4Y5VA

Diabody 305 complex with epor
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
SEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANIKPDGSEKYYVDSVKGRFTISRDNAKNSVYLQMNSLRAEDTAVYYCARVSRGGSYSDWGQGTLVTVSSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords diabody 305 VH domain
publication title Tuning Cytokine Receptor Signaling by Re-orienting Dimer Geometry with Surrogate Ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/immune system
total genus 31
structure length 121
sequence length 121
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2015-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y5vA00
3RY5A 3UO1H 4FQ1H 4OSUL 4N8CH 3ISWA 4YDKH 2F8OA 1IL1A 2MWCA 4JG1H 1CE1L 1YYML 4KDTA 1HYSC 2JJUA 2GSIB 4LCWD 3A6CL 1CXLA 2E9JA 4HAFA 4P2QD 4YHNA 3QUKA 1WCBA 2I5YL 4OCLC 5FOBB 2R23A 2ADFL 3OB0K 4OKVB 4KJPC 4BQBA 1HXMB 3BGMB 2FJHA 4ZAKA 2VAJA 2EIBA 3D2UD 3U7AA 4ELKA 4MXWL 5E94A 1HE7A 4JO2H 4DZ8A 5I8EA 1DUYA 4O51B 4PV8B 4DKEH 4GBXA 2ADJB 4YDJB 3HRZA 4MA7L 2F74A 2WWKT 3B9VA 4ZOCA 3WKMH 4J3VA 4M6OH 3GMPB 1SM3H 2JIXB 4QHMB 4GQPH 2KKQA 2DMKA 2GTWA 1VGEH 4GG6B 2BXZA 4EDWL 1J1PL 4LRIA 3MR9B 3QHFL 3RVUC 4EXKA 3AU1B 4NQSB 3WNKA 1A3LH 2LTQC 2YEZA 5ALCL 4G6JH 4U1MB 3BPOC 4N5UA 5A2FA 3PL6D 3C60A 1OAYH 5DD1H 4XCEA 1A4KA 1S7SB 3PIQA 1VPOH 2O26U 2P24A 1UKSA 2ZCLH 3SCMA 5CBEA 4NBXB 3MCLL 4G6FD 3KPSB 3QI9B 1F90L 3K1KC 1OGAB 1NCWL 3ZDZE 1N3NB 4RA0C 2FLRT 5GGTA 4PJBF 3CAFA 3LRSA 3VD9A 1VFAA 1DE4B 3OKDB 4K3DH 5DVKA 2Y9RT 1X5YA 5FCUL 4Q6IB 3HUJF 3GSUB 5KOMC 2VABA 2F5AH 3V5DB 4F7PB 4X5LA 1RZIB 1HHJB 3ECBA 4KU1A 5JPMA 5JW4N 5DMJB 2UWEB 4XCNA 4X8JB 3MTRA 1FFPA 1S9XB 2GAZA 1IQDA 5DMGD 5HD8D 2CJUH 4OJFL 4LHUD 1NCTA 3GNMH 5HVGB 2BNQD 1UM4L 3OKKA 4GKZB 2VLRE 4P5MB 4YUEL 1HWGB 1FVEB 3EYSL 4JGJA 5H2BA 4C56A 1HIML 4JJ5A 1I8MB 2FDBP 4NN7B 5DFWH 3VH8B 3AGVA 1IAIM 4KVCH 3MLYL 5F21B 3NZHH 3RWJA 2FX7L 5KVMC 3F12A 4PJCF 4BQ8A 3U4EB 3QPQD 1KLGB 4OB5H 4U7SA 4GJTB 1EJ6A 4P5KB 4PJBA 2FJFA 1BPVA 4PRBA 4FG6C 2YBRA 2Y07L 4NT6B 4RNRA 3UTZA 3H42H 3WJJA 3TVMC 2K1MA 3HUJA 3T0EC 4OCSH 5B38G 4CMHB 1J1XL 4NGHH 4MB5A 1LDSA 3S35L 2F8VA 5A2JH 4JZJB 3NPSC 5A43C 1RZGB 2VJXA 3RIAK 1HYRC 5JR1L 4X5WA 2DMBA 4U6XA 3SKNB 2EDEA 3MRIA 3W2DL 3LD8C 5LCVH 1INEH 1KOAA 1YMMD 3H3PH 3KYKL 3S37L 1IEBA 2WBKA 2ADIA 2NY6B 5CFHA 1MIML 5KVFL 3SKOB 3CXHJ 3V0VA 2D9CA 4WJ5B 1J0YA 4OZGA 1A1MA 1U95B 1HINH 3TESA 2VXTL 3UPCA 1EVUA 1JMZA 1BD2E 1BVKA 2C3VB 5KSVB 4XNYL 5I1CL 2QQNH 3WXWL 1QO3A 2H3NB 4J1UA 3CIQA 3QDJB 3GO1H 3ILQC 3H0TA 1F4XL 5SX5K 4QXGL 4MA3A 2DTMH 4X8XA 4L29B 2X4OA 1SEBB 4FTVE 5I1KL 3BEVA 3S8WA 1JFQH 5T3ZH 5F96L 4WCYH 1IC4L 1G7LB 4EJ1C 3W9EA 5C0IB 1N59B 2RCSL 4LKCA 4Y1AD 2NLJB 1MJJA 1U0QA 2HYMA 2GK0B 4KJWC 1NUFA 2CIKA 3O6FA 1FFNA 4NPYA 1G7MA 4N8VG 5IESH 4DTGL 3HLAA 4UTBL 3EFDH 1B9ZA 2YSSA 3DUUA 3PHQB 1UVQA 4EZMA 1T3FA 1IGML 4IRJD 4ZNCD 1INQA 4APQA 3T3PE 4PRAB 2NY2D 1M1SA 3BE1H 5DJAA 2NY3C 1SYVB 4N8VA 4LLUA 4OBRA 3FO0H 5HHOD 1ZSDA 4HZAA 3AXLB 1F8TH 4PLKC 4G9DB 5JLZA 5L2KA 3QCVH 4TRPH 3L7EA 4FFVC 3EYQC 2EECA 3PF2A 3IDGB 5F3HB 4X6EA 3F62A 4HK3N 5GRVL 4HUNB 3ZO0A 1A1NA 1XIWC 5T1KB 2BZDA 5E8PA 4KHXL 4NO0D 4CVWA 4HJ0C 3NFSH 3UAJD 4OBSA 4I2XB 3IVKA 3NCMA 2WIIB 1X5FA 1SJXA 4P0DA 2VDQH 3TNNB 2N7AA 4OAWA 4ZS6D 4OCRH 1P6FA 3LB6D 5KSUB 4U2YA 4XP4L 3HAEG 5MEOB 4PJGE 1IGCH 4YHKH 5HDLA 4MDJB 5CINL 1NDMB 1Z3GL 2JCCB 4RMQA 3OX8A 1NQBA 1B6DA 5C0AA 5IWLA 1V5JA 1WIUA 4F7EA 2ARJA 3LEXB 5DD6B 3ARFC 4L9LA 2W9DH 3WUZA 4ENEC 3HAEA 4FQJL 1JPGB 2X1OA 4XAWL 4AQOA 2XRAL 4UNTA 5F3BA 2G75A 1KXTB 2D03H 3CFIC 1NLBH 2NW3A 3ZDYF 2DDQH 4U4BA 1RJYA 4KQ3L 2LU4A 5F7UA 4YXLL 4KGLA 5HYSG 4YXKH 5C0EA 4X7FC 5D71L 2XTJB 3FMGH 2M2DA 4P2QA 4Z7UE 1T7WA 1X7QA 4Z7NE 1OARH 3FN3A 3IETA 5F88A 3FQXA 5C2BL 1OF2A 3SOBL 1ZLSH 2WQ8A 3KPPB 3D2UA 2FJGA 3MRMA 4JFQB 3WFCL 1WZKA 2P8LB 4LDEB 3JVGA 2IAMC 3QHTC 1EFXB 3ARBC 2BRRL 1I4FA 2D4FA 4MJ4A 4L4TD 4YE4H 2WUBL 4WHDA 2YPLD 1LEKB 5DA0B 1JHLL 3MNWA 2EEDA 5ITFA 4G8EB 5FXCH 3TZVC 1CD0A 3U82B 1T89A 4WTZA 3BRGC 2H2SC 3DO7B 4J3SA 2Z4QB 1M7XA 1JZ3A 1A9EA 1AGCB 4FRWA 1J05B 2J1KA 3WL9B 1QFUH 2Y36H 4NRYA 4O2FB 4F3FA 3HMXA 3MYJA 2FSEA 3PL6A 1QPXA 4KFZC 4P59L 3UBXB 1M7DA 1T5WB 3G5YB 3K4DA 5I1AA 2P43B 4UT9L 5EZIL 2VN7A 3DVGA 3RL2A 3EFFA 4FQXB 1I9JH 2P1YA 3RQ3A 3BMWA 4D0DB 4IIQB 5B8CC 2AQ1A 3FQTA 4MLIA 4M7LH 4KROB 1QSED 5CJQH 2WLYA 1NBYA 1N26A 4R7DB 5HJ3A 5F9JA 1U8MA 3AVEA 1T20B 1UJ3B 3MNZA 3UZQA 4NQED 4J8RA 4V1DE 3LKPB 1OLZA 1JGLH 2R4RH 4PLOB 1I9IL 1PD6A 3EKCA 3EW3B 4JQXA 1I7RA 3C9NA 2VLJE 4LHUA 3IFPB 2BNQA 2GEEA 2H26A 2R1XB 3Q6FB 5I16B 2WSKA 3FO9B 2BNUB 4RQQA 1RK1B 5MHSD 2HJKA 1VSCA 3J7HA 2X70A 3GI8L 5IVXB 4Z0BH 3W0WB 1CFNA 5E0QA 4KKNA 3SKJL 1J8KA 2A77L 2GSGA 1D5IL 4I4WA 3CFBA 5EOTA 2RAMA 4HK0A 1IKNC 5D7LB 1KTLA 3UPRA 5DHVA 3VW3L 3HG1D 3BPNB 3CFKB 1K2DB 4IEFB 4Y8DC 1CLYL 3T0EE 3GHBL 1GRWA 1R0AL 4WI4A 3CLFH 4GAGL 1AFVH 5KSAD 1Q8MA 2PTTA 1ZANL 2ARJQ 5EG6C 2W92A 4A6YH 4MNQB 1GC1L 4S1QL 3W39B 3QO1B 1OTTD 3WIIL 2X4TB 4KI5E 2WQRA 1DQJA 1WITA 1UENA 1TZHB 1MRCH 3FO2A 3KJ4B 2ZWLT 3ARSA 3FQUA 3PWJA 4H5SA 1MPAH 4TULL 