2HX7A

Crystal structure of cu(ii) azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "csphqgagm"
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
b'CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCSPHQGAGMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Engineering Copper Sites in Proteins: Loops Confer Native Structures and Properties to Chimeric Cupredoxins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hx7A00
1TEFA 2OJ1A 2IWFA 1E30A 3FSWA 4RH4A 1M57B 3FU7B 4E9RA 3QJVB 4UAHA 3OMNB 1MG2C 4KNTA 3ZBMA 1L9TA 2XU9A 5FC9A 4G7QB 4GXFA 1GS6X 1GSKA 2H47C 2PP9A 2JXMA 2I7SA 3T6ZA 2AZUA 2HRHA 1SDDA 2BP8B 3BQVA 3QJQB 1MG3C 1J5CA 3NJNA 4DPBX 2ZWNA 2GI0A 3NSYA 3ZX1A 2Q9OA 4AKPA 2FQEA 1PZCA 2EIMB 3NSDA 4DP1X 5I28A 3FPXA 4EF3A 4A2HA 1NTDA 3UACA 1JVLA 1PZAA 1CC3A 1UATA 4A2DA 2GBAA 1KDJA 2JKWA 2XLLA 3KW7A 1PY0A 3EH4B 4DP5X 1AZBA 1XB8A 2UX6A 2YXWA 1SFDA 5PAZA 1BYOA 1WS7A 3IN2A 4DPAX 3DIVA 1KGYE 4NAJA 2R7EB 1GY2A 2FQFA 3IEAA 4AI7A 1X9RA 5I5MA 1JERA 1L9RA 2FQDA 3ZDWA 4G71B 5AFAA 2FWLB 2PPDA 1AR1B 3PCYA 1PAZA 2GSMB 3X1NA 3FPYA 3IE9A 1NIDA 4E9YA 4KOBA 3EF4A 2UX7A 2DYRB 1E5ZA 1AG6A 2UXFA 3FU9A 1FFTB 3NSCA 2QT6A 2YAOA 4YSUA 3G5WA 4TXVB 4PCYA 4Q8BA 5I26A 3T6WA 2YAFA 3NJMA 4W1TA 3AG1B 1OV8A 1ZIAA 1V55B 1AS8A 3S3DB 1ET8A 1V54B 8PAZA 1PNCA 2CALA 4A2GA 3WKQA 3FT0A 3PXLA 4P5RA 1I53A 4L0PB 3QJTB 1GYCA 1BXVA 1QNIA 3N2JA 3FQ2A 3FU8A 3PAVA 4K9JA 2XXGA 4YSSA 1AZCA 1N68A 5I6KA 2N0MA 1ADWA 1A8ZA 3JTBA 1PLAA 1JZJA 1SF5A 3NJIA 4HCGA 3X1EA 4A67A 3QJSB 1PZBA 2VSKB 3FQ1A 2I85A 2BP0A 4YSQA 2IDSA 2Y1AA 3V9CA 3SQRA 2J5WA 3L45A 3WNJA 2QPEB 1R1CA 1GW0A 4UF7C 1OE3A 2CBPA 2I7OA 4G7SB 3QPKA 2EINB 4BDVB 3HEIB 1E67A 2UXGA 2MTAA 4Q89A 1KDIA 2VW6A 2XUWA 4BXVA 4GP5B 1GS7A 2BZ7A 4E9QA 5B7FA 1TKWA 3DTUB 2X87A 3SBPA 4HCFA 1AZRA 4QLWA 1NIBA 4ENZA 1SF3A 1BXAA 2TSAA 2FTAA 5D4JA 2OV0A 3SBQA 1WS8A 4M3HA 3GXUB 5B1JC 1AOZA 1JZIA 1PLBA 2J55A 5F7AA 1EHKB 1ET7A 2BW4A 3ASNB 1ASQA 2WSDA 2GB2A 1L9QA 3H4FA 4YSRA 2QPDB 1NPJA 3TBBA 5AZUA 1HAUA 1MDAA 4YSAA 1J9RA 1SNRA 4BDVA 4F2FA 5I6MA 4E9TA 2PPFA 1OE1A 2AFNA 1IUZA 2VM4A 2BHFA 3AG4B 2FT8A 1L9OA 1JZGA 2QDWA 3OMIB 1BXUA 2XXFA 2PP7A 6PCYA 1OE2A 3AG2B 2GC4C 3RYMA 3UAEA 3NP4A 4HAKA 5B1BB 4DP2X 4P5SA 2DV6A 3NJLA 5B1JA 1WA2X 7PCYA 2JFCA 2PPAA 2WO3B 5D4HA 4YL4A 3IN0A 2PPCA 4KO9A 2EILB 1A65A 1IBZA 1PCSA 2IH8A 4JKNA 2HXAA 4HZ1A 3FS9A 1CURA 1BYPA 5I6NA 2YQBA 1AS7A 2PCYA 3NYKA 3GDCA 3X1GA 1QHQA 2AANA 1N70A 2P80D 2AZAA 2UXVA 3D12B 1KV7A 3DKHA 2CJ3A 4UANA 4WKXA 1W6WA 1B3IA 3T6XA 4E9XA 1AACA 2CUAA 1J9QA 1NICA 3NT0A 3S3CB 2XV3A 2BP0B 5I6PA 1ETJA 2YAPA 3TU6A 3OD3A 1OCRB 2W88A 2VW4A 4YSCA 4DP9X 4CSZA 2VN3A 1JZEA 3NJKA 2XVBA 3S3BB 3OMAB 4DP7X 2IDUA 3PAUA 2OCCB 4KO7A 2YAMA 1DYZA 1ZDQA 9PCYA 2AVFA 2IWKA 4F7KA 2XWZA 2YAHA 1W6LA 1BAWA 3FQYA 1AAJA 2VSMB 3NJGA 1ASOA 3QQXA 5E9NA 4G72B 1JOIA 2A3TA 2BWDA 1BQRA 4G70B 3C75A 4GP4B 2YXVA 2CAKA 4X4KA 3UAAA 3IBOA 2Y69B 2HX9A 3WNIA 3ABGA 3HB3B 3X1FA 2E86A 1NIFA 1AZNA 3ABLB 1L9SA 5F7BA 2LLNA 1HAWA 3GYRA 3OQRA 4ZK8A 3WKPA 2HRGA 1J9TA 1IBYA 3NP3A 2XV2A 2GIMA 5I5JA 3WIAA 1MZYA 1KBVA 1M9WA 1PF3A 3ZIYA 4N8UA 2DY2A 2DWSA 3T9WA 1ID2A 2UXTA 1BQKA 2HX7A 3AG3B 2NRDA 4E9WA 1RCYA 3EH5B 4WTQA 2IDFA 3FSAA 1QLEB 1ZDSA 4FA7B 2IAAC 4YSTA 3ERXA 4JHUA 2HX8A 4KNUA 5I6OA 4KOCA 1A3ZA 3PPSA 5TK2A 1W8EA 3ABKB 3UABA 2IWEA 1L9PA 1PNDA 2X88A 1CUOA 1X9UA 4BWWA 1F56A 1M56B 1OCCB 1ILUA 3AZUA 3ASOB 1XMEB 1A4AA 1EZLA 4A68A 2TSBA 4DP8X 3MX0B 4A2EA 4DP6X 5LDUA 3NJFA 1YLBB 4AKOA 1A4BA 2PLTA 1KYAA 3CZUB 2RACA 2XX0A 2DYSB 4PAZA 1FA4A 2B3IA 3FYIB 2VMJA 1BEXA 1A4CA 4KO6A 5D4IA 1AG0A 1IC0A 3S8FB 2H3XC 4BWUA 4M4RB 1T5KA 1OF0A 7PAZA 1XB3A 4FAAB 1OCZB 3NSFA 2FNWA 3H4HA 2WO2B 3CDZB 3T6VA 2Q5BA 1NZRA 4W9ZA 1CYWA 1NDTA 4NB7A 4E9SA 5ANHA 2W8CA 1OCOB 5B1KA 5AKRA 1JXGA 2VM3A 3AW5A 1JXDA 2FT7A 1SFHA 1URIA 1SHXA 1HFUA 1PMYA 2MRYA 6PAZA 2XX1A 1KBWA 3WG7B 3CVBA 3PLYA 3UADA 2PPEA 3FU7A 4CSPA 5B7MA 2VW7A 1NWPA 2FQGA 3AY2A 3FSVA 2GHZA 4A2FA 1FWXA 4A66A 2YAEA 1AQ8A 1XB6A 4N4YB 1SJMA 4HALA 3S8GB 2BP8A 1AS6A 3CDZA 4QKTA 1RKRA 4BK5C 5A7EA 3EHBB 1OOWA 3X2QB 5TK4A 3SBRA 2FJSA 3CVCA 1NINA 4GY4A 4KNSA 4YSEA 2BO0A 1RZPA 2IH9A 4YSDA 3H56A 4MFHA 3V9EA 2GC7C 3TBCA 2PCFA 1AIZA 2PP8A 1JZHA 4KO5A 2ZXWB 2CCWA 1AZUA 3CG8A 2J56A 3TASA 1NPNA 3BVDB 1NWOA 1CYXA 5EHFA 4YSOA 2HLEB 1ZPUA 2XYBA 2EIKB 4HHWA 4DP4X 3WI9A 2FT6A 2R7EA 1AANA 1GY1A 2XV0A 1E5YA 1DZ0A 3PAZA 4G7RB 2P80A 4YVUA 2YAQA 4F2EA 5I6LA 1SHWA 1GR7A 4AZUA 1J5DA 3QJUB 4NERA 3EH3B 1ILSA 2DWTA 3ABMB 3CVDA 1TU2A 1JVOA 4AKQA 4DPCX 1JXFA 3U25A 1PLCA 4E9VA 3T71A 5IY5B 1ASPA 4HHGA 1ZIBA 1KCBA 4DP0X 3QJRB 1GS8A 5PCYA 2B08A 2J57A 3X1BA 3MBWB 4HCIA 1IKOP 1BQ5A 4YSPA 3JT2A 3FYEB 3NJJA 4GP8B 5I5IA 2BW5A 1RZQA 2QDVA 4JHVA 1KCWA 1MZZA 4AX3A 1SDDB 3TA4D 2ZONA 1NIEA 2ZOOA 1ZV2A 2YARA 4BXSV 4GYBA 2HZHA 1WA1X 2EIJB 3NJHA 3OM3B 5B7EA 1NIAA 1V10A 2BWIA 3UGEA 3KW8A 4BWTA 4YVNA 2BZCA 2IDQA 4HIPA 1TEGA 1E65A 1ET5A 1J9SA 1WAEA 1VLXA 3N55A 2H5UA 3FSZA 1WA0X 2IDTA 5B3SB 5B1AB 1JZFA
chains in the Genus database with same CATH superfamily
