2HX7A

Crystal structure of cu(ii) azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "csphqgagm"
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCSPHQGAGMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Engineering Copper Sites in Proteins: Loops Confer Native Structures and Properties to Chimeric Cupredoxins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hx7A00
2CAKA 3QJVB 3NSCA 4DP0X 4DPAX 1GYCA 5FC9A 4P5SA 2X87A 1JZEA 1A4AA 4ZK8A 2CUAA 3GXUB 1KDIA 2R7EA 1BXUA 1AG6A 1B3IA 4W1TA 3FU7A 2VN3A 3ABMB 3NT0A 1L9QA 1RZPA 2FT6A 2XXGA 3GDCA 3H56A 4YL4A 2J55A 1NPNA 5F7BA 2GIMA 5I6PA 1KCWA 2A3TA 2QPDB 2UX6A 3FSZA 5LDUA 2XUWA 4YSTA 2PPCA 3FQ1A 3QJTB 2Q5BA 1BAWA 2CALA 2MRYA 2QDVA 1TEGA 2FQGA 1CC3A 1IC0A 1BXVA 4KO7A 2CCWA 2EINB 2YAHA 1WAEA 3OD3A 4YVUA 2FQEA 2XLLA 3C75A 2YQBA 1KGYE 1E65A 4HHGA 4CSPA 3OMAB 1HAWA 2YAOA 5PAZA 5B7FA 1PMYA 2H5UA 2DYRB 2GC7C 1ZPUA 2BP8A 2VMJA 3UAAA 3S3BB 2EIKB 4AKOA 3FS9A 1DYZA 4QLWA 4DP9X 3FYEB 2GB2A 4NERA 5I28A 3EH5B 3HEIB 2BP0A 3S8GB 2YAEA 3NP4A 4AI7A 1ETJA 1OE2A 3SBQA 4G72B 4N8UA 1AANA 1SHXA 3N2JA 1JVLA 4KNUA 3IN0A 1ZDSA 3ABGA 1L9PA 3T9WA 3WNIA 6PAZA 5A7EA 3NJGA 1MZZA 1KCBA 4GYBA 3HB3B 3FQ2A 3WI9A 4HALA 1CYWA 1FFTB 1SDDA 3MX0B 3WIAA 4G7SB 1JZGA 2YARA 4A2EA 1AACA 3X1BA 1IBZA 5AFAA 1OCZB 2EIMB 2FQFA 3U25A 1NWPA 2XX0A 3ABKB 1BYPA 3KW7A 3L45A 3OMIB 3EH3B 3T6ZA 3T6XA 2PCFA 3S3DB 4M4RB 2DV6A 3ZDWA 2ZWNA 4GXFA 4E9SA 3ZX1A 3X1EA 1PNCA 4A2HA 4DP2X 4KO9A 2E86A 2VSKB 2GBAA 2GHZA 3FSAA 3TA4D 3AG1B 1NIEA 3GYRA 2UXGA 3PPSA 4YSQA 1A65A 1SF3A 1AZUA 3NSDA 3UAEA 3FPYA 2IDQA 3G5WA 2WO2B 1PZCA 2Y1AA 3EF4A 5B1JA 2N0MA 1KBVA 2IDSA 2VW4A 2PPDA 1AIZA 2NRDA 3SBPA 1HAUA 3UABA 1RZQA 1VLXA 3BQVA 1BQ5A 1JOIA 4E9XA 1GY1A 1AG0A 1J9QA 1MG3C 3PXLA 4AZUA 1OF0A 1MG2C 1GR7A 3EH4B 5I26A 2I7SA 4L0PB 2BHFA 3KW8A 2XV0A 2ZONA 5I5IA 1L9SA 2OJ1A 2B3IA 3CVDA 4DP7X 1ET5A 1SF5A 2JKWA 4BWWA 3SQRA 3S8FB 2UXTA 2IDFA 3X1GA 1QNIA 1ZIBA 3CDZA 1KBWA 2LLNA 1AOZA 5I5JA 1PLCA 3IN2A 3AG2B 1WS8A 1ASQA 3QJQB 2XU9A 1V55B 3FPXA 4HAKA 1URIA 3X1NA 4DP4X 3H4FA 3FSVA 1BQKA 1NIAA 1JZJA 1ZV2A 3OMNB 2IDTA 1TU2A 4FAAB 1NTDA 2FQDA 1NINA 2YAPA 2B08A 3TASA 1NPJA 2HRGA 4YSOA 3UACA 2XYBA 1PLAA 1EZLA 1UATA 2PPAA 3PLYA 1RCYA 1PY0A 2VM4A 1ZDQA 2Q9OA 2AFNA 1GS6X 2J56A 2JXMA 4E9WA 4A2FA 3NJMA 1V54B 3V9EA 4BDVB 5D4IA 4KNTA 1XMEB 3WG7B 1W8EA 4KOCA 2BO0A 5B1JC 1L9OA 1AAJA 1KDJA 2FJSA 3IEAA 5I6KA 2AZUA 1TEFA 4W9ZA 1WA1X 5B1BB 3OQRA 2BWDA 2P80A 4F7KA 1OCOB 3TBCA 1SJMA 1HFUA 1OV8A 4BWUA 2CJ3A 2XX1A 3ZBMA 4AKPA 2Y69B 4KNSA 2PP7A 1WA0X 4HCFA 4E9VA 3NJFA 5IY5B 2XV2A 1MDAA 2BZ7A 9PCYA 1V10A 2J57A 2PPEA 2XVBA 2QPEB 4JHUA 1AZCA 4PAZA 2IH9A 2ZXWB 2GC4C 2PPFA 3NJLA 2EIJB 1M9WA 3DIVA 1ASPA 2HXAA 1XB6A 2P80D 1R1CA 1GS7A 1JZFA 3NSFA 5ANHA 4M3HA 4UAHA 1AZBA 2XV3A 3AY2A 1AZRA 3EHBB 5B1AB 7PAZA 1AS6A 2HRHA 3T6VA 1X9UA 1NICA 1AS7A 3PAVA 5D4HA 4UANA 1CYXA 2IWKA 3QJRB 2HX9A 3DTUB 1AR1B 1GSKA 4BXSV 3FU7B 4FA7B 1W6LA 2FT8A 3D12B 4YSSA 1JXGA 4TXVB 3RYMA 3NJNA 3QQXA 2PCYA 2QDWA 4N4YB 2BW5A 3TBBA 3NJKA 1OE3A 1A4BA 3TU6A 3IBOA 1AS8A 1ASOA 4A66A 1PF3A 5PCYA 4E9TA 4E9RA 1W6WA 1PZBA 1GY2A 5EHFA 4DP6X 2GSMB 3AG4B 1BQRA 1OOWA 2HX7A 3AZUA 1ET7A 4G71B 1J9SA 1JXFA 5I6OA 2YXWA 3AW5A 3ASOB 2UXFA 3ERXA 3UGEA 1ILUA 1FA4A 2VW7A 3NSYA 4X4KA 1M57B 2YAFA 1N68A 3FU8A 2AVFA 2W8CA 3JTBA 1BXAA 2QT6A 2BZCA 2PLTA 3V9CA 1JZHA 3NJJA 2BWIA 1JZIA 1A8ZA 4ENZA 4MFHA 2AZAA 4YSPA 2OV0A 2DWTA 2MTAA 1J9RA 4AKQA 1E67A 4F2EA 4BK5C 1GW0A 2FT7A 2ZOOA 5E9NA 1FWXA 2EILB 1OE1A 3BVDB 3QJSB 4Q89A 4GY4A 1X9RA 5TK2A 1KYAA 2FTAA 1M56B 1SDDB 4NAJA 3CVBA 1JXDA 2VW6A 2XXFA 1PNDA 2YAQA 2J5WA 5B1KA 2PP9A 3QJUB 4YSAA 4KOBA 1KV7A 4HIPA 4AX3A 1BEXA 1NIFA 2VSMB 2IDUA 4KO6A 1E5YA 2CBPA 5D4JA 1L9TA 2AANA 2IAAC 1AZNA 5TK4A 4E9YA 3NP3A 5B7EA 1NDTA 1IKOP 4F2FA 4QKTA 1PLBA 4JKNA 1XB3A 1IUZA 2JFCA 4DP1X 1OCRB 4A2GA 4DPBX 5I6NA 8PAZA 4PCYA 4DP8X 3FU9A 2IWFA 1SFDA 2DY2A 4JHVA 1RKRA 3ABLB 1TKWA 4A2DA 1JVOA 2VM3A 4YSRA 3ASNB 3T71A 1J5CA 2WSDA 1SNRA 4BXVA 3PCYA 1ET8A 4DPCX 3CZUB 3SBRA 4YVNA 2GI0A 3X2QB 2IH8A 4G7RB 4WKXA 5AZUA 1ZIAA 1PCSA 3S3CB 1GS8A 4A68A 4YSCA 2XWZA 4NB7A 2X88A 3FYIB 3NJHA 1ID2A 4YSEA 2HX8A 3N55A 4HCIA 4KO5A 3ZIYA 1CURA 2PP8A 2DWSA 4EF3A 2YAMA 2I85A 4CSZA 3WKPA 1OCCB 4Q8BA 1PAZA 3CDZB 3DKHA 2R7EB 4YSUA 4A67A 1CUOA 6PCYA 2DYSB 1WA2X 2H47C 2RACA 2FNWA 3NYKA 1N70A 5B7MA 4K9JA 1L9RA 1AQ8A 1E5ZA 4DP5X 3IE9A 1I53A 1PZAA 1XB8A 2UX7A 2HLEB 4BWTA 4G70B 1ADWA 4UF7C 1SHWA 1J9TA 1NWOA 4E9QA 3FT0A 3FSWA 1EHKB 4G7QB 3X1FA 4BDVA 1SFHA 1JERA 2IWEA 1NIDA 3OM3B 5AKRA 1MZYA 4HZ1A 7PCYA 3FQYA 4GP4B 3UADA 3CVCA 3NJIA 2TSBA 4RH4A 2UXVA 1BYOA 3AG3B 4YSDA 1J5DA 2BP8B 2H3XC 1A4CA 1NIBA 4P5RA 1WS7A 4HCGA 3PAZA 1F56A 2BP0B 2WO3B 3WNJA 1DZ0A 5I6LA 1A3ZA 2YXVA 2I7OA 2TSAA 5I6MA 1QHQA 4GP8B 4HHWA 1IBYA 4GP5B 1NZRA 1YLBB 3H4HA 1ILSA 1E30A 3CG8A 1QLEB 5F7AA 3MBWB 3PAUA 2HZHA 2FWLB 3QPKA 3JT2A 5B3SB 2BW4A 3WKQA 3T6WA 2OCCB 2W88A 1T5KA 5I5MA 4WTQA
chains in the Genus database with same CATH superfamily
