2EDMA

Crystal structure of envelope protein vp26 from white spot syndrome virus (wssv)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
161
structure length
161
Chain Sequence
SVVANYDQMMRVPIQRRAKVMSIRGERSYNTPLGKVAMKNGLSDKDMKDVSADLVISTVTAPRTDPAGTGAENSNMTLKILNNTGVDLLINDITVRPTVIAGNIKGNTMSNTYFSSKDIKSSSSKITLIDVCSKFEDGAAFEATMNIGFTSKNVIDIKDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Major Envelope Proteins VP26 and VP28 from White Spot Syndrome Virus Shed Light on Their Evolutionary Relationship
pubmed doi rcsb
source organism Shrimp white spot syndrome virus
molecule tags Viral protein
molecule keywords 22kDa structural protein VP22
total genus 32
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2007-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2edmA00
2EDMA 2ED6A
chains in the Genus database with same CATH superfamily
4L4VD 1VERA 3OVUB 1K8DB 5DMIL 4AZUA 1T66C 3EYOA 2ZUQB 1JGEB 1IAOB 4NS0A 5C0JB 5I0ZA 2C5DC 4LPWA 4QF1B 4JJHA 3U7YL 1XV8A 3IU4H 5LDSA 1BOGB 3I84A 4JFWA 2LLNA 3BKML 5MENE 2YAFA 1PU0A 2OMZB 3WFBL 1FVCB 1R5VB 4AG4L 3A4AA 1MZYA 1H3PH 2RCSL 4ZX5A 2ICWI 5K9KB 1RVFL 1T7ZA 2XACC 2F68X 2HT3D 2D7OA 3TYFA 3FQWA 3KLAB 4FLRA 4BSVB 4PGJA 3BD4A 3BMWA 4FL4C 3QQ4A 1DFXA 2HKHL 4Z7NE 4TTDD 4FQJL 3MLXL 1KCLA 2G4GA 2YD0A 2BNUA 2VYRE 4DOHE 5DRWA 4ANVA 1PZ3A 2NUTB 2E8YA 3FCSB 3OKOB 4I13B 1SDDA 2OMTB 4GRMA 4ODXB 1GGIH 3INOA 4J23A 4YBLB 5T3XD 5FW7A 4ZMYA 5C3IA 1UWYA 2A77L 2FX7L 1IEAB 3M45A 4I18C 4IK6A 2A9NL 5ADOH 3T8XB 3V6OC 1YEGH 4MYWB 1Z5LA 3BVVA 1N5AA 2Q86B 7FABH 2HXAA 3U0PA 1EO8L 3MRCB 1N64L 4YDIL 7CGTA 2IWFA 1H8OA 4AIOA 1ZEAL 3O2WL 3AABA 4RCAA 4WUKL 3B9KB 1I8MB 2ZXAA 2W9DH 3SKOB 2YGQA 3I6LE 2YPLB 3V0JA 1BVNT 5EUOF 1IGFL 3T08A 4RDBA 5AFAA 3SDAC 3D2TA 4P3WA 4ZS7L 2X9YA 1MI5B 1X4YA 2AXHA 5GHWH 5AYUH 4AKOA 4Z0XA 4PP1C 1AKJD 4EOWH 2VQUA 3Q13A 2VL4A 3ASOB 3VACA 4I1PA 2ZX6A 3HCVA 5EC1B 1FH2A 1QP1A 4HH8A 4OZHB 1WBYA 3V0GA 4Y9EA 4KJWC 1WWWX 3TASA 3VFRB 3ULUL 5C09B 1CWVA 2R23B 2D7QA 3VXPB 1U3HA 4ORGB 2IAMD 1U3HC 3KAAA 3BKCL 2JFCA 3K0WA 3QPKA 1M56B 5HYSG 2UXVA 3L3IB 4W9DC 5CR1A 3LIUA 4JPIA 3RWJA 4MZIA 3CZFB 4TSBL 3GRWA 4AK1A 3KJ4C 2XZAL 3QUMH 1XH1A 4YHKH 4JFDA 3AB0B 5CNHA 4OT1L 4B5ZA 4YL4A 4EI0A 1DQDL 4QXGL 2NY6C 3ZTJH 4FNUA 3A21A 4F58H 1KLGA 3SE3C 2J57A 4JDTL 5B1JC 4YSDA 4MJHA 1S7UB 1VEMA 1ET5A 3B2UD 4APXB 2ZD0A 1E67A 3JVGA 1XMEB 4MAYB 3RPBA 5KYYB 3SOBL 3LZFL 3L7EB 4AUJA 1CR9L 3RWJB 5D5ME 4F7KA 3RDTC 3RKDD 2H6PA 3SY6A 1UGNA 1ZKAA 1UWGL 4MNHB 4Y9GA 1CLCA 2R4RH 4ZFFB 4PJBE 4PGEA 3OKLA 3KS0J 1L9QA 3FXIC 2E9WA 3FT1A 3VFRA 1NIFA 1AGBB 2F5BH 1R3JB 5HHME 1A6ZB 2AJVL 4YHOL 3FRPA 5GZNA 1SJHA 3BWUC 2CHNA 3Q2LA 4NM8H 4BH8B 4EN3A 4OLEA 4NPJA 3ZR6A 1LK3L 5DD0H 3FU5A 3QHZL 3P69A 2UWEE 1OAUL 3QSKB 5FLVA 3NG5A 4JREC 1L9NA 2Q8BL 3H2PA 5DUMH 4X50A 1TPXC 4UNTA 5AW0B 3WN5B 3HPLA 1SXBA 5L4IA 1RHHA 2Q6WB 3QXAB 3EJTA 4KTDL 4ZNCD 2V3EA 4BSWA 1TTRA 3D0AA 4NUPA 1WPCA 4KDVA 1CE1L 3WTTA 3GS7A 1DQMH 4IDLA 5F9WB 3ZDXE 3DV6A 1DLFH 3BUTA 4NQXB 3TBTA 4JO4L 3JWOH 5D7JC 2OI9B 4Q9RH 5EU6B 2OSLB 2PTTA 1Q9WA 3BZFB 4LXFA 4H1LG 4HJJH 4P2OC 3MA7A 2W91A 2I9LA 5MEPB 2MCPH 5T3XH 4F27A 5IQ9A 3G6JF 5ADOL 4HH9B 3CVHB 1KF9B 1N8OE 4JVWA 3BD3A 3OZ9H 1NWPA 3I6GB 1K4CB 4I3RH 1ZGLP 3RI5K 3DVGB 1Z9NA 1OGAD 3FO0L 1ZLUH 2UZXA 4ESKA 1NWOA 3KXFB 4UBDC 4MNQD 1SBSH 2C9RA 4JPWL 4GW1A 5GGRB 5IEHB 2BWDA 4HJIA 1GKEA 3CHXA 2AVFA 2PO6B 3K71B 3IGAB 1L9OA 5L2KA 5E9DD 4F7CA 3H56A 1G1KA 3FJTA 3IDJA 1AD0B 3DMMB 5I75C 2Z1PA 1FNEB 2AK1L 2ZF8A 2P7TA 3L2MA 3VB9A 1FO0H 5KSVA 1UWEL 4R3SB 4J3OD 4HULB 3DIDA 2L04A 1QX1A 2K0RA 4UV4L 4HKBB 1CDHA 1CD1A 1JK9A 4HIIA 4JZNB 4O58L 4ENED 1BWWA 5B1AB 1RK0A 1SGKA 1GGIL 1QLFA 3X17A 3FUDA 1KXQA 3CN3A 3N40F 4DCQA 1ET7A 1OKEA 4UDTB 4LSUL 1U3NA 4DEWA 3PWPA 1QEWB 1GZHC 1A3ZA 3WXWH 4JDVB 2ZAIA 4LL1A 2NOYA 2HFTA 4AXWA 2EDKA 4Y4HB 1NANI 1JXKA 1N64H 3QQXA 4OB5H 4YDIH 3ZKND 2AEOA 1MCHA 4PM1A 4Y1AA 2UYLB 4IU2A 3FT4B 1HI6B 4DEPC 2X3BA 2QADD 1GA2A 2H4EA 4X4ZA 1UCTA 5AUMA 2H9GB 4GSRA 4FNRA 4Z0BL 1HQRA 4ILDA 4D7BA 4HU8A 1UJTA 3MRCA 4OI7A 3QDMA 2VDMH 4AC4A 4GT7A 1CURA 5KYYA 1QSEE 5FOBA 5IUSA 4IYKA 3PV6B 4PP2A 1UB5B 2R0WH 2E7LC 4CU8A 4JPSA 3CQFA 3HNTL 3TTYA 3WFEH 3EJJX 4NQVA 5BUPA 3O9WA 1RIUH 5F9AC 5GGTL 1V8HA 3FTZA 3KMDA 5KW9L 4G1EB 4R83A 2LU4A 3Q5TA 1SYVB 3GIZH 1KWGA 2D8KA 3MHZA 4NFDA 5CMAB 3SDCA 2ITEA 1EDQA 1P4UA 2XKNB 4MS6A 2Y5TA 1RJCA 2J7LA 2FYYA 1A7NH 3I9PA 3PDGA 4PTUB 3BKYL 1AJ7L 3RGBA 1RZGB 3GNML 1KTBA 4LVHB 3PHAA 1LO5A 4PLJC 2HVBA 1A4CA 3NH7L 4RIRA 3TBYA 1NIAA 2Q2EB 4M7JL 4PJEF 5DQJA 4QRQB 2RTTA 5HPOA 3RGVA 5G4MA 3L3DB 4PS3A 1Y18B 5GRVL 3V4VL 1W0YT 2N0KA 2Z7ZA 3OTTA 5ITBH 5J4MA 1UFGA 4PP1D 4WEBL 4C56D 1OTTD 1WA2X 2BK8A 3OXRB 3UJTH 3OAYH 1KBGH 2YS4A 3HZKA 3SY0A 3U4EB 3WNPA 4KUZH 1G5GA 3SDAD 1U58A 1JK8B 2Z4QB 4JRYA 5JO5B 3C5SA 3VD0A 2VAJA 3HUJE 2OJ1A 3LKNA 4M1DH 3HC4L 3MGOB 4JN2A 4L9DA 1YYLH 3OR7B 1WWCA 3TA3B 5FDYA 3T0AA 5BCAA 3DDGA 4DQOH 3H42L 3KLHD 4RRPG 3P3TA 4IS6B 2EYRA 1Y0LB 3COOA 3CVHL 4IBQA 4KZDH 4ZO7A 1RZ8B 5T1KA 4UUJA 4XCCL 3BQUC 4KH9A 5T3ZE 2JQMA 3KPOB 4WU5B 3GHPA 2IPKB 3RWHB 3W11C 4XPBL 3P30L 1BF2A 