1TEFA 4ZQKA 4IGBB 4PWKA 2K4WA 3P1VA 1A6AB 1JPSL 1MPAH 1CGWA 4MMZC 5ES4B 1CVRA 3T0WA 1XGRA 2V3FA 3BP7A 3KXFB 1L5GB 3LNDA 2GFBB 3G6AB 1FO0A 1K2DA 3D4ZA 3KGTA 4HIXH 4IHOA 2PP9A 2Y36H 3BT2L 3F84A 3SD2A 1IKFH 3N41F 3BWAA 5JOEA 2CO3A 1P4IL 1XGUA 4FULA 3S35X 4CBZA 4RRPM 5IB2B 3WJMB 4XTRD 5TH2B 3HZKA 2A9BA 5EEUA 1XF4A 2H41A 5K69A 2AV7A 1GPOL 3KAAA 4H8PA 3HG1A 1ZTXE 3BGMA 2HA1A 4ZW3A 1KIUA 4JL1A 3LQAL 3P3UA 3SBWA 1MFEL 5LGHL 3ELAT 1LWHA 3C5ZB 4NKDA 4NKIL 2X3CA 3P2BA 3M45A 5DEZA 3ZDXB 5J1SC 2AHIA 1L6XA 3VGBA 3TYGL 4M6OH 5CR1A 2ZJSH 1UENA 4LLUB 2J4WL 2OSLB 1U8NB 4KXZH 3CXFA 3S36X 1FFQA 4YC2B 1PX8A 3G04A 5TE7H 2AK4A 3A4DA 1O5DT 1YEIH 3L3OC 3OKNB 2QQNH 5LQBH 3EF4A 3VFPB 1F6FB 3BX7C 3NFSH 3DRTA 4BHUA 1VKXA 1DBJL 1HNFA 4ZSOB 3ARFB 1UH3A 4X4ZA 4TTGA 2E47A 4ZS6C 3MFGB 3NAAH 3CMOL 4GSQA 4Y2DD 3EIFA 4MBRA 4M1CD 5I26A 4DVBB 5AB0A 4XZUB 4X4XA 4AVKA 4PJ9D 2BIOA 1V54B 2X6UA 1QLRB 1C7TA 4BZ1L 1D5ZA 3VRIA 1AFVL 4K5OA 2E4TA 2LVCA 3EYOA 4UIMB 5I73B 3GHEL 4K9JA 3SDAB 2EVJA 2F18A 2UZXA 3LZLA 1I7ZB 2R4SL 5EUOE 5I6KA 4AUUA 3MLRH 1GA2A 4K3JL 2AP2A 4CVXA 2W9LA 4TUOA 4A6YH 1MAMH 2E7CA 3ARSA 4QTIL 5J6SA 1IL1A 1SXCA 4CKVX 2DLEA 2IDSA 2WWMD 2CDGA 4FYRA 3UGXA 4ELMA 3C9NB 2AAVA 1A6VL 3TO4B 4P4KA 4DO6A 3GK8H 4K3DL 1T04A 2ZKYA 5ANMB 4KITB 3VQ2C 5EOCL 4FG4A 5G4MA 3GNML 1BMZA 2UXGA 4WFEE 1UZ8B 1G7PA 3LKQB 4LHUD 3KBHE 3TV3L 2QL1A 4Y1AB 2NR6D 4ZUVB 2EH8H 2WCPA 1CGTA 3PGFH 3TBVB 2CUMA 4G6KH 4MZIA 5GZOC 2W9EH 1H3XA 3US0A 1IM9D 1HH6A 3DTDA 3V8CA 4QNPF 5HI3D 5I74B 3BP4A 4XB8A 3MOQA 1QSFA 3EOAB 4X9IA 4N0FB 2EJ1A 3SBQA 3TN0A 4HJUA 3AU1A 4ENEC 3MUGB 3SE4C 4Z7UF 4TVPE 4B97A 2IIJA 1JZIA 2IPKA 5J3HC 1NGPH 4O2CA 4K94H 5I1DA 1PJWA 4K8RH 2CGYA 4M7LH 1T7XA 3TT1H 2C9RA 1NCTA 2NY1D 3KLHD 1DEDA 4I9WD 4OFDA 2J6EL 5DJCB 2VLRD 5I1EH 2W65A 4G80A 4MMXC 1WIPA 5BS0B 2AFNA 1H8LA 3FONB 2BHFA 1EXUA 1Q72L 2DIAA 3GMRB 1BXUA 4GFXA 4R2GC 1OK0A 4FXKC 1EAPA 4ZFOA 3PNWB 4HQQL 2EUZA 1O6SA 2DWEB 1J5HA 4NJAL 5MENE 3C60D 4OLXL 5HHMD 3NG5A 4ELDA 1FUNA 2DMBA 3O6FA 5FM4A 4CGTA 5T3ZD 2YJQA 3EGDA 2OULB 2ICWJ 3F6IA 4DK3A 2OPCA 4NQUA 3R18A 3NACL 1JTPA 3RWIA 3T77A 1E2VA 4F15C 4F2MA 3V5KA 3IJYB 4AVHA 1HCVA 5CCHE 1NFIB 2PTTA 3NA9L 1Z3GH 4JHWL 4U0RB 3IBEA 5D1XD 3U7WL 5D7EA 1SJVA 2PO6A 3IS0X 5D93C 3D0VB 5DD6A 3OVUB 5HYJA 3DOSA 4M7KH 3WD5H 1QYGL 3K3QA 4G6JL 4R4FL 1B4TA 3KLKA 4I1NB 3RWGB 4E41A 1UWFA 2DQIL 5FM5O 1B0GB 2Z64C 1LP9B 4UANA 2UXVA 2AZAA 2JIXD 3HHSB 4F8TA 1O6TA 2RIKA 2XFGB 1JHTB 4NNPL 2R1YB 5AZEL 2J2ZA 3QYNA 4QRPE 5IVXF 1NICA 2HJKB 1RZKL 4F33A 3F7YB 3OB0K 5DFVD 5E5MB 3GJEB 4JFEE 5J9PB 2QV2A 4JNXA 4KK9C 3A6CH 4JPSA 2HVJA 2P8LB 3CZLA 4PV1C 1B2WL 5AAWA 4ZRGA 4P23D 5C70A 5ACZB 3AQDA 1D9KA 4I3SL 4QEGA 4UINL 3RPIA 4NZJA 3OMAB 4TRPH 1QSVA 1NCOA 2ZOUA 3R1GH 2YXMA 4TNEA 2CMRH 3RKDC 1BP3B 3GGWA 4FX5A 4HPYL 1MCLA 4F7KA 2N7SA 5C86A 3LTVA 1CICC 3DVGA 4RAUB 2BDNL 4KJWC 5GGSA 1QQDA 4LLWA 3U0TB 5SWSD 3VXNB 5ADPH 1WG3A 4Z5RB 3B9AA 1BLNB 1RUMH 1IRAY 1I8UA 2ZCHL 1TNNA 4X9YA 3VWKB 1OAUL 2WXPA 4UQ9A 1G6RA 1QNZH 2OYMA 4I48A 4NI6A 4WTWA 2GTZA 1E4KA 5I9QB 3VDCA 5IOPB 1P6FA 2NNFA 2W9DL 4XMKH 4PP2B 3D0LB 3HB3B 4TLSA 5ABDE 1KXVA 1MDTA 4Y88A 2O30A 2E0PA 3L3HB 1MQKL 2R0KL 4BFEA 1D5MB 1TVHA 1P1ZB 1BM3L 1S7WA 3SYQA 1MFCL 3IYLW 1TJIL 1H6FA 4Z0XA 3GWJA 1QSEA 3VXOA 1V7NH 3L16A 2OI9C 2XZQL 3CFIC 1PZ3A 3M88A 2UXTA 3O0RH 3WKYA 3QEQE 1RIHL 2OX5B 5DJXA 4NQXB 4JG5A 3CH1A 4MS8D 4WO4A 2IDFA 2W95A 1KJ2B 2RQ8A 2ADGB 2BC4B 3PHQB 5G2NA 1XIWA 2YSSB 3L5HA 5T3XD 3TZVD 4JDTL 4YXHL 1XZ0A 2Q2LA 4KOCA 1A2YA 5I1IH 3ARXA 2XETA 3T08A 5INCA 4L9LB 4ETQB 2DLFL 2ZXEB 4KI5D 1AQMA 1HX0A 4M56A 4R97C 1GGIH 1S3RA 4PUBL 3AREB 1EO8H 1IEAA 1EO5A 2OMXA 4AT6A 2DL2A 3ZHLA 2HVKA 1BBJB 3VI4F 3TPKA 3RVWD 2OL3H 2YGOA 3NJFA 1E6OH 3W81A 4AC2A 5LG1A 4OFYA 5KTEH 3O3DB 1JYWA 1NL0L 1LTXA 3FQNA 1FA4A 32C2A 2XI9A 2DAVA 4PJ6A 5SV3A 5DR5L 5T8IA 1I8KA 2QGEA 3IXAA 4F80A 2G0LA 4PJFF 2FO4A 4L37B 5DLML 2I24N 3CUPA 1XAUA 2F15A 4ILDA 3L4TA 4IYKA 4DZ8A 1MH5A 1EEQA 7PAZA 3F2LA 3G6JA 4WU5A 1CFSA 5C0AE 5J13C 4Z7QB 3KYKL 1JZ3A 4OCMC 4NQED 3NABH 1E9OA 4IS6A 2CRYA 2ADJA 4EQ2A 2QMJA 3WJJA 2Y7SA 4LCIH 1NDTA 4GQQA 1JPEA 2X0UA 1MHCB 2W8CA 1YQVH 1OCOB 2YN3A 1UWXH 3GM8A 5KYWB 4E5XG 3ILQC 1IARB 4TNWK 5DD3H 3C6LA 3ZKXB 4X8GA 4JFPB 1CE1L 1NAKH 1SYSA 1VFOA 2A0LD 3STZB 3ULVC 3SO3C 3BPCA 3C5ZC 1JHLL 3UH8A 4TTDC 1ZD6A 2WXRA 1S8DB 5TTRA 1SXSA 2PPEA 3N06B 3KLLA 1CYGA 2JKJA 1N2RB 2C1OA 5IJVB 4GMTL 4YHKL 3L4WA 3WN5B 4TNGA 1DUYB 2R56H 1ODAA 3GEFA 1A8JH 2G30A 4GRWF 1J1XH 3WNOA 2HFGL 2P49B 4JMXA 5ID0B 3QK0A 4UQ2A 4P06A 4OJEH 4K23L 3EHBC 2OLDA 5BZWA 3FUMA 4J3OC 4S1QH 3W9DA 4PRHB 5DZLA 4UTAH 3H2WA 3QRBA 1R0AH 1A1NA 4ZNEA 3HUJA 4ZZFA 5CIPA 4MX7B 3UZQB 2AABL 1CG9A 2C4XA 5IB4B 2PABA 2KMWA 3NTCL 1AKJD 3M7FB 4NKMA 4X5PA 2XICA 2GC7C 2SEBB 2WMPB 5F9WB 3QJFB 1JBJA 5KJ4A 1A7QL 1IGJA 2DQUH 4JFHD 3PHSA 4PJXF 1WHPA 1XH3A 3ARGD 4APQB 1SVBA 3K5RA 1KTDB 2GCYB 4PG9B 4U3XA 1X6NA 1Z9MA 2ADFH 1S7TB 1UOKA 3NZUA 3UIZA 2I9TA 4K55A 2D9CA 4F2EA 3RHWF 3A4AA 4UILH 5LCVA 4YDKL 2X70B 1J8RA 3GJFA 4KHTH 3GTVA 4FQQA 1TU2A 3EJYD 4HSQA 1JVOA 4WGWB 4IDJL 5CO1A 