5ID1B 2R23B 3S96B 3O6KL 2AQQA 4DPAX 3NZ8B 4OZGA 2YMOA 5GS0C 1M3JA 1P4BH 2DDQH 1B2WL 2Z7UA 3ZE2B 3UTOA 1A3LH 4PRID 2CUAA 3EGDA 2NZ9D 3LNHA 3QI9A 3LXCA 1W16A 3ASWA 2QQKH 3L7FA 4U05A 4YGAB 3X3FL 2Z65C 1HOCB 4DN4H 3VFOB 4MRCA 4WW1A 1MSPA 2A1WH 4P2RE 3WNPA 4E5XB 5EV7A 2P7TA 4OUUA 4QY8B 3TT1H 2IGTA 4FNQA 2WNKA 4HWBL 5CJQH 5E2WL 3CXHJ 4FHJA 4YXLH 4IU3B 3T0ED 2ZKHH 1NLBH 2F7PA 1V05A 5ABZA 1T0OA 1DEEA 3EYVA 4B6ZA 1A7BA 5C7XH 1ZXQA 4AOFA 2KZ1B 2Q5BA 3B7RL 3QXUA 2MRYA 2ADGA 1HOEA 2GCYB 5E95B 2Q87A 4OW6A 1A7NL 4CAGA 2XQYA 1BXVA 2BNQA 3RWEB 5SWZE 1U58B 3MNVA 4U1SA 1HKFA 2E6JA 4M6NL 1AGCB 3QZWA 1E8ZA 3P0GB 5BJTA 3EXLA 3QG6B 3MLRL 4YGVB 5KBLA 4P99A 3FQUB 2CM5A 1AKJA 2EUVA 2R69L 1CE6B 1QLEH 2B3RA 2YD3A 1QD0A 5DK3A 3V6FA 2WBKA 5DD0H 4B0MM 4MX7B 1RZIB 2PCPA 3BT0A 4LHUD 2L7JA 1KTJA 3CQQA 3MUJA 1JXJA 4ZAKD 5KS9E 3JV4B 1EGJA 5A16A 2EC8A 3BDYL 2ADJA 3APDA 4J28A 5B38A 4R4BB 4NENB 3NP4A 1TMQA 1WIUA 5IVZB 1IIKA 2GK0A 4XVTL 2EYTB 2NY1B 3G5YB 4DFIA 1NBZB 2HT4D 1MVYA 3SB3A 1HH6B 5AVUB 5FM4A 1GZPA 3GO1H 1JGLH 1ZDSA 4LSTH 4NAQA 2UV3A 4R8WH 3RDJA 3MC0A 3GB7B 5I1EL 2R29H 4EUPB 2BNRE 5C2BH 2V37A 1EJOL 1Z9SA 3EYFB 2O61A 3KEHA 2NT0A 4AMKL 1JWMB 3MJ7A 3KL5A 4LIQE 5DEJA 3RG1C 3OAYH 1JS4A 1D7CA 3QIBA 1WCBA 3UO1L 2F8XC 4IBVA 1C8QA 1WFIA 4GW1B 3EH3B 1F0LA 5C07B 4UILL 1UM5H 2PXYA 4ZTPH 4PJAF 5HDWA 5G2NA 3TEXA 3S3DB 1OPGH 3BKJH 3WCYA 4OCRL 4HEMA 1AVAA 1IFGA 3E0GA 2YA0A 5AYQA 1EHLH 4NNPL 1PS3A 4KTEL 3UJJH 2X53A 1D5XB 2YZ8A 2PO6D 4Z7WE 3QJZA 1AXSB 1S9WA 4F7PB 2UZYB 4FA8A 3Q9PA 4CW1A 5TE4H 1RJYA 1S3KH 2IGFH 1E9OA 1BIIB 3BD4A 3GYRA 5ERWA 2NX5B 3ETSA 4UIMB 3F5WA 2XFGB 5D1QD 3E8VA 2DYPA 3ZKXB 2YKKA 4R2GD 1FPTL 3RZCA 1TFPA 1Z3GH 1AIZA 1JAEA 3BDBA 5FEBA 4G43B 1S7RA 1TCRB 4DO6A 3QYNA 4XHJC 1MG3C 3PXLA 4JY4B 4AZUA 3UH8A 4CMHC 4MSWB 2VMCA 5GRWA 1WDAA 1EVUA 1UUSA 4L0PB 3LDBB 3RHWF 4OLUH 2GJ6A 1KTLA 3NCFB 5EPMB 1HXKA 3A6CL 4HFWA 5EA0H 4HUWB 1RL1A 3EYUH 1QNIA 2FWOA 1KCUH 1KBWA 4PRBB 2VR8A 4N28A 4BZYA 2XHNA 2VOTA 4AXWA 3BP4A 3GSUA 2YHGA 3IMTA 4HAKA 3ELAT 4O2EA 1Z3RA 5KVFE 4PJCF 5DMKB 4K5PA 1YNKL 1FZOB 4ZFOB 3TVMC 5DLLA 4FQIL 1AXIB 3QDJB 1UATA 3F12B 3PHSA 4OGYH 1VKXB 4NKDB 4OCXH 1S9YB 1AP2A 1LO2L 2GFBB 4WW2C 2I9LA 1LP9B 4TVPH 1CG9A 2IMNA 3EGXA 1J1PL 3QEUA 4PJEA 1NAMH 5F9OH 1T03H 4P4RB 4RSYA 1CFTB 2R1XA 3AM8C 3V9EA 1E3XA 4BDVB 1QSEA 4LP5A 4X8CA 1DQLH 1KJ2H 3FAWA 5B1JC 2Q6WB 2ADFH 4PJIA 4Z7OE 1IAMA 1K8IA 3FCUB 1KBKA 1ACYH 3ZRFC 4RBPH 1LE5B 4RRPA 1HFUA 1FZKA 1XGTA 3NZHH 3TONA 5K9OB 4PRIE 2CJ3A 1GGIL 5IMMB 5DMGC 4U6VL 3WNMA 2BHYA 2BZ7A 2YK1H 3DX8B 4NUGH 4PJ7A 2DD8L 1YEIL 3T8VA 4KXZI 3U9PL 3ULSA 3BWSA 4KH2A 2O26U 1ZLVK 1VEMA 1QFPA 3TP4A 3QUXD 4JDEB 2V6HA 3T0EE 3WUWG 5I73B 3GMRA 3FRPG 3EKCA 4AEIH 2GI7A 2OR9L 1INDL 1M9WA 1F4AA 1S7XA 4LGPB 2FO1A 1ASPA 3OV6A 1IO4C 2FWUA 5DWUL 4IM8A 3FFCB 1GOHA 3MROB 5L9DL 5TE6L 1CI5A 5C0IB 5FX3A 2AXGB 1YHPA 4GLRH 5T3ZH 2XV3A 5B1AB 1PYWA 4PJ8A 2H7WA 1FO0L 2E9BA 2OMZA 4I88A 3LKSA 2LTQB 3DX2A 4N2LA 4JJOA 4XC1H 3LSOA 3MRIB 4HW6A 1OB0A 1VZHA 2EXYC 1YN7A 5D4HA 2IWKA 5HHMB 4HJEA 4GRLA 2OS7A 5I0DA 4B95C 3BUDA 4M8UA 3DBXA 4ZMZA 1A1OB 1ORQA 4PU2A 1G1KA 3TWCL 4ABWA 2O5XH 3LEVL 3O4LD 1C16A 4GXVH 4CC4C 4PRNB 3SE3C 3TBBA 3NJKA 3PNWA 3ILQD 2R4RH 4KROC 1H6FA 2BHZA 4N1HB 2YRLA 1TENA 4O02A 1C7TA 3E9UA 5B39G 3UTSD 3EBIA 1JV2A 1R34A 5BV7L 4FQJH 5EUOA 2EKSB 3MACH 1IEBA 2BHUA 3IVKA 1PKQB 5DJ0B 1ILUA 2ZP8A 5IJCC 2Z9TA 1RULL 2DI9A 1HCZA 2GJPA 1H8LA 1MCJA 4AM0B 4QRSA 2GSGA 1UVQA 4G11A 5AVTB 5J1TC 1TZIB 4JK0D 2B20A 4XXCC 5FK9A 3SDDB 2PKDA 1DJZA 1A7RH 3RX7A 3GINA 1MKFA 3DOIA 3MV8D 5CLXA 3DJZA 1H0DB 2DI8A 2F19H 1J86A 5I1AA 1KTCA 4F2EA 4EQ3A 4MA1C 2BJML 1KEML 2B59A 4UDTA 3BQUC 4LB8A 3ELQA 5ETUA 2E9GA 4FNLL 4MXWH 4NQSA 4BEIA 1ETB1 1G7HB 2VISA 4X98B 4WEBH 4NAJA 2ICEB 3LZOA 1MIEL 2ZCHH 2DOCA 4OF5A 5HHVH 1JPGA 4Y4FA 4GO6B 5B1KA 3F7YB 1CN4A 1DBAL 5DTFA 5K9QG 5A2CA 4OZ4B 5FWRA 1OP3K 3C5ZD 3QP3A 1FHNA 1MCKA 1NEPA 4MAYC 1G7QA 5CGMA 2E6PA 4N26A 1ED3A 3NIGE 5DCCA 4LIQL 3GM8A 3QEQA 3RNQA 1KPUA 2NDFA 1D6EB 2FO4A 1WE5A 5T1DL 4QKTA 1CXLA 5AVXB 1PLBA 3CZLA 1XGYL 3DJ9A 3QIWA 4KC3B 4JB9L 1FV1A 1EJ6A 2QR0B 5CJXA 2CRYA 4JKPH 2WNXA 2VLKD 4GKNB 4ERSH 5K9KA 2DWEB 2IWFA 3VD5A 3LH9A 4N5UA 5CGYD 1HZHL 3JWNH 5DK0B 4UOQA 1WAAA 5DQJA 4LLMA 3I75B 4LBAA 5AW5B 3CDCA 1A7PL 5IROA 1F45A 1YQVH 4RGNB 2QKIB 2XZZA 4MQ7A 4UV7H 3TN0D 3WFBL 2D7TH 4CVUA 2KS0A 3BVXA 2W38A 2EDNA 5L8LB 3O2WH 1T5XB 3D3VB 4YHPA 1SVBA 4YX2L 5D1ZA 2E7MA 2Y7MA 1U2CA 3KYMB 4RAHA 3WMSA 1P0SE 1RUAL 5HI4C 1DVFB 3T0XA 5KW9H 3N55A 4X7DC 4KRPD 1E4XH 1JTOA 4JPWH 3LXUX 4KJQD 1P6AB 3CLEH 2A74C 5GRUH 2EDBA 3Q06A 1HZLA 4TSAH 4AV0A 3JSSA 1KGWA 1GIGH 3GQFA 1MCBA 4PREA 4IRSC 5KVEE 1AE6H 2ZWKA 4N8PA 1QR1A 3K2IA 3ULVL 3STBA 4PW3A 4AUYA 4PWJA 4TSBL 3QO1B 4MJ5A 4AH2B 1DQJA 4KBPA 5E8DH 4ZPVA 1L6ZA 4I5BB 1BDYA 1LL1A 2NQDA 5B7MA 1JTPA 3I6LD 4HIJB 3MJ8A 4MJIB 3TX4A 2F54A 4CKQA 4NHUB 3QXDA 4XR8C 2K70A 2H32B 3GC3A 3OKKA 3G5ZB 2ZXGA 5EIIB 2BSRB 2XWJB 4Q2ZA 4AL8L 3L17A 3AU1A 4M3KB 3UC0H 5TD4A 1IC5H 3RHWK 4NQUA 6TAAA 2FLRT 1ZWIB 4WSGA 4JG1H 5ICYB 1EANA 1FZMB 2NNCA 3QCTH 1FZJA 5AVSB 4OVVA 1NFDB 2MNWA 4PCSA 2ZUTA 2F15A 