5B7EA

Structure of perdeuterated cueo
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
501
structure length
477
Chain Sequence
RAVFAAERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVSAWSHPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical, spectroscopic and X-ray structural analysis of deuterated multicopper oxidase CueO prepared from a new expression construct for neutron crystallography
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase CueO
total genus 138
structure length 477
sequence length 501
ec nomenclature
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7eA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7eA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7eA03
2PCFA 1A4AA 5I6KA 1GS7A 2DYRB 4QLWA 4KO7A 2TSAA 2XXFA 4AKQA 2DWSA 2J55A 2FJSA 2E86A 3NSDA 4E9WA 1ASQA 1ETJA 1GS6X 1BQKA 1JZJA 3WIAA 5E9NA 3NYKA 2PPCA 3QPKA 6PAZA 1XB3A 2Q5BA 1V54B 3PAVA 1OE1A 3UADA 3NSCA 2IWFA 4HAKA 3DIVA 3V9EA 1XB6A 3KW7A 2DWTA 3FSVA 3PXLA 5D4IA 1JXGA 1A8ZA 4QKTA 1SDDA 2GB2A 1ADWA 4E9XA 1AZBA 2EILB 3FPYA 3JT2A 1NPJA 1WS7A 1IBZA 3UAAA 2BHFA 3N2JA 1PZAA 3FQ1A 3OMAB 3X2QB 1ZV2A 2BZ7A 3NJMA 2XV3A 3GYRA 4KO5A 3S3BB 1L9RA 4GXFA 1JZHA 2CALA 4UANA 5I5JA 2AVFA 2IH8A 4HZ1A 3UAEA 1PNDA 2XX1A 3AZUA 1OCZB 1N68A 2WO3B 3ASNB 4AX3A 4HHGA 3WKPA 1X9RA 4G71B 1JOIA 3D12B 3ASOB 1MZYA 4BWUA 1GS8A 1CC3A 4NB7A 1V55B 3PLYA 1BYPA 2VMJA 1BAWA 4G70B 3NJIA 3ABLB 1AZRA 3IN0A 4L0PB 4JHVA 4G7SB 2N0MA 2YAPA 4A68A 3FU7A 2YQBA 3NJKA 5TK2A 4DP2X 4GP5B 1AS7A 4F2EA 1TEGA 2HRHA 1E5ZA 1PCSA 3KW8A 3CVDA 3NJFA 1YLBB 5I6LA 2BP0B 1L9OA 2HX9A 3AG3B 1OV8A 3T71A 1FA4A 5I5IA 3WNJA 1NINA 2LLNA 1NPNA 3NJNA 4HCIA 3CDZB 5B7EA 3MBWB 3CVCA 3QJSB 1A65A 4YL4A 4YVUA 8PAZA 3X1BA 4BDVA 2EINB 2UXFA 4G72B 1W6LA 5PCYA 4TXVB 5D4JA 2YAEA 1VLXA 2GIMA 3EH5B 4MFHA 3EHBB 4DP9X 2UX7A 1SFDA 2X88A 3EH3B 3UACA 2JXMA 4BXVA 5I28A 5I6OA 4A2EA 2OJ1A 4DPBX 1ZIBA 5I6NA 1GY2A 4NERA 1WAEA 2CJ3A 1RCYA 4KO9A 4G7QB 1KYAA 1OE3A 3OM3B 1B3IA 1NWOA 1MG2C 1PZBA 1RKRA 3ABMB 4CSZA 5F7AA 1PY0A 2FNWA 3CZUB 2XLLA 2YAMA 1WS8A 2YARA 2HRGA 2XU9A 2VSKB 4UAHA 4E9SA 4DP8X 1NIDA 4N4YB 2Y1AA 5B7MA 4A66A 4FA7B 4AKOA 4DP4X 2BW5A 2BP8B 4E9YA 1ET5A 4K9JA 4UF7C 1PLAA 1KDIA 1ILSA 5TK4A 3ZBMA 3FS9A 3OMNB 5AKRA 4GY4A 3WI9A 3CDZA 3CG8A 2FQFA 1SFHA 2B3IA 1PZCA 3WG7B 4W1TA 4FAAB 1AR1B 2IDTA 2BP0A 2PP8A 2YAQA 2VW6A 4KNTA 1J9RA 2XVBA 1E30A 3SQRA 3S8FB 2VN3A 2CCWA 4M4RB 1AIZA 3OD3A 4KOCA 3S3DB 1AACA 2W8CA 1AS8A 1PLCA 4YSCA 2VSMB 2PP7A 2R7EA 3NSYA 2ZXWB 3H4FA 4E9RA 4BK5C 3OQRA 3FQ2A 2IDSA 1AZNA 1JVLA 2YAHA 1ZDSA 3ZIYA 1NIFA 2YXWA 1KCWA 1JZIA 3T6VA 4KNSA 1OCOB 1NDTA 1TEFA 4M3HA 2WSDA 2B08A 1XB8A 1J9TA 1ASOA 2IDQA 1MG3C 2BP8A 2XX0A 4HCFA 1J9QA 1CUOA 1DZ0A 2HX7A 2VM3A 3AG4B 3C75A 4HIPA 3ABKB 3H4HA 3G5WA 2UXGA 1AQ8A 3UGEA 1JXFA 2Y69B 2OCCB 1BYOA 1JXDA 4A2HA 7PAZA 3ERXA 2GC7C 3FSZA 2J5WA 4YSUA 2YAFA 4AZUA 1M56B 2MRYA 1ET7A 2FT8A 4KOBA 5B3SB 2GHZA 4DPAX 1E5YA 2VW4A 2HXAA 2DYSB 3FPXA 3IE9A 2BWDA 3PPSA 3UABA 2ZONA 1E65A 2A3TA 2PCYA 2QDVA 4P5RA 1XMEB 3TU6A 3TBBA 1OF0A 2BW4A 4JHUA 2QT6A 1DYZA 3NP4A 4A67A 1SF5A 4KNUA 4DP7X 2AZAA 1ID2A 2PLTA 3BQVA 4YSTA 4W9ZA 2FT7A 2IH9A 4BDVB 1AG0A 1GR7A 1NICA 1URIA 2RACA 3MX0B 3FYIB 1W6WA 4E9VA 2FQDA 1BQRA 1MZZA 3NJJA 2FWLB 5EHFA 1A4BA 1GSKA 4E9TA 2P80D 3QJVB 3QJUB 2UX6A 1AOZA 1ZPUA 2H3XC 3NJGA 4RH4A 1EHKB 2JKWA 3AG2B 4N8UA 2IWKA 3V9CA 1AG6A 4PCYA 2BZCA 1W8EA 1E67A 3S3CB 1KCBA 1ZDQA 5LDUA 3QJRB 1AANA 3PCYA 1ILUA 3FU9A 1EZLA 4Q8BA 3FU7B 5D4HA 3FSAA 1BXVA 1A3ZA 1PF3A 3DTUB 1NWPA 5F7BA 4GP8B 5B1JA 3HB3B 4YSEA 1PAZA 1SJMA 2GBAA 3NSFA 4F2FA 3X1NA 2UXVA 3RYMA 5PAZA 3TASA 2CBPA 1QHQA 1IBYA 3CVBA 2XYBA 1RZQA 4GP4B 2PPFA 1CYWA 2FQGA 2I85A 2MTAA 2EIKB 3FQYA 3IBOA 4KO6A 2I7OA 5B1KA 2VW7A 4YSAA 2XV0A 4YSPA 1V10A 3PAZA 3WNIA 1JZFA 3EH4B 2GSMB 2PPDA 4DP6X 4HHWA 5AZUA 3DKHA 4P5SA 2J56A 2AZUA 2GC4C 2Q9OA 3GXUB 4Q89A 1R1CA 2EIMB 4EF3A 1L9PA 2BO0A 1IC0A 2BWIA 4ENZA 1J5CA 2XUWA 1CYXA 2XV2A 4HALA 1CURA 1WA0X 1AAJA 3FU8A 5I5MA 1FFTB 2I7SA 2H5UA 3IEAA 5B1AB 1BQ5A 