 2AQNA 3KYAA 4ZS7H 3RHWK 4HLEA 4NN7B 3NSYA 1L4IA 5E8PA 5T3ZL 4MB5A 2IBZY 2NPLX 4M43H 1CTNA 3OB0K 1QRND 5KVFH 5AENA 2ORBL 4J6RL 3MR9A 1X5KA 5AOJA 5INCB 1UOKA 2VO8A 3ARBA 2UVEA 4X42A 3HE7A 1JPFA 1AG6A 3ETSA 2VR8A 2PCPA 4KVCL 2YR3A 5CILL 2H9GB 1A3RL 3HG4A 4G9FB 1QACA 4NQSB 4AYBA 5JIMA 4FNTA 2VB5A 4K94L 2MPVA 3WFHB 2CK0H 4BCZA 3TV8A 1BV8A 1G7JA 3G7TA 1KGCE 1CFSB 5B8CC 2VOTA 5BQ7B 4DNLA 1KBWA 4XN9A 4MA1C 4TL4A 3UZEA 1ZSDB 2B5IC 4R5VA 1HHGA 4GO9A 4LGRB 5LKNA 4LU5H 4PMEA 4A68A 4L3EA 1M2VA 1P2CA 1XR8B 3GBDA 4L2LA 4PRHD 2K4WA 1CBJA 4ONHA 5AQ0A 5B7MA 4WWKA 2XFGB 3RJOA 4LVEA 4HJJL 4FADA 3GRGA 2PXYA 1YPZF 3V6FA 1MZZA 4OCWL 2V9UA 4YS4A 3LKPB 3I6KA 3V52H 3X1NA 2X9XA 4N0FA 1TQUA 4FLRA 5ISZD 4WI6A 2NZ9D 2F15A 5HHOA 5IR1B 2CO6A 4AE1A 5LNGA 2X4QB 1RXLA 4G7RB 4KDTC 7FABH 4NSKA 3MJ7A 5D2LE 1IQWL 4FG6D 2QADB 3PU7A 1FORL 2YN3A 1TIUA 6CGTA 4EXPX 1WTGT 1FC1A 2AKRB 2DF3A 3G5VA 2XNAB 4HHWA 2EABA 3V4LA 3NFPA 2OCCB 3IFPA 3T6QC 1UD2A 3WNPA 2XOTA 4RGNB 4PJAA 4V1DB 1PJWA 2ARJQ 2ZZUT 4AGMA 3BRGC 4XMUA 2X70B 3G08A 1A9EB 1GMEA 2QVIA 4L3ED 4GAYB 4Z7OF 4LRIC 4OGYH 2J1ZA 3U7WH 4AWJC 3D0AA 1X7SA 1T80A 1UGNA 2HRGA 3ZMEA 1JNLH 2HG0A 2I27N 2IIJA 2XFXA 4HIXL 4I18A 2IG2L 2EKJA 2EC9U 1J48A 2AXGB 1NGZB 4FD0A 1UWXH 2F8OA 4J3OD 4JUSA 1K85A 1CVSC 4BQCA 2UYLA 3TX4A 4B9PA 3PNWB 1KTDB 1UYWL 4UIKH 2O26U 2O5ZL 5ABZA 2Z8WC 4W9EC 1WUZA 1M57B 3JTSB 2QSCL 1KTLB 3MRJB 5HI3C 4OSUL 1CLZH 1FL6B 1NAMA 4FAAB 2GSGA 1VFAB 1HE7A 5A2BA 1CR9H 2F53D 4HWBA 3VI4A 5DJ0A 3HZYA 3NUKA 4U3SB 5JORA 2X4NA 4OQTL 4RSVA 1FL3A 5EC2B 3MTRA 2A6DA 2G0LA 1OM3H 3O2DA 1ED3A 1MWOA 1ZV9A 2AJVL 1T1YB 2CUAA 4I0PC 4WFHD 2GSIB 3QNYA 3WXVL 2LVEA 4M4PA 3SE6A 1OAXH 1RZ8A 5F7YC 3MQIA 2BOBB 4XMTA 3G6DH 4JQIA 4X6BB 4QHLB 2MCAA 5KYXA 4I18C 1MCKA 4TS6A 4MJ5A 3U25A 3KLSA 3A0OA 1B88A 2WUBH 4D9QD 4ZNEE 1N59B 3BFQG 1ES0A 4KBPA 3TO4D 3QQDB 3D50A 5G4OA 5D1ZI 3HC4L 4LPTA 4BDVB 