4XB7A 1S9KC 1FFOB 4Y5XA 1NEZA 4XPGL 1YQ2A 4XPHH 4O58L 1R3JB 1YMMA 2IH3A 2NZ9D 2IF7A 4JLRA 1YEFH 1YZZA 3QEUA 5HI4C 1S7UB 3BZ4B 2IANB 4WUUB 4HCRL 2X89D 4X4ZA 5GGRB 5TE7L 4HDIA 3K8LA 3UTSE 1QR1A 3OSKA 4RISH 3KHOA 4PJ9D 3F7QA 1LQSR 3ZKXC 1WC7A 3BQUD 1LNUB 5IMMA 1T2XA 2X5PA 3OV6A 3WS6A 6FABL 5IB1B 2B0SL 1EGJH 5E9DD 3T3MF 2CKBH 4DOHB 3BZFA 1DDHB 4HX1A 4PRNA 1ZLVH 5C0DA 4JM4L 1QBMH 4BFGA 3G5VB 5H37H 1TNNA 3TH4T 4HH9B 4N0YH 4PRPB 5F6IC 4R3SA 1IM9B 1QFPA 3MJ9H 4Y1AA 1MFDH 3AM8A 3VI3E 3WHXA 4WEBH 4TQEL 4L4VD 1KB5L 3QXDB 2CLVA 5I30H 4IRSD 5DD5L 1OM3L 1N5YL 5KAQF 2X4RB 5HHXH 2L7UA 4XVTH 4QGTA 2W0KA 3STLA 1FZKB 5IFHL 1ULVA 5CJOL 2GFBA 2ORBH 4MDIB 4IRJA 1LO5A 5DMIH 1CGYA 4HKJB 4ACPA 5I1HL 4ELME 4Y16C 3TT3L 1A14L 4QGYA 4YDLB 4BM7A 3VXPA 3O6ML 4MAYD 4NN5B 3RWHA 3BHBB 5MI0C 4OQ1A 5HGHB 1RSFA 5HHOA 5J6GA 4I18A 1MWAH 43CAA 4EBQL 4I2XE 5F1KC 3HR5A 3MGTB 3QUXC 2W38A 4LOUC 2X40A 4HAGA 5TDPB 4J3UA 3SPVB 2VXQH 4WI5A 5HPMA 3JV4B 1MRFL 5DHXB 1P69B 2GJ6B 5IBTL 4DKFL 4O9HL 5I8CA 4OZ4A 1BBDL 4S1DD 5BV7C 2RIKA 3S5LG 5GGVH 5CWSB 1A7QL 1BJ1J 4H8WC 4NO0A 2XQYG 1NFDF 1JRHH 5GS1C 1CF8L 4H0GA 4KRLB 3NTCL 2E7CA 2VL4A 4OZFB 3LQZA 4BZ2H 4E5XA 3R06B 2WBJB 3PHOA 2FATL 2PW1B 3R8QA 1AO7B 4JPVL 5F7DB 1FO0L 4I77H 4M00A 2HTKC 1JPST 3IDYC 3PP3H 3RJDA 4AEHL 1CICD 1K6QL 5FYLD 5B4MC 4NWUH 1K8DB 2OJZL 5DT1L 2HA1A 1YMHA 2Y4SA 2NX5D 1QFWI 1ZHKB 4FN0A 2CRYA 2VDRL 2BCKA 4Y4KC 4JDTL 4ZPVB 2RR3A 5AWNL 3HI5L 5IFJA 5T1MA 3UTQB 3OHXA 3SE9L 4CADB 4OQTA 4YNYB 1D9KA 2P42B 5KTEL 3B8YA 3V6OA 4EN3C 2E9WA 4KTEL 5DMKA 4XXCA 3MV01 1D3CA 3QHZL 1UM5L 1X3DA 3VA6A 1NFDA 3I02B 3CH1A 1IGFL 1ZA6B 2DKMA 3MRGA 4R7NA 4EDXA 3C8KA 3KYMA 1QNZL 3IFLH 4GAJH 4X80L 1W72L 4OZHE 1J9CT 4B7LA 4XHQA 4F15B 3WFBL 1TPXB 3FZUD 2V6HA 4EKXA 4LQ1A 1MHEB 1MCEA 2HRPH 4NHCL 4OM1H 1KB5B 4KKBD 2ZUQC 1UKTA 4L4TA 4R2GB 4UOW1 1NSNL 3L5IA 2DQUL 3QUZC 3U46B 1BGXH 2YZ8A 3SQBA 3VA2C 3BEWB 1UT9A 3VD7A 2Z91A 5IHZB 3G5ZB 2F19H 3UO1L 4FQ1L 2FO4A 4ZDHB 3SDYH 4PRID 4UIKL 3L3KB 4YDKL 2HVKB 4W4OC 4YO0A 2NY0D 4NP4H 4EI5D 2V5RA 4JKMA 4R0LA 5EO0B 5DJYA 3VXRE 3V7AG 4UQ3A 3R1GH 4D9RD 2WUCH 1NFKA 3VXME 1U8OB 1ND0B 1RMFL 4F8TA 1P1ZA 3CSBA 4HV8B 3RY6C 4K8RL 1VERA 5D1QC 3T2NH 1E27A 3BP5B 1JMXA 5MEND 4PJDF 2HP4A 5E2VH 1BFSA 4DKEL 1KG0A 1UG9A 3I9GL 1YEGH 4M6OL 1SM3L 2XN9E 4PJHF 4HIHB 1UADC 5IVXE 1D6EA 4QTHB 5JXED 4H20L 2EH7H 2BVTA 3DNKA 1A3LL 1AD0A 2CKNA 1KGCE 1MFAH 1NDGA 4PJ8D 3TBYB 1FIEA 5C9JA 1S5IH 2VH5H 5F8RC 1FO0B 3WLBA 1OAYL 4ZUUB 2G5RA 5IKCA 1VPOL 5IB4B 4HS6B 2CQVA 4TNVK 2VLMD 2XZZA 3KPMA 1KC5H 2QL1A 1RZKH 5E08H 1Z0MA 2H9GB 4IOIB 3IFNH 3WUWB 2PYFA 3RKDC 1PDKA 4ODTH 4Z76B 4PJDA 1KLFA 3HG1A 3BZEB 3B9KC 4NYLA 5F72S 1I8LC 5KN5B 1BP3B 2PO6C 1TQBB 2FO1A 2F5AL 4D94A 4FP8L 2DKUA 5KSAA 4RGND 2OTUB 4OIIH 2JJTC 1G9MC 4M3KB 3EOYG 1G9NC 1F00I 3H9SE 4U6VL 5IB2A 2IANE 3A67H 5AUMB 2ZSWA 2P5WD 2JE8A 4WUUE 5HSFA 1KCLA 1LEGA 2CJUL 5CP3H 3OPZL 4NZJA 4F9LC 3GNML 5F1NB 5C8JB 2RBLA 1W72B 5J0BA 5JDJA 3C6LC 5T3XL 3O6KL 3VFUB 5T5NF 3NZHL 4L8SB 3IAQA 4Q9BA 4NQCE 1MCBA 1JWSB 4OGAC 1I3GL 3CC5B 1IT9H 4HWZA 1W0VB 4K3GA 4X7TB 3OJDB 4HUUA 2YS4A 4P48A 1KPVB 1BOYA 2P8PB 3O3UN 3LS4H 3HS0A 4EVNB 3U0TB 3FOMA 3H42L 3LIZH 2CGRH 2FHCA 5FGBA 4PGJA 2DWDB 3BQUA 4OCSL 1Z9LA 2NW2A 3DURB 2OI9C 1ZLUK 4NGHL 2DI8A 1W8NA 3K0WA 5JOFB 4I5BA 4MVBC 4QHNB 1CGVA 4O2EA 3T0VA 3W11C 5JW4M 3WS3A 4G8IB 4TUOA 5D7JC 5CD3A 5LCVL 1INEL 4Q0XL 1RZJC 3H3PL 1DLFH 5A2KH 3O9WB 2OI9B 4NJ9H 4GMTH 4P57B 3QUYD 4OLZL 4NNXA 2XY1A 4HKZB 4MQXC 5E4EB 3VXUD 3HZVA 4L4VA 2X4UA 3G04B 4LVHB 4IRSA 3VU2A 4ZNEE 1NGQL 2ZJSL 5GGUB 3HE6C 4XVUC 4J3TA 4Y5YC 3NN8A 2QQNL 2IADA 2CUHA 1NEUA 2X4SA 1PQZB 3QIWC 1QSFD 1J8HB 1KCVH 4S2SA 4R96B 1HSAA 5GGVY 4PV9B 4O4YH 1U6AH 3GO1L 5EULV 2VIRB 4HXAH 1JN6A 4PRHD 4JKPH 1BJMA 3P11H 4MAYA 1IRAY 3HE6B 5E00B 3OAYH 2NY4C 5T3ZL 4QRPB 4LLVB 1XF1A 2MQ0A 1WWBX 4WCYL 4XPAH 1N6QH 2VDOL 4CVZA 1EO8L 3BUYB 1FE8H 1TETH 4HJJH 2E27H 1ZGLP 4OI9A 1AO7E 4P99A 4JO1L 1G0XA 4H1LB 1JV5A 1ES0A 1F5WA 3ARGD 1U2HA 1K9TA 4QEGA 3ETBF 4GO6B 1S7VB 2IPTL 5DFVD 5SV3A 3ESVF 3V5KB 5EU5A 3HZYA 4JVWA 5D2NB 4XMKH 1FIGH 1AGBA 3NACH 1QLEH 5EOCL 2V7NA 3Q5YA 2V2TB 5E6ID 2BVPA 1AQDA 4K9EL 2I9LA 4Z7QF 4U1GB 4DGVH 3MRRB 1KJMA 4FFWC 3N1GC 1QPPA 3TO4C 2XWJB 5DVMA 3ZE0F 2A9NL 3HC3H 1CICA 3HNVH 2WIMA 1BZ9B 5FOJA 3QQ9D 1F8TL 2X4PB 1M7IA 4HGKC 2WWMD 4QOKD 2NX5A 4ZS7L 5HHPA 3QCVL 2IG2H 2CLRB 4TRPL 3RL1A 5CJXA 4KRMB 2R9HC 2AJVH 5FHBH 3S96A 1MCOL 5DC4B 2YUZA 4EUPG 4GRMB 1A2YA 4HC1H 2ZG3A 1GAFH 1HI6B 3ALPA 1XF3B 2R29H 5MEPA 3QULB 3N50A 1BMGA 4OCRL 1U3HB 3ARED 1FGVH 1DQQB 1Z6JT 2AK4A 1DVFC 3RWIA 1PW3A 1INDL 3QBTB 1IGCL 4YHKL 1HDMB 3LKSB 4JFHE 5BW7A 4X6CB 3EO0A 2XG4A 1RZ8A 1CDUA 3L9RB 1SY6H 2W9DL 1MELA 1KEML 1II4E 1JPSL 4P46D 4RZCA 5FUZL 1F3DJ 1CDBA 5DVLA 4XRCA 2FX9L 4AK1A 1S9VB 2DDQL 4FQCH 5IEHB 3O11A 5C09E 4PG2A 2Q6WA 2DTSA 4Y8AA 4PRIA 3HC0B 4C55A 1CGXA 2Y06L 3NFPA 3LKNA 4C58B 2AQ3A 4EI5A 1KULA 4QRRD 3FMGL 3MNVA 3VFVA 3K1DA 1RURH 3ZDXF 4XXDA 3TP4A 4ERSL 2C7UA 1FPTH 4P4KC 4DKDC 1EXUB 5BCAA 1U9KA 2F54E 1FNLA 1SVZA 4FABH 3ABZA 4ZFOB 3ZMRA 5MENA 4MS8D 3RNKA 2NXYD 4PB9H 4ZTPL 