4IOIB 3ZVVA 5IHBA 3Q6FA 4NJAL 3FQYA 4N0CD 5T1KA 3RGVA 1T1WA 3I9AA 3QQ4A 1TUPA 3GJFB 3WEMA 1X3DA 2DWDB 2UXVA 3HE7A 3NACH 4P4KD 1T1ZA 4B3EA 4KQ3L 4TUOB 4Z3IA 1NGXA 1IGMH 2H9GA 5AZEH 1R4XA 4PJFE 1TPXB 1KV3A 2YJQA 3FFDB 1CGWA 1F56A 3CZJA 4NBXB 4QOKD 3QNFA 4APQA 3ZDYE 1PDKA 7CGTA 3ARFD 4WFEE 1ZLSL 2K0RA 1DHKA 4NQEB 4LPVA 2VJXA 5KJ4A 1QHQA 3GJEA 1JDAA 1TJXA 3TLRA 5HYQB 3T09A 1M53A 1E30A 5EIQA 4L3CA 1PW3A 1V7NL 1N0XH 3O4LE 3TBSB 4NCC1 4JZJA 2V33A 2GSIA 5CZKA 4PY8I 5JPMC 2OW6A 3CE1A 3QUML 4GIOA 5JHMA 1XIWB 2JCCF 3OXRA 3SQBA 1SLUA 3MNZA 3Q8AA 2XPYA 4U1IA 3UTSE 1GYCA 4PB0L 4IW4C 5KSVB 1OHQA 1MQ8A 2ZSVA 3UCQA 1OQOA 4AQAB 3GXUB 4NM8H 3WS6C 1E8WA 3VFWB 1BXUA 4PH8A 4EVNA 2P5WD 3FU0A 4BFOA 2YUZA 4M7LT 2QMKA 1KF9B 2Y9RT 3GSNL 3OKEA 1NPNA 3ECUA 5LLIC 4E41B 5JMOC 3NIDF 4LLAA 4OGAD 2EUXA 3L5WA 2OTPA 2PPCA 1NM4A 3FQ1A 4OCMC 5HYSB 3V4VL 3GIVB 4B3VA 1HCYA 1BAWA 2Y07H 3MV8E 4YHZL 5BZZA 3U0TB 1BSIA 4FI6A 3BW9B 3EHBD 3B2XA 3L1FA 3HMWL 2NY4C 2X4RB 1FCCA 2BZDA 5GZNA 3CK0L 4PRAA 2TAAA 3QRBA 3HW7A 2C3GA 5B4MD 4P9HH 5C09A 3HG1B 5ENWA 4W9IC 1YY8A 1BZ7B 3A3YB 5F1IA 3DYOA 5E1HB 5TPWH 2P26A 3C60C 1CE1H 1EAQA 4HWZB 4ZMLA 1Z9LA 1JHTB 3HS0A 3H0TB 5D7IF 4FQ2L 1F58L 1AQDB 4L37A 4U31A 5AOKA 4D2NA 1C7SA 1HHJA 4YFEA 4RMVA 1KB5L 1F4XH 3M46A 5FOJA 4UQ3B 3WUZA 1E43A 4XPAL 2F58H 2EE9A 3MLSL 3MXVL 1IAII 4XPTH 3RZWA 8FABB 2J5LC 3CBKB 4PJBB 4OY9A 4NBZB 4JO2L 3MUUA 3SGJC 4NC2B 5C0GA 4M93C 3DYMA 2VLKE 3UAJD 4NNXB 3IBEA 1N6UA 1YEKL 1YMMB 1UD8A 4WSJA 2AAVA 3H3PH 4TQ8A 3S5LB 4MDIB 3WIAA 5TH2B 5SWSD 3ZZ1A 5C86A 4OCSL 1I9RL 1N4XH 1NWPA 2VABB 1Z5HA 1BPVA 5D70H 4RESB 5DRXB 2NY6D 4JEGB 5DD5L 2AF2A 2W9DL 3IKCB 4BFGA 3MRNA 3BH8A 4ANVA 3UXFA 4F8PA 4P2RA 5F8RC 2GJZB 5JNYB 2Q8AL 2XRAL 5DJYA 4Z8FH 1OT2A 2VSKB 4DEUA 1GGTA 1PX8A 3H2PA 4HDIA 4H25A 4QHPA 4FKHA 3D2UA 2DQJL 1YUKB 1RZ8A 4B7LA 5FYLH 2Z1KA 1FVCB 1JVKA 3MQIA 1IAOA 1J8RA 2A77L 2UWEB 3OKOA 4N2OA 4X99B 5K33A 1UM6H 3TBVB 2XG4B 3G6DL 4J7RA 1MWAB 4QJ4B 4JCMA 4FABL 3JWNC 2J6EH 3GWJA 4GO9A 1RD6A 1G1YA 1BQ5A 3CFBB 3QUZD 4XNYH 3SO3C 3VQ2C 4F1SA 6CGTA 5LBSH 5HP5A 3I6LE 3IS0X 2O6PA 3ZKQD 2X4TB 3H3KA 3ZUNC 4UZGA 3HE6D 2WTPA 5EEUA 1Q9OB 1Q0XL 1X5YA 2X42A 3RPIB 1MCHA 4PS4L 2BHFA 2EEXA 3DX6A 5LUMA 1A4JB 3MA9H 3T6QC 1FL5A 3C6SB 5C97A 1AH1A 3A4DA 1V3JA 1WO2A 1XZWA 4UQ2A 4JFZH 4WV1C 3RWFA 3S8FB 3CZFA 1UEMA 1MFAL 5D6CA 3QUHA 4XOBA 1PLCA 3D7PA 4YHKH 3DYPA 3W37A 1U8QA 1C9SA 1HIML 3O3EA 4X4YB 1IGFL 1JZ5A 4QD2E 1V55B 4Y5YB 4UAOB 4W4OA 1PG7H 3LKOB 5DC4B 3HNVH 1KENL 1NDMA 4U3XA 5IW6B 3K72A 1IQDB 1JNLH 1FBIL 1AJ7H 4QOKE 4N0YH 1W2KT 4B97A 1JFQH 1KBPA 3G5XB 4FQ1L 4NGHL 3ZR5A 2CZNA 4Y4KA 1WUNT 2HWZH 4DESA 1BMZA 2FJFB 3KR3H 1I1AC 1KXQE 4MWFA 3LTVA 5F1NA 1JPFB 1ICTA 3FN3A 4GMSH 2CGRH 1SQMA 3K6SA 3HFML 1IT9L 3BP7B 5GS2D 4JFPA 4IHBA 1OTUC 5HHOD 1IC4H 2KHAA 1D6VL 4PJCE 4K23L 2WINB 4DGIH 4XP6L 2AZUA 3LXAA 5I30H 4KTDH 2VQTA 1F11A 2ZXEB 4XNXL 4FFZA 3CVHA 3TBCA 3O8XC 1JZ2A 1L9NA 4WHDA 5KYYB 2ADIB 2W81C 3ARBC 3V0WH 4BWUA 3BXNA 4DH2A 1B0IA 1J05B 3QDGD 4LDOB 3TFBA 4J3BA 3D06A 2P5WE 5HHXL 1E5BA 5TE7L 2QLYA 1CVRA 1P5UB 1IAKA 3RWHA 4N0UE 3FF7A 4YDVB 2NY7H 4H26B 2CIIB 2V8MA 4IDLA 2AQ1A 4NQXA 3S36L 3JQOB 4M8VA 3ULUL 4JFDD 3B2PA 1O7DC 3UMTA 2HFGH 3VB8A 2ZXQA 1XB6A 3BZ5A 1XO8A 1R1CA 2CDGB 2EYRA 3Q9QA 2J1WA 3C6LB 2ESVD 3GUFA 4I3RH 4M3HA 2DQUH 5F7LB 3S37X 5DHVB 3SDCC 4OLXL 1AZBA 2IAMB 3AQYA 4P2QD 5L88H 5EEVA 2NXYB 4XBMA 4PRDA 4R7NA 2RH0A 2GVYA 3QCVL 3MLZL 5CFAA 4GSDL 3LRSB 4QWWD 3IMVA 2HTLC 4ODTL 3QH3A 3WUWA 3DUHA 3FRPA 1JXGA 2YN5A 3X12B 3BGMB 1P4LA 2RD0A 3RYMA 2PCYA 4ONOA 4N4YB 3TO4C 1WLHA 4QTFA 4OJFL 4RMQA 4MCMA 2ZAIA 1MFVA 3WENA 3BKMH 3U6RB 3IF1B 1E28A 1OGAB 3OR6A 3QIUA 3EFFB 1XZ0A 2DIBA 1KJMA 1TKWB 1V3LA 4XXWC 5C0JA 5D2NC 3P69A 5L4JA 5C0RL 2H4EA 3HHSA 2NPLX 1TQUA 3ERXA 3UYPA 4BFIA 3NSYA 3QQ3B 3L5IA 5SWSE 2R2CA 4P9HC 5E1AA 5I1JL 1ZTXE 4WY7H 2EEBA 4RMWA 1WZMA 2ED9A 3B9KD 5KTEH 2HJKB 2Z93A 5J8OA 4LARL 1C5CH 2X4SB 4NO0A 4PV8A 4ONGH 1E27B 2YEQA 4FX5A 3RGHA 2E74C 3WFHA 4P9ML 3QNZB 2MTAA 1M6OB 5EU5A 1RJLA 1NCJA 2AK1L 2AXFB 2A73A 2GBVA 1ZVYA 3KYNA 4HOWA 1D3CA 2ZOOA 3B6SA 3QYMA 2ENJA 4M6MH 3T0EA 4MB5A 4TM9A 2YGPA 1L5GB 2G75A 2OTUB 3P9LA 4M7LH 5BQDA 4C8XA 4M1GL 5E99H 5F7EL 3IDJA 5FGSA 1D5ZA 4ODHL 3TYGH 1IIIA 2OL3B 3G5VA 5ICZA 1ZGLM 4F20A 1ANUA 3GBEA 4KOBA 1UT2A 5D8JH 2VRQA 4UNTA 3QK0A 4XODA 1W0VA 2OZNA 3SO5A 3NPSB 3AWEA 3PS6A 3KJ4C 3GD1C 4JO5A 4LLDA 4MLSA 5F7MC 1DE4B 4XBEH 4D3CL 2VLRA 4BSVA 1O6SB 4F2FA 1A6WH 2ZUUA 4FE9A 2KDYA 2ZYHA 2VDOB 4NN6B 2O5YL 4AY0A 1IL1B 4ZAKA 4G5AA 4OLWL 4FFYA 1NANI 4AQ1C 1UA7A 3PFUA 4PCYA 2WGNB 5DFTA 3MN8A 3ZTJG 2WCPA 2VDPH 1EGJH 4LASL 1T22B 3X3GL 2B5IC 4K07A 1RV6X 3ZDZF 3WE6B 3JWDH 3OX8A 2PWHA 4MCYA 4YHYC 5LNEA 4WO4D 1J5CA 4JJ5A 3F05A 4BXVA 1G6VK 3X14A 1WT5C 1JGEB 4JRLA 4H88L 5IMKA 4K5LA 3KPSD 1SYVA 4LPXA 3W9DB 3MJ9L 2OCFD 3VA6A 3WFZA 4YK4B 4YSCA 4FFVC 5SX4I 1MHEB 2BVEA 2MIZA 5IT2H 2V2TB 5HY9B 1GAFH 2ZG1A 4XVJL 2CPUA 3KYOA 3ZYIA 1BVNT 1LEGB 1RHHA 1A5FL 1FYHB 2XTJC 5FUZH 1MLBB 5IJBC 2EDEA 4TLUA 1UXMA 1I4FA 1PJ9A 3I3EA 3SKJL 2D0FA 2J4WL 5DZ9A 1RIUL 