4HS3B 2VLKD 1H9VA 1ZGLB 3GXTA 4PJGE 3H9ZA 3L5XL 2AABH 2BHYA 2EE3A 3RWDA 4K23H 5AVQB 3KJ6L 3QUYB 4XAKD 2EE6A 3JWOC 3U7YH 1RZ7L 1ONQB 2ENPA 1TVHA 2AJZB 2EEXA 5D7SH 2EH8L 4Z7WE 5FC9A 4IJ3B 3F5WB 4P57B 2FO4B 3H7BB 4OTXL 1AY1H 1SN0A 2YGOA 2IH3B 1OAKL 4OZHF 3UTTD 3VSVA 5FXCH 1BVKA 3ZQXA 4F7MB 4LPVA 1MCSA 1ZLWH 3GK8L 4G8GB 1MH5B 2JKTM 2OMZA 1KCBA 3OR7A 3FMGL 3TA3A 3SYAA 4UWQB 1ZY9A 2J5WA 3CWGA 3FU7B 1GS8A 3X13A 4UZGA 1D3CA 2K45A 4RGND 2DH3A 5E00B 5HGDA 5LCVL 2IQAA 5TE4H 4Z78B 1OF2B 4I3RL 4H8WC 1UTDA 4X42A 4ZUUA 2VH5H 3DROA 2Y1YA 4IHOB 2YLKA 32C2B 3QRGH 5BS0B 2VL5B 4CW1A 1E43A 3VJ6B 3O81A 3W11D 3AU0A 3QPXL 3BGMB 2PCXA 2R56H 3ZDYF 2B16A 4PYGA 1UXSA 1SXZA 3PWUA 4XT1C 3PABA 3HNTH 5EIQA 2EDEA 3VG9C 3CXHK 3R1GH 2GY7B 1TFHA 4D3CL 3NFPB 2CLVA 3ZN6A 1XGTA 5IW3A 2Z31C 4E9WA 2XWBA 2R1WA 3ZHNA 3EKCA 1ESOA 4F9LA 1OTTC 5LAXB 4JFHD 4PJFB 3IPBA 3WNMA 2AI0H 4R2GC 1ZGLA 1NCAL 3SHSA 2YRZA 5IMLB 5SWQA 3T0DA 1VGEL 5HY9A 2F6AA 4ZJ9A 1XFPA 2FNWA 9CGTA 3GXMA 4U6VL 3T77A 1DLHB 2EEFA 4NHCL 2O30A 4M7KL 2ATPA 1I9JL 2AAVA 5D1QD 4RMVA 3RILA 2LTQB 5DI8B 5IUCA 1QUNA 3CAFA 3VDAA 2ZG2A 5E4OA 5ILTL 3O0LA 3VD3A 3L7FA 1HHJA 2OTWB 3OLDA 1MHHB 1EEYA 3AXLA 4CUCA 1AHWB 2ZSWB 3C6EA 1CK0L 1BVLA 1QBBA 4ZUSB 3CXDL 3N9GL 4LARH 1P7BA 2IIJA 3G6JE 4GB9A 1JDCA 3VI3F 2DQDH 3QEQA 4X6DE 4WJKB 4KROD 1UZ8A 1C1EL 4BCYA 2W38A 4NLHA 1B0RB 4Y4KD 5I30H 3VDBA 3O3AB 2B4CL 1MQKL 2DQGH 4JZNA 2R2CA 2VDKB 2WLIB 3LHPH 1FFOA 3KPLB 4JBSA 4LLDB 5TDOA 4HDIA 3ZHDA 3L2LA 4XXWA 5EORL 1KN4H 4U49A 4KTEL 4E68A 4HHGA 1AKJB 3PCYA 4OZFB 4XAWL 3G6DH 5C0AD 5BV7C 3I6KA 4FULA 1R0AH 5AAWC 4U0RB 4F7CB 3UG4A 3RL2A 3V0WL 2C9QA 1I1CA 3K2UH 4H0IA 3IGKA 5I71B 3IETB 2UZYA 2EDMA 3G6JA 4LNRA 3TGXA 3PDOB 5E2WH 1F6AB 1I8KB 5JW4Q 2PR9A 2FUQA 4F8QA 3QJXA 1LE5A 1Z7JA 3O9WB 1AGCB 3R06B 3WE6B 2AV1B 4LHUA 4A2FA 1CLYL 2GPZA 3BUPA 4XCYA 3VG0L 1MNUL 3ARFC 4KKBC 2ZNXA 3BD5A 3WGUB 1Q0XH 2YJLA 1WC7A 4DETA 4V11A 3MNZB 4HGWA 1Y1DA 2EIZB 1ZLUK 3IS0X 5GGQL 5E99H 4GO9A 4YHNB 1IIKA 4ODBD 5LGJB 3H42H 1IJ9A 3QIBC 3D39B 4BZ1L 2NZIA 4J28A 4BRJA 4ZZKA 2XN9D 3HMXA 5FO8B 1JRHI 5GIRB 1VCBC 2GJ6A 1FNGA 3P0GB 5ICXB 4F15B 5IHBA 4UTBL 2ZCZA 1YSOA 4ZOBA 4WFFE 3FFOA 1NGQL 1JI2A 1S7WB 5KUKA 1UA7A 5C70A 2AXGA 1XSJA 4JRYD 5IROA 3LKQB 4UZUA 3K6IA 1EMTL 2Z93A 3U36B 4OZGE 4AEFA 4U6YB 4G6JH 5CAYB 4WHYH 2FB4L 2ATKA 1QLEL 4QLRA 1IM3A 2NXYB 3HPJB 3A6CL 3IKKA 3JYCA 1FYTA 5C0CE 4A7UA 4QXUL 3K3QA 4I4WA 1MELA 1TETL 4IBSA 4ELME 3C5XA 4R5XA 5IREA 2YQBA 1BFOB 4S1QL 2GIMA 4RAVA 3FT3B 4OFVA 2EE2A 1YHPA 4JG9A 4NM8L 2ZCHL 3MRBA 4DKEH 4HGKC 1MLBB 3EGSB 3IF1A 2CKBA 4C58B 5HHOE 5C07D 2F5AL 2CSPA 2DBJA 4FX5A 3THMH 2RHEA 5BW7A 1H5BB 4ZMLA 4ZMTA 3ARTA 1PD6A 3WS3B 5TPWH 3TN0A 4JM2B 5DJ6B 3O2VL 2B2XL 3DX8B 3L1EA 4FQPA 4N90D 3HC3L 3P0VL 3NRFA 2EYSA 5E08L 3KPPB 5B8CA 1IBFA 2ZIDA 1CL7I 3AUWB 1HL5A 2I7SA 4E42B 2ADGB 4FCHA 3G5XB 2VTFA 3WO3B 4MA7L 4YHIB 2E7DA 3UZQB 1M71B 1X9RA 2VLRB 3WN6A 4NQXA 5D7LD 2I9TA 3ZQ9A 3MUGA 1Z9OA 2BW5A 5EMYA 5FGSA 1HXKA 4K3DL 1MCDA 4KO7A 4BFIB 2R23A 3ESMA 2B3IA 1NDGA 5BNXD 4BUGA 5IFAH 1JDAA 3MNVA 3MUZ1 1RHHB 4I88A 4I2XE 5I15H 1JXFA 2EXWD 3FRUA 4PI2A 4G6AC 1IL1B 2DYSB 1WITA 2IDUA 1JNJA 2MFNA 2N7AA 5K39A 4LASH 1JXJA 4BM7A 3RNQA 4EN3B 4HKXB 3T2NH 1JZFA 3IVKB 5EU7E 1U4FA 5I0WA 2DWSA 2VJ8A 3EG9A 4APQB 4W68A 1YEDB 1KIQA 3LZRA 4G7SB 4NRYA 4XMVA 4WTZA 4AGOA 1OTSC 3FO1B 4HOWA 2ZNWA 4HALA 1RURL 2F1EA 2NYZA 2VLJB 3BP5B 4LFHD 3A67L 3B7RL 4Y16C 5D7JB 2QHRH 5JLZB 4ZPTB 1FIEA 2Z91B 1BLIA 5JZ7C 5JIPA 1QWUA 2Q86A 3IT8D 3WLWD 5AL0A 4LP4A 8FABB 1NCCL 3LQZA 2XRAL 4H8QA 3FSZA 1XHHA 4ZDHB 3A6BH 3W0WA 2FT7A 4TYUA 4X6EB 3V4UL 4RGNB 1WCBB 2G4EA 5DJAA 4Y2DA 4OBSA 1IGIH 1MQKH 2DQGL 2PABA 4OZFG 1AS7A 3ZRFC 5HYQB 1KSRA 1BVZA 1VFBA 4JFED 2JCCE 1LEGB 2WNGA 3NSJA 3DK2A 3JV4B 4PRIB 3ULUH 3FB6A 5D1QE 4BQ8A 2WKLA 4X5QA 4CAGA 4L23A 4BSVA 4JFOB 1JVOA 5D2LE 1XR8B 1IKNA 3MXVH 4YBLC 4HEPA 1H6UA 4N0UB 1A4JB 2IQ9L 4K8RL 5FLUA 1AFVH 2H1XA 2FWOB 3F65A 3MRDA 3CDGB 5I66B 2VN7A 2VZ1A 4AY0A 3I74A 1FH5H 1B88A 3EYFB 4HWNA 4YWGH 3GS4A 3Q43A 4ZXBC 4CMHB 4W1TA 1U8MA 2CKBL 3C60A 2LGNA 1G1CA 3E9TA 2V2WB 3Q7JA 3L5WB 2X4PA 4U05A 5JOFB 5ANHA 1BFVL 3F58H 4HCRL 3REVB 1AP2A 2IPTH 1WAEA 2ZXEB 3M17B 3SODB 1T2QH 5KJRH 4PRPD 3RJDA 2BP0B 5DMGC 4N2OA 2YRLA 3OQ3B 5CSZA 3OR6A 5AD0B 2QLYA 5AVZB 4UB0H 2GC4C 3NABL 3KVPA 4P4KC 4AW4A 1V3MA 1SJXA 4PJIE 5AKTA 1MRFH 3VWKB 1EMTH 1JFQL 3KPNA 4P3CH 4U1NB 3HG5A 5ESAA 1I3GL 2GUYA 5INCB 3LPOA 5EOTA 2AK4A 3WNLA 2PPAA 4HT1L 5BOZG 5C0AE 2E8ZA 1RJZA 1B6DA 3NTCH 4PRDA 1BZ7A 3AVEA 5HP5A 5DUBA 2AHIA 1S9WA 2FBJL 2UZIL 2X1XR 3RBSA 1I9IH 2VKWA 1Q9KB 4F9LC 1R9FA 2OAAA 1R33A 1MCWM 4OZIE 4RISH 5INCA 4MHHG 4ALAC 1MVFA 3A5VA 4N8PA 4POUB 4KY2A 2QKIC 3T04D 3OSVA 2WSDA 1LO0L 3QULB 1PJWA 4KFZC 1SF3A 4Z76A 5KVFH 4H20L 3CHRA 1PLBA 1IQDA 2IWGA 2JCCA 1FRGH 5DHVA 2HT2C 5D7EA 4H8HA 1MRDH 3FUJA 2CLRA 3WEBA 1FFRA 5JLZA 3X1EA 1N18A 3ILQD 4P5KA 2VXQH 1NIDA 4RFEB 3GSQB 1TZHB 2YA1A 5DJZB 2GTQA 3HMXH 4XE0A 1E3ZA 4O2FA 1VKXB 3F7YA 4KHXH 2FSEB 1U8MB 1XTLA 2C9UA 2WZ6A 3VTMA 4L8CB 1NFIB 5LBVA 3RTQC 1FNSL 3HHSB 4MQXD 5DRXA 4PY8J 3FUFA 2G3ZA 1E9PA 3LYRA 4NKMA 5FYJL 7PAZA 