1KPRA 5F7YC 1PYWB 1V3MA 5GS0H 4DCQB 1NMCB 3DYPA 4Q2ZA 4BELD 3CCHA 1X5IA 2P4AB 1U92B 5TE4H 5JXEA 2NXZD 1MREH 3GSRA 5DRZA 4IMLA 5GISH 4DN4H 4BFIA 1QYGH 2C26A 2R56H 3QYCA 5I76A 4MWFA 1V7NL 2GY7B 4G6AD 4QYOB 2NY1D 4YPGA 5DJXB 2E8ZA 1Y18A 4CW1A 4PJ8A 1MVUA 5D5ME 2Y36L 5JDSB 5DRNB 3I84A 3ROOA 2IAMA 4AEEA 4PJAF 1Y0LB 3IDMA 5DC9B 2AAVA 4WHYG 3SDDC 3FO1A 1XF2B 2WLZA 4P2OB 2ZUTA 4YXHH 3AB0C 1FVCB 3S98A 3F65A 5SWSB 5L8KB 3JWOH 1F58H 2B5IB 3U0WL 3ZTJG 1JHKL 1B0WA 3QIBB 4M7LL 4ZFZA 4FA8A 1NAMH 5J3HD 4MNHB 5GGSA 4ZD3L 3HRPA 4YJZL 1OT2A 3EYUH 5IBLD 5J11B 1S7XB 2OL3A 5DUBA 3KNBB 4I0PC 1KSRA 1YUHA 3U7YL 1T04A 4HMCA 4UV4H 4HIJB 4XT1C 1JF1B 2R4RL 3MV11 3RHWK 3MC0A 3DMMC 3P40A 4KV5F 3ARXA 1QLFA 1EERB 5EFIA 1PKQA 1G7IB 4PJAA 4PD4K 3W9DB 1CFQA 1RIVH 3QNYB 5BQ7A 4BFBD 4JFOB 4WNQA 3U9PL 3G6AB 4P2RE 4Z9KB 3DI2B 1T21B 4P23C 4AG4H 3OGCB 4W81A 4XBGB 4OGXH 1T1YA 2GITA 1N8ZA 2YC1A 4PLJD 3DUSA 2DWEA 2IPUK 1FL3A 4BH7B 1Q38A 4PJCB 1CXHA 2FRGP 3CLFL 5D2LF 2P44B 4OV5B 2CIIB 3MQIA 3VRLE 1IEAB 1TTGA 3HNSH 4XCFH 2VAAB 3TEUA 1QBAA 3QNZA 5I75C 2F53D 1ZHNB 3QXVA 4RMSA 1MPAL 4YAQB 3F7VA 4XMPH 1HEZA 4QRQB 3KLAB 3LPGA 5I19L 1MNUH 2AP2A 4JRXB 1ZA3A 4PG9B 4GQ9L 2FYYB 2E5EA 5JMRA 4MHHG 4WWID 3U7WH 2X6MA 1U8KA 4ZYKA 1J8HE 2EYTB 5H94A 3U83A 1YEFL 3QUYA 1XT5A 3QFDA 4LFHG 3ROLB 4QXTA 5IG7A 3EJYC 5IB3A 3VXUA 2B2XL 5DURD 1LEIA 3VFTA 4I0CC 3QJHB 3QIUB 1N0XL 2HWZH 4RISL 1YN6B 2ADGA 2EDOA 3ARDD 3D39E 4U1IB 3V4UH 3IAPA 1S78C 2VE6A 1QRNB 5D2LA 3K2UH 4WY7H 4N0CD 2N56A 3FL7A 1QSFA 3CVHA 2APWA 1Z9SA 2KUTA 2ZKHL 4N9OB 4Z7VE 3MO1A 1Q0YH 3BJLA 3QSKB 4PRHA 1ITCA 3NABL 5IT2L 4QRSA 3DTXA 3SBWA 3H7BB 1IC7H 3NA9H 1XZ0B 3QXUA 1UB6A 3RAJL 3RBGA 2YD3A 1CFVH 1LDPH 3BD5A 3L5JA 3BP6A 5IR1A 3INUL 2YMXH 2CSPA 2VDKH 5HYIA 2A74B 3EDKA 3MJ9L 4X6DA 1MFDL 3MLVH 2PYED 4FNLL 1UXWB 3WHE1 1YDPA 2OXHA 5ESQB 1WV7T 3ARGA 1MEXL 5I1IH 1GOGA 2A6KB 4XVTL 5B21A 1OY3B 1E0OB 5EU6B 2WM0A 5HPOA 3BJ91 4UINL 4WU7A 4G7VL 2ORBL 3NIGF 4R8WH 3S4SA 5E6IA 2DKSA 3DV4B 4PJXF 4HPYL 2ZP0T 3BKYL 2Y6SC 3B9AA 4JM2D 1IGTB 4NRZB 3U36A 5KSBE 5I1DA 3L3GB 3TPKA 3GMNA 4JO3H 1QBLL 4M8QA 5ERWB 2BSSB 2EC8A 3HFML 2C3HA 3VXTA 4PJEF 1MWAL 4OIAA 5E6YA 3RVTD 5ENWB 4HWBA 5DRXB 5FHAL 3JV5A 4QOKA 1AKJD 2E8YA 1ORSA 2J8UA 4QWWD 4XH2B 5HHQB 4S1RH 5JIIA 2EH8H 3RGVB 4E42A 2MOVA 4D0BA 1KJ2H 2E7MA 2HMID 4N0UA 3I75B 4LLDB 3HA0A 4QRUA 5GGVL 3VE0B 1J0ZA 3GBNH 4M7ZB 5GRJH 3U9UA 4Y4FC 1JRHL 1UCBH 1LO2L 4GKNA 3X11A 3V6ZB 25C8H 5CP7A 5C0ND 5FB8A 2UYLA 2DQTL 3MV8E 2K3TA 3AFLA 5BRZE 1J5OH 2QJDA 3AREA 1XEDA 5I9QC 4NQDE 1TLKA 4GMSH 4PJXA 4Z7WF 2L0DA 5JW5B 1IM3A 4W6YB 2ICEA 3WDJA 1FCCA 1T5XB 5FYJH 4IMKC 4NWUL 3ULSA 2KH2B 2MMXA 5T3ZE 2VISB 4U7MA 1GGCH 3GSVB 1E4XH 3TBVB 1AGFB 4P46A 2IH1A 4OD1H 2XKNA 3VGHA 2ZPKL 1A6AA 3VWJB 2ID5A 4LSVH 5CEXA 3OR6B 3P0VH 2CDGA 2D7MA 3SGEI 3LKRB 1NPUA 1PEZA 3TN0C 4GW1B 4CDGC 3S34L 5KS9E 1YEDA 3ULUD 5E8NB 4NUJA 1KFAH 4UBDC 5I6XC 5ALBH 3VXOB 1XGPB 4MJ6A 5DGQA 3P9WB 3VRJA 1WQVT 3IFLL 1IC1A 4XCCL 1TJIH 1FZOA 3HE7D 5D1ZC 4GKSB 4X4MA 4AY0A 3MLSL 1R5WB 2HRPL 4DAGL 4OM1L 5F1SA 3QQ3B 3I6LE 5EO1B 4FTVD 3PWNB 1UWXH 5D72L 3RUGE 4L3CB 1BGXL 1F6AB 4RWHA 5IROA 1ZAGA 1RZ7L 3DJ9A 3WE6A 2F19L 4XBPB 1JVKA 3QRFM 1H3VA 4GRLC 1FV1B 2LQRA 4F33A 5D7IB 3D1MC 5HDBE 4NP4L 5FK9B 4XP9H 2WV3A 5FGSA 1I8KA 3UTTB 1MCPH 3R1GL 1MWAB 5L2JB 2MJWA 4PB0L 1LP9B 3KPRD 3KPLB 4GAYA 1NBZB 1BOGB 5HYJE 2HT4C 1BX2B 4NRXB 5FYKL 4ONHB 3K2MC 4PUBH 2R2EA 3RDTC 2EE2A 1S7QB 5E2VL 5KANG 4XBEH 4K94H 5FF6B 5J6HA 4FQQA 2QADD 2YN5A 1BJ8A 4N0FB 3VG0H 3QJFB 4XNZC 5HYFA 3QR2A 1EDQA 1KF9B 4DZBA 4RGMC 4XP6H 4LCUA 1YQVH 2JJSC 3RDTB 4AIZB 4HHAB 1X4YA 4P5TB 3O3BA 4TTGA 4UB0H 3PGFH 5I17B 1P6AB 5HGAB 1S5IL 5JHDB 2WNGA 4NDMB 5T5FH 4NQVA 4NZTL 1VADB 1DEDA 5L88H 3E2HC 4M9OA 4WWKC 2L7JA 2O5ZL 3V6FA 4ONFH 1KC5L 4ZUVA 5E7FA 1RZKL 5EZLB 2ZOLB 3IDUA 1U8LB 3PJSA 5GRUL 4ALAH 3C5SB 4U6HA 3IFNL 2I07B 3SDCD 2A73A 4E41E 1NC2B 1MFEL 4ODTL 3K3QA 4JRXE 1S9YA 1JI1A 3FHQA 3MLTA 4HF5H 4QO1A 3ZKNC 3IU4H 1DCLA 2QR0A 1Z0NA 5EZOH 3HC4H 1T1WB 1W8OA 4OIIL 1FAKT 1BLNA 2DQFB 4LLWB 5HI3D 1F11A 4YFEA 1CLOH 1T0NA 3GMLB 4NZUH 1P7HL 3O3EB 3A67L 2F53A 3CD4A 5K59E 1C16B 1FSKB 4LCCB 3ZKQD 4JAMB 3QDME 2G9HB 1R3HA 3MCKB 2KZ1B 1SJEA 3X17A 1A3RH 3KPQB 3O2DL 3PNWA 4WI8A 2EE9A 2APTA 5BOPA 5DMYA 5JOPE 5KG9A 3CDGB 4ZUSB 1IT9L 3B5HA 3MRPB 2JIXD 4WFGE 4AQ1B 2Q86A 3GJFB 1MCNA 3LS4L 3ZDZF 5DWUL 32C2B 4GG8B 5I66A 1A6WH 4YGVB 1RJLA 3UEZA 3ARDA 2Z31C 1OP3H 1VEMA 3NZ8B 2D7NA 3V52L 2FGZA 3B2VL 4GXVH 3REWB 4N0RA 3KWWA 3LKQA 4BH8B 4A2LA 3KPSD 1VEOA 1VFUA 3QI9D 1FNEA 3FONA 3EGSA 1OGAD 3MV7E 1WAAE 4JR9H 5EU6E 5EU4B 4CJ1A 1GHFL 1IAKB 2CRIA 2HN7B 3TIDA 4R9HA 5LAXA 1FZJB 1Z2KA 2IEPA 3ZKSD 1V3JA 4JFYB 3HAEH 1QACA 1E28A 4Y4HC 2PYEA 1MQKH 4YEFA 1YPZE 3OZ9H 5CCKH 3TNMB 3IS0X 2FIKA 3OKMA 3P9MA 2AEWA 3T4AA 1RZKC 5E8OA 5ACLA 3L3OB 4HH8A 3HPJA 4NFBA 4NUGH 4X4XA 5GXBB 1P4BH 1A6TB 5EN2B 3X3FL 3NCBB 5IEKA 5JQHC 1HHKB 1U6AL 2MKWA 3VFOA 4X0KA 4JM2A 4JKPL 3UMTA 3BRFA 3P11L 1D5XA 3C6SA 1ZLVK 4QRTA 4XGZB 2CK0H 4XPAL 2IPUG 2IALB 4M4RA 1FE8L 4LK4A 4Z78A 4X83A 4HJJL 1AKJA 2E27L 1QFHA 2XACC 1JWMB 4GRWF 