3O6LH 2V2XA 2ZWKA 3K74B 4HHGA 2A6JB 1M42A 1J8KA 3GZPA 3RDTA 4OJDH 3P2TA 3N1PC 5SWZE 2MOGA 3R7QA 4ISVB 3GBNL 4MDIB 4PWEA 4JANB 3IDYB 4OCXL 5GGSY 4MD4B 3FW6A 1DQLL 1BBDH 4M8UA 5JIPA 3MRLB 2Z7ZA 4NZDA 4PJ7F 1MZZA 4UU9B 5C08A 4JFFA 5F7HA 2VCOA 4FOMA 1CXLA 2JJSA 4PLJD 1QPKA 1F58L 2FE0A 4MYPA 3UP6A 4LCWB 2WHVA 1C8QA 3NFPB 4WSJA 1MEXH 3NJHA 2MQGA 3VRJB 4K71C 4FP8H 2WP3O 4LKCA 5FKAB 1JZ7A 3OGOE 1U8IB 1MNUL 3QPQC 4CL7A 1U4FA 2K1MA 4PWGA 4YS4A 5IR1A 1OARH 3LKNB 3N55A 3OSVA 3FZUC 1R47A 2G4EA 3V5DA 1WD8A 3BN9D 4GG6A 1EGJA 2KPNA 2E8ZA 3MRBB 4RIRA 1TZAA 4I18A 4E9RA 3LRGA 5DD0H 4P2OA 4KNTA 3HE6B 3N91A 3NMEA 4NJ9H 4XPFL 3RL2A 1QRKA 4FERA 2DEYX 5FFGA 2OYLA 2VLLB 2Z7UA 3Q01A 3VXTB 2AZUA 3EXJA 2R1WA 1TTGA 3BKYH 1MHPL 1F3JB 4HHAA 3ZX1A 3UTQB 2QPFA 1FFPA 4Y19D 1JVLA 5HHOE 1NBVL 1QABA 5EC2A 4HOXA 1WZKA 3US9A 1C5CH 2JKWA 1UT9A 4OUUA 1UXSA 4RQQA 1PY0A 5KEZA 4JRYD 5GXBB 4A6YB 1FL5B 5CP3H 1H5BB 4G8GA 5BQDA 1W72L 2YUXA 5EG6C 3MLZL 5LXVA 4QYAA 2YQGA 1BQHB 5B4MC 2E27H 5IF0B 1KGYE 3D3VE 1ZPLA 3CFDB 3ILEA 2EDTA 3MGOA 3KXFA 3R4RA 4I0KA 4EN3B 2R7EB 5T5FL 5CEXB 5IEKB 1F3DH 3IPBA 3Q13A 3QDGE 1X9RA 4QLRA 4YIQB 5M7QA 2FQDA 2VXUL 4F1SA 5I6XB 3MQIA 5E8OB 1AR1C 4OCWH 3PCYA 4OJFH 1PAZA 2GSMB 2WNGA 1WZMA 5T1LB 4OH2A 4YAQB 3WJMA 1F3RB 5IHWA 2XIIA 1IGTB 1BJMA 3FQ4A 3B2UC 1ZT4A 4J3UA 3KPSA 4Z0BL 4K07A 3QCVH 3VW3L 4GIAA 5F1OB 4M1GH 3I50H 2VO8A 5FA4A 2IG2L 2NYKA 2WVTA 3DWTA 5I1GH 1LO0L 2EKJA 3AG1B 1MRFH 1DBKH 1AS8A 2EYSB 3TESA 3V52L 3S4SG 2F7PA 3UDWC 1H3WM 4OJCA 3SE3A 4JO2L 5DA0B 3N9GL 3CFQA 4N8PA 1ZKAA 3FTZA 3IFOA 2DM7A 1NGQH 3NIGF 3PAVA 3FQ2A 4Y4KD 4PBVC 2F9BT 5ISZE 2Z6FA 1X44A 2RBLA 4YSSA 43CAA 4WEBH 5F89A 4HUVB 4LEEA 2FIRT 4LDOB 5F21B 3VWKC 3EOBA 5EMYA 3RTLA 5ITFA 3BSZH 4LEXH 3VFPA 3U9PH 2I07B 3KCPB 1LEGA 4OW6A 3SKUD 4LSTH 3JTBA 1DLHA 1F4HA 4FZ8H 2AV1B 3MXVL 4JRFA 2ILLA 2HJFB 4R90H 3V9CA 2IJ0C 4WI6A 4KRMB 3BUYA 1RIUH 3W1ZA 1GAFH 4RMWA 4YX2L 3WNJA 3LKSB 3BWUC 3LMJH 1PG7W 1S7RA 2JLLA 1DANU 3HNSH 4N2HA 5AWNH 2BRQA 4BDVB 4JY5L 2DI7A 4MD5B 4JVWA 3SYOA 1TTAA 2AGJL 3MRRB 4FTVE 4WWPA 4N3TA 2BHZA 3EGSA 2OZ4A 2BOCA 1GS7A 1U8QA 1FYTE 3EJTA 1SXZA 1RUAH 5F44A 3GMLB 1MRDH 1MF2L 4AIZB 1AZRA 4LF3A 2PYED 4PJ5D 3UCRA 2TSAA 2ZXGA 4GXVL 4JFVA 5EZOL 4V1DE 4B5ZA 2FTAA 3VFGH 3GB7B 1S9VA 4NGHH 2HJLB 3HPJB 4MAYA 1FZOB 3C9NA 3K72B 3JT0A 1EHKB 4D0CB 5CJXA 4MXWH 2UY7A 2G2RA 3BUBA 4QCIB 1XH1A 3SDXE 3L9RB 2CHWA 4YUEL 3RPKA 3IGAB 1JZ5A 3ESPA 2BVUA 4FNPA 3ZE0F 5DWUL 3AUVA 2A74A 3V0JA 3BRFA 1MCFA 1OK8A 4G6AC 2FT8A 4IMKC 3BESR 1B4LA 1KFAL 2PN5A 4JO3H 5JQHC 1M6OB 4FQ1L 2PP7A 4LVOB 2QVKA 1BYNA 4OLZH 4OZGB 3MDJA 4FQXB 1P7QA 2XPYA 5HYSB 1UA7A 4HAKA 3UMTA 4KZEL 4ZAKC 2YPLD 1RZ7L 2O93L 4LSQH 3MYJB 3PXJA 1XF2B 5JQ6H 2YRLA 3GXFA 5BXFA 1I8LA 3LZQA 4HS8L 3UYRH 4MLSA 1XHHA 2OP4H 1AQKH 3D2UD 4TF4A 4OIIH 2IAMA 4KO9A 1ZLWK 3WY3A 3X12A 4O2EB 3FQWB 3QFJB 5L2JA 5DJCA 2WIMA 1JDDA 1YN6B 2HPTA 1R3JA 5ESQB 3EO0B 3FN0H 2WQAA 5BS0A 2KQNA 4IRZL 2DQEL 3FT1A 3GDBA 5IM7B 3FONA 5CSBA 3RFZC 1DQKA 2IQ9L 1U8JB 4OB5H 4CRPA 1FPTL 4H2AA 3TXAA 3L95B 4WI9A 4Z77B 2B2XL 1J9QA 4TUKL 2GJ6E 3WN5C 2X1PA 4U1NB 1ETJA 4L8BA 3T65A 3U6RB 4XNZB 4XPBH 3HHRB 3B3IB 4BKTC 4DJMA 5K59E 4IMLA 2HLAB 3NN8A 3ZUNC 3D06A 3P11L 3PAUA 4MA8H 3FCSA 2B1AL 1BG1A 9PCYA 4FXGB 2K70A 1Y1DA 3AWFA 3F7KA 4BYHA 2OL3B 4HJJL 5FUZH 3HC3H 3L2MA 1LNUA 4L29A 1YEFL 2VSMB 4ADIA 1RJYA 3HHMA 4LPVA 3O8XB 2FATH 5FR3A 1G9NL 1CI3M 2C1PA 3GMPB 5AW1B 5GGVL 4EI6B 1CT8B 4IJ3C 2W92A 3HHSA 4YK4C 4GP4B 1JHTA 4MA1B 3JTTB 2ZOTA 4JJOA 4XXWC 2HJKA 3V0GA 4AEFA 2OW6A 4HEME 5J9PA 1YPZF 1NC2A 1NIFA 2P8LA 4W6YB 5KVEL 1FZKB 2BSED 1KPRA 4YMPA 3W39A 5ACZA 4XN9A 4XI5D 4OBRA 3DBXA 1BVKB 2F54B 1ZCRA 3IF1B 5EB9A 1E5BA 4DOHB 4XO9A 1A9BA 2VDPL 2O72A 4FC3E 3T9WA 4KUCD 2BXYA 2ZOKB 3F7RA 4YLCA 2F19L 2BCKB 4UTBA 4X8CA 3LXCA 5IVOA 4LNRB 3IDYC 3UBHA 4Z5RA 1BLNA 1ZDSA 3QUZB 3KJ6H 4I13B 5CSGA 5H35B 3DHUA 4GRLA 4QPEA 3VFNA 3LS4H 3NCMA 2CJUH 1ZT1A 5IOPA 4UDUA 4DGYL 1OPGH 3VMPA 1AC6A 3EO9L 4G9FB 4IDLA 4X6CA 3CCHA 5K9OA 4FRWA 4J8QA 4L1LA 2ZCZA 3O4LB 1WT5A 3QR1A 3SE6A 3MBEB 4C4KT 3L3HA 1VACA 1S5IH 3WEMA 3OKMA 2GI7A 2Z7WA 3N41B 2NY3D 1DVZA 1D5MA 3WIFA 1P1ZA 1ED3B 4F7TA 3N42F 3BUTA 2ZG1A 1KPVB 1R3KA 1FNGB 4YFEA 1YLBB 2VXTL 4YH6A 5J3HD 5H94A 5GZNA 3MRQA 4JN1H 5I8OL 2AJZB 4JCMA 4NFDA 5DRNB 3SKMB 1W91A 1MELA 1UGKA 1MJUH 2Z0UA 1YMMB 5F8RC 1GGUA 2BY1A 4EJ1C 1KTRL 2MJWA 4IEFB 2ADGA 3VE0A 1ULVA 1NKRA 2GT9A 1Q94A 1SVZA 2WCSA 5EU7E 1CDCA 2XY1A 4HFUH 4NBXB 3EH1A 4H25B 3GS4A 1E7UA 3G6DH 4LVHB 2C9UA 1D3CA 1XL4A 1MUJB 3IKCA 3OHXC 4IBZA 4Y5VB 3TJHC 3FFCA 3ROOB 1UXWB 4HK3N 1R4XA 3AREA 4LCYB 1R33A 1CI5A 4PW3A 1HSAB 2OJEA 2R29A 3IDIB 4B7LA 4ACTA 1QR1B 3CIQA 1ZRUA 1VHPA 5DHYA 1DVYA 4TVPD 1RV6X 1H5BC 2HKHL 4TLKA 2KERA 1JCKA 2VIRB 3MR9B 1UM6H 1K85A 1GMIA 4L4TB 2J8UE 4DF9A 4EN3C 3UAJA 3MRHB 4X7TB 3FUKA 5J7CC 4HIHA 4XRCA 2RGSA 3SGDI 2E7LA 4N4YB 2XTJE 3BJLA 2BFVL 2AQ2A 4BSJA 3ZTEA 1JPST 4ANUA 1OL0A 4DQOL 2IDCA 4NWTL 2F6AA 1JAEA 3UAFA 3HTLX 1QUNA 2ZAIA 4ZG1A 2XJLA 4N28A 2QJDA 3GSQA 4J6RL 1CLZH 3V6ZB 3MV9B 1CZ8H 3RWHB 1EZVX 5JPMA 1WISA 4JFPA 