2OMUB 3PL6C 5INCB 5CZRA 4HAFA 1NKRA 1U8OA 3PWJB 1I7TA 5IK3A 4AIEA 2BVTA 1TU2B 2BSDA 3MRKB 4BFEA 4MD0B 3V10A 5D72L 4KY1H 3MFGB 3VU2A 1WGOA 1A22B 1LE9B 1DUYA 1AGDB 1DJYA 2LLLA 4P3CL 3SEPA 4GAGL 2YPKA 3KLLA 3OJVC 2A6DA 3SKMB 1GL4B 5E8NA 1U3HB 2VDRH 2GYSA 1ZHBB 4LEOA 3NCYS 4BQBA 5JOPD 3NFPA 4JFQB 1NIDA 2V5RA 4OQTL 2OZ4A 1T83A 4JFDE 3FOLB 4GP4B 4UM8A 4QUOA 3FCBA 5CM1A 1WZAA 3DV6A 4XCNB 4PJDA 3RUGF 5EN2B 2ESVE 1J18A 5HHPB 3IXAA 3WEXA 4O9HH 4R7VA 4Q9QH 4PTTB 4P2QE 5C3LD 1C1EL 2X1PA 4Y4HB 2R9HD 1A1MA 1LYQA 4XGZA 1KFAL 1WWCA 3L7EB 2JKLA 4F15B 4LSRH 5IOKA 1J8HA 2QHLA 5CS7A 1QUNA 1GW6A 4FNPA 1IVLA 3KGTA 1IBYA 2A7BA 4OJYA 4XP4L 4XPGL 4GUCA 3JTSA 3SE8H 5I75C 2D31B 3E6HB 5IB1B 1YEFL 1X5KA 3BVUA 3TT3L 3U0WH 2KLRA 2W9EH 4OZFB 4OF7A 1IE5A 3QZNA 5C0EA 1HXYA 3P0VL 2X5PA 2X2JA 4A6YA 2XKNA 4PCKA 2WQWA 4EOWL 2EIDA 2WXHA 2IH1B 4JG0L 4F7TB 1I3VA 5HDQL 4MJHA 5AOJA 5A3ID 2MOVA 2VR6A 4UOJA 2P47B 3L08A 3CPLA 3DURA 3TYFB 1CBJA 1JCKA 4Y2NA 1GA2A 4TN9A 1BREA 4BQ6A 4GRMA 4ZRGA 4O58H 3NT0A 2EE3A 3DHJA 5I66A 2FT6A 1S9VA 3CXFA 3GDCA 3N43F 4ZMVA 4MD5A 3QAZB 1X4XA 4ACPA 5C0NC 4CBZA 1KCWA 3V6ZB 2A2QT 4OI7A 1TETL 4EI5A 4PFEA 5FB8A 2JCCE 1YECH 2EYSA 2OMXA 3C09C 2HJFB 2DEXX 2Z35B 4WHYG 4X7TB 4U1LA 3ZMEA 4BFKA 5CCGE 2CCWA 1FVEA 3SCMC 1CICA 5I9QB 4PP2A 2AXJA 5BQ7A 1ZT1B 2X89A 4M6OH 3RTQB 3VXPA 5EO0A 3ZT7A 4W9HC 2Q10A 2YPVH 3BI9X 2NY1C 3NGBC 4WKZB 1OB1B 1WFTA 5T33L 4JZOB 2IQAB 1PZ3A 2VMJA 2FHBA 3NIDE 4I0CC 4X5LA 4QLWA 4DP9X 4EXKA 2QVIA 4NQDD 4IHOA 2C9SA 4IMKC 4X6FB 2WAQA 3EH5B 3VW3L 4OB5L 2HVKA 5HGHB 3HVDA 3C12A 1IAIL 5DUMH 1K4DA 3MRCB 3WEBA 2VXSH 3D85D 3CDGB 3IETB 2LU4A 2KKQA 3RAJL 1UA6L 5D96B 3L48A 4MBRA 1M3IA 2ATKB 1NKGA 4JANA 2E59A 4J8RA 4S1SH 1EWHA 5AOIA 5I76A 1HDMA 3NCJL 1QSFA 2W91A 4JQIA 2DL2A 4OKVA 1A1NA 1DSFL 2HFEA 2HH0H 1DQDL 4YBLB 1A9BA 2O5ZL 1I1RA 3GMOA 2P9RA 1T1XB 1UZGA 2Z3FA 3ZQWA 1CFNB 3KVPA 1BVOA 5CSZA 4HETA 3KLQA 4G6KH 1ZSDB 3TH3T 1KGXA 3VFMA 5JPNB 1A47A 2ZYSA 3Q8FA 4LSQH 4OM0H 5I8OL 1FSKB 1CLCA 2PCFA 3OJDB 3V7AG 5I1KH 4ZUWB 1BYNA 1KYOJ 5BCAA 5AAWA 1FNSL 3KPSE 3D39B 1UURA 2VUYA 1NBYB 4LHJB 1E8YA 4UUJA 3G6JA 5CP7A 1B9ZA 1ORSB 4KJYB 4EN3A 4PSPA 4DP2X 1ROWA 3MVSA 1MREH 1S7UB 3OKMB 3LD8C 1Y6MR 3EFOB 1ROCA 4B53A 3AG1B 3GGWA 1FNEB 2BCKB 4GBXB 1DLHB 4MXQD 1NOFA 3SDXE 4WWKD 3UAEA 1QLFA 4DKDC 1INEH 1BG1A 1GYAA 4WUUA 2Y1AA 4WSKA 2APVA 3LDBC 2QQLL 3LS5L 4JHWL 1YUHA 2PPDA 3S0PA 5I71B 2EXTA 3P73B 4KKPA 3V0JA 1MFDH 1GYWA 1OY3B 2BERA 3JWDC 2I07A 3CSPA 1J0JA 1IBHA 1NA8A 1AG0A 2A83A 5IHUL 2UYLA 1C12B 4HJ0C 2J88H 2D03H 1MCWW 1Q1JL 1A8JH 2C9PA 1EAPA 3RVVC 2B3IA 2DL9A 2WVTA 4M02A 3MUGB 4MKTA 3I50H 5IEHB 1KIPA 1DP0A 3IFNL 4NPYA 3QB7C 5IQLA 4NFDA 1QFWI 3QIBC 3WIIL 1D5BB 1ZIBA 4Z3EA 4FEIA 5I23A 2RAMA 2K4WA 5I19L 1Q9KB 4JM4L 5DHYB 1OSZA 4LVHB 2QJDA 1HSAA 3DJTA 2PXYC 3SBWA 3UZEA 3DSFH 4KFZC 4YHOH 3A4FA 5EC1A 4F3FA 1OP5H 3QUGA 4FXGB 5GJSL 4URKA 2FQDA 3DMMB 1SYSB 1FG9C 3TASA 3RFZB 3LHPH 4UQ9A 4HK0A 1TJIL 1E5AA 4XCFH 2F1BA 2YWZA 1H8OA 1JK9B 1GS6X 3HS9A 5EOCL 4HJTA 1PZ2A 2JI1A 2ZX9A 4R90H 1EIBA 2YWYA 2O6CA 3IB4A 3T2QA 2R8SH 4HUUB 2QEJA 2RMNA 4G2AA 2BFVL 5E2TL 4BA0A 3T4YB 3SYAA 3T2OA 4EZKA 1Y1DA 3W56A 4LPWA 1V7MH 3LZPA 3EFDH 2CK0L 1L7TH 4K3JH 5HXMA 1BP3B 1RK1A 4LL4A 4YAQA 3TF7C 4W70A 2ZXCA 4HKJA 2XX1A 4G9FB 5CMAA 4AKPA 4ZX3A 3BJLA 2FYVA 9PCYA 3VFVB 1UXWA 5C0BB 3GMQB 3QUKA 2B2XL 3M1OA 1X9LA 3FTWA 4KVNL 5CLYA 1GZQA 2CDEA 3HLAA 1XXDC 5JHDA 1HXMB 1WFOA 2BDNH 4EAEA 3P3YA 1J0KA 3DK2A 3ZLQC 1DJIA 4NRYA 4U49A 3ARED 3OLEA 4Z9KB 3IMBA 1VZIA 4XPHH 1FAIL 2DS4A 2MCPH 5DGRA 4L3ED 1MELA 3N1FC 4UBDD 1GS7A 3NK3A 1JZFA 3MRDB 3FNKA 3K5SA 2LVEA 2H1XA 1E4KA 1LO4H 4JRXA 4P5TB 2Y6SD 5AENA 4OAWB 3W0WB 1N6QH 2AC0A 1BBJB 4EI6A 2G60L 1FNHA 5FLUA 4WHTB 4NRZB 2AEIT 3QJRB 5F3BB 1CJYA 1AR1B 4B7IA 1XGUB 1U21A 2G4EA 1YEDA 5EBWB 4L29A 5AW0B 4D0DA 2NY0B 1O5PA 3GMLA 3DXAD 1JK8A 4NQDE 2Y36L 5E4IA 5I8KL 4QHUA 2ZPKL 3OL2A 3RY6A 4QOKA 1HHGA 2YEZA 5HHNB 1F6AA 1WBZB 4LSPH 1JZ7A 4RGOL 3EOTH 4PRHA 5H94B 3QXTA 4BKSC 2J25A 4NSKB 3HVNA 3O6FB 1MNUH 4EXPX 5EEZA 4JM2A 1KXQA 3G6AA 4G1MB 4TV3A 4KDWA 2X2HA 1MVUA 1ET7A 3AZUA 4V1DD 1JGVL 4POZC 1CLZL 3GKWH 4FLOA 1MAMH 1MW1A 5KN5B 1OAYH 1EEQA 3CQFA 3PABB 4PJCA 3T04D 4ZNCD 1N68A 1VDGA 3KGUA 4UQEA 1EFXA 1QBLL 3NUKA 4JRYB 4Z0BL 2AEPL 4DZBA 2AGJH 1WICA 2BH0A 3NJJA 1QQDB 2AK4B 1KIQA 4NEHB 5DUBA 1ZLWK 4JN2A 2Y22A 4LGRB 5C08D 4CU7A 1DANT 5IJVA 5DI8B 2IV9A 2R0ZL 4HLZG 2E56A 4PJ9D 4W9CC 3ZQXA 3A6BL 3R06A 1GJUA 2R4SH 4X5WA 2C34A 4LSUH 4FL4C 4NUJA 4QHMA 5D7LD 3BIAX 1JSYA 4TQEH 2FZ3B 3O6ML 4AZ8B 3M1BB 1T6BX 1UFGA 4X4XA 4X5PA 2ITEA 4P2OD 3TEYA 2AJYH 4GFTB 1HQ4B 3IPFA 1XF4B 2GTWA 4MKMA 1RURL 5CJ8A 4HIHA 3DRTA 2FVNA 1MI5B 4KTYA 5F2FA 5T1LB 4FF9A 5H35B 2PN5A 2IH3B 2DLFL 4WW2F 3NFSL 5I16B 1F90H 1SDDB 2WZ6A 3IDXL 3AXIA 4ANWA 1JZDC 2OMWB 4DKEH 4KKBC 5FS5A 3CC1A 3BSZH 3MYZA 4H0GA 5H2BA 1XF3B 3CJJA 3O4OC 4KO6A 3VJ6B 4TNEA 3MA7A 4UCFA 5D7JD 4ZSOB 4MMZB 2EKJA 5CEXB 2IAAC 4GSRA 5KVGE 2V9RA 2NW3A 3T0VA 2DB8A 3V4PL 3E6FB 4I3SL 1M1SA 2HVJA 1KELL 4A2GA 2NNRA 3QFGA 5I6NA 1THAA 3PWPB 4GINA 1RPUA 