2EDMA

Crystal structure of envelope protein vp26 from white spot syndrome virus (wssv)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
161
structure length
161
Chain Sequence
b'SVVANYDQMMRVPIQRRAKVMSIRGERSYNTPLGKVAMKNGLSDKDMKDVSADLVISTVTAPRTDPAGTGAENSNMTLKILNNTGVDLLINDITVRPTVIAGNIKGNTMSNTYFSSKDIKSSSSKITLIDVCSKFEDGAAFEATMNIGFTSKNVIDIKDEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 22kDa structural protein VP22
publication title Crystal Structures of Major Envelope Proteins VP26 and VP28 from White Spot Syndrome Virus Shed Light on Their Evolutionary Relationship
pubmed doi rcsb
source organism Shrimp white spot syndrome virus
molecule tags Viral protein
total genus 32
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2007-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2edmA00
2EDMA 2ED6A
chains in the Genus database with same CATH superfamily
1ZGLM 1JPTL 4G83A 1IGIL 2OCFD 4MWFB 1DEEA 3HZVA 5E95B 3EYFA 1Q90A 4Z77B 3HLKA 4U7KA 2Y4SA 4BSVB 3D87B 2JIXB 2WTRA 1U8IB 4UQEA 3S5LB 1C08A 1KIRA 2ED8A 2UV3A 2OTUA 5LGHL 3MO1B 1PQZB 1Q94A 1NJ9A 2E7HA 2IBBA 2KC0A 2VDMB 2ZOKB 3GO1L 4J4PA 4JO2H 3LZFH 2CDEB 4LCCB 4FQQB 1DVXA 2D7MA 4YK4C 2RCSH 4HXAH 3IEAA 3DIFA 4B53A 1EMTH 3BAKA 3GSNB 3CHRA 3S35L 3H42H 3OAYK 1CFVL 5CUSL 5F7NC 3T0VA 5CZKA 1WGOA 2C9AA 4FQXB 1QWHA 2XTLA 3DURA 3FRPA 3SE8L 4YDLB 4D0DA 3FFCB 1U3JA 3EOYG 3L7EA 4A6YB 3CUPA 2O30A 2XWZA 4C56D 2VSKB 3OR7B 4UMGA 3QNFA 4EI5A 4JPKL 2FEEL 1MWOA 2VDMH 3BH4A 1ESOA 4N0UE 5BNXD 3AM8A 1TNMA 5LQBL 1YEDB 3T1FB 2W8CA 1SEQH 3GDBA 3RWJA 3ARTA 1M9SA 2HX8A 2MTPA 4L8CB 3RWHA 2FBJH 3WUWA 3VXMD 3O3BB 3PPSA 5B1JA 5IFHL 1CFTB 3ULUF 2ZG2A 5IUSA 1GPOL 1TVBB 1UB6A 3VJ6A 4JQIL 5KJ4A 1EJOH 4A6YH 2NLJB 3FT9A 1KGYE 5LJYH 1H3UA 2NXYC 1MCBA 2WTOA 1FSKC 3ARWA 3BUIA 4KKAC 2VSMB 2E9IA 3L8QA 3PP3K 4L1HA 3GIVB 4ZTPL 2QGDA 4EZKA 2VDLH 3OSVA 4LOUC 3BXNA 3MLTA 3GYRA 4HFWA 3N0PB 4NM4H 2A3TA 3UTQB 4Y1AD 3VXQA 3OLEA 2VW6A 2Y7MA 1BVLB 3CJJA 3KNBB 3QWOB 2Z7YA 4FQ1H 4HCRH 3UOAB 5IESL 2FIRT 2J1YA 4GSUA 5FLUA 4JREB 1ZWIA 4N6RA 2ZXDA 2JE8A 1GIGH 1K72A 1NDGA 3CDCA 3MLYL 2VE6B 1FFQA 5T5NF 4QHPA 3VE0A 3QXTA 4NBXB 4A2LA 1KBKA 1D5XA 1T83C 8FABB 3WKNA 4UZSA 3ZDZF 3KBPA 3NPSB 4UYQA 4O5LL 4PLJD 1JZ6A 2WIIA 3RG1C 2R2EA 4BHUA 5GGQH 4Y0GA 3RHWK 3K46A 1BSIA 2CA3A 1D6EA 5AVUB 4DN4L 3QZBA 3WJLA 2E6JA 3WEAA 5KSBE 3FQNA 2IF7A 4L2YA 4B9CA 5CD5D 3QEUB 3SZ6A 4WI6A 4C56A 2YPKA 2B2XH 3V4UH 1SFDA 1RMFL 3E2HB 1BZ9B 1HHIA 1CFSA 2H0PA 2E9BA 1AI1H 1XCWA 3QEHB 3P2BA 1KTRL 3SYQA 2WNGA 3SKMB 3BP7A 1QEWB 1MFNA 3W5NA 2DQFB 3HS0B 4UOQA 3U4BL 1S7XB 5F9JA 4X9IA 1U93B 2HLEB 5ILTH 1AR1D 4WSJA 3GBEA 5FKAB 3VXMA 3V6BR 2HH0L 4XMLL 3WU1A 1DSWA 4OFVA 4XHJD 5L7XH 2F08A 1PNCA 3MUY1 1CUOA 1F58H 3D4GA 4Z0BL 2B59A 2BNRD 2HFGL 1KULA 3BSZH 5E2TL 2WZPD 4GUCA 2FR4B 4HU2A 1UOWA 3KH3A 5GSVA 5FO9A 2V5YA 4TRPH 1ZSDB 2NY1D 4Y1AA 1YEKH 4I77L 2NNCA 4PCSA 5ID0A 5J13B 2E76C 2J25A 3QXVA 2VGLM 4ERSH 3O3EB 3Q6FA 4YSEA 3I6LD 4ZMXA 1AHWC 5B38A 5KYUB 1BCIA 1YZZA 4K3DH 4HHAA 4ZX6A 1KIPB 2PCFB 1L0XA 1FGNH 3O2WL 5KSVB 3E9TA 3BO8A 4I5BB 1J0KA 5IMKA 4OD1L 4RMBA 1H15A 3QCUH 5EIVA 4AITA 2V3DA 1DSYA 2Y36H 3DKHA 1FCCA 3MQIA 5DJDA 1VRSA 2DBJA 3OHXC 4U1NA 2AK4D 1LP9F 4ZODA 1BEYH 2A2QT 2R2HB 1C1EL 2N0MA 2MCMA 4PCYA 5LG6A 2FBOJ 3ULUC 4PJCB 2D2CC 5EC2A 5GRJL 1KCRL 3BUPA 3PDOB 4R90L 4XC3L 4HYTB 1EEUA 3FULA 4XCFH 4AYMC 5G5DB 1I7TA 4PR5B 1OGAB 1N0XL 4WFHD 5LAPA 4EDXA 5BMFL 1SHWA 2GB2A 3F85A 4XNQA 1HZKA 3QRBA 1M6OB 4ZTEA 5IQNA 1QKZH 2BNRA 1N5YH 3ATFA 1SXZA 4JGMA 1GCFA 2VISA 4CU7A 1A4JA 3VFVA 4HA1A 4MVBC 3C5XA 4CVWA 1KPVA 2UWEB 5HHVH 1HC1A 2JJSA 5FB8A 2LVCA 3FOMA 1S9VA 3QDGB 2F19H 5DEGB 4RFNC 4DWHA 1BQKA 2ALWA 5AVQB 2CDGB 4D8PB 1CLYH 4AYDC 4HG4J 5B7FA 4QY8A 2Z93A 5C0CD 1TO5A 3K7UA 3OKOB 3GUTA 3L3GA 1PD0A 3NJXA 1VERA 4PRID 2F53E 2R8SL 3RY6C 1T6BX 1FVDB 2BC4B 1X5IA 4HHGA 5A7BA 2YR3A 1OW0C 2J1WA 3AMLA 4HKJA 5DZJA 2QT6A 5EZLB 4BSWB 4RGOL 5I19L 5IVOA 3EJQA 4LPCA 1NUGA 4PJEA 3V9CA 1URZA 4P3CL 4MQXD 2DWEA 2B3IA 3SDXF 2AK4A 2VUYA 4N9GA 4P59H 1P4IL 4KGJA 4HPYH 3IS0X 2H1PH 4PRAB 4FTVB 3SCMB 2NY0B 3MGTA 4M7LL 2P52A 4HZLB 2DTMH 1USZA 2UYLA 4KTEL 4XBPB 4AE0A 2IADA 4PJ5E 4PJ5B 2E6QA 3O4LE 3QORB 1N9PA 2H2PD 2OSXA 2DJSA 3O0RH 4ZMYA 3PAUA 3B2XA 3O4LB 3APDA 1AGEA 2X6UA 3GTTA 3MOAH 3GT6A 3U0WL 1I1AB 5CJ8A 1AYRA 4MA7L 4R5TA 3WDIA 4EZMA 1KYOK 4YDJB 1MCNA 3TVMC 3UZEA 1A1MB 5LBSH 2ICWI 3GMLB 1LQBC 1XF2B 1CK0L 4QR7A 4L9DA 1LE9A 4ZFFA 4HJJH 3FONB 4S1DC 3SB3A 3WNKA 2G60H 4NRYA 5EZOL 4FA8A 2FX8L 3GI8H 3E8VA 4M6NL 2BVTA 5D4QA 5D9SB 3SQBA 5FOBB 3IYLW 4MDIA 3WTUA 3CFQA 3IN2A 2ADFH 4HBCL 5C0CA 3KPRB 3U83A 3Q2CA 1WO2A 5C09E 1HCYA 2D9QB 2VLKE 2W9DH 2YD1A 4ETQA 1U0QA 3DVNB 3IE4A 4PRIA 2M2DA 3MXWL 5C09B 2VLKB 3OGCA 5L0QB 1OSPL 1WBXA 4R7NA 3WKML 2MQ0A 2NOYA 3B56A 4Q6IA 4BH7B 4D3CH 4JQXC 4H26A 3QHZL 4MXVE 1HEZB 3SDCC 2W07A 1U2YA 5TDOA 3NZ8A 3WL9A 1E4XL 4HUKB 2XTJE 1VZHA 2D3NA 4X42A 2LE9A 3SY0A 2Z8RA 2XTJB 5C0AE 1MH5A 2MTAA 2ZWYA 1MF2L 2JELL 3N85H 1NMAH 4IKLA 5TH2A 1FNLA 5C0AB 2XXCB 4J8RB 1MPAL 2FLRT 4P2OB 2YJQA 4WNJA 4EI0A 4C57C 1G9NH 3V52H 4NFBA 4NKOB 2BVOA 1QRNE 1ID2A 