4Y5VA

Diabody 305 complex with epor
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
SEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANIKPDGSEKYYVDSVKGRFTISRDNAKNSVYLQMNSLRAEDTAVYYCARVSRGGSYSDWGQGTLVTVSSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/immune system
molecule keywords diabody 305 VH domain
publication title Tuning Cytokine Receptor Signaling by Re-orienting Dimer Geometry with Surrogate Ligands.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 121
sequence length 121
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2015-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y5vA00
4I0CC 4TVPE 1A7OL 2A83A 1NMCB 2DQUL 4EI6A 2HFTA 4XPGH 3KPRB 4HULB 4ETQB 4OFVA 3HB3D 4JGJA 1RFDH 3QEGL 2JIXD 4Q9BA 1U8KB 3DURB 1F97A 5IVXA 3NA9H 5I1CL 3GUTA 2EEDA 3BI9X 4Y16D 1IBGL 1CD1B 3WFBL 3I85A 4P5TB 4KXZI 2DQIL 4MA3A 3LRHA 5E2UL 1JGLH 3I2CH 1LE5A 3OKMA 4OZHA 2W9EL 1D7FA 4RBPH 5KVEH 4DTGL 9CGTA 1GIGH 1IEBA 3HE6D 4UUJB 3U30C 2P5WD 4NQCD 3CX5K 1TXKA 4PB0H 5HPMB 4FFVC 1J0YA 4RZCB 1K85A 2DWEA 4GXVH 2ADIB 4G8FB 5CBEB 1Z0MA 4LSUH 1PSKL 2DD8L 2VDQH 1B90A 3TN0D 5CZKA 4Z7WB 3BGFC 4LSTH 4K23L 5D71H 1X5JA 2HKHL 3KPSB 4RMWA 1T5WB 1YNKL 4OCYL 4D0DA 1MJ7H 4HC1A 2I25N 3D69A 4YPGA 4Z7NE 1YYMH 2NY1D 3KPOA 4OD3H 4TTGA 1B0RA 2BK8A 4HAGA 3T8XA 5J6HA 4U1NA 5IFAH 2ED8A 4NWUL 4OLXL 4I77H 3K80A 5FUCC 1KJVA 3ILPA 2WBJB 2AK4A 4MNQA 4U6YA 3CAFA 3LOWA 1TQCB 1F5WA 4O2FA 2HRPL 5J8OA 3KJ6L 3GSUA 3IGAA 3PQYB 4HIEB 1XGUB 1CFNB 3UAJD 1FL6B 4NCC1 1MJJA 2ZG2A 4BFGA 4X6EA 2NXYB 1XF2A 2IANB 1IQDA 1S9WB 4GSDL 1PKQE 2FD6H 4XP9L 4F7EB 5GGSB 3VD5A 4PJHA 3MRGB 3OGCA 5HHPB 5T1LB 3CLFL 4FXLA 1QR4A 2AJYL 4UT6H 2J6EL 2F19H 5HXMA 2UY7A 3TZVC 2OX5A 4FQJL 1QVOA 2C3WA 2I26N 3F12B 3TWCL 4OCXL 3R1GH 4KK9D 4PJFA 5I2IB 1LO2H 2EECA 3QPQC 4Z77B 2XY1A 2IJ0C 4CN4A 1N64L 1J1PL 5E08L 3WMSA 4MSWB 5T33H 5BJTB 3SKMA 4QWWC 1IAKB 2BFVH 1NCBH 1KLUA 3ULVE 1TCRA 5E8OB 1KBGL 3AM8C 2BNRE 4BQBA 1OAKL 3VFWB 3BP7A 1NFIB 1DUZA 3BZDA 2BY2A 1BOGA 3WE6A 5JOFA 3DVGB 1DL7H 4ZPVB 4R8WH 1GGBL 5D2LF 5HGBA 2YD9A 3LMJH 4GBXD 3CFDA 4LLVA 5DC0A 2W07A 3HRZA 3GI8L 3JWDL 1IM3B 3QYCA 2CRYA 5HYQB 5IKCA 3O6MH 5FDYA 5BS0A 5DJXB 2V2XB 4HC1L 4R97B 5DEGA 5JNYB 4U3XA 3BZEB 5DRZA 4NRYB 3ZYIA 4LIQH 1UENA 3DO7A 1YEIH 4HKZB 4YLQT 1DEEB 5CEXA 1G1YA 5D1ZD 1ZT4B 5MEPA 1A4JB 3GHEH 3EYVA 4GW4A 3MRNB 4RMQA 4JGMA 3VRJA 4LEOA 1H9VA 2F15A 1S8DA 1LNUA 1MI5A 4I48B 4KI1A 3O2DH 3VGAB 1FRGL 1MCHA 5BVPH 4PUBL 5DTFA 5F1OB 4RRPA 4OD1H 1I7TA 1U6AL 3KYOB 4F8TA 2PYFA 2FWOA 3TVMA 2R2EB 1S7SB 1F8TL 3MNWA 2OP4H 1X5GA 1S9KC 5FGBA 3IDJB 4JKPH 1OF2B 1DFBL 1WZ1L 1YQVL 1DQQA 2VITB 3UTSD 2X9WA 3IFPA 2AEQL 4PG2C 4CGTA 3MRCA 3DNKA 2GEEA 2JIXA 1A7PH 4NQEE 3TJEL 3H9HB 4X4MA 5IBUB 1MVUA 3QI9B 1E4KC 2FX9H 3KYKH 4Y16A 1CLZH 3RNKB 3WSQL 2ICWI 1YN6A 3K8LA 4DZ8A 3NCYS 5D2LE 4LCYA 2Y6SD 1BBJB 5GS1A 5FXCH 1VPOL 1IGJB 4P2RB 5CUSH 2Y5TB 3O3UN 4TSCL 3QFJE 4YR6A 2VXUL 1WZLA 4PV9A 3HE6A 1CBVL 4NQCA 1IZKA 4LLDA 2VZ3A 3Q6FA 1PZUB 1OM3H 4GW1A 4MYWB 1F45A 3FN3A 3TA3D 3Q1SL 5FO9A 1CXFA 5I8CB 4FQQA 4GRLB 4OLUH 1U9KA 3SKNB 3O6KH 4F2MA 4UNVA 3CFIC 2V17H 2FB4H 3V2AR 4X4YA 2NXZD 3BO8B 5FYLL 1J11A 2XN9B 1C5BL 1BZ7B 3T3PE 3U4AA 2HTKC 2HKFL 3KJ4B 2EDLA 3LVEA 2C4FT 1I4FB 3CNKA 4IJ3C 3RVTD 4DCQB 1P4IH 2HVJA 2VO5A 5C0FB 1CD9B 2FGWH 2MPAH 2QQLL 2F5BL 3MLTA 2Q3ZA 4NO2A 4OT1H 5D7IB 4CDHA 5KW9L 3HZKB 2VDPL 1E4XH 1NCDH 4LSRH 3RL2A 4Y2OA 5T1MB 2QHRH 1KPUB 2DTML 1ONQB 3SN6N 5KS9A 4H1LA 3RUGF 2NZ9C 4UQ2A 3PDGA 1HSAA 5DA0B 1A7NH 1OLLA 3HR5A 1AJ7L 4R4BA 3DMMD 4OZFB 3IU3A 4WHTB 3U1SH 3VG0L 4OZIB 4GRWF 3ZT6A 4YBLB 1M71A 1R3KA 2DLGA 4LVNB 1N4XH 4OZGA 3WS3A 5A43C 3WL9A 1NQBA 4PJIA 4X80H 2XA8L 3QG7H 4MNGE 1JI2A 2R4RH 3OHXB 1FNHA 2E6PA 3NA9L 5E1AB 1CD0A 1M4KA 1IQWH 1T04A 1NGZA 3UO1H 4N1EA 5I1DA 4HV8A 5IMMB 1Q0YH 3LAFA 4NT6B 2W65B 6FABH 5IVXF 3EFDL 5FKAA 4PIRF 4GS7C 5BRZB 3WFCL 1CDJA 3ARSA 4P5KB 2X1QA 4PB0L 5EU5B 1M7XA 5JQ6H 1PDKA 4FXKB 3O8XC 3OKNA 4LOUD 4OZHF 4P2OC 1DN0B 4GBXA 4IOFC 4LSUL 3VXUD 4IRZL 5F44A 1J12A 2VDQL 2YN5A 4LSQH 4X8XA 5E7BA 1BD2E 4PJ9B 3JV4B 1ACYH 1BP3B 5EZIH 2L7UA 3VXTB 2R2HA 5I73C 1MJ7L 1BIHA 4NO5A 3EO0A 3MLZL 1YYML 2I24N 4ONOA 4K9EH 2OBGA 5CSGA 5D1ZA 3QDJB 1A21A 1KFAL 4HBQA 1OARL 3RUGE 5IFAL 1YEDA 3QUMB 4ZAKD 3VFVB 2UUDK 5C7XL 3RNQA 5EOCH 5GISH 3E8UH 5B39G 4I77L 5HD8C 4PJ5B 3T0EB 2Y7QB 4WI8A 1JV5B 1ND0B 2OTUA 4M7JL 1QSFD 3QNXA 4GRWE 4X83A 4LSDA 4CNIA 1CGUA 1XF3A 3GSWB 4KZDH 5IW6A 4G8IB 3RWHA 5T3ZE 5L6YH 4NUGL 4YK4B 5DVOA 3D0LA 5E03A 4XVUC 1KIPA 2VH5H 4BFIA 2AABH 4IS6A 3FQNA 5KSAD 2FCBA 4Z6AT 2XWJA 2EDDA 1UB6B 5HYSB 3F7VB 3UTSA 5CIPH 2C9AA 3RZCD 1YPZB 2AXFB 2FECL 3D25A 1EHLL 4JPVL 4M6ML 5IVXE 5I0DA 1NBVH 3MLXL 2X4PA 5CMAA 2WP3T 2F19L 1T22A 2EKSA 1SEQH 1TENA 4HK3N 5TE6H 5J57B 1U3HD 1IARB 1UXSA 4K7FB 3PWUB 4JREC 4S1DD 1EFXD 4IHOB 4ZUUB 4QYOA 3SDCD 1LO2L 2APVA 4JFOB 4OZHE 3LPFA 1MIEH 4JZOA 2XY2A 5CZVH 4ORGA 2G75B 3SGDH 5CSZB 3M8OL 4RMVA 1NPUA 2F8OA 2ZCLH 1DTUA 2HRLA 4CUCA 1CU4H 2BFVL 1NCBL 3INUL 1OP5H 5GGRY 3I84A 1J1XL 5ETUB 4ZFFB 2VRAA 3QH3B 4XBPB 5IGXH 4MCYA 2OK0H 32C2B 1JCKA 