5M95B 5CEZD 4M61A 4YO0A 1NBVL 3SPVB 4UMGA 4YNYB 2VKWA 3D0LA 1OT1A 3HPLB 1J5IA 1DVFC 4DHLA 4F5CE 1HESA 4ZI8A 2A6JB 4GW5A 2FNBA 2N01B 1OM3H 1ET8A 3WHE0 4AW4A 5JHLH 4CMMA 1QX1A 3CZUB 5EU3A 4MHHG 3VXMB 3QFJD 2ZOKA 2Y2TA 1UC6A 2VWEE 2JH2A 5SWSA 2Z92A 5ALBH 4L9LB 4P46D 3GPSA 3E80A 4ZTEA 4TOYH 2VE6A 1ZGLP 5EU6B 4M7KL 5DRWB 5LBVA 1CURA 4TTDD 3ZDZE 4XMUA 4Z77B 2GQHA 1FHGA 4NN7B 1U33A 2CPCA 1I7UB 2MOQA 4L0ZA 3CXDL 4GAJH 5GGTH 2Z8VC 3NH7H 3R18A 5GISH 3QI9B 2EZ0D 4OFYD 5B22A 1NC2A 2PR4L 5IEKA 2H47C 4FP8L 2ZWLT 1S5IL 2R39A 3SN6N 1VACA 5HI5D 4E42B 2NYKA 4LCCB 3CU7A 1I53A 1AQKH 5F3HB 1DEEB 3EYVB 4YHML 1G43A 2AV1A 4XI5C 4H4NA 1MAJA 1NCWL 2R0WH 2CKBA 1KY7A 2VDQL 2ORBH 3H3BC 4KDTA 4LLYA 1SHWA 3DK0A 3S34L 3FUFA 1J9TA 3IFPB 3FSWA 3X1FA 4YJZL 3UGXA 4ZO6A 3OM3B 5HD8C 1T7XA 5AKRA 4J2QA 1P2CA 3B2UD 3L4CA 2XVGA 3VFRA 5HPOA 4GUOA 2C7UB 1LO0H 1U3ZA 3MCYA 4NFCA 2CWRA 3V6FB 3MYJA 4L3EE 4LMQE 4NZTH 4L4TB 2WIIB 5GS0D 4DN3L 2ZSWA 5CJ5A 4HWEH 1A3RH 5JOFA 4Y1AB 5C0AB 4LRIA 4Y7MA 5A16B 3T08A 4AW7A 2OP4H 4B0MB 1DVZA 1X5MA 2E7CA 2YC1A 5F9JB 4B9PA 4HXAL 5DHVH 3GSRB 4EIZC 2J1ZA 2YQ2A 5HVWA 5I6LA 4HULB 1ADQA 1PSKL 1RXLA 5SWQB 3WMPA 4G8FA 3QNXB 3SGEH 4R0LA 3IDIA 2ZP9A 2F7IA 1SJXA 2OJZH 3BHBB 2ITCA 2ZKXA 3DXAE 2AJUL 3NDYE 1AYOA 2QSCL 4MQXC 3LH8A 4YH6A 1CD1B 5GS1A 4MMXB 3K7UA 2FWLB 4PVLA 3OSVA 3OWRA 1J48A 3RUGE 1MFBL 4BZ2L 3BKCL 4Y19D 4BE6A 4BQ9A 1F4YH 2WXIA 4JREB 4MNQB 1A7OL 2CAKA 3UTQA 5DK2B 3FKUS 4U1NB 4DP0X 2Y24A 4G8GE 4XO5A 1KSRA 5DS8B 2X87A 1BM7A 2DJUA 2JKRM 1FN4B 2FDBP 5MEOA 1R47A 2XIBA 4V1DE 5DJ6A 3T1FB 2DWXA 1AG6A 4O5LH 4XMPH 2VN3A 5GGSY 1U8LA 4PVNA 5MEQB 1SOSA 2ICWB 1DDHA 4Q52A 4PJXF 1E90A 5IKCA 4FFZH 5H4YA 4B5ZA 3CVHH 4BRVA 2AEQH 1NGPL 4JJHA 5C08E 3RGVC 1RJYB 1G6RL 2VXQA 3BUPA 1E9OB 1F97A 1CLVA 4KHXL 1NGYA 3HE7C 3JVFC 5D7LE 3O0LA 4DEPB 1KTDA 2EINB 2DYPB 2VAAB 4ISVA 4Y1TA 3DOSA 2GAZB 3C75A 3RZCB 5E94A 3FUDA 4ZMYA 3RNKA 4U6HB 1HAWA 1S7RB 1M05A 4OM1H 4TULL 1ODAA 2WZPA 4JGJA 3W9EA 4DNLA 4EDXA 5FDWA 3QUYD 1AGFA 3DTXA 3CFDA 1K8DA 4LCWB 3SJVD 1R3HA 1I75A 3UAAA 3MGOA 5L4FA 2EEFA 1AI1H 1NFIB 4LNRA 4AVJA 4JKKA 4ALAH 5FYJD 3N5AA 1RUML 1TVHA 4P2QA 4A7QA 3S8GB 4FQCL 4JZJC 4F9LA 3QNYB 5EORH 4LOUC 2ZYRA 3MV9D 4UT9A 1U30A 2R0KH 5EO9A 3NEXA 3C5JB 3VFNA 4N2BA 2FWOB 1VGEL 3KD4A 4JFXA 3WNIA 3CFIC 5FHAL 2WLNA 1MZZA 4I2XA 2VDNB 3ROOA 1NAKH 2J2ZB 3GSUB 4AXWB 1CQKA 1NCCH 3BUIA 2XOTA 2JJVA 3H8NA 1CYWA 4O2EB 5IHZB 5CEZE 4LKXA 3MX0B 2CO1A 2NNAA 4G6FB 4S0TD 4XAWH 4HSQA 5F8QC 3U30B 1JN6A 1QI5A 4KGJA 2VR7A 2EIMB 4X6CA 5FW7A 5F9WC 3DX9B 4Y2DC 1GGCH 2EECA 1DQVA 4PJ5E 5E8PA 3AGWA 3VUAA 1MFEL 1XFPA 4JY5L 1HJBC 5EOTA 3WD5L 3ZGHA 2JSFA 4JPIB 5B3NA 2DV6A 2X44D 4XHJD 5T3XL 4G59C 3S5YA 5KSBA 1SHSA 2Z91A 3OJ2C 3QFJE 2OMVA 4ODSH 3KE0A 2R1XB 4DCQA 1FFQA 5CZXC 2BMKA 2FX8L 2YOAA 4FG0A 3CIQA 1K8IB 1KPRB 3MSPA 1PIFA 1RJZB 3V0HA 1M7XA 5A6MA 3TA4D 1SOKA 1L3NA 1P6WA 2JCCA 3O3BA 4JQVA 1KC5L 3GS4A 4Y16A 4WFHD 4PGEB 3NCCB 3HS0C 5DEGB 4R84A 3EF4A 3MOAL 4K7FA 4IGBB 3MLXH 1U8IB 2JIXB 4ZUVA 3RBGA 4BELD 4ONFL 2UZIL 4Q7DA 1VLXA 4ZMOA 1CDGA 2YXFA 4JVPA 3P3TA 1JOIA 3ISWA 3TVMD 4E9XA 1OWRM 2VXUL 1YJDH 4WTZG 4HEPG 4M4PA 2OSYA 3RWIB 5I2IB 5KUKA 1K2DB 4C4KT 4XP1H 2EE2A 3VWJA 4MB3A 4AEHL 5I26A 1J1XL 5E6RB 4H1LA 2IMMA 3KW8A 3RL2B 1S6NA 1P7QD 1OCWH 1AHMA 4ZUUA 2OXHB 2FGWL 3PP4H 4XE0A 5IBTL 1QFWL 5ESAA 1SF5A 5DUPH 2GT9B 1H8NA 3MTRA 2JLLA 5IB4A 3HBGA 4NT6A 1JJUA 2OMZB 5GGSA 5HJDA 3IN2A 4ZTOL 3LKSB 3BMVA 2WUCL 2IPTL 2PYEA 1CGXA 1XR8B 2ED6A 3MCLH 3TEZA 2WJ5A 3EYOA 2R27A 1KCSH 3D51A 4OTXH 5EWIL 5C9JA 3C08L 4JUSA 3APNA 1TG8A 1MF2H 3DBXB 5DA0B 3UTTB 4ZX5A 1EV2E 3X13A 5DMGD 3HI5L 2DM3A 2K9UA 3F58L 4PGJA 2ENQA 5T5NG 2VM9A 3ALXA 1ES0B 1BZ9A 1ZDQA 2OI9B 2Q9OA 4JBSA 2JXMA 3GDBA 3P0YL 4UB0H 2ZCZA 1N64L 3CSFA 1DEDA 4O02B 4PB9H 3SE4C 1BXXA 2BRRL 3D33A 4PGCA 4JHZA 1RZKL 4D0CA 3JWOH 3KPQB 4UI2A 2FHFA 2BO0A 3MR9A 4H8HA 4Y5VB 5CLZA 3ZQ9A 3RVUC 1AAJA 2C9AA 1TEFA 2ZCKH 3QJFB 4FULA 4OZFH 3V52H 3A4EA 4PS3A 5ID0A 2VYRE 4NC1C 4I4WB 1UVQB 1BQHB 1R3JB 4BHUI 1J1OL 3SDXA 5J1AB 3CZNA 4ZMTA 2J7LA 3WIHL 3ARQA 1WA0X 4PLKC 3VVWA 3Q05A 2OMNA 3ZTNL 1IM9A 1X9QA 1UZ8A 1O75A 1NCDH 5C9KA 5FUCC 5GGRY 4Z7QB 1A9VA 3BT2H 2FD6L 2JKIS 3G9AB 1G7MA 1T04B 3B2MA 4JZNA 2HFFB 2NXYC 5AB1A 4LLVA 2GC4C 5HDOA 4QF1B 2B59B 1FLRH 4XN4A 2WQAA 1YNTA 4KROD 5ETUB 5CFHA 2APWA 1P5VB 2VISB 4Z5RA 4W4OC 4OFKA 3BVNB 3IWUA 1WISA 3DPBA 4L2LA 3MRPA 1JPGB 4UAHA 5IVXF 1VSCA 3ME0B 5I1GH 2IPUK 3FUHA 1AZRA 7PAZA 1ETZB 1MXDA 2PABA 1LM8V 1CMOA 1E50A 1I9IH 3MRJA 1ACXA 1YEJH 5EOQL 1RZ7H 2KZBA 4QNPF 4E36A 5DD3H 1N3NA 3UPAA 4Y4KC 5T1JA 2ZX6A 1GSKA 3H42H 3FU7B 1JMZA 5FUOH 3SJVE 2OZ4H 1AY1L 1O7VA 4MNGE 5E7BA 2VC2H 1NL0H 5K1VA 2H1PL 4TXVB 3MOQA 1A6PA 4M7ZC 5FYJE 3SSGA 3NA9H 2DLHA 2PNDA 4HLJA 4WU5A 4TRPL 5K9KB 2YSTA 4LLUA 3FB6B 3FRUA 1CQYA 3HOGA 3GLDA 4FNUA 4G3YH 3VFPA 3OAYK 3MV9E 3QORB 4NP4H 3S36X 4JAMA 1W6WA 1PZBA 6FABH 3S7GA 4OLYL 2NYYD 2A9DA 1EFQA 3BQUD 4NWUL 1HYSD 4XCCH 2VDLB 4AIZB 2XFXA 3S6CA 35C8L 3VI3F 1OTSC 3OKNA 2ITFA 3K5RA 2WNGA 1X7SA 5D5MA 2EH7H 3BAJA 3V0VB 1OSYA 3ILPA 4JO3L 1N19A 