4QRRB 4CJ0A 3DXAA 5CHNA 1DUYA 4W6WB 2EXSA 1KZYA 3CMOH 3R4DA 2AGJH 4PJGF 2X4TB 4NNPH 2CHWA 2WIMA 1G0YR 3BRGC 3ARED 4ONGL 2DEWX 1G87A 4MDJB 4ABQA 3MJ9L 3QHFH 4FQIH 1E9OA 1LK2A 5LNEA 1ZHKA 4YPGB 4WHCA 1JZHA 1VFBB 1EBPA 4K7PH 4YXLH 2VDOL 3JTBA 3CIAA 2NY4D 3VA6A 5JOEA 2DQIL 2B1AL 4QJ4B 5E9DB 5KVDE 3BRFA 4J6RL 2NX5D 3LS5L 1KJMB 1EDYA 3V7MA 2FWSA 3HR5A 1P1VA 1K6QH 1NCGA 4QHLB 3PWPD 1N5YL 2VDML 4Z1PA 4RGNE 4U1LB 5KVGE 3QIWC 2EXYC 5TD4A 3NN8B 3DGGA 5JIKA 3T2OA 1CD0A 4MNGA 3DC0A 1B9KA 1S3RA 4FTDA 1UC6A 3BAYA 3NIDE 4DNLA 1P9MC 1P5UC 3JWNH 3T0WA 2APWA 4U6HA 5CGYD 3NIFF 3UBGA 5HYIA 3IVKA 3FF7A 4LESA 4ZMWA 3QXDA 3I2CL 5TDPB 1VLXA 4PW3A 4L8SA 4QXWA 4LHJB 5E9AA 2I26N 4EZKA 1O7VA 3AAZA 3MV9E 5ECGA 3DV4B 4F8NA 1ZVYA 5KYWA 2WLHA 1MCPH 4PQXA 3EJUA 1FPTH 5BUGA 1SOXA 2KH2B 4EDWL 2DQHL 4UTBH 4WV1C 2SODB 5E0FA 1GGBL 1J8HD 1X5LA 4GO6B 2Y7QB 2XJLA 3UPRA 3MOAH 4XP4H 2XQBL 1M53A 2K9UA 3BQUA 4IKKA 1BD2B 2WLNA 1ZHNA 3JV5A 2ADGA 1NOFA 1LO0H 5KVFL 3ALWA 1TMQA 3PL6A 3QFJA 3A22A 2HTLC 2X89D 3QAZB 5T3ZL 3TU6A 3MLUL 2AKRB 3TH2T 1FL3A 2VLRE 5CJXC 4KI1A 4EIGB 5CILH 3TPUA 2R29H 5KZCB 3H85A 4ZAKB 4FXKC 3EGXB 4PRID 3ZT7A 4JHWL 2OP4H 5A2IH 1XEDA 3NCCB 4KHTH 5C3TA 1BF8A 2VB5A 3R06A 1L0PA 1T1ZA 1YO4A 4N5ED 5F9JA 1PJ9A 5IHUL 1DE4A 4F57H 1OT4A 2W07B 4NUQA 4GS7C 2E6QA 2G3MA 5GRZA 2CRMA 3F01A 1Q9LB 1P5VB 2QGEA 5DA4A 3THML 5I5RA 2OW6A 4NZUH 1P7QB 3B1UA 1U8IB 1VACA 3HE6A 1FAIL 3TL5A 1UOWA 2W8CA 1I75A 1U6AL 5DK2A 3NEEA 2QFRA 3QDJB 4YVNA 3UTPD 4MWFA 4KDWA 3TM6A 4RISL 5BUAA 4UQIM 1M2VB 4L1SA 5AB9A 4BDVA 4WCYL 4BFJA 1ZXQA 4PJAF 4RGMC 3ZGHA 4OVUA 4HCGA 2R39A 1PZ5A 3U36A 2TSBA 4XE5B 5I1AB 1EO8H 5J11B 5C0AA 1QFWH 1ZE3C 4ICXA 4DUXA 4GBXD 1T6BX 3X3GL 3HIZA 1ZLSH 4PJ9B 1NGYA 1ANUA 1AQKH 4NZFA 4ERSL 4KBPA 2W0PA 4OZIA 1OGPA 3TJHD 1WJ3A 1YUHA 2G3XA 4QDGA 4LSTH 3F7RA 1FL3B 1ZA3B 3N6YA 2AV7B 3HG4A 1MWAA 4HJ0D 4G43A 2D3LA 2GITA 4WFGD 5IB3A 3B2XA 4ZT1A 5C0FA 5KSAB 4JY5H 1BD2A 2XBTA 4GI6A 4G8FA 4EXKA 4P3DA 4BIKA 5FGBC 4XMLL 1A1NB 3EO0A 3QIBB 1MIML 5HDOA 4UIMA 3VE0A 2CGZA 3MRJA 1SEBA 3QUHA 5I1GL 4N86A 5TPWL 2ZPKL 3ZDXF 3IETA 3DJSA 3IDYC 4D9LH 3AXIA 3FSWA 4BK4A 3HZYA 1PLGH 3MRRA 1AKJA 4OZFA 1YJDH 2L4OA 4RMUA 1VDGA 3BXNA 2IGFH 2D9CA 4CGTA 4J1UB 1JYVA 5LN4A 4GAGL 3LMJH 2NR6D 5IV2B 4ZO8A 2PCPA 3FQ1A 1QQDB 1KPVA 4PV9B 3QFGA 4PR5A 3VFTB 3GMNB 3S88H 1WZ1H 1CYGA 4JFPA 5FM8A 5FYKU 3QE5A 5MI0C 2XQBH 3FONB 5E6ID 3S48A 1LO3H 1BVLB 4DFIA 4X7SL 2ZUWA 3BFWA 1G4RA 1G7JB 1HSBA 1NUNB 4U3CA 1U2HA 2ARJQ 5I76B 2J88H 2FQGA 1AS8A 2P8LA 1TQBC 1T1YB 1F4WL 2BY0A 15C8H 2E6JA 1F11A 4MD4B 5IKCA 3I2CH 1QPXA 1SMOA 1ZHKB 4WGVB 4I77H 4BHUI 3SYPA 2BERA 1WCQA 4HMCA 1NGWA 5FYLE 4AT6A 2AP2A 4XRCB 3DPDA 4Y8AA 5GGSY 1YEIH 3DYOA 5HYSA 3QK0A 2ADJB 4X4ME 2KMWA 1PDKB 1O5PA 3C9NA 2ZUYA 5DS8B 4NN5C 5EO0B 2FIRT 3MLWL 4OD2B 5DHYA 2R7EA 2ZG3A 3PL6D 5F1KC 3DX1A 1MRCL 5GS0H 2YAOA 2H8PB 3RIAK 1WGVA 4KO9A 2E7CA 1IC5L 4NNYA 4HKJA 1I3RB 4V1DD 1CD9B 1N0XL 5FIEA 2E59A 4QAWA 4AUUA 4HUVB 3SJVA 4JQIA 1H3PL 2ADYA 5F72S 4AYDC 2KUTA 1W72H 4OGAC 1BLNB 1NBZA 2Z7YA 2ZOKB 4GBXA 2L0DA 1TJMA 3GWJA 1VHPA 3FN0H 4AE0A 4B60A 4X4YB 3UEZA 1F1DA 5BS0A 3GJFH 1EHNA 3NTCL 2R0ZL 1JK8A 3HFMH 3DNKA 3TIDA 3OLIA 3IGLA 5DJ8B 5DJ0A 1BJ1H 2DW5A 3BHBA 1CVSC 4DKAA 3HG2A 2XPYA 1KB3A 1JG9A 1K3IA 4Z76B 4X5PA 3PGDA 2H41A 2ZXQA 2AQQA 4OV6F 3WUZA 3HZVB 4KQ4L 5CEZE 1A9BA 4E9SA 3CDGA 2XNAA 3H2QA 3RB5A 1CGTA 5J6HA 4PBVC 4K3JL 3KWVA 2RIKA 4N0UA 1WWAX 2X2YA 3FYIB 1TPXB 5E4EB 3UYOD 5KSUB 1NMCB 5KVFE 1AG0A 4KY1H 2HFFA 3WEAA 4PRDB 1IAIH 4DPCX 3H8NA 4R96B 1LE9B 1BQLL 2NY0D 2R51A 3B9DA 3CUPB 4NO5B 5C9JB 5T3XE 4QYAA 2HTLD 3QZMA 3EBAA 3LZQA 1QG3A 2E9GA 1O6SA 3DBXB 5FK9B 3ZL1A 4CVZA 5HD8C 2X0WA 3F8UB 2ITCA 1MCOL 4RMTA 2B8OT 3MX0B 2KL6A 4A55A 4MLSA 4HC1H 3WFBH 1T80A 2BMKA 2ZKHH 2BOLA 4FI6A 5I1HL 1KENH 5DQ9B 5T1DL 1AQKL 5CU9A 5AB1A 3TWCH 1BYPA 3PV6A 5KANG 2WNXA 5EF2A 5CJQH 4KMTH 4JFQB 1E9QB 5EO1B 5FV1L 3MNWB 3UCQA 3KPMA 4WFHD 1FN4A 2FJSA 1EEZB 5J89A 2HVJB 4KXCA 2VDLH 3B5GA 3FUNA 4TLTA 3J2PA 4PRIE 1TQUA 3VXUA 3FQTA 3NDZE 3ARSA 3FTUA 4PRAB 2Z6FA 1CU4L 3DI3B 5DS1A 2AJXL 4W9HC 3GZOA 4JG1H 4BFRA 5INDB 1NL0L 2PCFA 2BIIA 3DXAE 4KKCC 4JDVA 2EEDA 4ENEC 1A5FH 4HBCH 1WVZA 5HDQH 3GHEL 1Y18A 5D6CB 3B6SA 1QBML 1GCFA 4QHMA 4I18A 3CDCA 5IFJB 3GMQA 3NGBC 4ZW6A 2COQA 2VM4A 1L7IL 1G7QA 1SHSA 2DQEL 3BN9C 3I9IA 4C4KT 4MHHI 4NQCE 4JRXB 3DO7A 1TKWA 1I85C 1H3TA 5E5UB 3VSQA 4J8RA 5EOCH 4XP6L 3CN1A 1KBWA 3OMAB 4AMXA 3KR3H 2C9SA 2R4SL 4W4NA 1KIRA 2C9AA 2X9WA 4M3HA 4N2HA 2QADC 2ZOOA 3ILPA 4AVHA 1F13A 3IGAA 1RIVH 1A1OA 4L48A 4OZIF 5TJWK 5FFLA 2OMVB 5HI5C 3SCMD 5LBSA 4N6RA 2FEDD 4LLQA 1IT9H 5ESQA 4I2XB 3BEVB 1P84J 3RVUC 5EH1A 3VFUA 2WPGA 3DSFL 4HIHB 5ESVA 2V5SA 5EU4B 1DDHB 5BVPL 1EZUA 3PJSB 3QEQD 4XNZC 1WH0A 3IFOB 1G7LB 1ZCRA 4X6DA 2XG4A 4HIQA 4JY4B 4G80B 4KTDH 4NCC1 5LBGA 5DVOA 1BZEA 1T3FB 3F6LA 1J11A 5CGBA 2C7UB 3QPQD 3NCYP 3DURA 4E5XA 1E5BA 2E7HA 4NRYB 1V3KA 4XPBH 1FUNA 4BFKA 4MJJA 1CFBA 4XTRD 3T65B 4XMUA 1E5UI 4U1HB 5FB8A 2MPVA 4AYSA 2W88A 3BISA 1YUKB 1KLFB 5A43C 4BSWB 5B39G 3V6ZB 4GQZA 4YHZL 1X7QA 5C6TH 1KCVH 1LO4H 5GGVL 4MZRA 1G7MA 4YUEL 5GISH 2QV4A 1UB6A 2CIKB 