4XMPL 2Y0SA 3HOGA 1U91B 4KTDH 1IBGL 2ZSWB 3PWLA 1UA7A 3O2VH 2CXGA 4IBTA 1A7NL 4HUNB 2RCSH 3QB7C 1TJGL 1T2XA 4QTFA 4GRLD 4DPBX 2UUDK 3C5SB 2FWOA 3GHBL 1MREL 1Z3GH 4F7PA 2AHIA 2VW6A 1WS8A 1QPKA 5KTEH 3RFZC 4N0YL 3GSOA 3QIBD 4YIQA 3ZUNC 2XBTA 3MRHB 1XIWB 4EKJA 1P7QD 4Z8FH 1WYJA 2UVFA 3RPIB 4PVNA 35C8L 5KVDL 3EYQD 2G3NA 3P9WB 4DFIA 1I1CA 2AQRA 4HJ0C 3EJUA 1L9MA 1Y6MR 2YPKA 2H47C 1QATA 2J6EA 3OXRB 3QJTB 4RQQB 1DJGA 2FQGA 1TDQA 2N1KA 3QH3B 5LN4A 1HQ4B 5D1XD 4A7GA 1T83C 4R96B 2F61A 2XU9A 1I4FB 2WIIB 1CI3M 2ZKXA 4JFFA 4V1DE 5B8CA 3FFCE 3MV7E 4JQXC 2V8LA 2F0CA 3ECVA 5D7SH 3BFOA 1BMZA 4L4TB 4LHJB 5AAMA 2X4UA 4FULA 1PLCA 5KYUB 3X14A 2CLZA 3HHSB 4YHMH 3EBGA 3X2QB 5DK2B 3LEYL 1Q0EA 3P0VH 2F19L 4KX8A 5D2NC 1U2YA 5AB2A 4FCAA 4GT0A 4PJIB 1SYSA 1CTMA 1KIRB 4QGTA 4POZC 2BLFA 2EDBA 2VZSA 1HL9A 2XYBA 1OP3K 1QD0A 2ICEB 5G5DA 1NPNA 4AE0A 4LQ1A 5IEKA 3CFQA 5GS2D 3RL1A 4O4YH 2BFVL 3BW9B 4K15A 5BVJB 2A83A 3N0AA 2C9QA 1KENL 2XWTA 4ODTH 2DWXA 5L4IA 1XV8A 3VXRB 3Q5TA 3AREC 2CR3A 1CD9B 3BXNA 2GT9A 4KAQL 2ZJSH 8FABA 1UZ6E 1REIA 3RLSA 3S35L 3TBTB 2ITFA 5ENWB 1YYLH 3N40F 2HH0L 5C0RH 4GG8B 1LEIB 2FL5A 4OKVB 2EYRA 1DL7L 4JKPL 3IJHB 2EP6A 2J88L 3WIHL 4H88L 3ZSSA 4I5BA 1XSJA 4G8EB 3FO9A 3DO3A 5C9JA 4FQJH 5DQ9A 2E7LA 2FJGB 2P52A 1JNHB 4KKZA 2BSED 3ULAB 2GUOB 4D3CL 3ULUL 5EZLA 1E42A 2W91A 2A38A 3ZTCC 3EOTL 4GO8A 3WENA 2CGRH 1DJXA 4FNRA 2HG5B 1P6WA 5EUOB 3V6ZA 3A67L 3ULVE 4G42B 3FPXA 4DF9A 1INDL 2BP5M 4EEEA 4MD4A 1DR9A 4Z7VE 1EAOA 1NM4A 5FWQA 1UEYA 2VDOB 5LG6A 4KV5F 1RZGB 3OLGA 3QW9A 2Y07H 1CFVH 4PJ7B 5IHZB 2J1WA 3CFMA 1CD0A 5D8JL 4ATWA 2H32B 4XBEL 1BQHG 1T7YA 2G60H 4XO8A 1DJHA 4YDMA 2X41A 3KWTA 4XXWC 5C0CA 1UCBL 5DC4B 1CF1A 2VLKB 3L1OL 3W1ZA 1GZQA 4UNUA 1WA0X 4LE8A 3S34L 2AEQL 1IVLA 3MJ8A 4G7VH 4M43L 1BQSA 4NKDA 4YHOL 3UTOA 4ZAKC 4P9ML 4WV1A 1QLEB 4QTIH 1DANT 3L3DB 5ALBL 3U0WH 3CMOH 2N7AA 5CWSB 1WBXA 2PP7A 4TULL 