1L9SA 1KV7A 3S8GB 3N55A 2IAAC 1WA2X 4YVNA 1HAWA 2H47C 2ZWNA 4BWWA 1UATA 3X1FA 3SBRA 4G7RB 1BXUA 2DV6A 1NIAA 2HX8A 2XXGA 1AZUA 1NTDA 2IDUA 2PPEA 3X1EA 4DP0X 1GY1A 1NIEA 2FQEA 4WKXA 1ET8A 2PPAA 5I26A 3T6ZA 2PP9A 4X4KA 5AFAA 4WTQA 5A7EA 4JKNA 2DY2A 1JERA 1PMYA 4YSRA 4BWTA 5IY5B 1X9UA 1J9SA 1AZCA 2QDWA 2W88A 4AKPA 3AW5A 1M9WA 3PAUA 1OCRB 3SBQA 1KGYE 2WO2B 2J57A 3ZDWA 1J5DA 1L9QA 1GYCA 2IDFA 2YAOA 1GW0A 3OMIB 4YSQA 3HEIB 3NT0A 2CAKA 1A4CA 2AFNA 3T6WA 1MDAA 4NAJA 2OV0A 2QPDB 3ZX1A 2QPEB 1JZGA 1BXAA 1RZPA 3WKQA 1M57B 1NZRA 1PLBA 2JFCA 3AG1B 1PNCA 1T5KA 1TU2A 3NJHA 1N70A 6PCYA 3NP3A 4YSOA 1IUZA 2FTAA 3FYEB 2HLEB 2X87A 4GYBA 5B1JC 4ZK8A 3QQXA 2P80A 3QJQB 1TKWA 5I6PA 1ZIAA 1BEXA 1JVOA 4HCGA 7PCYA 1SNRA 4AI7A 1QLEB 2UXTA 1HAUA 1HFUA 3ABGA 2AANA 4E9QA 3FSWA 3NJLA 5I6MA 3X1GA 4BXSV 2XWZA 9PCYA 1AS6A 4DP1X 4DPCX 5B1BB 4F7KA 1WA1X 1OOWA 1QNIA 2ZOOA 4YSDA 4A2GA 3SBPA 1KDJA 1SDDB 2IWEA 1FWXA 3TA4D 1I53A 3TBCA 3U25A 1KBVA 2YXVA 3IN2A 2VM4A 5ANHA 5FC9A 1SHWA 2CUAA 3H56A 3AY2A 4DP5X 4CSPA 1NIBA 1L9TA 1SHXA 4A2DA 1JZEA 2GI0A 2R7EB 4A2FA 4YSSA 3GDCA 2HZHA 1SF3A 1ASPA 1F56A 2NRDA 5B7FA 3JTBA 3T6XA 2FT6A 3T9WA 2TSBA 1OE2A 4PAZA 1KBWA 3L45A 1OCCB 2EIJB 1IKOP 3EF4A 3FT0A 3QJTB 3BVDB
chains in the Genus database with same CATH superfamily
1ZTXE 5FHAH 5TDOA 1CDYA 2G5UA 2XWJA 4JO4H 4QLWA 3Q05A 4FXGC 2R2BB 2YLHA 2Y07L 3PU7A 1HE8A 1G4RA 5C0IB 1BBJA 3K72B 5E6SB 2FJSA 2ZUWA 5JXED 4ZXBB 4RWYL 5DHDA 3WIAA 1UXLA 5EOTB 3TO4A 2V3FA 4J6IA 4PJEA 3EOYG 4BZ2H 5AYTA 4XI5C 4XN4A 4MX7A 4TSAL 3VMOA 2MPVA 2P43B 2VLJB 4LSQH 2R27A 3WSQL 4AJVA 4WFHE 1RIHH 1DQLL 1JZDC 5DJ8A 2E7LA 2OS7A 4PFEA 1BPLB 5CEXA 1ZHLA 4X7SL 3MLSL 2NY7L 2N7AA 4MS8C 1OM3H 3BISA 5KYUB 3BXNA 4PBXA 1F97A 1KPRA 4MQXD 2XWEA 4NQQA 4JB9H 5EFIA 3FT3A 5A6LA 3PABB 4BD4A 1UA6H 2BNQD 2X4TA 2A74C 2HCZX 3B1TA 4QAWA 3X13A 4PJBF 1E4WL 4F80A 3SE4A 1BZQK 1J86A 2CK2A 3N1FC 2YKKA 5SWZA 1LO2L 2ZXCA 3D2UA 3F8UB 5FYJD 3T65A 2OTWA 1RPKA 3IDNB 4ZODA 4F9LA 4MJHA 2L3BA 2XI9A 4NUJB 1CLCA 3CZLA 1DVFB 5EUOB 3QR2A 1NGZB 1BVLB 4LL9A 2Y7LA 2V9RA 4RAUA 2DI7A 3VO0A 1QOKA 5GZNC 5FXCH 4ONOA 3WKPA 2EDDA 3DDGA 5M94B 4JFHD 2F74B 4F2ME 5F1KC 1MIMH 2BHZA 3T3ME 1W91A 4Z3GA 1HOCB 1MWAH 3A67L 3P69A 3IDGA 4MJ5B 5DK3A 1J8HB 1JGVL 3GBML 2KZKA 2F74A 2VRQA 1ERNA 4WRLA 4RSVA 1R24B 1U0QA 4FQCH 3VQ2C 4F3FB 1P7KB 3SGDI 1NUFA 3K8KA 1JWUB 1O9WA 1XF4A 4X6CA 5DJ0B 1YEJH 3IFLL 1RUMH 1E2WA 4PRNB 1T0OA 4ACTA 3O8XB 2KPNA 3TEYA 1TUPA 3ARYA 2D7TL 3FB5A 1UH4A 4J2QA 3L08A 4HV8B 1I1AA 2XRAL 1RFDH 2R2EB 4UCFA 4XPGH 1O7VA 3CZFA 1AGCB 3S34L 2HX9A 3T71A 4EI5A 2XN9E 1FA4A 4K3HA 1SXCA 1KLUA 1W2KT 3VCLB 3BH8B 5C07A 1NPNA 1Q9KB 2H6UA 4B7IA 2L7EA 3CFJB 3MROA 4JFEE 1LP9A 1NLBH 3O6MH 4XNZB 4RIRA 3KGUA 4Z7OF 3IWVA 3L6FA 5MEQA 4KKBD 1K72A 2KUTA 3MKKA 3ZVVA 1UXMA 2Y06H 4PJDE 2EDXA 4DEPB 2YWYA 1J0KA 3GHBH 5E1IA 1U36A 4I88A 3QQDA 5IP4A 4FL4C 4XP5H 3F04A 4ZSOE 2NY5H 4DP9X 2FBOJ 5DEGB 4KI5D 2EXWC 4HZLB 5I82A 2VITA 3U0WH 4OZHE 3B2VL 1ZIBA 3VXNA 4AYFA 1FQ9C 2MOQA 2DKSA 2EVFA 4R26H 4G7QB 1G6RH 1A6TB 5KBKA 2GG1A 4HWBH 3G5YB 4KROC 2NUTB 3DVGA 5F6HJ 4X83A 4WO0A 3P0VL 4KZDL 3Q44A 1U95B 3EJRA 5AW3B 1HSBA 3M07A 3T04D 1XCXA 2YAMA 2A6DB 4EQ2A 3UG5A 5FDWA 4DQOL 1F8TH 3KPLB 2PO6B 2GKIA 1OM3L 1KJ2L 1LK2A 2C9UA 3W0WE 3W3BA 1KY6A 1XDTT 2JJSA 4M43L 4MQXC 5TFSL 3PJNA 1DEEB 2IQAA 3TNMA 3SDAB 3VXUD 4RSYA 1IBFA 1KTLA 3BO8B 5TQ2H 4ZRGA 1S7SB 2W9DH 3U2IA 3PWPA 2AEQL 3TNMB 2P42B 2JKJA 2YRZA 4GBXA 2PP8A 2X4NB 1BM3H 4U0RB 1J9RA 3SE8H 3IDJB 3T2QA 3CN0A 5C08A 1MHCA 1HXMA 4QYOA 3TJHC 5AWNH 3T0EB 1TTBA 3IMBA 2YD6A 4MKTA 5CCJA 1DO5A 2DH2A 5D9SB 2VJ8A 3CH8A 1G7QB 3RUGA 4OZFG 1KCRL 3GO1L 4FA6A 3AADB 2UY7A 4DK5A 3WS3B 1CGTA 1EIBA 2YD4A 4FQQA 4HK0A 3RL2A 4BUGA 5L2JB 2WBJA 3D51A 1XBDA 2OMXB 2QPSA 1J9TA 1WV7T 1ZTXL 4MZ3A 1FO0L 2QHLA 4WI2A 2APVA 1UWXK 4FMKA 4MD0A 3QNFA 3LPFA 5TDPB 1QTPA 1WTGT 1TJGH 1XSIA 3PL6D 4QOKD 4UQAA 5J11C 3FT4B 4JFDD 1HOCA 4L8BB 1OIOA 3H4HA 8FABA 2WOYA 3MLVL 5L8KB 4TVUA 1IL1B 2NY4D 3WIHH 1DN0A 3PNWB 4G82A 4OV5B 3W82A 1KJ3L 3FOMA 3QG6B 5JIKA 4N8VB 