3FT4A 4P4KA 15C8L 3LRSA 5CBAB 3GSOB 3IJHA 4HT1L 2DQJH 2BCKA 4KKCD 4DWHA 2OTWB 5F7DA 1U3JA 4R8WL 4OLZH 4AT6B 3AFLA 5CD5C 1ES0B 3FT3A 1CGSL 4AEIL 4MJ6B 1IAII 3TBSA 3Q0HA 3C8KB 5IEHA 5DFVD 4J3WA 1P1ZA 3U2SA 3O6ML 4FOMA 3PGDA 4U1JA 5FUOH 4QXUH 4JVWA 1KJ3L 1IGCH 5EC2A 4LIQL 5GS0D 4FZEL 4UB0H 1XH3B 1SJXA 1KCKA 2K7QA 3TO4B 3MCKB 2Q6WA 1A7RL 2J8OA 4HIXL 5I1LB 3RY6C 1L7IL 3GHEL 1MFCH 3MREB 2AK4E 4MNQE 3LV3A 2BNUA 2I9LA 2WBJC 1KJ2A 1RUAH 4QXWA 1TQCC 5BVPL 5J12C 3QEQD 4ODWA 1HCVA 1H8NA 5H2BB 1PYWA 1RU9H 3RDTB 3HNVH 3PWPD 2AS5M 3QEUA 1GC1H 1MJUH 2VLLA 3P73B 4JQVC 3S5LB 4RFEB 1FSKB 2A6DA 4O58H 2NXYC 5E00A 4PJHE 3TEUA 2OP4L 1PG7L 4H20L 3ZKNC 2B1HH 2SEBA 3NCJH 1EEQA 3NABH 3QNYB 3REWA 4DKAA 5GPRA 3KPPA 3STZA 2BNQA 3HFMH 4J2XA 2WLYA 2PTUA 3RVWD 2G9HB 1W72H 2A6JA 3SDAC 5EU4A 2LV4A 3GM0A 4FFYL 3DV4A 5DI8B 4ZXBA 4PJFE 3DOSA 3RPIB 3VE0B 3QCUH 5DD5L 3SKOB 3MRKB 1NGWA 4HUXB 4X9IA 1XR9A 4XI5D 1J05B 1N0XL 3FQXB 4MQTB 2HT2C 3VWKD 1KIUA 3B6SA 2ZUQC 4ELMA 1MREL 1TQBB 2EDNA 2UZIH 4KMTH 4EUPB 3FMGH 4PB9H 5DS8A 2X9XA 5F9JA 4NKMB 3SJVB 5KVGL 3OXRB 1I1AC 4PJ7A 2CLRA 3IF1A 4NPYB 4HUUA 1OM3L 2ZCKL 1D5ZA 5ACZA 3BEVB 1KCSL 2QADC 3RJDA 5BS0E 1ZE3C 3VXUA 5FYLE 3RTQB 4LVOB 5F7HA 1PZ5A 3OV6A 3O6KL 4NZRH 1UXWA 4OM0H 1I9RL 5F6IB 1ZLUK 5EBGA 5F72S 2J1KA 3FFCD 2FB4L 5J7CC 3I3BA 5MHSD 4YHIA 4XPFH 2AEWA 1AH1A 5FK9B 3FOLA 3DV6A 2DLIA 1MH5B 1AQKL 1PKQB 1MI5E 2W38A 3MTRA 1QEWB 2D03H 4KKLD 2ZOLA 4ZO8A 1KXTB 4N0FA 4GW5B 3VGAC 2YZ1A 5EPMA 4MDJA 1KJ2L 2PTTA 1QSFA 1I1CA 4TYUA 3MXVH 4R7DA 1NCDL 1A1OA 2WUCH 5J89A 5TDPA 2OI9C 4F33A 1I1FA 5FHAH 3B5HA 2X7LB 3O3DA 2CLVB 2XZAH 1IKFH 1KCRL 1NCUA 3Q3GB 2MKWA 3GGWA 5KSAA 1A7NL 1KELH 2A38A 1ZGLM 5HHQA 2VR9A 3U1SL 1AP2A 3R0NA 4Y7MA 4X4ME 2G2RB 4X7SL 3ARGB 1QLEL 4N8VB 5DJ6A 5FA3A 4H88H 2ADGA 1LO4H 1G0DA 1I3VA 1G7IA 3IVKB 4X80L 4HGKC 2WSKA 4O9HH 1U3HA 1INEH 3NCMA 4U0RB 4AQ1B 3OKKA 1EFXA 3FTGB 2FSEA 4M5ZH 2EYSB 2RAMA 3MLYL 4K3HA 4S0SD 1BREA 3SDCA 3UO1L 3ZSTA 2OTPA 3JBG7 4DK3A 5EG6C 4NKDB 1G84A 2VUYA 2XWTA 4OFYA 4PJIF 3HMXH 1YYLL 3TBTA 5H35A 1EAPB 1NLDL 4NQCE 1MLCB 1MRCH 1U2CA 5SWSD 1TNNA 5KTEL 2NLJA 3G08A 2FATH 2VERN 1JYXA 3GMRB 3EDDA 1CWVA 1PVHA 4HWZB 5F9WB 1J8HD 2ZOKA 4XH2A 2AJVL 3UCRA 3WXVL 5ICZB 2M1KA 4H5SB 1AHWB 1E6JH 3VFRB 1ZHNA 1R3JB 1IEHA 4X99A 3V7MA 4DVRH 2D31B 1J0IA 2E3VA 1P6FA 3BKCL 4HFUL 1ACYL 2NYYC 3O9WD 3LEXB 1DQML 3HUJB 4WU5B 2V5RA 4EIZC 1DANT 2LE9A 4WFHD 1E4JA 43CAB 4F58H 1CIDA 3EO1A 4YEFA 5DFTA 3IDGB 5FO8A 3GBML 4LKCA 3MLSH 4JM2F 4F7MA 1D5BB 3SBWC 1NJ9A 4W81A 1R3IH 3DGCR 5D5MB 1JYNA 3EGSB 4F15B 3D9AL 4Q6IB 1MCDA 1ZT7A 4PRID 4NQEB 1T1WB 5KS9E 3QEQA 4OCMC 4HJJL 3PWPA 1XEDA 5JMOC 3F7PC 1CDGA 1RHHA 3VFPB 2VISB 2YBRB 1XCQA 4YHZH 3MV01 3VFNB 2EE3A 4WWKC 2P8PA 2J8UA 4DKEL 1SYVB 1Q94B 4UBDD 5CJQL 4OZGE 1R5IB 4YBLC 4PJ8D 4PJIE 1A6ZA 1QNZH 1W72A 4LVNC 4HS6A 5AEAA 2P8LB 5C1MB 3U9UB 4X5WA 5IR1B 4IRJC 2W0FA 3W9DB 4OI9A 5GRYA 1KACB 1A3RH 3PV6A 4Z9KB 4F3FB 1H3VA 1U8HB 3GJEB 5FGCE 5BV7B 3DIFA 1U95A 1JMXA 2B1AH 2D0FA 3QXTA 3GIVA 2PN5A 5F7WC 7FABL 3NBNA 2JE8A 2V9TA 2F54D 1I3RA 2ZCLL 3MRFA 3VWKA 1LMKA 5HVHB 1CFVH 1B0GA 1TTFA 4DGYH 3CFJB 5EO1A 4HIIB 3RY4A 1QLRA 1X5HA 2ED7A 2FEDD 2FBOJ 4JY5L 4LCWB 4X7DC 2D7OA 3BPLB 4ZYKB 3WO4B 1EEZA 4P23B 3EYFA 2Q76A 4ZS6C 1FO0A 3MGTB 4BH8B 5IBUG 2ADFL 2DQJL 2YS4A 3U0PA 4M1GH 3U7YL 1H3GA 4OLZL 1A2YB 4HQQL 4PJ9C 1QFWI 1JGVH 1I1RA 1ZVSB 4LIQE 5EZJB 4OV5B 4OCRL 1VEPA 3FFCA 5FUOL 1IGCL 3LQAL 4J3UA 4NQUA 5EO9A 4H26B 3BZ4A 3RWCA 5GS0L 2IAMC 1PFCA 2DM4A 4OAWB 1UM4H 1L6ZA 3PL6D 3T0WA 1MFCL 1T66D 4JQXA 2AV7B 1BQSA 2D0GA 1ZLWK 3H7BB 3LS5H 2AI0H 3EAKA 5ICXB 4MCZA 2C3XA 1RZKL 1YEJH 3OKEB 2RCSH 3CLEH 1DUYB 4PGBA 1FORL 5I1KL 2OL3H 4OF5A 3NCCB 1GC1L 4C83A 5JHLL 3BP5B 4TUJA 3AREB 1KCVL 1N8ZB 1NANH 2E6JA 2GQHA 3OSKA 3UTSE 1LEIB 2ARWA 4BQ8A 1FLTX 1QSZA 3CSBA 1V7MH 2V5TA 1R3LB 4PP1C 4CDGC 4U1MA 1HILA 5KN5A 2ORBH 3OXSB 2FIKB 3HPLB 4F80A 3P77B 1RUML 3MODH 3HFML 1T1ZB 2VSDA 5F1IA 1W72L 2EE2A 1MHPH 5HYJD 1NCAH 2UZYB 1HHGB 5DD1H 2YA2A 3BP4B 2FJHB 1RJZA 1E6OL 1JP5A 1X5AA 2W60A 4OCSH 3MLPA 1BD2B 4NC1C 1ZLSL 3FQUB 5DQ9B 2JB6A 5EBLB 3UYRH 5DURD 5MI0C 3VW3H 2H3NA 5JUEH 4RNRB 1H5BB 4OZFG 5ID0B 3TLRA 2YK1H 2VKXA 4GT7A 3H7LA 1P5UA 2DIAA 2X42A 4MJIB 3QUZB 2UZIL 5SWSA 5HPOA 3ILQD 3FMGL 2GHWB 4PB9L 3RPKA 3RX7A 3HR6A 4AEEA 4KJWD 4WUKH 4NNXA 2XWBB 3S4SB 1FO0L 3U9PH 3B8YA 1J8HA 3PWJA 4ELMF 4L9DA 3I3DA 2HJFA 3RWJB 5MEND 4R2GC 3CFKA 3EHBC 5BZDA 4FP8H 3O9WA 4N5EC 5I1IH 3A0OA 1WFOA 4HF5H 4FQ1H 4NQVB 1Q72L 3K1KC 3L1OL 2JJWA 1CGXA 5IOPB 2JCCB 1U8LA 2VE6A 3MSPA 3L5JA 1OL0A 2D03L 4GKNA 2LTQC 3WFEL 1J0ZA 3NFPA 2Q1EA 4Z5RA 3ULUH 3OAYK 2QKIA 3GUTB 3JV0A 1PY9A 4PRIA 3QO1A 3EOBA 3MOQA 5EULV 3RDTC 4D8PA 3D85D 4YHPA 2E8YA 3WFDH 1MNUL 2YWZA 2X4TA 2JK5A 3TJHD 4MWFA 1FSKC 4F9LC 1OAXL 3QAZC 1Z5LA 5FHAL 1ZXQA 25C8H 2XZAL 2BNQE 1IKFL 1HZHH 4R3SA 4WEBL 5KG9A 4CW1A 4F7TA 5LCVH 3DPBA 4G7VH 1EO8L 4OKVB 1JFQH 4LLWA 2DWEB 5ABDE 3MV9D 4K94H 4PJ8A 5DHVA 3MUY1 2RR3A 4X7FC 4HW6A 1RZJL 2DBLH 4YH6A 3Q5OA 1LO4L 2KZWA 5IFHH 3KLHD 4NO3A 4D0DB 4O9HL 4WU7A 1INEL 1DP0A 5JLZA 3KPOB 2VDKH 4XXCA 4ELME 