2YUWA 4I3GA 5GGQH 4RMWA 3OXRA 1IJ9A 3KLDA 2P47B 5E56A 1K4CA 1S8DA 4K3HA 1C7TA 3P4OA 3BIKA 1EV2E 5D8JL 4H0HB 4XMKL 4TVPD 3HTLX 3KGRA 1FIGL 3ULUF 1P2CA 3NACL 5ICYB 3DARA 1EEYB 1QLEL 2QSCH 3HMXH 3RGHA 1UQSA 4LKXA 1XCTB 1NCAL 4CUCA 3IJHA 4DGVL 3CJJA 2H8PA 5FYJU 2VB5A 4HFWB 1MUJB 5EUKB 2NY6D 5C0CE 1FNSL 3HC3L 3BT2L 3PABA 4KI5D 3MJ7B 1I1CA 3P0GB 4G8FA 1AHWB 2BVOB 2AEQH 1KCUH 5CEYB 3DX6B 3OKNB 2XA3A 3W5MA 1QQDB 1T1XB 2IG2L 4HULB 3FB5B 1HH6A 4PTUB 4PYGA 3RWDA 5FHBL 4WFEE 3RIAF 5ISZE 3E6HB 4M1DL 4OLUL 2IQAA 2WANA 4KMLB 3QWRD 5EBLB 1JF6A 4HUXA 3ZTNL 1DQDL 1B88A 5EORH 4G42B 3JZ7A 4HGMA 2XWTB 1GAFL 5EUOA 3AY4A 4JQIH 4KGJA 3BD4A 2G2RB 3UTSD 3FTGB 1DBML 2DN7A 5K9KB 3MRFB 1DLHB 3L3IB 1FGVL 4E0RA 1F4WH 3GBMH 4UQ2B 3GB7A 3NVQA 3O41A 1ZVSB 3P30L 3O45B 3IF1A 3T3PF 3HE7A 1A6UH 1KJVB 3VWKB 1N5AB 3LCYA 3TBWA 3MA7A 5DHVH 3LZFH 1VESA 4KTDH 1SY6L 3CZFB 4AJ0A 2AXGB 4LCYB 2OBGA 4U1LA 5FECB 1LP9E 5FA3B 3UC0H 1I1AA 5GSVB 2AJYL 5AG9A 2J8OA 3GUTA 1UB5B 1TCMA 1KBGL 3UTPE 1U2CA 1NUGA 1L6ZA 4R4FH 5DRWB 2W59A 2EDBA 4N1EA 1UZ6E 4CKVX 4OIBA 3C5ZB 1RURL 1MIEH 3FN0L 5D1XC 4KJQC 1ACYH 3IS1X 2P5EB 2EXYD 4KZDH 1FPTL 3GHEL 2VUYA 3KPRA 1NMBH 2HT2C 2XZQH 3TPUA 2ICWB 1P9MC 3SE4C 2VLLB 1XR8B 4FABL 3HI1A 3MROA 1G7JA 4FQLH 1UCTA 5DYOA 5JHDE 4X9IA 1BVLA 2GUOB 5GS0L 4KKAD 2ESVE 5MEQA 2GYSA 1A9BA 5T1KD 4RIRA 1YNTA 1BIIB 2C4FT 5TE4L 4GXUN 1KNOA 1NANH 3VCLA 1MREL 4YBQD 4LDOB 3JWDC 4WO4C 1KCSL 4GKOA 5GISL 1I7TB 2UZIH 2X2YA 4F2MA 1ZGLM 1U8IA 1QYGL 5HY9A 2R56L 3KLHD 3PGDB 4PJHB 1RK0A 3QWQB 5KJRL 4NQXA 3FRPG 5AYUH 4J3OC 4YWGH 2FB4H 4WVRA 5HGDA 1EAPB 4AMKH 3RTQB 4B50A 1CFTA 3BP4B 3MRQB 4HS3B 1OAKH 1E4KA 3X12B 1VFBB 1PZ5B 4ZFFA 4MQ7A 1OWWA 3MBEC 1KT2B 4HEPG 4NM4H 15C8H 4H88H 2BHYA 4O2CA 5FDWB 4GG6F 4MJ2A 3JTSA 4JFEE 4OLWH 4Z7NF 1ADQA 3SDCA 4NBZB 1DBBH 1NAML 5MP6H 1FVDB 1U3ZA 3BPCB 1V05A 2YUXA 3GI9H 1CN4A 2C4XA 4HPOH 4M43H 3PHSA 3QEQB 1GGIH 4F80A 3GRWA 2D2OA 1ZK9A 1UFUA 3TJHD 2XTJD 3QFJE 5C0BB 3ZL4H 4Q97A 4PJ9B 2HVJA 2DJ4A 3LH2H 2XOTA 5J12B 2Z93B 5FOBA 5AZEH 4OKVA 5F9WB 1HXMA 5JXAH 3WYRA 5FV2A 5TDNB 1IGJB 2EDTA 3F5WB 1Q94B 4LVNB 5HHVH 5CS7A 4ETQB 1EFXD 1EMTH 4O51A 4PV8A 3VFRB 2ADJA 4YDJA 1P53A 1WBYB 4AG4L 4OLXH 3GMPA 3BKMH 1CIUA 1S3KH 4QHMA 2UWEF 1C5CH 4GG6A 3ARRA 1ZT7A 3T0BA 1O7SA 4WW2B 3MR9A 1RUQH 4ODSH 1F4AA 3MRKB 1A22B 2F8XC 3KG5A 3AU1A 3OKOB 4NQSA 1PLGL 2VL5A 2MTPA 1WIOA 2VDMH 1TZIB 2EEAA 3HNSL 4XCFL 4OCXH 5ID1B 1REIA 1S7SA 5GS0C 5C0GB 2ZUSA 1AP2B 2VLKE 4XMPL 4NKDB 4KK6C 3KPSA 3QI9A 3RI5K 1DSFH 1MNUL 2K7QA 4FQXD 3BIBX 1OGAA 1WCQA 4N68A 5CD5D 3QG6B 3OKDA 3U4AA 4JANA 4KROD 4B5EA 3TYFB 4JFPB 4Q6IA 1K3ZA 3GSUA 2R0LH 3V5DA 5M7QA 4BK5A 4F7PA 3T2QA 1S7RB 1RZIA 4OQTH 3U0PB 3CPLB 1S7WB 3L1OL 4XMLH 2D31B 2UWEA 1AGDA 2YD1A 4X8JA 5JORB 4LU5H 1S9WA 1T1ZB 1S9XA 1BBJB 1BQSA 1M6OA 5D6DC 3JWOC 1CVSC 4WY7L 1NKOA 5ADPH 5E1AB 43C9B 3ZSTA 2HKFH 1FVEA 1PSKL 1Q0YL 1I8MA 3VH8A 3MJGX 1MCFA 3T0XA 1L9NA 3O8XC 5IHUL 5JO5B 4N5ED 3W0WD 4KI5F 3QRGH 4NJAH 3RVVC 5J1AB 4MA1C 3U4EA 4PGBB 1OGTB 2Q3AA 1LDPL 2DLHA 3RZWA 1KLGA 5CSZA 2H45A 2DJSA 5D7LD 2VDKL 4P5KA 1BWMA 5DZOA 5C07B 3DX7B 3MLVL 2UY7A 3F7RA 4LVOC 4MNQD 2UUDH 1IGYB 1CYGA 5I1IL 1PX4A 4PBWD 4UAOC 4M5YL 4KRPB 5F44A 4KK8C 4KHTL 4JFXB 4ODXB 2LU3A 4JZJA 1MAKA 1WFOA 1RZGA 3BN9D 4R8WL 2AK1L 3SKNA 2GJZB 1Z5LB 1P4LB 4JO3L 1UZ8B 3MLRL 3OAYK 5FA4B 5T33L 3SKOA 4FQHB 4WJ5A 3IDXH 2IAND 1U95A 3WN5C 3VFNB 4WUUD 3K74B 5CUSH 2Q20A 1TVHA 3WXVH 5F89B 3SGJC 3O4OB 3SO5A 5J89A 5EIIB 1KTRL 4ODVL 5F9OH 1UM6H 2EH8L 1P5UA 4MNGB 1I3RB 2C3VA 1ZTXH 5B22A 5KSVA 1KJ2L 4MYWB 4YIQB 3B8SA 3BO8B 2H3NA 4JJHA 3QWRA 5C0RL 3MXVL 3WN5B 3QDJA 3GBNL 3VI3F 4MD0B 4PJ7B 1F6FB 1AR1D 3ZLQC 5E2UL 1O7VA 4R90H 4L29A 1SEBA 1SBBA 2AEPL 3Q5OA 3NGBB 1WWWX 5C6WH 1J5OL 5JQ6L 2LE9A 3D85B 4LPUA 4X5XB 1G7LA 5DUPH 2EE6A 1I7UB 4O5LL 1A6VH 4PRPD 3VXSB 1IM9D 5C0IA 1N59A 4AT6B 2NLJA 2YWZA 5JTWA 4ZSOB 2XG5A 2GK0A 1MFBH 3LY6A 3JV6B 1GGCL 4N1HB 2VR9A 3ILPB 3BKJH 4U0RC 1E4XL 2DYPB 4LSSH 4XCYB 3EDJA 2JKXA 5DJ8B 4LSVL 3PHQA 1UXSB 5JHLH 3ZT7A 4PRAA 3P0VL 3ARQA 3TA3B 1EEUA 1H3UA 5H37G 3CMGA 3BGFB 4XPTL 1SYVA 2RJMA 5LGJB 1U3JA 2ITCB 5EH1A 4JHBA 2AJ3B 4M62L 3DLQR 4LEOB 5DZNA 4F7MB 3G6DL 2PXYB 4KK9C 4KJYA 4HBCL 4OGYH 1YC7A 3AXLA 4IS6B 2OZ4L 4KDTC 1H3PL 1TQCB 3T8XB 4G9DA 3N0PB 5BJTB 5GZOD 4BZ1H 4JG0L 1IAIL 2EXWD 5FGCB 4MAUH 4Y2DB 3IDGA 3GSXB 3UBXI 3HB3C 2Z8SA 4RAUB 4ZAKC 1WF5A 5ANMB 1I85A 1LE9B 5T1KA 1U58B 2NQCA 3AS3A 2APVA 1NAKH 4JCLA 4I2XA 1AH1A 4TSBL 1CK0H 4GBXC 1CD8A 4OF8A 5HYQB 1P4IH 2WIIA 3V79C 3TNNA 2R23B 5D1ZA 2IPKB 1VHPA 3O4LE 4HIXL 1Q0XH 3O2WL 2FJHB 2WBJD 5KSUA 1AO7D 4J3XA 1GSMA 3PV6B 5MEOA 4LRIC 1ZXQA 1MI5E 5INCB 2XZCH 3QEQE 7CGTA 2JCCA 4UT6H 1DUYB 3KR3H 3C08H 3HRZB 2R2BB 4XI5C 3QDGE 4M1CC 3LEXA 5DD6A 5HI5D 1GXEA 4W70A 3C60C 4PUBL 2GTWB 4TUJB 1UEMA 1A7PH 1JGVL 4UOJA 1JPGA 2EZ0D 5L0QB 4JFDB 2HTKD 1KJ2B 1OTUD 4K94L 3UDWA 4HXBH 4OZHF 3BKCH 1RAMA 3SCMC 3I85A 5B4MD 1CT8B 4WFFE 4HEME 1KCRL 3DETC 2BSRB 3KAAA 3TV3H 1RHHB 5I1JH 3GGWB 1YQVL 2ED7A 3L7FA 2JK5B 1EHXA 2J4WL 4UB0L 3PGFL 1NFIB 1I75A 3NA4A 4DUXA 1MCHA 5CSBA 5T5FL 3OL2A 4X9BA 4KDVA 