5HDBB 1BFVL 4U7SA 4GS7C 3TPUA 4J12A 3QNXA 3GJFA 4NFBA 3BEWB 4P59H 1ETB1 3D4GA 1WBYB 1JF1A 5C6TL 3VM5A 4KOBA 4RGOL 3K1KC 1PSKL 3HS0C 3FPXA 3NEEA 4Q2ZB 1OK8A 1XR8A 3C5SB 5DRNB 1SXBA 3SO3C 3D08A 1BMGA 3FB5B 2YRBA 3LVEA 5E8OA 5EU6B 3WN6A 1NBZA 5FFOA 4LEOA 3LPGA 5TQ2L 1BLNA 4A6YH 4PI0A 5IMMB 1BVOA 1JPGA 2AJVH 2F54A 4IKLA 4AW4A 4QXTB 5JHDA 4N2OA 5HGDA 1IV8A 1JI2A 2NTSP 4GAGL 4YSTA 1C9SA 3CPLB 1CFNA 3S37X 4OCWH 5IMMA 2X4PA 2CO7A 2EYRA 3EF7A 3PQYB 5DTFA 3GIVB 4OJEH 4XH2B 3FONB 4YBHA 5K9KA 3C60D 5BZWB 4QHLB 5DEZA 3LB6D 3VM7A 4YAQB 4WUUA 5INCA 2JTDA 2VC2L 2VT0A 3NIDE 3ARDD 1OQXA 4GAFB 3BPCA 1I7ZB 1L7TL 2WTRB 1AGFA 2CIKA 3AXIA 4N8UA 3UOAB 1BZ7A 4O02B 1Y0LB 1KGJA 3KPNA 1KXVA 5CJXC 1D9KC 1G9NL 1NAMB 4M00A 1JNHA 3DC0A 3IXAA 4FABL 4ZUSA 2X09A 2Q76A 3EGDB 2XQYG 3CX2A 4XPFH 4J8RB 3BCFA 3FU7B 5E1HB 1RJCA 3QXDB 1SN0A 3QEQE 1WP6A 1PAZA 1T1XB 3BSZH 3GSUB 2BDNH 3HMXL 5LGJA 5JPNA 3WO3B 5DWUH 1OF2A 3VXMA 1QQDA 5TH2B 5FYJU 5IQ9B 4NQUA 1GXEA 1T0PB 4OCXL 3TV3L 5DUJA 2XYBA 2OQJB 4AH2A 2X6MA 1L9MA 4E42B 3FTSA 3DJSA 1SEBA 1WTLA 1KCSH 2AQQA 2ZCZA 3HZMA 3PAZA 1IC4H 4Y4HA 2PPDA 1ZJAA 5I17B 2BSDA 2XQBH 3M86A 4EZMA 3NN8A 4JDVB 1WWBX 1VSCA 4LSUL 1KIUB 4FFWD 3OLGA 4FN0A 3SQBB 2Y1ZA 3NZ8B 1QSEB 2H8PA 4ZPTB 4YNYB 5E5MB 2OMTB 1P9MC 3CFBA 4FA8A 1MJ7L 2IPTL 3OC5A 4B27A 1G7JB 4GW4A 1NGQH 2Q1EA 3UZVB 2HKHH 3BEVB 4IS6A 1D2OA 5CZVH 1FFRA 3JT0A 1T04A 5FGSA 4GW4B 5GPRA 4G7RB 1LWRA 4YGVB 1NIAA 2DQGL 2CM6A 2XC8A 2YPKA 4HISA 2PPEA 1U4FA 2IDUA 2VC2H 3L3HA 4ZUWB 1GTFA 4LCWB 4B3EA 5CP7A 3ULSA 1XIWB 2D4FA 2AGJH 2NXYB 5I1EH 4H8PA 3K46A 3QDMD 4JHZA 4AMKH 5AFAA 3NFSH 4PB9L 1F11A 1MN4A 1TJIL 3ZE2F 5DQJB 3FCSB 2DL2A 5ADOH 4Y4HB 5IW6B 1KGWA 1A4KA 4GUQA 2WO2B 1YEHH 2ZUVA 2QKIC 3VWKC 1JTPA 4XMPH 4ZG1A 1G6VK 2JXMB 5DMIH 1UCBL 2C34A 5A7BA 1KJ2A 2C1OB 1UD2A 3WKQA 3RWHB 1EMTH 3SODB 4GW5B 4FYRA 4OH2A 3VFWB 5LNDA 5DD3H 2VR4A 2CD0A 5ENWA 1FNGB 5EORL 4BFJA 4ETQB 3KG5A 3OKDA 4N85A 1T89C 1TCRA 1ZA6B 2DB8A 3OR7A 2V8LA 3FYEB 3LKQB 3WKYA 4HGWA 1EZVX 1MCCA 2OZ4L 4W6WB 4AVJA 5D2LF 5A6MA 5JW4R 2GJZB 2WLLA 4AYMC 2LVEA 5IR1B 3QJQB 1QR1A 1MCIA 3VX0A 4P23D 2BNQE 1SNRA 3DNKA 1VADB 4NPYA 1EBPA 5DUPL 5BW7A 4HWBL 4HUVB 3K5SA 2YRPA 5IZ7A 3E80A 2Y6SD 4BXSV 3KYAA 3IDMA 3M46A 3MRFB 2VDOH 4BELD 3ARSA 5EU6A 1BP3B 4Q0XH 2HKHL 4JFWA 4KXBA 4QRRE 3TBCA 1A0QL 5IJKC 2YO3A 1ND0B 4HIQA 4NNPL 2AXGB 2B16A 3DROB 2HTLD 3V8CA 3NZUA 5DJ2B 2KH2B 4ZS6D 1AGDB 5I9QB 3QPQD 4KKCC 3TCLA 4AQOA 2HRPH 3P02A 3E6FB 3EDEA 1J05B 4Z7WB 4YSSA 2HZHA 1WD9A 3T1FB 1J1XL 1ACCA 3BZDA 3MCG1 3Q3GA 3DMMB 4XVTL 3WELA 2DIJA 4NM4L 4W4OA 4P8QA 3KJ4B 5ICUA 3WIHA 5A16B 2V2WA 1VADA 4JM4L 1OP3K 1IC4L 3SDCD 5AAPA 3K8MA 3VXOA 3L45A 3ARVA 4R7XA 4XVUC 3UBXI 5E08H 5FWRA 4EIZC 5E6YA 4TKWA 1W0WA 5EDSA 3ZTJH 2X7LB 3G6JF 3V0AC 1KULA 4JX0A 5LLIC 4PS4H 1VHPA 4N1HB 4Z7NF 1ZK9A 4L4JA 1GAFL 2Q0ZX 1INDH 4N25A 3GSVB 3EO0A 3MRQA 1EEYA 3DX7A 4ODTL 2FO1A 3NSDA 2DQHH 4HAGA 1FSKB 2HVBA 3VFOA 5HYFA 4Z95H 3RTQD 3GLAA 1E6OH 3QI9B 4P04A 4XN5A 3RKDD 2QEJA 4YBQD 2UZXB 2OMZB 1G1CA 3DX1A 1T2QH 5GQBA 1QSEE 3PAVA 5IWLC 4JFFD 4DK3A 4J3BA 4PP2A 1V7MH 1RJZA 4FQ1H 2DQJH 5T8IA 4RISH 3REVA 3II1A 1KB5A 3NTCL 1A2YA 3QO0B 2MCPH 1HESA 4S2SA 1IB5A 1MFBL 4BH7B 1VGEL 1MQKH 4LVEA 2X10A 3V95A 5GS0D 3JYBA 3EFOB 2ZX6A 1YEWA 2HFGL 2XTJC 3KD4A 3OZKA 5TTRA 1OCWL 3VI3B 4YXLL 1N64H 4GUOA 2GUOA 3MLWH 3WEXA 3UTSA 4H2AA 5EEZA 5ACLA 1SOSA 4X42A 5E6IC 3O6LL 4OLYH 2YSTA 1K9TA 1M1XA 2P5ED 2ZWSA 4NO3A 1NBCA 3FHQA 1MCNA 5D5ME 5E6ZA 2OW6A 4XVOA 5FA3B 3TZVB 4CMMB 2AVFA 5I1JH 2DLIA 2QQLL 1M1XB 1IGYA 3POHA 3QGVA 5I73B 1GJIA 4OZIE 2PWDA 4XP1H 3RWFB 4N0YH 1AO7D 4G71B 4JDEA 1IGTA 2AV7B 5DYOB 1RJYB 1E90A 2BMKB 4JLRA 5HDQH 4FQHB 1D5MA 4WQOA 1JGUL 1QD0A 4Y5VB 3QI9C 2WBJD 1MCBA 3BPLC 5CJ5A 2Y22A 1G87A 5SWZE 3RL1A 1XGYH 2H9GB 2VZVA 1BYPA 2A5UA 1PX8A 4E5XB 4TQ8A 1QRKA 1JP5A 4ATTA 3ML9A 4NS0A 4WUUD 5T5NG 4P9HH 3GSQA 5D5MB 2DD8L 1AZRA 1O5PA 3AWEA 5C0RH 5I30L 3H85A 2AGJL 4MZRA 2QTVA 2OI9B 3FO9A 2XFGB 4LF3B 4QXWA 2BOBB 2BX5A 4GP5B 3CVIL 4F2MA 1CE1H 5D7IF 1B4TA 1QHPA 1DQDH 2GY5A 1MRFL 