2EDMA

Crystal structure of envelope protein vp26 from white spot syndrome virus (wssv)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
161
structure length
161
Chain Sequence
SVVANYDQMMRVPIQRRAKVMSIRGERSYNTPLGKVAMKNGLSDKDMKDVSADLVISTVTAPRTDPAGTGAENSNMTLKILNNTGVDLLINDITVRPTVIAGNIKGNTMSNTYFSSKDIKSSSSKITLIDVCSKFEDGAAFEATMNIGFTSKNVIDIKDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 22kDa structural protein VP22
publication title Crystal Structures of Major Envelope Proteins VP26 and VP28 from White Spot Syndrome Virus Shed Light on Their Evolutionary Relationship
pubmed doi rcsb
source organism Shrimp white spot syndrome virus
molecule tags Viral protein
total genus 32
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2007-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2edmA00
2EDMA 2ED6A
chains in the Genus database with same CATH superfamily
2HTLD 4PJ8C 5CSGA 1TETH 3K0WA 4GAJH 5DHVA 5E9NA 1KCRL 1GY1A 4DP1X 2PCPA 1VDGA 4CGUB 2PR4H 2F2HA 5AW1B 2CO7B 3FUFA 2BP0B 1DUZB 4IGBB 3AQZA 5FA3B 2QFPA 2DYPB 3DA0A 4JFSA 1HH6B 4NT6B 1Y1DA 3D0LB 5BZZA 1M7DB 3LN4B 3LPWA 1RIHH 4DGWC 2VXQL 1TLMA 4IOSA 4MDJA 1M9WA 3RBGA 2BSRB 4UT9A 2A9MH 4FQXC 3KWWB 1KPRA 1HHHB 4S1RL 3NPSB 4NNXB 3QCTL 4URTB 3U4BH 3VDBA 1ZEAH 2HKHL 1KG0B 5JR1L 4F1SA 3U2IA 5LUMA 2EO9A 4HIHB 5C9KA 2PR9A 4N68A 4UQ2A 3T1FA 5E1GA 4JCWA 3SDAA 3PIQA 1UGKA 4HKZB 1UA7A 2MNWA 3SGKC 4QRTB 1FFTB 2C7UB 3QWRA 4KVCL 1T21A 2DMHA 4K9JA 43CAA 4YFLI 5EEYA 1DBKH 3GZQA 3ZJAA 1ASOA 3CFMA 4DNLA 2WBXA 3O81A 5B8CA 4OD1L 1NMAH 2B8OT 2FHCA 2H3NA 3GXDA 3LXUX 1SHSA 4M43H 2GSGB 1DLHB 3L1GA 1GY2A 1QEWB 3LD8C 3IDYB 3PWUB 4PB9H 1JPFB 5AW6B 4AK2A 4ONOA 5D1XE 5FYLH 2NDGA 4MD0A 2UWEA 3U0PB 2F7IA 3W0WD 2ZXDA 3ZDWA 4J2QA 1A4JB 2WLIA 3JV0A 1Q4NX 3S3CB 3SBWA 4JN2A 1M7XA 1CGVA 1TJGL 4BQ6A 4G43B 4WUKH 2NZ1A 4MJID 4NKOB 5DF0A 3N41F 4WU7B 5GGTL 3OLGA 4MA3B 4P2YA 3HHSB 3WN5B 5BV7H 3QC6X 1CG9B 1JHTA 1IBDA 1KTBA 3FQXA 1S5IH 1E30A 3GMOA 4HHGA 4JG5A 4LRIA 1XSIA 4NHUA 5GRUH 3FQRB 3TXAA 4P05A 4KWUA 1FVDB 1YNLH 3TWCH 3K1DA 1NANI 5EMYA 1EZVX 3WJJA 1AGEB 4KHXL 4LL9A 3N5AA 5L88L 2JCWA 4QRPA 5FB8A 4OCRL 3V7AG 4H8VA 5GSVB 1U3JA 2BSEA 5EUOF 3SPIA 5KAQF 3BOVA 1MG3C 5HYJA 4Z5RA 3ZGHA 2LHAA 2VAAA 2F9BT 5HVGB 3ZMNA 5I73C 4HZLB 4G80B 1FP5A 1UQSA 2ALWA 4HV8A 2LR4A 2XKNA 3WELA 1IGMH 1JBJA 4POYA 2VERA 4LVHC 1PEWA 5K59F 3EZ8A 2X4SB 3RP1A 3R4RA 1NTDA 1N64L 4NZRH 3NCCB 5KVGL 3ILPA 5CEZL 4FD0A 3LZOA 1BYOA 4YFDB 4TNWK 4ILDA 4L0ZA 4LGPB 5JHDE 2Q3XA 3EJYC 3UO1H 1U30A 1XB8A 1N0XH 5I76A 4UNVA 1FZOB 4URKA 2HLEB 3T8MA 3VDCA 3PWPE 1RU9L 1W72A 3GO1H 5FO8A 5I8CB 3AS0A 4WHYH 1TQVA 1ZIBA 3GI9H 4FTDA 1MCOL 2KDYA 4R83A 4GEJA 3VWJC 4KZEL 4PBWD 1NMCB 1LEKA 4B6ZA 5C86A 2X4OA 4NKQB 3ZTCC 4BFJA 3KVPA 4NBYB 1TQTA 2Q87A 1IFRA 1HNFA 4GBXB 1SMAA 1BD2D 4EN3A 4EO5A 3MMEB 4B9PA 2CALA 2R2CA 2E47A 4GS7B 4L1LA 4KV5E 1U6AL 3WNMA 1GMEA 4QWWD 1KSRA 3KGSA 4R4FH 2C4FT 3OKDA 4ZZKA 4YSQA 3VX1A 3QEUB 1AXTL 5C0CE 4W9LC 2QKIB 4EI5B 3VFSB 1L0YA 3NN8B 2GBAA 3SZ6A 3ZHDA 1WIUA 3IU3B 2ZYIA 2YBRB 4OT1H 1LMKA 2Y1YA 2ZNXA 1P7KB 5E1IA 5G4MA 3SCMB 4OV5B 2QDWA 1OAUL 5HYSB 2IWEA 3QIWA 3MV9A 3ILQC 3ZE1E 3QUYA 3NCMA 5CEXA 1CD1A 4MSWB 3G6DH 2NYKA 1QG3A 5I6XB 3F84A 1MAML 3U7AA 5KSAA 2L4OA 4F7TA 2PXYA 4XN1A 1BGXH 3QPQC 4QGYA 2FD6L 2AK4A 4XTRD 4TNFA 1CVRA 1FVCB 4P2OC 1A7PH 4ZS7L 4EVNB 1NCCL 1OB1B 4FQJH 2BNRE 5IB1B 1IC5L 1U2HA 3D0VA 4A7GA 2GVYA 4L5FH 3HZKB 3HZMA 1WBYA 1IRAY 5D1QD 2ODIA 3BZEB 4MA8H 3M7OA 3APMA 3HC4H 3FN0L 3EGXA 4R4ND 3K3QA 4KITB 3PNWA 1DQKA 1DUYA 2VSDA 1P53A 4ZQKA 4UM8A 1D9KA 3UPCA 3CUPA 2W0FA 5AVUB 1SEBA 1MQ8A 2C9VA 3ECVA 4I2XE 3V5DB 1R24A 3Q2CA 3OB0K 2VOTA 3OKNA 1JD9A 2IBZX 3RU8L 2JLLA 4DKFH 4XWOC 2OMUB 2VQ1B 3N1FC 2VLKB 4CMMB 4NQDD 4ZW6A 1OTUC 3CHRA 2JTYA 3QQ4B 2G30A 2ZOKB 1CD0A 2XY2A 5T1MB 2W88A 3VG0H 5CCJA 1LK2A 5E51A 3K80A 4R4BB 4UYQA 4GXFA 5JOFA 4U3XA 1DQLH 4GUCA 4DP7X 3SIKA 1EFXB 4L3ED 4LIQH 5I66B 1A0QL 4M6MH 3SKMB 4B97A 3KBHE 1U91B 2R15A 1HSBB 1Q9WB 4TQIA 1CFBA 4Z7VB 5DUPL 3VGBA 4ZFOA 4FNTA 3KXFB 3D3VA 3P9LB 1NGPL 2WQVA 5GZNC 2YQGA 1Z9NA 2YGVA 1J8HE 1X4ZA 3FQWB 4PV1C 2W60B 5T5FH 5GRVK 3A6BL 2E27L 4WO0A 5AUMB 1PIFA 3HS0A 1E65A 4MCZB 1KLGA 3UTZA 1ZCRA 3D06A 3TVMC 5F9WC 2QZ5A 1E7VA 1F90H 3EH2A 1EPFA 1TZHB 4OF5A 1QSZA 2N7BA 4TTDC 3EYUL 3F3HA 3JTTA 5FYJH 1WFNA 4HFUL 5FFGA 2R23A 1HL8A 1XX9C 1WWCA 2GIMA 2HLFC 1AZCA 2HG0A 2VRKA 2EDLA 4FEMA 4YSDA 5T1KA 5IKCA 5B7MA 3D2TA 3UTTA 4YDKH 4XX1G 3CVCA 4DFIA 3BPCB 1B4JH 4NPKA 4P46A 4HOMA 4BZ2L 2AJUH 1DSFH 4MMZB 1E4WL 2EXWC 2H0FA 5AKTA 1CQKA 3NIDE 4KDTC 1MH5A 4LZKA 4IOSD 1A2YB 1I9RH 1X7QB 2B1HL 4DGIH 1YYLH 2EEFA 3EH4B 2C3GA 4K15A 3FZUC 1IM9A 1NCJA 3V0JA 4W9EC 2WWNA 3AG1B 2D7NA 3SDAD 3KH4A 1WBXA 5MHSD 1NBZB 3VXNA 4XH2A 4PCYA 1UVQB 2ALAA 4WFFD 5BVJA 3VRJA 1HL5A 2DWXA 2EYTA 3N2JA 5DJ8B 2JSFA 3OZ9H 5GGRB 5ICYA 3E3QC 4Z77A 1XZWA 1H5BB 4N5UA 3QHTC 3ATDA 4OD3H 1ZAGA 4E9QA 4IBQA 2K8MA 3K6DA 3QIUA 1BZ9B 3NJJA 2R69L 1BZQK 3H2WA 1TVHA 1KXQA 1XGQA 2Y2TA 2XWBB 1XF3A 4YDIH 2Y1ZA 3DX9A 2DI7A 1XAUA 2QZQA 3ZE0F 2ADJA 3D09A 5C0RL 5KAQG 2W0KA 1WAAE 3SZKC 4RLDA 1C16A 3KR3L 2QV4A 2X1OA 3FRPA 