1B0RB 3T8XB 1LDPH 5J6HB 3SY0A 4U1NB 4NN7B 2F54A 3CDYA 5HYSG 1ZANL 3IAQA 4PJ7E 1LILA 2BJML 4QNPF 2I60H 1MRCL 3HPJB 1KJVB 2Y4SA 3J8F7 4R90H 3IDIB 4LCCC 5D7LA 4YXLH 5BQ7A 3OTTA 5IG7B 3VXUE 1S7VA 2AK4B 2FATL 2R69L 1IGIL 4BH7B 2NY2C 1GL4B 4LVOC 5F6IC 1E6JL 2GSIA 4X5XB 1MJJB 4PTUA 4DVRL 1HWHB 4X6EB 3BIBX 5JOPD 5ADPL 2GFBA 1B88A 4YUEH 3CDGA 1YEFH 1BFSA 2HN7A 4PJHB 2MJWA 4XMKL 2B7DT 3VXRB 3SGKA 1WWAX 3H9YA 3OGCB 4F58L 4XP5L 1A1MA 1OW0A 2VUOA 4U6XA 1U91B 1IMHC 4YAQA 4FTVD 3MLSL 3X3GH 3ZDZE 3PL6A 1MEXH 3OAUH 2B0SH 1QSFE 3GSNH 1QVOB 1KLGA 4HCRH 3SO3B 1EERB 3KGRA 4HDIB 4TTDD 3SKJH 2NY7L 4KTYA 2D9CA 4LASH 5KOMC 3S34H 3HNTH 4PJFB 3L3KB 1YECH 4TSAH 4G6FB 3IDUA 4Y1AA 3SKMB 1KGCD 2O5XL 1FGNH 4JRYD 4FG6C 1KLUB 1TCRB 3RWGA 1I9IH 3LKQB 2F8VA 2UUDH 2XG5A 1RD6A 5ALBH 2CDGA 5C0IB 4L8BA 4P9MH 3BDYH 3MJGX 2YD7A 1BM3H 1CLYH 3DX6B 5I19L 5JOFB 1BOGB 3LHPL 5GGQH 3ARGC 3X13A 3X11B 2HJLA 1KTKE 1WQVT 5HYJA 2HFFB 4QNPE 4N0YH 4IEFB 1WEJL 4FFVD 4BA8A 4R4NC 4U0RC 3BKJL 2WMPA 5IKCB 1VGKA 4RMSA 5BS0B 1DQDL 2ATKB 5DEGB 1GAFL 4ODSH 4FQXC 1MCLA 2KL6A 3A67H 4NFCA 2E9JA 1K5NA 3S88H 3QQ9D 2HVKA 5CEXB 2DJUA 1P7QB 4KK6C 1EFQA 5JDSB 3EYVB 4GW4B 4RIRB 4ZQKA 5SWQB 4R0LC 4LEOB 3DYOA 4NQSA 4X6DA 3NIGE 4XC3L 4YHMH 1L9NA 5SV4A 2A6IB 4G6AC 1J1OL 1KPRA 4OGXH 1AXTL 4J23A 1I7TB 2BSTB 1AHWC 1I85A 1UEMA 1RJCA 4LARH 4XPBH 3QPXH 1HKFA 5TDNA 5K9KB 3TVMB 3V4UH 4JANA 5MENA 1T1XB 1VGEH 2HFGH 1KYOK 3MPCA 1BZ9A 3MNWB 5HVFB 1WGOA 5TJWK 3MNZA 5HHXL 4L8SA 3UPRB 1NCCL 3UP1A 4JDTH 2R4SH 2CRZA 1DQQB 1LK3H 4EUPG 5BMFH 1EMTH 3GMMA 3GK8L 4D9LH 3S35X 4F15C 1A14L 2AERT 3O6FC 4Q6IC 3ZE1F 2GK2A 4FQLL 3LB6C 3QEQE 4YWGL 1BJ1H 3LS5L 3LS4L 5J6GA 1C5DA 4U0QB 1MVUB 2C26A 1QRNA 1SBBA 3L3DA 3PWPE 2GJZA 2XICA 3QRFM 4EN3B 3T4YA 4JHWL 1N5AB 5E8DL 1ETZA 1YN6B 4DZ8B 1V3KA 1YEJL 3C5SA 2MOVA 3D85A 1DVFC 2RCSL 4LCYB 3HHRB 2HT4C 3TZVD 3S35H 3H9SD 1SJVA 2XYCA 2XKUA 2J8UE 4NIKB 3QZWA 5JHDD 3FL7A 2BVQA 4KTEH 5KSBF 4Q9RH 4QCIB 5C2BL 3MXWH 3QPQD 4I3GA 4WV1A 4YR6B 1QBMH 4QXGH 1DCLA 1V7ML 3SE4A 3HE6B 4I3RL 2P5WB 4NQCB 5GRJL 4Y5XC 3Q6FB 1CF8H 4M61A 4QWWD 2AJUL 4K71B 5HGAB 1NDMA 3MV9A 5M7QA 1XIWB 4MZ2A 5FO9B 3MLRH 5ILTH 1MHPL 4JR9H 2MMXA 4BM7A 3TN0B 2Y9RT 3ZDXE 2X4OA 4F2MB 1PEZA 4X7TA 2A9NL 5IBTL 4HEPG 4FHBD 5EIQA 1T0MA 1WBYA 2ICEB 4JJHA 3UTQA 4OLWL 3UYRL 3U4BH 2NY1B 5HDQH 4XT1C 4L4VA 3OZ9L 1NEUA 5F93C 5HVHC 3HS0B 3STBA 2ITDA 2NQCA 1MHEB 4Z7OF 4WEUD 5T5NG 2HVJB 3HCVA 3KYMA 1NGXA 43C9B 1FFRA 2FDBP 4N90D 3MLTB 3BPLC 1KLFA 1MWAA 4N8VG 4P23C 4NO2B 5IIEA 4MD5A 4ZG1A 3MFFA 2Q7NA 4BFBD 5IT2H 3TBWB 4BZ2H 3GMQA 2BVEA 4RA3A 5EBWA 3RL2B 1E4WL 1MFAH 2BRRL 4FQHA 1CFQA 4GO6B 1DBBH 4XX1E 3FFCE 4UIMB 5KS9B 4WO4A 4H1LB 5MHSE 1QFUL 4UQ2B 5JPMA 2YEZB 2HA1A 4OUUB 4R4BB 5C08A 4JG0L 3WIFB 4HF5L 1H3XA 3MBXL 2LU7A 4OTXL 4YDJB 3RI5K 4QF1A 4OLVH 2O61A 5D2NC 4HH8A 4JKLA 1I8MA 3EJJX 1M71B 1PJ9A 1EZVX 4OZGB 4FTVA 5D7KD 1DLFL 1CE1H 5HHVH 3WL9B 3WS3B 4YX2L 5DWUL 1T5XB 2IFFH 2BC4A 3DROB 4DKFL 3U7WH 1HH6B 1ZLUH 5IFJB 3I6LD 4Q2ZA 1T04B 3HZVA 1A02N 1WAAA 1NGZB 4LHUD 5I1DB 5J56B 4Z7VA 3RFZC 4ONGL 2ZUYA 3UBXI 1U8JA 2DQFA 3VGEA 2AXGA 3DRQA 5EOCJ 4PJEA 2NY3C 3AREC 1NMAL 4ZOEA 5FGCB 4JRYA 25C8L 4Z8FH 2XI9A 1AGEA 2AK1H 3M1BA 3VXQB 3IRZA 1UH3A 4ENEC 4C56B 5HYFA 3U36B 1MLBA 3JWOC 1JFQL 3FOMA 1UACH 3I9GH 3H9ZA 1CXLA 1FNEA 1Y18A 5I8KH 4OCWH 4Z7OE 4GBXB 2FBJH 4JFED 4JEGB 4LQ1A 4OIAA 4N0RA 3BW9A 5HVGB 4RGMB 3PGCB 4EVNA 1HK6A 1L7TL 1C7SA 5I30H 5JXEC 4NO5B 3EO0B 1H3WM 5JA9A 1UVQA 2XNAB 2VDKL 1H5BC 5SWSE 2JELH 5D1ZB 1LDPL 3IDMB 4C4KT 3LQZB 1IE5A 4D0BA 3GMLB 5D7JC 5KSVA 3WO3B 2HTKD 3MCLL 5DMKB 1J8HE 4K3GA 1MWAL 4YXLL 1ZV5A 3F7YB 1Q1JH 3HLAB 3T65B 4UQ3A 2AEIT 3QNXB 4O51A 3O45A 4EDXA 4JE4B 1YNLL 2R15A 2ERJB 2YR3A 4QT5B 1I9JH 4OGYH 5FFLA 1F3DH 5IW6B 3RWHB 3RVXC 2A2QT 2W91A 1U8IA 3O4OB 4Y5VB 2VDMH 4G9FD 4WFHE 2FEEL 3NZ8A 4HPOL 5L8LB 4MJ5A 4BFIB 3LN5B 4IS6B 4MD4A 4R26H 3RRQA 3MA7A 3S8WA 5ERWA 2XQYG 4QTIL 2XWJB 2VC2H 2PNDA 1XGRA 1YEFL 1NAKL 1N26A 4Z7UB 5F3BA 4JZJB 2NZ9D 4WFEE 1NGPH 4X0KA 1H3UA 1F3RB 2X4PB 3FFDA 4PRIE 5CMAB 3X3GL 3K8MA 4QTHA 1MEXL 5D93B 1K6QH 1VACA 4PV8A 3CXDH 4JFDA 1UM6L 4MAUH 2YPLD 3QQ4B 1YECL 4JZOB 4U1HA 3ZTNH 4TSAL 3TZVA 4ORGB 4YC2B 2UVFA 1A6UH 5JHDA 2EIZB 5T1DH 1KB5B 1QACA 3V6OC 5F8RC 3FRUA 1I9IL 2EDBA 5L7XL 1OSZA 1J8KA 3H0TB 3E6HB 4MCYB 3BDYL 3FT4B 3HC0B 4N8CH 1BM3L 5K9JL 3IJHB 5GGQL 5K9OA 5C07D 5CP7A 3DGGA 3OJMB 4KHXL 1YUHA 3TA3B 4GFTB 1HN1A 3BRDA 3AM8A 1C1EH 1I9EA 4PJAA 4K3DH 1FVCA 2OR9L 1ZGLA 1JGDA 3BHBA 4ZD3L 1T03H 3OJDA 3FO2B 5IEHB 3O8XD 4OM1H 3PGDB 4U1JB 2NXZB 2WANA 3H42H 4ODSL 3ZE2F 2F54E 3E6FA 5EC2B 4P3WA 1GJIA 1R0AH 2CKNA 2Q6WB 4BK4A 4BQCA 5D7LE 3JZ7A 5FM5O 3C08H 3MLUH 1RIHH 4W4OC 4GMTH 3ESUF 2VN7A 3LV3B 4PREA 2BNUB 2UWEA 4K07A 2I9LB 3MROA 4BSJA 2OYPA 4HZLA 1P7HL 1KJ2B 3AVEA 3MRQA 1U93A 5LAXA 3T77A 1XGYH 3QHFH 4OGXL 2GTZA 1Z3GL 5EUKA 4ODHL 2O5YL 2PW1A 2VLLB 3QEUB 3RIAK 5HD8D 1Z6JT 4XPBL 3QPXL 1F58L 3BKMH 5KVMC 3V4UL 1S7TA 5E00B 3MA9H 1VGEL 3NCYP 2LVEA 4ODBD 4YQXL 3IU4H 3REWB 3DMMB 4OCNC 3KPPB 3WJJC 4JN2B 3OJVC 1F4HA 3STZB 2IBZX 3CZFA 5FDWA 1UZ8A 4XVUD 4LVHB 4YBQC 4M43H 