1O0VA 5GS0L 3BIKB 3B5TA 2X10A 3D08A 3QYNA 1FH5L 5DA0B 5AW1B 4A67A 1NH6A 3KEDA 4URTB 2XOTA 43C9B 1HYRC 4X80H 2WVSA 5FO8A 2AS5M 4IHBA 1F00I 3WMSA 1H5BC 4I0PC 2UXFA 1CYWA 1MFVA 2A83B 3DX3A 1ORQB 4XP5H 4YZWA 4Z3FA 2UWEA 5F89B 4GG6E 4JM2C 1QFUH 4K07A 5AW6B 2FR4B 4CBPA 4BA8A 1IAIM 1MCQA 3GBDA 1OPGH 2J6EA 3NFNB 2A38A 4Q9QH 4ZTEA 3S37H 1GXEA 1S7XB 4MFHA 4UBDD 5KJRL 4C57C 2WTRB 4MNQE 4WWKD 3RUGE 4JG5A 4HUXA 5IQNA 1PZSA 3EYUL 2Z8RA 4G83A 5HYJD 5DJ2B 3OKMB 2GTZB 5CEZH 1SVBA 1OXYA 5JPMB 5IF0B 1HCFX 1WBXB 3KPQB 4JO4H 1JPFB 2J6EH 2JKSA 1ACXA 3P2BA 2BRRH 3CFKA 1BEYH 3VB8A 1DYZA 1O9WA 1XIWC 2EIJB 3LPGA 4FQ2L 3X2QB 1MCEA 2UY7A 1TYRA 5IMMA 3MV8B 4W9ZA 4EEEA 1QVOA 3AT0A 4XB7A 4AQAB 3UZVA 2K4WA 3GI8H 1IFHL 3ET9F 1XCTB 3ESNA 4PRHE 2VMEA 4WW1A 3LOWA 5CWSA 3UG3A 2MHAA 4ZFOA 1DQIA 4TULH 5EU3B 4MQXC 3ZKQD 3MBWA 5JNYB 2DWEB 4Z3IA 1QACA 2WP3T 2OP4L 2BSRB 1OAQH 4PJEB 3AU1A 2JMRA 4YBQD 4YN3A 4JFDD 5B7MA 5ID0A 1DQTA 3EO1A 4LVOB 1SBSL 2CUMA 1MW0A 3GSOA 3KL0A 3GLAA 5EPMB 4JCWA 5E2JA 4DP6X 5ILTH 3TESA 1P7KA 4LZKA 1T2JA 4WWKC 4JM2D 2VJ0A 4WRLA 2YPLA 1C7SA 4DP9X 2WYZA 1GW6A 2M26A 3SCMA 4UAOB 1OB1A 1M6OB 3KDPB 4E5XB 3MLSH 5IB2B 4FLSA 4OAWB 2WYHA 4X5LA 3L1OH 1MRDL 1BXXA 1MREL 3QWQB 2BVPB 2WXRA 1LDPL 5T1KD 4KU1A 1RHFA 5D6DC 1HEHC 2IGFL 1A1MA 2HT4C 3MV7D 2AFNA 2UY7B 5KSBE 1L7TL 3Q2WA 4L4TE 3RIAF 1LHZA 5BPPA 1IGFH 4DH2A 3S36X 1R6VA 2OTPA 5E1QA 5IF0A 1KLGB 3AXHA 3P4LA 5H94A 3AFLA 5A6LA 5BOPA 1F18A 2JKLA 1QEXA 5C0RL 4K3HA 4DSYA 5D7IF 3ZBMA 4OD1H 5EOCL 1DBBL 3WJMB 4MLIA 3GKWH 3DJ9A 3I75B 5HHXH 3H4FA 3MCKA 4W6XB 5E9DE 4HHWA 4XAWH 3QQ4B 3NPSC 4FXTA 4YHZH 4ICWA 4LLDA 3O3UN 5TDOB 4BCXA 1WZLA 4HZ1A 1TCRA 4NUGL 4TOYL 4P2QD 4D0DA 5F3HA 3KPSE 1MG3C 4LLUA 2JI3A 4KTYA 3RGVC 4HV8A 1ZK9A 4L18A 2QPUA 2A4EA 2E7LA 4KOCA 3A24A 1JBJA 5CINL 4PMFA 1RFDH 32C2A 4Y16D 2P47B 3D18B 1IAOA 5C0JA 4MMXC 4Z8FL 4O2CA 2RR3A 2ZSWA 4AV0A 4F5CE 2DD8H 4P23D 2AJUH 3HHRB 1BZDA 3X13B 4JB9H 3O9WD 3X3FH 1AHWC 2PYFB 1S78C 1UJ3C 4K9EH 3RVVC 3LQAH 2D03L 1S2EA 2VERA 2YRBA 5FYKE 3S3JA 1U93A 4GUPB 3T71A 2YOAA 5EO1A 2JE8A 4DP4X 1KBVA 5CLTA 1OM9A 2FAUA 1EA9C 3B9VA 4NENB 5DD1L 3V4PL 4NQDB 2X4RA 4WUUE 1YJDC 5DD5H 1H3UA 4L8BB 4OFKA 4YAQB 4W81A 4Y4FB 1HILB 3IMRA 2HPOA 3H9SD 4OV5A 2X4NB 3HAEH 5IJVB 1LD9A 1XTMA 5DUPH 2I24N 3FCSA 1RSFA 3OKOA 2NUTA 3QG6B 2ADIB 2GI0A 2HAZA 3TC9A 3U0WL 3QUMB 3QCUH 3VFUB 2JB5L 4Y2LA 1DSYA 2IPKA 3RWHA 2FEDC 4M5YL 1MCIA 4P23B 4YSPA 1ACZA 4J5VA 3AY4C 1HEZB 3RAJH 4TVPE 5EOQL 1RUKL 5H2BB 2IGLA 3FOLB 3VXRE 4ES8A 3LXAA 1L3WA 4BINA 1BIIA 3HRZA 5EZOH 2VZOA 3ESVF 3T09A 1XR9A 4ZMVA 1KIUB 1TXKA 2A9MH 3TCLA 3UTSD 5DK0B 1ILUA 1ASQA 4Q4IA 3FS9A 4P4RB 3GLDA 1T2XA 3OKEA 1BQLH 4GRWF 4G42B 4DGYH 2AABL 2BIMA 4D8PA 3K6NA 4N8VA 3AG2B 1BQHG 2JXMA 1NCAH 3C6SB 1NPJA 4Z95L 1AZCA 2YSSB 4HUMB 3FB5B 2CO1A 4MA1B 3TCLB 2NX5A 1DVFB 3ZYIA 4FLHA 4QRTB 4JUSA 1BVKB 5EBWA 4KXZI 2HMID 1OD9A 2WTOA 4TKWA 4RDQG 4ZW7A 4FFTA 4F7PB 3KDMB 4GSXA 3NJKA 5H2BA 4I7ZC 1WS8A 2ATAA 1D5BB 1X5FA 4YEEA 1CFTA 1E8YA 1SUHA 5IW1B 2R0ZH 1KT2A 3F12B 3IDIB 1JYXA 4N2BA 4PGCA 3TO4A 2FBOJ 1NFDB 3QRGL 4LCWD 1H3GA 2BSBA 2CDEA 3O8XD 3ZL4L 2VXVL 4HZLA 4LK4A 4HD9A 4DGIL 3CFQA 2VXTL 4AMKL 3VXNB 4OQTA 4KO5A 3RZCD 4A38A 4FQCL 3CLFL 2XV2A 2DIEA 5D5MB 1TEYA 5C0DA 4K73A 3HW7A 2P8LB 1MWAB 4XVTH 4A2HA 4JMXA 2NW3B 1J86A 5DHDA 4EN3D 3MBEA 4RFNB 1VA9A 1WRFA 3AGVA 4GKZB 3TH3T 5F0JB 2YR3A 4CILA 3FUEA 1AGDB 2BOCA 1Z2KA 3D4GA 3BO8A 4JO2H 5K9QG 4WDIB 1X7TA 5D2NB 4WLCA 4ZOCA 4QKXB 2H1PH 3DO3A 4E9QA 4TNWF 2VDOB 5AWNL 5FFGA 5CFAA 3F00A 4XO9A 1ZA6B 3IFNL 2LAGB 2JWYA 3O0RH 4HS6B 4HF5H 3TBYB 3FTYA 4ZTOH 4YDJB 4EUPH 4KZEH 2JNZA 1SOQA 5B22A 1DJWA 12E8H 4XN5A 1BD2D 1EEUA 5E03A 4MNGE 4EI6A 2X4OB 1U2CA 5KSVB 3V4PB 3T4YA 1RK7A 5CGMA 1KYAA 1KGWA 4O5LH 4EXPX 1JV2A 4PJBF 4BGLA 2BXYA 4N5UA 2E9JA 5JPNB 3SQBA 2ZG1A 2PO6A 4CA4A 1KXTA 1NEPA 3WL9B 1DBAL 3TA3D 3MRJB 5C08E 3EZJB 2ZUUA 3LJ3A 3WY3A 5LXVA 5F7FA 3SEPA 3PUCA 1BHGA 5FO7A 1KIPB 4UT6L 3VSTA 1WDAA 2XQYG 1OAXL 3KPSB 3D25B 3UERA 3I6GA 5IB5B 1DJHA 2NLJA 1S7RA 1TIUA 2AERT 3QJFB 4Q58C 4FG2A 3UO8B 5DC9B 4GMSH 3WY4A 3TPUB 2ICWB 3D30A 1NAMH 5EG6C 3RPIB 4X5XA 4UQ2B 2Q87A 5AUMB 3F7VA 5MEPA 4PRPA 4HG4K 2FVNA 5E2TH 3BH8B 1JNNH 5FDWB 3DOIA 4PCTA 4PJAE 1GPOH 2MRYA 4HJJL 4RGNC 2FSDA 4OQ1A 3M8OL 3D7PA 3IE4A 1G6RL 1W6LA 1KGIA 3MACL 3PQYD 4OUOA 3PWPB 5E6SB 3S2CA 5B39A 3ZJAA 5JQ6H 4M6NH 4P3CL 2ZTBA 4LCUB 3K1KC 4H25B 5J0BA 2EECA 1ILSA 3BOVA 3LEXA 3U83A 1AZBA 3ZK0A 1B2WL 3U9UB 1FZJB 3VFSA 1KTJA 3V9EA 4NLAA 3P2DA 4IEFB 5KYUA 1IGJA 1FVDB 5CU5A 4ABWA 5ID1A 3RVWD 1XGRB 2VDKL 1YDPA 3P0VH 4UZSA 5JMRA 5CEZL 4GSQA 3OAWA 3N0PB 4ODHH 5CP3H 4Z9KB 4AYID 4G3YL 1BCIA 3BPCB 3DMMD 4NBXB 4PJ8B 3CGTA 1INDH 4PJDF 5T5FA 1PQZB 4ELMB 3QIWD 1AQMA 4PWJA 2DWDB 4E9TA 2J6EL 4ZW5A 4W9CC 2DLEA 1D2OA 2NY5L 3OB0H 5BO0D 1J5OH 1P1ZB 1JZJA 4MQ7B 3BSHA 3BP4A 1UKQA 2J5LB 2YGPA 5F1OB 2F54B 5F0MB 1NOAA 3X1BA 5F7BA 4LRIC 1ZAGA 2ZAGA 4OFDA 3CVHA 4XCNA 3B3IB 4GKSB 4XODA 1WAAF 1P69B 4E41B 4HX1B 4BGDA 1A1NA 2C7FA 1FV1A 2DY2A 4BUQA 5GPRA 4L4VA 4B97A 4BD4A 1FNSH 1Q9WB 2X88A 4JFUA 4L2YA 1AR1D 3MV7B 1U8LA 4X4XB 4GAJL 4XPTH 4ABUA 1KCKA 4HSQA 2AJSL 