1ODUA 1SVZA 3VXMA 3P73B 3BT2H 1I1AA 4C57C 1XGZA 1RUKH 3FH7A 5K9QG 2B1HL 3UL4A 2F7OA 1DCEA 1KCWA 3NCYP 3L16A 5L4MA 1T21B 2O6PA 4P23A 2XIDA 2DICA 1TPXB 4JFFE 1GSMA 5HYEA 3C75A 3U4EB 3VD9A 1DUYB 3L3KB 4C47A 1YMHA 2NY2C 2LQRA 3IJSA 5AB1A 3VW3H 4UV4L 3GXTA 4WU5B 3O9WC 5IB4B 1U2CA 4UM8B 2FEDC 1K5WA 1G7MA 3B7TA 1AHWA 3HS0B 3VXUD 1NGPH 1U4FA 1KIUB 1BJ1H 1U8NA 3MUGB 3BWAB 3UBFA 1JCKA 2XQBL 2EEBA 4FLOA 3QUGA 4N2NA 4NHUB 5J7CC 1S7RA 1DO6A 1JHKL 4IGBA 5FUOL 4TTDD 1SN2A 1BMWA 3N50A 4GRLC 4OZIA 4KRMB 2DMGA 3QNXB 3KBEA 4MMYA 2X0WA 1BD2D 3TA3B 1Y07A 1MY7A 1QG3A 4UNIA 4FQPA 4NQEB 3TH3T 3QUML 5K39B 5DC9B 3WAJA 2PCYA 4ZXBB 3I9IA 1UATA 3ZHLA 1HEJC 3HVDA 3MLUH 1I1FB 4PRID 1CLYH 1ZY9A 5GGTL 2X6BA 5IQNA 4QEGA 1FG9C 1MWAL 1ZS8B 3ALXA 1OAJA 3HRZC 4X4ZA 4YK4B 1JWMA 5I76A 1IBZA 4GEJA 4QRRA 1S3RA 3V7AG 3UXFA 1OWWA 1OAZH 4JVWA 1XSKA 3MI6A 3MLYL 5D1XC 1HH9A 2YKKA 3H2QA 4K9JA 2UZIL 1A7RH 2CUIA 4O00A 5C0AB 2ZIDA 2VRKA 2WLYA 4YFLI 4XMZA 5IMLA 1EFQA 3ARWA 4I1PA 3W82A 2K7PA 1QNIA 5E2UL 3BCFA 4PJDA 3O41B 3P0YH 2HLFD 4M1GH 3CHRA 4Y5VB 1HS6A 4K73A 1K6QH 5GGSY 5A2AA 4JKNA 5IVZB 5LNDA 2CALA 3KJ6H 3ZTDC 2QTVA 3RGHA 1L7TL 2BVQA 4ENED 4UT9A 3O6LH 4BGDA 1JPEA 4U1LA 2A73B 5FGBC 5ACZB 3WEXA 3BOVA 5DZNA 1A1MA 2YD7A 4M5YL 5IB5B 4JM2B 5D4QA 3EAKA 5ANMA 4JRXD 4WO4D 3X13A 4HULB 4WK4B 1OM3L 3ZKMC 4UWQB 3D0LA 3TGXA 3UTQB 5CGTA 4NQDD 3KGUA 4GG6F 3RY6C 4LZKA 3LXCA 3LZNA 1V7ML 4I2XE 3EBAA 3BQVA 1Z5LB 3B7RL 1AANA 2CIIB 4LEBA 1SOSA 3SYAA 2B4CL 4HLZH 4QF1B 3V95A 1YNKH 2VDNH 4KFMA 2AF2A 1NH6A 4L5FH 4K5LA 5JIDA 3CPLB 1X5IA 4QHKI 4WKXA 5GRJL 1SHXA 3EYFA 4XN1A 2XSKA 4MNGE 3ZKND 2WKOA 1SOXA 4ZOAA 1CFQB 1JF1A 1UWGL 5ETUB 2WZAA 3BUDA 2P5PA 2WJ7A 2YD0A 3G6AA 4GAAA 4ZMNA 4U6VL 4U0QB 1BSIA 2PXYD 3L1EA 2BS8A 5CJ8A 1N0XH 1INQB 3VXNB 3BVVA 5TD4A 4G5ZH 1V3LA 4KUCD 5EIIG 1YYML 3G5XA 4ZZKA 3FYIB 4KVPA 1AR2A 2P5WA 5E6SB 3DVGA 2F7QA 1QLFA 1O7DE 