1X4YA 4Y4FC 4L4TA 3HI6H 4PRHD 1QTYT 3S4SG 4KY1H 1FP5A 4M6AA 4UTBH 4Y1AE 3OAZK 3EIFA 1FIGL 4KUCD 2FLBT 4PG2A 4LHUA 5E94B 5HHNB 1I1YB 3GO1H 1OGTB 1XR9B 4X6FA 3ZSSA 3SCMA 1KXVC 1EJ6A 5K59F 4G43A 2WIIA 3ULUF 3C60C 4YJZL 1E4KA 4Q9RL 3MXWL 1ZLWH 5DS8B 3B3IA 1K8DA 5EORH 1VCAA 3HRPA 3JV6A 5JW4R 3H8NA 4XXDA 4U6TA 2EE6A 3ARTA 4PJ7B 3IF1B 5HYJE 2RHEA 3TC9A 4HUUB 1ZVHA 1D5ZB 5ILTL 1DSFL 1A3LL 4JFEA 1PZ5B 1B0WA 4J1UA 4G3YH 1MCRA 2IADA 4OI8A 4JFQB 3IDYB 1FE8L 4XAWH 5E5MA 5CD5D 2EICA 2OLDA 3QISA 4K8RC 4YHIB 1UWEL 2NR6C 4QHNB 2RQ8A 3C5JA 5DJCB 1B4RA 5CKAA 3FOLB 5E8EA 4X6DE 3BE1H 4S1SL 3P2TA 1FC2D 1CFTB 4XB7A 5EZOH 3U6RA 2OCFD 2CGRH 4ZAKB 3PHOB 3O81A 1XF4A 2V5MA 4O02L 1JN6A 3U0TA 3TCXA 4MDJB 3DVIA 2PTTB 2FH6A 2XZCH 1LP9B 1QSFB 4ODUB 1A7QH 3TCLA 3K46A 5MENE 2X4RA 5I74B 2MHAA 1MFAL 4RGOL 1JTOA 2FX8L 5DRXA 4X5LA 3LZFL 1NUGA 1DBBL 4LHJB 5L88L 3IXTA 1JZ5A 2FRGP 3NPZB 3HZYB 3O3DB 4NN5C 4C57C 4G9FA 3WKNA 2XPGA 1GVIA 1R5VB 3GGWB 3DUSA 3PQYD 5HHQB 1RAMA 3V5KB 1FFOA 1U36A 5C6TH 1AP2B 4KUZL 3RZCB 2RB8A 3LEYH 3HB3C 5K59E 2ZWLT 1QRNE 3MMEA 4I9WD 5FA3B 3ZKND 2ADGB 4AIXA 4ZTOH 4XNZB 4NQXA 3IB4A 3DVFA 1X5KA 2C7UB 3CX5J 5CEZH 4EN3C 3KHQA 2O26U 3OKKB 4MB3A 3QSKB 3QNZA 3SDAD 1M7DB 5EB9A 3UTOA 4TSBH 3SDCB 2I07A 3DTXA 3I6KA 5F89A 2YPLA 4ZSOA 3Q6GL 4HS8H 3ARZA 4J12A 1Z0NA 2Z4QB 2F5AL 4KC3B 5HI4C 5F70A 4TULH 1CS6A 3L5IA 4D9QD 4YO0B 3L3OA 2NLJB 5L8KB 3MV9E 4L8DA 2FYYA 1XGQB 2VWEC 3OAYH 3G08B 4JG1L 4K71C 5DR5H 2ENSA 1YZZA 2HT2D 1XIWC 4LFHD 4B7IA 5FAAA 5C09B 1CFSB 1TVBA 2ZOKB 1FLRH 3I9GL 4XH2B 1WJ3A 3QIWC 2QV2A 4OCWL 1OAYH 2FBJL 5D7SL 1ZHNB 3NZHL 5EU7C 5GHWL 5EWIH 3CK0H 1I1AD 4X99B 4M7KH 3BRFA 4GLRH 2BVTA 3O8XA 4L4VE 5B38A 3VMOA 2DI8A 3C6LC 1MAKA 2QADD 4P2OA 5I30L 3VFMA 3EO9H 3KR3H 3TIDA 4P9HC 1OT2A 1BFVH 4LVEA 1IT9L 4I8DA 3LDBB 5SWZD 1P2CA 4M3KB 3EW3B 2JELL 1K3IA 4X6BA 3OG6B 2VJXA 2XZZA 1J18A 1MFEH 3RBGA 3EDKA 1ZT7B 3VGHA 4JAMB 1Q1JL 3MYJA 1G6VK 4TUKL 4XNUH 4G5ZL 3QEQB 3S97C 3PWVA 5FYKU 3PWPB 3UAJC 3B9KA 5JOPE 4N68A 4Q0XL 5C08E 2IALA 1SVCP 1CICD 2QEJA 4LF3A 1AGDA 3AROA 3MRIA 1T21A 3WIIL 2P49B 2P8PB 5GSVA 3B2UC 2J8UB 4ZUWB 1S7XA 3ES6B 4R26L 3VFGH 1N6UA 1D5IL 5IB3A 2VC2L 5TH2B 4FTVE 4NNYA 1HH9A 2HYMA 5C6PB 1A6ZB 2X1OA 1RY7B 4M93B 1XF5B 1HKLH 4X5WB 4UOJA 1HHIB 2P7TB 2J4WL 3DRTA 4PRHA 2W0FB 1WAAE 1G9MH 4RRPG 1DQJA 1X5LA 4Z7VE 5GGVY 3BT2H 4UT7L 4GMSH 4PJEE 5F7KC 3MJ8B 4XNQA 3NAAH 1KGCE 1AE6L 4MAUL 4JRYE 3NH7H 1U8KA 3DURA 3GIVB 4PRPD 4HUKB 1T89C 1NC4D 3ZTNL 2WNGA 2R0ZH 4L29A 5SV3A 1I3RB 2ILLA 2YUZA 1A6UL 3MRFB 3VWKB 3VI4E 5T1DL 3NGBB 5EO1B 1QLRB 4AK1A 4NHUB 1ZHBA 2CMRH 3EOTH 4P2RD 1I8KA 2VDLH 3EYFB 2Q76B 2OQJB 4WY7L 1FO0B 2PO6C 3SE8L 3ULSA 3U0PB 4UUJA 5C0CB 1TJGL 4UILH 1TZHB 5IM7A 4RZCA 5SX4H 1T03L 2ADIA 1RZ7L 3PGFH 5ICYA 1CL7L 1AXSB 4XVTL 4LPTA 3FFCB 1F4WL 3C9NA 2GJJA 1UA6L 4Y19D 3TF7C 5IB2B 4PJAF 3KPSA 4JPKL 1CGVA 1T5WA 3BZ4B 2JJUA 1R0AL 2NYYD 5TFSH 4LAJH 4LHQB 1BQLH 1U41A 1GOHA 4I0KA 3C08L 4GMTL 2DS4A 1V3JA 1JYWA 2OS7A 2IBBA 5CZXD 4EZMA 5FUCE 3ZKSD 4CBPA 4OV6F 2HLAB 3RY6A 5LKNA 1XGYL 2ERJC 4YHKL 4PGBB 2KH2B 1J0HA 1U2HA 1GGCL 4P0DA 2WBJA 5CCKL 1MJ8L 4CVZB 3VXNB 1IGYB 4DOHE 1K9TA 3MA9L 3VD7A 3IU4L 5HDLA 4U1MB 5E0QA 3GRWH 1HILB 3PQYA 5KN5B 1XGUA 1G1CA 4CN1A 1FL6A 5I75C 4JZJC 4JQVA 1X6NA 2VZSA 1IM9D 2DQHH 5F1IB 4WWKD 2IANA 3LQMA 4JFDE 4MX7B 5D93C 2CH8A 4OZFH 2W59A 3V6FA 1AFVL 3MRGA 5T1LA 2Z9TA 1EHXA 3JVGC 5DMIH 4AM0A 1RUPH 3ARBB 5KVFH 3SDAA 4H1LG 5IF0A 5JHDE 4IRJD 5TE7H 4OGZA 5D96C 4HMEA 5KANG 3GI9L 2NX5D 5I2IA 3WUWA 3J7HA 5SWSB 1WIOA 5BJTA 2CUHA 1HEZA 4GAJH 2YWYA 4PJAE 1BBDH 4ETYA 5J11C 3VWJB 5E8OA 3BAEH 3NIDF 4NNXB 3TA3C 5BRZD 1NMBL 4NUJA 3VFWA 3KS0H 4ACPA 1NFIA 2HJFB 1K4DB 3DVGA 3E2HB 5JW4Q 4ZS6D 4ZPVA 3WS6C 2KDGA 3SDDB 3O9WB 2EDYA 3VGBA 2IGFL 1MAMH 3NPSB 4PJ9D 3NFNA 2OMNA 2OZ4H 4Z7QF 5SWZA 2UWEE 5DJXA 3HC4H 5H94B 4N90E 3F5WA 5JNYA 3BZEA 4EI5D 2VE6B 4U05A 4NRYA 5CKGA 5DUBB 4CRPA 5EZOL 3KPQB 4GKNB 4DKDC 3QDJD 4Z5RB 1AXIB 2QKIB 4EQ2A 1E4XI 1YEKH 2IAMD 4PRIB 3QO1B 2NY4D 3MRNA 3QUMH 2XZCL 5LBSL 4AYFA 2R0KH 2GJ6D 5K33A 4PJBB 3CVIL 4I48A 2JK5B 4MWFB 1EX0A 4R3SB 3D0VB 3DMMC 1S5HB 3MLVL 4OQTH 5AZ2H 4CW1B 4F7TB 1S7SA 5D7KE 1HQ4A 4L4TE 2BY0A 4LLWB 4PFEA 4RQQB 1J9CT 4PJ8B 5DHVB 4PY8I 5KVDL 1KN4H 2B2XL 4MMZC 5C0AD 3UYPA 4PP1D 1OF2A 5EOQH 2DRUA 1D5XA 3I6LE 3HG1D 4HBCH 4L5FH 3RY5A 1T83A 4NO3B 1MRFL 4WU7B 4G6JL 5IHLB 3DJ9A 2Q8BL 1KEGH 3NA4A 1HDMB 2ZG1A 4IDJH 2WIMA 1MVFA 3AAZA 3SE3C 4TSBL 3MUZ1 3LKNA 1C16A 1RI8A 3R06B 2QSCH 1NC4A 4V2CB 5KBNC 3DHJA 1EHAA 4HXAH 1YNTA 1EZVY 2NY6B 4WI4A 4JHAL 4M9PA 2GIYA 2C4FU 1AY1H 1Q9OA 3QCTL 1IGJA 1S5IH 3TPUB 1F90H 3QCVH 4P2RA 4TN9A 5DR5L 4JFEE 3FCTA 2Y5TA 4Z7QE 1H15A 1P69B 1FLRL 4GKSB 5DRNA 1EUUA 2GSIB 1U8QA 4PTUB 4JFZL 1MFBL 1I7ZA 1PX4A 5HBBA 5D1XB 1U8PA 4P3DA 5I8CA 1OD9A 3CDGB 3SKNA 2FJFA 2H8PB 4Y19A 3TH3T 2ZKHL 5JR1H 3ARYA 4R2GD 4DAGH 3U79A 3WUZA 4LDEB 4I13B 3X14A 3BO8A 4N5ED 5TE4H 3PL6B 3QRGH 1L0YA 1EBAA 4DGIH 5BW7C 3RA7L 4TVPH 5CFHA 1KLGB 1KN2L 4X9FA 1VFUA 1I4FA 3MACL 1JWMB 5IHZB 3VDCA 1CT8B 1IC4H 1OAZH 5ESVA 4XNUL 1FCGA 3SBWA 3BESR 1W0YT 3GNMH 3QA3B 1TJHH 