1H6EA 1PTZA 2YD8A 4QRFA 3A6OA 4B6ZA 2VC2L 1BZ8A 5DR5L 3QUXA 2NSXA 4ISVA 3E38A 4XCNB 1SYSB 2ITDA 1MREH 1F41A 2J8OA 3L3GA 3NCJH 3SDXE 4D94A 5C7XH 5K1VA 5KYXA 1J9CT 1JYWA 1XF5A 2DS4A 4Q56A 4RWHA 4NDMB 3WN5A 3QO1A 4DK6A 1L7TH 2VDOH 3GBML 4PJ7F 5B38G 3H0TB 4KDTC 5IW6A 2QELA 1IU1A 3S8GB 1JZ6A 4BFBD 2FCBA 4FFWD 5DJCA 3UO1H 4IGBC 1R3JA 1N67A 1A6VL 4O02A 1NBQA 1JF1A 3DURB 3QDJA 3SKJL 2C7UA 5E6UB 1PZBA 1YDPB 5CLXA 1QBAA 4PN6A 1JTPA 2GK0A 3NFSH 4HK0B 4M00A 3ZE0F 1MWAH 3GB7A 1MFAL 1OD7A 2D4DA 2L7EA 1PY0A 1Q94B 1RLBA 3BCDA 3BP6B 3CFDB 1NQBA 2YMOA 4LOUD 4HIJA 2YD6A 5DD3H 5C0CD 1N19A 2ALAA 3FBKA 1ROCA 1DJYA 3TIEA 1NAKL 3BZEA 3RTQD 5DWUH 1JJUA 4XNBA 1ECZA 4YX2H 5GSRB 1XF2A 5E9DA 2I07B 1ES0B 3GSNH 4H40A 1CDBA 4WW2C 3L48A 2D7NA 4K3EH 5F6HJ 5MHSD 3QIUD 3UBXA 2VQ4A 1TZ8A 2CD0A 4YSRA 3LRKA 4ZAKA 3WIFA 1RAMA 1YY8A 4XMPL 4MVBD 3SO5A 2W60B 1FZMA 4UQ2A 2V2XA 2XWXA 5HHNA 4G7YL 5IBLC 1YNTA 2HTKD 4NRZB 4ZS6C 1JD9A 3LIZH 3P40A 2YWYA 5EOTB 1FYTD 3UPCA 2PKDA 5LVEA 4OIIH 4LEEA 5F71A 4DZ8A 4LLMA 4QEGA 4CMMA 1Z6JT 3B2UC 1ZANH 2N56A 4LQ1A 4B0MM 1IT9L 1MJ8H 1BV8A 4OQTH 1G1OA 2XDHA 2B39A 3QUYC 3MRNA 4NKIL 1E2VA 4B95C 4YZFF 3GSQA 3DV4A 4XP9H 3BGFB 3D0LB 2EO7A 6FABL 3BW9B 4Z7QF 3D0VB 5E99L 3O3DA 1FYHB 1J0YA 1OAJA 1GTFA 2BP3A 2A9DA 3NSFA 5IMKA 5KAQF 3N06B 2WQWA 2NW2B 3UDWA 3OGCB 1M42A 4GI8A 3L9RA 4PLJD 3CZUB 5E5MB 3SJVD 4L4TB 3WDHA 1MHEA 3BYTA 1RQ5A 5LG1A 1E6OL 3AWGA 1CGYA 4L29A 2IPTL 4IRZH 2FD6L 3CVDA 1FO0L 1NCUA 2Y2YA 2C1OA 3QUZC 5F21B 5BO1L 4UQ3A 1FBIH 3ZYJA 5E94A 4JJ5B 4QXUH 3VGBA 2P4AB 3HBQA 3TYFB 5HVFB 2DJSA 2GSGA 5I5MA 2J4WH 3SBWC 4LHUG 4L8SC 2EDTA 5EZJA 6PCYA 2CRZA 4KJQC 1YMME 4IRZA 1YEJL 4XVJH 4HS8H 4QJ5B 2RCSH 2P52A 2QPSA 4Y4KA 2HT2D 5SWSD 3MYZA 4KKAD 3C5JA 3PGDB 5C6PB 1JPSL 2EH7L 4FZ8H 3Q2CA 3QNZA 5LO7A 3B7TA 2DBLL 2YBRB 1N68A 4TQPA 2JV6A 4JKWA 4QJ3B 4D2NA 1MLCB 5H4ZA 5CHNB 1IIIA 2DQJL 3BUIA 4AH2B 5F7LB 4H2CA 1J8HB 2O61B 3UGUA 3U4AA 3BW9A 4ETQA 2ZUTA 2IALA 3RWCB 3UGXA 2A77H 3BVXA 5I17A 3MRNB 2YQ3A 1IBHA 3L8QA 1R46A 2YPVA 2GI7A 3I3EA 4HQQL 3T0BA 4WWOA 4ZK8A 3Q9PA 3V5DA 2FEEI 1QFOA 1AZUA 4D0CB 4QXTA 3CX2A 2H26A 3MZGB 1TSRA 4AQOA 1U30A 4OGXL 2X41A 3O8XB 4H5SA 3L5JA 4M93C 2EEBA 3F83A 1TZIB 5IQ7L 5GS1C 5I15L 3G08A 5IB1A 1DN2A 4J4PD 4OFYA 5T1MA 3V79C 1FGNL 5DEGB 5LQBH 2L3BA 1PZDA 3MMEA 3U30B 1AD9B 4ZG1A 1I7TA 3L45A 1JE6A 4WEBH 4BE6A 1AD9A 4ANWA 4PJ9C 2E56A 5FYLL 1A6AB 1BIHA 2AANA 2FO8A 4C4KO 1N3NB 2GJZB 3QH3A 1EVTC 2YMXH 4OLYL 2F53D 3KZ8A 2A3TA 3CDYA 2Q8BH 1M57B 3MTXA 2BSTB 1QMUA 3L4TA 3VYNA 1HSAB 2DTMH 1BBJB 3AREB 4LSQL 5I18L 3N1PC 3PFQA 5IR1B 1GAFH 4EIBA 2MQ3A 3MFGB 3IF1B 4PVLA 4QT5B 1U8HA 5ALCL 1T0NA 3UTSB 5J1TC 2XZAH 3HNSH 2JKRM 3QC5X 3MRBB 1EFXD 4LGSB 4XOCA 3N44B 1BQHA 1WFJA 3P30H 1T66D 3OKKA 1CF1A 2CBTA 3TEZA 2CCLA 3HAEB 4ODTH 3DVFA 3L4VA 3WUWB 1DBBH 3TV8A 3RZWA 3L2NA 1KPUA 5I1DB 3GRBA 3BZ4A 5IVZA 1LLAA 2FUTA 2ZYRA 3MA9H 4ODVH 1WA0X 4O2CB 5JHDB 1GPOL 1BQ5A 2KQMA 1A6TB 1S7WA 4H8WH 3HS8A 4NCC2 1MFEL 2DYPA 3CPLB 3ZSSA 4F33A 4Y4KB 3SYCA 3FMGH 3EO0B 4AITA 4ES9A 2DJ4A 2CAKA 3N43F 5FUOH 3C8KA 3JTSB 5EZJB 3JQOB 1VGKA 1SY6A 4NPYB 5AVSB 4KTGA 2IC2A 4Z8FH 2KBGA 4L4VB 3RHWF 5C0FB 5KSAA 4QHUA 5IB3B 1OW0C 3WS6C 4E42A 3ULUC 5E23A 2AK1H 4ZI8A 2W60A 3N5AA 2BSDA 4S0SD 3NCMA 2WZPA 2X6BA 4R4FH 4PRIA 1OZTG 3MRHB 2X6VA 1DVUA 1VESA 4U31A 2WBJD 1TQVA 2OMWA 4N1CA 4F8OA 2EDJA 2HG5B 1PMYA 3DVNA 1LYQA 1QBLH 5FHAH 3ATBA 4M8RA 3FK3A 4UV7L 4EQ3A 5HGBB 2KS0A 1YNTF 5I1AA 3W0WB 5DJXA 3ZTNH 5KBNC 2IOOA 1WA1X 3QDME 4WO4A 3FOMA 4KK5C 1SPDA 2BVEA 2FWUA 4JLRA 3ROLB 3ARPA 4PJ8A 4U2ZA 4F24A 2K6YA 3EYSH 2A4CA 1CQYA 3I6KB 4YBHA 5CM1A 1SHWA 1NA8A 3PL6C 4G9DA 4KK9C 1XGRA 4PS7A 1CFQB 3IN0A 3LRMA 3MLVL 5TQ0H 2H1LM 3MLPA 4KRNA 4FI7A 5HHMB 4UOW1 4W9JC 1EHKB 3DECA 4ZQKB 1TF4A 4KPHL 5I1LB 1I9IL 3CK0H 2LLGA 2OFQA 4LIQL 2W07A 4JO3L 3DWTA 1E4WH 4HPYL 2XYCA 3EH1A 1KC5L 5D93B 4IRSC 4LU5L 1F3DH 3KLQA 2BIPA 3N1GC 1A66A 1ORSA 5GJSL 1NCDH 1PG7L 1XF5B 2DQFA 4N3UA 1GC1C 4P2CG 2LW3A 2EJ1A 2EE0A 3L6FA 4N87A 4D9LL 3WLBB 2WWNA 4HIEB 3MV01 1OP9A 3QDJD 2G9KA 4DP2X 3T0EB 3QEUB 4CC4C 1WLHA 2EIZA 3ARFD 3SPIA 4N8CH 1IM9A 5BQDA 3CXFA 4JHZA 1EFXA 2E76C 2EICA 5CN2A 3UIZA 4LARL 2N7BA 3UBXB 3CC5A 1FV1B 3DKHA 5K9OB 3DRTA 3IRZA 3SJVE 3ERXA 3KPQA 4L0YA 4Z6AT 3ULVC 4QRBA 1JN6A 3GMPA 2OYMA 2IADB 4FG0A 4QO1A 1ZDSA 2IXQA 3EYQC 1ZDQA 2NNCA 1MCNA 1HH6A 3TIEB 3BZEB 4XMXA 3WOVA 2WO3B 3US0A 5I26A 3RWIB 2YPLD 4PJCA 5LQBL 1YNKL 5AYQA 2NNRA 3D33A 1T5XA 1GC1H 2YPLE 3CVIL 4LCIL 4M1DL 1CLZH 4EAEA 3BIBX 2BNRE 3DXAD 3HZMB 4DO5A 4CBZA 3CHSA 5IHWA 3DX9B 1L9PA 4LE8A 1XVSA 1NPNA 1GYVA 1NJ9A 2CMRH 2V7HA 2JIXB 3C08H 4U1SB 2QQKL 3KEHA 1CDYA 1SF5A 4QRUB 1U41A 4OFYD 4XC3H 5EZIH 5AVXB 1I9RH 1UM5L 3F05A 3LKRA 3Q3GB 1Z9LA 3MBXL 4KNTA 5C7XL 2H45A 1KGCE 2AK4E 1IGJB 1NIEA 1TCMA 4YHPB 2VDRB 4PH8A 4LDCA 3B7SA 3S2AA 3TA3C 4JPKH 4M02A 3L9YA 1CGVA 3LDBB 5IVOA 3VVVA 5E1HB 2ZE0A 3GT6A 1NGXB 4ZFQA 3PHOB 4H25A 5JXAH 4R2GD 3MBEB 4KRLB 2AXGB 4YXHL 5JQHC 5I1IH 3CCHB 2KZ1B 3B9AA 2W9EH 3CNKA 1UD8A 4M4PA 5DTFA 3HKZA 2DZEA 3VMOA 4TN9A 5DI8A 1A47A 3NCEB 5B7FA 1U8LB 4GRWB 2AQNA 4L3EE 1G9NL 3VW3L 3VD9A 4PCYA 1WIUA 1AY1L 