2YEQA 4I9WD 3GSVB 2XWDA 1AFVH 3VUAA 4L4VA 4PRIA 1UWGL 5F3BB 3LKQB 1YMHB 1SYVA 3SDXF 3MTRA 5L8JB 3QEGL 3A21A 2DKUA 1A7QH 4A7SA 1G7IA 5B38A 1HX0A 3PAUA 3QUZC 5CO1A 4XMWA 2QHRL 2DQFA 2EDBA 2KZBA 3QJRB 4MNGA 4UDUA 5DHYA 3VSQA 3BIKA 3L3DB 4PCTA 4NXSA 3H54A 2D7MA 1R0AH 1ZV2A 3MLTB 2FEDD 5DUBB 3CIQA 5JHAA 1KIPA 3ARGC 3RVTC 3OKMB 4WFGE 5J11C 5C0AB 4JVUA 5JUEL 3RJOA 1DDHA 5DA4A 2CKNA 3VX0A 1SY6H 5DTFA 5CAYB 1QPXA 1H3UA 1EJOH 1EO7A 1XH2A 3ML8A 4BFEA 5CGMA 2FE0A 2BXZA 4UU9B 3IDJB 3SGDH 3LEYH 1RP9A 4G8FB 4PJCF 3F7RA 3KYKL 1VPOH 2BSED 4O00A 4XBGB 5HHNA 5KS9E 5CILL 1N3NB 5HYJD 1HQ4A 4DW2L 5C07A 5HI5D 5IV2A 4PRDB 3V95A 4Q56A 4QF1A 2DD8H 1F97A 1F4XH 4H2AA 3H8NA 4O2CA 4P5RA 3T77B 1THCA 1M7UA 2EYRB 3SGJA 4HJEA 4FP8L 1HAUA 1HOCB 3HC0B 4EOWL 1HQRB 3UO8B 2WYTA 3D34A 1KPUB 4CC4C 5JO5A 1FUNA 4F7CB 4JMXA 2ZWYA 5E5MA 5G4OA 5HYQB 1LTXA 3EYFA 1CR9H 1F18A 1RJLA 2EEDA 4APQC 1R5IA 3BKYH 5IB3A 3H85A 1JNJA 3FQYA 4HKXB 3DPBA 3RX9A 2V6HA 3L3IA 1N6QH 3HNVH 1GC1C 1MCLA 3HZ3A 1OAXL 2XTLA 5KANG 1JGUL 1QNIA 2ZKMX 1OP5K 1UH2A 3OHXA 3DSFL 3REVB 2VRAA 5DQDL 4HWBH 1LO4L 4NKDB 4OJEH 5DVNA 5ACMA 4LCYA 3GPEA 1ZGLP 1ES0A 2ZICA 3PWVB 2BDNH 3ZSSA 2IGTA 5GS0L 3DURA 2J8UF 1CPUA 4I7ZC 4C59B 5H4ZA 1XF4B 2IV8A 3KVDD 4EN3D 4HUKB 4GMSL 3HS8A 4OZGE 1F86A 1KENH 4JX0A 1A6UH 2OLDA 2YQ2A 5I1KH 1SN0A 1FVEA 3FT0A 5IHZA 1U8LA 5IW6B 1C5CL 3ME0A 3V8OA 4DCQB 1DVZA 4GG6A 2GY5A 4JB9H 4WW1A 2R0WL 1PS3A 1JK8A 2CKBL 5FM5M 1KCVL 1D6EB 1HKFA 1SVZA 2WNXA 4GIPD 4OM0L 3FUMA 4BZYA 4I18A 4I0PC 1MFDL 3ZUCA 5I2IB 3S35X 1G1YA 3D39A 1KCKA 4OZIE 1UWEH 3QIWD 3VGHA 3MV9D 3IJSA 3MZGB 3QUYD 1W6WA 1MWAL 1D5RA 1IKFL 1A8JH 1X4XA 3MRKB 1FLRL 1QVOB 2V7HA 2ODHA 1QWUA 5EOCJ 2UXFA 5KSAD 3SDCC 4AQ8A 2CO1A 2PXYD 4BRJA 5I16A 2NTFA 3ZHKA 5EU5B 3K4AA 3QDAA 4PJ5A 2AK4D 1NCAL 1B2YA 4XP1H 4PG9A 5DRZA 2NY0C 3KYOA 5KYYA 5LXVA 4X6FA 1WT5C 1A4KB 5IG7A 1KYOK 1PX3A 5BQDA 4ZPTA 3UC0H 1WZAA 4KZ0A 3GLAA 3LHAA 2OA9A 2JB5H 3FUEA 2HYMA 3JWNG 5IVXF 2X1PA 1MFEH 1KTRL 2CO3A 1PDKA 2ADIB 1F6LL 4HJIA 1E0OB 3DOSA 3CSPA 2Z31C 2OR8A 4F9PC 3IJHA 4QTHB 3CVHB 3LZFH 4UB0H 3GTTA 3QO0A 2GUOA 3GIZL 5E4EB 1D9KD 5I6PA 3L3HA 1OLZA 3E8UH 1X5AA 3TBTB 1FO0H 4IHOA 2VLJA 1ZGLM 4RMTA 1CFNA 1JDAA 1GW6A 3RDTB 4A66A 1BQLL 5I0WA 5LQBL 1OK8A 1BP3B 2VDMH 5D7LB 4ZAKB 3TBCA 4AQZA 1NINA 3WI9A 1AE6L 3UEZA 5LBSA 2QQLL 4MYWB 5E23A 3HMWL 4D0DB 3UTPD 2PLTA 5FIEA 3OAWA 3E0GA 4ZUWA 2ZX6A 5JIKA 3FO1A 3VE0B 2YFNA 4H5SA 1KGIA 1U8HA 1G9MC 5DFVC 4JO1L 3D3VD 2FJHB 4K94C 1O5PA 1FHGA 5D70L 1L9NA 2J88L 1OARL 2Z9TA 3SSGA 3F7LA 1VFBA 4GT7A 2NNXA 4M93B 1RHFA 3FSWA 3IM1A 2P49B 1IKNA 4X5WB 4DO5A 4Z3GA 1AG0A 2N4IA 3CFQA 3RFZC 5FO9A 4ZPVB 3QXWA 3J07A 5D5MA 2X38A 1FNEB 1C08B 1E8YA 2WP3T 3PXLA 4XBEL 2MRYA 1QQDA 4FQIH 2D9CA 5D93B 3K4ZA 3C9NA 3L9YA 4V11A 4N3TA 4OGYH 3C2AH 3P9WB 3VXMB 1PZAA 2WCGA 3OJDB 2ADFH 1CN4A 1X5MA 2XZQH 5KBMA 3QA3B 4Q6YA 3HJEA 3ZYZA 5GZOA 1OVZA 3MRFB 4M1CC 4TRPH 3O0RL 1O9ZA 1R5WB 1TCMA 4AM0Q 2VABB 3CDFA 4NN5C 3UTTD 2XTJC 3RWHB 5FEBA 1G4RA 1KYFA 3UMNA 3FMGH 3T4YB 2O61B 3WE1A 2J2ZA 4M6NH 4NQCB 5FC9A 3RBSA 3QFJE 4D94A 1IL1B 3RWDA 2WXRA 3QAZC 4O02H 3N43B 3FUKA 1HH9A 2CBMA 1E2WA 3QNZA 4JK0D 3FOMB 1LEGA 2XN9B 2YRPA 2QBWA 1XO8A 1N5AB 2HTLC 1IM9D 3O3EA 1BZDA 1AMXA 3FO9B 3AY2A 5D2LE 3O9WB 1FZMA 1OAKL 5K9JL 5MP6H 2VZ1A 2VR7A 5I1AA 1FE8H 2JKWA 1BOGB 1YJDH 1JWMB 4XPHH 4P2AA 4XXDA 5JNYA 3LSOA 3MXWL 2E6PA 2RCSL 3WDHA 3L2LA 3QIUD 1B2WH 2AJ3A 5DJ2A 5JQ6L 5K9OB 4DZ8B 3R8BB 3VYNA 2KYIA 1H19A 3H0TA 3UTSA 3VYPA 1FZJA 4X5XA 1ZK5A 3TPKA 3TFKD 4YSTA 1TFHA 1FO0A 2BW5A 3NIFB 2JCCA 4P57A 3SE3C 3S8FB 3D50A 2V9RA 4XXWC 8FABA 1RUQL 3OKOA 4IRSB 3BKML 5IJKC 4L4VD 4PRID 1VEOA 1G7JB 3TV3L 1ZA3B 2ZX5A 3LHPL 4G8EA 3TV8A 3NBNA 4KPHH 4H25A 1IM3B 3GSQB 1XCTB 1HXMA 5LGJB 1MCWM 1DVSA 2D73A 1CK0H 2XBDA 4OKVA 5E94A 4XN5A 1XZ0B 2WY3B 4BINA 1T6BX 1CFSB 5TDNA 1T6VN 4NYLB 3C08L 3LQZB 1ZK9A 3UZQB 1XF5B 3GXFA 4F7KA 2VAJA 1ET7A 1VFAA 3BP7B 2K6YA 3GK8L 1WFIA 3L5WA 3RTQA 1Y18A 5DK3A 3OV6A 3UP6A 7TAAA 3WAJA 3TEZA 5HDBE 5IQ7H 2WHVA 3HN8A 3BPNC 4BXVA 1DQJB 1DLFL 3JWOH 1T03L 3DUSA 2C4XA 4FMKA 1WCQA 2WINA 1DQQB 1GZPA 4JFFE 1EX0A 4XPFH 5IFAL 4GW4A 3VO0A 5T1DH 1MI5A 2G0LA 2J25A 1N4XH 2YJLA 4N0FB 3KJ4B 3QIBB 4GIAA 4AZ8B 5ILTH 1NBQA 2JE8A 5I8EA 5BOZG 4TKWA 2J12B 4YEEA 1UA3A 1RULH 4N2CA 4R6UA 1JZ5A 4HT1L 5B3JE 3H3PL 4PJ7A 1H9DA 5C07D 3IDXL 5I15L 4JR9H 5DC0A 4HH8A 3K0YA 4OW6A 1SN2A 5EC1B 1FBIH 1PIGA 2VR4A 3KM2A 3EF7A 3PJSB 3HPLB 4Z3FA 1LE9B 5ITFA 4BKLB 2K6ZA 4HLZG 3ZXAC 1AI1L 3T09A 1RIUH 2NNFA 4WCYL 3UEQA 5HI3D 3BQUC 4O02A 2FVNA 3KWXA 4KI1A 1OP5H 4ABUA 1KXTA 5D7IB 2YPLE 2E74C 4S1SH 2PWFA 5FCUH 1MCCA 2GB2A 2O5ZL 4NFBA 3MJ7B 3A3YB 5D4QA 2IBGA 3CFCH 1B0RA 3LXAA 2R39A 5HDRA 4K9EC 3L45A 4B7IA 2L7QA 1T1ZB 1KYDA 4ODTL 1V3LA 4X5LA 1NGXA 4U1SA 4P23A 3Q6GL 2LLLA 1H15B 5AALA 4RGND 5EEVA 1RPUA 4GRLC 3CZGA 5AVXB 2H3KA 3NJNA 2I7SA 4YZFF 2DPKA 1YNTB 2IGFL 3IMVA 4AT6A 1MHCA 4U1NB 4L8SB 3OX8B 2DJUA 1WWWX 3DVNA 4PJIF 3P73B 3WLBB 4PJ8B 2NSMA 1XGUA 4MKTA 2MQCA 2E9WA 2A6IA 1KXVC 5E1QA 5TE6H 5BMFH 4JDZA 1NM4A 4Y5YA 3BKCH 3KGUA 3DX8B 1K8DA 4OZIB 2QL1A 1UM4L 2GTZA 1OHZA 2VDLH 3MKGA 3QWNA 4K4KA 1FFOA 