4G9FE 3T2OA 4HFWB 5GGRB 4PJXF 5CP3H 4GQ9L 5I16B 1BX2A 1JMZA 3MR9B 4LCIL 2VZOA 5T1MA 3IKCA 1ONQA 5FCSH 2N4IA 4H8WL 3RZCC 2NW3B 1QFOA 2E27L 1EHNA 3NN8A 2Y23A 1X5ZA 2XQBH 3X13B 5JIIA 1J5OL 3UZVB 1S7WA 4W4NA 1IM9A 4XNZC 2HJLB 5IUSA 4WWKA 3WNPA 2YKLL 1SM3H 4OZFA 1MUJA 5HDBE 5HYJB 4WHTA 1P4BH 4X6CF 4HMDA 5D1QC 1IAIM 5GRZA 2BVYA 2YPLE 4ZSOE 3FQRB 4GMSL 3MRHA 3SGDI 1K5NB 2HVKB 4O2CB 1JVKA 3RZWA 5DURB 4IRJA 2H41A 4P49A 2ZJSL 3FN9A 3OHXA 1BJ1J 2GUOA 2YA0A 4G80B 5TF1L 2LU3A 4M00A 4ZQKB 2NX5A 4LPCA 2BHUA 4ZS7L 2H2PC 4ZUVA 4NQSB 4X6DB 1BLNA 3CJJA 4KUCF 4NT6A 2W65A 3V4VL 4S11A 3THMH 1B4JH 1KPRB 3QXVA 1XF1A 3EYSL 5BRZA 4EUPH 1FL3A 2XTJC 5E9DD 5IK3B 1DDHB 4P5KA 4POUB 4PBVC 5F7LB 5EU5A 1PBYA 4QRUA 4FXKA 4UILL 3P4OB 1CLOL 4WGVB 1AO7D 3UTZA 1JPTH 3PGFL 5I71C 2NY2D 5DSCA 5GZOC 2AXJA 3VGFA 5E7FA 3MNZB 5ITFA 4TPRH 3PABA 3LDBC 3ARFC 3RGVC 4PJ9A 5F7EH 2OZ4A 1ADQA 1C5CH 1SJEB 4M1DL 2VZVA 4WW2B 3GMMB 3KPLA 2VOTA 5FHBH 4M7ZB 1G9NC 2DWDB 2HLFC 4KH2A 1EJOH 4Z7WF 4TRPH 1EVUA 5J6GB 1C5DB 4DFIA 5E99L 3QDJA 3L3DB 2GJZB 2IAMA 2DF3A 3T4YB 1ETZB 3C5SB 1OT1A 3D85B 2GJ6A 3LPWA 4ZUSA 1TIUA 1JV5A 4N0CD 3WIHH 4Q9QH 3QZWB 1GGTA 2BVQB 4BZYA 5E8NA 1KULA 1OCWL 5GRUL 1VDGA 3GSWA 3IXAA 5BXFB 2BERA 1RURH 3WNKA 1S9VA 1Q9KB 3D2UD 4M61B 4FG6D 4M93C 3BXNA 4PRHE 1NDMB 3MV9B 3O0RH 3WBDA 2DQHL 3ULVH 3HG1A 4JFFD 5HGGS 1RUKL 1YPZA 2AXFA 3ARGD 2ESVD 1MCEA 1T0MB 3VXSD 1NFDA 1LEKB 3UTQB 3Q2CA 1GHFH 2AV1A 4CMHC 2A77L 3FQTA 5K9QI 3S37X 5LQBL 1YEEL 1WT5C 2CLZB 5TE7L 1F3JB 2ITDB 4DUXA 1RK0B 4FQXD 3HCVB 1ZVYA 3LN4A 4Y5YC 1NGXB 1MWAB 4YE4H 5IIEB 3WLBB 4NNPH 2UV3A 4MD5B 3T0AA 4GAJL 5JA8B 3MFFB 1UM5H 3S37H 5I6XC 2PETA 3EDJA 5A2FA 3BAEL 3GIZL 5EBWB 5ETUA 4ONHA 4ZFFA 5IESH 3BPCA 3QH3A 4FQHB 3T2PA 5MP6L 1CFQB 5LGHH 32C2A 3LRGA 4PY7B 4G6AD 5ID1B 5EA0H 3KPSE 2OTWA 4IMKC 5JPMB 4AT6A 1ES0A 4UNUA 5BCAA 3KYAA 5DJZA 1NGQH 2NY0C 4QF1B 1DBMH 4L9LC 2O61B 1MQKH 3BKYH 1ADQL 1I8MB 4XPAL 2YRLA 3TV3H 4RMRA 4FTVB 1D6VL 3CFCH 3WHE0 4KMLB 1N3NA 2MQCA 1U3YA 3TO4A 3MCKA 4P3CL 1MELA 3TNMB 5T5FL 4OZ4B 4RA0C 3HZVB 4G8GD 5FECA 5CEYA 1CIUA 4Z7VB 3O6FD 1N2RB 4PRNA 3W2DH 3LB6D 3DRQB 3UJJH 1GPOL 4PJEB 3VFTB 4U3HA 1B2WH 4BFEA 3PQYE 5JXAH 4JRYB 4JQIL 5H2BA 3RDTA 1DVFD 1HYSD 1ZMYA 3M1BB 2IANE 3L3HB 4NO0D 3S5LA 3AB0C 4KZEH 1F3DJ 4HWBA 4KVNL 2V6HA 4F9LA 4JLRA 1H3TA 5F7MC 5C0GB 4ZDHB 3QNYA 4M8VA 2RGSA 3T3MF 4AJ0A 5EOQL 3U30B 4HBCL 1CDIA 1G7QB 5J3HC 4NFDA 3BW9B 3R4DA 2G9HA 5GGSY 2EE9A 3ARBC 4KAQH 4P59H 1KEGL 3QIBC 1HHJA 1B3JA 2IG2L 2A0LC 3FB8A 1P5VA 1TDQA 1UVQB 3BGFB 3ABZA 4U1IB 3NACH 4D9QE 3BPOC 4ZPTA 1OAQH 1HINH 4MA1B 3MOAL 4FABH 3M07A 3RPIA 4D0BB 2YD8A 3V4PH 4TOYH 5BV7H 2D7MA 3TFKD 3MRKA 4POZC 4XCEA 5KSVB 1J05A 4LCUB 3VWJC 3FQXA 1RJLA 3WFHB 1N5YH 5HJ3B 4W6WB 3QCVL 2YSSA 5CINL 4RFOH 4KRMB 1EVTC 4EUPA 1URLA 5ISZD 1JZ7A 4RX4A 3SJVA 4LCWD 4P23D 4LCCA 4NPYA 4JPWL 4Q58C 4XMPL 1W0WB 1BAFH 1C12A 3SDDC 1AO7A 4JFPA 1X4ZA 3BEVA 4YGVA 4XP6H 5SWZE 4NKQB 3PG2A 3MA7B 3RU8H 5ITBH 5AAWA 5GGTA 3L5HA 4DOHB 1XGRB 2YD4A 3C6SA 2W9DH 3HNSL 1EPFA 2XRAL 3ORJA 1WBZA 4X0KB 3FFDB 3B9AA 4QTHB 5TE4L 3QRGL 5MEOB 4N9GB 2FJGB 1MH5A 1NKRA 4WUUD 2W0LA 4I2XA 3QEGH 1UCBL 3CU7A 3OKDB 4RAUB 1QEWA 4NHCL 1IC4L 2YA1A 3QDMD 2R0LL 4PJCA 5I1CH 3TZVB 1DEDA 1TJHL 3H9SB 4Z95L 4XX1G 4RISH 3T3ME 3WIHA 4HWNA 3BJ91 1IBGH 5JHDB 3WFBH 3FRUB 4IOSD 1KSRA 2Q20A 2KPNA 4QRSA 2DQIH 5CHNB 5E2UH 1RIVL 2NY3D 5TQ2L 2W9EH 2X7LA 3D2UA 4TQEL 4HWBL 5D7IF 4M5YL 4PD4K 4DTGH 5K9OB 3FO0L 3F7RA 1MCPH 2IH3B 4AENB 4LLAA 1FVCB 1FGVL 2PXYC 1QFWM 1EAJA 3KYNB 4JFFA 2P4AB 3OJDB 3L5WB 3VD4A 3ARGA 2ESVA 2DD8H 1AR1C 3VXSA 4KHTL 4K23H 4MA7L 4GXUN 3E6FB 1YNKH 5I1JL 4OCYH 2NY6C 4OZIF 1IZJA 1JHKH 1T3FA 1DANU 4HXBL 5JXED 1XZ0B 4FQXA 4P2RE 3W9EA 1BEYL 2UWEB 1GZQA 3D5OF 3MROB 2FEDC 1KG0B 3MNVB 4JO3L 4X9GA 1U93B 5LAXB 3THML 3T77B 4MJID 1R6VA 4NWUH 3L3IB 1MLCA 4OLXH 2GTZB 1CYGA 5D7JD 2J12B 4R0LA 2PW1B 5FKPB 1KCUH 2XV6B 1WFUA 1YN7A 4YXHH 5D1XC 1S7TB 4Y19E 2Y36L 1LEGB 2HRPH 4KTDH 4AIOA 1JPTL 3KJ6H 1AHWA 1PG7W 4V2BA 4GRWH 5GGTL 4TPRL 3RVXD 4LBEB 5DMJB 2N7BA 3CZFB 1C5CL 4NKOA 1WTGT 5FDWB 1UZ8B 4N1HB 3HUJA 5GGVL 2Q3AA 3OR6B 1WWBX 4NRZB 3CLFH 3IDGA 4TRPL 2ATPB 4I3SL 2J6EH 5D5MA 1G9EA 4FQIH 3KDMA 4Q6IA 3O6FA 2RJMA 2EZ0D 1A0QL 1EBPA 1N6QH 1HSBB 3ZDYE 4G43B 2WIIB 3WIHL 4FFZH 4IBLT 1M7IB 1N64H 4NZTH 4LSSH 5E08H 5GIRA 1A6AB 4JFYB 1U58A 3TYGH 3JV6B 1DVFA 5DD6A 3AGVA 3VFPA 1YMHA 3MV7D 4NO0A 5CJ8A 2UYLA 1KBGH 1A6WL 4JHZA 1OAKH 1HE7A 4HKJB 3MZTA 1CR9H 4ALAH 3HAEA 1Q94A 4R6UA 4JFEB 2P42B 5DJAB 1R5IA 2YMXL 3OQ3B 4J1UB 4I1NB 3VRLE 1GGBH 2X4SA 4QHLB 4K7PL 2P8LA 3U9UA 3HN3A 4U1LB 5E5MB 1B6DA 3JWDH 5IR1A 1DBAH 1FN4A 3LEVH 2NX5E 5E8EB 3V0VA 4F3FA 4N9OB 4HC1H 1U8HA 1YPZF 3GJEA 3N50A 4ONFL 5FV2A 1XF4B 3D3VD 5BRZE 1MCSA 3UEZA 1IGTA 4KJWC 3RI5F 3U0TB 1MFNA 2R0WL 4NNPL 3W0WD 3IFLH 3UPCA 5HI5C 3S37L 1TJIL 4PGJA 4IJ3B 1QBLL 4CJ0A 4MQXD 4HIIA 2MHAB 5DRXB 1FRGH 4LCWA 4XPTL 5LGHL 1KIQA 2O5ZL 4PUBH 5E5UB 4P23A 3IXTB 5CJBA 2GTWB 3MGTA 5EIVA 4BH8A 1NSNH 4G9FB 2B4CC 2XPGB 4JY4A 2Z31C 1Q9WA 1JGUL 3T2QA 4MXQC 1F8TH 1FFOB 2WP3O 1ZVSA 5EZJA 5AG9A 1NGQL 3LKSB 4OV5A 4WW2C 