3RQ3A 3I02A 1IZKA 5K9QI 4X7FC 1RP9A 4AEEA 1RY7B 3UC0H 1K5NB 4X5XB 5E6IC 2R9HC 4G80A 2GW5A 2WJ5A 4PB9H 1TUPA 2VQ1A 4FQQA 4NN7B 2OCJA 5I19H 4XP1H 3Q0HA 1Q9OA 5DWPA 1C9SA 2IV8A 2NY3C 2AQ1A 1KIPA 1ETA1 4C8XA 1XZ0B 5I0YA 3WEXA 2VM3A 5AB0A 1GGUA 5BRZA 2YUWA 2EDWA 2A74B 15C8L 3KLHC 1BYNA 2TAAA 2ENQA 1YEEH 3KLKA 1U0QA 3NDYE 1CFSB 1MIEH 5LGHL 3T6ZA 3OGOE 3CSPA 2XBZA 3IYLW 3Q48A 1IAKB 3A4FA 5CZVH 1LP9F 2XU9A 5GJSH 1N7ML 2CO6A 4F9PC 5BO1H 1MCKA 5DRZB 1NCHA 2CJUL 2EUZA 1R1CA 3GDCA 2P5WD 5IT2L 4RX4D 3NIGE 5IFJA 2VLKA 3KCPB 5KBDA 1IQWH 1HWGB 3UAEA 4HUNB 4CC0A 2WVUA 2DLFL 4AE1A 1BAFH 1IFHH 1H8SA 4X8JA 1S7VB 4JFYA 4Z7IA 4JFXB 3RX8A 4S2SB 3KGRA 5BZDB 1LO5B 4M56A 4ZX6A 4K3DH 2QLVB 4FE9A 4XCFH 1JPSH 4PRPB 4HYTB 4BFGA 2X0VA 1MAMH 4LCCA 5HHOB 2XETA 5CD3A 4U6TA 3EOBA 1IEBA 4L1HA 1VFOA 2AK4B 3IDXL 3QDHA 4JG1L 3T2NL 4PB0H 4QRPD 5CP7B 1T1WA 5DQ9A 1BVOA 1YPZE 3GLEA 2Z65C 2CU9A 3M86A 3KPOA 4WU5A 1LEKA 2QMJA 2H32H 2OX5A 5IB4B 3WXVL 3L1OL 4KVCL 5T1KB 1A7QL 5A40E 1FNAA 1SRDA 4Y5VA 4KUCF 1C12B 2C8NA 5HHVL 4FFZH 1EHXA 3H55A 4FQLH 3CUPA 1IBYA 1A25A 1TQCC 4NO2B 4Y5XC 3P9LA 1URLA 3LHPL 2XIDA 4HCRA 5MEQB 4WNSA 1CBJA 2W65A 3WIIL 1JZ5A 2XVLA 1E5CA 4CL7A 1CE6B 3MLRH 1NCCH 5AAMC 5SWZD 3QIUA 4QCIB 4CC1A 3GD1C 3OAUL 3LXBA 4M8QA 4M03A 2FWLB 3TTSA 1N70A 4L9LC 3P4NB 3ULVD 4PG2C 1DVFA 2CBOA 1GYUA 3WIAA 2XKUA 3FW6A 5HYEA 3IJSA 4PJCE 4LCWA 4ODUB 4PRNB 3TO4D 1UATA 5IGXH 5LGKA 1A0QH 4LLUB 2OMYB 5F3HB 1JIBA 2PMZA 4NQDE 3VI4A 4OVVA 5DZLA 4ELDA 3FU7A 3ZU8A 1L5GB 4EMZA 4HOZA 1QRKA 3MXVL 1LWJA 1PLGL 3ARXA 3ZIYA 2NW3A 5JIDA 3CVBA 3N9GH 2P7TB 4NO2A 4RMQA 4P2RD 4DVBA 1G9NC 4B9JA 1HQ4B 2Y7NA 4AI7A 4OLZH 2RB8A 1JNHB 4IRSA 5EZIL 1E8ZA 4JUTA 4TQEH 3RZCC 4P46B 1DUZA 4FNPA 2OXHB 1YEFH 2CKBH 4FXLA 1A8ZA 4GLRI 4NQTA 3LNFA 3C6LC 1QRNE 3KVDD 2F74B 3UTZA 4XZUA 2ZOTA 1J1XH 1XH3B 4MB4A 4HHAB 3GI9H 1Q1JL 4HS3A 2DYPD 3EOBB 5JXEA 1FL6A 1KT2B 2X4NA 3QVAA 1PG7W 4B9YA 3L54A 4ELMF 2L7JA 3KR3L 1CDCA 4XN7A 4EVNA 4WY7H 1HI6A 4CKQA 3HVDA 5HYJE 4B53A 4HZAA 4FHJA 3LNDA 4A7QA 4PJDE 5ANME 3FQNA 4WK0B 2VDNL 4ZPVA 3WKPA 3N3EA 4X99A 5C07A 4X8JB 3QS3A 2IPUK 3ARDB 3ZE0B 4PG2A 1GGYA 4JDZA 4P46D 2DIJA 4BBWA 3VFOB 2QDVA 5KSBB 4WFHE 1SOKA 4H4NA 4X9GA 1OOWA 4OLXH 1L9RA 2NY4C 3U79A 3W56A 2NZ1A 3C5ZC 4JVUA 3D18A 1FVEA 5DK0A 1M7XA 3BLKA 1OP3H 3RGVB 4L37A 4BH8A 1E65A 2H3XC 4R26L 5HDBE 3PWVB 1P7QD 1KPVB 4A2LA 1F3DJ 1JPTH 2B20A 5LWYL 3MUHL 3HNVH 1RU9H 3DVIA 3QT2A 4UV7H 2ED7A 3MRPB 5GGTA 1JZ7A 4PGEB 1N7MH 1TLMA 2ED8A 4NQEB 5EFIB 3U7WH 3Q8CA 2BCMA 3FQ4A 3BXNB 1Z3GL 3QR1A 4KX9A 1UVQB 4UV4H 3SDXF 4PLOB 1PS3A 1W0WB 4DEPB 4XNDA 3IDMA 3KL3A 1RLWA 1DVFD 3AY2A 2X70A 3RRQA 5D1XB 2VQ1B 4MXQD 4D9QD 5J11C 1ZTXE 5EUKA 3AS0A 2E46A 1F45A 3QJQB 5C2BH 1OV8A 1RZJC 3ASNB 2NY7H 4L3CA 5CXPA 1MLBA 3V0VB 2ZWNA 3UJIH 2WBKA 2J20A 3NJFA 2J1YA 5ALBL 4AKPA 2V9UA 1MHPL 1AVAA 3QG7H 3KPRB 3CCHA 2ROYA 4QAMB 5DTFB 2BOBA 3IFLL 3QEUA 3SDDB 4J7RA 4LAJH 4OLVL 4S11A 2ZQKA 1G7PA 4G1MA 3STLA 1JGIA 1S9XA 2F7QA 4GP4B 2C9VA 3E8VA 5E08H 6PAZA 4PSRA 1X5IA 4PB0L 1TVBA 2AXWA 3ZDYB 2JKWA 2ATKB 4AXWB 4DVRL 2A1WL 4G7VH 1DHKA 3MLYH 1MEXL 3U1SL 1P7KB 1LP9A 4YHKL 2J1KA 2P5WE 5HYJA 1MHCA 1I8LC 3KD4A 4Y9FA 2E9BA 4E9RA 1VGEH 1DFBL 2NY2C 4QRUA 3U46A 1GOFA 3JT2A 3FT0A 4K7PY 5KVEL 1I9JH 3B9KA 3HZMA 4M48H 1I8MA 1CD8A 1QWNA 3D39A 5AAPA 5EU3A 5IFAL 1EJOL 1V5JA 1DQQA 3LZPA 4LO9A 1KPRA 2O6DA 2EO9A 1W0VA 4NYLA 3UAJC 3T8VA 4YDLB 1VPOL 3HE7B 4HJUA 2XUWA 3CZLA 3L3OC 4YSSA 2FZ3B 1N5AB 3QRFM 2BSCA 4MA1C 1D5IL 4NI6A 4AJ0A 5D55A 2CHXA 4RX4A 1IGTB 3IFNH 1S46A 4BV1A 1ZVNA 1E4WL 5MENA 4HXAH 4YHOH 4GW4B 3HZ3A 3VG9B 5EULV 1E4XI 4LLQB 3FFCA 3KXFA 4AL8H 1HCVA 3CHOA 4GRMB 2P49B 3VX1A 5K9OA 2ICEB 3GM0A 1AOHA 3JWDL 4M6AA 1TENA 4JFZH 1BYOA 3GLZA 5KS9A 1YC8A 2HP4A 4HH9A 3HC0A 3LSOA 4QHKI 5FO2A 1H8LA 3ESOA 3L95B 3GMLA 1DBAH 2V2TA 3RA7H 5MP6H 5E6RB 2Q5BA 4N90E 2EIEA 3L1GA 1F6FB 3WLWC 5DGRA 5JHMA 5KJ7E 1JZ2A 3IBOA 2NXZC 2ARJB 1C5BH 4DQAA 3LKPB 4Q2ZA 3OF6D 4F33B 3T2LA 1YN7A 4NFCA 4UNVA 1YEIL 3KM2A 3MYJA 2FQFA 1IGIL 2NT0A 4WI0A 1T4KB 1KELL 3EO9L 4WWKA 5IK3A 1XB6A 4OLYH 3WG7B 2WANA 4BZ2L 2K1MA 2APFA 1BM7A 1HH9A 3QZWB 1NCBL 4LOVA 3PWNA 1J05B 3OKDA 5CF3A 3PY9A 1IC1A 4PJAB 3EIFA 2AITA 3Q5YA 2CIIB 5D7HA 3WUWA 4BKLB 4ANXA 1FFNA 1HOCA 1JUFA 3OKKB 4KRPC 4K5NA 1JTOA 4KHTL 4XR8C 4FLOA 4I85A 4MQSB 2XT1B 3TO2A 3PP4L 4P0DA 3CFKB 3MJ7B 4PJHA 4QHPA 2Y1VA 4P5TD 4WO4B 1JWUA 1T0PB 4YNYB 3QJUB 1KYUA 2PWFA 1I53A 4OCLC 1A7BA 2OSYA 4PJ7E 4RBPK 1FAIH 5EEVA 2NT1A 4M6OH 5CZVL 2E5EA 1HXMA 2CO2A 1T22B 1G7LA 2XZCH 4X6DB 1JI1A 3E3QC 3L7EA 2DQUH 4FTVD 4HHAA 3IFLH 1KJ2A 5LAXA 4LSPL 4I2XA 3AQZA 3A6CH 3QORA 1MW3A 3B4NA 2EIBA 3ARGC 3LPPA 2OXHA 3OSKA 4QTFA 2IDSA 3WFCL 3NFPA 3D4YA 5JQIB 4NKDB 3BSZA 3C12A 1HIML 1JP5A 2PXYC 3GIVB 1FCGA 1A1OB 1CFNB 4BSJA 4X8XA 4PEEA 1KJ2H 3O6ML 3SBQA 4PCKA 1E5AA 3VRJB 3CMGA 4GIPD 1GMIA 1P5UA 5DZNA 5SX5H 3S3DB 1P9MA 5F8QC 1PD1A 4EI5B 1OCOB 1Y6MR 4JRXA 3QCUL 5DJ0B 3WEMA 2J8HA 4OZHA 3WO4B 3KHOA 2HPTA 1IB5A 4C4UA 1A6WH 4I18B 4JPWH 4QHMB 1KFGA 4RQQA 3CDFA 1NC2D 1PYWA 5IY5B 2XIBA 3QXVA 4U1HA 3ARFA 4HW6A 2VMDA 2BXZA 3P0YH 3LDBC 2VC2H 2R0WL 5DYFA 1PCXA 1VKXA 4QWWD 