1UUNA 2ISDA 3QHFH 3PG2A 4O02B 3GHEH 3LRMA 5IOKA 1TTFA 5C0DB 4F7PA 2HMID 1KGIA 4MQ7B 3WJMA 3QZPA 3ARGB 2EO7A 2VLME 1AJ7H 2ED6A 3D2UD 1BF5A 1OTUD 1RJYB 2J57A 1FG9C 1CR9L 1Y6MR 4PLOB 2AABH 1HKFA 3TO4B 3B2VL 4YO0B 1JZEA 4E9LA 2VDRH 1OD9A 1U9KA 1EO8L 3S2AA 5JIQA 5FGSA 4E9YA 5FYLE 5CR1A 2DB8A 5I5JA 3PL6B 1E4WL 2WAQA 1I7UB 3EOBA 3IXAB 4Q0XH 1E4JA 2NPLX 1SJHA 4U1SA 4XXDB 2C9SA 3GXUB 4JDEA 1ICTA 3NJLA 4N8VG 3ZDWA 5E23A 3U2JA 1A7BA 4IM8A 3ZZ1A 1I53A 4C83A 1VKXA 3VXUE 2CM5A 4NN7C 2VIRA 1HHHA 4BQBA 3FN0H 4LGRB 1JGEB 4B3EA 1D5MB 3AGWA 4QHMB 2F15A 1X5XA 3DJSA 4NQSA 4OM0H 2NUTA 4G1MA 5A43C 1OEZW 4PJ9B 3LEXB 4NNPH 1DVQA 4GO8A 3HB3B 1PG7H 2E7LA 1BIHA 5C08E 3OLDA 4KK6C 3REWB 3V0IA 2FQDA 1SEBA 1SDDA 3AC0A 4JY5H 1PZ5A 2XBDA 3DUSB 4U6TA 5BOZG 2FATL 2BCKA 4R4FL 4MD4A 4JZNB 3VFOA 1PSKL 2OXGB 4J3VA 5CO1A 4QXUL 3T6WA 3VG9C 1BREA 1P9MA 1MCPH 5EZJA 3IJSB 4Y4FC 1PKQE 2WQSA 4HMEA 1AGDA 3TFBA 3D2UA 2P8LB 3QH3B 3L9EA 5EPMB 1MFEL 1ZLWK 1BM3L 4Z5RA 5A7EA 2FWSA 2ZOOA 5EMYA 3WMSA 5I71C 2GTQA 3EH5B 1HILB 4Y5VB 1XZ0A 4O51B 4OI7A 2VXUH 5E4EB 1XGYH 4QT5B 2BVPA 4M62L 1VENA 5AW0B 4KTYA 3RVTC 1VPOL 4DVBA 1WFMA 3D33A 3QJVB 3TV3L 4MX7B 3KCPA 4P48A 3IJ8A 3V4VL 1H3XA 1KXTA 3RU8L 3TNNB 4H25B 5EZIH 3GBNL 1NEPA 4F20A 4YSQA 3QJHA 2Y72A 4X6CA 4EXPX 3E3QC 4CVXB 3K2UL 3PGCA 5ESAB 1S7SB 3IVKB 4ZD3L 5I6XC 1A6AB 3CPLB 5CGBA 1X6NA 2ZSWA 3AXLA 2A74B 5EU7C 1AACA 1ONQB 1A47A 2OXHB 4Q9QL 4K71B 1NEZG 1Z9SB 3TO2A 2ZOLA 4UQ2B 3ZKXC 4HLEA 3HC0A 4OCXH 2DLIA 1H0DA 2WW8A 4CRPA 5D6DC 3VX0A 3NZSA 1UH3A 2XKUA 4UQCA 4QRRD 3PJSB 2CHNA 5I0XA 2BPBA 2IV9A 3LKNB 1RUAL 4IOFC 1BBDH 3QFJD 3D7PA 4XMWA 1RVFL 3BHBB 1CBJA 1V27A 2R0ZL 5BUPA 5EIIA 3VG0L 3VWKD 4DP8X 3MRIA 4WSGA 5ICYA 4H8PA 3CFEA 1SBBA 2BLFA 4E68A 3P3SA 4RNRA 3MRRB 2BP8B 4MSWA 4CC4C 2I07A 2VAAB 1KCWA 1TVDA 5IKCB 1BBJB 4ZS6D 4LARH 2NNXA 4M8QB 1XL6A 3TJEH 4BUHA 1IFRA 2IQAB 2AJUL 5CSZB 2DQDL 2ORBH 2BCMA 2KZBA 1AR2A 3PUCA 3FQXA 1WC7A 3SPIA 1FWXA 4G6JH 3PWUB 2Y3AA 1OB1A 5E08H 1XR8A 1EAJA 4E5XB 3MLZL 4RMWA 4UZGA 1B4TA 1QI4A 3NCJL 4JFSA 4CC0A 3MRGA 1T4WA 2XKSA 1EHKB 3A0OA 2LLLA 3TZVB 2WINA 5B1KA 5GRJH 3MNVB 3T0DA 2B1AL 1X5ZA 4L4TD 4R90H 4E0RA 1GGYA 1HNYA 4P9HH 1UWXK 4PP2B 15C8L 5FGBA 1B0GA 3CWGA 1HXMB 1WIUA 2XT1B 1U8MA 1NFAA 1XH3A 2ZT9C 35C8L 4NC1E 5HJGA 2Y1AA 4NSKB 1Q0YL 1ZHLA 2DM3A 4WJKB 3JWNC 2VM4A 5ANME 3OAYH 5HD8D 4QXGH 4MJ6B 3IFLL 3MFFA 3SHSA 3TH2T 1GY1A 5I82A 3WFBH 4LVEA 3DECA 2QEJA 1HH9A 4GG8B 4HUNB 5CD3A 1FH5L 2UY6B 2X42A 2VDKB 5G55A 2JKNA 5SWSD 2J8OA 3QZWG 4BE6A 4QRRA 1CDUA 5EFIA 2H3XC 3C08L 3DX7A 4F9LA 3R1GL 4UQ3B 3MJ8A 3QFJA 3M1BA 3U9UA 4WY7H 2J20A 2GT9A 1WF5A 2A73A 3S37X 3V5DB 4WV1A 5EH1A 1QPKA 2PPCA 5C07E 4ATTA 1HJCA 3VWKA 2OLDA 4IOIA 4N4YB 4B41A 1Q9WA 3KYNA 4G1EA 4W81A 3RURA 5INDB 3D07A 4MAZA 2O5YH 1G87A 3N1MC 1R75A 1FPTH 3LIUA 2AV7B 1SOKA 1F4WH 3ECWA 5DUMH 5DYOA 2XOTA 2VDKH 3O6FB 4TQEL 2R8SH 3ARDC 4JHAL 1K8IA 4J3TA 1GJUA 2X7LB 2YRPA 3OKNB 3RL1A 1BA9A 2NYYD 4NP9A 5KBMA 1RU9L 1XZWA 4HDIA 3VFNA 1W6LA 5I8CB 1JGIA 1NCTA 5DVMA 1DBML 4UAOC 1J1XL 4A04A 4J28A 2AV1B 4OLXH 2W38A 3CSPA 1NGPH 1KOAA 3NP3A 1AFVH 1HINH 3VXTA 1Z5HA 3VFGL 4HPHA 5AZEH 2YLKA 3BEWA 4GMTL 4G9DB 4L4TA 5T3ZE 1I8UA 3BN9D 4OLYH 5HHME 3GJFK 4LEOA 3F7YB 4GQQA 1X7QB 5B4MD 3BD3A 1LNUB 4H0LC 4LSVH 2EDRA 3JVFC 4ZSOA 5CEYB 4QJ4B 4KMTH 4OKDA 3STLA 3MRJA 2H9GA 3H9ZA 1RUKL 5SWSA 2GIMA 5SX4I 2DKSA 4NO3B 5IV2B 1FZOB 4XAKE 3UBXB 4HT1L 2FO1A 4PEEA 1ETJA 3TP4A 4JPVL 2GJPA 1UOVA 2I27N 3HMWH 3M17A 1K2DB 5DQDL 3SY6A 3J07A 5KAQG 1UADC 1F3JA 4HBCH 4UV4L 1S7QB 4YSDA 2LU5A 4NQEE 5IQMA 2ZKWA 3G5YB 4L29A 4N5EC 5HGDB 2YZ1A 4RIRA 4HJGA 2IMMA 2APSA 4DQOH 4RETB 3V6FA 1PLGH 4LT7A 1BJ8A 2V6HA 2AQ2A 1VEPA 4KK5C 3NN8B 5JIDA 1EIBA 1IZKA 1E4XH 2YXVA 3RVUD 4HUXB 2WCPA 1WFNA 1T5XB 3IPEA 4B95C 5CJOH 4CN1A 5BS0B 2FJGA 4GXVH 4L5FE 3HHSA 5T3XL 4PU2A 1JZGA 5EO0A 1M7IA 1KLFB 1RZGA 4G3YL 4GPVA 4TL4A 2X4RA 1TZGH 1NCDH 1ZXKA 3SGDI 5C0JA 2DIAA 4PJFB 1BG1A 1LMKA 1RJLA 3JV4A 4BCYA 2XWDA 4FFZH 3B9AA 2G75B 2WWNA 3V7MA 1AY1H 1NZRA 5DMGD 5MEQB 4HS3B 5AZUA 2G5BB 3GNML 4UDTB 1W15A 2JI2A 1FFOB 1ZA6B 3MA7B 1MHHA 2TRHA 1HQRB 1XFPA 3LKRA 4P5SA 5HDRA 2YXMA 3I2CH 1T1XA 2N0KA 1YNTA 3CVHB 3UAJC 5D8JH 5DD5L 3WDJA 5IHZA 3C12A 4LXFA 4QHUB 3M8OL 3QIUD 4J5VA 4QAWA 4XOCA 2LV4A 3BQVA 1BYOA 2CLZB 3IN0A 4FA6A 2E47A 2VO8A 5BVJB 5AOIA 1B0RB 3SYOA 3TA3C 5EBGA 3AG4B 1GS8A 1SQ2N 4U1KA 1T20A 3VM7A 1PLCA 1J87A 3EHBC 4HWZB 5J9PB 1OY3B 3D0VB 1FL6A 1Q9KA 4MHHI 2NXZB 1S7VB 3SPHA 3TOPA 1KELL 2PW2B 3TT1H 2GHWB 3CVHH 4RVBA 3VXSE 5D7EA 4Q6KA 4KBPA 3QYMA 4ZUWA 2I24N 3V4LA 2AITA 3VXSB 2EDTA 3WN5B 2HRHA 4JRFA 2F54D 3EYQC 4X8GA 3Q9QA 4HD5A 5DUJA 3BQUC 3EG9B 3WIAA 1CDIA 4UF7C 5E6IC 3H9YA 2DWDA 2QADB 4RMTA 3RWEA 3ULVE 2M1KA 3VXOB 2OTWB 5JOEA 3LX9A 3K6SA 3AG2B 4WI0A 3K6FA 4F8PA 3KLHC 3Q7JA 2CK2A 4FLHA 3IETB 5F88A 3LN4A 5C71A 1C12A 5EB9A 1M57B 5I66A 1A5FH 1WT5C 5J8OA 4PWJA 1F3DH 4UTAL 5KSAC 2OULB 2IV8A 1U2HA 3H9HB 3P4NB 1BD2B 4IYKA 4BFRA 4CL7A 4H8WL 1MXGA 3BRDA 1FYTB 2EVJA 1LL1A 4EVNB 2GUOA 4TV3A 3QIUA 4AQ8C 4Z7QF 2PW1B 2VR7A 4P46B 3HPJB 4HKBB 3S3BB 3H0TB 2BRQA 2NMSA 3BP4A 3B9KB 2HJLA 4I1NB 2BY0A 2W95A 1V5JA 4NYLA 