1ADQL 2R69L 3NFNA 2X40A 3STZA 2J5LB 4DW2H 1UZ6E 4HS3B 3CG8A 1CICD 1UD6A 3IRPX 4OLWH 3MNWA 3ILDA 3GSNA 5IJVA 1M2VB 4H88L 3VYPA 1CGXA 1D7DA 1KELH 1FZJA 2DTMH 4LP4A 4FE9A 1DUYA 2P80A 3GO1H 1F97A 4C56E 1YEGL 1AGEB 3DXAA 3GI9H 5ID0A 5I8CA 1K6QH 2YD5A 3B2DC 3ZYOA 3UTOA 3KWWB 4QRPD 4B9IA 4OIBA 4CC0A 4ABQA 4PRHA 1KCBA 4FYSA 2PW2B 1MLBA 3B6SA 4EIZC 5DK3A 1TJMA 2I60L 1DUZB 4CVZB 2C3VB 2YMXL 1K8IA 3FQTB 3ZKND 5E00B 3QR2A 2BSSB 2YRPA 3SQBA 5DUBA 4MXVF 5JO5B 5CWSB 2X2JA 5DS8A 3QJFA 3WFDH 1LQSR 4YQXL 3VXUE 1BZQK 2VDKL 3L2NA 4I3GA 2OJZH 5E5LA 5IJBC 1U8MB 2GCYA 2C3GA 3Q2CA 4OGYH 4Z7UB 1SDDB 1ZHLA 2W60B 4AE1A 1JGIA 1NIEA 3IU3B 3VA6A 2KZBA 1DFBL 1S4IA 4OZIE 1T4WA 1KCRL 4BQBA 1EWHA 2XNAB 3ML8A 4GMSH 3LEVH 4IOFC 3E7JA 4MNGE 1FFRA 4X5LA 1PCXA 5F6HI 3CE1A 2XC8A 3C8DA 4XNYH 4BWTA 2WW8A 1FV1A 3F85A 1GL4B 3F5WA 1WBZB 3IFLL 4NT6A 5J5EA 1SQ2N 1ET5A 3QZWG 4KTEH 1NDMB 2JJVA 4RZKA 3BZ4A 5B38B 4FI8A 2EH7L 5B3JF 4OAWA 4KK5C 2FD6L 5B3SB 4X6BA 3FO9A 5AENA 4MD4A 2M2DA 1V05A 1NLBL 2B3RA 3BVTA 4QRRE 3RWJB 3ZE1F 3ZO9A 1L9TA 3ARUA 1HCZA 3IWVA 3OAUH 4OZHF 5AW6B 3QHFL 3UFIA 2W0FB 3QEQD 5GRUL 2ED8A 1KN4L 4ODUB 3BSGA 4R6UA 2ZWNA 2X1XR 1L0PA 2F5AH 4JE0A 4DP1X 4XWGL 5TQ2H 3OLDA 4UDTA 5I28A 4JJ5B 1T1XB 4XMPH 3V4PH 1OP5H 4LSUL 1H0DA 5E08L 3KW7A 2PETA 4FQXC 1Z9SB 2CLRB 2N7AA 2ZOLA 3CFBB 3LKNA 2WNWA 4M6MH 3TBWB 3QIBD 1PZSA 4Q6YA 3S5LG 1CK0H 3T2PA 4AY0A 5DSCB 5L9DH 3DRQA 5IVXB 4X7SL 2XZCH 1V3LA 3L4YA 4K4KA 4DSYA 5DT1H 3DK2A 2X6MA 3MV8B 1VCAA 4JKMA 5EWIL 3S34H 1L9RA 1TMQA 3B2XA 2OTWA 3ULVL 3ARBA 4LLDB 2Z31C 1B0RA 5LXGH 3D48R 4GAAA 3AS3A 4Y8AA 4CW1B 3CFNA 2O6FA 2WLLA 1DHKA 3CDYA 1ZANL 2DS4A 1WAAF 3UTQA 4V11A 4JFXA 1PFCA 3L3JA 1MWAL 4N22A 3IJ7A 4F8PA 2Z34A 1FC1A 2BS8A 5C0AD 3EHBD 2ZQKA 5FYLE 3EYQD 1A64A 3O81A 4WI4A 1J05B 3DARA 4BK8A 2BH0A 3S37H 1OB1A 5KBLA 2Z7YA 1ACYL 2X38A 1V3MA 4XO4A 3S3DB 5EU6B 5ALCH 5IF0A 1P1VA 4FNQA 3ZGIA 4FYTA 5GS3A 4X4YB 4FQHB 3IAPA 3TCLB 5IEKA 4P5RA 4HIIA 1ZLVH 3ZSTA 5DYFA 4PYHA 1F4XL 3EDKA 1DSFH 5T1KD 1CXEA 5D2NB 3ZRCC 3B9KA 4IRJD 5D8JL 3HG1E 2XXGA 5FM5M 2DQHH 4H8WC 5EA0L 3B37A 1OAYH 3MRDA 4JPKL 4Z7VF 1A4KB 4X4MA 4WWKD 4PIBA 2WOYA 3AS2A 2R8SL 4P3DA 1A8ZA 1BFOA 2XKNA 4MA1C 5C07A 2CDEA 1GZPA 4AJWA 3TA3C 1I8MB 5FWRA 4K15A 2ED6A 2ITCB 2JB5H 2YS4A 4G8IA 4QHKJ 4CMMB 3X14B 2CSPA 1WK0A 2QQLH 2JKSA 2EYSA 2R59A 3DX6A 3QIWA 1OD7A 4ZW8A 4PGCB 3QPKA 2AK4E 1GC1H 1I7TB 1OT1A 2ZZUT 1JWMA 1OANA 1WUNT 5F3FA 3HRZA 3AWGA 4Q74A 1GZQB 3AT9A 5H2BA 4MQTB 2ATPB 3WO3B 3Q8CA 4HMEA 3ZIMA 3VI4B 2V2TA 4HUVA 4C83B 2R39A 1NMBL 4LZKA 1OGAB 1N59A 2Q8AL 3AS0A 2I9LA 2EAEA 1YECL 1R3LB 3V6FA 5JIHA 3SBWC 1WRFA 2DPKA 3AAZB 3LZPA 2C7UA 2NXZC 1U8PA 4PJFB 4PJEF 2HJFA 3UP1A 2HTLC 3MBEC 2X3AA 1YG9A 4P5MB 4PP1C 4JZOB 1NPJA 4A38A 4K3EH 3QUKB 1NGZA 2HTKD 1PKQB 4BDVA 4FEIA 5I6MA 1HZLA 4ONHB 5SWZD 3SPJA 4LFHG 5GGUA 3I6GA 1A3LH 3AG4B 3BPLC 2X5PA 1BEYH 5FYJE 1U2YA 4F7CB 2CRIA 1MXDA 3LZFH 5KZCD 3VFTA 2DWDB 3G5XB 2DQTH 2IXQA 4ELME 5K9JH 5IHUH 2P45B 4OFPA 1EZUA 4CU6A 1A9VA 4FLRA 4R26H 3SE8L 3F3HA 3DMMD 3GB7A 2VDNB 4YE4H 3BKCL 3O3BB 2FK9A 3LVTA 4LSSH 4KTYA 2ZUUA 5IHZA 2W0PA 5B1JA 3HPJA 2YPVH 1QKZL 3PWNB 5E8EB 4DO5A 1FZOA 1IX2A 3K72A 4DO4A 1N5YH 2OMTB 1HI6A 2NY4C 3EJCA 4QJ5B 3QO1B 3FOLB 4QCIA 3CFCL 4GRWB 4GPVA 4XMXA 3KDPB 1UA6H 2IH8A 3T4AC 3MCKB 3OMZA 5C0NC 5B4MD 5AVTB 5CGYC 4ZMWA 1QSFE 3LRLA 4UM8B 3P2DA 1BXXA 2AI0H 1XF5A 3DYPA 3CXDL 1J0KA 3FB6B 2ADIB 5BRZD 3I3BA 4O9HL 4RGMB 5E2JA 1AR1D 3BVNB 1AACA 2MWCA 3K1KC 4OZGA 2J88H 2OM5A 4ONFH 5HDBB 3NT0A 1KTJA 1ZV9A 3UGUA 5CZVL 4JKWA 4YPGB 3S3JA 1MFUA 3BP5A 3MKKA 2R2EB 2MPAL 1QACA 3I75A 4P4KC 5DD5L 3JUYA 4PJ8D 4BINA 4PJXB 5KSUA 4DP9X 3WFCH 1H3PL 3ARYA 4X9BA 1WV7T 4RBPH 3WTXA 1H8SA 5I15L 2ORBH 2IFFH 3L7EB 2O5NA 3LHPH 4G3YH 4ZD3H 2BOBA 1U6AL 4MJ2A 3L1EA 5EO0A 3SGJC 3FQWA 3QFJA 4FI7A 4LLMA 4YHYB 1YN6A 3SDDB 1RVFL 5ESQA 1ZWIB 3QUXA 4HJSA 4X83A 4B9KC 3QG7L 3CDGA 1A3RL 4G72B 4PS3A 3D3VD 4IOIA 5L7XH 2PWGA 1U8JA 1BQRA 1CFQA 5JA9A 3RB7A 2K8QA 1QWHA 3QDGD 2A77H 3GHBH 2J1WA 4F2ME 2WUCH 1TSHA 2RCSL 4K5MA 2FIKB 3BIAX 3I6LE 4N2MA 1TOXA 2C9SA 1UXLA 1T83C 2CLVB 4WZ9A 3SKNA 1D5BB 2G2NA 3QP3A 3R8QA 5HYJE 2RFXA 4PJ7B 1R24A 3B3IA 3GZQA 5D1QB 4JFQB 1AD9B 3RAJH 1KGIA 4E41E 2IPUG 1MREH 1UVQA 3BKML 4W6WB 3GMQA 5F9OH 1RMFL 4N8VG 4QHMB 1HINL 5GRJH 2A6IB 4OCSH 2QADD 5I8KL 4BFIB 2HX7A 4UOQA 5I8EA 4WV1B 1BPLB 1KB5H 4FL4C 1HU8A 2IBZX 4OFIA 4GXUN 5F0MB 5FEBA 3QARA 4EI6A 3OHMB 2FBJH 3MNZB 3BQUB 4JO5A 4D3CL 4XXCA 5KG9A 3WN6A 4QOKA 2JNZA 2K6ZA 2X7LB 3JTTA 1W8EA 2VM9A 4IK7A 4DVRL 4YHIB 3SCMB 2CIKA 5ISZD 4LPYA 1N12A 4Q0XL 4Q7DA 1KJ2L 1FZKA 2D3VA 1NC4B 4GQ9L 4NM4H 3UYPB 4MA3A 2PO6C 2Y3NA 5I76A 1QFUH 2VO5A 2Q6WB 1HVXA 1IM3A 3HLAB 4DP8X 1D7BA 1Z9NA 2H0PA 1Z5LA 4P46A 4O5LL 2R0WH 1D5IL 1S5HB 2OMYB 3QNZB 4M4PA 3CZUB 1RXLA 1R5VA 5IW1A 2VMJA 2NYZA 3IB4A 4MKTA 4BE6A 1QFPA 2XN2A 3QUZA 4D0DA 4NZTL 1Z5HA 4Z3FA 5HHVH 1MWOA 2AEWA 4G6AD 2ZWZA 5BV7C 2WQUA 4FTVD 3FCGA 2M8XA 3WNPA 2YXFA 3ARWA 3FAXA 4TSBL 2WLJA 4ZXBC 1DVSA 5KJ7E 2Y72A 4XPGL 5I17B 1QSEE 1FYTD 3PV6B 3A23A 4R5XA 4UNTA 5EEYA 3H9SA 1UUSA 3I6KB 