1YPZA 1AIFA 4MAYD 3TO2A 2BP5M 3VMOA 3WHE1 4A6YH 2CO7A 4YDJB 2KBGA 5IHLB 4M43L 2GHWB 1JZIA 3KGSA 1B2YA 3RVWC 1R3IL 3PDOA 1BCIA 2AZAA 4UT7H 1H3PH 1Q94A 4ALAC 1I7ZA 2E9WA 3T0AA 1RVFH 4CSTA 2DTSA 1MFMA 2FL5A 4RSVA 2VLLA 4U1KA 1O9WA 4BQCA 2XBDA 3NPSC 4M9PA 2EILB 4MJ5B 3L54A 1DBMH 3Q8BA 4XN1A 1X7QB 3BZFB 3W11C 1M56B 4Q0XH 5GSRA 3AY4C 1ZCRA 4WFHE 1PZSA 3WV0A 4NN6C 5K39A 2QQQA 4LCIH 4A7SA 1HX0A 1CK0H 3OKKB 4ELDA 1FFNA 4PWIA 5CZVL 4HH9B 1JCVA 1TYEB 2QTVA 3BEVB 1AFVL 3CHSA 3KPRB 3HJ0A 1G7LA 3NP3A 4L4VB 1KYFA 2FATL 3DARA 3QIUC 1NUGA 1DFBH 3Q6FB 5J13C 3FOMB 4JFYB 3GMPB 2L7QA 3BPLC 2AS5M 4FTVE 1WBXA 5EFIB 5A6IA 2ZQKA 4IRJB 5K93A 2WXPA 4ZOCA 1VA9A 3WFCL 1DO6A 4I18B 1JHKL 3P4NA 2OR8A 3D09A 1CGSL 2I9TA 4W93A 4XO3A 4G6JL 1FGNH 4TUJA 2IALB 4C47A 4M5ZL 4N5EC 5E6SB 3ARDB 4XN7A 2H0EA 4PTUB 3TC9A 1HKLL 2I5YL 5IVNA 1NGWA 4JQIH 1FCGA 4WKXA 1H5BA 1V3KA 3PY9A 1GS8A 3WE1A 1AYRA 1USZA 5IG7B 2XN9D 2C3VB 1YJDC 3MDJA 1UH4A 1WFJA 4S1QH 4YDIH 3VD9A 1NC4B 3GEFA 3EG9A 3L3KB 1JPTL 4JHBA 3AUVA 4RBPK 2Q7YA 4YC2C 2DQDL 1W72A 1CPUA 2X70A 2A38A 3RL1A 1T4KA 4LKCA 3U0PB 4TVPD 1J12A 2ZSVB 3VI4A 4XP9H 1BFVL 1V27A 4OT1H 3ZE0B 4FLHA 1BGXL 1WA2X 1WITA 1DQQB 3N44F 2AQRA 4FQXB 5GS3A 4BV1A 4UZUA 1DN2A 2CBMA 4KKAC 1QTPA 1FH5L 3OKEB 4PRPA 5KAQG 2CXGA 3U7YL 2QQNH 4HVBA 1B90A 2UX7A 4QCIA 2ZNXA 4DGYH 4WNQB 2B39A 3IMRA 2CHNA 5IW1A 2MNJB 1NWOA 2XA8H 3BAXA 1KJVB 4RZCA 2HT2C 3HNSH 1A64A 4G42A 2WYZA 4S0SD 3QJHA 2ZG3A 4K9EH 1T66C 3BCDA 5ITFA 4ODUB 3BKYL 5MI0C 4HZ1A 4F15C 2MH4A 4MZIA 3RDTA 1AO7A 4X6EA 2AABH 2EIEA 3FO0L 3JWOC 2WVSA 4LPTA 2HUEA 1DLFH 2H2SD 1JDDA 4HU8A 3DDFA 4XBGA 3X11B 2Y7QB 5KZCB 5T3ZD 2WLMA 3KHOA 3MV7D 2UVEA 5ISZB 1P4IL 2UY6B 5MEND 3D69B 3MRBB 4XP5H 3GZKA 3IRZA 3U4EA 1BEYL 3NTCL 3VE0A 4JPVL 3MBWB 4RFOL 1NMBH 1XQ4A 2YD7A 1PY4A 1FO0B 4NLHA 2XTSA 3KCPA 1V8HA 5D7KE 4GH7B 1WBYB 5I5MA 4OD1H 4M7JL 5FM8A 4MA7H 2NY4D 2EEDA 2IAND 4OLZL 2BOCA 4NZRL 2BC4A 1FIGH 4OIBA 1DVUA 1FDLL 3DSNA 2BSSB 1MJ7H 1P1VA 1EJ8A 4QRUA 3V5KB 5JIQA 1XF1A 1LK2A 3HZVB 2NSXA 5GRVL 4Q56A 1CL7L 5F89A 3LZLA 5IBUB 5I9QC 3MTXA 4P2RB 1TZGL 3CX2A 1L6XA 3B1TA 3N3EA 5TDNB 4WJKB 3GK8H 1T21B 1JZ4A 3F7LA 3K74B 3L4YA 1N7MH 4PJHF 1XT5A 1GVIA 1RZ8B 2QDVA 3B5GA 2FQGA 3LEYL 4P23B 2ZX7A 3SKNA 3AT8A 2DQFB 5JQ6L 3BVVA 4LQ1A 2YRBA 3CBJB 5SWZB 5EC2A 2ZAHA 2PWGA 3L2LA 3TBWB 4LT7A 5GGQL 4XOAA 4CSPA 3MUHL 3HCVB 1D9KA 2QVKA 3O9WB 4N0FA 4GT7A 2CLZB 2NNFA 2HFTA 5D96C 1MJJB 3L1OH 2OYKA 5LNGA 2EAEA 4PJXE 3GSVA 2BP8A 1KOAA 1B0GA 5CHNA 5HBBA 5F7DA 1I3GH 5KYXB 4NQVA 4I89A 2NTFA 3L1EA 1EMTH 4WUKH 1H6EA 5KS9B 2B1HH 3SDAB 4NQTA 3WO4C 1FL5B 4YBLC 4M5YL 3P4OB 3RWGA 4U3SB 1U3HD 3B2VH 5BZXA 4C4BA 2QSTA 4L8DB 4UQ2B 3MREB 3D0VA 5C0CB 4HS8L 5D2LE 4RFNC 4BGLA 3O3EB 1NCAH 1W0YT 2V8LA 5D55A 5GZOA 3L9EA 3V2AR 1UT9A 3BGAA 2BNRB 4NJ9H 1TQBC 3T65A 4BKLA 3D1MC 1IBZA 4TF4A 2WUBH 3U25A 4QXGH 4YHLL 2ICES 3HI6H 4G8GA 5DJDA 2DQEH 2R0LH 3L45A 4GQRA 3T77B 4AE1A 3Q1EA 4BCXA 2YD8A 3OXSB 4EI5C 5CKAA 2JQAA 3HRZA 2FK9A 3DA0A 1I8KA 1T5WB 3N40F 5GRJH 5TGBA 5JLZB 2I69A 1FUNA 1TJHH 4A2HA 1JNHA 2XN9E 4G6AC 5EDSA 2BSTA 4U1GB 3TBYB 3KLKA 2X0WA 3OPZH 4Z7WB 5I6XC 1Y1UA 1K6QH 1ZA3A 2GHZA 2ZUYA 1MCFA 4QO1B 1U3NA 4LEBA 1F11B 1NIEA 2FAUA 3BZ4A 4K3EH 4E9LA 5C08A 4CVXB 4HIIA 5FHBH 3KLHD 4TVPE 5KSAB 5LWYL 4L1LA 3EDKA 1U93A 4TSCH 4X5XA 3VXRA 5KJRH 2VW4A 3BAEL 2Q3ZA 4P2OA 3EOYG 1P84K 3MNMA 4HJGB 4N87A 4F7MB 4XO8A 4DUXA 2C1OB 2ZKMX 3ML8A 3HG4A 4L8SB 5D1XD 2EC9U 5F0PB 3UABA 1BJ1H 2ZF8A 4MDJA 2EVGA 1WZ1H 2Y25A 2JELL 4Y88A 4RX4D 3SYQA 3MCG1 4DKFL 1SVCP 2F5BH 4OZIA 3LVTA 5FECB 1I9JL 4ESKA 3TZVB 1FF5A 3KPLA 3OSKA 5I5IA 4XHQA 3UBXB 2BX5A 2QVFB 5KSUB 1I1AD 3VG9B 1R24A 3S37H 4HLEA 3SQRA 3BRFA 3VX1A 5AOZA 1M1XB 4GJTB 3WTSA 1OTUD 5BNXD 4XNAA 4DOHE 1MNNA 4P49A 3V4VA 4OD3L 1K5NB 2WBJB 3QXAA 1PTZA 1NGQH 3O8XD 1X4YA 1TVBA 3QWRD 4WLCA 3LV3A 3QDHA 4HEPA 4WTZA 4A7TA 4FAAB 1UWGL 3RVXC 3ARBD 4RQQA 4F91B 4LZKA 1M2VA 1AHWB 1NPJA 2HRGA 2OSLA 3ZDXF 4EN3C 4B27A 2C3XA 2V7NA 4JO4L 5T3ZE 5IJKC 3MV7E 3MZTA 4GAYA 4ELMF 3CHPA 3TV8A 1RK0B 4PJ5A 5MENE 3EOBB 3L95A 3IDNB 4KZDH 1Q72H 2CRMA 1LDSA 2YQ3A 1V54B 1TF4A 1WEJL 1N6VA 1WC7A 1SY6L 3FB5A 2Z31D 3QFJA 4OSUL 4GUPB 5JR1H 1JPSH 4UNUA 1KB5A 2DDQL 1T0NB 2MQ0A 1KDJA 1RIVH 5I6KA 1XL6A 2FX9L 4OV5A 2XC8A 4UMSA 4K9EC 5FPIA 3L3GA 1S78C 3BIKA 3SDCD 1DJHA 4KK6C 1GOGA 1MLCB 2IANE 4OZGF 2BCMA 5D9SA 4OCWH 3TT1L 3FQRB 4CA4A 3KPPB 4UIKH 3KS0J 3PHQA 5CJQL 2EO7A 3FU3A 4PRIB 4YXLL 5H4ZA 3MRFA 4C55A 7FABL 2C4FT 2HTLD 2R2HA 3GSWA 3QUMB 5EU5B 3HBQA 3EIFA 3N0AA 4P5TC 4ZXBA 4BFNA 3NRPA 2ZXWB 2B1AH 1MWAL 5D93C 3TO4D 4FYRA 2KPWA 2PW2A 1AR2A 2W59A 3T0EB 3TPUA 4YXHL 4N2KA 2X41A 1XF5B 1TTRA 3PIQB 2G75B 1CTNA 4U6XA 3P9LB 4WJ5A 3PQYA 1R0AL 2O4EA 3EYSH 3KDPB 1FLTX 3R0NA 4KXDA 2XJLA 3R0MA 4OUOA 4DUWA 2EVJA 2CKBH 2RBLA 3STZA 3LNDA 3GSNB 4BINA 4JFEE 4LQFH 1E6OH 4KITB 3TBTA 1ZGLB 1OGSA 3AGVA 5FAAA 2A9MH 4MRBA 1BZQK 3PYCA 4LHUB 4H40A 1MJ8H 4OZHF 3CHXA 2KERA 4ZAKB 2CO4A 4GRWH 1SJEA 3GO1L 3L16A 5LCVH 2P8LB 3VQMA 4WHCA 2GIYA 5IVXE 3ULAB 2YMXH 4LOFA 4O4YH 2H41A 3GI9H 1UKQA 1RAMA 1ADQH 2MQGA 3OKLA 