5BS0E 1UD6A 3D50A 3G9AB 3DRTA 3WO4C 4GG6B 5F7NC 1RU9H 2WVUA 1Q1PA 3V55A 5F9JB 5DVOA 4GQ9H 1NJ9B 1H9VA 1M7IB 5B7EA 3C6SB 3FAXA 1A1MB 2I9LA 3BWSA 4X6CE 4LOUC 2ZAIA 4MD5A 1W6LA 4KHXL 5PCYA 3SE8L 4PJ5E 2EDJA 2YAEA 2BVPA 4FLRA 2BNRA 4A63A 2BHYA 2O1AA 1ZK5A 1AP2A 1PS3A 5CJOH 1N5YH 1WT5C 1OAQL 3ABZA 4PS7A 4L37B 4H0LC 3F7PC 4PI2A 4J3OF 2XN9A 4GSXA 1SRDA 1LEGA 4R4FH 3N44B 4C8XA 1QI4A 4H8WH 1ZSHA 4KRPB 3QHZL 1HEHC 4O02H 3DROA 4PRAB 3PPEA 4F3FA 1XZ0A 3GK8H 3GXNA 1ZSDA 2ICWI 3QDJE 4JFEA 2YMOA 4KK8C 1T89A 2ROYA 3WAKA 1J0ZA 5MP6H 4X5XA 3AXHA 4PW3A 4N2KA 2YARA 4K94L 1REIA 1ZVSB 3K2UH 1ADQL 3COOA 4HWEL 1NIDA 2DQFB 3CXFA 4YXHH 5KYYB 4MXQD 5AOMA 1XEDA 4JZJB 2F61A 2XN2A 3ULUE 3L3KA 4JQIH 4EI5D 4XMLH 3FFOA 2X1WL 4PJIF 3MO1A 4OZHA 2GFBA 1A6WL 2K45A 2R0LL 1BREA 3CG8A 3SQOL 3BH9A 3L17A 4NO0B 2NUPA 5IB1B 3LV3B 3O6FC 2X53A 1I1AD 3BDYH 4MLSA 4OCMC 1KZQA 1UD5A 4MNHA 1KN4L 3TBYB 5C09A 4I5BB 4KRMB 1F4WL 1RVFL 4ZYKA 4P9MH 1W16A 3O6ML 5FM4A 3S3DB 4UOW1 1AACA 1A6VH 2W8CA 4K7PX 4ORGA 2AJVL 4XP4H 1CT8B 4R97B 3AC0A 4NYLA 4NC1E 4DZ8B 4ZPVB 1BOGA 3HVDA 4FRWA 4NBZB 2E75C 4GRLC 4QRPA 4JG9A 5I6XC 3QEQD 2YXWA 2ALAA 1KXVC 4KQ4H 4LDCA 2PCPA 2Z1PA 3T2PA 3LNDA 3WFBL 1MG3C 4FLSA 2R56H 2JIXB 3MNZB 3IDJA 2VM3A 4LKCA 3IFLH 2Z34A 1FP5A 4IRZL 3V0IA 3ME0B 4QRFA 4JM2D 2WWMD 4XOEA 2UXGA 5I18H 1T1XA 4KMTL 4S1DD 1D7BA 5IEKA 3GBMH 3K2MC 2IFGA 3MDJA 1KTLB 3BO8A 5CSZA 3QA3A 1QRNB 3WIIH 2ZSWB 1CICB 1M56B 2MNWA 3DXAE 2MRYA 1ET7A 1KBPA 2EYTA 2QKIA 5D1ZI 4NQXB 2R0KL 4JRFA 3HUJB 5EWIH 2KZBA 4JFXA 3IETA 1N6UA 3K81A 1OD9A 1MCEA 2YEVB 5L7XH 3PIQB 4N2CA 3A22A 4JG1L 5CGBA 4QRPD 2W9LA 1IQDB 4IIQA 4KJWC 2EJ1A 1U21A 3ARUA 4X7FC 1VZGA 2H2SD 1SF5A 1P1VA 3JWNG 1CLZH 3BIKB 3D5OF 4DGYH 5K9QI 2GJRA 2VDNB 4JUTA 1AXSA 3OZ9H 4MJIA 2JQMA 1EH9A 2FJHB 2ICEB 4P57A 4XOCA 2IPUK 3P30L 4PJHA 1URIA 3P73B 2FECL 4HS6B 3UJIL 2J5LC 2FGZA 3KCPB 2VWEE 2DYPA 4JRYA 4P07A 1T1YA 4XPBH 3SKNA 5DO2D 1BQRA 3VWKA 2AXFB 3NJJA 3UCRA 4TUJA 1CDJA 5BJTA 1RULH 4Y5YC 3RTQC 3O2VL 4Y9GA 2VDOB 5GSRA 7FABH 1YJDL 2JSFA 3EGSB 1INQA 3UH8A 5E03A 2FX9H 4P23A 3EOAA 4KITB 4PCYA 4KNQA 4DW2H 3GUTA 1RIHL 3CXDH 2R1XB 4W9IC 1ZDQA 2ITCA 3ZKNC 4FXKB 4G8FA 2WXIA 5FYLE 5BO1L 4TF4A 1FYTA 3FF7A 4Q8BA 1IFHH 4XVUD 4XZUA 4C4KO 1YECH 4AIZB 1SJXA 4ZMAT 3L54A 2DWEB 1KSRA 3QHTC 1SUJA 3OKOA 2QADC 4F2FA 1G7LB 5BRZA 4JFYA 5C2BL 2LAGB 3AGVA 5FCSH 1DUYB 4NP9A 4N20A 2WSKA 1C5CH 4YSAA 3I6KA 1YA5A 2XWXA 5IB3B 2Q3XA 4LCCB 2EQDA 1OT4A 3EJSA 4A37A 4QHNA 4KGJA 4HHWA 2XJLA 3D85A 2YMXH 3WS3A 5EIVA 2NLJB 5F89B 1CJYA 3IJHB 4IBYA 4KV5F 3V4PA 3UTTE 1MRDH 4U1SB 2E4TA 4FQPA 3EYOB 3O3EA 5FGRA 3TV8A 3ROOB 2H0FA 3ALPA 1CGVA 4HWNA 4JKPL 5I5MA 2CLRA 3FCTA 5I15H 5SX5K 2CIKB 2YN5A 3F01A 1VPOL 5JNYA 4PUBL 3N55A 1WA2X 3EJPA 3LS5L 1UZ6F 3MLXH 4R6UA 3SBRA 5CN2A 3DOHA 2JJTC 3U7AA 3S3JA 1RULL 4JFFA 4AC4A 3R4DA 5AKTA 4AIXA 3LHAA 4L3AA 3TCLB 1HIML 2PXYA 4YHYB 2PP9A 1FL6A 5GJSL 3I84A 3FTGB 2P9RA 2ZCHL 4LIQH 3IBEA 3PHOA 5DD0H 3MGAA 1FFOA 3HIZA 4FCHA 5E6RB 1BLNB 5I5RA 4Y9FA 3VFNB 3HHMA 1JV2A 2PXYD 3TT1H 3IPEA 2X0VA 2F54D 1CXLA 3SDDC 1MUJA 4AQ1B 2V17L 2C9XA 4NC1C 4YO0A 2XDHA 3CU1A 5IHBA 1E9QB 3MMEB 3ULVL 1R19A 2V2TB 5C07D 4UTAL 5L7XL 2IPKB 2OMUB 1YEFH 3H3KA 4JUSA 2BPBA 5ETUB 1VEMA 1FNLA 1A21A 3J27A 3VXMD 4G6KL 4UTAH 3MA9L 5EG6C 1XIWA 4OLZL 3LMJH 3MJ6A 5JOEA 1S6NA 1NBVL 4K8RL 1TU2A 2EUZA 1W0VB 4J3SA 1E2VA 1MFUA 4IOSA 1IQWL 1E4WH 2EDEA 4N8CL 2HLEB 3AT0A 2ZCHH 4LIQL 3QXAA 4GYBA 2LFGA 4NJAH 4DSYA 1XGUB 2CBQA 3UBFA 5DCCA 3AITA 1GZQA 2P7TA 3RU8L 4IRZH 1IZKA 4ELKA 4BRJA 2VXVH 1ZHLB 2H2PD 2VXQL 3HPLB 2QMKA 2VR6A 3ESUF 2WTOA 4QTHA 4I2XA 2QZ5A 3D8MA 2CCLA 1ANUA 2UY7B 1Y18A 3I2CL 3BVXA 3SKMA 1WA1X 1XCTA 1IEBA 4I3RH 3RQ3A 1KTBA 4FQ2H 2M1KA 1KGXA 4WY7L 1T5WB 3VUAA 3FCSA 1QSZA 4F91B 2VE6A 3RZCD 5FKPB 2RJMA 4XOBA 4B6ZA 4YHZL 4YWGH 5BVPL 3QUGA 1U8LA 4U3SA 1S78C 1EDYA 3HI6H 4JREB 2PWGA 1GJWA 3LRGA 1ZHBB 1JHTA 1IE5A 1BECA 4M6OH 3UYRL 3MAWA 5FGBC 1DLHB 4NUQA 2EVHA 1WQVT 4RETB 5CLTA 2ZP9A 1QATA 3QO1B 2FT6A 3EBAA 3SKUD 5TE7H 3RDTC 4P3CH 2CRYA 1NCJA 4XHJC 5DI8B 5C3IA 5FLVA 