5CU9A 2Q5BA 3MLSL 2AXWA 4P2QB 1U8KA 1DQJB 2J1ZA 4ZAKD 4K73A 2CDFA 3VCLA 1U8LB 5AKRA 3V0VA 4V1DD 3AW5A 1EEZA 4PCTA 1KTLA 2EDLA 1XEDA 2FT7A 3JZYA 4UTAA 3U1PA 5IMKB 3K0WA 4OF0A 4OD1L 2NDFA 4MDJA 4HLZG 5GSVA 4WW2B 3SHSA 3EUDA 3U6XA 4H26B 4YWGH 4GEIA 4L4VB 1EMTL 2XX1A 3K2UL 2QR0A 4LOFA 4XCYA 2A4EA 3WG7B 2H3NB 3A6BL 3VMOA 3EJPA 4WDIA 4X80H 4UV4H 2DQGH 5F1NA 3OLIA 3AY2A 4YO0B 4CNIB 2DYPB 1KXVC 1P5VA 4XP4L 1FWXA 1IAIH 1WFIA 2HWZH 2VZ1A 4N2BA 3C2AL 2QHRL 1G7JB 1C8PA 4L3AA 5ADOH 3G9AB 5HGDB 1UEYA 4J4PA 1AS6A 1ETA1 1CLYL 3B5GA 5K1VA 3ROOA 4CDHA 5A2JH 5CD3B 5KAQF 5K93A 2AJSL 4LCYA 3WJLA 3BT0A 2NY0D 3NIGB 3PWJA 5IB5A 1HSAA 1T0OA 2B77A 1T1YB 1FRGL 4LK4A 3RA7L 1W15A 4OTXH 2FH8A 1EA9C 4R7LA 3N1GC 5GSRB 1NAMA 3G6JE 1G7MB 3U2IA 4M8QA 1ETZB 1HH9B 1YN7A 2Q8BH 4K9EH 3TASA 1JXKA 2J56A 2DTSA 4EI5C 5FWQA 1TQTA 3JWNG 4XNBA 2WXJA 2C8NA 3BDXA 3WI9A 3C8KB 2Z1PA 1UACL 4CSTA 1CDUA 1OTTC 2NUPB 1P7BA 4PJBF 1SHWA 3QQ4A 2FX7H 4W4OA 4KKAC 3V55A 1H8NA 2EDNA 3SPCA 3L4UA 2OCFD 4D9RE 1KTKE 3TIEB 4AMXA 4HIXL 2GJ6D 2X2IA 3VB8A 1ZIBA 3VGEA 2Y36L 3APNA 5AW0B 3QJRB 5KSAD 3V4PB 3KJ4B 3MV9A 5DMIH 3P30L 3RWHA 3TM6A 4AQAB 2L3BA 4Y9EA 3RUGA 3A24A 5BO1L 2VXQH 5I1LA 3ARDB 5FOBB 1ZS8A 3BH4A 4JY6A 4LDCA 1S7QA 5DD1L 4PRPA 3O2VH 4OQTH 5GRXG 4HS3A 1OSZA 4NZFA 1XFPA 1KSRA 3KEHA 1FVDB 3TP4A 4WO0A 3C6EA 3Q1SL 2RJMA 2D7TL 1M2VA 3KD4A 2HT2C 2ZONA 3TA4D 3OR7A 2GJPA 1U42A 3RGVB 3TBSB 1QLEL 1L7IL 1XCTA 5ELIA 3S36H 2VZVA 3WJJC 1IEHA 1WA1X 4ZNEE 3HUJE 1JGLL 1CFVL 2NY6B 4FFZH 4H0GA 4YXLH 3T0EB 5FA3A 3OJDA 3ZE0B 4UMSA 1NBYB 2FLRT 3ECBA 3D4YA 2AXGB 4MCYB 3MNVA 2ZUXA 3GS0A 4R7NB 4W9CC 4S2SA 3OAZK 5CKGA 3VD7A 1I7RA 1IIIA 3RNKA 1HHHB 1HCYA 3C12A 1V7ML 4KGLA 4X6EA 3II3A 3W3BA 5TE7L 2CUIA 1HKLH 3ULUH 1RZ8A 5CP3A 4WI0A 1AGFA 5CWSA 2X6VA 1QLFB 4UAHA 3WFEL 4ERSH 5LUMA 3ZBMA 5KJRH 4GXFA 3FH8A 3TPUB 3FC8A 4RA3A 4Y16B 2BSCA 3D08A 2BY2A 3LIZH 1SDDA 2BINA 3IMSA 3IU3A 3NAAL 3JV5A 2F58H 4WUUB 4KRPB 1NKGA 1BM7A 2FQEA 1Q1JH 2KH2B 3FPXA 3OPZH 5TPWH 3AROA 4X6DF 1WBZA 3QS2A 5B8CA 2MKWA 5IBLC 1BAFH 3VJ6A 1YY9C 1V3KA 1MFAH 2BY3A 1KBGH 3EH4B 4YZFE 4QI3A 1CXFA 3RKPA 3GMOB 4BD4A 3F05A 5C08E 4JFFE 4R7DA 4UB0L 1FE8H 3UC2A 4OY9A 3CK0H 2B59A 3IN2A 4BSWB 4AWJC 4Z76B 1SGKA 2FX8L 5ERWB 1FLTX 4BFRA 4AEEA 1TZHB 1T66C 3C5SA 2Y07H 5DDHB 5ID1B 2DM4A 5DMYA 1JGEA 1NGXB 3O0LA 4GSUA 2VN4A 4LRNH 3VFUB 4ODUA 4EDWH 1FNFA 5DC2A 4WWOA 3X1NA 4I0PA 3S96A 3PGCB 1UOLA 2H8PB 4UBDD 3AXLB 4GG6E 4UMGA 4ANKA 3GSUB 4RGMC 3RDTC 3BVUA 4GB9A 1R17A 1RLBA 3BSZA 4P9HC 4R8WH 4PV9B 4ZS7L 3GBLA 2P5EB 5KBPA 4LCUB 3IXTA 4PCYA 1M3JA 1SY6H 4U3CA 1G94A 1NCWL 4TQEH 1G7HB 2A6KA 5EH1A 2WGXA 3UTSA 4G6KL 5DSCA 2W9EL 2PCPA 3H85A 4MJIA 1U8CA 3MJ8A 1TT6A 5IESH 2EABA 1ET8A 5AL0A 4JZNA 3M1BA 4PJCA 1GIGL 2IC2A 2JJSC 4KVCH 1YPZB 5A43C 1EUTA 2XV6B 3SDCB 1NH6A 4HS6B 4PR5B 3K71A 4JG0L 2VLJA 5KYYB 5CMAB 3N2JA 3MCG1 4LBAA 4LLDA 1IFHL 3QISA 1JGDB 4PS4L 2YEZB 5H37A 2GVYA 4CW1A 1GTNA 2GJZA 1NOFA 3IMRA 3LEXB 4JG1L 4Z7NF 3FUJA 5JXEA 2WLNA 1E9QB 1K5WA 3BSHA 4G8GE 4K8RL 4NX0A 3TT1L 2B0SL 1KB3A 1P4BL 3ZDZF 4BGDA 1I8IB 4XBMA 3LRHA 2ZE0A 3OXRA 2XTJD 3AB0B 5DJYB 1QA9A 3KXFE 1MFBH 2WLMA 1BIIB 2XWRA 4G6FB 5IQLA 3GJFK 2IV8A 2MNJB 3H3PH 3K4DA 1FCCA 5EU6A 5AW8B 5IOKA 3WAJA 1EFXA 5KBDA 1E67A 3SN6N 4I3RL 5T5NG 1U3HC 2XWBB 2AQNA 4PJ9A 5D2NA 4EZKA 1QTPA 2OK0H 2NQDA 3N42B 3KPSE 1KT2B 3R7RA 2WKGA 4XVSL 4PTTB 4E9QA 4HUUB 4X2UA 2DH2A 4UQBA 3WFHA 4PCSA 1PSKH 1SF3A 4NRXB 3QIUA 4U2YA 4RISH 5B1CA 1T03H 5JR1L 1T22B 1WEJH 5ILTL 5DK2B 3MJ9H 3GXUB 4AIEA 1I8MA 1FI8C 3SY6A 2J55A 2DBLH 3QXAB 4NNYA 2Y24A 4MVBC 1J8SA 4KK5D 1GHFL 5C6TH 4HYTB 4JAMB 3WIHH 4X6FB 1BJ8A 2CO4A 1K4CB 1DQDL 1QVOB 2PPFA 1OE1A 3MFFA 1ZHNA 3DHJA 2IOIA 4IBLT 2AKRB 3FDWA 5DS2A 5GGTH 3BEWB 2R4RH 1U93B 4F37F 3RVXC 3CZJA 3O2DA 2YLHA 3IGUA 4UOZA 3VXUD 1IC7L 2VSCA 4XP5L 1TO5A 1U8OA 3R1GL 1DO6A 1OGAA 4N0UA 1AQHA 1NJ9B 3QEGH 5IEHB 4AENB 3H0TA 3N44F 4WNQB 4JFYA 3T1FA 4B3VA 1CMOA 2R23A 3A3YB 4AMKL 1SOQA 5EU3A 3H42L 1JTOA 1E4XH 3SE3C 1EIBA 1CD1A 1KNOA 4P5MA 2LAGB 2LGNA 3PWLA 4F7EA 2N1KA 5C0BA 3VH8B 4JKNA 2OSYA 4UZGA 2OTUA 1ES0B 2K3TA 1JZ4A 4F20A 4WW2C 4HKXB 8FABA 5K39B 3CXHJ 1KB5B 43C9A 3B3BA 4QRRD 1E4WL 4LPTA 4MSWB 4OZFA 4F7CA 2IPTH 3CN4A 2Z31D 4FMVA 4FQ2L 2VLRA 4J12A 1A6WH 3RZCB 2ZX7A 1FG2B 3VQLA 3NEEA 3REWB 1OHQA 2O61A 2QEJA 4EPSA 5ICZA 5KYNA 1WICA 4L5FH 3VXPB 1AGCA 3CLFL 3W57A 2ZXAA 1YYCA 5D7LB 1DBBL 1TZ8A 4L1BA 1HSBA 2IDUA 2OMTA 3BH8B 1CDYA 4WFFE 4AYID 2EVGA 4KO7A 3UOAB 3VSTA 2EVIA 3QO1A 3LNHA 1XCQA 5G5DB 4C57C 5TF1H 4L8SB 2WZPD 1OM9A 3LIUA 3Q2WA 2H4EA 2Y6SC 3NJGA 2CRZA 3DX9B 1YQ2A 4MNQB 5E9NA 1GXEA 2NX5B 3GSXB 3BCFA 3P4NB 4M93B 3U2SB 1MJJB 4ZX3A 3FB6A 2FWOA 2VDMH 3CV5A 4JDVB 2H9GB 5EN3A 2ED9A 4N0YH 3FHEA 1OGPA 2OL3L 4XPTL 1E6OL 3BPNB 3FN3A 1UFGA 2BVQB 2AXJA 3E8UH 4ZFQA 5E8DH 5AVSB 3V4UH 3SQOL 4R4BB 4FKEA 2NZ9C 1XH0A 3TVMA 2ESVA 4B50A 4AM0Q 5C09A 5BS0E 5G4NA 2CK2A 4JM4L 5KN5B 3UC0H 2A74C 2HPOA 4YDIH 2DY2A 2CPUA 2DWSA 3EDJA 2AJXH 5FYLD 4NO2B 1LK2A 2E4FA 2VQ4A 3TJPA 2D8KA 4H8QA 2WBJB 4OF6A 4R3SB 2ZG2A 3IJHB 5DJZA 5IVZA 3SDDA 3FSAA 4MXQC 5ICXB 