4UAOC 4UQ2A 4LK4A 5EBWA 3DK0A 3H1ZA 3NP3A 4P46D 5CZRA 3H8NA 5CZVH 3BH9A 1HZHL 1H3GA 1UH4A 1A3LL 1Z9PA 4DVRL 5D1QA 4HFWA 4Y4KA 5SWSD 5IG7B 5D5MA 3RIFK 5D7EA 1T7VA 2HFFB 1RK1B 3DGCR 1D9KC 3V5HA 3GXMA 3RAJH 1DJYA 4AYFB 4OZIE 1BF2A 2XV0A 3DDFA 3SOTA 4P5TC 2X4TA 4KROB 3BIKB 3HE7D 4ZPTB 2ZYHA 1MCSA 5D7JA 5ISZE 1FYTE 5EEXA 1WIUA 2KQMA 2J5LB 3O6FD 5CP3H 3RUGA 3O2DL 3DBXB 4PJ9A 4QIRA 1R5WB 2VXSL 2OMBA 4PCTA 2Y2WA 3E0GA 2YOCA 3V4VL 4DP5X 2XCMC 1PZ5B 5CO1A 1A1OB 3NZ8B 2ISDA 3T2OA 2B20A 5I1DB 5ICXA 1CFMA 3BDYL 4PJFA 4KHTH 2AAAA 2X88A 2BOCA 2F8XC 5KVGL 3CHPA 3VGDA 4PRHE 4EIBA 2FIRT 3GSRB 4PPTA 2FR4B 1G1CA 2AGJL 1GXEA 5DQJA 5D7IB 4J6RH 3BISA 5CIPH 5B1AB 1JK8B 2HLEB 2R2BB 1WJ3A 3IN0A 3P0VL 3ZHKA 1A5FH 2PO6A 2AV1A 4G8GA 4NRXB 5EUOF 3GSVA 4B97A 4X4YB 3P2DA 1AQHA 2XZCH 2F58H 1P4BH 2IOIA 3KPMB 4JO5A 2WXGA 5FAAA 4RBPH 5D7KE 1AFVH 5JQ6L 3R8QA 5JHBA 4YZFF 2JK5A 2IAAC 2VXQL 4ODWB 4WI5A 3UAFA 1BX2A 3NCXA 1NEZB 4Y16A 5DRWB 1PYWA 1HHJB 3GLDA 4HH9A 3PWJB 5I8EA 3MBXH 4DFHA 2XN9E 1GH7A 2GTWA 3TEWA 2F68X 1OAQH 3MREB 2R1YB 4LLYB 1TTAA 4NRZB 3VQLA 3FT3A 1EAPB 5TDNA 5BRZA 1ZPUA 3AG4B 2EVGA 4OTXL 1BXXA 4FI6A 2BNRA 5DHMC 2ID5A 3LRMA 1WFIA 2VERA 4FFZH 3VFMA 4CW1A 3QUXA 4X8JB 4EUPH 3H7LA 4YUEH 2L7UA 3IKCA 1JNJA 4P59H 1MW3A 4PW9A 4B9JA 1K4CB 1WV7T 4A2GA 1HFUA 3ZQWA 1HEHC 4CVZB 3ZE1F 1SQMA 1Q94A 3UBGA 4D3CH 3ULUH 5FV2A 2EEXA 4OFPA 4J3OG 4NWUH 3EOTH 4MQXD 3BSZH 2VLJA 3WD5H 3CN3A 1ACXA 5F89A 4MZ2A 1Z5HA 1N0LB 1JDAA 2VXUH 4WCYL 4W9IC 3ISWA 1BJ1J 3BCDA 2QHRL 2X53A 4AIOA 1F4AA 5DZ9A 1JV2A 3E6FA 3G3LA 3QR1A 5EU6B 4M7KH 1QNZL 4QOKD 3OKDB 4UZGA 1JS4A 2ZWNA 4KROC 5D2LA 4N5EC 1YSOA 5A3ID 2EKSA 4PP1D 1H3TA 3ILQD 4ZMYA 2VJ0A 4HIEA 2K9UA 4XPGH 1KOAA 3F7YA 2DYRB 4PUBL 2VN7A 3E1ZA 2XJLA 3CFDA 2YD6A 3QE5A 4U1MA 4YN3A 5I66B 2D3VA 1I85C 4WGWB 4XCYB 1PG7L 3HUJA 4FQIL 3UEQA 4A37A 3O11B 2AK4A 3J07A 1GPOH 2IPTH 4UQAA 4X7DC 4D9LH 