1L0YA 3VQ2C 4ZXBB 2O5ZH 4OJAA 2HKHL 3O2VH 4ZUSB 4FXGB 3T4AC 3DUUA 5DS8B 3MUUA 5DZPA 5KYYA 2MPAH 5B3JF 1AGBA 2WBWB 4PJGE 1ZJBA 5EU6E 5BV7H 4HIQA 5DXWA 3VI3F 1A4KA 3GRGA 2R69H 5CLTA 1D5ZB 5I1DB 4FFVC 5EU3A 5CILH 2F54A 3UYRH 4JMNA 3UTTB 3GGWA 4G6AD 3UO8B 2R2BA 1LO5B 2WXHA 4L4VE 5C0IA 4HAFA 5AB9A 4AV0A 3IM1A 1OCCB 5ADOH 2CK0L 5DJAB 4JFEE 1CE6B 1JZDC 1AZRA 2EILB 1XSKA 2BWDA 5D1QC 3F00A 4JFEB 3KD4A 2K9FB 4OUUB 3GJFA 4AYEC 1BWMA 1MRFL 3QQ4B 2J3SA 2WJ7A 5AG8A 3MAWA 4OZ4B 2F7QA 4NQCE 4TNEA 3L3DA 1SF3A 3EIFA 4MNGB 3M7OA 5IIEA 1R5WB 4FHJA 4KZ0A 4DAGL 5K39A 4NO5A 2M8XA 2EZ0D 5DHVA 3FT3B 5JPMC 4MA3A 1AIZA 1MW2A 3MODH 2YSSA 4IQHA 4TSAL 4OV5A 4S1SL 4U4BA 5F3HA 5GRUL 2AVGA 3ZTDC 2X4NA 4UIMA 1TT6A 2Z31D 1JNHA 1LO4L 3G5VA 4XNYH 3VWJB 4FNLL 4DFHA 5EEWA 5JQIB 4H1LB 4OCRL 3ZZQA 1E27B 1EEYB 3VFMB 4D7BA 2MHAB 2WMPA 4LSSL 3MLZH 3KDMB 1YEHH 4QXTB 4YDIH 1EVUA 1NKRA 2PPEA 1ADQH 4GRLC 3JWOC 1G9ML 3RB7A 3ZE1F 2VZOA 4OSUH 3UO1H 4MRCA 4OKVA 1QFUL 1TDQA 4OCLC 1RLBA 1LK3H 4B9KC 3L3OB 2NDFA 1KXQE 2GC4C 4P23B 5ICXB 1A2YB 1EAOA 3U0TB 1RZJL 1IGFH 1JXKA 1JG9A 4Y9FA 4HPOH 4PY7B 1JZ5A 2P28B 4ONFH 3CDGA 1BZ7A 2EJ1A 4H1LH 3NIGF 1IM3D 2ZXEB 3LIZL 4ZMLA 3LEYH 1KJMB 1AP2B 3NABL 5JUEH 2WCGA 5AW2B 1BZQK 3O3DA 1U42A 4JJHA 5TDPA 4G8IA 4H44C 1P7QD 4V11A 5FA4A 4JQVA 2AAVA 2HRLA 1MG3C 3LVTA 4MBOA 2EXWD 1UD4A 3WO3B 5TQ0L 1UVQA 3CN0A 5DD6B 1EDYA 1F3DJ 2DQJL 3CLWA 4QOKE 3STZB 3VSTA 3WJJA 1BQHA 4A7TA 1D7DA 4JG0L 4AZ8A 3QXAB 3QZLA 1R3HB 1QR1B 2Y2WA 1IGML 2ICEA 3T3MF 3NJMA 3DPBB 5FECB 1SHSA 3D09A 4FLRA 4NB7A 4XVJL 2YQBA 5DC9B 5LAXA 3GSNL 1DZBA 3VSQA 2NY2B 3QO1B 4Z77A 3PJLA 1NC4B 2A83A 5DVNA 2Z31A 1X5JA 2RALA 3Q3GA 3Q5YA 3WFEH 1F2QA 4AT6B 2FSEB 4GXFA 5LXGL 5I18L 4AEFA 3GS4A 3WY4A 1RHFA 3GSQB 2OL3H 2JB6B 4K9JA 3GMQA 4K94H 3S4SA 4LCCA 2CDEA 4APQB 5K9QI 1W91A 4N1HB 1P7KB 4MDJB 4JJ5A 4M1DL 1ZOXA 3CFCH 3KLSA 3OKYA 4O2EB 4MZ3A 5EUOB 5EOCH 1OTSC 4JVPA 3ZTEA 1VF5C 4XP4L 3NK4A 5B22A 3LZRA 2QGBA 3ZRFC 4HP5A 4LCUB 2NZ9D 3BPOC 4QO1B 5LGYA 2XJKA 3RZCC 2JCCE 1IM3A 4TVSa 5T33H 3TJHD 4G7RB 3LSOA 1FFNB 5BO0D 2F8IA 4YHPB 1ZLWH 32C2A 1CS6A 1RUKH 5ABDE 1JHTA 1MQ8A 1YEDA 3CGTA 4N0UA 3QZOA 5JORB 1P7QA 3IKKA 3MV7E 1T3FB 3D39E 4K8RC 4A7GA 4YX2L 4IBUA 1KTCA 4RAVB 3I84A 3MV7B 3D39B 1QYGH 4ADIA 1WFTA 1CFTA 4GAYB 1TYRA 2WQVA 5H2BA 3VB8A 1UM4L 3GFUA 4YSUA 3QDME 7PAZA 4AK2A 2X1OA 1P0SE 4YHYB 5MP6H 3BAEH 2V4LA 3I6KA 3QDMB 3F01A 5L4JA 3TCTA 2CKNA 4NNYA 2DLHA 1S9XA 1PCXA 1PD6A 1WA0X 4FLQA 1B3JA 3AGVA 1MAKA 3GIVA 3N2JA 5DUBB 5HHQB 4ODTL 3WLBB 4ZPTA 1U3HD 5H94A 1A7OL 2JJTA 3VGDA 1S78C 1BVLA 3KNBA 4F37F 4JM0A 3QWOA 5D2LF 5FYJU 1JK9A 3VTMA 5AB0A 5E8DL 2E75C 3L7FA 4FXLA 4KVCL 1DN2A 4WW2F 3UGUA 4B50A 1XV8A 4QRTA 2YAHA 3IDIB 1DVFC 4GSXA 4S2SB 1QR4A 2E9GA 2G3XA 4Y2NA 3JT2A 3SBQA 1ET8A 2OMZB 3S3CB 5IJKA 2BK8A 4I3RH 5I8KH 1EO5A 4XAWL 1RSYA 4PG2C 2FEDC 2ICWJ 2M83A 3RGBA 2EIZA 2GJZB 1AQHA 3QEUA 4CW1B 4GBXC 2HTLD 1DBJL 2OPCA 2XNAB 4TULL 3LOWA 5KSBA 1DE4B 4N24A 4PJXF 3CSYB 4OF3A 4IIQB 3WTVA 5GGSB 2ZUQB 3ILEA 4DZ8A 4GRWH 2BY3A 3LS5H 4NNXA 5CGYC 1E6JL 3KYOB 3TEYA 3QEHA 2QQQA 2G3NA 3QXUA 3HLAB 5E8EB 2NNFA 4KO6A 4JPIB 1QEWA 3T0WA 2OR8A 3T8XA 3KGTA 4RBPK 1BVKB 3FT4A 5T1KB 3VRLE 4BDVB 1OSZA 1L4IA 2IPUG 3L5IA 5IMOB 4PWIA 1BQLH 3PP4H 3TS8A 5I6LA 1KN4H 2YOCA 4N90E 4P5KA 3L5WA 4ABVA 2FR4A 1UWXH 1HS6A 2LGNA 2Y07L 3P73B 5K59F 3DX2A 1U3HA 3FTWA 2R59A 1RZFH 3VVWA 4DKEH 2WO4A 3N55A 2A9MH 4UNVA 1MCHA 2FTAA 3OJMB 5H4ZA 2WQUA 2WV3A 5FYKE 1JMZA 3CV5A 5A6MA 1FE8L 4DTGH 1M42A 2EH7H 1OHZA 2UVEA 4WTQA 4LASL 3PXLA 3O3EA 5EOCJ 5AALA 4CJ1A 2DYRB 5HGHB 1IFHL 3LRKA 2VR6A 3HZMA 3MZTA 4KRNA 5IQLA 4ALAH 1X6LA 5JHLA 1KACB 3VW3L 1BFOB 2QVIA 4PG9B 1KIPA 1OGPA 3E7JA 2D4FA 4PH8A 3BP6B 4IHOB 2Q10A 1GHFH 3AU0A 1JVOA 2VABB 2F53D 3FO1B 2RQEA 1ZE3C 2Q86A 1T89A 1N7ML 3Q8AA 1FN4A 3EYOB 3F7PC 4DGVL 3P40A 3S3PA 5DQJA 1DBBH 3D85D 3QPXH 4PW3A 2EDFA 5E5RB 3NZHL 3N1QC 4QAMB 1LDPL 1OF2B 3PWNB 3ZDYF 2RBLA 2NY0D 4BZ2L 2J8UF 1V7ML 4HWEL 5CAYB 3GMNA 1BLNA 4UT6L 3BZ4B 1EPFA 2FVNA 1IEAB 3L2LA 3QIBB 4LVHB 5C0BE 3K8LA 4B0MM 5I1GH 5GJSH 3U7YH 4M5SA 4YXLL 4PR5A 3TYGH 1SJVA 5BO1L 4PJ5D 4DQAA 2HFEB 3KG5A 4YDKL 5CZVH 4F2ME 1I3GL 4MB5A 2BP0B 2GTZA 2X28A 1SXSA 4OGQC 4KZEL 3O4LD 4R4NC 5CIPA 3MJ6A 4HK3N 4F2MB 2VH5L 3GJFH 5ERWB 1NAMA 1N3NA 2CJTA 2PWDA 5EORH 4QRAA 4G8AC 4UINL 3BDYL 1CXIA 1DQQB 1XL4A 1M7DB 2D3JA 4PJ8C 1HL8A 3F83A 4GW4B 3RGVC 3CZLA 6FABH 3QO0B 5DHVH 3IFPB 4NUPA 4R7LA 2Z34A 2VL5B 1G7HB 5DEGA 4PRBB 4GQZA 4HS8H 1K9TA 2CDGA 1QEXA 4NERA 4Y8DC 3V7AE 5DC2A 3KPLA 3WNPA 5BVPL 2ZTBA 2ZX5A 2Z1KA 3FAWA 2CLVA 3RTQD 4NQXA 1O7SA 2AHIA 3EF7A 4TLUA 1DQLL 4EIGB 4EBQL 2VLKD 2SEBB 2BC4A 1CQYA 2CLRB 3P2TA 2F53A 3QFDA 3K6NA 1QFPA 2AW2A 5DJ0A 4ZQKB 3HPLA 5EZLA 1RLWA 2KLRA 5JDSA 1UA3A 4AG4H 1XEUA 2WLYA 3WY2A 3M46A 1DUZB 3FQ4A 2C26A 3ZXAC 2R1YB 1S3RA 3D85A 4QF1A 3T3PF 1A7QL 3S36L 2XTJD 4LLVA 4FNLH 4BXVA 3C8HA 4X6DF 4H88L 1UXSA 3VD3A 2X2UA 2LAGB 4LLDB 4LSQL 2DZEA 3X3GH 1DBKL 5LNEA 4YXHH 3IXTB 3HUJE 2ZCKH 3VGAB 5D1XE 5E9NA 4OZIF 3TN0D 4BSJA 3PXJA 1YA5A 2OYKA 3HUJB 4FG6C 3EJRA 1KIUB 5D1XB 3AITA 3MRFB 1QRND 3SEPA 4MAYB 2BDNL 1MHPL 3C5ZC 4PJ5A 2AJYL 