5TFSL 3R0NA 2VLME 1F1GA 2GSIB 4GRMA 5H8DA 5DQDH 3MGTB 4KQ4L 2Q20A 2ZYRA 1T1ZB 4ZUSB 2UWEF 5LAXA 1YQVL 5FCUH 3D4GA 1RU9H 4RDBA 1QG3A 1IQDB 25C8H 5ECGA 5HI4C 3HG1D 1CUOA 4G7VL 2V9TA 5HHPB 3OJVC 3ZE1B 1JNHA 1WP6A 3APMA 4OF7A 5IB1B 4OZHB 2CWRA 3FB5B 1OCCB 2NY6C 2E7DA 5D1QA 2ROXA 2FAUA 3T0EC 1AD9A 4AH2A 1OM3L 5IG7A 4PCKA 4UI2A 1MCPL 2NXZD 5CZKA 3QQDB 5CJQH 1IVLA 1RHFA 2HTLD 3LPWA 1QBAA 3OKDB 3RY4A 2RHEA 1A4BA 1GOFA 1KG0B 4AKOA 1KN2H 4BQ8A 2Z1KA 4BFIA 2XX0A 5BPPA 4O58H 5EU4B 2F7QA 4WV1A 1ZVYA 1J1XL 3HCVB 3FYIB 2K78A 1BEXA 5E6SB 3VXSA 1D6EB 2NYYC 2AK4D 1HDMA 4S1QL 3ML9A 1NCNA 4IRSB 1Y1UA 4X5RA 1RUPL 5ALBH 3LQZB 5KW9L 4P5TB 1BF5A 3ETTA 5AVWB 3Q0HA 1ZGLM 1CGYA 4FFYH 2EICA 4LCVA 2H0EA 4XCFL 4HGWA 3MRMA 3CZNA 1QRNB 1G9MC 5D7IA 5EZJA 3D9AH 3ZT7A 2BFGA 3LH2H 1RZJC 4U1KB 5KBMA 4WK0B 3ILPA 3HLAA 3BUPA 4M6NL 3RVTD 3QUYB 1N7MH 2JJTA 1C12B 2CGZA 3GSVA 4XMLH 1JRHI 1EEUA 1S5HA 1MCKA 1DVFC 4XN1A 4HZLA 5KSVA 3ABZA 3M07A 1NEZG 3H9HB 4M7ZC 2WYTA 3KWUA 4LIQH 3QW9A 4X6CE 4WUKH 35C8H 2EEXA 5CGYD 2AAAA 4NQCD 2H3KA 3T3ME 1MI5B 4L8DB 4LMQE 4KX8A 2BZDA 4NI3A 4U1LA 2XWTA 1WFUA 4XVTL 3RY6C 2C7FA 5FYJD 4I89A 3ZZLA 5LJYH 4QGYA 1NDGB 2NY2B 2BSBA 3N40F 3PV6A 4RWHA 4X9FA 1RKRA 1JPSH 3I6KA 3NRQA 5A7EA 4LHQB 2CBOA 4P2QA 3NCFB 5DHVH 3LN5B 3EYSL 2EO7A 2XZAL 4P4KD 1PEWA 2OMVB 1U8LA 3PL6A 3FL7A 1N6QL 1X5GA 3WO4B 3BLPX 4Z7VB 3F58L 4JY4B 5JORA 2P8PA 3K4ZA 1J5IA 4LT7A 3VUAA 4HFWB 3QXWA 3L5XL 4LPUA 2QGBA 4NQQA 3WOVA 1P2CB 4HDIA 4GRLC 1S7UA 1KEGL 2H3NA 1FLRL 1KXTA 1UXMA 3MHZA 3LN4A 3D8MA 2X44D 3DV4B 2F1AA 1MN4A 2ZCLL 3FFCE 4ACPA 4P99A 1OARL 1U3NA 1DZ0A 2A1WL 4HX1B 1WT5C 1AO7D 4JM2A 3DETD 1QSFD 3LQAH 4N9GB 5LGHH 4TSCL 2LE9A 3MO1B 1J5DA 4NKIH 2YUVA 3TN0D 2D2CC 4ZMAT 4Y0GA 3IS1X 4PMEA 2V5YA 3CVDA 2GAZB 5CD3A 2XQYG 5EZPA 2Z35A 3TNNA 3U25A 1NM9A 4AYSA 3PAYA 1FYHB 1CFMA 1Y18A 1OPOA 2J4WH 3KBPA 1WBXA 2D4DA 3X1BA 4R9HA 5FGRA 4O4YL 1OB0A 3POHA 2OS7A 3V2AR 4DZBB 5HGHA 2QVIA 5D1ZB 4Z7WF 4K7FB 1Q9LA 2CRMA 1DBJH 2X4QB 4PJEB 3MLXL 4I5BA 1KCUL 3WIIL 5E2VL 3NIFF 5IROA 5KYXA 2FRGP 2HRPL 3O6FD 5D9SA 4ZW6A 5KVFH 1X5FA 2OMBA 4B60A 5HI5D 3JV4A 4O2FA 3UTTA 3ARGA 4L1SA 2CK0L 5CILL 4CDGC 4HIPA 3GXMA 4ORGA 4N1CA 5F7DB 4KZCA 3N85H 4M8VA 4BZ1H 1MVUA 4L3EB 1A5FL 1AFVH 2PO6D 4J3OG 5DEGA 3IDMB 4DCQB 5HYJD 5BMFL 5E7BA 3T2QA 3GHEH 1F3DJ 2CCVA 4KROD 4QXGL 2E5EA 4E41D 1U58A 3P0GB 3OF6A 3QJVB 4HT1H 2R4SH 3BIKB 3C5JB 3P73B 1SXBA 5F1SA 3DXAE 3QA3A 3ZJAA 2E7LC 4K3JH 3MLPA 4LVNB 4ICXA 1JYNA 1OAQH 1UH4A 2WVVB 2YWZA 4QTIH 2VKXA 2BP8B 3TBSA 4KWUA 4AYEC 1DE4B 4PRHE 1N3NB 4OKVB 3VA2C 5I1GL 2Y7OA 1XSIA 4W93A 1A6VH 1BLIA 1DBKL 1HS6A 3MYZA 1PYWA 4YHNA 4K3DH 3VFRA 1A66A 1UKSA 1IJ9A 5BV7L 1NBYA 1D9KD 2AXGA 5E1AA 1G4RA 4MD0B 3GNMH 4RZCB 4ANXA 5GS0D 4MASA 1ERNA 1MFNA 3TV3H 1TQCB 2NNRA 1NGQL 4JVPA 2QVTA 4PRBB 1U3ZA 4B53A 4DPAX 1MCRA 5IT2L 3US1A 3CSYA 1QLFA 4UCFA 2G5BA 1OWRM 4XGZB 3ULAB 2ZUTA 4N6RB 2N0KA 3TPUA 4CSSA 4HOWA 1SN0A 4LEOA 3W2DL 3TT3L 3HAEG 3D51A 3O3EB 2VAJA 3NIDF 1GAFL 2CNZA 4NQVA 4WWID 1A1OB 2PWDA 2UX7A 1KYOK 1CD0A 3HNSL 1OP3H 4B0MB 1MY5A 4DN3L 5FK9B 1A9EA 4PTUB 2J6EH 5T33L 4KI1A 1QSED 3G5WA 2VDLL 5L0QB 1DQQB 1OV8A 1Q72H 5INDB 1RUAL 3DVNA 1ZJAA 3DX3A 4WO4D 3MA7B 3CVHB 4HQQH 5ERWA 1HEJC 1FAIL 5FB8B 1J0HA 5EZLB 1XIWD 4M03A 4NJAH 1KJMB 3UERA 4OLXH 4AZ8B 5DDHA 4M8RA 1DJXA 1WPCA 1SEQL 4NYLB 3HR6A 3FUEA 3RU8L 3NACH 1NGXA 1JYVA 4AGOA 4GKZB 5MEPB 3B2VL 4PG2A 2BSTA 3J27A 1OGSA 4XXDB 4KBPA 4JHWH 3AXLA 4KTDL 5FGSA 3U7WH 3MXWL 4L18A 4IK6A 3VD5A 3NJIA 1QYGH 4KJPD 3MTXA 4G6JH 4R4FH 3BZDA 4A67A 1ZSDB 3I02B 4NQDB 5JLZA 1BMGA 4U33A 2H2PD 2Z92B 4GSRA 4BFNA 2DQIH 3T09A 2D2OA 4PY7B 4PYGA 3SQRA 5FO8A 3BKJH 2PR4L 1G7HA 4OFYD 5GHWL 5IMLB 4JO3L 4EBQL 4OM1L 1QATA 3S5ZA 4OSUL 2ZSWB 3BZ5A 4OLZL 4HJ0C 4NNPH 4PB0H 5AZEH 5LB1A 5CCKL 3FTXA 1IFRA 1RZKH 2F53A 3SDCA 1KWGA 4PR5A 3B83A 2WBJC 5KYYA 3MRGB 1B2WH 3DJSA 2JELL 4LSQL 3EZJB 1NEPA 3V4VL 2YEZA 3PUCA 1WE5A 3KPPB 1IGCL 3LEXA 5B7FA 4UINH 5GS1A 2KLRA 4HCFA 4PBXA 4OIIL 1IZJA 3ME0A 3HI5L 5E6UB 4KNQA 3W37A 3KPQB 4HPYH 2OV0A 2NXYB 3HG5A 4Y4KA 5BVPL 5LLIC 5DJYA 2JTYA 3CFEB 2B8OT 4R4NC 4Z3HA 3JBG7 4LSPL 1BIIA 1AOZA 3C6LD 3MLVL 3QWOB 1MW2A 3IJEB 4D9RD 1G87A 1OAUH 2NNAA 5TE6L 3VNYA 1DEEB 5FM8A 4BK4A 1JRHL 5I71B 3V6BR 4X7EC 4X4ME 1B9ZA 2W9DH 3O41B 4QRFA 2X2UA 1IUZA 3T8VA 2JQZA 4PJHF 1MQKH 2YR3A 5C07E 3QAZC 4RLDA 2R0KH 4AL8C 2NTFB 4PTTA 3KBFA 3NGBC 1HL9A 5HJDA 1MFCH 4MA8L 1J0ZA 2VDMB 1DVQA 4B9YA 3RWFB 2XZQH 5B1BB 1TDQA 3FT2B 1ZVNA 5FUZL 3K8MA 1DBML 3SPVB 1RIHH 2MNUA 3FUFA 1OHZA 4NRZA 4QT5B 1I85C 1WA2X 7PCYA 2FATL 4X9HA 1YY9D 3N04A 4PJ5A 1YY8A 4QRQA 3K8LA 4D8PB 1CFNA 4JDTH 4YXHH 2J7LA 4U1SB 5JIQA 1YUHA 3QUYC 2VDNL 4X6FA 1K4CA 1QVOA 3PJSB 1QASA 2DLFH 1GGBL 1XGZA 3FB8A 4UUJB 5AG9A 1NFDA 4XC3L 1QHQA 4L3FA 1WTLA 3V9FA 4PUBH 1U93A 5FDWB 3EYVA 4C4KO 5C0RL 1PTZA 5C0GA 4GEJA 5FO9B 3TEWA 1UOVA 2WZ6A 4JFWA 4IJTA 3D39B 2X41A 5I6PA 4G9DB 5T5NF 2Z91A 2W88A 1NL0H 1AR2A 2VMCA 3RDTD 3QIWC 2GJRA 3Q2LA 2NY2C 3IKKA 5DR5H 1TCRA 3S3BB 2ARWA 2G0KA 1KTCA 5LNEA 5IB3B 4P9HL 2WTRA 3LS4L 4PJBB 3GRBA 4PRIA 3ZHKA 4LPWA 3UG3A 