1DBML 3UJTL 3CMOL 5C0JA 2B20A 3QDJE 3TV3L 1YQVH 3WD5H 1F6LL 3DI2B 3ARDC 1OAUL 2AEQH 4H26A 4NYLA 4PR5B 3CIQA 2GJ6E 3P40A 5D2NA 3BVNA 4OAWA 3L3JA 3QJFB 4WUUA 1WWWX 1BQUA 3QNZB 3TJEH 2AV7A 4YBQD 2V5YA 3H7BA 2I07B 4Y4FD 3DTXB 3QDMA 5F89B 2YPLB 2P47B 4JM4L 3DX7B 3TJHC 3UYOD 5C92A 2X10A 3W2DL 3UJJL 1T7ZA 4F8QA 3QWOA 4WJ5A 4HWUA 4Y2DC 5CGMA 2ICWA 3L3OB 2H45A 5ECJE 1VPOH 4G8EB 1A7BA 5FYJD 5FYJH 3UC0H 2R1XB 2NCMA 3AREA 5E8PB 4TSCH 5C0DB 1XCTA 1MIMH 3C60D 1LEIA 3HG1E 2VXUH 1TVBB 4LMQE 3QXWA 1YPZE 1NCWH 5C07B 4GS7B 1CBVH 2FIKA 1NFDE 3N06B 3T04D 1RZIB 2QSQA 3P77A 3U4EB 2OSLB 3Q1SH 4H0HB 3O8XB 3GSXB 5B38B 4KROC 1UJ3C 2H2SC 3T08A 3VFMB 2BSSB 3TIDB 1HHGA 5F9DC 1YQ2A 1YJDC 4EOWL 3FQWA 1FNLA 2AJXH 4NC1E 1P2CB 2MKLC 5EO0B 4WDIA 3S7GA 5FYLH 4FMKA 1Y6KR 5I73B 1C5BH 5DQ9A 4FABL 5EBLA 5DD0H 4K8RD 2HKFH 2NR6D 3TO2A 3V0WL 2LU4A 1JPGB 4RGNB 4ISVA 5GXBB 1KTLA 1H5BA 3QUXC 4WRLA 4QRRD 4MJIA 5HYEA 2K7PA 2F5BH 5D7JA 1SY6A 1IC1A 1IGFH 4WNQA 3MC0A 1GH7A 1FV1B 3V6BR 3GMOA 1PY4A 2IALB 2VDPH 3S4SA 2XWBA 4Z7NF 1BAFL 1XT5A 1AGDB 3MRIB 1NUDA 4XP6L 2DTMH 1INQA 1S7XB 4U7MA 1ZHKA 3SQOL 3C2SA 2R56L 1HH9B 2DKUA 3DI3B 1AJ7H 5LVEA 3L7EB 4ESKA 1CDBA 3VG0H 3T4AB 3FRPA 1IFHH 3DRTB 4PRHB 1A8JH 4NQVA 4PRAB 4TTDC 1DQJB 2JB5L 2J6EA 5IOPA 2JCCA 1FNAA 2MQ0A 4XNQB 4N5UA 5C9KA 1WUNT 2XA8H 3F65A 4GG8B 5KSUB 4ZOCA 4MD0A 2VXTL 1UFUA 4A6YB 4FS0A 4WCYL 4EN3D 5DQDH 4RISL 4JREB 4KKBC 4L29B 5I8OH 1K8IA 2H26A 1MCWM 1K4CA 1F4XH 2V7HA 4QGYA 1ZHBB 4N1CA 3EFDH 1T2JA 1I8KB 3MV7A 3VXMD 4P48A 1JZ4A 5HI4D 3WFCH 2J8HA 3ULSB 3V6OA 2XIDA 1MCPL 3AUVA 1BQHA 5IM7B 4QHUB 4OKVA 1X44A 2X41A 2FO4B 3BWUC 2AJZB 1XIWD 5ICYB 1FZOB 4IRZH 3JWOL 2J5LC 3C9NB 4FQ2L 3QIWD 3QZWG 3QQ9C 3BJLA 3OBAA 3RIAF 4HG4K 3RBSA 5F71A 3OL2A 5T5NF 3ULVF 1DE4B 4MA1C 2WAHA 4NBZB 4APQC 1KYOJ 4JPIB 1JZ6A 1JHKL 3MLZH 4QOKD 3C6LD 1MPAL 4QKXB 2VYRE 3OKLB 3D3VA 1KFAH 4IRSC 2APFA 1OARH 2E7LC 3JTSA 3O3EA 3SJVE 3W0WA 2CK0H 5C7XH 4W4OA 3HPJA 1AO7E 1SY6L 3IDIA 1KCUL 1ODAA 5IG7A 4M7JH 5JQHC 2VAJA 1AI1L 4BH7A 1FNSL 4YXHL 5J12B 4KTDL 1MHHB 4WFGD 3FONA 3MUHL 4NUGH 3KS0J 4H1LH 4G6KL 4HJGA 4X5XA 4GAFB 4P46D 3I02A 1EH9A 2DTSA 3B2UD 3C2AL 4I2XE 5I18H 3LKOA 3V6FB 3VXRA 3WJJA 2DM3A 1EHLH 4JPVH 1DBJH 4M6MH 4PJCE 1U91A 3MLXH 4AM0B 4A2LA 1RK1A 4ZTPL 4CJ1A 2G5BA 5DLML 4UOW0 3SDAB 3HUJF 3VDBA 1ZKAA 5IF0B 2P44B 1H8SA 4Y4FA 4AMKL 4FQIL 4H25A 2R1WA 4HDIA 4XTRC 2PYED 1KIRA 3DWTA 1N6QL 1EIBA 2WQRA 4E5XA 3L3KA 4HUNB 1CDHA 4FFZL 5INCA 1LO3L 3WUWB 1W2KT 4NZTL 4LSSL 2V2WA 5D5MF 2MTPA 5DYOA 3EUUA 3M8OH 3K0WA 3TYGL 2BVOA 3DX9A 1HEZB 2JLLA 1MCWW 4O5LL 3INUH 4M3JA 3RWFA 2WWKT 3LKQA 3C60A 1J1XH 4JFFE 4JB9L 5C0IA 2ZUQB 5FEBA 4NUJB 4JM2C 2ESVE 1CR9L 4ALAL 4NRXA 15C8H 3VXSE 3ARQA 1JNNL 3DX6A 4C56D 2MCPL 4HT1H 3O41B 1I1AB 4IIQC 1I3GL 3X11A 2J3SA 2PO6D 5CAYB 1CGSH 2QADB 4AEIH 2HFFA 3EOAA 1DBAL 1QZ1A 3NFNB 3LEVL 2E7BA 2D9QB 5SWZB 3T1FB 2ATKA 3C09B 3F5WB 2B39A 2WQ8A 1KJ3H 1S7QB 1UYWL 4FZEH 5F3HB 3GJFA 4DW2H 1A7RH 1KEML 1P9MC 4HIXH 2VDNL 1P7QA 1L7IH 4GG6A 5JDSA 4RIRA 3MJ9A 5SWQA 3IFLL 4QRRA 2A6IA 4GJTB 1T4KB 5L2JA 1JI1A 3WEXA 1PG7X 2GK0B 1E27A 1CICB 2BSTA 3T3PF 3X12B 1NSNL 3HI5L 3GSRB 3RAJL 3HUJE 5K9KA 4OGAC 3V95A 1T1XA 1HQ4B 2OI9B 4LP4A 4XNYL 2YPKB 1PG7H 4H20H 1IEAB 1FZMB 3UPRA 3B8SA 3WD5L 2DLEA 3WFZA 1D5XB 1KXQE 5D5ME 4JN1L 4TNVK 5I15L 2EDFA 2HAZA 2YD6A 3BMVA 1RZGA 4FFYH 5CILL 1V7NL 1I8LA 3AAZB 3LKNB 1C16B 3X3FH 4PRPB 1NC4B 1YNTB 2FNBA 4EN3A 5DGQA 1Y0LA 3BRGC 1N5AA 5DD5H 2HH0L 4P4KC 3WN5B 3B2VH 1FL5A 1Q9OB 1N0XH 3K2UL 1Y6NR 4URTB 1MOEA 3W11C 3V79C 1HCFX 4ZO9A 5FYJL 3BGMA 1MREH 3UC0L 1KB5H 3FCTB 3VXMA 4QCIA 3NCEB 1MIML 1H15B 4XNMB 5KVGH 5DRNB 1NCWL 3HE7C 5E6ID 1A6TA 1JUFA 3K7UA 2P5WA 5EOTB 1U8QB 5HGAA 2ZCKH 3TH2T 4LPVA 1KCSH 1I7ZB 4RWHA 1XIWA 4WI3A 1U8PB 4P3DB 4P2YA 1TVHA 4IMLA 2EEAA 1DBKL 1QLFB 4I0PC 3TN0A 2FJFB 4Y19B 2R1YB 1I9RH 3SGEI 4MS8D 4NZUL 1IAIL 2AJXL 2ICEA 3X14B 4HUVA 2CIIA 1KCLA 3C6LA 5DD0L 3HZMB 4G6MH 4K8RL 2IPUG 1AQKH 2Y5EA 2P48B 2DL2A 3HS0A 1MHEA 4JFHD 4LCWE 3LKRB 2L0DA 5ESVB 3MJ9L 43C9A 2YPVH 4MLSA 3VFSA 1IGFL 1KJ2H 1OY3B 4MLIA 1QBBA 3IETA 4B5EA 3OKYA 1AGFA 3TBWA 5EU3A 1BX2B 3ZHDA 1H8OA 2APBA 1LO5B 5CGTA 3DECA 3IKCB 4UIMA 1C08A 5DC4B 1KCRH 3NN8B 4Z0XA 4RFNC 1AGCA 2YEZA 1S7WB 2M2DA 4OUUA 1IM9B 4WWKB 1F4YL 5D2NE 5JW3H 4OB5H 1MUJB 4WUUE 3WIFA 4YDJA 1IFHL 1L9MA 2IPKA 2E7HA 3MRRB 3UX9B 4X7SH 1QLEH 1WITA 3QDME 3VH8B 4M8QA 5HVWA 3MRHB 1D6EB 1T5XA 2AJSH 5DEZA 4FNLL 3DROA 4HJ0C 3UJIL 4IRJB 2GT9B 1EGJA 1HH6A 4R7NA 5IFJA 2GUOB 4UT9L 1GCFA 3MLYH 5DQDL 1N7ML 2NX5B 1PKOA 2JCCF 4HPYL 4ZUVB 5I8OL 1BLNB 1A22B 3D18B 3VXOA 3FB7A 1YYLH 1OGAD 3SEPA 1F4XL 1NLDH 1FG2A 1T89A 1LQSR 5I9QC 1HHHA 2DN7A 2WV3A 4L3CA 5KTEH 3S9DB 5C2UB 1FL3B 3L5XL 4AG4L 3VXQA 1HXYA 2DMCA 5BOPA 2ICCA 4QRUB 4C56A 3VG9B 5EFIA 3U36A 4MXVF 4JFXA 4LHUG 4P5MA 3GBNL 3OPZL 3UTZB 1HWGB 2AJVH 3D39D 4K9EC 3WXVH 5DSCB 2PO6A 4KJYA 2VL5A 5ITFB 2PCPB 5FYKD 3PABB 4ODVL 4JCMA 3BKCH 4HFUH 1YA5A 4FXGA 4L1HA 3PGCA 1ORQB 3PP3H 1DQMH 4G7YL 3KPLB 3QFDB 4EI5B 2V2TB 4YHNA 4RGNC 2XNAA 3IRPX 3MZGB 4MJIE 3BZFA 4P9HL 3GBMH 3IDMA 3LQZA 2IAMB 2NY4B 3WV0A 