3CUPB 1IILE 3KPPA 1QVOB 4JFQA 5H8DA 5L88L 1OTSC 2W0LA 2P8LA 3UTOA 3TFKD 4R2GD 1LEKA 4RMTA 4LF3B 4XP5H 2OQJB 4G8EA 3CFEB 5IQ7H 3ZHKA 4MZ3A 1T66D 2Q8BH 4PY8J 3TWCH 4HF5L 4PD4J 4FXGB 3IU4L 3DO7A 2Z4QA 2X1WL 4PJ5A 4ZTOL 3S9DB 2Q7NA 1CU4H 3SJVA 1AGCA 3WL9A 1J05A 4C54A 4XAKE 5BVPL 4O2FA 2X1PA 4NZUL 4JJ5B 2EDXA 3B9DA 3UBXA 5IVXF 3G5YA 2FHBA 1YEIH 4ODUA 3WJJC 2HLFD 3OJVC 1YECL 1ORQA 2H1PH 4HS8H 4FQXA 2M26A 1A3RL 5FYLH 3ZE2E 2H32B 4IIQA 4D0DA 5GQBA 4TOYH 2I9TB 4PRBB 5GS2D 5FUOH 4RMRA 5BS0E 1TFHA 4OD3H 2V5YA 4R7DA 1X9QA 5HHME 5A16B 3B2UD 2OMBA 3CDFA 3F8UB 1T20A 1UJ3A 1NCUA 3LKPA 1A6WL 3OB8A 3EO9H 3IFOB 5GRZA 2IGFL 1MHHB 1RUMH 3VGAB 5CEZH 5C07E 4MJIB 3IJYB 3VXQB 3NBNA 3IFPA 4X5WB 4U6XB 4K94C 5I16A 2R1XA 4KMTL 5B38B 3FO9A 4GXVL 4HKXB 5A2IH 1RK1A 5AG8A 5HGBB 4JGMA 1RIUL 3W0WA 5I1LB 1TJGH 5ESAB 4AEIL 4L3EB 3VJ6A 3G5XB 3IDJA 5HGGS 2DBLH 4G43B 1BQLH 2BNRE 2R8SL 5D7LA 3CFKA 4D0CB 1K2DA 2EDDA 2A6JA 1KEGL 3QDAA 2PW2B 1MQKL 4MNQA 3W39A 1LHZA 3QO1A 3FT4B 5TQ0H 2X4TA 4TNVF 1C12B 5GIRA 1TZHA 1V8HA 4OGZA 4UU9B 1FYTE 2AJUH 4NUGL 1T7YA 4HIIB 1FFOA 4MXQD 5IMLB 3O6FC 4AM0A 3QCTH 4OI7A 2DAVA 5JUEH 5J9PA 3NCCB 1JZ5A 3LN4B 2JB5H 3MUGB 3QH3B 5DHYB 1IGIH 4BQ6A 5SX4I 4APQC 1S7UA 3BZ4A 2IANA 2FBOJ 3EJZD 4ZOAA 1J10A 3EZ8A 5GGRA 5DJ0B 5CBAA 5IF0B 3PWLB 2D0HA 2YPKB 2BVEA 3D3VE 1FAIH 4G8GE 4PJEB 5GGQL 3SQOH 4XHJC 5I2IB 3GMQB 3CX2A 5SWZB 1LNUA 3RWEA 4FMKA 5C08E 4LASL 5IB1A 4UIMB 1E4WH 4C4KT 3S36H 1ZS8B 1DDHA 3PE9A 3CMOH 4DVRH 4N8VB 3E8UL 2QSCL 3TLRA 3HMXL 3VFWB 1AJ7H 4K8RD 3SE8H 1CLZH 1F2QA 3IT8D 2FBJL 3G5VA 3T2PA 3QUML 4R97B 3VGEA 1SVCP 3M8OL 3O9WD 1F2XK 1FDLH 4U1JB 1KXVC 4HH9A 3EO1B 1LO3H 4JFFB 3WBDA 1I7ZA 3L7EB 4MVBD 4PRPA 1IM9A 5EOCJ 2D0GA 1BZ7B 4OCWH 4YPJA 3MRBB 3RZCB 3QXDA 4WFHE 3MZTA 1P7QB 2AVGA 2OL3H 3CFJB 1T7ZA 1SJVA 2X4RA 4OFIA 1FZKA 4OZIE 1N64H 3FFCE 5D70H 5F93C 3KLSA 3ZTJH 5IWLC 3G6JE 2IBGA 1J8HD 4MDIA 3T1FB 4MQXD 4OAWB 4L9LC 2R0ZH 5MERB 1G6RB 1YJDH 4HKJA 5L7XL 5EWIH 4JQIL 4MX7B 2V5TA 3HE6D 3BHBA 3DRTB 2VSCA 3FKUS 5ANME 4QRPD 5HGHA 2YK1L 2IBZX 4G9FB 3ALWA 4FXKB 4U1HB 3GBML 5DO2D 1S7TB 2DI9A 3MGTA 3HAEB 4NBYB 1N4XL 5TDPA 4JFZH 3SPVA 3JV4A 2WP3T 5F1IB 3EHBD 1A7RL 3EAKA 3HZKB 2GJ6A 3LZFL 2BSTA 4KTDL 4U1NB 4S1SH 1Q72L 2UVFA 3ZYJA 3SDAB 2VXVH 5CWSA 2X05A 3UC0L 3FFDB 3DXAB 3FB6B 3JVGC 3QG7L 4YHLH 1S5HB 5TF1H 4Z77B 3BH9B 3GSNH 3OKEB 4BYHA 1XR9B 4OZFA 5T3XD 4XNUL 5F70A 4HG4K 3O81A 3BP7B 2WBJA 1DQLL 2PW1A 1AO7A 5A2LH 5HYSB 5F7DA 2HTLD 1T89C 1ZVYA 2Z8VC 3LEVH 4KZDL 3N1FC 4M6NH 2R2HB 1K8DA 4HCRA 1NMBL 2XZQL 3N1MC 1RPQA 1ZHKA 2W07A 1QR4A 4D8PB 5GHWH 2PUQT 4K3EH 4ZPVA 5ITFB 4Z0XB 3L3JB 3PL6C 2C1PB 2AEIT 2UZXB 4M6MH 4U33A 3UTQA 2Q76B 2CPCA 4CADA 4YNYA 1MJUH 5FYJE 1UWXK 5I71C 5DVNA 4NNYB 4N90E 4TNWF 4P9HH 2UZIL 3BYTA 3NIDE 3CVHH 1MJ7H 3WV0A 2DIJA 2R9HD 1NCBH 3I02A 5I1AB 1P9MA 1D5BA 1U3HD 3QUMB 4YWGL 4GS7B 3RL2B 2QLVB 4AMKL 1BQHG 3EYVB 1KLUB 4IHOB 2DQDH 3PQYB 1OAKL 1ACZA 4B53A 3WSQL 1JNLH 4OLYH 1MHEA 4NM4L 5DMGC 4JQXC 5KVDL 4C56E 5HD8C 2DRUA 1KB5A 2JELH 2ZOKB 2PTUA 3QAZC 4HUVB 2GK2A 5JW3H 4NFDA 1U8MB 3U46A 3A6BH 5CJ8A 5DQDH 3JXAA 3BEWA 5IHZA 3G5ZA 4ZDHA 1KIPB 3GI9L 3AMKA 2E3VA 3L3KA 4ZFGH 4HPOL 4PJBE 4M43L 5IJVB 2NR6D 1I7RB 1GGIL 5GJTL 4PY7B 2ERJC 4PJIB 3AAZB 3VXNB 3ZL4L 4RQQB 5T3ZD 3MBEA 4U3CA 5EO0A 3LH2L 3HUJE 5K9QG 3J8F7 3RWGB 1XGQB 5AZEL 1VACB 2VDLL 4YK4B 1QZ1A 1U8OA 1ND0A 4GXUM 5JXAL 3ZHDA 4FFZL 4HV8A 4Q9QH 1G0YR 4KQ4H 4OF7A 4YR6B 4CRPA 1R5IB 3BP5A 4G5ZL 2GIYA 5EOTB 4HWBH 4N9GB 4MCYB 3K81A 1JTPA 5FEBA 1MLBB 1PVHA 5JIKA 4Y5XC 1S3KL 1C5CL 4F9PA 1JZ2A 4QTHA 3UJIH 3M1BB 4PS4L 2YA1A 3BUTA 4LSUH 1RUQL 4OZGE 1BFVL 4F58L 2F58H 2YRPA 2VITB 5C7XH 2AGJH 3MFGB 2E7LA 3TBYA 4LBEB 4JE4B 2EDHA 3HNTH 4NC1E 4Y5XB 1FO0A 2XTLA 3CX5K 4OCXL 4Y5VB 2IWGA 3FQNB 4ZUUA 1GIGH 1DFBH 5IB4A 5L6YL 4HS6A 3NFNB 4YEEA 4UNVA 2YD2A 3TH2T 4P2OD 4IJ3B 4XPFL 1X5HA 5BV7H 2H9GA 3WS6C 3FB8B 4IOIA 5SWSD 3M17A 3WUWA 3QIBD 2OSLB 2EC9U 1LK2B 3BZEA 2XXMB 4PY8I 5KN5A 1EHNA 4RFNC 2R0LL 4M6AA 5FKPB 3DYMA 2OTUA 3WO4C 4YDVB 2VLRB 5D7SL 3QXTA 5IOPB 1EEZB 4OKDA 4LU5L 5AUMA 3QP3A 1OP3K 4XC1H 4LNRB 3AM8C 5CLTA 5F1NA 4K71B 5C8JA 1W72A 3LDBC 5LGHH 5J57B 1TVDA 4X7EC 3VRLF 1TJHH 3KXFB 5B3NA 3I3DA 5TE6H 3VFUA 5EDXA 4L8SA 3QRGL 1HCVA 2OXGA 4NJAL 1JWSA 4HIEB 4IRJC 3CC5A 3RPKA 1W0VA 4X7TA 3OJDA 1W0WB 3MLZL 4BSWB 1KPVA 2NY2C 4X6BB 5SWQB 2P8PA 5K33A 5I74B 1UC6A 3WNLA 4EVNA 4JB9H 5F7NC 3U0TA 1SJHB 3FAWA 2BERA 4I18C 3EOBA 3QQ4B 5FGRA 4WV1B 1GYAA 5AZ2H 1EH9A 2DWDA 1JZ6A 4JHAH 3DURA 1BEYH 5DD3H 3IDIB 3SHSA 5JOFA 1MY5A 3QZWG 3RWHB 5K9JL 5EU3B 4Q7DA 1OAUH 4QHNA 4I9WE 1TITA 1JNHB 4JRXD 4FMFA 4OF3A 1JCKA 4G8IA 5ID0A 1OW0A 1VCAA 3O9WA 4M7KH 1BD2B 3UAJC 4P57A 5BO1H 1JK8B 2Q1EA 3HMWL 4JDVB 4PRDB 3G08B 5C3TA 4HKZA 5JA9A 3KJ6L 1L7IH 2GW5A 3WXVL 4ZS6C 2IQ9H 2J3SA 3LB6C 1D5MB 1AIFB 3G04A 4KH2A 3V0AC 3GKWH 1QP1A 3RNQB 1UM6L 5GGUA 3IGAB 1RVFL 5D96C 5C0AE 5IJKA 4FXLA 3STZB 4NKOB 1Q9WB 3IAGC 3BSZH 1T0MB 1QRND 1PQZA 3VFPB 4GLRI 4R96A 4PV9A 5DQJB 3S5LB 1DANU 2VIRA 5EBWB 4R90L 4M48L 4DGYL 5E00A 4QRPA 4LLVA 1EK3A 4QHLB 5E99H 1D9KC 3V6OC 2NNAB 1FN4B 1XCQB 4XXCC 3QNXB 