4JFPB 4PP2A 1A25A 4RQQA 2VDOL 4OTXL 2DS4A 1SOXA 3V4LA 3IETA 3VD4A 4JCMA 3Q2VA 2BVOA 3D39D 2C9PA 1E4KA 1I75A 4FQXB 2FJGB 3MBED 5AVRB 3OGOE 1P1ZA 2KZWA 4H44C 2XZAL 2WAQA 2E7CA 3SOBH 3IFLL 3NDZE 3PUCA 4G7VL 2WXKA 1WGVA 4YLCA 4QWWC 5TE7L 5IQOA 2Q0ZX 4PJ5D 4BFRA 4DN3H 5ICXA 4YC2B 1RZKH 4DGUA 4IM8A 3IB4A 5D1XC 1T80A 3HRZA 5EU4B 5C0FA 4JJOA 2VDRB 5HGAA 2WUBH 1OAYL 2NX5B 5D9SB 4GAGL 4ONHB 4OD2A 4F3FA 4JFDB 3P4LA 2ZOOA 1SMDA 4K5LA 5FM4A 2WOYA 3MJ8B 3RJDA 1DO5A 2OW6A 5C3IA 1I8MA 2QSCH 1IGJB 3B2VH 1DBAL 4NLAA 3MV8B 1J1XL 4M5YL 4RRPM 4W9KC 4H20H 3RWCB 5I71B 1DE4A 1U8JB 1C1EH 2E9GA 3HFML 2X4UA 2ZNWA 4AKPA 5AW7B 3WNLA 4AQEA 3FW6A 4MDIB 2VLJD 4XTRC 5C09E 5GJTL 3H7BA 2OR9H 4Y9CA 1OAZH 1H6FA 3AXHA 3K72B 4I85A 1CCZA 4N0UB 4BK5A 1URZA 1E42A 1RUAL 5D1QC 5HGGS 5FXCH 1L6ZA 3FB6A 2CHZA 4RETB 5E95B 4I3SL 4JE0A 2O5YL 5KYUB 2BJMH 4R4NC 4N26A 1QNZH 4J3XA 2MCG1 3P4NA 4AJVA 2W65A 4N2DA 5F89B 2NZIA 1EUUA 2YD7A 4YEFA 1RURL 1GJIA 1XQ4A 2B20A 3QZLA 1PW3A 1BPVA 2H6PA 1NGZB 3E2HC 2YGOA 1MDAA 3SKJH 4GQPH 5HPMA 2WC7A 3QUMA 5JW4R 4WI3A 4BZ1H 2KHAA 1YQVL 2EKSB 3L9BA 4P59H 3JV5A 3GM0A 3N06B 4U6TA 2XPZA 5HHMB 1Q1JH 2G5BB 4R2GB 4PRPA 2VSCA 3I9IA 1I85C 3FRUB 1ZV5A 1UB5A 3X3GL 4AGQA 1RMFL 1DDTA 2VT0A 1BEXA 5AZEL 2VN5A 4LOUC 5D7EA 4NZFA 3ZL4L 4PGZA 3VMOA 5GZOD 3CXFA 4LVHB 1LXMA 3FHAA 3RFRA 2Y5TA 1CFTA 3CZUB 1IEAA 2DLFL 2XTSA 3ULVL 1S9XA 4OB5L 3FQUB 5B22A 12E8L 3IU4H 4PVNA 3G6JB 3CN4A 4CADB 4IIZA 3M7FB 5IJDC 3APDA 3RY4A 1R17A 4L48A 1Z2KA 1SYSA 5JQHC 4WFHD 4KMTL 2ZX9A 1K9TA 1DVUA 1O0VA 5MEQB 2K7PA 2NY4D 3GLDA 3VXUE 2EIJB 2HFEA 5H37A 3BLPX 4MQXD 3VQ2C 2YSSA 4GSXA 5CUSH 4WI9A 4XNAA 1PKOA 1DQDH 1HE8A 2CDGB 1JL8A 5DS8A 2OMZB 3FUNA 3OMIB 4PV9A 1EV2E 4YNYA 5KJRL 4RMVA 5JPMA 1BJ1J 1F8TL 2AQNA 2WD0A 4Z8FL 4JDVA 3I6KB 1ZSDB 3OQRA 5KZCB 1F5WA 4NUGL 3UTSD 3GHEH 1UUSA 3BH9A 3O3DB 4JFXA 3V10A 1AIZA 1M9SA 3LN5A 3QFDA 4HX1A 4UT7H 3JZ7A 3LVEA 1ZTXE 5ADOH 3QR0A 4H26A 3STLB 2ZUWA 2H26A 2P42B 1QR1B 4Y1AE 1NDMB 3LKPB 3SDAC 2WANA 2XQ0A 1BXXA 4RX4A 4ODXB 5EA0H 1T66C 1L9MA 1THAA 5T1LB 5DEGB 4G7SB 4AMWA 2I9TB 1L9RA 4L9LB 1A6VL 3DC0A 1T89A 1JXKA 1QAWA 4I48B 4P5SA 5JZ7D 3DIVA 1KC5H 4LLMA 3TYGL 4KUZH 4NP9A 4IDLA 2OX5B 1UZ8A 4U4IA 5B8CC 3OBAA 3RTQD 2Q5BA 5CBEB 1P4BH 3WTXA 5J9PA 5TF0A 1YQ2A 1UKSA 5DHMC 4UTBL 2ITDA 2D3NA 4A7QA 4OLUH 2W80C 1JVOA 2Z3FA 1QRNB 1MI5D 2HP4A 1H3PH 1AZVA 4GI9A 3V9CA 3NG5A 4PJBA 1EAQA 1GOFA 2VLMD 2IMNA 3DBXB 4Y4KA 3RPIB 3KYMA 1TTAA 4YDVB 4M8VA 1NUFA 3B2PA 5C0BA 2GT9A 1OGTB 2E8YA 2GK2A 2K6WA 2BVPA 4HKBA 2DF3A 2OP4L 1S8DB 1MRCH 2FEDC 4KV5F 1J05A 2XBZA 4LCCA 3HUJB 5J06A 1VGEL 3MXVL 4NENA 1I3RA 5CBAA 4MMXB 1J5HA 1FPTL 5D7KD 4P5MA 4ZNEE 4FQHA 1ZGLA 3WJJC 2UV3A 2HMID 1NEZA 4QRUB 3S96B 3EUDA 4PJAB 1KJMB 3DV6A 2F68X 3QULA 1ZMYA 3NJFA 5IMMB 4DGVH 5A6MA 4GMTH 4P5KB 4A6YH 3ZE1F 5I6NA 4LL4A 3OAUH 1QBML 4M7JH 3MRGA 1A22B 4QYOA 1G7QB 2ESVB 2XFGB 4TVPH 4ZUUB 3IXAB 3EYQD 2VMJA 3B7SA 4P23D 4ZS6D 3DARA 4XZ4A 4ZMXA 3S36H 5BCAA 4N2GA 4MLSA 4NM4H 4ZMTA 1QFWM 2IDFA 3I2CL 1ODAA 2CHDA 2D9QB 3TVMB 4OSUH 2OZ4H 4MCYA 2C1OB 2OJEA 5F9WB 3D33A 2B14A 3CFTA 2IF7A 4KOCA 4FCAA 4X99A 4IU3A 5KSVB 4W6WB 5LAPA 2H8PB 3C8KA 4KBPA 3CK0H 1UCBL 3PHQB 4WJKB 4XNZB 1N59B 2QADD 1LJMA 2OJ1A 2VTFA 4N0CD 3VI4E 1HJBC 1Q0YL 3I6GA 3BP6A 2DQIL 3IPEA 3VRLE 2J1ZA 1NH6A 4UTAH 2EYSB 3L6FB 4MJ5A 4P9HC 5E08L 5D8JH 5E2VL 5F8RC 1M57B 3ZZSA 1EAPA 5LB1A 3CVHL 1X7SA 4Y16B 2FJUB 4N0YL 4DZBB 2E7DA 4OZHE 4LEOB 5EIVA 1ZLUK 3SJVA 3CSYB 3GC3A 4RMWA 2F7RA 1CXFA 1MIML 3KYAA 4A2GA 2DWTA 2IIJA 1OWRM 1ETZA 5IEHB 3S5ZA 1RHHB 1ROWA 3C5SB 4OCYH 4JJ5A 2PTTA 5J3HD 2VKWA 2BIOA 4F20A 2HVJB 4WNSA 3ABZA 3E8VA 3ARDA 4ZUTA 1OB0A 1I9IH 2ZF9A 1HEZA 2WB7A 3DX4A 4XAWH 3UG4A 4DPAX 3NJIA 4ONFL 4PLNC 3QUKB 5CCKH 4CMHC 5F7DB 3WSQL 4WHTB 4YAQA 3RVVD 3FCGA 2CGZA 5FLVA 3ULSB 1KJ3L 3CGTA 1CIUA 3QIWC 3QUYC 1NMBH 2WKOA 2FGZA 3G5WA 1J7VR 4M5TA 2KERA 3QAQA 4HWZB 4LSRL 1BA9A 3HJ0A 5KSAC 3HI1B 2XQYG 2PXYC 2ZG1A 5DQ9A 2OTWB 3CHQA 2J8UB 3ZKXB 2YPVA 1UFGA 2FX7L 4HJGB 3TNMA 4EDWH 5LWYL 2V8MA 3GZKA 3QUZB 3EO9H 1I8UA 4UAOC 4YE0A 3VFPB 2WN2A 2AQ1A 1NCGA 4HMEA 3FH7A 3UPRB 1B0GB 4JFOB 3NIDF 1S9VA 1U3ZA 5B7FA 3UH8A 1UOKA 3IRPX 3QRBA 5E1AB 3ARGB 1A14H 3ZE2E 5H2BB 4Z76B 1U0QA 5KSBB 1P7QA 1IAIH 2OKMA 1ZHNA 4HDIA 5J11B 4DN4H 4NRXA 3EO1B 1A6ZB 1L6PA 2EH7H 3MA7A 3NFSH 2RQ8A 2X4NB 5D55A 4YQXL 3F62A 4DQAA 3C8HA 1U8QA 3HVNA 3KPSA 2QVMA 2L3BA 4YHML 3S8WA 3G08B 4NQXB 4LE8A 5GJSH 3NRQA 4ORZC 3B9EA 4X6CB 1RIVL 3HNTH 5CZKA 5AYTA 3MI6A 1TNMA 4PRPD 3P3TA 1V3KA 3LOWA 5EZLB 4U1KB 4DVRH 2R1WA 4BE6A 4FTVB 2ENJA 2GFBA 2YKLL 2ICES 3OGCA 3IAPA 5EN2A 1BM7A 2HWZH 5I18H 1ACZA 4UDTA 1WAAF 1KIUB 3PWNB 5I19H 3U0TA 3F5WA 2LE9A 4TULH 3VXUB 2EDQA 3ETBF 2F1BA 3UXFA 4M1DL 4JKMA 4TUJB 4XCCH 5AZ2H 2MHAB 3HS0C 1FQ9C 4P3CL 4APQB 1Q9OB 1IFGA 1W8NA 1UZ6F 1IU1A 4FNLL 2ZF8A 4OAWB 2VC2L 3IMTA 2YQBA 2ORBH 3OJVC 4RFNB 4UT6L 4JO4L 1MXDA 3UYOD 2ZWNA 1T5WB 2PN5A 3MLVL 4LXFA 2QGDA 3CWGA 3RGHA 4FA8A 1BVKB 1OGAA 4ZFGH 4XODA 3PY9A 4YGVB 4OF3A 1LMIA 2H0PA 3VXQA 1X9LA 1XB6A 2H7WA 2XWEA 3EUUA 3OXRB 6FABH 4U1GB 3HCVB 3IFNH 3KLAB 3OKKA 2SEBA 4M02A 5ADPL 3I02A 2FHFA 1T20A 2FSEB 3VFVA 4ZSOA 