1G1YA 1BPVA 2BRRH 3ARGD 3UC0L 1XCQA 3V5HA 1JTTA 4PJAF 1U8OB 4TMPA 1CFQB 2VLMD 3LY6A 3O4LA 3ZDXF 1ECZA 3GSOB 5C6WH 5I0DA 4KK9C 1DLFL 3LNEA 4YDJA 1RZIB 5SX4H 4JKPL 2LU7A 1NBYB 4YBQD 1A1MA 4L8SB 3WE6B 5C7XH 1QNZL 1XF2A 1KDIA 4WW1A 4QYOB 2W60A 4FG0A 3RUGF 4FLOA 5FYLD 4FMKA 5JZ7C 5TPWL 2RJMA 3NESA 5IHLB 2WXNA 4J3XA 3RJQB 1A6UH 1HX0A 2FJHB 1RK7A 3AXIA 2Q76B 2HYMA 3J7HA 3GXTA 1PAZA 4D9QE 3BKJL 3RTQA 3VMNA 3B1UA 3QUZC 1XWVA 3VXUD 2VLKA 1KTBA 4FS0A 4KV5F 4FFWD 43CAB 4WFEE 3GD1C 3V55A 4O02L 1MW1A 4YL9A 1FG2A 5LG1A 1CQKA 1QOKA 5D93C 5H35B 4QWWC 1X7SA 5D7LE 1HE8A 3MRLB 4UWQB 4N20A 2OAAA 3X1NA 2Y7QB 1ID5I 5F7BA 3MLVL 5C08D 4DPAX 3CFJB 4P06A 4BYHA 4J8RA 5ESQB 1UZ6F 4XN5A 3ISYA 4NKOA 4UQAA 1ZT7B 4GKSA 3TN0A 4AM0Q 5BUGA 3WHE0 3LD8B 2AJZB 3C75A 3T1WA 1QRNA 5FYLL 5HHNA 5C0DA 3W81A 4ZG1A 5TK2A 1JPGA 5D1ZD 1YMHA 3ARGA 3CD4A 1AQKL 3QJRB 2BINA 4PMEA 1YEFL 1O6VA 1QABA 3PE9A 3NQIA 1EZLA 3WO4B 4YO0A 1CGYA 5GGRY 3BDXA 3FB5A 2EYTA 1UA6L 4KRPC 5IWLC 1BOGB 2VQTA 4WK4B 12E8H 4KK8C 5FW8A 1NDMB 1VLXA 1JHLH 5EBLA 1XCTB 3G5ZB 3PREA 3SGJC 3FSAA 5B38G 2B4CH 5BCAA 3HNVH 2H6OA 1PX4A 2XPGA 3EFOB 5H4YA 3S88L 2FX9H 4PP1C 2NR6D 2D7TH 1OGTB 1JF5A 4TSBH 5I1CH 1UACH 1R0AL 4TL5A 2AC0A 3OJ2C 1DVYA 3VXUA 4ZMWA 1TVHB 2W9EH 4EN3D 3DTXA 3QPQC 4P0DA 3RFZA 1D5MA 4QHMA 1J9SA 4MJ5A 3CAFA 3LXUX 4HIEB 5FX3A 5HPMA 1VGEL 4NXSA 4OD3L 5A3ID 2Z35B 2K0RA 5A2KH 1CZ8H 3VD7A 1FC2D 1YQVH 1BMWA 4QRFA 3LEXA 2IPKB 4N2EA 5C0NC 5K9OB 2AZAA 3GLAA 1LYQA 1TTRA 1BFVL 3MOBL 1KF9B 5C08A 1FLTX 1XGZA 1JFQH 2EYSB 3QIWC 2C4FU 5DK0A 4BZ1L 3NVQA 1IQDB 5E8DH 5IHUL 3UZQA 2YZ8A 3DO7B 2VDNL 2XWTA 3P69A 5E0FA 3BZDA 4KZDL 5GS1C 3KE0A 5ALCL 4OCSL 2P5EE 3WIFA 1T03H 2YPLE 5D1ZA 4R26H 3DOHA 2V2TA 1PKQA 1PCSA 2P5EB 3MV9E 4XZUA 3KR3L 2QSTA 1A14H 5HJDA 1UXLA 2EXYC 3AWGA 1EERB 1LEKB 3MV9B 4BZ1A 3FSWA 1T7WA 4Z7VE 4NO2B 4MCMA 2W94A 4YSAA 1J05B 5KBLA 2VLRB 4Z7VB 4YDMA 2DRUA 3W9EA 1KJ2L 4RFEB 5F7KC 5JO5A 1S9YA 4OIBA 3VFSB 5GRVL 3D69A 4MX7A 2UZIL 4X7SH 3FTXA 4OJFH 1URLA 5C0FA 1ETA1 5AW6B 1NCHA 2E3VA 1CURA 3EJJX 5GRYA 5HI4D 1UH2A 3TZVD 2VQ1A 2NR6A 1RZKH 3K4AA 5F0MB 1UD5A 3IVKA 1RIUH 1PZSA 3CPLA 2CCLA 3C09C 4EN3A 4NQVA 1G7QB 1KJ2A 4UV7L 4LHJB 4D0BA 4YSPA 1N8OE 2OXHA 1E5YA 1FNSH 2E9JA 2BNQB 1HAUA 2L4OA 3MU3A 1Z9SA 3ZVVA 4OCYL 4UQ2A 4AWJC 1T22A 1T6WA 1PJ9A 5DURB 2HT3D 4U3SB 5JHLH 3O41A 3CCHB 2NSQA 1G7IB 1IARB 4ZAKB 1KTLB 3S97C 4W9KC 5GGVH 2AMUA 5I17B 4GQ9H 4NJ9L 2IG2H 3OMIB 4MJJA 2KS0A 1AO7E 4WO4C 4LP4A 2D3VA 1UG9A 4YHML 2FSDA 2XU9A 3BE1L 3V0HA 4PGCB 5C07D 1AO7B 1QLFB 3GSWB 1NC2B 5BQ7B 3L3HB 3M45A 2YK1L 3RBSA 2XLLA 2EDLA 2XPYA 3A67H 1IC5L 3X1FA 4JHWL 5IKCA 2Q7NA 4W6WB 3EO0B 3OHXB 4F58H 3HAEA 4KTDH 3ESUF 2JKLA 4NOBA 3ULUE 5CEZD 4PYGA 1J8KA 1CJYA 1FFTB 2K4WA 4L3AA 3RKPA 4OF6A 3EYVB 4KROB 4OIFA 2DI9A 1F42A 1XR9A 2NUPB 4DGVH 2F0CA 1AG0A 1HK6A 3IWUA 4GSDL 5EIQA 2XI9A 4P5RA 5IBUG 3TPUB 3MLUL 1IAII 4M9PA 2C4XA 3DETD 4DGUA 5DZVA 3TZVA 5J1AA 3THMH 1NAMH 5DZOA 3MNVA 1WWCA 1YNLH 1NBQA 1QBMH 1IGJB 5E8NB 1WDAA 1E28B 5T3ZD 1ACYH 4NN6B 3BUBA 5AAMC 3WAJA 4DP0X 2WWKO 2BVQA 2AEOA 3L13A 5HHMD 3N06B 4XGZB 4NSKA 1FCGA 1JSYA 1MELA 3ZDZE 2R1WA 4MJ6A 2YMXH 5LO7A 4XNXH 4KZEH 5KVDH 5ANMA 3CXHK 1V7NL 2G4EA 3FCTA 3NACL 4B9FA 2Y2YA 1LO3H 4IMLB 2WLIA 2BSCA 3TYFB 1Q1JL 3JWDL 5K93A 1AQMA 3A24A 3AY4C 4HV8B 3KEDA 1M2OA 3ARFB 4XAKD 1UJ3C 4JDVA 4P4KC 5C07A 3APCA 3K8MA 1AXSB 2A1WL 1GGUA 2XZQL 2H2SC 3GSVB 5GGTA 3DSNB 2VC2L 1ZS8A 4LSDA 4FERA 5B39B 4OT1L 4LRIA 5A2LH 2FECL 4MAUH 5FUOL 3UROR 3AFLA 4GO6B 3MV01 2AV7A 1F11B 4HJ0D 3HNTL 4NQED 2J1XA 5DK2B 3WG7B 1P4BH 2KDYA 5CJBA 3WUZA 1FLRL 3US1A 2ATAA 1KLGB 3BUYB 3KJ6H 2HFFA 1AQ8A 5T3ZL 3I3DA 3P0VH 3SZKC 3ARSA 1EHNA 2HWZH 1E4HA 1MFBH 4FI6A 2E6PA 5FKPB 5I8CA 3O81A 3MJ7B 3FCSA 5IBTL 4KRLB 3E9UA 1UASA 3TBYA 1OV8A 4GXUN 1HHGA 4X98B 4XVUC 4A7SA 2P47B 4IRJB 3BH8B 4JGUA 4WEBH 1K4CA 3C9NB 3GSXB 3QA3A 1RV6X 4X5XB 1RFDH 3C5SB 4KKBC 4N8UA 1S7WA 1I3RA 1IBYA 4G9DA 4AMXA 2IH1A 3G6DH 4U0QB 3F7YA 2ZSVA 2ADGA 4K15A 1X7QA 4NM8H 1LNUA 5I9QC 1U4EA 2WLLB 3ZZSA 4IU3B 3QFGA 4HVBA 4MD5A 2L7QA 5TDNB 4N2OA 4M5YL 3T0EC 1BEXA 4E9RA 2DQUH 4GW1A 4ZMQA 2X1WL 2WKOF 3I6GB 1PTZA 1PY4A 1GOFA 3ALWA 3ECBA 1FZOA 4XNZC 1WD9A 5FS5A 5IV2A 2R0LH 1NCAL 2GITB 3GMPB 2Z92A 5I5MA 4O9HL 3CQFA 4UTBL 5TPWH 1IM9B 2EICA 3KYAA 3IRPX 4I9WD 4FD0A 4LNRA 2X2IA 1H6FA 3B7RL 4U6XA 4MQSB 5JNYB 1DVZA 5IW3A 1LGVA 1LP9E 5E2UH 4RBPH 2NXZD 2QTVA 3RWDB 2KBGA 2WZ6A 2K9UA 1LP9B 3G6AA 3OR6B 4X8XA 3JQOB 5DFAA 5AVRB 4KHTL 2BW4A 4NQEA 3INOA 2X4PB 1OCWL 2ZUSA 4L5FL 4L9LC 1XGTB 2HLFC 3LNFA 1NGYB 1ORSA 3VXSD 3TNMA 2VDOL 4MXWL 1PS3A 3WKPA 4WKZB 1GJIA 3SOBL 1U8JB 5DFTA 3BIAX 2QADD 1NAKL 2V8LA 2NX5B 1RZ8B 3RVVC 1FIEA 4AQAA 2ODHA 4FQ2L 5DR5H 5H8DA 1KLFA 1A3RL 2X4OB 3LPFA 2VDQL 2O4EA 1E8ZA 2Z4QB 3MRBB 4PIBA 1X3DA 4HIPA 4NUJB 5KYWB 4FNQA 4YWGH 2HSIA 2N56A 2AXFB 2NY3D 2G9HB 1JPST 4DT2A 2OCCB 2VB5A 1LK2B 1I31A 2ZUYA 3MJ9L 4M61A 1TTGA 4U6VL 5MEQA 4FL4B 2EDHA 1G5GA 2G5BA 4HETA 4QHNB 4UDTA 2UY7A 4IGBC 5MEOB 1GC1C 2F1EA 1ZA6A 2VZVA 3I75B 3QI9B 2IFFH 1HQRA 4PGDB 4XB8A 3RPKA 1KSRA 3RPBA 3V5KA 1WS8A 4QRPE 2HVBA 2YFNA 4IBWA 1OZTG 1AZUA 1TZHB 4QRPB 4P46D 2CLZA 