2DEWX 5C08D 1PZ5B 4JFFD 2AJ3B 3TOPA 2AC0A 2VDRB 5HP5A 3VG9C 1GKEA 3WKNA 2Y5QA 4UAOB 4XBGB 1MFDH 4NNXB 4OVVA 4JQIL 2F8IA 2IFGA 1MNNA 1FG2A 4ANWA 1TVBA 2JCCA 1CXIA 2HG5B 4NHCL 3FT4B 3LXUX 1RK0A 2JMRA 4NP9A 5J11B 1JHLH 2D7NA 4FQIL 1M7DB 5D7LA 4NKOB 4XVJH 3NP3A 4IIQB 5M95B 4MJ4A 3DURB 1HHIB 3ZU8A 1PF3A 4HFUL 2VRQA 5D6DA 4P2OD 4GMTH 2YA0A 4HUWB 1M53A 4NPKA 1EPFA 1LO4L 1IC4H 1OLLA 2HT4C 4OZGE 1FNAA 2E7MA 2VN7A 5K1JA 4HULB 4WTQA 5F9JA 1QOKA 2HFGH 3DO7B 3MLWL 4WNJA 4K23H 2EDKA 1IAOB 3C2SA 5D1ZC 1SEBB 3IWUA 1YC7A 3BDBA 5I6OA 4KUCF 1L9PA 2AABH 5FECB 2X88A 3F7VB 3SGKA 4AUYA 5CUSL 1ID5I 3NTCH 4PHZA 5JDSB 4KAQL 1QEWA 1D2PA 3QFJE 3IMBA 4E5XA 4R4BA 2Y1YA 1ND0B 4G8GD 2AEOA 1I3UA 4NUMA 3O6ML 4IGBD 4AITA 3MX0B 5DHVB 3TBYB 3PS6A 5KN5A 4Q9RL 4JB9L 3KXFD 3E6FB 5DHEA 3O11A 1CU4H 2RACA 3VTTA 4WF7A 1YNTF 1AHWA 3CMGA 4WHCA 4X6DB 5D4IA 4YDKH 5ICXA 1S9XA 2GSIA 3VU2A 1JUFA 3MGTA 4IDJH 1LM8V 3QC6X 1T1ZA 4K7PY 4ZUSA 3RVUD 3GINA 3P9WB 2LU4A 5DHXB 2A4ZA 5E6YA 3VFSB 4LVNC 1LWRA 5DTFB 3OGCA 4XNXL 3H4HA 4U1HA 1AIFB 3KNBA 3KPSD 1F2QA 4BKSC 5HHPA 1P84J 3PIQA 2K3HA 4OCXH 4DW2L 3L3IA 1DQLH 3ETBF 4JLRB 2PWHA 4HLZH 3FB5A 4NZRL 5FDYA 1SJEB 1TQUA 3CNKA 3FO1A 2R27A 3JV6A 3M1CA 2Y6TE 3QC5X 3STLB 2EE6A 5DJDA 3U36B 5GS2H 4JFDA 1BQLL 2DTML 3QUXC 1KG0A 1S7SB 2APXA 2CKNA 1F58H 4HUCA 3GO1L 3LPOA 4QOKE 3AFLA 3X13A 2AF2A 4R84A 4HKBB 1S7XA 3HCVA 5HHNA 1SLWA 4P48A 3RNQA 1D6EA 3UADA 2AS5M 3MJWA 4DQAA 2JSFA 4ZUUB 1EDYA 4IRSA 1AJ7L 1MNUH 2GITB 1AGBB 1SUJA 2CKBA 5EF3A 1SJMA 1JZ6A 1COBA 1I4FA 2XZZA 3I9IA 3MRJA 3ARFD 2ID5A 4ZX4A 4BQ6A 3LYRA 3RL1B 5FGCB 3BCDA 4RRPG 4WI7A 4XT1C 4JGNA 5L2KA 3RI5K 2APSA 2EYTA 3CXHK 2ZXCA 1INEL 2L4OA 3KCWA 4HVBA 4Z7NB 1AD0B 4M43H 1TPXB 3JWNH 4ZO6A 2YK1H 1MHPH 1BDYA 3B7UX 3IDNA 3LEVL 1UHVA 2EUVA 3DOIA 3H9HA 5L0QC 1DDHA 2L7UA 3ZDZB 3O45B 5F3HB 1VFAA 2DJUA 4KX7A 3MV11 3NK4A 1AXTL 1KXQA 1EO7A 3BD4A 3NDYE 3H9SE 5ESAB 1NBVH 3E1F1 1AQDA 1GGCH 5CSZB 2IF7A 4QF1B 1KYUA 3MLYL 3RZWA 3QRGH 2VZ3A 3OL2A 1G0YR 1RK1B 3BEVA 3BZFB 3KWVA 4NERA 3MLZH 3NCCB 2J71A 5EOQL 3OX8B 1WYJA 5DMKB 4MAYD 4FFZA 1MHHB 1XD1A 4P46C 1IV8A 5T5FH 2H26B 4Y4FC 5IBTL 4RGOL 3C09B 4HJIA 2NZ9D 2VXUH 2YBRB 2DQ6A 4OU3A 4X5WB 3NCBB 3MBWB 5GJTH 3IFNL 3FTGB 4YSPA 4Z7OE 1EEYA 5EDXA 1IJNA 4LHUB 4WFFD 5C3TA 3MUHL 2YRZA 1H6TA 5E1GA 1EXHA 4G6ML 4F57L 3V4PL 4CJ1A 1IM9B 4Z0BH 4A7GA 2ZOOA 4RDQF 2P44B 1KBKA 4N85A 2M26A 1P7QD 4UT9L 4PSRA 3CLEL 3Q1EA 5C1MB 3MO1A 1H6EA 1LO0H 3KW8A 4BH7A 1NCIA 3E9TA 3HBZA 2IWGA 3CC5B 3QHZL 5DT1L 2NZIA 4Z3EA 2IEPA 5C0IA 3FFDB 4JO2H 2V9QA 2XPGB 3S34L 3SOBL 1URLA 3N9GH 2ZKMX 4FLQA 4JDEA 1E42A 2IAMD 3EYUL 4FZEH 1FH5L 4S1DD 3NEOA 3U83A 2VN6A 3UPRB 3G5ZB 3RWCA 5LXGL 3X11B 1X5JA 5D5MF 5A2LH 2F08A 2HP4A 4AGQA 3QH3B 4IU3B 5BS0D 5EBMB 4DZBA 1MG2C 5JHMA 4HOZA 3FB7A 2GJJA 5FC9A 2IH1B 3WFBL 1S9KC 4JZJA 3N44B 3SGEI 4PRAB 4JPVL 1UWXK 3S7GA 2HRHA 2J20A 2XN1A 5E9DA 5KVDE 1MG3C 1KLFB 2H0FA 4UM9A 3C60B 2VLMD 4HH9B 5HJGA 3AY4A 3P77A 3MV9E 3RJOA 4DGWC 4OGQC 2ZXQA 3UTZA 3M7OA 3RUGE 4YX2H 1J8HB 5ALCL 3FBQA 1G0DA 4PRPE 5E99L 4JY5H 5ITBL 5IHHA 4IBUA 4N2GA 5D1XB 3BWSA 5TF0A 1T4KA 1DSFL 3CQQA 5JW4R 2X9ZA 4OKDA 3S4SA 3ZYZA 5DF0A 5F71A 4DERA 4LARL 1RZJL 3KGSA 1SY6A 1XF3A 4AG4L 4MQSB 3D85B 3C5JA 3RILA 1MF2H 1H3VA 3P73A 4BE5A 2XWJA 2FQFA 3FBKA 3F62A 3PXHA 4GXVH 4PREA 1JERA 2JIXB 2YD1A 5EZOH 1VSCA 5F93C 4HKJB 4MLIA 1Z0MA 1EUUA 1NBCA 4UV7L 2DMKA 1N3NA 4MNHB 1AI1L 2FLBT 2BCMA 3L7FB 1NC2D 3VWJA 3ULVF 1UB6A 4KK8D 3EXLA 1AG6A 3WUWG 4FXTA 2PTVA 2UXFA 4P23B 3IDXH 1T0NB 3FU9A 2BVOA 5DWUH 5DJ8A 2C9VA 2EQDA 3TIDA 3KL3A 1I9EA 2YAOA 3HS0A 4TXVB 4Q8BA 3QYCA 2W59A 5C0FB 3JSSA 1SBSH 4YEEA 1DSYA 4Y5YB 1KFAH 1SJHA 3KBEA 4FQ1H 1F6AA 2E74C 8PAZA 2BS71 3DGCR 5SWSB 3K81A 4RSVA 2NY5C 1BZ7A 4J3BA 4X8XA 4KZEH 4KY1L 3VFMB 4JGJA 1RZ7H 3L5WB 3QEHB 2X4SB 5EN2B 1BECA 3LXAA 4NO3B 1BOGB 1P7KA 1UA3A 3FJTA 3MCYA 3E80A 1AZCA 4HS8H 4N5EC 3T8XA 3ZQ9A 3KHOA 1H15B 1HL8A 3HZMB 4HAGA 5DGRA 1URZA 5ESVB 2DQMA 3MLUL 5LGKA 5T1DH 2E6PA 4E9LA 5CZXD 4MQ7A 3INOA 2G60L 3KS0J 1A3LL 4IRZH 2DQEH 4FFVC 3VQMA 2UWEB 3LKRB 3KYMA 5GZND 1BEYL 3GTTA 5HYSG 5J11C 2IQ9H 2KZ1B 5INDA 1FPTH 2WXKA 1F2XK 3AU0A 4MCZB 4UT6L 3IMVA 2DQTL 3MA7A 5LO7A 4GSXA 5IWLC 3DPBA 3WIHA 4TUKH 4AZ8A 1ZVHA 3UJIL 1KDIA 2Q7YB 3TZVB 4NYLA 2A9DA 2XWEA 4Y2NA 2Z93B 4ZPTA 1XCXA 2MH4A 5EBGA 5I16B 1RP8A 4QY8B 2HAZA 5B8CC 1JFQL 3AM8A 3OQ3B 4U1MB 3P11H 1SBBA 3UTSE 5CJOL 1BFVH 4P5KB 2B1AH 3ARED 4I8DA 4HBQA 4JUTA 4MJIE 1TO4A 4YLBA 3TNMA 1B0IA 1CVSC 1ZVSB 4HJJH 5LNDA 3DIFB 4PJCE 3M8OL 3TCTA 4M3HA 1YEFH 2LLLA 4H1LH 4NUPA 3QNFA 4XCNA 2R1XB 2VLJE 4HIEA 3ASNB 3GMMB 5GGVH 5CBAA 4YSRA 4JX0A 4NN7C 2N7BA 1HAUA 1J9RA 4WJ5A 5JW4N 3NQIA 4ZI8A 4ODHH 3GLAA 5BJTA 3CZFB 4HWZA 4XNQB 2XTLA 3QUMH 2MOVA 3UAJD 1AC0A 1IAIM 1SXNA 2G75A 5AKTA 1DJGA 4I88A 4H0LC 2UYLA 4OF5A 3MRGA 5KVEH 3O9WB 3SE9L 3GD1C 3OMIB 5EBLB 4R7VA 3IGKA 1T7YA 3KPPA 4MDRA 4XCEB 3T5WA 3FTWA 2ENSA 2VITB 1YMHB 4NQEB 5D71H 5C6PB 4ZD3L 4FN0A 4XAWL 3ZK0A 5D1ZI 2VDPH 5E23A 5E6IB 1O9WA 4XTRC 5EU6E 2CR6A 1T5XA 1NCCL 4KJQD 4IHBA 2F19H 1BX2B 1OWWA 4PV8A 3RVVD 1Z32X 3BW9A 