4I2XB 5D1QC 3RKDC 4A1RA 4NAMA 3UBXB 1JWSA 1YN6A 4BQBA 4YLCA 1EXUA 3IYLW 4FG0A 2EEAA 3RDJA 4I18C 5C2BH 4WEEA 2KL6A 3LN5B 4M6OL 4ZQKB 2ZIDA 4APQC 2DLFH 3TT3H 4LLDB 4NFCA 3R06A 3G9VA 3GMMB 4HT1H 2BNUB 1SBSL 2DWSA 1HH6A 3NGBB 4HEMA 4X98A 3SYQA 1GS6X 1S3KH 2OSXA 3PGCB 1RAMA 1SY6H 4LAQH 2OMVA 5E9NA 43CAB 4DHLA 2PPCA 1AHMA 5LN8A 1IAIM 2CUHA 2Y24A 2YSSA 1RLWA 3RWEB 1PZ3A 3QDGB 5L2KE 2H7WA 4MNGB 4CMHC 2OBGA 4CILA 1UJTA 2KQNA 5GS2D 5E4OA 4TVPE 2AXGA 2CJUL 4NLAA 4S0SD 4PGDB 2DWTA 2BSCA 4UAOC 2ZNWA 3FO0L 3PXLA 4YS4A 3QRGL 1LEGB 3H3PL 1EMTL 3DX0A 4MVBD 4TNVF 4MSWA 1MJ8H 3KS0H 4AYSA 5C0FB 1BM7A 3P3UA 1PX3A 4K3JH 3SDAD 2KKQA 3CSYA 5HI3D 3JT2A 1MEXH 1FFPB 1T6WA 1I7RB 3KPPA 4M1GL 4HT1L 1JUFB 1LO4L 5MERB 3GF8A 1DSFH 4JKMA 4DCQA 1F3JB 5EU5B 5FW6A 1I3GH 3GYRA 4FL4B 3VXOB 3HZ3A 1JCVA 3MRLA 3WE1A 4IDLA 4IEFB 2MOGA 3PWPD 1PZ5A 3PFUA 4HZ1A 4S1SL 3WE6B 2AF2A 1EO7A 3NOIA 1SJHA 2QBWA 4GBXD 1K4CB 4AQZA 3AZUA 3LZFL 3Q3GB 4NXSA 2BSRA 4P3WA 4JFQA 4GMSL 5JPMC 3GHEH 5DRXB 1FLRL 2X6UA 2DMHA 4X50A 3PWNB 3MCKB 5FS5A 2C7UA 3MLRH 3D39E 4JFUA 1X5GA 3PLYA 3HTLX 4FOMA 1RK0A 1BAWA 1DVFC 1HE7A 3NDYE 1NMBH 3LZQA 5KBPA 2WXMA 4M6ML 5LXVA 3PL6B 5I18L 4R7NB 3JWDC 2CM5A 4IHOB 1EEUA 2ZAHA 4JJ5B 4QY8B 2HUEA 3TH4T 1Q8MA 3QIWC 4FQ2L 3RNKA 2G3NA 4GUPA 1AS7A 1N0XL 1GAFH 1NEZA 1R3HA 2P48B 1LO3H 4F2EA 3LYRA 1JGDA 2HRHA 4ZNEE 1WIPA 1YMMB 2RHEA 3ES6A 2JQAA 5CSBA 3D2UD 3PAYA 1CFMA 2QLYA 3S2CA 3GZOA 2PXYC 4BFNA 4PGJA 2GTZB 4HSAC 4RMUA 2LLNA 2Z8WC 4LPVA 5GIRA 1IM9A 1TZIB 4UQ2A 5DC0A 5EPMA 3NABH 5IM7B 4JFOB 2H4EA 3E1F1 4PRDB 3VD9A 2VZ1A 2EIDA 4POYA 1ORQA 5D7EA 1AIFA 1AZVA 4F15C 4XVJL 1RY7B 3MFFA 4LOEA 5DVNA 3TTSA 2OR8A 2I24N 1OANA 1KGCD 2PO6A 2VN7A 4ADIA 1RZIB 3DV4A 3KPRA 3NJVA 4ICXA 5BS0A 4H26A 1BVNT 1I8IB 2HP4A 4CNIA 3C2SA 3E9TA 2HH0L 2EE0A 5I66A 3O3BB 1A6WH 1J18A 1DUZA 1K5NA 3EG9B 4MJID 1P5VA 5BQ7B 2WZ0A 2HT4C 4WWKD 4ES9A 1Q0EA 2WIIA 3TBWB 1GY2A 3WY4A 1XH1A 2WWNA 1FUNA 4GXUN 5EIQA 5KS9E 3WTSA 5DT1L 4OCYL 1LE5A 1IAIH 1PYWA 4FHKA 1V7ML 1PZBA 2VKWA 4U3SB 4UTAA 2WO4A 4PWFA 3OJ2C 4F24A 2NXZC 1BPVA 3V6OA 5DR5L 1G94A 4B9JA 5I0XA 2QVTA 3LRMA 2QSQA 5JW5B 3OKLB 4QRRB 4JFHE 1ZXQA 4NZRL 2VSKB 4QOKA 5DRZB 1GGIL 1A3RH 5IHUH 2VLME 4D9LH 3VD2A 1C7SA 4OY9A 4AGMA 4GG6E 15C8L 4HIXH 4FQLH 1B88A 1PLAA 1KYOJ 3MOQA 3B9VA 5B3JE 4PJ8B 3F7VB 4S0TD 1OW0A 1JD9A 1X9LA 2XT1B 3EHBD 3GJFK 1FFQA 3FT2A 4NGHL 3HR6A 3BFWA 2PETA 5F72S 4YK4C 1C8QA 1MNUL 1RV6X 3M17B 1RERA 1PVHA 3CCHB 2WYZA 4MCYA 5BQ7A 2O5XH 3SQRA 1JZ7A 1IBHA 1J1XH 4OF3A 4FG4A 4FQHA 2I69A 4TUOB 2Y7MA 3G08B 2PW2B 3CE1A 3SPCA 5F70A 5LCVL 3N9GH 5DUBA 4HUUA 5F7DA 5AZ2L 1ZLWH 4AL8L 5AD0B 4LHQB 1DQTA 2VLRB 3V2AR 2CU9A 3G6DH 2CK0H 3BAJA 2NZ9C 3A4FA 3QIWB 4J8QA 4R2GB 4HPYH 4B41A 4ILDA 1TEFA 2FO8A 1RUPH 2JKIS 3IDXH 4KU1A 4PTTB 3RVVD 1NOFA 2B08A 2E7LC 2QMJA 4J8RA 3HS9A 3IDXL 2VIRA 2F7PA 3RWIA 1EO5A 2AV1A 3L95A 3CIAA 2J6EH 4RGMC 2ITFA 1HKLH 1AR1D 1K2DA 3TO4C 4PLKD 1A6ZA 2A4CA 4OD2B 2V5RA 1UTDA 2EIZB 1AQ8A 4P2QA 1OGAE 3CSGA 1JXFA 2IPTH 4KBPA 5ACMA 3B9KA 4KK6D 1ZHNA 2VL5A 4A2HA 3U1SH 2R2EA 3FQWA 3PL6A 4HWUA 5IVZB 4K3EL 1SY6A 1T6VN 1I7TA 3WCYA 5DJ6B 5IJBC 2BOLA 3LPPA 4DPAX 1Z5LB 4HUNB 3GLDA 2DLGA 2P52A 2A3TA 2HN7A 4LARL 3KZ8A 1DHKA 3WL9B 4ZOCA 1FF5A 3TBBA 2AKRA 3CH1A 3GMQA 3ZTDC 1OSZB 1S4IA 2R83A 4R90L 3UO1L 3OPUA 5IIEA 1JPST 1J7VR 1ZEAH 3F7RA 4X80L 4EE2A 2CIIB 3QIUA 4I0PC 5T5NF 3VACA 3LKPB 3IJ9A 1GGBH 5F93C 4MMZA 1YPZE 3DXAA 5J0BA 5KJRL 1TZHB 5JNYB 1JPSH 1QUNB 3F58L 3B2PA 3PJSB 4XP9L 5H8DA 3BPCB 2Y5TB 4WDIA 2EIEA 5HHXH 1T5XA 4OCYH 3TIEB 3I74A 2FBJL 5KSBB 2FH6A 4BUQA 2FJGA 4LEXH 3SE3C 5CZVL 1B3JA 1C7TA 3DUSB 4TL5A 4RISL 3O6FA 4NKDA 4MD4A 5I19L 4IKIA 5E2UH 3LS4L 4JHBA 4PU2A 3WJLA 3FU9A 4LOVA 2UZIH 5DC2A 1XR9B 1CXIA 3ARDC 2VL4A 4ODTH 5FWQA 5CMAA 4PMEA 5F7BA 1TETL 2H8PB 4ZPTA 5E5MA 1GGBL 35C8L 4F58L 3KYOA 3C5ZB 2P24B 3WTXA 4JAMA 2EC9U 1FNFA 3MXWH 5ABAA 5C9KA 4RAVB 4PRHE 4O4YH 3RYMA 1J0HA 2AK4D 5AAWC 2CBPA 1HYSD 1J5HA 1JTOA 3CJJA 3SD2A 1SEBB 5JO5B 3GB7A 3MBED 1QYGL 2X1PA 1D5MB 1MHCB 4M6NL 4LLVB 3MN8A 4XP4L 3KAAA 2XRAH 