3IMSA 2DIAA 4JKMA 3RFZA 1IGMH 2G5UA 4OW6A 5E2VL 3LCYA 1QRNA 3SPGA 1A7QH 1RZIA 1GMEA 4M7ZC 5I16B 2AJXH 4UOQA 2LU5A 3EDEA 4G6MH 4Z7NB 2EVFA 2NY5C 3SDAB 3SBRA 5D2NE 2WC7A 3MU3A 2P24A 2VDPB 2Y2WA 5EF3A 3NAAL 4Y2NA 5CUSH 4U0RC 3APMA 3U30C 1FORL 5AZEL 3V10A 4LSUH 2E0PA 3TO4C 3WIHH 3FQUB 1W91A 2QQLL 3IRPX 1DUZB 3UO1L 3DA0A 3KYNB 3N41F 3O6LH 4XI5C 1T1WB 5D7IB 4I89A 2OMVA 4ZBJA 4ZMXA 1WIPA 1UWXK 5D96B 2D3JA 4P49A 5I6PA 4OGQC 4ZTOL 1P4BL 2VLME 3ISWA 5LAPA 2IDTA 4F2ME 1TTUA 2WLLA 1I8UA 3KJ4B 2GT9B 1LDSA 5KG9A 1HVXA 4HWEL 5ICZB 1U58B 3SD2A 5T1JA 4XH2A 4DP7X 5AOIA 4H5SB 4NO3B 4ANKA 3EHBB 4L5FH 4U1NA 1JZ8A 4DK3A 2Y22A 2HRPL 4F15C 4NUJB 1JL8A 4FMKA 1Q4NX 4PJBB 3OGCA 2K9FB 5AOJA 4RDQF 3ULAB 4A63A 4XPFH 3P9MB 4H8UA 1QZNA 1JWSA 3H9YA 4UDUB 2JELL 5DJ8A 3CE1A 3KWXA 1QQDA 2WQVA 3S96A 4TS6A 3UAJA 2HZHA 3NZ8A 4W9LC 1E50A 3ARVA 1NEUA 5DRZA 3H9HA 4PGBB 4UTAA 1SHXA 2X1PA 2XZCL 1GJIA 3GNMH 3FRPG 3MLRL 2CR3A 2WSPA 2HVJA 5G2NA 3MFFB 3QNYB 4WHTB 1IMHC 5K9JH 4XHQA 1C5BL 4NT6B 3L5XH 2Z31A 4UT7L 2V2WA 2F18A 4MA8H 4NUGH 2CUIA 3V5HB 4LCYA 2FJFB 1GYWA 3WHE1 2NYYC 4OTXH 2OR8A 3MJWA 2CRIA 1HINL 4GW5A 3MQIA 4JRXD 4N0FB 1R3LA 5KZCD 2EYTB 4JFFB 4G82A 3ZZ1A 4LLMB 1G4MA 1I9RL 3MRDB 1LO4L 5GGVH 4FHBD 3ZTJG 5JW5B 5T3ZD 2B15A 3CFJA 4OBRA 5D5MF 1I1AA 4FJZA 4M3JA 3CZGA 4JMNA 5ERWB 5CJ5A 4KKRA 4P5TA 2HUHA 4O5LL 4JG0L 1TJIH 4AYBA 3NEXA 4UU9B 4X80L 5D1ZA 5CEYB 3AB0C 4APQD 4Y9BA 1K3ZA 4IIQB 3IK2A 4PJ9A 5CEXA 4NERA 3DTUB 25C8H 2HFEB 2KT6A 3I85A 4FTVA 1QNZL 2LAAA 2ZUSA 5GSRA 5FUCE 1XF2B 1UH4A 3OHXB 4J39A 3MOAL 4XP4L 3TEXA 4J6IA 3NYKA 4YLQT 4EDXB 2QTEA 1QFWL 3ZOAA 3QQDA 1A22B 2KZWA 5E0QA 3U82B 2NMSA 1IGML 1I3GH 3OKYA 3LQAC 4R4BB 5DCCA 5IQ9B 1UA6H 4PWHA 1QSEB 2KI6A 4E41D 5GGUA 2JK5A 1JYNA 1P4LB 1BLNA 2NY1C 4L4JA 1XIWB 4PUBL 4TUOA 4JFPB 5KOVC 1U8IA 4HFWA 1OY3B 4GJTB 1BFTA 3IDJB 1CFSA 4WI6A 3KYOA 1KY6A 4QY8A 5BXFA 5I6XB 1ZTMA 2AZAA 2XX0A 1AGEA 2PCPB 3AS2A 3UBHA 3P73B 2ZKHL 3P2TA 1BWMA 1N26A 1UOLA 2YN5A 3WEXB 3RIFF 4E5XG 4G8IA 3H0TA 5DLLA 1GTNA 2CO7B 3PWLA 1XXFC 2LR4A 3MN8A 5ALBH 5D2LA 3D9AH 3MV9A 4NP4H 2LLLA 3LKSA 2FE0A 3RURA 2NUPB 3UAFA 4BRVA 3P54A 3C09C 3D07A 3CFUA 4K15A 3F6IA 2BS71 4QHKJ 1TLKA 7TAAA 1R3KB 2VABB 3GHEH 4ZX4A 4AT6B 3I02B 1A7OH 4XVSL 4XWOC 4UAOC 3KH3A 3FU6A 2OBGA 2G30A 3BZFA 4R7VA 3D85D 1KB5L 2VERN 4MAUL 1I1AD 1F42A 2OSWA 4P9MH 4LSRH 5EDXA 4U3SA 1KNOA 5D4IA 4FQHB 3G5VB 3OMNB 3IDYB 4KI5F 1D7CA 1YEHL 1FP5A 4QPEA 4EZMA 1I4FA 1HSBB 3KXFD 1CPUA 1SQ2N 3STZA 1U95A 2MPAH 3EGDA 4FEIA 4F80A 2KLRA 1J10A 4M61B 5JHLH 4LSTL 4GBXC 1KN4L 5E1IA 3N40P 4QUOA 5AW2B 1JF5A 1SLVA 1WICA 5E1AA 3V4UH 1T0OA 4BH7A 2MQCA 5C0AB 5CGYC 3D85B 4M7KH 1VFAB 1KCUL 4A39A 2IH1B 1ZLDA 4HAFA 3SE9L 5E2UL 5F0PB 5FHBL 4BDVB 4JPVH 4HJ0C 5I73C 3WFEL 3BWSA 1V54B 4J12A 1CXEA 1MIMH 4OJFH 5EIIB 5J9PB 2AXJA 3JWNC 4JN1H 4ZFFA 3ZE1F 2C1PA 2OSXA 2WHVA 4FQLL 3LD8C 1EFQA 3BDBA 5MEOA 1MNUH 5GS0C 5CZKA 2ZICA 2WO2B 4NQCD 2HN7A 2ICCA 3RL1B 2HRPH 3J27A 3ROLA 5IEKA 1O6TA 3CDZA 4RLDA 3SPHA 4XO8A 2WXJA 4UM9A 4WI5A 3Q1SL 4MMXB 4AJVA 3UX9B 4XN8A 5CFHA 4IIQA 2WD0A 3QO0B 1OCWL 5DRNB 3CFNA 1L6ZA 1VZIA 4TUJA 1ZS8A 5EORH 4JPIB 3ARYA 4TUUA 1DQKA 3VI3E 1DSWA 4OZ4A 4Y1TA 1PEWA 1W72L 4AEHH 2RMNA 3NA9L 3UCRA 3UJTL 4XO5A 5DURB 4PWIA 5L0QC 1OIOA 3BQUB 2CJSA 3CN4A 2WKOA 3TT3L 3T9WA 4LHUB 1QNIA 2IG2H 3HC2A 3CLWA 2K70A 4K5PA 3D3VE 1KCSL 4QR7A 1E5YA 4N1EA 2WZPD 4RZCA 1F3JB 4HCIA 1QFUL 3BVUA 1MCFA 2HLAB 3F7YB 4GAFB 5FCSH 2OXGA 3VXRA 3E6HB 4XP5L 1BMGA 4LL4A 3EOYG 2MIZA 2YSTA 2ZXGA 3INUH 2WY3B 1ZHLA 2Y3AA 3ZLQC 5L2JA 1TZGH 3AAZB 5ABZA 3QFJD 5MP6L 4KY1L 3EYQD 2LE9A 5C0NC 2FEEL 3D9AL 3HAEA 1PD0A 2QVTA 4JGJA 4LEXH 3T2QA 3BQUD 5CKAA 2DMKA 3GBNH 4M6MH 4MGXA 3BPLB 1JGUL 5EWIL 2F8VA 2XIIA 3V0EA 1Q9LA 4JQXA 2FLRT 4FEMA 4GAYA 4N2GA 3TP4A 1Z0MA 4FQ2H 4NKOB 5I8KH 4OZHE 1N6QH 3EYSL 2C3XA 4WUUB 3WKQA 3MACH 5KSAD 4KKLC 3EO9H 4EBQL 4GKOA 4WW2A 5J12B 4ZOEA 3GC3A 3QJHB 4ZUTA 2K4AA 2X7LA 2WMPA 4NQED 4YDVA 3MRHA 2R69H 2FJHA 2HJKA 1S7SB 3CK0L 2EKJA 4B5EA 4NRXA 2BVQA 5ERWA 3NK3A 4JO8A 1S9YB 4LLYA 2HB0A 3RZCB 5C0BE 3GTTA 5E8EA 2UZPA 1JZ3A 1VGKB 2DQTL 4NPYA 2QSTA 3QJFA 4NQCB 4JS7A 2OJEA 1DLHA 4Y89A 2CXKA 1TR7A 5BS0E 4OFIA 3QI9A 4OJDH 5F9OL 3UYRL 4HZLB 1MKFA 1MFDH 3E2HC 4AQEB 5SWQB 5HBBA 4F5CA 3HG3A 4WTQA 5DVLA 5F7HA 5EEYA 3CZEA 3QJOA 3VH8G 2K8MA 4GH7B 4FOMA 3U4BH 4NX0A 4Q8BA 2H6OA 3BUBA 4PJDB 4RAHA 5ANMB 2EKSA 4E9YA 3NAAH 1UZ6F 1SXSA 4MD5A 4QXTB 5SWZE 4N9OB 2Q9OA 4OCRL 3VXSA 3X1FA 2PTUA 1MCOH 4IQHA 3O9WC 5J1AA 5TDNA 2CZNA 3K5RA 1TJXA 4JY5L 3T3PE 4GQPH 3WIHL 1WUNT 4J2QA 1QI3A 4XOEA 2BY1A 2RQEA 3D34A 4L0ZA 4HWZB 4JRLA 2DWYA 3EOAA 4FP8H 4KVPA 3U6XA 1ZWIA 4KV5E 3BO8B 1TEFA 4N2NA 5DZOA 2WAQA 3DX6A 1H6TA 3DK0A 2CRYA 3ZDWA 4N8VB 1T5KA 4HWEH 2BSTA 1PSKH 2Q20A 1B9ZA 3OKEB 1NFDE 1NANH 3TFKC 4EI5A 1B3JA 4K8RH 2RBLA 1CUOA 1NBYA 4KRPD 3C2SA 2VO8A 3T0XA 3QH3B 2LV4A 3ZMNA 3EXJA 1YJDL 1KLUB 4NZDA 3K6SB 4PGDA 3VGFA 1K4DA 1D7BA 3TYGL 5D5MA 3WNJA 4K2UL 4Z3EA 1I8LA 4DN4H 3OAYK 4NQCA 1HDMA 5EN3A 1XCQA 4OZGB 4C47A 1L7IH 4PYHA 3OJDA 5CCKH 5D1XC 5JW4N 4N25A 1MFMA 1NBYB 1ET8A 2HWZL 1S7SA 1AR2A 1MCPL 1LILA 4KJYB 4M62H 5I71C 2VLLB 5E8NB 