2W0KA 4JFOA 4RA3A 4XXWC 4AC2A 1MG2C 4NN7B 1G1KA 3B9KD 4HC1H 3MJ9A 1OQOA 1K85A 3UPAA 4JN1L 5EIIG 1JNJA 4JO3H 4YPGA 1JDCA 1IQWH 2IANB 3KYKL 3TBBA 1A7PH 1YEEL 2VR5A 4TQPA 3SDXE 2DBLH 3NCCB 2Q2LA 4UI2A 5JHDE 1G7LB 2NZ1A 3O8XC 1NCGA 1YMME 4PY8I 4XPAH 1I3UA 2PW2A 2WTPA 4POZC 3SDXB 5T1MB 3S8FB 5D6CA 4KJYB 2WWOA 1E0OB 3ULVL 5EU6D 1Z9MA 3BKMH 2DDQL 3IU4L 3VXSA 3WIHH 4ZW5A 1VGEH 2A9CA 5CBAB 1MCOH 1WTGT 3VXRB 2W9LA 2YOAA 3VG9B 3ARYA 4L4VD 4GEJA 3TIDB 4WWKD 4Y4FB 2I60H 4UOW0 4P5TC 1NBVH 4JFED 1DQDL 2J4WL 4B5EA 5FW6A 4RA0C 2X3CA 3PCYA 4YAQA 1MNUH 5JW5A 3UZVA 5L2KE 3ZTNL 3ZTCC 3PRZA 4LSPH 3SDDB 3U30C 4NQCD 1E3XA 2WXKA 4IIZA 1B0IA 3CLFH 3W0WB 2A9BA 1KZYA 2H8PA 1B6DA 1TF4A 5I75B 1U58B 5B8CB 2ZUTA 4LVNC 4EVNA 1G7JB 4L05A 4WWNA 4GKNA 2BFGA 2FBRA 4CSZA 3VU2A 2DH3A 4P46A 1GA2A 3QYCA 4HKBA 3IMSA 2ED9A 2HRGA 4YHZH 5EU7E 2AFNA 2A6JA 4KHXL 1N6UA 1ZRUA 4ABQA 2CKBL 4OGAD 2LHAA 3DBXB 3BDBA 1L9QA 1EEZA 3D48R 2BS71 2HG5A 3ZKXB 3N42B 4W6YB 3SE3C 3U46B 2QBWA 2GEEA 4I89A 4LKXA 4OJCA 3BGMA 2VDPB 3OMAB 2AK1L 4LAJH 4P23D 5IG7A 4PJGA 3ZKMD 4AUJA 2XZZA 4OVVA 5SWZB 5EU6A 3FCUB 4JM2D 1D5ZA 5I1DA 5LN8A 1DDTA 1YC7A 2CKBA 4PTUA 2RFXA 2TAAA 4WEMB 2GTWB 2A77L 3EOTL 1EO7A 1NCNA 2DJMA 4XMVA 1X7TA 4L4VA 4CADB 5DJAA 4WWKA 3WFDL 3LRGA 3NA9L 2HJKB 2WM0A 1UWGL 3HAEH 4JRLA 4R0LC 4WDIA 4MZRA 1P5VA 4W9IC 3AB0C 4JFEA 4NJ9H 5C3TA 4W9FC 2OMWA 2E27L 1TETL 1U2CA 4JFYB 5IB4A 2CA4A 3IMRA 4OZ4A 4V2CB 3CN1A 3IAGC 4KNTA 5JQ6L 3LZNA 4YGVB 3GQFA 1R5WA 2FE0A 3FOLA 3KPNB 4NQCA 4QOKD 2ATPA 4KX7A 3T4YB 3OAUL 2HX9A 2NY7H 1QO3B 3EGXB 4LL4A 2EAEA 2XYCA 4R2GC 5DFVC 1CCZA 2XICA 4CJ0A 3TIEA 1TQBC 3DNKA 4K07A 1LTXA 1ZHKA 3MRMA 4HCGA 2DN7A 4NQTA 1EEYA 4PB0H 4NQQA 5I6NA 4L8DB 3D51A 4JFXB 2WIMA 1G7MB 3PHOB 2IJ0C 4FLSA 4QXTA 1KJ3H 1ZTXE 1KGCE 2XG5B 1C5BL 2NYKA 3DROA 3X3FH 4XC1L 1IKNA 3NFPA 1H6TA 3WXVH 2FL5B 4WI3A 1T2QL 2PLTA 4NKMB 1MIML 1KDJA 3DX4A 1MCLA 2DLGA 2A4CA 1GW0A 2WOYA 3RIKA 1NMCB 1F56A 1PY0A 4EF3A 3F7VB 4LRNH 4P23A 3F12A 4JO8A 4BINA 2YKLH 43C9B 1OCZB 1JF1B 1T1YA 2J1ZA 3P4MB 4K2UH 4PY7A 5L9DH 4JM2A 5EN3A 3FBQA 1KG0B 1IBBA 2ROXA 3K2IA 5GGTH 1H3PL 4PS3A 3RP1A 1KJMA 4MCYB 2V0AA 3GK8L 2J88L 5FCUL 3N1PC 4NZUH 3CHXA 5EO9A 4B9PA 3HR5B 3S34L 3TWCH 4EUPA 3WLWC 5KVFH 5E2WH 2LAAA 3GPEA 1IC4L 1F4XH 2YD2A 4OLUH 5CEZH 1W0YT 3U9PL 1WV7T 3D39D 3MV7D 5IEHA 3PWPB 5DD6A 3UPRA 1GSMA 4LPXA 4LPWA 4PJIB 3X14B 4YFLI 4RESB 1YY8B 1PYWA 3HA0A 1ZLVK 3OX8A 2D7QA 3QHTC 3PF2A 3QDMD 4QOKA 4FNTA 4IOSD 1KCVH 2BZCA 1K3ZA 3HNTH 5HVHB 5IK3A 4U2ZA 3DX6B 1TFHA 4X0KB 3QK0A 3D34A 4JPWL 4ANUA 4PREB 4YFDB 5FHBL 1QUPA 1O6TA 4BK5A 1SDYA 3RIAK 4OV6F 3GSQA 1JGVL 4FQXC 2JB6A 4N3UA 5DVKA 4MXQD 4YDLC 2HKFH 3EJYC 2LLGA 2ZJSL 1A4BA 4ZPVB 3IDUA 2VO5A 4JZJA 2AXJA 4NBYB 4LLMA 4PHZA 3BSGA 1RJZB 3I9GL 2BSRA 3V4PB 1ND0B 4Z7UB 3WYRA 4JAMB 3WNLA 1OP4A 2EE3A 3AJ7A 3NCYP 3MA9L 1DQJA 1RP9A 2UUDK 5J11B 2QVFB 4HQQH 1U8KB 2QQKL 1HNGA 2O6PA 1YRKA 4PJCF 1BIIB 4NENA 1S7TA 1KB9K 2JCCA 1MLCA 3ATEA 1O5DT 4G6ML 4X9YA 3TFKC 1QNIA 1LEIA 3OKKB 2WUBH 1Z0MA 2BNUA 1Q4NX 4Q14A 1CLZL 5EV7A 4BKLB 5JORA 3HZYB 1NCAH 1QBBA 4M6OH 1JGLH 1I9RL 3D39A 1T0NB 3MV7A 3CC5A 1R3JA 3GUFA 3OG6B 3QG6B 1CGUA 5CGTA 2HLAA 3K6OA 1EZUA 3K72A 4HF5L 1Q72L 4NZDA 5EU4A 3QDMA 4NHUA 4LQFH 1HZLA 5DUPL 4JREC 3KWWA 4GG6F 2EKSB 2W0FB 2UWEF 4IOSA 4NLAA 4W9HC 5HHQA 2ROYA 3MNZA 1S3KL 3WLBA 2EEXA 4WWOA 4P2QB 3NPSC 4PJBF 1Z9LA 3AU1A 3P4OB 3QW9A 3RDTB 4GH7B 2VDOH 5GS0H 1ZMYA 1IKFL 1N26A 1FDLL 3AABA 1JV2A 3PV7A 3SDAB 4HAGA 1J10A 4WCYL 4RGNB 5DC4B 2CO4A 2OM5A 4DP5X 4E9TA 1JTOA 1PG7X 4MBRA 1IBGH 3CVDA 4PSRA 2OKMA 1UM6H 4BGLA 5EULV 1CI3M 3O9WD 3MBED 3HE7B 3CDZB 5CCGE 3HS0C 1MFUA 2BSSB 4UILL 1M05B 1ZS2A 4OGXH 1ZY9A 5C2BL 5AVSB 2KYIA 1K6QH 1OPGH 4EDWL 1X44A 5HHXH 3U82B 2SODB 4MCZA 5E8EA 2EDOA 2FD6L 1L9PA 2J7LA 1ZT1B 1JAEA 4PYHA 3MKGA 4JPIA 2ZAHA 3LJ3A 1YEJL 2CRIA 1IZJA 3CK0H 4A67A 1MRDL 1SQMA 3BVWA 3MCKB 3QIBD 4K23L 1EJFA 1UTDA 1WCBB 5KOMC 1CICB 2X4UB 4FJZA 2XWRA 5CFHA 1BAFH 5C0BD 4Y16D 4X7TA 3RI5F 1EANA 5FYKL 5TE4L 1UOLA 1B4JH 1JPSH 2E7MA 2ICES 4NT6B 3HMXA 1BVOA 1FNEB 2LT9A 2JXMA 4WKXA 5IFAH 4Z95H 1N2RB 1IGCH 3P73A 1D2PA 4F33B 2DWYA 5L6YH 3I85A 3IJHB 1L5GB 1NUDA 4NGHL 5KVEE 4ODVH 3D3VE 5IREA 5D7SH 1P4UA 4JO4H 1FNFA 1MCEA 2OMTB 3NFNB 4HEPA 1QI5A 3V6OC 1UKSA 3D3VB 1SFHA 3E1ZA 5PAZA 1TJGL 2FNBA 3AY2A 1F90L 4LDLB 1SZNA 3FDWA 3OB0K 3MRHB 4Y5XA 3U25A 5C6PB 2IGFL 2HT4C 2XA8L 3BGAA 3VTAA 4NC2B 5CINH 2A5UA 3S7GA 3VD1A 4H5SA 3IJ7A 4PG9A 2VZ3A 4KKLD 1RQ5A 1NM9A 2B20A 3A6CL 2PP7A 1E43A 4D8OA 3BH9A 3O9WA 3BP6A 3MBEA 9CGTA 1HHKA 5DHYB 3B7TA 4K3EH 2AEQH 3A23A 3LKPA 2KLTA 3VA6A 2GJRA 3BT0A 3WTTA 3EYOA 1B0WA 1OTTD 3B2UC 3D4ZA 1OT1A 4R8WH 2X3AA 4GT0A 5I1HL 5TD4A 1WZKA 2VZ1A 3ISRA 1KGJA 2Y9RT 1RJCA 1UT1A 3N44F 2R56H 3N6YA 3W57A 5GQBA 2PYEE 4NEHB 1CYWA 4XTRD 1IAIH 2WXIA 2GCYB 2P44B 2PYEB 4MTMA 4AOFA 1V55B 2WSDA 2ZZUT 2NW3A 4U49A 1J8SA 5JIHA 3QIBA 4MNQE 1HSBB 1OWWA 5B3NA 2MPVA 3ILPB 5C0BA 4Y16A 3MGOB 1J88A 4JE0A 2WKLA 1BQHG 5EF0A 4XRCA 2YUZA 4HU8A 2PWEA 4W4OC 1II4E 2MQGA 2QZ5A 3RBGA 2Z3FA 5LLIC 1NM4A 3EYUL 5DQ9B 4BFIA 1LILA 3APMA 4F2MA 2YEZA 1I9JL 1OOAA 2X4SB 4LEXH 5FWRA 3WELA 