4P46C 2C3HA 5CSZB 1IJ9A 4DOHE 2JKTM 5DD3H 2A0LD 2AJXL 2X6UA 2DRUA 2HT4D 1HNYA 3M17A 3RGVA 1WPCA 4CSZA 3DJSA 4X0KA 4ZX4A 3X14A 4KK6C 4A7GF 3SE8L 3ZRFC 1JZHA 3BSGA 5IK3B 3FH8A 2XXCB 3SQBB 5KS9F 3R7QA 3NCXA 2LW3A 4CUCA 4WENB 4FZEH 2XHNA 4L29A 4BXSV 3BDBA 5FHBH 4WW2B 2NPLX 5B1BB 1UA6H 1WC7A 3WO4B 5IB2A 4RX4D 4HIIB 2J1WA 1CTNA 1LP9A 3UBXG 1UT2A 4JPQA 2H45A 4QOKE 3ZKND 3B6SA 2ZUQC 2J57A 4O9HH 3TH3T 4YHKH 3D4ZA 4YS4A 2VLRA 1RUMH 4RFOH 43C9B 1BFSA 4LLWA 4Z7OB 1CJYA 3LX9A 3QIUC 1PSKH 3AREC 4H1LA 4ZFZA 2X9XA 3CVBA 5IQNA 4OQTH 2CR6A 4DETA 2ZXAA 2XG4B 2ZZUT 3ZTDC 1WD9A 2NY0B 3O3UN 3Q6FB 1E40A 4EZKA 4KHTH 4DH2A 4A63A 1YNKL 1D5BB 4FQ1L 5E9DE 2FEJA 3D2UB 2HFGL 2WLMA 1AZUA 1F0LA 1QO3A 4Y19A 1GYVA 5HDLA 4AKQA 4ZO7A 3NZHH 1E8WA 1KBWA 4BQ9A 2HLAB 4J8RA 5BZDB 2Z31B 4B41A 3TEYA 2HXAA 3V0WH 4LBEA 2QPDB 1XSJA 5F7NC 1CT8A 4Y4KD 4JG1L 4C56B 3LMJL 3LKOB 5C0BD 2I9LA 2AEPH 4QEGA 1KB9K 5L2KB 4LLDB 3GSXA 3RNQA 5BOPA 3DXAB 4G42B 1JZ8A 2JJWA 1LK3L 4JFHE 1H3WM 1BQRA 1KEML 4YHZH 2KZ1B 5KVDE 4FNPA 3Q1SL 4RRPA 3HAEB 4JRFA 1PU0A 1OSPL 2E59A 3BUYA 3PAVA 4GP5B 3WS3A 2XY1A 3FT4A 1AD9A 1S7QB 3ARWA 4LNVA 3FONA 3MLZL 5A16A 5I6LA 4BYHA 4NP4H 4Z6AT 2H4EA 3BH8A 4W70A 4JFWA 4QRSB 3NZ8A 3QWOA 2IWKA 4UIKL 5DZAA 4FEIA 5EU7E 3MRCA 2ICEB 2X4TA 4AL8H 1BVNT 3DI2B 3WNIA 3K5RA 1NCUA 3HR5B 1CYWA 1FF5A 1Y6KR 4X6EB 4AY0A 3B9KA 2CRIA 4JFQA 2PNDA 3G3LA 4KAQL 4ZDHA 2GK0A 2XIIA 4LPCA 3EFDL 1M1XB 4QHMB 1TITA 3SGJC 2QSVA 4I1NB 4N90D 5I1LA 5LAXA 4Z7WE 4K3EL 3QG7L 3QNXB 4P2QA 4ZOAA 5GRXG 5HI3C 2X0VA 1CE6B 4JHWH 1A7OH 1D5IL 3GNMH 4N2FA 3FCBA 2OZNA 3DMMC 5B39B 4ODUB 2OCJA 1PZSA 1MFBH 1S7UB 4OZHB 2DWEB 2FJSA 4E9YA 4HK3N 3L5HA 3S37L 4NN5B 2DOCA 2WTRA 2FL5B 2GC7C 2I5YL 2K9FB 5F44A 1VZHA 3OHXC 4DGYH 1E4XI 4M62L 1QMUA 2BFGA 5EIIB 4RGNC 5CWSA 4I9XA 5KUKA 1FA4A 4IRZA 4WY7L 1A6AB 4YDNA 4JRYD 3SJVD 1MY5A 5I6KA 1UWXH 4OQTA 5EPMA 1OTTD 4Y88A 5KYWA 1U9KA 4GRWH 3VACA 2NW2B 3N1MC 2CJ3A 3MLXH 2IPKB 4YDMA 3VTMA 5JIMA 3BAEH 1LQSR 2Z92B 3U4EA 2O4EA 3LEVH 3UPAA 5CD5D 4OLWH 3QFGA 8CGTA 3RB5A 1LWHA 1R3JB 4N6QA 5C0EB 1VADB 3GSOA 1I7UB 5EF3A 5F6HI 2IQAA 1YPZA 3EFFA 3NEOA 3AGWA 4QRQA 1ML0A 1SEQH 3NH7L 3QDGA 4X5PA 1EVTC 4KGLA 3O4LE 3HPJB 5BV7C 5IUCA 2OK0H 4YIQB 4WFED 4UTCA 4F8TA 1T0MB 2EIKB 1YUHB 4I18C 3LV3A 3HMXL 4PJHA 5EU6A 2EDFA 4NBXB 4KQ4H 5CF3A 1BREA 1U58A 2UUDK 1EO8L 4J1UB 5J12C 5I17B 3W9DB 5BQ7A 2XV2A 4Z3TA 3NDYE 2H0EA 4MX7A 2YRZA 4PJIB 2P8LB 1IGIL 1MRDH 5AL0A 1NFDA 5CJ5A 1ZXQA 4XVJL 2AKRB 2JLPA 2PYEE 1CO1A 2XXMB 2DTMH 4IJ3C 1GSMA 3MV11 1N70A 4NN6B 3IDNA 4AC2A 4Q9QH 1ZLWH 2VDKB 1UACH 4KZCA 5TDPA 4R26L 2EUVA 4TL4A 3U9PL 3DX0A 1JGEB 3QPKA 1AANA 1C8PA 1N12A 1JNLH 4FN0A 4KXZI 2Z34A 1P7QD 1AXSB 2COQA 5FGSA 3BWUC 3O4OB 4GAFB 4FG6C 4F7EB 1FFQA 1MCQA 1XR9B 3DJZA 2B2XH 5EFIA 1I1YB 1E6OH 2WXLA 3D9AH 3CFUA 1G7HA 4PGDA 2AXGA 2H6UA 3T6WA 4WV1B 4Z95H 3W0WB 5I1HH 1MVYA 4LGSB 4F7PA 3KPSD 4FFVC 3D87B 2H32H 2B0SL 2KQNA 4EPSA 5L8KB 4ZFFB 4M4RA 2R4RH 5KSUB 4I9WE 5TQ2H 4MJIB 1R75A 3ZDZE 1K5NB 3UYRH 1JYNA 2RQEA 1GA2A 1KCSL 3ML9A 3WS6A 3DO7B 1ZHBB 3POHA 2QQNH 2R29A 2X9ZA 1IIIA 1A6WH 2DQTL 4Z7UE 3JYCA 5F7LB 2WZ0A 3R06B 5D1ZA 2UXTA 1KB5B 3ECUA 2O5ZH 4JGUA 2ZKWA 2DWSA 4HUXB 3I3DA 2O26U 2FDBP 3MGTA 4HHWA 2CGRH 1B3JA 4U6HB 3S88L 1SM3L 4F57H 3AMLA 2WQSA 2I25N 1IKNC 3PP3H 4GG6F 4WUUA 4ZQTA 2YUXA 3D5OF 1BZEA 3P0YL 3GRWA 1YC7A 2ARWA 5K39A 4ZTOH 3H55A 4N9GA 5GGQH 4ZW7A 5HHPB 1CLOH 2VXSL 4Y2DD 2Q10A 1OGAD 2BS8A 1MQKH 2AABL 2W9LA 4UCFA 3L7FA 4YBLC 4X9BA 1TU2B 2Z8WC 5FLUA 1QHOA 2PW1B 5DZVA 5K1NA 3QHFL 3SE4A 1TTRA 5BS0A 5GZOC 5HDBF 4PJDE 3VXOB 4X7TA 1XGYH 4AM0B 5IM7B 1LVEA 1L7TH 2PUQT 1EDYA 1LO0L 3RGVD 3U6RB 5F0MB 3VTTA 1TOXA 1XSOA 1CGSH 1O6TA 3V9FA 3WNOA 2BVYA 1HILB 3VGAC 5SWZA 5B3JF 4PCKA 4MQXC 3O45A 1JG9A 1LD9A 1Z5YD 4BDVB 1CDCA 4PFEA 1T2QH 1SLUA 2G75B 4RZCA 2WLHA 4ALAL 3BWUF 3ULUH 1KOAA 5ALCH 2OTUB 5BZWB 4N25A 2AJZB 2VLRD 3BSZL 3W9EA 3WHXA 4Z3IA 4G6MH 1AQMA 2WUCL 3B1UA 4PS4H 3VI3B 6PCYA 3AADB 1L9QA 5C0ND 1X6NA 3PGDB 1BD2B 2EAEA 3IDGA 3PWJA 4I8DA 4GG8A 1JERA 1XGRB 3L3GA 2XRAH 4I5BA 2J55A 1N0LB 2ZCKH 2N0MA 2VN7A 5D6DA 5F72S 5BNXD 1FH2A 3DOIA 4HWEL 2X7LB 4NCDA 1A6TA 2EE2A 2CIIA 2F54E 1E2ZA 1MW0A 2VERN 2AJVH 3FFOA 4HCRA 4EUPG 2H32A 4Z7QB 4MQ7A 1X5XA 4Y19D 2FWOA 4XMZA 2WIIB 2C26A 3HZVA 4K2UL 3WKNA 2FJFB 8PAZA 5FYLE 3ESOA 2EO1A 3ATBA 3FCTA 1MKFA 1JN6B 1BF8A 5JZ7C 2BOBB 4RA3A 5MENE 1BFVH 2IDTA 4JY5H 4OI8A 2A1WL 1IEBB 3LEXA 5ENWB 2FO4B 5D5MF 1SOQA 3MV9E 3BD5A 1AHKA 2ZUSA 3HI5L 1BJ1H 4PY8I 3FH5A 3FTZA 3K2UL 4ODBD 4MGXA 3FU0A 3JWDH 5D1QB 2F1EA 4NQTA 2CIKA 1E3XA 1URLA 4N28A 5E2UL 2Y72A 1E3FA 4HXAH 5LN8A 4WEEA 3D69B 1E5BA 3FRPG 5SX4I 3WEMA 4P04A 2I07B 1K4DB 4PG2A 4FKKA 4BD4A 2GJZB 2UZXA 1VHPA 4YXHL 3TCLB 5B38G 2HFTA 5TJWK 3B9KD 1ADQA 3Q8BA 3E2HB 3IXTA 1BVLA 2BVTA 2CDFB 3MRPA 3OXSA 4NQDB 1XIWD 2NW3B 1MCSA 5EBWB 3TNNB 1WUZA 2DIAA 4U6VL 1J11A 3F83A 3MGOB 2EDHA 4P2QD 1LILA 5DJXA 3UZVA 4U6YB 5IESH 5JIDA 3BFOA 3NA9L 4DVBB 2E86A 1KNOA 4CSTA 2F08A 3U0WH 3WL9A 2WBJB 1J9SA 1A4AA 2YRBA 3L4TA 1WA0X 3Q44A 4L3EB 3VYOA 4F15C 1OTSD 1CXLA 2DQHH 1VRSA 4W9HC 3GGWB 4F37F 1T1XB 1UWYA 4QXGL 2APXA 5F96H 1QZ1A 4F8NA 