4JFZL 4L1DA 4MYWB 4N8VB 5CNHA 4N26A 1FSKB 3IJEA 3D69A 5DUJA 2Z3FA 4FMFA 3UCQA 3CAFA 2XN0A 5D2NE 1DEEA 5BOJA 3IFPB 1UOWA 2A6DA 1T21A 2WUCL 2FO1A 1HE8A 3D34A 4DGYH 1TTRA 2B20A 3EO9H 4HZ1A 4JPIA 1U92A 2LU5A 1CDIA 3O41A 2AQ3A 3EOTL 2Y7QB 2YQBA 2FHFA 4L8CA 3GDCA 1JF1B 1JPFB 2MSPA 2P80D 4NSKA 3GSNL 4MJ5B 1TTBA 5FHAL 1MREL 3UBXI 3DXAD 1JNNL 4V2BA 3OAWA 4CADB 3WDHA 1GGYA 1PLGH 3VVWA 1J0IA 2VXTH 1X7TA 2P8MB 3E8VA 1FL6B 4ZOBA 3DX1A 4PRHD 3VI3A 1DN0B 3FT2A 3QPXL 3OB8A 3IDJB 4UZSA 5EULV 5I8OH 1L3NA 3HOGA 1ZLDA 3QXDB 3GIVB 1HOEA 2OCCB 5HY9A 1AKJB 3OB0H 5AVQB 4Y2DC 3WS3B 4D8PA 3L4ZA 1DYZA 1J0YA 1F8TL 3GLZA 4M1CC 3CBRA 1JGUL 2P5WA 4PJ9C 4H20L 1SOSA 1BAWA 1OGAE 3CSGA 4IW4C 1TPXC 2X3BA 1DSWA 3QWRA 4N0UE 4AQEB 4L4JA 4LU5L 4MRCA 4D2NA 4KQ3H 4MWFB 1QFUL 5FDWA 4CMHB 3QDMA 2WAQA 3PDDA 5FO9A 1FL3B 1QTYT 3SOTA 4G9DA 1IEBB 4Z7WB 1D5XB 4LNVA 2GUYA 2YEQA 5C0BE 1UASA 2HKHH 4PM1A 2QV4A 2BMKB 3Q8AA 5BRZA 3CC1A 3U46A 4DKAA 3VU1A 3N3EA 1TTUA 4PRDB 2VL5B 1BFTA 3NIFB 2WWMC 1TR7A 2NW3B 2F7IA 5KVMC 3MRNB 3VFOB 4LAJH 4I9WE 3LZRA 2VLRE 3GMNA 4FDWA 4MMYB 1YEDA 4E9WA 1RCYA 2BFVH 3LPPA 2W07B 3DX7A 1NMAH 1TEYA 1PIFA 2WC7A 4DQOH 1CTOA 1YSOA 4NWTH 1HQ4B 2NR6C 2HX8A 1ACXA 1KIRB 3KEDA 2K6YA 5C7XL 3V4LA 1VGEH 3WENA 5TGBB 4DEPC 4J6RH 4NNXA 5TK2A 1JPGA 3BWUF 3UABA 5A6MA 3ZUCA 1ORSB 5HI3C 3H7BB 5T3ZE 4W9DC 1ADQH 2R69H 4MJJA 4LDEB 1KZYA 4C58B 4JDZA 2O4EA 4FFYA 5F9DC 1U2HA 3V7AE 2FSDA 1NUDA 4A68A 3OBAA 1Y07A 1S9YB 4Z6AT 4X80L 2CHZA 1AXSA 2XA3A 4Y8DC 5H4YA 4A2EA 4W81A 3PFQA 2KDGA 4H88H 1Q9OB 2PLTA 4Y5XB 2IOMA 2HWZL 2FUTA 2P4AB 5AALA 5D7JB 5AW4B 5GGRY 1JV2B 2V8MA 4OD2A 4U4BA 4BKLA 4APXB 2NY1C 1YEGH 2FWSA 3KLHC 3ARBD 2ODHA 1YNLL 5FGBA 1B4RA 1UURA 3RIKA 3HC2A 3LRKA 4TPRH 1BMWA 2FZ3A 1KLGA 1T5KA 2WTOA 1E4XI 4CN1A 4QRTA 2ESVE 5C09E 2I60H 3NSFA 4Y2OA 4Y19B 2YMXH 1OP9A 1ZK9A 1ZA6A 1G7QA 4AL8L 4JRLA 1M6UA 3C60C 2BVPA 4H0HB 1TETL 4NPYA 5JDSA 4R0LB 5JZ7C 2WN3A 2PWEA 4JRYB 5AVXB 4NO0A 4ELKB 1B0WA 3CFJB 4YQXH 2VE6A 1X5ZA 4G1EB 3QXUA 1VFUA 2VDKH 4FABL 2VM3A 3M86A 3NIDB 2EXWD 4TV3A 4L3CB 2FECI 4PVNA 4IKNA 1BF8A 1XGQB 5D1XC 1DFBH 3ES6B 5I66B 4J3SA 1BGXL 2J43A 1KCRH 2A73A 2ARJQ 1XL6A 4WI2A 5E94B 3U7YH 1HXMA 1JVKA 2L7QA 3G5VA 3BRGC 3B9KD 4WW1B 3U9WA 5FIEA 1G1CA 1FAKT 4PB9L 3IFLH 4J27A 5IW3A 5AW2B 1JDCA 4A2FA 3BXNA 5D1QE 3TH3T 2ITDA 2YAEA 3ARTA 2EH7H 2F1BA 4ZFFB 2FD6H 5DTFA 4PJDA 3PUUA 1UQSA 1I7UA 2VXQL 4QRAA 2G9HB 2PXYA 4FQLL 4KVNH 3TVMC 1DR9A 2ENYA 3IJ8A 4OQTL 5DFVC 3SDXF 3E2HB 1NLBH 3KDMA 1LDPL 1A6UL 2D73A 5J12B 3VXSE 3LHAA 3QIWD 3QHFH 2X9XA 1I75A 1OTSD 5DZPA 4RWYL 4XVUD 4OF3A 5GRUH 4X42A 1B6DA 1KN4H 4JQVC 2ZCKL 3HZVB 3MLTB 1R3HA 3LDBB 1JZHA 3NA4A 1T6WA 4HKBA 5B38G 1R3IH 4Y5YC 5CEZL 1RSYA 3BVDB 2A2QT 4AM0B 4ZUUA 5D7IE 2GITA 5LWYL 4LSUH 1PGRB 2X4UB 3U4EA 4QMEA 2YAQA 2HH0H 1MHEB 2H1XA 1F02I 1K4DB 2A4CA 3KVQA 3QZWA 5HYIA 1WDAA 3LN9A 4X7SH 4W9HC 1CDGA 1LEIB 3FCUB 1JXFA 4E9VA 3T71A 3OKEB 2ZX6A 1NBZB 4N87A 5EWIH 4ONGL 1O0VA 3TYFA 3FH5A 3DNKA 4BZ1A 3ULVH 2EEFA 5EDSA 2QVMA 2E9BA 1JTTA 5DRWB 2K6WA 3OPUA 3QR0A 3KE0A 1G7LB 1RPKA 1QWNA 1ZANH 5HTSA 1HESA 2QKIA 2H6PB 5KVGE 2EIDA 3L17A 5DEFA 1ZLUH 5D7SH 1RUQL 1Q1JL 3L48A 4H0IA 3WE1A 4ES8A 1MIEL 1MWAH 4JHVA 3SYAA 3RHWK 4AX3A 4BEIA 3CZEA 1HHKB 4MS8C 3CLWA 4P2QE 4I2XA 2P9RA 3IU4H 1E6JL 3GSRA 3TZVC 1ITCA 1RL1A 2PYEB 5K59F 4HOMA 4P2RB 2BNUA 1ACYH 1KC5L 1K8DA 1OO2A 2Y3AA 3PP4H 1BD2B 2GY7B 4J3OH 2Z4QB 1RULL 4GAFB 2IDQA 4FQPA 4KI5C 4PJHB 3CFMA 3A47A 3M17A 2JKNA 3S5LA 2H26A 3HC4H 3QEUB 1F4XH 4HC1L 3VXMB 2V7NA 5D96B 1XXDC 4EQ3A 3DVIA 1J18A 4J3TA 5KUKA 5D8JH 1E30A 5MERA 4M5ZH 5EA0H 1INQA 4MMZB 4JPKH 3OMNB 2FEDD 4YHPB 3MSPA 2VUYA 5DGQA 1JZ2A 2E6JA 2R8SH 3B8YA 4O51B 2H47C 5EC1B 3KZ8A 3WEXA 3ATAA 4OGXL 4A39A 1GCYA 4WTXA 3W56A 1VENA 4GBXA 4FS0A 2W0LA 3GM0A 3NJNA 1DDTA 1H9VA 3P9MB 1CB4A 2GI0A 4HWBL 4W9EC 2Y2TA 2YPLB 3PL6C 4XB3A 1NTDA 1RH8A 3ZTNL 4G8AC 5F7LB 3UPRA 2J6EA 3P3SA 3VACA 3GXDA 3QFJD 2KQMA 4PBWD 4EZLA 1T7VA 3Q8EA 1FSKC 3QH3A 3QUXD 3HAEH 1NMBH 2F8VA 4IU3A 4ZTEA 3MJ6A 2JKXA 2Q76B 2Q8AH 4JM2C 3S48A 4YHMH 1GZHA 2VDQL 2NQ3A 4JFHE 3UTTE 1X7SA 1YECH 5EO1B 4N2NA 4G71B 2EIZB 4HH8A 3CHXA 1W0VA 1FH2A 5HD8D 3L3OB 1WCBA 2YGPA 1FVCB 3F6LA 4H5SB 2DDQL 2V6HA 3DJ9A 4U3SB 1SLUA 3TO2A 3EFOB 3FTUA 7CGTA 2MHAB 3NCXA 2CLZB 4JFTA 1TQWA 4B6ZA 4NRYB 5J6GB 1G43A 2IH3B 1M1XA 2YPKB 5LNGA 3FKUS 4QRBA 2OK0L 1YDPB 2CO1A 5EPMA 4H1LB 3QNXA 1QI5A 1CFTB 3OXSA 1I1FB 1VF5C 3SGDH 3ZHFA 5IMMB 5K5YA 1T6BX 3D85A 5CXPA 1PSKL 3O8XD 4FJZA 5IROC 5BRQA 1S9WB 1N0XL 3SE8H 4L0PB 5LHDA 3ZE0E 2JQAA 4QOKD 3R0MA 3QUMB 4DKTA 2PCXA 1SRDA 3BKCH 3MJ9L 3ARGC 1F1AA 1UG9A 3P4MB 3FMGL 5CZRA 1QKZH 3CVHL 4AXWB 2YMTA 4QYOB 5C6TL 5DYOA 3ZL1A 2N0MA 4XO5A 3NH7L 3H7LA 3CFCH 3SQBB 1IM3D 1LEKB 4PGDA 2VDPB 3S3PA 4UYQA 3HR5B 2FEEI 3EJYC 3L3GB 4ODWA 2ATKB 2Y1AA 4XN2A 5C0DB 2D03H 2HG0A 4P46D 4PGBB 2J5WA 5GGTL 5E1HB 2J3SA 3CXDH 2B1HH 4N2FA 2EE9A 4O9HH 4GINA 5F0JB 3WL9B 4BQ9A 1ACCA 3QUZD 2GUOB 2AMGA 2MTAA 2NOYA 3Q3GB 2VH5H 3HNVL 4NDMB 4QHUB 5BZZA 3QEGL 4QHNB 4CAGA 5CZVH 2QPSA 1LO5B 2MPAH 5DD5H 4Y4HA 3HVDA 1KGJA 2XVGA 3WHXA 2NPLX