3GC3A 4CRPA 3MTRA 1ZT7A 2GTWB 3K72A 3F7KA 4AW7A 1GSMA 5LG6A 6TAAA 4PJ7E 4Y5XB 2RAMA 4XPTH 3GXUB 4Y8AA 4YQXH 4D0BB 5IVXB 4IJ3B 3F64A 3V4PL 2NT0A 2FYVA 4OLXH 4N5UA 1CN4A 32C2A 3FOLB 5B1AB 1UH3A 4D9QD 5T1JA 2QR0A 4U6VH 5I19H 1JPFB 3VD1A 4KAQL 3L81A 2NXZD 4OBSA 3LRSB 3CK0H 3L1FA 3CVIH 3FOLA 4ZMQA 3HA0A 5IGXH 1FVDA 4O2FB 1FHGA 3AJ7A 1U2YA 3BMVA 2GCYB 4DUXA 1XD1A 4JQVC 4UU9B 5D2NA 3EADA 1VEOA 1GC1H 4PLJD 3WFCH 2ZOWA 5SWQB 3HJEA 4XAWH 4L1DA 5FA4A 4BKSC 5MP6L 1UCTA 4G9FA 4Y5XA 2OZ4H 4JKNA 1OGTA 3B2UC 2CXGA 2X4PB 1VZIA 3DTXB 3DX9B 3L5JA 4LLVA 3WEMA 5FOBB 3IGKA 2IAMD 1KIQA 3NCBB 2X42A 5EO9A 4ZDHA 4DIXA 4KQ0A 5HXMA 1KYFA 5EIIB 2FX9L 3DX3A 1MF2L 3MLUL 1H3TA 3V5DB 3VVVA 4HIJB 3D39D 2R15A 5D2LA 1QAWA 1T7ZA 4AM0A 2OXHA 4HU8A 1FNSL 4JO2H 2AHIA 4L0ZA 3B3IB 1A4CA 2EYSB 3LNFA 2J1KA 4YDNA 2QSCL 1IIIA 3QZBA 4F57H 2QPDB 1FZOA 3L9BA 4GXVH 1BXAA 3CUPB 5K1NA 4FG2A 5J5EA 1G5AA 1WAPA 1SVBA 5F3HB 5DVMA 5E56A 3KPSA 5LG1A 1FL6B 2UZXA 3CVHL 1LD9A 3U36B 3MLUH 6PCYA 2CLRB 3FCTB 4CW1B 3HC4H 4QYAA 4X6CF 5C7XL 3ARZA 1HSAA 1TJIH 3AM8C 1CDHA 3ALWA 3WTUA 2IDCA 4JW3A 5ADOL 3TC9A 5IJVA 1YVLA 3DIDA 2X9YA 4BE6A 5H37G 3SDCB 1KB9K 2OR9L 3HB3C 2E76C 5F9WB 2WUBH 5K93A 2F19L 4Q6IC 1Y0LA 1MJJB 2VR3A 3NJLA 4H5SB 1OAJA 3X1GA 1JZ3A 1G7HB 1MFBH 1AS6A 3ZKXC 1KDJA 1YC7A 4OD1H 2C26A 1P69B 4KI5F 5DRXA 5DJYB 3U0PA 2ZNXA 3CN4A 3QXDA 3IN2A 2CHWA 1R33A 2DQIH 1K85A 3ARXA 2NSXA 25C8L 1BV8A 2G0LA 2DEXX 2QQNL 4GS7B 1E6OL 3QYNA 4HXBL 1IGCL 3THMH 3QQ3A 5F96L 3TH3T 2VOTA 4WI9A 5DZNA 5GISH 5ACZB 3BVUA 3IGAA 4FTVA 1TIUA 2IBBA 2GAZB 2R56L 3A5VA 1F56A 3PV7A 1LD9B 3U36A 3JTBA 4JANB 1RIVL 1JPTL 3NEXA 2VDPH 2V7HB 3NESA 1T4WA 3RVUD 3E8UL 4UQIM 4DK6A 5SWSE 3GXDA 2EIJB 2BIPA 4RRPA 4H88L 2MCG1 4Z7WF 1CD1B 4JRLA 3L1GA 2XWDA 3GBLA 2PCFA 1GW6A 1JK9A 3CFMA 4APXA 3KYNA 1YPZF 1ZT1B 3BH4A 2BVYA 4OZ4B 4U7MA 5IMLA 5KSBF 1DQML 2FEDD 1IT9H 3FQXB 4V1DD 1SXAA 5LCVA 1T7WA 4HXBH 3R1GH 4DEUA 4QRSA 1MFDL 4B96A 1UOVA 2VMCA 5E2UL 3ZKXB 1MRCH 3MOBH 3N41B 1BZ9B 2LGNA 3ZYJA 5HGGS 1G6RL 3QEGL 5I1CL 3TO4D 3EXJA 5CZKA 1YN7A 4R83A 3KM2A 2XY1A 2HLAA 4WSGA 4F5CA 4XN7A 2WBJB 4KWUA 3TWYA 2K7PA 1JXGA 4LP4A 3RWFA 3NJXA 4Z1PA 2PWFA 3TYFB 1CFSB 3EYQC 5IMOA 2FSEB 2IANE 4POUB 4PWKA 2NY1D 2WWKO 3DETC 3SB3A 2NYYD 3LJ3A 3UAAA 1Z3GL 3Q1SH 1WD8A 1NL0H 1SMDA 4R8WL 3RUGF 4ZOAA 4YDLB 2EZ0C 2XV3A 1Q38A 4OCRH 2ZX9A 4PRIB 4B95C 4FXKC 3ZE0F 5CJQL 1KZYA 4WTWA 3F85A 5CAYB 3KPRB 1TOXA 5GS0C 1WBZB 1JWSB 1UHVA 2OSLB 4OFKA 4Y1AD 3NZ8A 3RL2B 5E4IA 2DI9A 4R5XA 3D0LA 4ZI8A 2R2CA 1HT6A 4N24A 2N7BA 4KXZI 3FT1A 5AL8A 5GGRA 4F57L 4B7LA 2NX5D 3TBWA 1ICTA 4Q6YA 3P40A 5AVSB 1ZLVH 5FB8A 1RUQH 3CPUA 5EO0B 3S35H 3LVTA 4WGKA 3QE5A 4WV1B 3MJ8A 4CGUB 1MZYA 3A47A 3EUUA 3JUYA 2VQ1A 1XAKA 1KEGH 3CDFA 3VW3H 3DTXA 2WOBA 1HS6A 3N1PC 4PPTA 4F27A 4ZFOL 4Z7VE 4ZUWA 4I3GA 3NJIA 3ABLB 3MLVH 1HZHL 1MCOH 4BZ2A 5BV7C 5IUSA 3WIHL 5EZLB 2J73A 3MJ7A 4IOIB 2Y72A 3JVGC 5CBEB 2DJUA 3Q7JA 5D7LA 3BKMH 1RZ8B 5CWSA 2N0MA 3I9GL 3JWOL 2WXRA 2RFXB 4XX1G 4I3SH 3REWB 2WLHA 4HKBA 2Y07H 5EMYA 5TE4H 5TK2A 3V10A 4DVBB 2FR4A 1DVUA 5TE4L 2P45B 3DJTA 3TS8A 5GS1B 2P5EA 2W9EL 4YEEA 3NCMA 1R34A 2WINA 5FW8A 5DMGC 1N26A 4RAUB 2IAMA 1M42A 4RMRA 2X70B 1XZWA 4HCIA 3TVMD 3TBSA 3RURA 1N6VA 5TE7L 2E0PA 1TTRA 2W07A 5KSAC 1B6DA 3QIBA 3MLTB 3DVIA 4QRPB 1VKXA 4XH2A 2D7QA 3S98A 1IKFH 2OZ4A 5SX4H 3N43F 4X6CB 3ZE1F 4N0YL 3RZCC 3RJQB 4EUPH 1I7ZA 4JZJC 3MRPB 1SFDA 1GKOA 5ESVB 5EBMA 4NJ9L 1JXKA 1PIFA 4XMPL 1I1AB 1J87A 3FO0H 4WGVB 4UDTB 5I8CB 1KCUL 1WAEA 4JKWA 1K4CA 1LQSR 3IDMB 2NY2C 1RZFH 5CR8A 4CSZA 3PHOB 4XMXA 5AW9B 5IHUL 3P2TA 2HSIA 3QC5X 5ICXA 3V6ZA 2C7UB 1PGRB 2FB4L 4PWEA 4J39A 1LXMA 2QGCA 1U3HB 4DP8X 3MUGA 4A66A 1ZE3C 3GSOB 3JV4B 4HIIB 5IQLA 3AABA 3FFCA 4WSJA 2ED9A 3FDWA 4EUPG 3MLTA 4FQIH 4TL4A 3GDBA 3T77B 3T1FA 2VC2B 3B2VH 5KS9A 4NKMB 1MPAH 1T7YA 4K5PA 1IE4A 3MOBL 4Q4IA 2OL3A 4AUYA 3JTTB 1S7QA 1P84J 2VABA 4HKXA 2VLKB 2YEZB 2Y06L 4K94C 2ZWLT 2YAQA 3DIFB 1A1OA 3HRPA 3R0MA 3VB9A 3WENA 2ZTBA 1IEHA 1DN0B 1HDMA 3PNWA 1SYSA 4UIKH 3LNHA 4MHHG 1UA3A 4NN5B 4X8JB 5DLLA 5CUSH 