5JQIB 5AAMA 2XX1A 3CLFH 1HEJC 1AH1A 1AKPA 2BOCA 2K78A 3EYQC 4NNPL 1AHMA 4P23C 4ZS6C 4E41E 4AQAA 3IKCA 1MIEH 2FT6A 5GSRB 1GPOH 1Q9LA 1S7TB 2VDPL 5DRNB 2WVVA 3TYFB 3VD5A 4HPHA 4AC4A 3FB7B 1SJHA 4OF8A 4ZTPH 3UAJC 3QP3A 4TNEA 1FI8C 3H3KA 1EIBA 1PYWB 3WXWL 4MXWH 2IFGA 4MJ4A 2QADC 3FFCE 3TO4A 4DWHA 2DLGA 2CRMA 2PCPB 4UUJB 4BCZA 3BGFC 1IFHL 2WLLA 4L37A 3O3BA 4Y5YC 3N44B 5CP7A 2YPKB 4OIIH 1WAEA 1YLBB 1X6LA 1UH4A 2WQRA 5I23A 4N8UA 3QDGD 4AW4A 4AYID 2Y7NA 1U3HA 5DHEA 4B9YA 1AXIB 2XUWA 2CO2A 1O7DC 2DTSA 2BMKA 4CVUA 4MDJB 2X3BA 1RUKL 3RE0A 3O2WL 3NVQA 1E4KC 1J0ZA 2OL3A 1OAJA 5EU6D 1KPRB 1X4YA 4U1IA 4L8BA 5I1EL 5LGHL 2BIMA 3BXNA 1A3LH 3TEWA 4X9FA 2P9RA 3CLEH 5HJ3A 3C5ZA 4FYQA 1MCRA 3JT2A 4UQ2B 5J3HC 4G8GA 1P7HL 3SDAB 3WE6A 5CJXC 1FNHA 3PIQB 4AZUA 2JVUA 4MMYA 3GZPA 2G3NA 4JRXE 4RGOH 5E6IA 5KN5A 3DWTA 3RIKA 2QMJA 4S10A 1QSEA 1U93B 3HRZC 3LS5L 4YXKL 1C8QA 1FDLH 1T21B 3IF1A 4X8GA 5F9OH 43CAB 1JHLH 3RX8A 3F6LA 3DBSA 4AXWA 1GYAA 2HRGA 3H9SE 4X7SH 5ES4B 4ZI8A 4M7LH 4PBDA 1AP2A 4YHOH 3B2DC 4M8QA 1U92A 2QSQA 3ARRA 3DSNA 4WWPA 5B8CB 3KWUA 4L05A 3MLWH 5HVHB 3QUGA 4NO0A 4KTEH 4OM1L 1RZFL 3QC5X 1NEPA 1RJZA 1OIOA 3ES6A 2VW6A 1V7ML 1JF5A 3GIVA 3BH4A 5CJQH 5DMJB 1M3IA 5GISH 2V3FA 3ZDZB 4LRNL 1A1OA 1IE5A 4PTTA 4NHCL 3PHSA 4MD0B 5KVFH 2AV1B 2UWEB 3APFA 3QCVL 3TBSA 2VQ4A 2WLIB 1QHQA 4JN2B 4BK5C 3BP4A 3U2SB 4QYAA 3V7MA 3GXUB 4L4VE 2DM7A 4FXGA 3QS2A 5K5YA 3X13A 4K5PA 1ID2A 3IJ9A 3EBIA 4LNRA 2ZONA 1JHTB 1DZ0A 4PJXA 3FQXB 1NCWH 1ZTXL 2VJXA 5JIIA 4UQCA 3GMOB 4LIQE 5L4MA 3AITA 1QUPA 4KNUA 3MRJA 4NHUB 5D1ZD 1SXCA 4AV4A 4QKTA 1JWSB 1KPVB 4XT1C 3S34H 1KBGL 4AV5A 3FT2B 2YR3A 4UM9A 5GGSY 1NIFA 1TENA 2HN7B 5FB8B 3DI3B 4X7FC 1B6DA 2B4CC 2K8QA 5D72H 1M53A 1ILSA 1VFOA 3E6HA 4YHPB 4O4YL 3JUYA 5HYJB 1ZS8A 4MAZA 4RAVA 3TPUA 2CAKA 4D9LL 2UZYA 3OZKA 2YZ8A 3PXJA 3HG1E 5CR8A 2UX7A 1B9ZA 2AJYH 1UQSB 4HV8B 5IF0A 2XKNB 3GMLA 5FYJE 3DGGA 5BS0D 2ROXA 3EOBA 3PF2A 1XGZA 3QDME 4JG9A 4OF0A 4G83A 5E2WH 3L3JA 2OW7A 4MAYA 5CXPA 1GAFH 1UXMA 1DJWA 3KPRA 1J0YA 5KWYC 1SHMA 2O6CA 3ILPB 4LVNC 1GYCA 2WOBA 4BCYA 3AS3A 3P0VL 4XNMA 5FECA 4GKNB 2OMXA 3CC5A 3X12A 5I76B 3MJWA 2FZ3B 3GMMA 1NAKL 5HVWA 1ZLSL 4C83A 3OM3B 4JHVA 1PD0A 5FO8B 4OV6F 2N59A 3PE9A 4PJFA 3K7UA 4FFZA 1LEKB 5CFAA 4PIRF 3BCFA 4S1QL 4N1HB 4TVSa 4ACPA 5JPMC 1N26A 4JM2A 1BM3H 3MGAA 5BRPA 1I7ZA 1W0VA 1I53A 5HHXL 1HCFX 5E8EA 3WJMA 4EN3B 2HT4C 3GZOA 4HJJL 2XACC 4TVUA 2Y1VA 3OKDB 4HXBL 1AOZA 3IEAA 3WGUB 4NB7A 1B4RA 1R3HA 1V7NH 1JTOA 4Y5VC 4FQCH 5INCA 1LQBC 1E4XL 2IALB 2FQDA 2W0LA 2D3LA 4KTGA 2P4AB 3ZKNC 4MHHI 4XOBA 1Q90A 3X3FH 4K73A 3L5XL 3QIWB 1NPNA 2IG2H 3MV9B 4M3JA 5FAAA 3QUYB 4QHPA 4GT0A 1CD1B 5CEXB 1T89C 3QSKB 5KSAB 1WP6A 1D7CA 3HE6A 2PPDA 4F7TB 2PXYB 5DGRA 4O58H 3BP5A 4TNVF 5CP3A 5IQ9A 2AK4B 5ABZA 2YC1B 4WDIA 3S6CA 3S7GA 5DRWA 3NACH 4JPWL 4N1EA 5ICUA 5F7EL 3T6VA 3VI4F 3TWYA 2WVSA 4JUSA 4UAOB 4YXLL 1KCUL 4XNQA 3P77A 3KHQA 4OGXL 5C7XL 3HZMB 5CIPA 3ARFA 3UGUA 1WBYB 1DQML 4HBCH 4FJZA 1AMYA 1GR7A 3EGXB 5E2TL 4G9FA 2D8KA 3B4NA 5C0GB 4CGTA 2K3HA 5KVEL 3PNWB 1KWGA 4X6DE 2XVGA 1DUYB 4Y4KC 2GI7A 4KH2A 4ZQKB 4OJFL 2PWDA 4UM8B 1D9KB 3IBEA 5HSFA 3CUPB 2W0FB 1SEBB 1ZJBA 2JIXD 1RK0A 2PYFA 5J57B 1R24B 3PQYA 4OBSA 4F9LA 4NN7B 5I74B 4LCCC 1U8NA 1WTGT 4QR7A 3VXSE 1E9PA 1GJWA 4A7VA 3ZW3A 1U8IA 1DVXA 2PCFA 3IE4A 1LK2B 4JQVA 2VXTL 1CWVA 3LQAL 3FL7A 5JOFB 1Z3RA 4U1JA 3EOAA 3O6ML 4LSVH 4FQPA 4WSKA 4E41B 4NPYA 1IQWL 2X6BA 3P0GB 1FNLA 3L2MA 4ZFOB 1CDBA 1PKQE 1UCTA 3V6OA 3D3VB 1J9QA 3ULUD 3MBXH 4FFTA 3H7LA 2BVUA 3T2LA 3X1EA 4K0OA 4TMPA 2VL5A 5JTWA 2HG5B 2MIZA 3PUUA 4UINH 4OJCA 3NGBC 4TQEL 3UTZB 2QLVB 2XQBL 3EGSA 2DH2A 1BXAA 4WWKA 5DK0A 2C9UA 2UZIL 1JFQH 1RZJH 4Y9BA 1PLGH 3WMPA 3JTTB 3TO4D 1ZE3C 3WIHA 5J8OA 3MNWA 3MV7A 1TYEB 1KT2A 1R1CA 3FQ2A 5ANME 3ZE2F 3NTCH 5IKCB 1SXNA 1FLTX 3UTTB 5FWRA 3S5YA 2KPWA 2H1PH 5JLZA 3ASNB 2OJZH 3HE7A 3FUHA 2Z93A 4G6KH 4XPBL 4LPUA 3V4PA 1OTTC 2YO3A 4NRYA 4W6XB 1WDAA 1JPSH 4DESA 2V5YA 5F7BA 3JTSA 1IM9B 3ARPA 3C5ZD 5T33L 1NKOA 2DQDH 4KY1H 4G8GD 5HDQL 4PJBF 1WBXB 3H9SB 3ARDC 5CD5C 4XH2B 3MCG1 5BVJB 4LFHG 2B59A 3FQNA 1EMTL 3QQ3B 1I8KA 5E6ID 3VRJB 4Z7NB 1J9TA 5ICYB 4FZ8H 5F3FA 1FIGL 1QSED 4Z77B 2EVFA 2ZOLA 1YYCA 2VO8A 1QSFA 1FYTA 3QIUB 3UJIH 3U2JA 1NICA 1TVHB 4PJGE 2PETA 1XF3B 2IPTH 4NRZA 4LARL 2ADJB 2VM3A 4EZJA 3NABL 5EZIL 5I1JH 1BWMA 2EQDA 2LAGB 3QEQD 4NO0D 1U8PA 3LN9A 1C16B 4CN1A 4ATWA 4O51A 3T0AA 1V54B 3RUGA 3HB3D 4L4VB 4PRIB 2FWUA 3ZT7A 2DEWX 2XZZA 1SYVB 4RDQF 2BRRL 4PUBL 2DL9A 5DC4B 5FYKH 1N5YH 1G7IB 1JZ4A 5B38B 2HVBA 3PP4L 4JHAL 4YX2H 4ZMVA 2D2CC 3P2DA 4AMXA 2DQFB 1BOYA 4UDUB 4MNGB 2JKSA 5DHYB 1NOLA 1YDPA 2ZCLH 3BIKB 4GYBA 1CZ8L 2JJSC 3EIFA 3MRNA 3N9GL 4HAGA 4XP5H 3EOYG 1KIPB 2DQUL 1YHPA 2WVTA 4NJ9H 5MEOA 2B9BA 3OKYA 1B3IA 4DP5X 3VM7A 1RSFA 1HJCA 1DDHB 3Q8FA 1BIIA 3VXRA 5DTFB 1I9JH 4U7MA 1ONQA 3TJHD 2KKQA 1F4HA 1R3IL 4RISH 5T3XD 2P8PA 4UM9D 1PTZA 3BVUA 3WTTA 3L1OL 3ARZA 3WKML 5HHNB 2A9CA 3CFDA 4JUTA 1CLCA 4XCFL 5FUZL 1HS6A 1SOSA 2FX9L 4L0PB 4BWWA 1HQ4B 2E76C 5EU3A 1S7VA 4TOYL 1FSKC 2NXYD 4BFOA 4P2RE 5DXWA 3S35H 1ACYH 4O2CB 4NAJA 1KGYE 2EDYA 3ZDYE 4ELMA 1ILUA 1MUJA 3S2AA 4I4WA 