1JWUB 1NDGB 2D3LA 4QNPE 5FCUL 1KLGB 2DIEA 2HX7A 4PUBL 4HKXA 3SOBH 1J9SA 4YN3A 4UTAL 3FO9A 4AIOA 5KVDH 2R56H 3EADA 3ORJA 3ISYA 3FU8A 4N2FA 4RGMB 3GSXB 5F88B 3L4WA 4OD2B 3JWNE 4L8BB 4P3DA 1LWRA 3UJJL 2WXJA 1ZT4A 1C5BH 4WFFD 4RIRB 1WTGT 4X6DA 3KYOB 3LKQA 1MY7A 1UQSB 1DFXA 3DV4A 4Y0GA 4YUEH 5HI3C 5TE4L 3U9UB 5IM7A 3UTPD 3HUJA 1LEKA 4G1EB 3BEWB 1E4KC 3HPJB 1G4RA 4KK5C 4J1UA 5J12C 2PO6B 3VI3E 3OQ3B 1SZNA 3SKOA 1B9KA 5EBLB 1EEZB 1RUPL 3H9SD 1X9RA 5DD1H 3ZZQA 1OSPH 3GS7A 5I0XA 2G9HB 3DGGB 1XAKA 4GKLA 1NEZG 1TZHA 4YL9A 1H15A 4YWGH 3GS0A 5FYLD 5D1QB 2VXQH 4NUQA 1AXTL 2CBQA 2OXGA 4R2GB 2V9UA 4AX3A 4HIPA 2X4QA 1YYLH 3V6BR 4XN5A 3HC4L 2A6DB 3KXFA 5D1XE 4ZOEA 3RY6C 2O93L 2VZSA 4WEEA 5E8NB 3DVIA 1NSNL 5BZWB 3K2UH 3SYPA 4FFVD 4P04A 3FW6A 3NIGB 3NFPB 4KK8C 3Q0HA 4FNRA 4AENA 1CLYL 4M8QB 1DUZA 3MJWA 4QHKJ 5EMYA 3WFDL 1KCUL 3MODL 3S88H 3B3IB 4ICWA 4R4FH 3NFNB 4U2ZA 4D8PA 3RY4A 1X5AA 2KLSA 2DY2A 1X5FA 1UXSA 4FKKA 1FYTD 3PL6D 4NFBA 2XJKA 4WHYH 3FQWB 4F24A 3TV3L 4H8VA 4UT9H 2PETA 3NAAH 4OCXL 3B9VA 3SBRA 1N26A 3MLTA 1ZKAA 2JJTA 3CHQA 1HNYA 3NABH 5IBLC 1EEUA 4ZQKB 5G5DA 1IV8A 1QRND 3D30A 4UNVA 2J3SA 1T03L 2VLJD 1X44A 1VF5C 2ZOLB 3AMKA 3K6IA 4IOSD 1R3LB 3AAZA 3QS2A 4L5FL 5EUKA 4KTGA 4GSXA 4L4JA 1KJ2L 1OAUL 5J0BA 1MHPL 2DWSA 4KRNA 3LIZL 2HPTA 4LCCC 4PJEF 3V5HB 1WF5A 1RZGB 1O7DE 2A9NL 3VFGL 1PAZA 4NO5B 5TDOA 3DKHA 4N0RA 4ETQA 3GNML 3KWWB 3NN8A 4QYOA 4PJIF 4GQ9L 1MIMH 2PUQT 2VN6A 2OFQA 1HI6B 1QNZH 1S9VB 3FCSA 3VWKC 3V4LA 4TUKH 4WQOA 5FYKH 2P1YA 1CD8A 1MOEA 1XGPB 2VSDA 3BWUC 5EIVA 1MCLA 1Z7JA 1PZAA 5J6HA 4WNJA 3TF4A 3LAFA 4FD0A 4MA3B 1YEGL 3UEZA 4BYHA 3IFOB 1CT8A 2AEWA 2R1WB 4FYTA 5L2KD 1J5OH 4PJ7F 3I74A 4KMTH 3FAXA 3UPCA 3WOVA 2QZQA 1B0RB 2XN0A 3F65A 3CFKA 3KL3A 3G9VA 2G3NA 2CHWA 2BVQB 3VXPB 1NFKA 3QUXB 2LE9A 3O6KH 5B8CB 4CVZA 2CCVA 1B2WH 4UM9D 4XC1L 3O2DA 3AB0C 4FTVA 4HUKB 4JPQA 1AD9B 1A4CA 4NNYA 1Z66A 2VDOL 3A23A 5AWNL 4MMXC 1WS7A 3HZYA 3PGDA 4IHOB 2GUOB 5IQ9A 4PJFB 2VITA 3BISA 3WNJA 5KANI 5ILTL 3S35L 4CL7A 3EO1A 5J6GA 2J73A 3ZDYB 1OTTC 4HWBH 5E2WH 4UQDA 4K4KA 3MBEA 1LXMA 3AADB 5C0ND 2ALAA 2LW3A 3FQXA 1LO5A 3CG8A 3Q48A 4YDLC 1BHGA 3PAUA 1CGTA 1A7NH 3GMNA 2XKSA 5MEPB 4CVWA 4PP1C 3O4LB 1G9NC 4FQJL 4CDHA 5CILL 2HSIA 1EXUA 4KX7A 4M6NH 1CF8L 1NLDL 3SCMD 4MJJA 3IDGA 3GMOB 5K9JL 3MLRH 3NSCA 4WF7A 1QTSA 5CSZB 1M7DA 1BVLB 4IRZA 1E9PA 1XGRB 1XCQA 2R69H 3HAEG 1GH7A 3UTSB 2NY3C 5LAXA 2XWCA 5HYEA 2LFGA 4EIGB 5EUOF 1V5JA 5C6TL 4ANUA 5CCHE 3O3DA 4MMYB 4I9XA 4R96A 2YA1A 1A7RL 3Q8CA 4KDTC 1X5IA 4A2MA 4DEPC 1OF2A 3BDYH 4YL4A 3PF2A 5HVHC 3P40A 4UU9B 3PGFL 4Z7VA 5I0ZA 4WFFE 4XVTH 3F62A 4YSTA 4NI6A 3VXOB 2D7PA 3BVTA 1PLGH 1IM3A 1IZKA 3IDMA 2Z6FA 4U3CA 5IREA 3US0A 4AJ0A 1HQRA 4F57H 4BD4A 1KGJA 2DQMA 4MXWL 3MV8B 5T5FL 5I1EH 4HJUA 2FRGP 1EJOH 4HMEA 5C0DB 4U3HA 4AMKH 1KWKA 3DJSA 1Y18A 2XQYK 2YQBA 3RIAF 2CO2A 1ID5I 2Y1YA 3H9SE 3UO1H 4LVEA 1CDYA 5EZLA 5B7FA 3D4YA 2ATAA 3EH2A 2CH8A 4JDTH 4Q6IB 4UILH 5FYLE 4DGWC 5IB3B 4E0RB 1VCBC 4ZPTA 1EAPB 2VZVA 3FYEB 4OCRH 2NLJA 4I0PC 4PJHE 4E68A 4N2GA 3KNBA 4N20A 4NNPH 1NCNA 4KTEH 5D7HA 3C5ZB 3CIAA 4ZMNA 5JZ7C 3KYKL 2BNQD 4G5ZL 4N8UA 3U30C 4HS6A 2APSA 3EJTA 3TA3A 3LQZB 3Q6GL 1L9PA 1BWMA 4L1BA 2J1KA 4S0HA 2B16A 5H37G 1AKJD 2XTJE 3U1SL 5DJXA 3DTDA 3M86A 4XPBL 3BSGA 3MAWA 3FQ4A 1FQ9C 2VLKB 1FE8H 1FPTH 3GBDA 3UDWA 5C8JA 4QRRA 4IDJH 2XBTA 1FYTE 4K8RL 5AW8B 5F6HJ 3OZLA 1WAAF 4H44C 2DEWX 4JY6A 1E7VA 4HK0B 2XX0A 3T6ZA 2JI3A 3BQUA 2ZUVA 2L7EA 2FCBA 4HJ0D 1HNGA 3TN0B 3NBNA 1PD6A 4DW2L 4BE5A 5DZJA 1BZ8A 1QRNE 3MKGA 3RVVD 1GIGL 3N04A 3MRRB 4Q74A 3A6CH 4MAYA 1F1AA 3DUSB 3GFUA 4KRPB 4JUTA 5MP6L 4X7SL 2X3CA 3QIBD 3R8QA 3HG0A 2VIRB 1NMCB 2QSQA 5BRZD 4F7CA 4IOFC 2N0MA 3PREA 5AOMA 5DRZA 1MCIA 4XNZB 5FKAB 5IQOA 2PXYD 1CDIA 1C5DA 1KG0B 1YNKH 4PJAB 3UCRA 5M7QA 3V8CA 1N0LA 3CUPA 1UXWB 2OSXA 2AQTA 2EACA 2XNAA 3QWOA 1JDCA 4FQIH 4AC4A 4CDGC 3CD4A 5IMOA 3BH4A 3QARA 4R7LA 2X4PA 1F4WL 4NQCA 1LO2H 5CIPH 4XMKL 2AQ3A 4G7VL 5L2KE 5IQ7L 2WMPA 4UYPA 2J21A 4TQPA 3HC0B 2YIHA 1T2XA 1DO5A 4GAFB 4GG6B 5AEAA 1IC1A 4HUCA 4LVOB 5KYWB 4WI0A 2XETA 1QMUA 1IGML 4HLZH 1D7DA 3IU4L 5AZEL 5I5JA 1PD1A 1KPVA 2V2WA 4POUB 3L3OB 5AVZB 1HHHA 3UZVA 1XVSA 4EI6B 4K7PX 2A74A 4MAUL 5D2LA 4ZUTB 1JZJA 3RB5A 4PG9A 1GGIH 4NYLB 4P4KB 1PJWA 5IIEA 3HS8A 4IRSA 1XD0A 4U6VH 4NKOB 2ZJSH 1Q9WA 1YEIH 3U9PH 3L3JB 2WXQA 2GJ6D 4QOKB 1N0XL 1LMKA 3ARFB 1E40A 5IMLA 4QIRA 1EBAA 2X4UA 3HG5A 4JQVC 2OR9H 1INDH 4NUMA 5DWUH 2WWMC 4PLOB 4CSSA 1XMEB 5L9DH 4KUCF 1HH9B 1W8EA 5TE6H 1SBSL 2B4CL 2Z7ZA 2ZWYA 3L2MA 3BH9A 5DVPA 3RWJA 4U1JA 2D3JA 3TWYA 1WA1X 5JXAH 5B1BB 1FO0H 1AGEB 2X4NA 4G6FD 2P80A 3QR2A 4HKBA 4M5SA 4PJCB 4N3TA 3ZYZA 2GW5A 3ZDXE 2CGZA 4U6YB 4RDQG 2FYYA 3AT9A 3VWJC 3FT3B 4DZBB 4ELME 1MH5B 1E9QB 3O45B 5CR1A 1BFSA 1NAMA 4JN2B 5DJZA 3OC8A 3TWCH 1F3DH 3LEVH 3R06B 4WU7A 5E5MA 2P5WB 1UA3A 3OAUL 2CMRH 4E5XG 1AZCA 5MHSE 4C56A 1QSED 4N0UB 2I25N 1EDYA 1DQML 2EDOA 5J11B 3THML 5HYJA 3T3PF 2M2DA 4LF3B 5BV7H 4FXLA 1DN0A 5DJCA 5DHXB 2XZCL 4XXDA 1CE1L 3UPRA 3BUYA 3EHBB 4QHNA 4IIQB 3I9GL 2AJ3B 2Z34A 4R3SB 5EU4B 3US9A 