5KG9B 2ZCHH 3K74B 4AC4A 4HXBL 2VTFA 3L3KA 4KNUA 3HC3H 4ONGH 4XBEL 4NIYE 1M7DA 5DMKA 4GJTB 1I9IL 3T2NL 3QO0A 4X7CC 3Q05A 1DQML 1REIA 4Z8FH 3IFPA 4PJHF 1K4DB 1MHEA 1Q9LA 3V6ZB 2JWYA 3S4SG 4PGBB 2X4TA 2ZWNA 3G08A 2R4RH 3HNSL 3PFQA 3OJDB 4TKWA 2ZKHL 3UTZB 1A9BA 3TEZA 1YO4A 2XVGA 3Q0HA 4PBXA 3WS6A 1C8PA 5F1NA 1C5DA 2NTFB 1CDGA 3VI4F 4U1HB 1C5CH 4D9QD 3GMMB 5FV2A 5AB2A 1E5BA 4HIIA 4MZIA 2R1XA 5JPNC 1W72B 3SCMC 1A6VH 5D71L 4JANA 5L2JB 3D1MC 1Z5LA 2MOQA 3BWSA 4UOW1 3TBSA 4HJ1A 2Z6FA 1HE7A 1Y07A 4WRLA 4K9EH 3LH2H 4WFED 4G11A 2Q7YA 1T7ZA 2E7CA 2HVJA 1MFDL 1NCOA 4PRNA 1TTBA 3UGXA 2AJ3A 3QORC 4OFPA 4Y5YB 5D7LD 4N0CC 2DLEA 5I76B 3R7QA 3RVWC 3IXTA 5IQOA 1D9KB 1I1AC 3MI6A 4I0KA 5HTSA 2LR4A 5K9KB 2H32B 5KS9B 3GKWH 4WHTA 3HUJA 4XN9A 1ZDQA 3K91A 1E3ZA 3FMGL 5J12B 2DEYX 2RGSA 4NP4L 2MWCA 4HIHB 3WSQL 3C2SA 3KLQA 3P30L 4HZAA 1CXEA 1RHHB 5EOQL 3MR9B 2OX5B 5D2NE 5FDWB 1JK8B 2N3JA 2Z9TA 5D2NB 5E9AA 4KNQA 4OB5L 1SMOA 2CO3A 4G9FD 3IE9A 3QS2A 4MHHG 1SM3L 2AAAA 4J3WA 2CHZA 3EO9H 3CH1B 5MENB 2CNZA 2H32H 3UJIH 3ZKNC 5L0QC 1XX9C 4PVLA 3KLAB 5HHOE 2NT1A 3IJ9A 4RDBA 3NCBB 3R06A 4M6ML 4PJDA 3RAJL 2NXYD 3S3JA 1INDH 5HHOB 2O6FA 4KKAD 1S7RA 2BHYA 4JHBA 4TSCH 1MNNA 2QQNL 1OGSA 4M7ZB 4Z7QE 5CCKH 3RB5A 1WFOA 4LOUD 3CLEH 3NJNA 4Z7QB 4LOEA 2R29L 4JFDE 1SY6H 1G6RL 1DSFH 4HUCA 4M02A 2ZX7A 4JFDB 2XSKA 3RYMA 1WPCA 2A6DB 1FP5A 3EBAA 1NFIB 4P2OC 4YDVA 3RGHA 2BMKB 3FO9B 2ZYIA 1HOEA 4LCYB 1DL7L 4R96A 2F5BL 5B3JE 1XQ4A 3BAXA 1G4RA 1T0OA 4JPWH 1OAQL 3U1SL 5FHBH 3VI3E 3ABGA 4AKQA 2V2XB 2JNZA 2Y7QA 1QLEB 5D7LA 3VI3B 4KXAA 1G6RA 2PETA 3PUUA 4N8CH 3TO4C 4HGMA 3ECVA 1CGXA 2GIYA 3V0WL 4G8GD 1EXUB 3KVDD 3LKOB 1FC1A 3HFML 3UAFA 2AJZA 3TT3H 2WYTA 3BPOB 2PWGA 3MMEB 3RZCB 3GZQA 1HZHL 3PL6C 1OL0A 4ODHL 4TUJA 3NJIA 5E7BA 3DX3A 1W0VB 3MUZ1 5D7JB 5DJCB 4KQ4L 4UNTA 2YPLD 4OCWH 1L7IL 1EZSA 1Q0XL 2ATKB 2HZHA 4WFFE 5F96H 1QFWL 3MV9D 1JWUA 5CCHE 1P84K 5HJBA 1MCDA 4FULA 4G9FA 4UIKL 2QQKH 3A4DA 3NJGA 1RPUA 3GMOA 4TQ8A 1INQB 3HE6B 4RSVA 3NGBB 5I30H 4FP8H 3QRLA 3S0PA 4LB8A 5CU9A 1BECA 4ZFQA 4L1LA 1O0VA 3PAZA 3SKJL 4J6RL 1OCOB 1XF5A 1O9ZA 3QQ9C 1OAZL 3RWGB 1A0QL 2CBTA 5I1EL 1NOAA 2Z0BA 2QDWA 4PJ9C 4U1IB 4NIKB 3HB3C 3IJEB 4IBVA 4Q89A 2JK5B 1PBYA 1L9RA 3AAZB 1JFHA 1KIQA 3HOGA 2C7UB 1SBSH 3QNYB 3TEUA 4DKFH 5KJRL 3GSUA 1S5IL 1Q72H 4TVPH 2IWKA 2NY5L 1GXEA 2AJXH 4YUEH 2XWXA 4R83A 4HIEA 1O7DC 3EGDB 3ZE1E 2WCSA 5CN2A 5JR1H 4GRMB 5DURD 2ETWA 2WNKA 1M1XA 3ZE1B 2K8QA 2GC7C 5K9OA 3EXJA 1T83A 3OLGA 3FT2B 1MJJB 4KKCC 5B7MA 1F6AB 1NCBH 3CFKB 4ECNA 4OZGF 5DZNA 2FYVA 5EA0H 5AENA 2EYSA 2DW5A 1MWAB 1UQSA 3DDFA 3BMVA 3T6ZA 3NIGE 4BBWA 2OSYA 2L8AA 4TUOA 1IAKA 2Y5TA 1XF4B 4G8GA 4KY1H 4M7JH 4Y5VC 4AKPA 3DO7A 1NC2D 4MKMA 5EG6C 3JZYA 1OM3H 1NIEA 3H9SB 1QI3A 1BVNT 4PJ7B 4KX8A 4IBZA 5T1LB 4AJWA 4DP7X 3RHWF 2YPLA 5TE6L 1V8HA 1R5IB 2E86A 2DJUA 2OJ1A 1TJHH 2PXYB 2ITCB 3BVTA 3MV9A 1C16A 3PGFL 4R5VA 1LEKA 1ZK9A 2ZPKH 4UILH 4DZBB 4ZO6A 3Q5OA 3ULUD 4LLWB 4LLYA 2DLFL 4Z7VA 1MWAH 2XKNB 4J39A 2WBJC 3T3ME 4LSTL 1SHMA 3WEBA 5JXAL 1JGUH 3U36A 1DBAH 3HKFA 2A74C 3HMXH 3QNXB 7FABH 3D0AA 2FD6H 4JFPB 1FL5B 1AXTL 1NMBL 2PNDA 3VXPA 1DVSA 4HHWA 4QJ3B 3BP5B 4FQIH 3BJ91 5F7AA 1XDTT 4FI8A 5JHMA 4JO1L 5H37A 4XI5C 1D5IL 1NANH 5ALBH 1JIBA 5LNGA 3QEQB 1H8LA 4MVBD 1FA4A 1WE5A 2Q8BL 2EXTA 2W65A 1UWEL 2EIEA 1BMGA 1WBYB 3CQQA 1YYLL 3DX8B 3KZ8A 2R27A 3BPLB 2FJUB 4YHNB 1A1OA 2KDGA 5HGGS 5E4IA 1AZVA 2CRMA 5BRZB 1AHWA 1UZGA 4XPTL 3CCHA 3EKCA 2F5AH 4WGVB 1G7IA 5I8OH 4Y2DB 2QELA 4FKKA 1XO8A 1Z6JT 1IFGA 5AL0A 1E5UI 3VGEA 5I17A 1YEIL 3IDNB 2JCWA 3PIQB 1WRFA 3QQ3B 4P9HC 5CJXC 4AMKL 5JLZB 3ULUL 4JN2A 1U3NA 1YECL 2A9NL 4XO5A 5KN5B 3GSWA 1NC2A 2NW2A 4LHUD 2G0LA 4FQCL 3C6SA 3D30A 5K1NA 4ES9A 3W3BA 5D70H 4U3XA 1AMXA 1J1PL 2C1OA 3OHXA 2JLLA 4HUUB 1NINA 1T7YA 4LLQA 5ECJE 1ZLVH 1ITBB 2J5LB 1MJUH 5M95B 4XOBA 3CZUB 1FZJA 2V3FA 2VXTH 2ZCLH 2C34A 4JRYB 2IAAC 5T1DH 2DD8L 1NCUA 4IK6A 1IEBB 3K4ZA 4DEUA 4PJFF 1XTMA 1EHLH 1B2WL 1R3IL 1U8HA 5CMAA 5ID1A 4GAFB 5A16B 1HDMA 4PY8J 3TPUA 5EEUA 3DX9A 4UT7H 2VLLB 3IRZA 2CBQA 3QQDA 4UM9B 3MYJB 5E8OA 1Y6KR 1BZDA 5D2LE 1DEDA 1IGJA 1RZPA 1UWYA 4A66A 2COQA 5D2LB 4U1MA 4U33A 1N59B 3TM6A 5K69A 1L7TL 3TVMD 2C9RA 3FO0H 1R5VA 2IOOA 1M3JA 4WW2B 3ARXA 3VXNA 3EYUH 4S1DD 4KUCF 1JV5B 1YN7B 5JW4R 1SMAA 4AH2A 2UUDH 3GDCA 1QWNA 5T5FL 2A7BA 2N1TE 4IMLA 3QUKB 1DJXA 5CFAA 2Z65C 4K7FA 1NIFA 1RUQH 1XSOA 3O6FC 3E6FB 1X5YA 4MRBA 4JFVA 2BJMH 4PJXE 4QKTA 3ZT7A 3RY6A 1EXGA 3X11A 3DGGB 4JJOA 4M48L 1AXSA 4PJXB 4LHUA 2EO1A 1ZT4A 1OW0A 3GSVA 3U7WL 3FUJA 3P11L 1LE5B 3SDCD 5EEZA 5B39A 4OGZA 3T2PA 5F0PB 2YPVH 4IS6B 3L2MA 5T5FA 1A22B 3LPGA 1SN5A 1WZ1H 2H0JA 4LAQH 1GKOA 1PZBA 5DK2A 5AD0A 4EI6B 2FUTA 4X6CF 1SLVA 1R33A 1GMIA 3BUYA 3INUL 4YZFF 2Z1PA 4MQTB 4N85A 3U6RA 4ZDHA 2ZX6A 1KCSH 2FB4L 3UBHA 3EH2A 2K6YA 2YQ3A 3C6LB 3ZLQC 2OK0H 1UOKA 1MFDH 2IBZX 5HSFA 1XIWB 1CE1L 3LMJH 3KPSD 3ULAB 5F1IA 3C5ZB 5K59E 1AS7A 1DANU 4ABUA 1KLUB 3BH8A 2IBZY 1EAPB 3BVUA 1OKEA 4YQXL 4KQ3L 1JWSA 3C5SA 2P24B 5IM7A 1IGTB 3HCVB 5BRPA 1G0DA 2CJUL 4Y9BA 5KYXB 2QKIB 4JHUA 5DU7A 2WP3T 2FDBP 1PD1A 3L1OL 3TVMA 5JHAA 2XQYA 3B4NA 5BZWA 1UYWH 4GAJL 5FM5M 3BGFB 