3GMLA 3IDNB 3D9AH 2CK0L 1QG3A 2NMSA 3GBLA 2GJ6B 1ZLVK 4DVBB 5DMKA 4OFIA 4ZUSB 4BSWA 5E4IA 3T65A 3F7YA 3WYRA 3HLAA 3QUKB 2EXYD 1LD9B 4NSKA 1NAMB 4HJJH 5E8NB 2JJTC 3IXAB 3OF6D 4QT5A 1I75A 2D0HA 4JY6A 1S9VB 3MJ7A 3K4DA 3HI1B 4Y5VA 2DDQL 3BXNB 3VMPA 5J4MA 3D87B 4DKEH 3LN5A 3T0BA 2D7TL 5CJQH 1PLGL 2JCCE 5C0AB 5I18L 2IC2A 3HG1B 2VXVL 1IRAY 1FH5L 4Z7UA 4JZJA 2DM2A 1DBJL 3KLSA 2BSED 1NFDB 5F88A 2AV1B 3FQTB 2EC9T 2GI7A 5D1QD 1OLZA 4PJHF 1OB1B 2H1PL 3G04B 1EGJL 3JVGA 4MXVE 2EXWC 3MV7E 3LN4B 3QQ4A 7FABH 1QHPA 4P2CG 5MI0B 3V6OE 3VMNA 3ARVA 4WTWA 2EIZA 1KB5A 1WFNA 3FJTA 1PX3A 4PJFF 5C9JA 2H2PD 2KBGA 4ONHB 3V8CA 3BPCB 3H0TA 3E6HA 4JY5H 4LLQB 5I8EB 3HC0A 3TYFB 5C09D 2ADFH 3V5DB 3U7YH 3TA3A 3O2VL 1BWWA 4HQQH 3B5TA 4L8CB 3G5YB 2XTJD 2OM5A 5DJZB 4U6HB 5GSRB 1UWXK 4OCRH 3FO2A 4R2GB 4HK3J 3WS6A 3ZKMC 3D3VE 5GZOD 2HG5A 3W0WE 3FN0L 3LQAH 5EU6D 3ARFD 1N3NB 3RGVD 5GS0H 4DW2L 1DQLH 5D6DC 1OVZA 1TFHA 1BFOB 2CJUH 2BY3A 1FVEA 5LWYH 5FECB 5CEYB 2HLFD 4PRNB 5B38G 1QQDB 2LTQB 2QLVB 3N9GH 1K2DA 3PDOA 5IWLC 1RZKH 3HTLX 3K4ZA 4YFEA 1QOKA 2P24A 1FORH 2IPUK 5I1KH 3UZEA 2AW2A 1JNLL 4KQ3L 2WINB 3VGDA 4DUWA 5JHLH 3P9WB 1KCVH 4JLRB 3VXRE 3QAZB 1VFBB 2EC8A 2X89D 1CFBA 2BNRD 3DMMA 2R9HC 1JZ2A 4L3ED 2LABA 2NTFB 4JN2A 1RUMH 2QQKH 3BPNB 2FX7L 2VL4A 3CCHB 1M6OA 4MAYB 1X3DA 2MFNA 3BH8B 3CC5A 1HHJB 5JOEA 1Q0XH 3FB8B 4QRTB 2QQNH 2G60L 2PKDA 1SJHA 1E6OH 3MRPB 4X9BA 1RZFH 4RWYH 3X3FL 4ZPTB 4JCLA 3BUTA 3KVQA 1ZLSH 2C5DC 2VTFA 5FYJE 3TNNA 1G6RB 3IFOA 5E94A 5HHNA 4XCEB 2WK2A 1I1YA 3B2VL 1OGTA 4JVPA 3SE3A 4E41D 1T20A 1ZAGA 4KRPD 1JGEA 1RJLB 4NWTL 5IROC 1X5IA 2YSSB 3ISWA 1KB5L 2A74A 4Y4KB 3ALWA 5B8CC 5E9DB 4GLRI 4WI5A 4LCCB 5HHOD 2FLRT 1C12B 1FO0H 2N7AA 4KDTC 1AO7B 4JFPB 4B7LA 4YGVB 4NJ9L 3D39A 2NY2B 2VIRA 3CFEA 5C0CD 1VADB 1W8OA 1ZA3A 2H9GA 4JZNA 3NIFF 3C6SB 1QFWL 1UKSA 3C09C 1CTNA 3AC0A 4JFQA 4LQFH 1WBZB 3QG6A 3FO1B 4GG6E 5CJOH 3QP3A 4QHNA 1Q72H 5DJCA 1VEMA 5BVJA 4QRRE 3L1OH 3QHZL 2NY0D 4G6ML 4IDLA 4I2XB 1CFTA 4JDVB 3WNMA 4ZAKA 3WFEH 3PHOA 1J87A 1S78C 5IJKC 4PJCB 5BW7A 1CK0H 2YPVL 3JTTA 1CICC 4S10A 5DO2C 1LP9A 4ODUA 4LPXA 1A5FL 1ACZA 4M48L 1MNUH 4H8WC 4QRSB 3OF6A 1UEYA 1OAXH 1D5MA 5D70L 3AS1A 3D2UB 5EN2A 3HZYA 2CO7B 4WEBH 5DFWH 1RPQA 1R5VA 5F6HI 2EDWA 3AXLA 1FVDA 3QFJD 3RL1B 1EO8H 4OB5L 3V5KA 5JW3L 5J13C 4XP1L 4PJDA 5KS9F 1ZHLA 4JFFB 3RZCA 1F00I 1RZJH 2PR4L 4JO1L 3TPKA 2ESVB 3K8KA 1MY7A 4JDZB 2VLMD 3VXSB 1FNGA 3V0AC 2C7UA 2VZUA 1BVZA 2CUMA 2AJSL 1A1NA 1RUQL 4LDOB 5T3XD 2E9BA 5D1QA 5J3HD 3IFNL 2C1OB 4YDVB 4E0RA 1T3FB 3ARBD 1YEGL 3WN5C 1M7DA 5DJDB 3QIBD 1SYSB 4FQXB 3W9EB 5DUPL 4OZGF 2A0LD 3VXME 1RHFA 1GZQB 4NN6C 3JUYA 1EO7A 4HUMB 1AKJD 2Z4QA 5IB5B 2IQ9L 1ZANH 3NIFE 2P5WE 2BJMH 2VWEE 5HHMD 1MFDL 4YO0A 4R0LB 4POZD 5FUZL 5SX4I 1XGQA 4EIGB 2R69H 3VWJD 1IGIH 4P4RA 1YN7B 3BYYA 5C09A 1CFSA 4HZAA 5EU7E 1G0XA 4PGEA 1ZSDA 3CXHK 3M17A 4XBGB 3WUWG 1TZGH 5I76A 1S7UA 4NKOB 3SDDD 3UTTD 5ADPH 2MCG1 5KJRH 1GGIH 5JIKA 4LNVA 4XMKH 2M26A 3K1DA 5CZXC 5FA4B 4XP5H 5EU6A 3ARFA 4LFHG 3RGVA 5CWSA 5FM4A 4QY8B 1TTGA 3LIZH 2Y1VA 4G8GB 2EH7L 3KDMB 3O6FB 2XFXB 5FIEA 4BYHA 2DQCL 4NOBA 2NY7H 4J4PC 4JAMA 3C5ZC 4XWGL 4WFGE 4AQOA 1U3ZA 5GIRB 1UZ6E 1U58B 1X5XA 1V5JA 4G42A 1DVFB 5DD6B 3LSOA 2O5XH 2ED9A 1YMHB 3N1FC 4NO0B 1PGRB 2UYLB 2C3VA 1PEWA 4WFFD 3O11B 4ZUWA 3ES6A 1JK8A 4GAGL 4WTZA 3HAEB 2X89A 5I19H 2Z0BA 5C0BD 3LHPH 5TH2A 4L3EA 4GKZA 2W92A 4MQSB 4Y5XB 5DHVH 2ZUVA 2X4SB 1NCNA 4XXCC 4V1DD 1XF5A 4D3CL 3KXFD 4C4KO 1HHIA 2P7TA 1WEJH 4LLUA 4YZFE 1OSPL 1FN4B 2PXYD 3BKJH 1DQDH 3V0VB 1GAFH 3GB7B 1A9EA 4NQTA 4Z7UF 3MJ8A 1RV6X 2X1PA 2GW5A 3PHQB 1AR1D 1Z9SA 2BY1A 3BN9D 2H32A 1QYGL 4JKMA 4E41A 1IGTB 5EUOB 5F21B 1WT5A 2NY6D 4CVUA 4PGDA 3A6BL 4U3CA 3BH9A 5DXWA 4C56E 4PBXA 4XC3H 3QULA 3VCLA 4Y5YA 3WCYA 4NHUA 5ISZB 3VG9C 1J1OH 1KIQB 4QXTA 4ZOAA 5HHOA 2OQJA 1AXTH 3Q48A 2K1MA 3HC3L 4JY4B 2AJ3B 1Q9WB 1QO3A 5C0CA 5DJ0A 2YUVA 1TZHA 3REVA 4DEPB 1Q9LA 5T3ZD 5D1XD 4ZFZA 1AXSA 5H37H 1YMMD 4EI5C 5HHXH 2Z8VC 5C0JB 4IMKA 1NCCH 5FCUL 4CVXA 5ALCH 2VLKD 4HWEL 5IB2A 2VQ1A 1NGYA 1X4XA 2FHCA 4NYLB 3SDXB 2NY4C 3GK8H 4L9LA 5D2NB 3BVNB 1A14H 1DQLL 3L3JB 4WUUB 4NZJA 4FQLH 2CJUL 4YWGH 5LWYL 3LS4H 1FG9C 2CKBB 3QDMB 1G9NL 2MSPA 1ORSA 4MVBC 4U1KA 3S3SA 1FIEA 3N9GL 4JHWH 5E8DH 3QWOB 4WJ5B 4XWOC 2HLAA 3EKCA 1XGTA 5EBMB 1VFAB 2ICWB 2EH8H 3N1GC 4CVZA 3VXNA 1IGYA 5E24E 2IQAA 2NY3B 4D9RD 3N85L 5C2BH 4HIJB 4Y0GA 1XCTB 1CZ8H 3UMTA 2QHLA 4Z7UE 2K3TA 4I3RH 5GRJH 3B9VA 3F6LA 2AJUH 4NM4L 2QQKL 3CSYB 3ZMRA 4OF8A 4MX7A 2C1PA 1OQXA 2VXSL 1FZJB 1Q0XL 2A9NH 2QQNL 5IBTH 3FQWB 3MV11 1WK0A 4BQ6A 4WDIB 1WCQA 4OIIL 1RZFL 4RWYL 4OLWH 3ARBA 3O4LD 1HXMA 3QIBA 3TO2B 4DK6A 3OZ9H 4HMCA 1BECA 4ISVB 5E95B 1KTLB 1FHGA 2VLRD 1AKJA 2DIBA 4L3AA 3S96B 5TF0A 5DJ2A 2Y25A 2X4NA 5D7JB 3QIUC 2OXHA 5DK0B 1IC5H 3VH8G 1LK2A 4WNQB 4OFDA 4HUWA 3GMOB 2Z8SA 3VWJA 3OJ2C 3KNBA 5HI5D 1E4WH 5IMLA 2BRRH 5C3LD 1INQB 3P30L 1ZHKB 5FOBB 5F7UA 1K4DA 4FMFA 3RKDC 1QFUH 2LAAA 1TITA 1UJTA 4PJ7F 1NBZB 3IDXL 4W70A 1JF1A 2L7JA 3SDDA 3UTTA 3T1WA 5DHXB 4LQFL 1LHZA 4JG0H 3OB0K 2Z31D 3ULUC 4OTXH 3MBXH 1A6VL 1FAIH 5CJOL 4LPYA 4MXQD 