1G7IB 4CBZA 2VLJA 2Z9TA 3B7SA 3R8BB 4E9RA 3RFZC 1S7RA 2TRHA 4WWKA 3KPMA 4YWGL 3C8KA 3CFCL 5HHOD 2P44B 4XXWC 5GGSA 4Z5RA 5F7LB 2IF7A 4UQ3A 1JZIA 3OAZH 3T3PE 1CI3M 4YHKL 4WI7A 4M3HA 5C0IA 5IW3A 4HJ1A 3C60A 3HNTL 2VM9A 2OMBA 5AW6B 5JO5A 3P9LB 1L5GA 2BP8A 5BXFA 2YHGA 1P4LB 3D0VB 2XX0A 5JDSA 1DUZB 3EG9A 4GW5A 4ZTOH 2X4TB 4WW2B 4L2YA 5I16A 3WLBB 3QG7L 4L5FL 4XPFL 3M8OL 2FD6H 2L0DA 4B3VA 5KVDE 4N6RA 1OKEA 2A6KA 5IBUB 3QWRD 3BUQA 4HD5A 3VXUE 5I1HL 1I85C 1SDAB 2B5IC 4LVOC 1Q90A 3W5NA 4PJHF 5BVJB 5H37A 1D6VL 5C9JA 4GKLA 2ZONA 2PCYA 1U8PA 5E2WL 1HHKB 1CK0L 1VGKB 2CGRL 3K7UA 1X7TA 4WI4A 2UWEE 4A67A 3GSNH 3H42H 1NCAH 2QKSA 3RBSA 3PJLA 2PLTA 2BSTB 2YGOA 2XWJB 1P84K 5GRVK 4K7FA 2PYFB 4LP8A 4ANWA 1PD6A 1EJ8A 1WFNA 2DICA 1GZHA 2RACA 5FYLD 4OZFB 5C86A 1TLMA 3DBXA 4FNLH 4XRCB 2YD7A 1HCVA 2YRLA 2AI0H 1LWHA 4IRJC 2K1MA 5E1AA 1JVKA 5LAXB 5IUCA 3BGMA 2UUDK 1AYRA 1Z32X 4XB7A 3VXSD 4YHPA 3MR9B 1R5WB 3LEVH 3U2SA 1ORSA 4IRJB 4J2XA 1UT2A 4RWHA 5IROA 1KCUH 5JW4N 2Y36H 5CU5A 1KLUB 3OLIA 3VCLA 5I6XB 2OLDA 3HOGA 4YH6A 2WKOF 1I1RA 1U92A 2CDFA 3N40P 4LSPH 5D1XA 3GS4A 1V7NL 1VJSA 2GEQA 3DX4A 3MCLL 2FDBP 4RMVA 2AI0L 2W0LA 3FFDA 3AUVA 1OD7A 2BRRL 4LNVA 1AO7A 3WMPA 4ZD3L 4QHMA 3DTUB 5J13C 1RK0B 2N56A 5LQBL 1S3KL 4LHJB 3MRJA 3SE4C 5F7HA 3EYQD 4UT7L 3S97C 2IPKA 4L8SC 1YDPA 2OMZA 3NSFA 4Y2DC 1P0SE 2C3WA 3DETD 4ZXBC 4MA8H 1LK3L 1HN1A 4CU6A 2FEDC 1YNTB 1OB1B 3PV6A 4G43B 3IBOA 1N8ZB 3VFPA 4YGAB 1ZOXA 9CGTA 3AROA 4OZGE 2GSMB 5LCVH 3PV6B 1CDCA 2DIEA 4I13B 4MNQD 1QLEL 3O9WB 4LL4A 1HHIB 2VKXA 2RGSA 3MUY1 2F0CA 5D71L 4Q89A 2PXYB 5B8CA 3VDBA 1UWGL 1L9PA 2WB7A 3L3DB 3ZN6A 1P4BL 2GTQA 3I3EA 3RNQB 3ZTJG 3S96A 4CADA 3H9SA 1BYNA 5E94B 3QYCA 3DOSB 3OR6A 2Z31B 1M05A 1AKJA 3SCMA 5ADPH 5ALCH 3HI1A 1EEZB 4KZCA 4LBEA 3S8GB 3ISWA 4ONFL 2J43A 4JFDA 4YVNA 3VRJB 3RWHA 4HPOL 1RK7A 4BWWA 1HCYA 1LO3L 1SEQH 1Q72H 3NCCB 4Y88A 4FMFA 3BN3B 3ARRA 4FQXC 3HZKB 4WAFA 1G7PB 3VYOA 3IF1B 4MAYB 2FQEA 3LIUA 2X4OA 4OLUL 2XKNA 4ETQA 1E3XA 1EGJA 1TQBC 1L0XA 2EDWA 3KBEA 5A7EA 4U2YA 1MFCH 4BSWA 4GINA 2GI7A 5HGBB 2ZUSA 5DDHB 1J9SA 4Y7OC 2QDWA 1AD0B 3HBQA 1KLGA 3IFNL 1TNNA 3GI9L 5JW5A 1N0LB 3O6LH 4OLYL 4ZUVA 2OW7A 1TPXC 3EO1A 4TULL 1B0WA 1UADC 5L2JA 2JB5L 1ZLWK 3LKRB 4X6BA 3TL5A 2X4NA 4XN2A 3MA9H 2ERJC 3O4LB 2R4SL 5D2NE 5DJZB 4EBQH 3BIKA 1JZGA 2Z31A 1F6LL 2R4SH 3LD8B 2JWYA 4OUUA 3T0EE 3VMPA 5GRXG 4TNWK 4KJPD 4H0IA 4K15A 3G5VA 4MHHI 3U4EA 1NH6A 1TZGH 4YLBA 3TYGH 2WM0A 4GRLD 1QFWL 2EVJA 1BGXH 1KG0A 1F58H 3L3HB 4WHDA 2P7TB 5D2LE 4V2CB 3ZHLA 3QDME 3BZEA 4LVOB 2Y7QB 1HNYA 3BAWA 1L3WA 2N1KA 3TFKD 3X14A 5IHZB 4J3XA 1JNJA 3MC0A 1XH0A 1S3RA 5IW1A 2GABA 1MLBB 4A7SA 4I0PD 2EECA 4LLYB 4OJFH 4DPCX 2VDMH 4YSDA 3DPDA 4YHPB 3MRGA 4S1DC 2EO1A 4Y5YA 4E41D 5T33L 1DJHA 3GJEA 3MGOB 1I53A 4FLQA 3TIDB 1S7VA 2AQNA 3RP1A 4UI2A 1U8LB 4BH8B 4OI8A 3OAYK 4ELMA 4G6JL 4HFWA 1FZKA 4F7EA 4NKQB 4CSPA 1NIBA 2OMWB 3IDYB 4LLQB 4GSDL 4ODUA 1IGFH 2MSPA 5DQDH 2PYFA 1JPTH 3BKJL 5IESL 1IM3B 5TJWK 4JJOA 4HFWB 4JNXA 3MXVH 1ONQA 5B7FA 4QRQB 5ABDE 1E42A 1XVSA 5DHVB 4LEBA 1HCFX 3IFPB 5F7EH 2Z7ZA 4ZSOB 4IGBB 1KG0B 3DPBB 4JY6B 1OE2A 3MSPA 1NQBA 4JDTL 2CK0L 2VZTA 4S1SH 3HE6C 4N8VG 5AZ2H 3DX7B 3BVDB 4QXUL 3FRUA 1A4AA 2DBLH 5BV7L 2DYRB 2LAAA 4JM2F 4DAGL 4KO7A 2Q76B 1GIGL 1OPGH 4LNRB 4AVHA 4JPKH 3MPCA 5IJCC 5L4FA 3FHEA 4W93A 3JZYA 4FTVE 4G3YL 3ZRFC 3O11A 4FTDA 4LMQI 3HZYB 1NMCB 1HNGA 2W81C 4C58B 4C83A 2A99A 4P46C 2VLLA 5IB4A 2X6BA 1EBAA 2F53A 1F3JA 1H9DA 3K6OA 4PJIA 1V7NH 2GW5A 3VRIB 4G1EA 5ALBL 4TNVK 1TZHA 4MMYA 4YHLH 4PWHA 5IF0A 1T66C 4HPHA 2AQPA 1A9VA 3TN0C 4N9GA 1CG9A 4QRRD 3CVHH 3HG3A 4UBDC 3BRFA 4P4RA 1QSFB 3WOVA 3LRLA 1JNNH 5GS2H 3L8QA 4BEIA 5BW7C 3AAZA 4R4FL 2X0WA 5D4IA 3ATBA 3ZU8A 4BZ2L 1FPTL 4FFYL 4OZ4A 2X4UB 2ZKXA 2M8XA 2O6CA 3SE9L 43C9A 4E9XA 4RVBA 4I5BA 3OXRB 1WS7A 4HLEA 1FNSH 5DR5H 1XHHA 2F18A 1DQIA 4PJEE 5GZND 1YEHL 4HUWB 4NRYA 1KWKA 3Q0HA 5CIPA 5AVYB 2JKRM 1M05B 1T21A 3EHBC 3M1CA 1UEMA 3HCVA 4E2OA 3CX5K 3PWVB 1SXSA 1YMMD 3V0DA 3VFUA 5IQ7H 2EDLA 2J2ZA 2VO8A 3BPOB 2G3XA 4PB9H 5FYKD 4WNSA 3SDDB 4Q9RH 