2VXQA 1EHLH 1EXUA 4E9WA 2X2HA 5EDXA 2VGLM 4WU5A 4PJEE 1F4AA 5DT1H 1PZUB 5HHOD 2MCPL 1IC4L 1INEH 2VDRH 1D6VL 4MAYD 4WJ5A 2WK2A 5E5MB 3WFBL 4S0HA 1Z32X 5D7JA 1XBRA 2R8SL 3EYFB 3KPRD 1BW8A 1MPAL 1RJLB 4JRWA 4MVBD 4NERA 3TLRA 3WY4A 4B0MB 3EG9A 3QH3B 2K4AA 3ZKSD 5IB3B 2E75C 3CC1A 5F70A 5IHUL 5IMOA 3L95A 3DPBB 1N7ML 1NWPA 3FSOA 3L3IB 5CKAA 1MHEA 1XL4A 4HPYL 5EOTA 3FF7A 5PAZA 5KVMC 2XC8A 3KGRA 1NIDA 2EDNA 1U21A 3BWZA 3OHXB 2XA8H 2EEBA 2IDUA 2FGWL 3VM5A 2WKOF 4RGNB 4NI3A 1DSYA 2GYSA 4Y1TA 2R83A 4V1DE 1UXLA 2CO6A 4LCYB 3Q48A 4F58H 1ES0B 4L1HA 3MJ9L 1G0XA 2BSSA 2OSYA 2W9EL 4BSWA 2Z8SA 4F93B 2EIDA 4FQ2H 5I8OL 4JM2D 3MYJA 1HAWA 2E4FA 1E4HA 1KGJA 3LRLA 3CFEA 2FB4H 3WIIL 2XVBA 3GMNB 2D0HA 3RGVC 3TBWA 3ZTNL 2PWEA 1RH8A 3SPGA 1UM6L 3NCJL 2P5EE 2JTDA 1XD0A 5CINL 5IHZB 1U8LB 4GG6B 3ME0B 4XNDA 4KZDH 5DYOA 1BZ7A 4WW1B 4AGOA 1S6NA 3G5ZA 3VG9C 1ID5I 4LSTH 1PNCA 4LAQH 4DERA 5GGTA 3RDJA 4JPKH 3T8VA 3HZYA 4G1MA 4KNQA 3UJJL 3D39B 3OKEA 5H37G 1RFDL 3IJSB 4B53A 2GHWB 3MBEB 1Q72L 4JO3L 5JW4Q 1T5XB 2DY2A 2FYYB 5J12B 1RLBA 3WFDH 2NY1C 3NSDA 3HE6D 5I16B 3EJJX 2NTFB 3VW3H 1RPQA 1RZPA 1AYRA 4NO3A 2DN7A 4PJ5B 2YA0A 5DRZB 4PG9B 7CGTA 3KYOB 5KYYB 3B83A 4X6FB 5IG7B 5IGXH 5J1AA 2CLZA 3MOBL 4ZPTB 5ALBL 2CDEA 3JZYA 3RKPA 3AY4C 1DL7L 2VISB 1FFNA 2IH1A 3ARFD 4GAYA 3BVDB 4R90L 4N5ED 2Y3AA 3ROLA 1ORQA 1I8AA 1PDKB 2FUTA 1JHKL 1KCBA 1NCDH 2GABA 2Y3NA 3DOSB 3GBMH 2C8NA 4HIXH 1WFUA 2A83A 4UILL 3RAJL 5DRXB 3T04D 3VD3A 4BKTC 4G9FD 3B7TA 3IJHB 4XHJD 4D0BA 3D12B 5DDHA 1TTCA 3BDYL 1HWGB 3BLKA 3KAAA 3QO0B 2B3IA 3OR7A 3L3HB 2EADA 4N2EA 4XN8A 3UFIA 1MEXL 5I0YA 2JKIS 3PQYD 4IHOB 2VLJB 1MFVA 2Y07L 1CFNB 1EGJH 4OJDH 5I8KH 4F5CA 4XPTL 3KBEA 1ETJA 1IGFL 5HTSA 1TMQA 1XGPA 2QHLA 4MBRA 5SX5K 3IDMA 5L7XL 3QR2A 4HGWA 1DVFA 2HJFA 5I0ZA 4IDJH 4MD4A 3OQ3B 1ZHLA 1IC1A 5I1CH 1RVFH 3ARBA 4EXKA 1U8MA 5F0JB 5BO1L 3KJ6H 3WFEH 5AW4B 3ULAB 1HXKA 1J48A 3SGDI 4B3EA 1G0YR 3JWNH 4N6RA 3FO1B 4IBVA 4H5SB 3NIGB 4MZ3A 1OGSA 4JY4A 4PN6A 4F27A 3ZK0A 4BFBD 4KRPD 5JHLL 2DQ6A 2FH8A 1T0PB 2YLHA 5F1NB 4XC1L 3V5KA 2QQQA 1KFGA 4ZTEA 5DJ0A 4ETYA 1AJ7L 2VXUL 4KGJA 1OW0A 5FO9B 4MS8D 5A6IA 4HIJA 3ASOB 3QRGL 4POUB 4XNXH 1CXKA 3U7WL 3F04A 4WWKD 1R46A 3GXNA 2IANE 4ETQA 1XH0A 4LDOB 4N8VA 1J5DA 1LP9F 1KUMA 2WQWA 1QQDB 4KKRA 3C9NB 3W3BA 5IT2H 4XNUL 1OTSC 4J3VA 4BELD 3T4AA 3MV7D 4IBWA 3HHRB 3MBWA 1A9BA 4QRRD 5T3ZH 4HEPA 3TN0A 1C5DA 2HJKA 4KK9D 4FI7A 4FERA 3VFGL 3MRDA 4JZJB 3AU1A 4YHLL 3HE7D 3O6LL 4OCSL 5DO8A 2J2ZB 3QYCA 4XMTA 1TQSA 4M7LT 3GRBA 4XI5D 3RWDB 1I1AA 2F18A 4M61A 4MNQA 3U36A 4NNYA 1BAFL 4G3YH 1HH9B 2NDFA 3QNZB 4IU2A 4R3SA 1RJYB 1LEGB 4CW1A 2PP8A 2CK0L 2NY4B 4WKZA 3U1SH 3O3EB 3VGAB 1OCRB 2I69A 4PS3A 4LLVA 1FZMB 1PX4A 1J1PL 4PJGB 4H8WL 3TCTA 3GINA 2WSDA 5CJ8A 2A38A 5I1AB 2BP5M 5TH2A 3ZYJA 4Z7UF 3MN8A 4XO4A 1G7PA 4XXDB 3CPUA 3LSOB 1WBZB 1QSFD 4NOBA 3L8QA 3IJEA 1FYTD 4H88L 3T0EE 5DJ2B 2AJ3B 1ESOA 2ZXEB 3H0TB 2NT1A 1AY1L 3UTSB 4U49A 3DDGA 4DP6X 1FZJB 1SQ2N 3PG2A 5CMAB 4K3JL 1FO0B 5FHAH 1QACA 3BT0A 5CSBA 2OMWA 5C08E 3SDYL 2JCCB 4OLZL 4DAGH 3IN0A 4P57B 1AQHA 2IADA 1KTDA 4FG0A 3TGXA 8FABB 5SV3A 1F4YH 3OKOB 4QRFA 1BFTA 4PWKA 1M4KA 1TETL 4GAJL 1AZZC 1K72A 2WBKA 3LNIA 4G8EB 3KL5A 4ICXA 1MNUH 4H25B 3K2IA 1IBYA 2PR4L 2QPFA 4OKVB 5E94B 4MTMA 1BJ8A 2G2RA 4ES8A 5J0BA 3MHZA 5TTRA 4PWFA 3AT8A 1AQKH 5TDNB 2Y2WA 1EO5A 4AL8C 1F58H 5DK2A 5EO9A 4D0CA 3RWJA 1RIHL 3L5WB 2X6VA 3REWA 2WXHA 5I30L 5AOIA 3RTQB 1Y18B 2XWCA 1ZANH 2ZJSH 2NR6A 5HHQA 2A9ML 2F8VA 4K8RD 2VUKA 3U4BL 4ZMPA 1ZEAL 3DKHA 3F01A 2XFXA 4QT5A 3VXRD 4P5TA 2DMKA 4K7PY 2WINB 3C8DA 1GZPB 5KYXB 3R0MA 2X5PA 2KBGA 3D07A 4P9HL 3DX1A 5I8EB 1QEXA 2YD1A 1U8CA 1TJHH 2CUHA 3SBQA 4XP9H 3V0DA 2E7BA 3WCYA 4P2OA 1DBKL 4PJ7B 2WP3O 4BZ2A 2K7QA 4LSUH 3WS6C 4FYRA 3TBVA 1L3NA 3MOAH 4LSSH 4M43L 4B9JA 3SD2A 4W9JC 3MLPA 2MJWA 5CHNA 3LRKA 3U46A 5KVGE 4O02B 1HYSD 1CFQA 1Q38A 1HSAB 3H42H 5ESAA 3QJZA 4KVNH 2ICCA 4PB9L 1KXTB 2VDQB 1IZJA 2BW4A 5D7JD 3QDJE 5LGYA 3BYYA 4RBPH 2R1XB 1JZ3A 2XICA 5TPWH 4F15B 3RA7L 1T1WA 1NPUA 1VCBC 3UTOA 4PLKD 4C54A 1B0RB 1IJNA 4Y2OA 1VGKB 1KYAA 3WY3A 3GFUA 2IOIA 2Q7AA 2PTVA 1AGDA 3ASWA 5FM8A 3PREA 3GXMA 3K6FA 1AS8A 1NGXB 4U1SB 4P23B 5BV7L 3ILDA 3ZZ1A 5C0JA 3UAEA 1A1NA 3SE4C 1S5IL 4CKQA 1U4EA 3CN1A 3DUUA 2D4DA 5GRUL 2HRPH 1A65A 1CVSC 2Y24A 1MHCB 3B3IA 1YNLL 3DVNB 3TWCL 4LVOC 1E67A 2IH8A 3SDXA 3HTLX 4PR5A 1XGUB 3WHE0 2H0JA 3BGMA 5B7EA 3FF8A 2A6IB 4IIQB 3BGFB 4JDZB 1BMGA 3TJEH 1LDPH 4Y5YB 1PF3A 4PGBA 4LT7A 5EO0A 1K8DB 4XO8A 2GTZB 1CQYA 3RX5A 1OM3H 4PP2B 5I75C 2BNQE 4RQQB 4CDGC 4IBTA 3CBKB 3CSTA 3IETB 4MWFA 4S0TD 1DTUA 5AOMA 1TDQA 2BVOB 1IGML 4HD9A 4PWGA 3L17A 4GOSA 4YWGH 1OALA 3AG2B 3HBZA 1P1ZB 2YBGA 3MOQA 4TYUA 1V27A 4NZRL 3RWGA 1R3KA 1YZZA 2WWMD 2WXOA 3PHOB 4FGMA 3UGEA 4J39A 3S9DB 4JRYE 1FL3A 5D6DC 4PJCA 2YXWA 3ISWA 5DJCA 5ICXB 3IAQA 3UO1L 1PQZA 5F8QC 1MJUH 1N0XL 3HRZB 5C0FB 1NWOA 5DHDA 5HGAB 2F53A 4X4ME 3LRHA 3MCLH 3VFWA 1YYMH 1YMME 1H8OA 4P8QA 4A7UA 4F2MA 2XV0A 4K3DH 3HC3H 3GMPA 4ICWA 4OD2B 4F3FB 1PFOA 3GO1L 3D25A 1NEUA 3IWUA 4ZFOL 1YY8A 3BZFA 1L5GB 1I8MB 3GI9L 2CMRH 4YUEH 5BJTA 4LEEA 1P84K 4BWUA 3CZEA 4A2MA 2VR6A 5SX5H 