3U0WL 1I7UA 1ZS8A 4XPHL 2VLJD 1A64A 5H94A 4EEEA 3CUPA 1DLFH 3PF2A 2E9WA 5DUBA 4YX2H 5DWUH 3H3KA 3KPQA 3VDAA 3ARDD 1P84K 4DKFH 4MD0B 4MA8L 1CK0L 4WV1C 3P4NB 4YDKH 4DJMA 4ONGH 1K8IB 1ZOXA 2H26B 1RVFL 4PJBA 1K4CB 2AAVA 4K94C 2V7HB 3UBXA 1NMAH 4KPHL 1JNHB 4Y88A 5ANMA 3MV7B 4HIHB 3ZDZF 2NZIA 4Y2DD 1LP9F 3D0VA 2F8XC 3BN3B 3P3YA 4WW1B 1KC5L 1S5HA 3O2WL 3KG5A 1KB9K 3BPNC 4GXUM 4TNWK 1BQHB 5C0BA 4BUGA 4MAYC 4RQQA 2VDRH 4OSUH 5KZCD 3UDWC 2R29L 1CTOA 3BSZH 1WC7A 4UI2A 4V1DA 3AU1B 3KXFA 1PQZA 2COQA 4YIQA 4EDWH 2PXYA 4YXKH 5JPNA 2YZ8A 1MCOH 1L7TH 3LH2H 5T3XL 1T2QH 2GKIA 4KROD 1HDMA 2H2SD 3SE9H 1JRHL 4Y4HC 4XP4L 1CDYA 3R06A 3D3VB 2VQTA 1VESA 3JTSB 3O3EB 3W0WB 4Y4KC 1NH6A 3MCLH 1U8MA 3HMWH 1MWAH 1S9YA 3TPUA 3D39E 1YY8A 4UDUB 3QUXD 1SEBB 4J6RL 1FFNA 2CR3A 4LPWA 4DGVH 1YNLH 4Z0BH 5BZWA 4GKSA 3BUYA 1J86A 3FONB 4XBEL 2VAAA 3D6GA 3B9EA 4HJGB 3WHXA 1TZGL 4HPOH 1MRDL 3MRLB 3RHWK 1W0VB 5D1XA 1YMMA 3I02B 3NIGF 4QTIH 3AS0A 5KJRL 2FO1A 4KV5F 1RMFL 1HNFA 2H8PA 1JF6A 1GGIL 1NAKH 2VLKA 3LKOB 4BQ9A 3F62A 4MGXA 1CCZA 1RK1B 4Z18A 2QR0A 2G5BB 2EDQA 5DJ8A 1OP9A 3LIZL 3SOBL 3A6CL 1LP9E 3L9RB 4XZUA 2C4XA 4Y4FB 1UQSA 1UM6H 3P0VH 3LPGA 4H25B 2R1WB 4N0CC 3P4MB 1CVSC 1KIRB 4XVSL 3ZYOA 1JWMA 5IHZA 1CT8A 4E5XB 5IHBA 5INCB 2BHYA 2V2WB 3MRBA 3QA3A 5DYOB 1CN4A 3GKWH 4HFWA 1XGPA 5GGRA 2BVOB 3DX9B 5C70A 2AKRA 4EXPX 4ZO6A 4KKBD 4LKXA 3RWFB 5I16A 3C60B 4PJDE 1JHLL 3MR9A 4FFWC 5L7XH 3PWLA 4HX1A 1ZLVH 2DQDL 3UTPD 4Q74A 4NRXB 4DN4L 2NW3A 2Q7YB 5K9JH 4XMLL 2DAVA 4KHXH 5EZLB 2OR9H 4LNRA 1H0DA 3H3BC 2J8UF 4ZD3H 3EOAB 1MF2L 2G5RA 2WZPD 4XCYB 3FQRA 1EXUB 4FQPA 3O4LA 3EYOB 3S5LG 1UKQA 4BSVA 4O2CA 2Q86A 4Y8AA 3C8HA 3GJFB 4XGZB 1ZTXH 4G80A 4APQD 4GG6B 2X4QB 2VLRA 4UZGA 3BQUB 4QRRB 3ZDXF 2X44D 5C09E 4YDLC 4RDQG 4KV5E 5L2JB 2Z8RA 5DEFA 4IRSD 3WEXB 1E27B 3D1MC 2XTJE 1Z3GH 5DD3L 5F97E 1TZIA 4ODHH 2O5YH 4BJLA 2QTEA 3QB7C 4K2UH 5IK3A 1DDHA 1MQ8A 2NY5C 3GFUA 1XFPA 2W0PA 1F58H 5IMOA 4ERSL 3P4OA 3BOVA 4LLYB 3ZT7A 4YQXH 5EU6E 5T3ZL 2Q8AH 4NN5B 2BX5A 2Z31A 3QUYC 5ALCL 4CL7A 3ZKXC 3G6AB 2IFGA 5HY9A 1V8HA 1SJEA 2VLJA 4WW2A 1RZGB 4WHYG 3L3GB 1X9QA 2DWDA 5MEQA 3L7FB 1CQKA 3P9LB 2XA3A 4OLYL 1UWXH 3ARDA 1FIGH 1Y0LB 5F9OH 2A1WL 4WI6A 1QR1B 2Y72A 2BOCB 3TM6A 3ME0A 1HYSC 1FL5B 4KK8C 4NC0B 1CXEA 2EH8L 4DN3L 3UZQA 4XTRD 1VERA 3BGMB 1U8NA 5E2TL 3VXMB 4L3EE 4YHOH 1CZ8L 5B21A 4PG9B 4NCDA 4Y2DA 5BXFA 2R8SL 2XOTA 2UY6A 2IMNA 1E28B 1A6TB 1JUFB 1Q9KA 4I4WB 3EYQC 1ZWIA 2EYTB 2CD0A 4U1GB 5DQJB 1DSFH 1A3LH 3CVHA 5L2KD 1TVHB 3N1PC 4IMLB 4F7PA 4Z78B 4JM2D 3QIWB 2OJEA 5AZEH 1R24A 1FDLH 2CIKA 2FIRT 5DT1L 1FE8H 2IEPA 4E41E 1LEKA 4HUVB 3TFKC 1UWEH 2CIIB 4QOKB 1UJ3A 3WKML 3C6LB 3RWIA 4PRDA 4K3JL 1I3UA 4PY8J 5DMGC 2CLZA 5E56A 4S1SH 1F3JA 3VU2A 3MRMB 4ZFGH 1JWSB 1IGML 1X5FA 4U49A 4UINH 1RK0A 3MBEC 3CMGA 5HHOE 4LSVH 4O02H 2EDRA 4P2QB 4KKAD 3TT1H 3VFSB 3WLBA 5ESAB 1IC5L 1QA9A 4KVCH 4ODXA 5C0CE 3IETB 4YHYC 3QUXA 1AGFB 5JIPA 5EU3B 4DQOH 4YNYA 4RGOH 2Z8WC 2FX8H 4KRNA 4DEPC 3LZFH 3CFBB 5L88H 3EZ8A 4PY7A 3B5GA 1C08B 5ID1A 3G5ZA 3SHSA 4Z0XB 4DZBA 2D7NA 5I1AA 1AGCB 3W82A 1AD0A 4P46B 4WWID 2B4CL 4UV4L 3NVQA 4KUZH 4R96A 2IPKB 1FAIL 4OGAD 1KNOA 2YC1A 5BO1H 2ARJB 4M8QB 4NGHL 3DARA 4PD4J 3SCMC 4LRIC 1EEYB 5TDOA 4C59B 4R7NB 3TNMA 4B50A 2PYEB 4OZ4A 4HH9B 4YDKL 4UTAL 4CU8A 3Q6GH 1N2RA 3VXOB 3FB7B 3GMPA 1F4AA 3VFTA 2RIKA 1FG2B 2F5AH 1HHHB 5GRVK 4L3CB 2EIBA 4F7CA 3SO5A 2KUTA 5A16A 4P4KD 2ADJA 1CDCA 2WBWB 4B53A 2HTLD 4JG1H 1HXYB 4M7LL 5A3IC 3L3HA 1VEOA 4PJBF 3W11D 4KRLB 1SVZA 1OHQA 2VLME 3NFSH 3GKZA 5EFIB 1MAJA 4JFXB 4P5MB 5C0GA 2VDRL 4OSUL 2PO6B 2VDOL 2DQTL 3BSZL 5T3XE 4ZDHA 3CVHL 4KJYB 5D7SH 2VL5B 3NZHH 3HE7D 5GHWH 2A9MH 4LP5A 1G7QA 4EDWL 4FXGB 4PLKD 4YXKL 1S3KL 3QDGD 1MCOL 4ZODA 2KQNA 3LH2L 1T2QL 4ZOBA 3SE9L 4RAHA 4I0PD 1IT9H 4YHNB 1WBXA 4U1IA 1I8IA 3BZFB 4W6XB 5HHME 5CSBA 1VFOA 2ITCB 1YJDL 3HAEG 1BIIB 4APQA 2HWZH 4LSPH 3SGEH 4QHMA 2PTVA 1CE6B 4JO4H 1P6AB 5TPWH 3IJYA 2OJZH 1NC2D 1QPXA 4EXKA 3QT2A 1ZA6B 4GUPB 1G0YR 4LCUA 4BSWB 3HMWL 3WFHA 5HJ3A 5IB1B 4IRSA 4TUKH 4NSKB 4G5ZH 2E7LA 4NFBA 3RX8A 5E2VH 1XR8B 5GGUB 4DGVL 3ROOB 2F58L 4Z0BL 3S36L 3FO9A 2DLFL 3UTTE 4JY6B 4LU5L 4Q0XH 3MJ7B 1W0WA 2RBLA 5LXGH 3WIIH 2FR4A 3QXAB 4PLOB 1D5IH 2BNQD 1L0QA 4XPGL 3FAWA 3ESVF 4ZXBD 5I75B 1RFDL 4AH2B 1D9KB 5F88B 5DK2A 2J4WH 5MEOA 3F7QA 4N9GA 2EZ0C 1UB5A 5F9AC 2FJGA 5C86A 4PJGB 4UT7H 3P0VL 4PJBE 2P5ED 1EEUA 1V3LA 2YXFA 3OKDA 4RAUA 1AE6H 5ANME 1WTLA 1WIUA 1KENH 3H9SA 4HJ0D 1JGLL 3I2CL 3GKWL 4M62H 4WFFE 2V5SA 3VGGA 3G9VA 5J1AA 5C8JB 5D96B 1PAMA 5KVEL 5C0BE 5C9JB 1F13A 1GIGL 3EBAA 5CHNA 5E6IB 5JW5A 4V1DE 2DICA 3KXFE 4WY7H 4GXVL 1HYRC 1FCCA 3RKPA 3SE8H 1GYAA 5J11B 1VKXA 1UG9A 2IH3A 4F9PC 1ZT1A 4AENA 1VSCA 4LSTL 5L2KA 1TJGH 2BZDA 5D71L 4JM2A 4KGLA 1MCIA 5LGKA 2VSCA 5JIHA 4MMXC 3KYNA 1RZ7H 1CL7H 3L5WA 4XVTH 4IIQA 1F4WH 1X7QA 4J8RB 1UA6H 1WLHA 3S3PA 2HG5B 1BVKA 1G7PB 4OD3L 1VB9A 4JPKH 4D94A 4YFDB 3H3PH 3PV7A 1ZTXL 3Q5TA 4U6VH 4MQXC 1XZ0A 1FVEB 3B9KC 3QR2A 4RGND 3O2DA 1KG0A 1ROWA 3MNVA 1P9MA 1K2DB 3PDOB 4TNVF 3V7AE 3L3IA 4YHKH 2P24B 5J9PB 4OCLC 1GGCH 1F6AA 5DRWA 5FKPA 4AL8H 4X6DF 3QO0A