4P2QE 4YQXH 3BUYA 1A6VL 3M07A 5CILH 2WW8A 4P2YA 4XWGL 2PETA 4YBLB 4J6RL 1OL0A 4X9FA 4QCIB 3PDDA 1KELH 3PV7A 4H1LA 1D9KB 1UACL 2XYCA 4G7YL 2HG5B 3L6FB 1J86A 1S7VA 4LSSL 3V5KA 2BOCB 3O0RL 5EU6D 1WZLA 5D2NA 1XF5B 1BAFH 1OPGH 4X7SL 3ARTA 5CZXC 1J1OH 1G7QB 5JHLL 2V2TA 2QV2A 3I2CH 1GPOH 3S88H 1RIHH 2Y5TB 1XGRB 4ZXBB 3MRRA 3BPLC 3GDBA 1EZVX 2APXA 4X6CF 5I18H 1PG7X 2XWJA 5J56B 4M7JL 1FNGA 2J5LB 3QISA 1BZ9A 2BHZA 3Q48A 2X4PA 1B6UA 5LKNA 3D69B 4BZ1L 4R0LC 1G9NH 2CLRA 3LHPH 5I73B 3RGVD 4XNXL 4MAUL 3DX9A 4KUCD 5I8OH 5EC1B 5CIPB 4I48B 4G80B 1DBJH 4QTIL 4GRMA 3AMLA 4FHBD 4ZUWB 1NAKL 1HI6A 1PKOA 1XF3A 5LXGL 2C1OB 2EDYA 4PJGB 5DI8B 1P4IL 2G60H 3MCG1 2CRZA 3QULA 1KV3A 1TNMA 3JV0A 1ZV5A 3B3IB 1U3HA 5DJ2B 1DQQA 2AABL 4M61B 8FABB 5IIEB 4BJLA 2A9MH 1HDMA 3LKSA 2IBZY 1YEEL 4PJIE 5IMOB 2WWKO 4I3SH 2BNQE 4X6CA 3C08L 1WK0A 4POUB 2A38A 3L9RA 4XC3H 4MXVF 1A7PL 1J7VR 2BC4B 1HILB 1S9VA 4AIOA 4U2ZA 3BKCL 5IEHA 3VWJD 3MREB 2HT3D 1YEKH 4Z7UB 2YKLH 3HC0A 3RPIA 3OB0H 3TV3L 1RZJH 3C09C 1KACB 2VNCA 1U8PB 3RUGF 5E2WH 1R5VB 1T03L 1URLA 5KSAC 2JF1A 3VD3A 1EXUA 3VD5A 5I1EH 5ISZD 3MJ6A 5K9OB 2EKSB 1OTTC 4N8PA 5HDBF 4HW6A 4ZFOA 1X44A 2PYFB 4D9LH 1M71B 1T4KB 4HUMB 2LTQB 1AC0A 3UP1A 1PYWA 3AS0A 4DCQA 2FEDD 1YMME 4EI6B 2O5XH 3BPOB 1E6OH 1G1CA 3PWUB 5CSGA 5DEGB 2BDNH 4XP5L 1YY9D 1OSPH 1U92A 5FIEA 1A7OH 3MMEB 3QXWA 1I1FA 5AEAA 5IQ7L 2EYSB 3FT3B 2NZ9C 1ZT4B 3ORJA 4NO2B 1NGWB 1GJIA 4QYOA 5DJXA 3MACH 2ZCHL 3QEGH 2VDNH 1EHLL 5JDSA 1VGKB 1K3IA 5DRNA 3UTTD 3D18B 1JNNH 1MFCH 1NGZB 2EO9A 4OF5A 4RFOL 1PG7H 1Y0LA 1YEIL 5C92A 4MSWB 5JMOC 4JZNB 3MRCA 5FGBC 3MRJB 4LLAA 1XF2A 3BQUC 1D5ZB 2IMNA 4P2OA 2QHRL 4ZMAT 3SO3C 4HWZB 4PLNC 1FVCA 2AKRB 4TOYL 1F3JB 5SWSA 4P4RB 1U91B 3QIBA 2FD6H 4V1DB 2AJSH 4MNHA 3LQAC 4A2MA 3PWPB 4OD3L 3KXFE 3B6SB 1S7XA 2JB6A 3T0AA 3KNBA 5JZ7C 1HQRB 4GRWH 3H9HB 2VLJB 3F58L 1KN2H 4KTYA 3RDTD 1UYWL 3HZMB 4P5TD 3MUY1 5CKGA 3EO9L 4HIJA 1X6NA 1JF1A 1AQKH 2WINB 1M05B 4LSQH 1IAMA 1RUML 2RB8A 3U30C 5CEZL 4OUUB 3OKYA 5JHDD 3RU8L 3ULUH 5L9DL 4IRSC 4NZDA 4JPIB 3R0NA 4HKBA 4NKMB 2NTSP 3W9DA 3MOAH 1C5DA 2W65B 3BXNB 3QNYA 3TVMB 4JFOA 2XQYK 3GIZH 5IW6B 5KVEH 3T0EB 3G6AA 1DUZB 5T1LB 1T21A 3SDXB 4Q6YA 3OGCA 4YX2L 7FABH 4XBGA 2EDJA 5J8OA 2DBLL 1NC2D 5HHOE 1BQLL 3T4YB 2CUMA 5IMKA 1SEQH 2LVEA 3NH7H 4MAYC 2CH8A 3NPSB 4BH7A 4PJCA 5J4MA 2YHGA 2FECL 1CTOA 2HFEB 4OV5A 1B2WH 3LD8B 2CIIA 1BECA 1IEAA 4W68A 2VXUL 5TQ0L 2VAAA 1ZHNA 3D0LB 3PGCB 3BISA 2AJUL 2CXKA 4YAQA 4YZFF 1G1YA 4S0TD 4QRQA 4YHML 4S1DC 4JRXA 4PG9A 1C1EH 3JTTB 4NWTH 3QCTL 2FYYA 3IXAB 4CVZB 3UTSB 5JUEL 1L7TL 2F5BH 1J11A 2EYTA 2W60B 3CFCL 3OF6D 1CD1B 3FOLA 5TGBB 2B1AH 3KPNB 1MHPH 2Z8WC 3ROLA 3W5NA 1WEJL 2AV7B 3SKUD 3QJHA 3QIUA 1MCQA 1YN6A 12E8L 5SX5H 1T6VN 4R26L 1GGTA 1AGBB 2V5MA 1CICC 3SQOL 3MXWH 3MGAA 3HKFA 1ZHLA 1QRNA 2VQ1B 3D87B 1KIRB 4DFHA 1E4WL 3S36L 2ICWJ 5HVHC 5CJXC 4NIKB 3WNNA 4QT5B 3SGKA 3UZVB 3SE8L 1CZ8H 1CDCA 1YEJH 3V6OE 4AL8L 4DEPC 1XZ0A 5FYKD 3T65B 4QKXB 3RIFK 1M7IB 1FDLL 4KK5C 4J23A 1NFDE 4JN2B 4ZQKB 4K23H 3SKMB 2A74A 1ADQH 1U8JB 4KUCF 2XIDA 3RWFB 4OCWL 1BF8A 5L8JB 3VMNA 4Y7MA 1QKZL 4YHZL 1UXWA 1H8SA 2NY3B 4R4ND 5ESQA 4X99B 4LSRH 1H15B 4ELMB 3GRWH 2FGWL 3FZUC 1N64L 5EU6A 2BP3A 4L4TE 5D70L 1N2RB 5BW7C 3LPWA 2DLFL 4KKBC 4EUPB 3DV4A 1FLRH 2NY5H 2AK4B 1IGTA 4NRZA 2MKLC 3RWIB 2D7TH 2ED8A 1F13A 4L3AA 3L3GA 5ERWA 4OCYH 2BSSA 5B39G 5JIPA 2EIEA 4PG2C 4UTAL 1XIWB 5ENWA 1NMAL 5DRXA 1RZ8B 3ZKMD 2NY0C 4YC2C 4EI5C 1OD9A 3T08A 4JFZL 3EYFB 4XH2A 5HHQA 3RGVA 3CLEL 2A83B 5TPWH 5B39A 3O11B 4R6UA 1RULH 3ES6B 4S1SL 3I75A 4LLDA 1IC5L 2VXVL 2LV4A 3V7AE 3VE0A 2DQCH 4QRRA 1U8QB 1EIBA 4YHLL 1BFTA 3VFVB 3ZT5A 5TF1L 1DQMH 3L95B 4TSAL 3V6ZA 3GSNL 1XGYL 3ARFB 4PJFB 4ODHH 3OGOE 2VZUA 4LCWA 4ZPTB 5JXEC 2VQTA 3BWAB 3LEVL 1JRHI 1T5XA 1JYXA 4NHUB 1AI1L 4PJ8C 1MVFA 4HLJA 4Q2ZB 2VISA 3MYZA 4WTZG 5MHSE 4K3EL 1IEHA 4LAQL 3GSVA 4M6ML 1DBKH 4Q9RH 3HCVB 1G7HB 3UYPA 1FNAA 3VWJA 5D7IF 1NLDH 4MA8H 1MJUL 3B4NA 3OR6A 5BXFB 4PJDE 2MHAB 2BJML 2EDKA 3LKRA 4P9HL 2IAMB 4OZHB 2D7PA 1K4DB 4GW1A 4PIRF 3ARBB 4YFLI 1NCBL 5LBSL 5E8NA 1LP9F 1GGBH 4WDIB 1XGPA 4RX4D 4NN6C 5HXMA 3WFEL 4J12A 3LOWA 4RGNC 2DQDL 3TZVB 4M03A 1EZVY 4GKSA 1JNLL 3RX5A 4KPHL 3R4DA 3MJ9A 3VWKD 1R5WA 1UZ6F 4OLYL 5FO9B 4JGUA 1YJDC 4JN1H 2JELL 3QQ3A 4FQIL 4KVNL 2JJWA 5EO1A 5IB5B 5JW3L 2QQQA 2XV6B 3SE3A 1Y6KR 1U41A 5DQDL 1F6AA 3ELAT 1CLCA 4Z95L 4CVXB 4HFUH 4HWEH 1ZT1B 4LHJB 4RBPH 1JNJA 4XBPA 3A6CH 4LHUG 3VXRB 3S35X 1LVEA 1FV1A 3VXMB 4TVPH 2ADFH 1A64A 5D7IA 3DRQB 4DFIA 5FK9A 5B8CB 4X98B 3PWPE 2P7TB 3C5ZD 2QBWA 3UTTA 1YC8A 4MXWH 1B90A 2P5ED 1G0DA 5L2JA 1MWAA 4NCC2 2FIRT 3RKPA 4Q9QL 4YFLF 3KPLA 1NBZA 1BOGA 1KIQB 2XN9B 3LSOB 4KQ4L 1BX2A 2LFGA 4NRXA 3ZHLA 4LMQE 4ONHA 4HWBL 4AENB 4DUVA 2XA8L 5IP4A 4YBHA 3MX0A 1S7QA 3MOBL 5BMFL 4EDWH 2YA2A 3QHFH 2B8OT 5FF6A 4OLEA 4N0FA 4WW1B 5FKAB 3QJFA 5HDQH 2YD8A 4LSUL 3UYRH 3QNZB 3SDXE 3B43A 4AIZA 4HHAA 1XGTB 3GSNB 5ICXB 4P5TA 4FQ2L 1NEZG 1UEYA 4UNUA 3QUYC 3P73B 4L4VE 2NY7L 1ZKAA 3MCLH 5HGAA 4CU8A 3HNTL 3MUJA 5JHDA 5D93C 3RTQD 4NDMA 3I3EA 1GIGL 1DFBL 1VADA 2AXFB 5EC2A 2DQGL 1MH5A 1U8KB 1KPUB 