3CH8A 4KKNA 1XCQA 4RAUA 3EW3B 2EH8H 3RWFA 1DE4B 5JXEC 1GC1H 2X4UB 4AQEB 4YSUA 1N19A 4O2EA 1L7IH 4R4FL 1XTLA 4PGEA 5EZOH 3H7BB 5CEZD 4H1LG 5F88A 4WI0A 1LYQA 2M2DA 4ANXA 4KNTA 4ZO9A 2Y5QA 1DVFD 1IZKA 3HKFA 4GB9A 4UOJA 1RLWA 4ENZA 2Q8BH 4E68A 1J88A 2NY5C 3FB6B 4OT1L 3ARBD 4AYSA 5CD3B 2X4QA 4QXTA 4MB1A 2WJ7A 2ARJA 4HJ0D 3NEXA 2QSTA 4PG2C 2JJUA 3P4NB 3G6DL 2W65B 2QLYA 1PMYA 3CN2A 5LNEA 1HHKA 4NQEE 1JZDC 5BRZA 3WNKA 3QXVA 2H6PB 4UQAA 1ZPLA 1BGXL 2APWA 5HPMB 4TVPE 4AYFB 1LWRA 4O4YH 4B9FA 4IKNA 5BVPL 3COOA 3P3UA 2GPZA 1A7PL 3QUMB 2OI9C 2P47B 4FQJL 2AQQA 2GC4C 3D08A 3FOLA 1GH7A 3LDBC 4L5FL 1K2DB 2X6MA 1A3ZA 2H3XC 4G7YH 4RRPG 4PRPB 4MA8L 1R3LA 4LPXA 2GSIA 1JPST 3HC4L 2XA3A 4LOVA 1UB5B 2CKBA 2J20A 4F1ZA 1B88A 1DQVA 2YMOA 4S1DC 3RTLA 4YHNA 3TN0D 1G9NC 5AAMC 3L9RA 4EN2A 1IEAB 1MWAA 1OSYA 3U25A 4QHKJ 1AS7A 3H56A 2YS4A 4DKFL 2WGNB 4NIKB 4LVNB 3RLSA 1FC1A 4KMLB 1I1AD 2N7SA 4MNQD 3SQRA 4U1HA 4CKVX 3W81A 3MLRH 3VG0L 1SYSB 2KT6A 3WIAA 4BSVB 5IVXA 1GOHA 2J5LC 3IRZA 2K0RA 3FHQA 1J0HA 1QFUH 3DOHA 4DUVA 5DC9B 2HFEB 4DHLA 4M03A 1WFOA 2WW8A 4QY8A 1DQLL 2MTPA 3TESA 2YSSB 4FFWD 4LIQL 3PL6B 3TO4C 3VD9A 1P5UA 2NY2D 4M6ML 1AS6A 4K71B 1E6JH 4FXKA 5I1GH 4NQSA 1BFOB 3F6JA 1QOKA 4FHJA 1PY0A 5DS8B 2X12A 4PV9B 4YNYB 1OKEA 5JPMB 5SWSE 3QARA 1S7SA 3V0VA 5T5FL 3T65A 1U3HC 1GCYA 5LG1A 2QGEA 5I0VA 3FQ4A 1G6RH 3BH9B 4JFXB 5HJGA 3LN5B 2NY3C 3QFDB 4HX1B 3E9TA 1PZ2A 1G9MH 1F90L 4H26B 4F2FA 2J4WH 2H26B 3BAIA 3C5ZC 1FAIH 4WSJA 3VWJD 1IC7H 4K94H 2P8MA 5CZVH 5LO7A 5FYJL 4R5TA 2AEQH 5E5RB 3ZDXB 5E6IC 1GS8A 1OK0A 5B21A 2H5UA 3B1TA 1DUZA 1FRGH 2DYPA 4YDKL 1B4JL 1FGNH 3X17A 3K6OA 3DX2A 1DSFL 5I82A 4LMQI 4Q89A 1U3YA 1PAMA 2GJ6E 1L9OA 3BEVA 4P2CG 5LNGA 1I9RL 2NR6D 1T83A 4C47A 2JELH 4XN9A 3BJ91 1VEPA 3MA9H 1YYLL 4HIHA 4AYBA 4DGIL 1XBDA 4LLUA 4K7PX 5J9PB 3TIEB 4PD4J 4I0PA 2C1PA 4P5TD 4WEMB 2ITDB 2P45B 4OCWH 2OXGA 2BZCA 5E0FA 3O2DH 3NT0A 1RZQA 3F7QA 4OUUA 4PJBB 5IY5B 3OZ9L 3T3PB 3SDCA 5DJAA 4MNHA 2X4RA 4Y4KB 1HZLA 1PBYA 3LIZH 4OD3L 2GT9B 4FXGC 4ZW5A 5J6HA 4P2OD 1ECZA 2BVPB 4HKBB 5T3ZD 2YAHA 4YDIL 1RZIA 1HKLH 4LCCB 4GPVA 4X50A 4GO9A 1KIQA 4XVOA 4ATTA 2A74A 1UTDA 5AB9A 1RQ5A 5CBAB 5LXGH 2NOYA 2F19H 3U4AA 3ECQA 3BE1H 4EIZC 5BUAA 4P5MB 2FATH 2HX9A 4FQHB 3J7HA 1JPFA 5B1JA 1AFVL 5FGRA 3TJHC 1NEZB 5GS1A 1KDIA 2ATPB 4KXZH 3ZRSA 3DV6B 1TPXC 1VACA 3HHMA 3QULB 1ZVYA 1A7QL 4YGAB 2A9AA 4L4JA 2P80A 4MXVF 4V2CB 2GEEA 1KY7A 2R4SH 3BWSA 4OIAA 3EF4A 1P1VA 3FT3A 5ISZA 1GSKA 3ARVA 4QYOB 2EECA 4N4YB 3HHSA 2XWJA 2NXYC 3I6LE 2J3SA 2V5RA 1NBVH 2X2YA 3BSHA 1R0AL 4MRBA 4LU5H 4X5QA 1EQWA 4R9HA 1ZJAA 1REIA 3NGBB 1UADC 2MWCA 3MODH 3ZQ9A 4MCYB 2OJEB 5DWUH 3QJOA 4L8DB 1G6RA 1AGEA 2VUYA 4MAYC 4XN4A 1SY6L 4X99B 3ZKQD 4BGLA 4IU3B 2Q6WA 2W59A 3T3MF 1EJOL 3OC8A 2VDKH 1T2XA 4MVBC 3C8KB 4PI0A 4AUYA 2G9KA 4F80A 1AQ8A 3LEYL 3I6GB 3GSUA 3BP6B 4S2SA 2ROYA 4X6DF 1VPOL 1Z9OA 1ZT7A 1J5OL 4PTUA 1PCXA 4MJ5B 3RZCA 1DJYA 4IMLA 1A4CA 1JZ7A 2V9TA 1MELA 2DDQH 4ANVA 1EAPB 1KJ2H 2DD8L 1F4XL 1XH3A 3F00A 3GPSA 3NRPA 3S3JA 3D7PA 4NS0A 1BXVA 4JRYB 3SJVB 1ET8A 3MUY1 3P4MB 2WZ6A 4L4TE 4TNWF 4FKHA 2VWEE 4JM2C 4XVUD 3MUGA 5E2JA 1ETZB 2V2XA 1IIKA 3QE5A 3THMH 4JJ5B 2C3XA 1CR9L 2PTTB 3EAKA 3BKYL 4ZUTB 3DYPA 3FTGA 1AO7A 3FSZA 4JFEA 3V79C 3WTUA 1HEZB 1J5CA 4GXUM 5J13B 3LKRA 5KTEH 5AYUH 1N6QL 3O2DA 3HNVL 4Y8AA 2F53D 3E7JA 1GGCH 1WEJH 1KB5H 4DJMA 5FFLA 5DJYA 1GTNA 5GIRA 2AEOA 4YAQB 3LIZA 4ZK8A 5AW5B 4D9RD 4KFMA 1S7WA 4HWBL 5AKVA 3FZUD 2J6EH 5BO0D 5D2NE 2FWSA 2BDNL 2EDWA 4M6AA 2BZ7A 3ZT6A 3QDGE 4X7EC 3BRDA 4K9EH 3HE6C 4IBUA 4Z9KB 4JHAH 1J8KA 2XWRA 4X6BA 1KENL 1A6UL 3FN9A 2EUXA 3TNMB 5I1KL 3CXDH 3MJ6A 3VFSA 3NN8A 3TZVC 3RVXD 3BWAA 3IU3A 4DKTA 1HI6A 3EGDA 3WEBA 2KLTA 3ARFC 4FL4B 1P7KA 5BUGA 4NQEB 1BMZA 4A6YB 2IC2A 4WKXA 4L3CA 2CRYA 2CJSA 3KG5A 1S9VB 1SMOA 2CLVA 2Z7ZA 3WXVH 4NWUL 1O9VA 1P6AB 3HLAA 3MFGB 4Q4EA 1UWEL 3GJFH 1P7QB 4L18A 4HDIB 1ZHNB 1PNDA 2VB5A 3AC0A 3GB7A 5GS0D 4QRAA 1FWXA 5BRZD 3MA7B 2EVIA 2C4FU 2MPAL 4F9LC 3DJRA 4LHJB 3RL1A 3WKMH 1Z9LA 5E4AA 1XXDC 2CWRA 2DYRB 4XP1L 25C8H 1U8QB 4FMVA 4CBPA 3UC0L 2R0KH 2XPYA 4X7DC 3HZKA 5J1SC 3DPDA 4N8CH 2JB5L 3M46A 5GHWL 3S5LG 1JPEA 2APTA 3P11H 1MFEL 1F3DJ 5AENA 1FSKB 2N1TE 2R1WB 4ZXBA 5HJBA 4YVNA 4A2EA 2GFBB 5HGHB 3NOIA 2RH0A 3LZFL 3OGCB 5EN2B 3I9GH 1IAMA 1KJ2A 4UB0L 3V5DA 1WD8A 3VTAA 3V6OC 4UDTB 1NUGA 5I28A 5CZXD 4JHUA 1PZBA 4KRPC 4Y5XA 5CJOH 4CU8A 3E8UL 1AIFA 4DKEH 3U0TB 1FO0L 2VQ1A 1UJTA 2CJUH 3S4SG 4I77H 4PWHA 5MI0B 1L6XA 2BWIA 2ZOKA 4MS8C 3GSNH 2IXQA 4KJQD 3HIZA 2VDML 4FMFA 3P3SA 4H4NA 1D2PA 1ERNA 5DEFA 3VFRA 3P4OA 3OC5A 4Y2DB 2LU4A 4GRWE 1UT9A 1OGAB 1MJJB 1O7VA 1ZPUA 2R56H 3SKMA 3X1BA 4ZMNA 4OF7A 3OAYH 3VXQB 1HSBA 4ZG1A 3NZSA 3ATAA 3BCDA 3OKKB 2ZUTA 4IMKA 3ZIMA 3X2QB 3P9LA 4GSRA 4JQXA 4XP4H 2N01B 3I02B 2YK1H 3FQWA 1T20B 1E5UI 3VFVB 4KK9C 4ZSOB 2EDKA 2VZVA 3S48A 3HE7C 1CFVH 4X4XA 3I50H 5IQLA 3C5XA 2YSTA 4XI5C 2IFFH 3M17B 2AITA 3RGVB 4X0KB 1XVSA 5IW3A 2ZKYA 1GTFA 2F6AA 2HA1A 1NIEA 5B3SB 1K5WA 1COBA 4L29B 4GRLA 4FQIL 5IB2B 1WC7B 3QJVB 1K8IA 3CLWA 3C2AL 4OGYL 4XWGH 5AOJA 2ADFL 3BPOB 3B6SB 2XZQL 3S3PA 4TRPL 3IGKA 4XPAH 4LLWB 4GI8A 1I3UA 5EH1A 