2OJZL 4Z3TA 1CDYA 4XZUB 1HEZB 1HN1A 1NM9A 3TPUA 2EH8L 3CK0H 4E68A 2D4FA 2ED6A 3ZE0B 5LDSA 2YEZB 3W39B 1S9WA 5EOCJ 1FG2A 3UZQA 4X80H 2BO0A 4JM2D 4OQTH 2FT7A 5FIEA 3LKNB 3C5ZD 1PQZA 3C2AH 4LLWA 2D0FA 4I7ZC 4NWTL 3U2SB 3BO8B 3FRPA 4LOVA 1KYAA 3T3PB 4PJFE 5E2WL 3SPVA 2BY0A 3UFIA 1USQA 2WHVA 1BXAA 1OAXL 3GK8L 1L0PA 1LDSA 2EZ0D 4OZHA 1H6UA 2PPFA 5DXWA 5FUZH 4YE4L 4ZRGA 2NY4D 3HNTL 1OD7A 4XNUH 4RMWA 1I1AC 1JZHA 5FO9A 1DVXA 2X5PA 4Z7OE 4HCRL 4HUXA 1IC5L 4PN6A 4BSVB 1C08B 5AZEL 3JZ7A 4NYLB 2ADGA 2R0LL 2EYSB 5GGTA 3MRPA 2EDHA 4U7KA 2CRYA 1JWSB 3IDIB 3FONB 3PWNB 3WAKA 3VM5A 1AKJD 1PZ2A 1R46A 4PRIB 5ILTH 1GCFA 3QUMH 4BHUA 1BGXL 4ZQKB 5CSGA 1J1XH 1SMOA 1MFUA 1G7LA 1WFTA 5C0BD 4HWNA 2VRAA 1NFIB 1YEEH 1RJCA 1S8DA 3ARUA 3INOA 2OCFD 1CVRA 1DDTA 3IDYB 3IVKB 3AXLB 2L7JA 5D1QD 1MREH 2BNRE 3STBA 3P69A 1MUJA 1ZT7B 1AD0B 2X3BA 1CK0H 3LIZH 1D6VH 4UU9A 1NCWL 4HUVA 5F7FA 3HBGA 1LP9B 2B77A 2CBQA 3V4VB 3DUUB 3Q1SL 3QG7H 3MCLL 1NEPA 1RZJL 4JRXE 1L5GB 5ABDE 4NPKA 2AJUL 4NRYB 3C5XA 3EJCA 5I6PA 1GRWA 3HR6A 1DBJL 3I75A 4H0HB 4LRNH 3K0WA 5E5MB 1DDHB 1PIGA 4N8CL 2HZHA 1ZANH 4M1GL 4KDWA 2DEYX 2FK9A 2DBJA 4JFQA 2DLFH 1R5IA 3RP1A 3T4AB 1WZMA 2YMOA 3OAZH 1DE4B 4MAZA 1ACYH 2X12A 5E8EB 1C9SA 2KBGA 15C8H 4IJ3C 3QZWA 2QKIA 3II3A 2OI9B 3DMMC 2K78A 3ROLB 3TA4D 3HZKA 2XA8H 5FM5O 3RUGF 4YC2B 4KK8C 1UG9A 1BMGA 4Y5XA 1JXGA 4Q14A 4XP4H 2UY6B 3R4DA 5IHHA 2Z31D 3WDIA 1B6UA 5TQ0L 3QZMA 2NNRA 4HOXA 3ILPB 4XOCA 1MFEL 1QX1A 2VDOL 3HKFA 4IIZA 2DEWX 4NZFA 2VAJA 3BE1H 1PEZA 4NKIL 2GJPA 3VE0B 1EHKB 4JM4H 4R97B 3T71A 2XQ0A 3DYOA 3ZKSD 1FPTH 2IH3B 4P2RD 3T3ME 2MJWA 1EAQA 4IMLB 1UENA 5EO0B 4Y89A 1DVTA 4XCEA 1KPRB 3C9NA 3A4AA 5GRJH 4QO1B 4QXGH 5KSBA 3TWYA 3V0GA 2R29H 1AGFA 1IGYA 4OD2A 2EUXA 3VFSA 1PL3A 5ID1A 1IGFL 1KV3A 4ODSH 3ARTA 4FQHA 4RAUB 3KDMA 2VC2B 2AQQA 2VLRA 3KW7A 2MCPH 1U0QA 3H42H 4G5ZL 1BPVA 1KN4H 3D6GA 4HA1A 4MQXC 3QQ3A 3QUXC