4QJ5B 4POZD 1AKPA 2XPGB 4FA6A 3HC3L 4XNQA 5INDA 3AJ7A 3OHXB 4W9EC 2OMBA 1BAFL 3H1ZA 3EOAA 3TIDA 5TDPB 1CFSA 1D5MA 5IV2B 2F58L 5GGVY 3D12B 4U1HA 4XPTL 1U2HA 3O41B 3S97C 4HSAC 2WKOA 5EF1A 1U8JB 3CZKA 1GGYA 3WS6A 3U36A 2YEVB 1OE3A 1NUDA 4G8IA 5FO9A 1AS8A 1RLWA 2BNQE 2HLAB 2BJMH 2E27L 1A6AB 1KEMH 4M61B 4IEFB 4ZJ9A 2MMXA 32C2B 2YOCA 2H6PA 4PJ8D 2W07B 4HUNB 2F68X 3QJOA 1DQIA 1OVZA 1EDHA 2W94A 1R19A 3MRQB 1WP6A 1MIEH 4M1DL 4EUPG 4HXBH 4CMMB 4GRLD 4M56A 1OSEA 4QT5A 1UFUA 3D50A 4PGBB 3BE1L 3WY1A 4D0BA 4KFMA 4OZHE 2YAFA 1ZAGA 3O3UN 1BD2D 2W8CA 4ZFQA 5SWSB 4O2CA 5DVKA 3LMJL 4KMQA 4U0RB 3BP5A 5J9PA 3T3MF 1KBGH 2PLTA 3WIFB 3A67L 2BWIA 5G4NA 1A8ZA 5T1DH 4ENZA 2ZCLH 1JMXA 1XGYH 3L4UA 5GRZA 3C60A 2A4EA 2NY6B 3B4NA 4JB9H 1I3UA 4AGLA 3K3QA 3QCUL 2Y7LA 3BYTA 1SUJA 4HGWB 4PJGA 2CIKB 3COOA 3BLKA 1HZHH 4IK6A 4Q89A 3ARVA 1ECYA 3RIAK 3CVBA 2WQVA 1A7PH 2MQCA 4P5MB 2J6EL 3WN6A 5BRZE 3KPNB 2FJUB 5DEFB 3WFBH 1FVDA 2V3FA 2EH8L 4YSAA 2VDKB 3B83A 5A2KH 4N90D 3SGJA 4YX2H 2FBOJ 4M4RA 1VIWA 4HEME 1Z2KA 4IRJC 2DMCA 4LLYB 4BSJA 5HHQA 4JFEA 4RISL 4HPOL 4ZS7H 4WCYL 1CFQB 4I18C 3QUZB 4N9GB 5L0QB 1WTLA 3RU8L 1A9EA 2A4ZA 5B7EA 4MJ6B 1CD9B 4QRPD 1S8DA 5ICUA 1VRSA 4QRTA 1UB5A 1P2CB 1DBJH 5E9DD 2DF3A 3HE6B 5DRNB 4ANXA 3MYJB 3R4RA 1TQCC 4JLRA 4D9LL 3U2SB 1NEZA 4S10A 3V4UL 1TZ8A 4AWJC 1PL3A 3FT4A 4NDMA 4Y4FD 3ULVH 3MBXL 2ZKWA 3ABLB 4ZFZB 2J8HA 1TO4A 1WCQA 2L0DA 2YUXA 4TSBH 2Z4QA 3GXDA 3QDMA 1SNRA 5FO8B 3K0YA 3TTYA 1JFQL 3HTLX 2X9YA 3CFCL 5G55A 3QEQD 4XH2A 2H26A 2HWZL 4H20L 3KWTA 3VDBA 4X8XA 2ITCB 3B2DC 3DI3B 3W2DL 4AL8H 2VN7A 4WDIA 2XY1A 2F6AA 3QIWD 4XI5D 2NQ3A 5DJ8A 4YSEA 2DKMA 2GJ6E 3E3QC 4CADB 5MERA 3FTXA 4KMLB 3ZZSA 4JRFA 1HHKA 4H8PA 1QO3B 1MRDL 5DEZA 4NJAH 5FYKU 2WLKA 3VRLF 5HD8D 2YAMA 3S2CA 2X1OA 1OOAA 3E7JA 5D1ZI 3KH4A 2DQGL 4U1MA 2LAGB 5IROD 1L3WA 1F6LL 4UDUB 4KQ3H 4OR1A 5DJ6B 2GPZA 1CUOA 4RMSA 5F71A 1AGBA 3CLWA 3V0WL 4JVUA 3UX9B 5HHOB 3LYRA 1NOAA 1INQA 5E6IA 3BOVA 4Z3TA 5D1ZD 1YSOA 4P59L 1DDHB 4F33A 1AQ8A 1ZLSH 2B9BA 3MI6A 3UO8B 4ABUA 4XO9A 5IKCB 1H6TA 3WJMB 1ZY9A 3LY6A 3IAPA 3IJYA 3IXTB 3L6FB 2EDQA 3UIYA 5CJBA 4YFLF 2P8MA 3FHAA 3CH8A 3QDGB 1DVQA 3A47A 1WZKA 1I7RA 2RFXA 4PJEE 3DRQA 4I1RA 4MQXD 1KTDB 4E9QA 3TIEB 3QBTB 1YY9C 2J1XA 2V9QA 4FXTA 1QSEE 4ISVB 3QXWA 3LCYA 1U8KA 3L3DA 1PKQE 2MPVA 2DQUL 1FNFA 2CJUL 4PJIE 2H6UA 4RAUB 4K5MA 4OCYH 2PTUA 5FDWB 4JFDB 4PB0H 4GKSB 1QPPA 4Z23A 3Q2WA 4Z3FA 5KEZA 1PPIA 1MCCA 2ALWA 2ESVB 2F54D 1H5BC 1OGTA 4J6RL 4P5RA 5T1MA 5CEYA 2F53A 1OL0A 3K8MA 2GJJA 4P2QB 2R2BB 4PJ7E 2G5BB 2YO3A 4N6QA 5J56B 4LEXL 3GSNH 1IGYA 5EO9B 3K6DA 3VXSA 2JLPA 5I8EB 3TCLB 3V4VH 2WW8A 4JFXB 2N1KA 5HTSA 1HC1A 1OLLA 4ECNA 1IKNA 5T1KD 3RGVD 2CO6B 5B3SB 4LESA 3HE7D 3HMWH 5GIRB 4HHAA 3CK0H 1TZAA 1BV8A 2YGVA 1IBBA 1P6FA 4G8EB 4XCYA 5C2UB 2FECI 1OAXL 1Q38A 4APQD 2DZEA 3LKRA 1IFRA 5BV7C 2KQMA 4WY7L 4Z7NF 4HCRA 4LSSL 3L5JA 4KXBA 2G9KA 2X9XA 1B3IA 1MAKA 3EZJB 4FQ2H 2IOOA 4NKIL 5JDSA 2Z91B 4ONGL 4Z7OF 2QZ5A 1KB5H 2J55A 2WJ7A 1BD2E 4KUCD 5L7XL 4KX8A 3EAKA 3P9MB 3IKKA 4XPAH 5LDUA 3MLSH 2XUWA 4NOBA 2PTTA 1AOHA 1E3ZA 3B9KB 3MXVH 3OB0H 4LOUD 2CHZA 3RDTC 4AGQA 1TR7A 2UY7A 4KKZA 5ITBL 2JCCB 3HG3A 4LCUB 4JO2H 4R7DA 2WAHA 1CWVA 4OIAA 5FO7A 5EUOE 5HJ3A 2OCJA 4AITA 3CZEA 4DGVL 3SDAC 2K7PA 4HHGA 3ALPA 5K5YA 4OCSH 4FG4A 4JQXC 3N9GL 4RWYL 1RZJL 2YQGA 4M5TA 5E70A 1I9RH 4N8VB 2GC7C 3VXUD 5L2JB 4Y2DD 2J1YA 3NIDB 3QZOA 4H1LB 5D2NA 1OP9A 2FJHA 5AZ2L 5DD5H 4N90E 2OTWA 4ZUUB 3LHAA 3DVFA 1P4UA 3VXQA 1JGDB 5D71L 2A9CA 1F3JB 1RQ5A 1SEBB 2BVOB 2XZAL 4P5KB 2VDPL 3GMMB 5IB4B 2UVFA 4NT6B 4LVNB 4P2YA 4QRPE 1KGUA 3IDYC 5E9DE 5C09D 3VX0A 5BS0D 3GTTA 1V3MA 2CLRB 1FL6A 2A77H 3EYOB 1DVXA 3QFDA 4HALA 4FXKB 2YGNA 4N1CA 4Y2OB 4FABH 3BPOC 5D7IB 4ZNEA 4U1GC 3V4PB 1CS6A 3TFKC 1BYPA 2WLIA 2EICA 4WO4B 5J3HC 4KI5C 2DEYX 2ADYA 3QEQE 1KWGA 1YVLA 1Q0XH 2QVMA 1NJ9A 4PS4H 5GPRA 5KSAC 1AC0A 3KPSB 3LS4H 4HU2A 4G80A 5FUZL 1KT2A 4PGCB 4KRMB 4D0CB 3REVB 3CMOL 5H37A 3CFJB 1FP5A 2EEAA 1EDQA 4K7PY 1S7SB 1GC1H 1LHZA 4DZ8A 2AHIA 1JF1B 1MFAH 1NCHA 1QLRB 3VNYA 1D9KC 1OAKL 1L9MA 4YSQA 2Q3AA 1WAAE 3VG0L 1R5IB 2Y3NA 3JZ7A 1HIMH 1KULA 2WOYA 4YOKA 1IGFH 3A21A 4GS7C 4Z76A 1URZA 2FH8A 2EUWA 3CVIL 1KENH 4KY1L 3ULVC 3E2HB 3I6KA 2V7HB 3VG9C 1FBIH 3LPWA 3BGFB 3A0OA 4RDBA 1MUJB 1MRFL 1XBDA 5KYUA 4FQ1H 4NGHH 4D9RD 4HIEA 5AVYB 3BSHA 4FMVA 2VDRL 4LLVB 1P1ZB 5FA4A 3U4BL 1GR7A 5DJ2B 4YQXL 2BVPA 3PHOB 1MHHB 4F2MB 2SEBB 2XYCA 1VADA 5EIIG 2EE6A 1N2RB 3D2UD 3OZ9L 4PJHA 4XZUB 4AL8C 2X1QA 4YR6B 2ARWA 3W1ZA 12E8L 3DPBB 3HFMH 2JJWA 4ZS6C 4N9OB 4L3FA 3DX3A 1D6VH 3JYCA 3EBAA 4XP6H 3RVUD 2IBZX 2L7UA 4ONHA 4WEUD 5LBSA 2C3HA 1N3NB 4DP4X 2XQ0A 3G04A 4LE8A 3HRZC 2FSEB 2VDQB 4PJDF 1YMHB 4PR5A 5KUMA 1B3JA 5IOPA 2F54E 4KXZH 3FQTA 4UQIM 5GRYA 4PLKD 3FSOA 4LCYA 5HHXH 1EZLA 4JN1H 2VDNL 5TE7H 1FYTA 3FRUB 1PY0A 4I7ZC 5DUJA 4G9DA 1E4WL 3VU1A 1T20B 3T4AC 2FJGB 4YHNA 1QEWA 2J56A 3S36H 2YR3A 3ULUH 4AG4L 2F61A 3HG1E 1IGCL 2COQA 4LPYA 1UXLA 4AT6A 4YDKH 4IMLA 3PXJA 4S2SB 4WI4A 3WG7B 4HG4J 1A4KA 3DVNA 5JQHC 1AD0B 2H0PA 2NZ9C 1N8ZA 3MRLA 5IQNA 5F9DC 4KUZL 1ZVNA