3K4DA 4G8FB 1FZKB 2JKSA 3C2AL 1NSNL 2J44A 2WLLA 4NUGH 1X5LA 1CGTA 2Q1EA 3AVEA 1R46A 2HJFB 4I4WB 2W0PA 3MNWA 4M5ZH 1WK0A 4YR6B 5LCVL 5TDNA 1UGNA 2K8MA 5J1TC 2GAZA 4AJVA 1IT9L 3EH4B 1WSST 1E9OB 2HN7B 3VO0A 4ZFGL 4I18B 1NBZB 4DVRH 2GITA 3FYEB 1IAMA 2XHNA 1DVTA 3KPOB 2DIBA 1J48A 2Q6WB 4JFHE 3H2PA 2EDKA 2YD7A 3O6LH 4KI5F 3FU7B 3ECUA 2Y7NA 2DM7A 4JQXA 1HI6A 2GKIA 1JWMB 3KWVA 1AOHA 4UT9L 5DJZB 5LCVA 3SDCA 1SVCP 4Y1TA 1LP9A 4TS6A 4AW4A 2J8UE 4IBTA 4XP1L 5JHDD 4H0HB 4KQ0A 3ZDYB 4Z76B 1YMMD 1PDKB 3HG4A 5DEZA 5GJTH 2J8UB 2X4PA 4KK6D 4F9PC 1ACCA 1SJXA 3KPQA 1NGYA 3D4CA 4AGQA 4FXKB 4LIQE 3F6IA 2Q8AH 1UJTA 4NWTL 3EOAB 3Q2LA 5DD3H 4I1RA 2YGVA 3SO5A 1DL7H 3DV4B 4PWHA 4NZRH 3LHPH 4UT9A 1KB5L 3KPSA 3FN9A 1XGQB 2LOEA 4Y4FD 3VCLA 3QUYB 5TGBB 4BUGA 5BZDB 3B8SA 3MXVH 3CXFA 5IF0B 4AYSA 1KEML 2X4OA 3DRQB 4XMPH 3CZGA 3VYOA 2Z4QA 3V0WH 2WANA 3P3UA 4NUJA 2Z8VC 4G8EB 4LPVA 3OB0H 2AXFA 3CVIH 3P0YH 1UFUA 2C5DC 5L2KD 1LEGB 2AEPH 1QFOA 1J12A 4KRPB 1SXBA 1IB5A 5E8PB 3RVTD 3CNKA 4S0SD 3ZGHA 4ESKA 1KB5A 3COOA 4NKDB 5MEOA 4XP5H 2CIKA 1U6AH 2GSIA 1QFWH 3UXFA 5GRWA 1KB9J 3DO4A 2P42B 1NFKA 3TWYA 3KVQA 3E6HB 4GP4B 5FK9A 3GTVA 1JVKA 3TBVA 5HDBB 5TFSL 8CGTA 4KOCA 3SGEI 4CKVX 4X4YB 3VFPB 4JVUA 1XTLA 2IH3B 4LF3B 3K5SA 3FUDA 5AUMB 3WN5C 4EIUA 2QDVA 1K8DB 2BS8A 1A0QH 1PGRB 3T3PE 4BM7A 3SN6N 4KXBA 4X6DE 1TQWA 4LSUL 5JHDA 1AE6L 5KJRH 3MROB 1YMMA 3K71B 3HAEG 1FFRA 2J55A 1N18A 4KJYA 5AW8B 4OZIE 3QXWA 1Z9OA 4XWGL 4IOFD 4R7DB 4XMUA 4FHKA 4I0PB 3ULVC 5DSCA 4X9BA 4OZIB 4G6FD 1M4KA 1FO0B 5DFWH 4F5CE 3H3KA 1BQRA 4DGIH 1MEXH 1UD2A 1QG3A 3GBML 3NOIA 4KJQC 3ZDXE 3FU3A 3TIDA 4PJAB 5DHEA 3TBTA 4Y4FA 1Z9PA 3GSRA 3TL5A 5D7IF 5DRNB 5TE7H 5C8JA 5GGSY 3SIKA 3PV6B 3SKOA 1EH9A 4GUPB 1YSOA 1P1ZB 4HIJA 3RUGE 3ZRCC 1ADWA 1J0JA 3G6JB 5L2KA 3GEWB 1EWHA 3WXWL 3A4AA 3RUGB 1IMHC 1RURH 3VFTB 3B9KC 5IQ9B 1JYXA 3IK2A 4ES8A 1U8NB 3F2LA 1ZJAA 3ZK0A 1OAUH 5GISH 3BPCB 4POUB 4ZXBC 4OIAA 2EH8L 4N2FA 1TEFA 3QP3A 1G7JA 3N9GL 4FXGC 4EKJA 4NI3A 3KXFE 4KV5E 4EPSA 2VDPL 4ZFOB 3B9VA 4F57L 1XH2A 5IVZB 4HSCX 3H54A 5EUOF 5DI8B 5L88L 2QSCL 1JNLL 3ATBA 4KI5C 3FYIB 3TF7C 4L3CB 1JGDB 1FV1A 3T77B 4ZTOL 3IU3B 3VGBA 4KVNL 1KGCD 2P1YA 2Y6SC 5LGJB 3OZ9H 4CNIB 2BY1A 1ED3B 4JO1H 3OWRA 3D9AL 1WWWX 3OLIA 5D6DA 4NJAH 5E99L 4Y7MA 3ZQWA 4CU6A 5IB5B 5AYUH 3A22A 1UZ6E 3QUHA 5TQ2L 5KZCD 1A3QA 1A3LL 2XPZA 4JL2A 2F8XC 3MKKA 1FHGA 2JKIS 3SO3C 4RAUB 1HESA 1QSEB 4C4BA 3FQUA 4NPYA 1I8IB 3GIZH 3MLRH 2ZYHA 1H5BC 3HKZA 5AWNH 4KI1A 3U4KA 4JGNA 2J1KA 1I9EA 3HRZB 4CC4A 4UYPA 3ZHNA 2HJKA 1YEWA 4QTIL 3PQYB 1YNTF 1YUHA 4YEFA 2X2JA 3MREA 5D7KE 4OZFA 5HGAB 2UX6A 3ARDD 3VWJC 4JLRA 1C7SA 4XR8C 3QRFM 1JXFA 1FFPB 3IFNL 4YGVA 3TTYA 7TAAA 4UDUA 3RWFB 4N2GA 4EQ3A 3GRWH 3NTCH 1NBCA 4YHKL 1FI8C 1X9RA 4X9HA 3OKEA 1NEZB 1H8NA 4AVJA 3HW7A 4AIEA 4AK1A 1GH7A 1ZTXL 2OMNA 3EGXA 3R0NA 3HZKB 4GRWF 4NI6A 3X1EA 2BZDA 4WEUD 1VSCA 5JTWA 4YDNA 3DPDA 3CFUA 5DMIL 2VSDA 4F3FA 2FHCA 3SE9L 1T21B 4ORGB 4AL8C 3L3OC 3SKNA 2RHEA 4JY6A 2V9TA 4RMRA 1SXNA 1GZQB 3HBGA 4L3EE 1R3IH 4AKOA 1ZANL 2H7WA 1ZV9A 3L1FA 1DCLA 4DP2X 2FIKA 2R7EB 5GS3A 3MBWA 4BFKA 2CH8A 4AXWB 4NKMA 3VRJB 1CBVH 1TTCA 2XETA 4DN3H 2X0VA 3ZYOA 2EVGA 3PLYA 3BT2H 3QUMB 1NLBH 1YDPB 1GGTA 3Q1SH 3SD5A 1JXDA 1BLIA 1U91A 4ZMNA 2ESVD 3P4MA 1E90A 2H5UA 3TH4T 2JH2A 3LZPA 4I1PA 1KG0A 2ZKXA 4K94C 1UUSA 5DWUH 4M43L 3SPVA 2YSTA 4AQEA 3MLSL 2WQ8A 2BSTB 1HIMH 3N5AA 1A7RL 1MIEH 1DQIA 1XGUB 2R0KL 1YPZF 3FJTA 1T0MA 2APFA 4X7EC 1H3VA 5TF1L 2KUTA 1MAML 4LCWE 4N5ED 5DTFB 2NY2C 2PUQT 1YN6B 4JKMA 5F71A 4HGWB 2VITB 5I5RA 2ZWKA 5JOFA 1P7HL 1CF8H 1H8OA 2A4EA 3ARDA 1QSVA 4NKIH 3DJTA 1GS7A 2KZ1B 2YWYA 1N0LB 2WZ0A 4CMMB 2ZYRA 3O6MH 5HYEA 5KW9L 1AD0B 2FQGA 1WLHA 4KK5D 4CBZA 1ZK5A 4ZO8A 4Z3GA 3FPYA 2IH9A 4APQC 4HEME 2DQIL 5DYFA 4JR9L 4YE4L 4X0KA 3QZWB 1SVBA 1A25A 2FZ3A 3V4PL 3MBXH 4QRBA 1CG9A 4G7VH 1MI5D 2WXRA 4ODUA 4PREA 2ZUWA 2FB4H 4Y4KB 3WIIL 3OBAA 5I1IH 3TX4A 4AENA 3IDJA 2AGJL 2AJVH 3JYBA 4QCIB 2N7AA 3QJFA 4FMVA 3VYPA 1TU2B 4ZPVA 1O6SA 3B6SA 1VFOA 5AG9A 3GEFA 4I3SH 4G43B 2OMUB 2B1HL 3DYPA 4JKWA 3T0EE 4Q6YA 4X50A 4J3OC 4R97C 2YGQA 3V4PA 2P26A 1ND0A 1HKLH 3BEVB 5HHPB 5IUCA 3CFBB 5GGRB 1RZ7L 3UAJD 4PLNC 4J1UB 5I1LB 4P3DA 3WTSA 3VD9A 2DQHH 3QEGL 5T1JA 2ESVA 4N0RA 5DRWB 1MVYA 3I50H 2V8MA 3MLXL 2EIKB 4A63A 3TA3D 4J23A 4WSKA 4OF7A 1BIIA 4GS7B 4AQ1C 1A65A 3EHBD 4MMZB 4YHYC 5DMYA 4ZS7L 4MS8C 1KEGL 3T6XA 4BFOA 2I9LB 2ENYA 1JI2A 2YD6A 4XZ4A 4QMEA 5IHBA 3GJEB 3FO2B 1A4CA 1NGXB 4U7SA 1JNNH 3A5VA 3S96A 3QJTB 1TMCB 4N6QA 4OY9A 3ASWA 3EYQD 2B0SL 2WQXA 3U2SA 3BQUD 3MACL 3O3AA 1ETZB 5E6ID 1E9QB 4ACTA 4LSRL 4OFYD 4GT7A 1NCIA 2HTKC 1IC7L 1LO0H 1RY7B 1SLXA 1VACB 1Q8MA 1ZHNB 1MI5A 3QDJE 1J5OH 3NSJA 1DZ0A 2VXSL 2XN9E 5IJVB 5ACMA 2I5YL 3NT0A 3HC4H 4KJWC 2QGEA 3KLHD 4JDTL 1KB5H 2DQGH 2FEEI 5DT1L 3LQAH 4F7EB 1N68A 3HI5L 3KVPA 1NGWB 4X7FC 3KWTA 4Z9KB 2XQBL 2PP9A 2NNAB 1Z66A 4IDJL 3Q48A 4IIQC 5JIKA 5KSAD 2ZUQC 1YEGL 1MUJA 1KWKA 1NFDB 2EINB 4IEFA 3WEMA 4PV8A 3UYPA 5J0BA 3UAJA 4JFQB 5ESVA 3MJGX 2WXGA 4ODWA 4XBGA 4LMQI 1AKJB 2DQTL 4EJ1C 4WEEA 3OKDB 5F7DB 3TBCA 1P84J 3IMUA 1N8ZA 1BF8A 1F4YH 3TA3A 3DV6B 2CMRL 5HVGB 2H6PB 