4L5FL 3U2SB 3RFZC 5FCUH 2DQIH 3GBLA 4JY5H 5EZLA 3MUZ1 4P9HC 3V7MA 1U8LA 5BV7L 1LE5B 3C5SA 2I07A 1LEIB 1HOCB 3O4LD 1NC2A 4H8WL 1XH3B 3SBWC 3H9SB 3RY4A 4KXZH 4PREB 1CD9B 3QEQD 1T1WA 1KB9J 1DR9A 2DQFA 4K7PX 4LLWA 4Q9CA 5C0BD 4YUEH 2Q7YB 1PG7W 3Q1SL 3GMLA 4RFEA 3O3EA 2V17H 4QRSB 3DTXB 3MLYH 1C16A 3ARVA 1TVBB 4NQCB 4LCCA 2N4IA 2A6DB 1EUUA 2FX7H 4JAMA 3BH8B 2G9HA 3ARGC 3MCKA 3LV3B 1J12A 4WFFD 1TJHL 5DFVC 2OP4H 5TE6L 3H2WA 4X7DC 1NJ9B 3ZKXB 3DROB 1OCWL 2ITDB 4NC0B 4ZUSA 1GH7A 3OF6A 3MRPA 5E6IC 3DBXA 1I9EA 3GJFA 2CDFB 1PZUB 1OHQA 5FYLE 3UJJL 2G5BB 32C2A 4GG8A 4JB9L 3QCUH 2BHUA 4YGVA 3S35H 2NX5E 3UYOD 3PXJA 4NZRH 3QQ9C 1BEYL 3NZ8A 2WWMC 2HKHH 3KHQA 4MQSB 1Q1JH 4NO5B 5F6IB 3U36B 3T1WA 2YD9A 1OAUL 1RI8A 4BH8A 3CU1A 2Q8AH 1MIMH 1AGEB 4F37F 1DN2A 1QG3A 5EU4A 5CEZE 1IAKA 2HN7A 2VXTH 1FZJA 4CU7A 3LVEA 4JFYA 2AK4E 1RUAH 1D6VL 3BI9X 3H3BC 4XNYH 4Z7QE 1HH9B 3WXWH 4TTDC 5KAQG 3AREC 4Y16B 3TNMA 1XF4B 3GKWL 3QXAB 5MI0B 1A1OB 1QOKA 3ZE0E 1F4XH 4QXGH 2LABA 3L3OA 4RSVA 5I1KH 3QUXB 1A6TA 2R0WH 5EN2A 5EA0H 5H35B 1HHKA 2MSPA 2V9RA 1AXSB 1IC4H 3NPZB 4P46C 4PRIE 2OX5A 3GIVB 4HUWB 4XGZA 5BV7B 1A4JB 3REVB 4Y19B 1PY4A 3VDBA 5E5RB 2IALA 4GH7B 5C07D 2NMSA 5GS1B 4BSJA 4D9RE 1FBIH 4HWUA 4PJFE 5CILL 1JWMA 5HHNA 1TMCB 3OMZA 2DM2A 1A6AB 5INDB 4DTGH 2VTFA 1IGMH 4K7PH 5MENE 3BVNA 2UY6A 1I9RH 3IDYB 3ULVH 4KRPD 2ICWI 1SBSL 1OPGL 4MS8C 3T04D 1YEDB 5ICYA 1EEYA 2NXYC 3I6KB 1J1OL 3GJEB 2VXSL 3DIFB 2GCYB 1G6VK 1XCTA 2BY3A 2WAHA 4Y4KB 3VRJB 1GPOL 3O2DA 3S88L 3R8BB 1JI2A 4ZUTB 4PGDB 4Z7OF 5IROC 2NXZC 1U8NB 4HFWA 4N1CA 3ZSSA 3PWVB 1MUJA 5EUKA 5I18L 4UDTB 3GSQB 2A0LD 4XTRD 3MJ7A 5IQ9B 1A8JH 3FB7A 4G6AC 2NY1C 1AHWA 2BVOA 4EN3B 5CZKA 5CEYA 3DX6A 3OKNA 1KJ3H 5F7EL 4HG4J 1G9ML 3WLWD 1G9NL 1FRGH 3LHPL 3FB5A 4PTUA 1IFHL 2VLME 3RVXD 3FT2A 4F7CB 2A6IB 4OLVH 4W6WB 2B1HL 5I8OL 3E6HA 2YPLA 4JY4B 4XNMB 4JY6B 1XGUB 4HQQH 4HD9A 1K8IB 2XWTA 1QA9B 4XP4H 4N8CL 2XPGA 4CGTA 3WNPA 2G2RA 2G60L 3FTGA 4JG1L 2BVUA 2ZUQB 3ARZA 5K9KA 3MRFA 5IBLC 1QLRB 1DLHA 3L3IA 3CH8A 3BZDA 3QUZB 1L0QA 4RX4A 3D85D 4UQ2A 1T6WA 1ZVSA 2A9ML 3O45A 4M7LT 1N6VA 1KJVA 3VXSD 4XAWH 2XRAH 3VWKA 4NKIH 5AAWA 3TC9A 5EU7C 1N5AA 3MRDB 5C09B 4HLZH 1H5BA 4JO2L 5DTFB 3CZFA 1PKQE 2AXGA 4YXLH 2DYPD 4IDLA 5FECA 4MD5B 2OTPA 5FA3A 3L3DB 3WKML 5GSVA 1QSEA 5D71H 3OG4B 1YEKL 1UB5A 1W0YT 1MCWW 1VGEL 2YKLL 4LLQB 1EBAA 5D1QB 5DRWA 4KY1H 2YRZA 3TA3D 3C2SA 4NQEA 1RZJL 4W6XB 2F54B 1DEEB 3SOBH 2BMKB 2FZ3A 3C5ZA 4PLJC 5CJBA 2ZSVB 4WFHD 3WDIA 3OKLB 4G6JL 2P5EA 2PXYD 1A7NH 4CAGA 4XWOD 5TQ2H 5DD1L 4K2UH 5I1EL 4HMDA 3FFCD 4MQTB 3CNKA 4NKQB 2WUBH 2ICWA 1WJ3A 2FR4B 1U8HB 4U6HB 2ZCLL 4OM0H 2VLLA 5C0JB 1XR8A 2OM5A 2DIAA 3V95A 1MF2H 2XFXB 4Y2DD 1PEWA 2GUOA 4KV5E 1PGRB 2O5XL 2YRLA 4K3DL 1E6OL 1JPFB 5GPRA 4DKAA 1BIIA 5D5MB 4DVBB 1I7TA 4P59H 3VXUE 3VG9C 3PGDA 4YHIA 4PJHA 3MACL 4LNVA 2VDNL 1EAPA 3RTQA 1MFCL 3BP4A 3MRQA 5DUMH 4RRPA 3X12A 1VFBA 1PZ5A 5F7FA 5E70A 3B9KB 5DJ6B 5D2LE 2PO6B 3ARDC 1KT2A 1QSFE 4DWHA 4S10A 5ICZB 3RWCB 5FDWA 4PRHE 5IVZB 4KVCL 1D7FA 2XNAB 4N0CC 2Z35B 3CX5J 3R0MA 4WW2F 3B5TA 1JHTB 4JFDD 4OT1H 2FD6L 1B3JA 1FVDA 3BPCA 1RJLB 1T2QH 3GMOB 4OB5L 2VZ1A 3HPLB 2X89A 1I9IH 3C6LB 3P9LB 4XI5D 1CXKA 3C60D 2FL5B 4RDQF 1KN2L 4X6DE 5D6CA 5C0BA 3F7PC 1WTGT 4PJ9A 5E5MA 1AQKL 4LSQL 2Z93A 3EDEA 3GI8H 4QF1B 4XVJH 4DUWA 4P2RB 5IFAH 5E9DA 3L5XH 5TDNA 3SKJH 1IGJA 3F5WA 2A77H 5T5NG 1Q94A 1D5IH 3MGOB 5AAMA 1BREA 2EIZA 4ETQA 3MOAL 4N90D 4AYFA 3VFRA 5KVEL 1X5GA 3S7GA 1WBYA 1FG2A 4JCMA 1TTFA 2JLLA 3ZYZA 3KS0H 4GAGH 7FABL 3VFMB 1KTDB 4JM2C 1GC1H 2W9EH 1SEQL 3NH7L 3WIIH 4CMMB 4WW2A 3MRKA 1HINL 5E8OB 1ETZB 3OKOA 2HAZA 5D7JB 5SX4H 3U6RA 1B2WL 2J8UE 2ZNXA 3RVTC 3MFFB 1TZIA 4TULH 3GM8A 4POZD 4PBVC 4OZFH 5ID1A 4O58H 5C0FA 4N0UE 4QWWC 1AP2A 1D5XB 1NGXB 1HNGA 4GW4B 1EJOH 1CVRA 4NKDA 2HMIC 4U1SB 2DTML 4NWTL 2VZSA 2FH6A 2VUOA 3QG6A 4HJGB 5DGRA 4HCRH 4LPVA 5ACZB 5TE7H 1JFQL 4Y5YB 2HLAB 4V2CB 3IU3B 3TYFA 4JFPA 3B9EA 2D9QB 3QIWB 3D39B 4DK6A 3OXRB 3WIHA 5C0NC 1T7XA 1S7RA 3U0PA 4J3WA 3CPLA 1S7WA 2YD7A 4PTTB 2D31A 4Z7VB 6FABH 2NY4B 4Y19E 5JORA 1T1ZA 5I1GH 1BBJA 3MXWL 4MJID 4TUKH 4AH2B 4JM4H 1UA6H 4K7PY 5F7MC 5IESL 5E1AA 43C9A 3IJHB 1P84K 4WI9A 3EFDL 1VENA 2MPAH 5FCSH 5JO5A 1JZ8A 5IM7B 4L8BB 1YEJL 1E4JA 3BE1L 4L3ED 5J1AA 4U1KB 5E8DH 4L1DA 3FO0L 4PGBA 1OGTA 5DSCB 3AY4C 1KB5H 4K23L 1N5YH 2VN4A 5C07A 2X09A 1ADQL 3JWDH 4LPCA 3DX7A 3ULUC 3V5HA 1CQKA 3IKCA 2I60H 2WMPA 4U0QB 4X4ME 3DX8B 5CJOH 1Q9LA 3OAUH 2ZNWA 1IGYA 4OF6A 4PJ7F 1TIUA 3HE7C 3TO4B 5KSBB 1MHCB 3O6MH 2X9WA 4JFXA 4ODXA 4NFCA 4YHYC 1DBAH 2X7LB 3NFSL 2GT9B 1FLRL 2XWBB 2GJZA 3VI4E 1Z5LA 1P4LA 2BVQB 1I1AC 2VDQL 1UZ8A 4RAVA 4OCYL 4WENB 5DK2B 1HQ4B 2COQA 5IBUG 4IOFD 4GOSA 4DKFH 2OK0H 4O9HH 3VFNA 2I26N 4F57H 5F89A 3LKOB 4MCZB 5EIIA 3TYGH 4MNGA 5TPWL 4B41A 1I3RA 2L4OA 3LN9A 1ITBB 4YIQA 5SWZD 2VQUA 3TO2B 3NTCH 1DVFB 1JJUA 2D03L 1CFSB 1NLBL 3WD5H 3MV8B 5BRZB 2DQCL 5CHNB 4MD0A 4NQDB 4PJ7A 5M94B 1WTLA 1FO0H 3V4PH 2B4CC 5E8EB 1U93B 1HHGB 2QADC 4YXKL 5FO8B 1K6QH 3LN5B 1WFNA 3G6JF 4X5XA 4JFFD 2VDRH 5EU7E 3MZGB 3WNMA 1I7UA 5ESVB 1OARL 3VXSA 3BAEH 3HI5H 4AT6A 