2DYPD 1KXVA 1CGWA 1S7XA 3LXCA 4ZFZB 2A3TA 1KBBA 3H9HA 3FMGL 1D5MA 1A2YA 2CD0A 4M6NL 5E9AA 4AIXA 4N1CA 3LPPA 4ENED 4O02L 3T71A 3QJHA 2Y36H 2GTWA 3PABB 3BYTA 1VB9A 1U4FA 2YIHA 1RAMA 3OPUA 3H2QA 4I0PD 1QO3B 5E8DH 2EXSA 4Y19B 3IYLW 2CUAA 1J18A 3QZWB 3MUJA 5DJ8A 4QI3A 1DVQA 5MP6L 2UY7A 2ZWSA 4J8RB 5F3HA 1FE8L 2HAZA 1YJDL 4LBEB 3SDCD 1CT8B 4XPHL 3CXHJ 2Y07H 1U95A 3VFMA 1G9EA 5A7BA 3WDIA 1H6TA 1IBGH 1BZ9A 5EORH 4ZX5A 2X70A 1U8KA 3OSKA 3T0WA 3FTSA 3ZO9A 3AZUA 3MSPA 5AOLA 1B2WL 4HUUA 3GSXB 3RNQB 3TU6A 5E70A 4KXDA 5D1XA 5DHVH 2YD4A 5D4IA 1BYPA 3DRQA 1J9RA 2UVFA 1J12A 1OM9A 1TQBB 4BFKA 5BPPA 1DFXA 2AAAA 4K8RC 2DMBA 1D3CA 1CFMA 1IAII 1J86A 1ZHKB 3BUYB 4B7LA 5AG8A 1JJUA 2Y6SD 3WS3B 3FT4B 1QLRA 1YMHA 2NNAB 2VN6A 2Q76A 2D7TH 1MCEA 5AAWA 5A16B 4DP4X 2EE6A 2HUEA 3BH8B 4FADA 1PG7X 3N42B 4KPHL 5DLMH 1JF1A 4P3DA 2P80D 3RI5K 3TBBA 1CK0L 2HTKD 4UT9H 3MRCB 4WQOA 5ISZD 2ZX7A 1WLHA 3VH8B 4ADIA 3B9KB 4JFQB 3DVFA 1WK0A 3BIAX 4ODVH 4ZDHB 2GK0B 2X1WL 1NDGA 4JY6A 3ESNA 1XIWB 4AYEC 5IQ7L 5I1LB 5LAXB 2G2PA 3JWOL 4XX5A 3AS1A 4DKAA 2C34A 4P2QB 1P2CB 3GXIA 4WIQA 3W57A 1ZV9A 5D7JC 4XPFL 2O93L 1NJ9A 2X2IA 1KBKA 5AKSA 5DFVD 1Z9PA 4FFYH 5T1DL 1N4XL 5IHBA 1IGYA 5ILTL 4XBGA 4NFCA 4H13C 2YGNA 3KPOA 3IJYA 2WQ8A 1KWKA 3RZCD 1RULL 2AXHA 4PRDA 2AXFB 2WTRB 4F7MA 1U36A 3T77A 2YAOA 3VU2A 4KDWA 5CWSB 1FBIL 4EMZA 3PAZA 1OO2A 2EDOA 4ACTA 4M00A 1FNSH 4LPYA 1ACXA 5JHDA 1NC4A 4K23H 2FAUA 4EQ2A 1TVBB 2GJJA 1RIUL 1OT2A 2VLKE 3RUGF 5KYWB 3PWPA 1R4XA 4TV3A 2GCYA 3IFOA 4A2HA 3CDYA 4S1SL 3U4EB 4KOBA 3KPNB 1DQTA 3HG2A 3VRIB 5FCUL 4PJ9A 2J44A 4N2LA 3A4AA 2CHXA 1AO7D 1CYGA 2X0UA 2XTJD 3APCA 3L3KA 3WFCH 4JFED 2QJDA 1FORH 3CFCL 3O2VH 1L9SA 3GSOB 3BISA 4WRLA 4AOFA 4GKSA 1IUZA 1YPZB 3EFFB 3QS3A 1MAJA 4GQ9H 4ZMLA 4QRQB 1SLWA 2CG9X 3QDGB 1C12A 1FGVH 4Z7VE 3TT3H 1BMWA 1LNUA 3KXFE 4MYPA 3CDGA 1BECA 4ZZFA 1OEZW 2J71A 3UBXA 4HWUA 3LV3B 2Z0BA 1PCSA 4PJHB 5C0CA 4JQIH 5EU6B 3SYAA 5ID1A 4LO9A 1U58B 2H1LM 4A2FA 5AW9B 2WWMC 1CE1H 1Y07A 1ET5A 4MX7B 3SKNA 2E7HA 1XT5A 3PJLA 5TE6L 5BMFL 1NFDB 1M3JA 3BKCL 3OPZH 3CFJA 5I30H 1TCRB 2VDLL 4G8GE 4UI2A 2BSTA 1DJHA 2EDXA 4ELMF 2CA3A 5PCYA 1VZIA 3L5IA 4HSQA 5TK2A 4N3UA 1MZZA 2BNRA 5DZPA 4NWTL 1KY6A 1R5VA 1TQCC 3L4XA 1QVOA 2AW2A 4WO4A 1JGDA 2WKLA 4P9HH 3SOBL 3HN5A 5EFIB 5FWQA 5FX3A 1G7HB 4PGDB 4AQ1A 4E5XA 1W72H 1HIMH 4DN3L 4F7PB 4AIOA 1URIA 3QEQE 1E50A 4OZFA 1RZKL 2AVGA 3INUH 4D7BA 4FFYA 1DVFC 3AWGA 1JCVA 4JO5A 4JO2H 4M4RB 4WI5A 3ZMRA 2WUBL 4I2XA 2BOLA 2WIMA 3RVUD 3FFDA 4KU1A 1S3KH 3ECWA 3ARBC 1N67A 3EFOA 1TTBA 1YEFH 3FB5A 4JCLA 4ZXBD 3OKLA 4HJ0C 4JW3A 3PLYA 2QSCL 3B2VL 4FNQA 3Q2NA 1YEKH 4FHBD 1ZOXA 4H20L 3ULVE 5D1ZB 4JFYA 4M7KH 4WNJA 1C1EL 5GRJH 4WGVB 2FUQA 3RA7H 1MNNA 3CZNA 2A9NH 4WWID 2GHZA 1KMGA 1INQA 1KFAH 4GRWB 4KKAD 4CSPA 4HSCX 2PCXA 1OW0C 2OR9L 4ZAKA 3E1F1 2FLRT 2HVKA 3EBHA 1OAZL 2HT2D 3DRTA 4E9SA 3TH2T 5K39B 3AACA 1J8HA 3QPXH 4N9GB 3SPHA 1JXGA 4D0DA 4G8IA 4PS8A 3M1BA 1XEDA 3MVSA 2W92A 3NSJA 4KJPD 5M7QA 2BJML 2FQGA 3L7FB 2CLRA 3CD4A 2JK5A 3LZLA 4NM8H 3X1GA 3DUHA 3T4AC 3BQUD 3PV7A 1QR4A 5BS0B 1QNZL 1FZKA 1IV8A 3TN0C 4W6YB 4X7TB 4JQIA 5F6HJ 4GW1A 5C0AE 1NSNH 4LVOB 3SKJL 2F8OA 4UV4H 2Q7YA 1OPOA 5D1ZI 4JGMA 2DBLL 1I1AC 2ATKA 4KX9A 4BZ1L 3GHBH 2IQ9H 4NC1E 5HHOE 4P59L 3A67H 5F71A 4Q9RH 3LNGA 1KCWA 1Q1JL 2KQMA 3SOTA 3QNFA 5E6ZA 4GRLD 5I75B 4X4YA 4KRNA 3DTXA 4FFWC 3O45B 2H9GA 1LD9B 2E5EA 2MOGA 2NY2C 4PY7A 4HG4K 1OD7A 1K85A 3MNZA 4WJG3 4RZCB 4UZUA 1RV6X 2ZP9A 3W9EB 2DAVA 3WHXB 3IPBA 3RWHA 3IDGB 3PWJB 3RL2A 5L2JA 4GG8B 2GTQA 3L3GB 1OOWA 4I5BB 3IU4L 2B7DT 4PH8A 3WIFA 1FNGB 4NBZB 2WZAA 2M26A 2IWGA 3FPXA 1RZGA 1VAHA 1A6TB 5GQBA 4LKCA 3BQVA 2CIIB 3NAAH 4AJYV 5TFSH 2H32B 1JMZA 4MQ7B 4UMSA 4WGWB 2Q9OA 2FWOB 1MFUA 4TNGA 5DZ9A 3MRHA 5CUSL 3EDDA 1GZQA 1VFUA 2YQ3A 1VENA 3HZVB 4H0GA 5HHVH 1DQDL 2F7QA 1WAAA 2QV2A 4R5XA 1AG6A 5KVFE 1MAKA 3SY0A 3PDOA 3NUKA 4N85A 1ZDQA 4NZDA 3JWNC 4I3RH 5DD1H 5D71H 1LL1A 5AB1A 3WFHA 3LEXB 3AAZA 1EH9A 3CNKA 5D1XD 2R7EA 3GHEL 2NR6C 4UOW1 2BC4A 4JGJA 4UT7L 3RUGE 4LVEA 2P44B 3AXIA 5ADOL 4WGKA 1DBBH 1ZT1A 4P5TC 4KQ3H 1ZA3A 3QISA 5KW9L 3FU7A 3OHMB 4G5AA 4AITA 3RURA 2ARJQ 1XCTA 5EA0L 1EDHA 4Z0BH 4C4UA 3LXBA 4ES9A 3Q05A 3IGAA 3V52H 4EUPH 5HJDA 1FNAA 3CU1A 2AEIT 2JIXB 2VH5H 3POCA 4JDEA 1KGWA 5BVPH 3ARUA 1KC5L 4JKNA 5GGVH 3US1A 3OZLA 4KUZL 5E8OB 3D30A 3ROOA 3IXTB 1BVLB 4OU3A 5LDSA 3G5VB 1DQJA 2YA1A 4ODSH 2IAMB 3MRPB 2CO4A 3OXSB 4XMKH 3MRBA 5KS9A 2OI9B 4XC3H 1KGCE 1P4BL 3EYOA 3SO3B 1HVXA 2F5AH 2Y9RT 3RG1C 1DQQA 5J56B 3LDBB 5DJXB 2JQZA 2XG5A 3I75A 3GLZA 1AGFA 1KNOB 4OLUL 5LCVH 3OLEA 1P84J 3WL9B 2EE9A 2MQ3A 4S11A 2BINA 5DURD 1H3PL 3H9YA 2FR4B 1QLEB 3M86A 3IBOA 1IKOP 2WXGA 3U1PA 3WLWC 1WISA 1JI2A 3T2QA 1MRCL 1NCOA 4BKLA 5IWLC 4KROD 4OI9A 4AQAB 4DUXA 5CLXA 2FRGP 1FNFA 4U05A 4B9ZA 4HEME 1Q9LB 4J23A 5JHDD 1NC4D 5FKAA 2P26A 4JM4H 2WVVB 4U6XA 1H0DA 1P4UA 3SD5A 3B5TA 2Q86B 2X9WA 3FTVA 4PREA 3PWPD 1BVZA 4N2IA 5D7LE 4JFZH 4LOUD 1MY7A 3B7RL 4ADJA 3TCXA 4L2YA 3N85H 5L9DH 1GKOA 3F12A 3TO4B 4PJ9D 3N04A 2FQEA 1M2VA 4DGVL 2IMMA 2WLLB 1Z7JA 3O3BB 4GMTL 3BAYA 3DX3A 3KE0A 4L37B 4MB4A 1AR2A 5CP7B 4A6YL 5J4MA 3OAUL 4M7JL 4WI7A