4GT0A 1B4LA 3QUMA 3K2MC 3CU7A 1RSYA 3LH8A 1MW1A 2BCKB 2ETWA 2ZUXA 1K9TA 1T22A 1I3VA 1AGFB 2CBMA 3MRIB 3K6DA 1RJYA 2AJ3A 3PYCA 5D1QB 5EC2A 1Q0EA 5F8RC 4JKKA 3MV8E 3GRGA 4F7PA 4NKOA 2G2PA 2EINB 4X98A 4Q9RL 3PJNA 1C5CH 4ONHA 4P2OB 4V2BA 3ZYOA 5AVTB 2BZCA 3O6FB 4PJ5E 3OG6B 4AL8L 3ZVVA 4FA7B 5HVHB 2GVYA 1MRFL 1R24B 2Z35A 2OYPA 2YUXA 2PP7A 1QKZH 3RNQB 3WKML 3P77A 3MR9B 4G6AD 2LFEA 5ETUB 3VFPB 1LM8V 5L9DL 2NY4B 5D1ZD 5GJTL 4FXKA 1EHLH 2WCGA 3M17A 3SCMC 2KHAA 2XFGB 3OZ9L 5ETUA 5FYKL 1QHOA 5H35B 3HS0B 4DUVA 3CSYB 2GEQA 1ADQH 3T2PA 4V33A 3B7UX 1ID2A 5JHLA 4HUWB 4NC1C 3JYBA 3BI9X 4ONHB 4P2OA 1JHLH 3WJJA 3L3JA 1NAMA 4NKQB 1ZT7B 3HI1A 1MQ8A 2AJ3B 3R8QA 3DSNA 3N1QC 2F7RA 2I7OA 2FWOA 5D4JA 1KB9K 5HHOD 4AQ1B 4RIRB 4YDLC 3GIVA 2WNKA 2CR0A 3QPQC 2IANE 5HVGB 1VADB 1CICD 1HAWA 2VXSH 3L9EA 1UWEH 3TNMA 4I9WE 4DP1X 4Z7VB 4ZW8A 4UTBA 3NSDA 2EYSB 3PWPE 4YHYC 4NRXB 1RJZB 2EQDA 1A7RL 4TSCH 1IQWL 3EFDH 3SDCB 4TRPL 4LSSH 3V6BR 5I5JA 1XCQB 2F9BT 1FFQA 1HHHA 2CXGA 3B9EA 4OZGA 2EIDA 4F93B 5AVYB 4JW3A 1BPVA 2H32B 2FT8A 4YHML 4YPJA 2L7QA 3D87B 1S4IA 2G2RA 2XQYK 1U8CB 4ZUVB 5F70A 5G55A 2NW2A 1B2YA 2GABA 1MAML 4ERSH 5ICYB 1TJHH 2D0GA 8FABA 2ZX7A 4XCFL 3N50A 1OWRM 5AW4B 1RCYA 4L8DA 1PCSA 3OLGA 1CXIA 5EU6D 1MAKA 5T5FH 5JXEC 3CFTA 1OL0A 3BP6A 1OW0A 4F1ZA 2O72A 3JVGC 3MLSL 4JQXC 1TYEB 3FT4A 1L0QA 1RULH 2NY3B 1AP2B 4NSKA 3CH1B 2D7TH 3RTQA 2FX7H 5F6IC 1E4KA 1ZE3H 4RMSA 1AO7B 3IGFA 5KWYC 4WWKB 4JM4H 3LQMA 3IMVA 4MAUH 4YIQB 3ZKXC 4HETA 3LKQA 4ONFL 3VXUE 1ZSDB 5DO2C 3CSTA 3EJRA 1G9EA 5IHHA 5E1AB 3HKFA 5I66A 2VR5A 2ILLA 1F0LA 1YEHH 2BSEA 3RWFA 2OA9A 5I1CH 5FYJE 4R7DB 2IBZY 3L4CA 3W9EB 3WGVB 5JHAA 2UX6A 3MV7E 3ENEA 3MBWB 5DDHA 2IBBA 3CLEL 1YNTB 1HEJC 1CXKA 3K72B 5DFVC 3WS6A 4R97C 4M43H 3E6FB 4IU3A 2FX9H 1N5YH 3WIFB 2VLJE 3JV6B 3KYMB 2G2NA 2O6PA 4DIXA 4TOYH 3BRDA 1ECYA 3FO9B 4MAYD 3H4HA 4Y2DB 5JORB 3OLEA 3MXWH 1KGXA 2YC1A 1MUJA 4IDJL 4OGAD 2NCMA 1FO0A 1QHPA 2EXWC 3QIUC 3ZDXB 5IGXL 1EAPB 3EUDA 5ADPL 1UM5H 4Z7UA 1SXCA 3LQZB 4M5SA 3ARBB 4FF9A 1NMAL 1U33A 2VW4A 4S1DC 2DYRB 2IGTA 4MRBA 2JJSC 3S4SA 2GUOB 4ODWA 3AW5A 2CUAA 1BGXL 2VXUL 3DBSA 3U25A 1DO5A 4WW2B 3R0NA 4RSYA 4Z3JA 1A7OL 3O4LE 3QCTH 4XVSH 2J12B 2DQHH 4NQEA 2KQNA 2A83A 1FLTX 5I1IL 1I7ZB 1SZNA 1FJ1A 1WV7T 3EHBD 4OKDA 1S5HB 1CT8A 5BS0D 5DURD 5GS0D 2BHUA 3A6BL 2QZQA 1JPGA 3FT3A 3GJEB 1B4JH 4TNVK 4YOKA 1BZOA 1ZT1A 5HJGA 1RV6X 1ED3A 1YMHA 3BWAB 4OJAA 5ISZA 3GSOB 1OAXH 3HRZC 3OG4B 3EH3B 3NOIA 4F7TB 3L4XA 5TTRA 3QORD 5I2IB 1FZJA 2V6HA 5E70A 4G5AA 6TAAA 4ALAH 3U2IA 3HN5A 1G7PB 3TT3H 4ZXBB 2VITA 1RPUA 5GRXG 4MXWL 2MKLC 1JNNL 3K6OA 5I0XA 3W38A 2WXHA 3DPBA 2DICA 4GXFA 1QVOB 1I1RA 4TV3A 4R7NB 4FTVB 3GMMB 1AO7D 1MFBH 3X1GA 3IJ7A 2VE6B 4XWGH 4JN1L 5C86A 2JELH 4JAMB 4POZD 4ZMAT 2ZCLL 3D09A 4F3FA 3MBXH 4N2IA 2BVOB 5DVKA 4P5TB 4WO4D 1NMCC 4AYFB 4GRWE 4L3EB 1KYOJ 3MNZA 4HGWB 1KEMH 4R90L 2VMCA 5T5FL 1JRHL 4KKQA 3LPWA 4GQ9H 4LEXL 4TVPD 4R7XA 3ZO9A 5B8CC 2NLJB 4U4BA 2NY0C 1NC4B 4UT7H 1OHQA 2CO7A 3PWLB 3BP7B 4WI3A 3R0MA 1OT1A 5AW5B 5HVWA 1H0DA 4QXVA 3WENA 4K3JH 3CDZB 2NY5H 4IRJA 2HX9A 4I0KA 4D3CH 3RL2B 3CZFA 3KYOB 3ILPB 3SYQA 1PKQE 4KGLA 3TBSB 5EUOA 5F0LB 3O3EA 5LN8A 3FAWA 3MLZL 4DKFH 2APXA 1ZLSL 3VFNA 1B0GA 2JK5B 2VDLB 4ZRGA 5T5NG 4PY8I 5DS2A 1CI5A 1M4KA 3F7QA 3DROB 4IHOA 4BCZA 1CGUA 5DYOA 4JQIH 3QNXB 4HS6A 5KSBA 2P5ED 4U6YA 5EZOL 1UZ8B 5I1KL 4FQXA 4V1DA 2Y6SC 1KXHA 1X9QA 2AJSH 3DOHA 1MHPH 3QG7L 3LH2L 4IBTA 1IGYA 2V7NB 4J27A 3W5MA 3LTVA 2QZ5A 2IH3A 3HG1B 4XCEB 4F7MA 4ZPVB 2TRHA 3KS0H 2OR9L 3AXLB 4X6CE 1ZJAA 1JZDC 4XPGH 5FKAA 3NGBB 1A3LL 5GGSA 3TEWA 1RULL 4EVNB 2BFGA 1CL7L 3FYEB 4K71B 4NQSB 5BRZD 1MCRA 2Y7MA 1R3IL 2ZOLB 3FFDB 4GNKB 5F88A 4XZUB 4ZSOB 3NRPA 4LAQH 5CS7A 5D7IA 3WE6A 1AR1B 3FH7A 2VXQL 5ENWA 5EIIG 1JGVH 4HSAC 4GW5B 1EUUA 2UZYB 3G6JB 5IMLA 2NUPA 4XBPB 5DRWB 4IS6A 1JNHA 2BDNL 2A6IB 4EJ1C 1KFAH 1ADWA 1AQHA 2CCVA 4NWUH 2ZOLA 4PGCB 3KHQA 4NO5A 3TBWA 5DO8A 1BFSA 2YRPA 1LWRA 3T4YB 4A37A 5JTWA 4OM0H 5EN2B 1FAKT 3KVQA 1MFNA 3OHXC 4J4PA 3UH8A 1CICB 3D12B 5L8KB 3KYKH 4X9FA 1GZPB 4PJGB 3S8WA 4K2UH 3MODL 4N2CA 5BRQA 1PIFA 2VN5A 1MVYA 4IKJA 4LSRL 2DTSA 2WYTA 5C0EA 4CW1B 4GG6A 1QSEA 1RZPA 1BQSA 3A0OA 1RZFH 3SB3A 1QASA 3L3OA 5EU6E 4NQUA 3RYMA 2DQIH 4Q4EA 1K8DA 2K78A 5CIPA 5IJDC 4NJ9L 5DFWH 3NH7H 1HHJB 3BEWA 3V8CA 3KH4A 4YH6A 3WV0A 1P5UB 5CJ8A 3QXUA 3O3EB 4TNGA 4MNQB 5IVXA 3BH9A 1GC1L 4Z7UE 5AWNH 8CGTA 4ONOA 2B7DT 3SE4A 1PW3A 1MJ8L 4Y5VB 3N1MC 3PNWA 4G1EA 2J8UA 3KYNA 2Y6SD 2FH8A 1HXYA 5I8EA 4HPHA 4HUKB 1ZMYA 3IDGA 2R15A 5DD0L 4YXKL 2NY1D 2XFXA 1I1AB 2BZDA 4H13C 5GJTH 5T1LA 2H6UA 5J1SC 1PSKL 2X9XA 3WKMH 1HL4A 1S8DB 2X28A 2ADIA 4PVBA 3QDMB 1O6VA 1FPTL 2G5BA 4LLWB 2L8AA 1HKFA 3TBBA 3MJ6A 1K5NA 3GXPA 2BVOA 4KVNL 5D7LA 5FM4A 3VGGA 3GZPA 1OSYA 3AJ7A 3FUKA 4JRFA 2WW8A 3LQAL 3T6VA 2V33A 5DD6A 3LRSB 4EUPB 4ODHL 2EDLA 4F37K 1I8IA 4XCCH 1S7VA 1JUFB 2ZCLH 1KGJA 4JFYB 1RI8A 5DHMC 5FPIA 2F5AH 1WTLA 5IFHH 4UILL 1XGYL 3ABZA 2HWZH 3BVWA 4RQQB 1AYRA 2APVA 3H9SA 4LDEB 4PJAA 4WI7A 1QWHA 2QGCA 4JQVC 3O2VH 4NBYB 1GR7A 1X44A 2VXSL 5CIPB 1CXLA 1TT6A 3QUXC 2MOVA 3B5HA 2YXMA 2X0UA 1TZOA 2AF2A 3CU1A 2BVUA 2XCMC