1ZLSL 1CDJA 1MAMH 4ZSOA 3RZCD 4OCNC 3H3KA 1RV6X 4XZUB 3FQWB 4I9WD 5BZWB 2GTZB 3MV9B 4G6KH 1P7QD 5KTEH 1I1YB 2DLGA 2DYPA 1E4KC 4KTEH 4PGCB 2EDLA 1FL6B 4YE4L 3ESUF 4XCYA 1UM5H 5DJ8A 4P4KB 3S6CA 5CGYC 5KS9B 2O61B 1FLTX 4MA8L 1IGFH 1UXSA 4TN9A 2DQJH 1DN0B 2R0KH 3TA3A 4UDUB 3SDCC 3TH3T 1ZGLB 2VKWA 5LGJA 5J1SC 1E4XI 3WFBH 2ITCA 2AJ3A 4G9FD 4LEOA 1GGBL 4YDIH 1QFUL 2OMNA 2PXYA 5F9DC 3SN6N 4D9QD 4IS6A 2F53E 1CR9H 5HI3C 3T8XA 2ENYA 2P8MA 3RUGB 5E6ZA 5BJTA 3C2AH 5F97E 3FN9A 1GGYA 4I13B 2IJ0C 4JN1L 4M93C 4P3DB 2NY5C 1I9JL 2EKJA 3GSXA 4UIKH 4RAUA 3GSWB 5ANMA 3SDAD 1LE9A 5A40E 2H6PB 4JZOB 1U58A 3DXAD 2H2PD 4HFUL 4HWEL 5CJQL 3SDDB 2APBA 2HVJB 1IAII 5HYQA 5HVWA 1HSBB 4M93B 3AB0B 1C08B 4TVPL 2IPKA 3SGDI 1RMFH 4J4PD 4K8RH 5HYJB 1Q9KB 3PV6A 1JGLL 4X9GA 2P5WA 3I3BA 5INCA 4I0PB 1AXTH 3NIDF 1IAOB 1ZVHA 2R2BA 3QWOB 3I9GH 5I0ZA 2VZOA 2DQHH 2R15A 1WT5A 1LK3H 4Z0BL 4TUJA 1ZT7B 1JP5A 4JFDA 4H20H 1KJ2A 4FOMA 1R3IH 5DEZA 4OFPA 2YA0A 3QI9C 1DQTA 1TZGH 3DMMB 2M1KA 1CIDA 1CT8A 2BVYA 2VL5B 2BSRA 5HDQL 3QA3B 1RHHA 5DK0B 4Q58C 3GGWA 5DDHA 3UYRL 2DB8A 5BVJB 1AFVL 2JK5A 1C7SA 1N7MH 4OFYD 2PYEE 1NFIA 4A6YL 4Q6IC 4P23B 4LSPH 4U3XA 4LPWA 4XP1H 5CGTA 2VMFA 3PQYD 1MRCL 3CUPA 4LVEA 1QVOA 4E41B 1KTKE 4JANB 3FQRB 2DQIL 4JY5L 4XPHL 4FP8H 4KRNA 1RHFA 5I75B 4LF3A 4NN7C 5IK3B 2OQJA 1BQUA 3CFEA 4H1LH 2XKUA 1AGDB 3WCYA 2PKDA 2ZUUA 5HDOA 3WIFA 3ZYIA 1S9WB 4U6VH 1CL7H 4FXGA 4NSKB 1WLHA 3BESR 1M6OB 1CDIA 5C1MB 3OPZH 1Z9OA 3QDMB 4WHCA 2PCPB 3KYOB 2OTWB 2HJFB 2V17L 5T3XH 1WBZB 3O6KH 4OZGF 3FCTB 1EGJL 2OZ4A 1I3GH 2CKBL 5F71A 4CMHC 2OP4L 2H32A 5CSZB 3MLXH 1QBML 2I9TA 2Q87A 2E6JA 4JZJC 5GZND 4LL9A 5LQBH 4ORGA 3NCFB 3MJ8B 5A16A 4N0YL 1LD9B 1OAQH 5E5UB 3TM6A 1KN4H 1AXIB 2VO5A 3QCUL 3BDBA 1K85A 4WEBL 2NY6C 3DI3B 3S4SG 1PY9A 3IFOA 5I30L 1OAXH 4KI5C 1UWGH 1MHHA 4NZRL 4MJIA 3IJYA 3VXQA 3MV7B 4UI2A 5HHXL 3VGFA 2HKHL 1SQ2N 5B38A 1Q1JL 4HKXA 4GRWE 4Q0XH 4PP1D 5HGBA 2MCG1 5AD0B 5DMIL 3S3JA 3F7YB 2Q8AL 4M5ZH 5I1LA 5ESAA 5EUOE 4OLZH 4L3EA 4GLRH 3G5XA 1TVHB 4CL7A 1YPZB 2IFGA 3BOVA 3ULUE 4G43A 1FORH 1QEWA 1R3KB 2AJZA 1NGQH 2ZJSH 4MD4B 4D0CA 1YY8A 1RUAL 4UV7H 2AV1A 3OG6B 3RVWD 1MCLA 4C57C 2PW2A 4MZ2A 2DM7A 3LEYH 2VXQL 2VLRD 1T2JA 3FT4A 1C12A 4A6YB 2HFFB 4YH6A 1SYSB 4UU9A 3BDYH 1ZMYA 4HIIA 2R0WL 2RFXB 5EA0L 1JTTA 3FRUB 5IMLA 3KXFD 1HKLH 2VDOH 4YHOH 2JJVA 1EO8H 1MLCB 1HCFX 3LN4A 3MUGA 2X4QB 1MCCA 3QH3A 5DHYA 4BZ2L 3QDHA 2AI0H 4I77L 4JO1H 2YUVA 2FLBT 1CWVA 4Y4FB 5GGTH 5DJ0A 4NC2B 5IF0A 3PWLA 1FBIL 2YPKA 2IPTH 2O93L 1OOAA 1MCIA 1ED3B 3KPRE 2BOBB 4PJEA 4ODWB 3GMMB 4ZG1A 3W81A 2QSQA 2EXYC 3NCYS 5I2IA 3GMQA 5EOCH 5SWZA 4K7PL 5I9QB 2AXJA 3B5GA 1I9RL 3ULVL 4K9EH 5F9AC 1RY7B 4UIMA 3T09A 1ZS8A 1QHPA 1B0RB 4CVUA 5ILTH 3MV9E 3VFWA 2CKBB 5C0CB 1KIUA 5FM8A 2A9NH 1J0JA 4KKAC 4KJYB 5DJCB 1I85C 3MUHL 3P4MA 4OD2B 4R4BB 1F42A 4U1JA 2IBBA 1BD2D 3EO1A 1MCJA 4ZS7H 3L5WB 2BX5A 4JFFA 4YBQC 1FQ9C 4MB4A 1ZE3C 3KLHC 4Y89A 4GAJL 1NC4B 4KKLD 5DQ9B 5ISZB 1BZ7A 1J87A 1MCOH 3MRBA 5JPNB 3RZCA 4Z7WA 1KJ3L 4PR5B 3GK8H 3TN0B 1FRGL 1P7QA 3Q0HA 5IVOA 1F3RB 3CFJA 4OLVL 5I6XB 5LGKA 5BZDB 6CGTA 4EOWH 5IHLB 3T1FA 1CDYA 4HQQL 5D1ZB 4Z5RB 1FZMB 5MERA 1WBXB 1G6RA 1IZJA 3SDYL 4G6MH 1INDH 1KYOK 4MX7A 1VA9A 3UDWC 3DRTA 3KPOB 5KVGH 5JNYB 4G9FA 4FXKA 4U1HA 3OAZH 1S7TA 1JGDB 4AEFA 2RHEA 3CXDH 2WUCL 4BQ9A 3TJHC 1KEMH 2XTJC 5HVFB 1JPSH 4CN4A 5FUZH 1AY1H 4GRLB 4NKIL 2FX9H 5F1IA 3HZKA 3T2NL 4EQ3A 1D9KD 4U1NA 5DLMH 2Y06H 2B7DT 3SDAA 3DV6B 4ISVB 3FFDA 1YEGL 3DXAA 3FB6A 3L7FB 2XI9A 1S5HA 2E7HA 4FZEH 4Z77A 3BH9A 4GG6E 3MODH 3OKEA 3LRHA 4KY1L 2EH7L 1XR9A 4ERSH 1AD9B 3WFZA 3BP7A 4ZXBD 4J4PA 1R24B 5HYSA 1OB1B 1NCNA 1MFAL 3IRPX 3SY0B 3DWTA 2VH5L 3MRLA 5TH2B 1A6PA 1A7NL 3VGDA 5TQ2L 5CZXD 3ULVC 4H0IA 2R2HA 4K2UL 4ZTPH 4XNZB 1JUFB 4H26B 2ESVB 4RGMB 5IUSA 4D8PA 4OM0L 4Z0XA 2Y25A 3L3JA 3OR7B 2C1PA 3VRIB 3KPSE 1MF2L 2EYRB 4WHTB 3T77B 5E08L 1OGAE 5D7KE 2Q76A 3BWUC 4PJ5B 1V7NH 5FFLA 4FQXC 4PJIF 3BN3B 3SJVB 2UZYB 4MLSA 5FO7B 5CD5C 4NNYA 1C8PA 4IIQC 2E9IA 3P4LA 3E2HB 4FS0A 4UZGA 4WWKB 4RBPK 3EYOA 4KROC 4BA8A 4OFYA 4ODUB 4XNQA 2UWEE 1ORQB 3QUMA 1T83A 35C8H 4MMXC 3EYVA 1KLUA 1UJ3C 4IHOA 3PQYA 5EO9B 4JFEB 5DUML 1NANI 1A6ZB 2X42A 4L1HA 3U0WH 1JHKH 3VDCA 3QO0B 4ZD3H 1HYSD 2ZOKA 4HGWB 2X4NB 4HUVA 1MSPA 2EE3A 3BW9B 4OT1L 3U7YH 1TCRB 1ZWIB 3QFJB 3WDHA 5CKAA 4KJPD 4N5EC 1GZPB 4O02H 2FWOB 1RJZB 1T2QL 1KIPA 4K07A 5IJVA 3LAFA 4PY7A 1OQOA 1FL5B 3B83A 1TENA 4PJIA 3AAZA 3AROA 3LIZL 3VXNA 2CGRL 1BM3H 2IC2A 3BPNC 1XMWA 3RWGA 1EA9C 1XGQA 1VACA 1ZLWH 5E95B 2DIBA 1H3XA 4XVJL 3U9PH 2EEBA 4MGXA 5IFAL 3L5XL 4J7RA 3VJ6B 3IDJB 3CSYB 4YR6A 1X5JA 4TVPE 3RVUD 1R5IA 5IV2B 1UKQA 2APFA 4PYHA 4N9GA 2FHFA 4MCYA 3TCLB 4H25A 3KJ4C 2Z31B 2I27N 1MLBA 1UWEH 2A6JB 1DLFL 3MPCA 1OWRM 4NJ9L 3BN9C 5EPMB 4GMTL 1B0GB 1CXIA 3M1BA 1R3LB 2W9EL 1B4JH 2W9LA 1MQ8A 1WSST 2FNBA 5K93A 2J2ZA 5GIRB 3Q3GB 2VLKB 5CJ5A 2VITA 1SMOA 4NO3B 3PUCA 4OCMC 1BIHA 4LBEA 1CDGA 5I19H 2MNUA 3TBSB 3S97C 4Y5VA 3FQNA 4AM0B 4EIGB 2OR7A 4GQ9H 3NFNA 1FC2D 1PX3A 5J9PB 1EJOL 1KCVL 1YNKH 3QDJE 4Y4HB 4O4YL 4HXAL 4IRZH 2ICCA 3WFHB 3L3HB 3U4BH 3FB8A 3C87A 2B2XH 5CBAB