4PRPE 2CDFA 2F58H 1T2XA 2L0DA 5CSBA 3QNZB 4D94A 4PTTB 4LKCA 2Z64C 1WS7A 4NWUH 5E1AB 2EDYA 1BX2A 1EX0A 4M3KB 1P5UB 4F8TA 4BHUI 3UMTA 5L8LB 3DUHA 3O8XB 4IKJA 1MCWW 1SLWA 3L9YA 2WPGA 3CFDA 4YHIA 1FUNA 2GEQA 3RILA 3P9MB 2GSGB 3H55A 4CGUB 1F1GA 1X5GA 3GS7A 4L37B 4GFTB 4FFVD 4MNQD 3KCWA 1FL3B 5KVEL 2ZF9A 4WUUD 1RULL 4XP9L 3LYRA 3BQUA 2MCPH 4BA0A 5E6IA 3BKCH 5DRXB 5CBEA 2BVYA 1AE6H 1GGIL 4G42B 2YMOA 2Q2EB 5SWQB 1MJ8H 1MFAH 2C4FT 3UIYA 2K78A 2O5XH 4OJEH 5D1QD 1DJYA 2FX7L 3BLPX 4PPTA 3IJHA 1L5GA 3OHMB 3DLQR 3WI9A 3O45A 4UMSA 2DM2A 1XB6A 2EUZA 3T65A 1GGBL 2HX7A 2R4SL 4E42B 1EGJL 2VKWA 4RWHA 2ZUXA 4GW5A 1FORH 3ASOB 5KVGH 2IOMA 4UB0L 1WT5A 5DCCA 3MUGB 4ONHA 5KSAA 2PR4H 4U6HB 4G7YH 4K3JH 2NY6C 4XCCH 2NYZA 3RX9A 3U1QA 1VFAB 3MYZA 1ZVNA 2ITFA 2B9BA 5DHYA 4AQ8A 2XZCH 4FQJH 5FYJH 1KJVB 1IAOA 1KENL 4ANXA 5GGVY 3BW9B 4LVHC 1KNOB 2ZF8A 3W9DA 3C8DA 3L3IA 3FFDB 3OF6D 7PCYA 2XY2A 1M9WA 4GRLD 1XGPA 3LQZA 1RZQA 2C9VA 3DI3B 2HXAA 3T4AA 5E9DE 1VJSA 4EUPG 4HK0A 2KL6A 4NC0B 4WUKH 5FPIA 3IS1X 3PWVA 3AUWB 5L88H 1T4KA 2QSCH 1OE1A 3ARBB 3FUHA 4NN5B 5HJ3A 3VRIA 2PO6B 2LABA 1V3LA 3ZIMA 5EO1B 2OR7A 1OP9A 1WBZB 3F62A 4MNQA 3S37L 2WGNB 5KBNC 2HRPL 2N59A 1W0WB 3FB6B 4WUUA 2V7HB 2V7NB 3OXRA 1I1FB 5F9WB 4KGLA 3QCVH 4OAWB 4KKQA 5ADPL 1VZGA 4S1RH 3ESOA 2X4SA 3MRPA 1DUYB 5KG9A 1I8KA 4OZFH 5D1QA 1ZV5A 1T66C 2EP6A 3LN9A 4X9FA 4XH2A 1W72L 4I87A 4R4BB 5I16B 3QG7L 4YE0A 1CDJA 1WHOA 2ARJA 3F04A 5CJQL 2FO4B 3MCYA 1NGZA 4RZCA 2DQEH 3ETSA 5I23A 1N6QH 4PGBA 2X0UA 3MCG1 3W11C 1R24A 3D25B 3W39A 5JPMA 4DHLA 3EZJB 1RUPH 1BMZA 3JWOL 4JG5A 4APXB 4YL4A 4LU5L 4O2CB 1ORQB 3GMMA 3DXAE 1QPPA 1DFBL 4ZW3A 3ORJA 5F93C 5ICUA 3DXAB 1FAIH 5LWYL 4FQLL 1CB4A 1OD7A 2R9HC 4CBPA 4TOYH 5AYTA 3DVGB 4QLWA 3AACA 3FFOA 3UYOD 1PW3A 3CBRA 3VGAC 5I28A 2EC9U 3G5XA 1F6FB 3TCLB 2BWQA 2XACC 3JWNH 3W1ZA 5CS7A 4XN2A 3OF6A 5D1XC 5GS2D 5A6IA 5I1AB 4MAYC 5I0YA 4GRLA 1PZ2A 3NFSH 1EFXD 3I74A 2QHRL 1R17A 2CR3A 5GRXG 3SE9H 1OTSD 3EFFB 5MERA 3FK3A 1A7NH 3PU7A 1DTUA 3NJVA 5CWSB 1NCWL 2R23A 1G9HA 2DM4A 2J2ZA 4GFXA 3V0GA 4K7PH 1ZGLA 4L8SC 4OZHB 3RZCD 3ERXA 3MRDB 4GI8A 4QXWA 3MRCB 1MREH 2PTUA 1S7UB 1R3LB 5FGCE 1RHHA 2OX5A 3KYMB 5FGCB 4S1QH 1OARH 4I48B 1P6FA 1TQUA 5DVPA 3OQRA 3DX0A 4K8RD 4WFFD 3FUFA 2EEFA 5I16A 3QCTH 3O6KH 3IKCB 5DZAA 3IJYA 4XVSL 1SOSA 1A6ZA 3K2KA 3LRSB 3UADA 2GK0A 3BOVA 3CH1A 3D18B 2WUCL 4M4RA 2X6VA 4H4NA 4OM1L 1DJZA 2DIJA 2BFVL 1VADB 4LCIH 5DD0H 4FCAA 5D5MB 1QBLH 3LDBB 4X5WB 1IVTA 4KFZC 4NDMB 3J8F7 4EZJA 1C8QA 4HKZB 1FRGL 1QLEL 2GJ6E 5C0GA 4YSOA 3ULSB 1S78D 4Y9CA 4L3FA 2GJ6B 1MHCB 3NJHA 4PRHE 4LDOB 3R0MA 2OK0L 3AS0A 3FFCE 1MCQA 2B14A 1WIOA 4N0FA 3RL2B 1KC5L 2Q5BA 4PRHB 2DQCL 2LQRA 3FO9A 4AVKA 5KBDA 5GGUA 4LLUA 4QTFA 3LD8C 4LCYA 2BOBA 5EUKB 4I7ZC 1TZIA 3R19A 5KSUA 4AGLA 2B4CC 3O11A 2IQ9H 1DVFD 1EFXA 2UZXB 5F89A 4BGDA 5ISZE 1BGXL 5EN2B 1Y0LA 2J6EL 2VDLB 4EQ2A 5ISZB 2OMXB 2JB5H 3FRUA 4K8RL 3WO4C 2XWJA 4X80L 4Q2ZB 2AGJH 1H9VA 4HWBH 3SYAA 1EXUA 2FEDD 2XV3A 3ZL4H 4GBXD 2YEVB 4V1DD 3MMEA 3RZCA 2AXWA 3ABLB 3ZJAA 4MJIE 2FWOB 3H3PH 1GYAA 3ESNA 1YNKH 1NTDA 5KANI 1ZVYA 4MJIB 5CGYD 3ME0A 5AYQA 2DWSA 2HVKB 2J6EA 4FNPA 4JMXA 3FCGA 5J5EA 4PM1A 2I32A 1X4YA 5FO8A 5FF6A 1CU4H 4ZFZB 2DMCA 2D0HA 4KUZL 2YAEA 2P8MA 3NRQA 3AQYA 1CD1B 3IF1B 3AWEA 3SGEH 4HEPG 2BSDA 1I8AA 4L4JA 2VXQL 1E4XI 3D2TA 4Y4HB 1HNFA 2WXJA 4JQIA 3AQZA 1VA9A 3RWGA 4HMDA 4PUBH 4U1IA 3B7SA 2W92A 2D03H 5C97A 3IJEA 3GMRB 4WU7B 3FS9A 5C86A 1GZHC 4WQOA 4Z3TA 1HXYB 3S5YA 5AAPA 3LS4L 1A9EB 2EE2A 2QQLL 2A9DA 5GXBB 2XFXA 4XCNA 1HCFX 2NY4C 3FHQA 2NY5C 2FGWL 2QFPA 2VXQA 3IT8D 4IHBA 4LSRH 2Y3NA 4BKTC 4NAJA 5IB1B 3UC2A 2YN3A 4PB9H 1WWBX 1IC7H 1I3VA 4NZTL 3CMOH 3H7BB 4ZUTB 1DVFA 1RZKC 1F6AA 2OI9B 3HG0A 4X6EB 1FGVH 5DRZA 5F9OL 5DLMH 4N0YL 1HEHC 4QRUA 5DO8A 3PGDB 1UZ8B 4PG2A 1DQKA 3RKDC 1NCCL 4GBXA 4V1DA 1QQDA 4N86A 2WZ5A 3MDJA 3FU5A 2VMCA 4RISH 3RDJA 1ILUA 1W2KT 3B34A 3STBA 4ZYKA 1VEMA 5ICZA 1V3MA 1QLRB 4FJYA 1QSZA 3QC6X 3FSZA 3EFDL 4XP6L 1Z3RA 2UZPA 2C1PB 3FT1A 4PGEB 1THAA 2PYFA 4D0CB 3FF7A 5FOJA 5LUMA 3HG1D 5ABAA 2X70B 1J86A 2P8PA 1CDYA 1OAYH 2CALA 3SYPA 3NJFA 3O2DL 5K33A 4M5TA 4L1SA 3NIDF 1GTFA 4E9QA 5CF3A 5IB2A 3OQ3B 4JFPA 1OAKH 3K0YA 4OF5A 4XCEB 5TTRA 4DW2H 5HDQL 2BIHA 3MRQA 2YFOA 4FZEH 2WQWA 3G9VA 2VMJA 1HSAA 4R4ND 4AEHH 3HVDA 4AEIH 4YXKL 2R0WL 2MFNA 1MRCH 4GAGL 4FZ8H 4ZAKC 5LDSA 4WZ9A 1L9OA 2A6IB 1VAHA 3RGVD 4PJ8D 2OJZH 3JVGC 3WMPA 4TPRH 3V6OE 2QVMA 3LKQA 1JHKL 2CRYA 1ACZA 3DJ9A 3DTUB 3BVNA 3VH8A 5A40E 3DX8A 3HI6H 1KPUB 4YHLH 2WQRA 3E1F1 5HVWA 3K6IA 2IAMB 1MVFA 2ZUVA 3ZT5A 4ODXB 4IU2B 3A21A 5F0JB 5IBLC 2XWBA 2C3VB 3Q06A 3NAAH 5C6TL 5CP7A 2XG4B 3FB7B 3P77A 3SDYH 3L17A 1GMEA 3PIQA 3QQ3A 5JDJA 4MMXB 4PJCE 4PWKA 5KWYC 5CEXA 2B77A 4KROC 1KTKE 1UD8A 1OGAE 4AV4A 1L6PA 1NGQL 5HGBA 3OKLB 3ZE0F 4ZT1A 1CLOL 3DOSB 2ZXAA 4D9LL 5D72H 3WFCL 4FDWA 1COBA 3Q8EA 1D5BB 3OG4B 3LKSA 4YIQB 2WZPA 2AJSH 5MEPA 3X1GA 3HG1A 3B1TA 4JDZB 4ZMVA 4ISVB 1HL5A 2WYZA 3P9LA 1IEBA 4NN6C 5ECGA 4GG6E 2UWEE 4FG6D 1JPEA 4GG6B 5FAAA 3C5ZD 2OMYA 3DMMB 3QDGE 4CA4A 4PJBE 3RNQA 4O00A 3ZKSD 2JKJA 4S10A 4PJBB 4HSQA 4KITB 1BM7A 5E24E 3C60C 3KL3A 4RDQG 4J2QA 3E8UL