1OEZW 4XWGL 4NP4H 1MI5E 4JRXA 1G9MH 5C7ZA 4AX3A 1ZS8B 1QLRA 1FN4A 2YOCA 5KANG 1OTSD 3P2BA 3E0GA 2IANA 1OAYH 3LH8A 3LZOA 4QRAA 1XD0A 5FV2A 4KAQH 4FHBD 2R1WB 4PCTA 1MAMH 2IANB 4M02A 4RZKA 4AEIH 4PIBA 5GJTH 4WFEE 5C0RL 1FIEA 2BOBA 5FOJA 2WLNA 2C3XA 4L8CB 2H0JA 4PBWD 2BNQB 2W38A 4W4NA 4MBRA 2YQ3A 5HYQB 3ROLB 3MRDB 1CDIA 4XPGL 3NJKA 3HC3H 4DP2X 3IS1X 4UYQA 3RPKA 5CIPB 4Q9BA 3HC3L 1PCSA 2EC9T 3GBNH 3PWPB 4LOUD 4X0NA 5DJXB 4QHUB 2VAAA 3AFLA 1UXWB 1IQDA 4IIQB 4Z3JA 1OHQA 1BFSA 1Z9PA 2VB5A 3PQYE 1FVDB 4O2FA 1I9IL 2XIIA 3S5YA 2COVD 4FNTA 1LEIA 3WV0A 4WWID 3VQLA 2ZYSA 3KWTA 1KMGA 2R1XA 1IEAB 1QZNA 2AEIT 3OAWA 1MAML 1QO3A 1RVFH 5JIHA 1QRNE 4PW4A 3SKOB 2QELA 3S9DB 3I85A 1IM3A 1BMZA 2A0LC 3LCYA 2KDYA 1JFQL 1OAYL 1R5VB 4GQZA 1EZVY 1IGCH 3THML 4TUJB 1UWFA 2CDEA 2XWRA 3GBDA 4GMSH 2OL3L 3LQZB 1HKFA 4V1DA 2G60L 2X2IA 3FU3A 2E8ZA 4J4PD 2ZXEB 2O93L 3RPIA 1BG9A 3TXAA 3FO9B 2X4RB 2RB8A 3DPBA 3OKNA 3EH3B 4I48B 3IMRA 4AYBA 3GJEB 3TIDA 4BBWA 1MPAL 5I28A 3QJOA 5C0DB 4GFXA 1KIRA 1FIGL 3U82B 3RPIB 2PMZA 5GGTA 1HHKA 1VGKA 4FLHA 1XGQA 1MW2A 4PY8I 5EBLA 3VH8A 3ULUD 3QCUL 4ONGH 3VTMA 5D7SL 3PG2A 3ECBB 2CPUA 4YDJA 1SXNA 2XZCH 2HRGA 5I1LA 3F7YA 1KELH 3KNBA 2OMNA 4NPKA 3BZ4B 4PV8A 1LILA 1IT9L 3MLSH 4N5ED 4ZSOA 3GI8L 1KPUB 3KXFD 2K4AA 5IV2A 2I9TA 1W9XA 2G2NA 4PS4L 3GSXB 2F5BH 5HHNB 5KAQG 1OAZL 3LKSA 3ZMEA 1GTNA 1M6UA 2H45A 4GMTH 5D6CA 1YEDB 1G5GA 5CWSB 3V6FA 1Q0XL 1DLHA 3VFTA 1LTXA 4XX1E 2ORBH 4RIRB 4QRTB 2ZX7A 1MXGA 3L4UA 1KXTA 2BP0A 5EZOH 3SJVE 3SYAA 2Q7YA 5C8JB 2VW6A 1P5UA 2NT1A 3CXHJ 5FUOL 1D5IL 1E30A 4RNRA 1UQSA 4B53A 4OKVA 2HJFB 2P8LA 2A6DA 1DBJH 3QWNA 4LQ1A 1TVHB 4D9RD 3U1SL 3L5XL 1U91B 4Y16C 4F7TB 2P49B 1QVOB 1J88A 1I8KA 3BJLA 3FQ2A 2HT2D 3B8SA 2YBGA 4I0KA 4UTBL 1P2CA 4UB0H 2QVFB 4G8GE 4LHUB 3T6VA 1XF4B 1EGJH 2KI6A 2YFOA 1DSYA 2GFBB 4JY4A 3VRLE 2CLVA 2FEEL 1PKQE 2A73A 3WL9A 3QI9A 2MPAH 4WI5A 5EF3A 3BKML 2A83B 2FO4A 2HX7A 1YECL 3QUXA 5EPMB 5I30H 3C5JB 5T1KD 3BKCH 5DGRA 3OSKA 3RJOA 3CN3A 3WMSA 4JY5H 3C8DA 3FFCB 4EI0A 4XNZC 1U8MB 2JB6A 1MFVA 1LM8V 1BYOA 1JXDA 2C4FU 1XGPB 3TO2A 5I8KH 5AG9A 1TFPA 4KY1H 2YAFA 3LH9A 2EEBA 3SDDA 3HFFA 5ICXB 3V6ZB 3RVWD 5DFVC 4WTXA 1ZTMA 4TNWF 5IBUG 1BWWA 2BWDA 5KZCD 1IGJB 4NNYB 3CBRA 4IDJL 4B97A 1NGWA 2QHRL 1YY8A 3HS0B 1DL7L 2CHNA 4RESB 3SDYL 4GMTL 4HVBA 3C5XA 3O0LA 2D7NA 4P2RA 3B37A 2F8XC 1LYQA 4NDMA 1ETZB 3HMXA 4Z77A 4J4PA 4WO4B 2B4CL 1A6VL 3SKNB 4JS7A 2A77L 3GINA 4H1LH 1ID2A 2APSA 1TZGL 3MCKA 1EAQA 4U6XB 5IK3A 2A9DA 2UY6B 4P2RB 1RJLA 4FQQB 5FYKU 5GRUL 4J27A 4QWWC 3PUUA 4OUOA 2BFVL 1HI6A 1W6WA 3MLWL 2NY0C 1D9KD 1D3CA 3ZDZE 2H32H 1H8OA 1MLCA 4UZGA 3QARA 4W81A 2PO6C 1RUAH 4XCEA 5FUCE 4E9TA 1KB3A 4YR6A 1ZGLA 1ZPUA 5IEHA 1FI8C 5KVEH 4Z7OB 3VB8A 1HL9A 1PKQB 2OMYA 2VDLB 3F12A 3QEGH 1EXUB 5BOPA 1AMXA 4N8VA 3C60C 3K2UL 1AI1L 2DQTH 4FQXB 2XZAL 4I0PA 3H9HB 4FYSA 3ZSTA 1BXVA 3CDYA 2NR6D 3E38A 3NRQA 1NFDB 4FFVD 3BAIA 2CDGA 1UM4H 1ZA3A 2GBAA 1G84A 3GZQA 1QKZH 2SODB 2AABH 1U8NA 4HZAA 5CXPA 5DXWA 5IB3A 4HOMA 3UTPE 4H8WL 1X5YA 1BJMA 4YXKL 3LS5H 1FJ1A 3NZHL 4GP4B 2J72A 4NZ8A 2MTAA 3E8UH 4Y4KA 5F88B 4Y16D 1SJEA 3HVNA 4WV1A 5I71B 3A4DA 3T2NH 4EIUA 1CGSH 1Q0YH 3DKHA 5I66B 4M56A 5KBDA 2AZUA 1SJEB 2IAMB 1O7SA 4FXKA 2NOYA 4KFZC 4X4MA 2CKBA 5K9OB 1M7DA 1I75A 4IGBC 4HALA 2IGTA 3CDGB 2IALB 4OI9A 5D7IA 4JGNA 3L3OC 1KLFB 3LZRA 1I4FA 4TRPL 2HJLB 1ONQB 2VDLL 4PQXA 1L3NA 2R9HC 3JVGA 2EDQA 2B8OT 1HH9A 3IVKB 2D73A 5K9JL 2R29L 5AVQB 1RSYA 3BHBB 3QWQB 1HAWA 1DJIA 4QOKB 1ACYH 4XR8C 1XO8A 1OGAB 1RUAL 2WLIA 1JGLH 3BVNA 2SEBB 1JBJA 2HFEB 3CZKA 4P2OD 1A1NB 1OGTB 1J8RA 2LT9A 4EN3A 4Y1SA 5BO0D 1QFHA 2GSGA 5JPNB 2V2XA 1JMZA 1PLGH 3GJFH 1Z5HA 3X12A 4PJ9A 4G6AC 4BZ1L 3FQUB 3B5GA 3BP7A 2XY2A 5IFHH 1U42A 3OKMA 2A6IA 3ZDXB 3B43A 4GKSA 4PP2B 4G9FD 1MEXL 4U05A 3SDYH 4YMPA 5IFJA 1OW0C 1NDMA 1W72B 2A9AA 5ECJE 2NR6A 5K59F 1R3JB 4WWPA 1FO0A 4OZGB 4PGCA 2B5IB 2IAMC 4M5SA 1NZRA 3QRGH 2CMRH 3VXRE 1C12B 1EEYB 3L6FB 5MEQB 5T1MB 1T5KA 2J8UF 1Z5YD 4PRHD 2GTZA 4KTDH 3OR6B 3NP3A 4YSOA 5IVXE 4DO4A 4A6YB 3IMVA 2AP2A 2VLKE 5LBGA 2YZ8A 2X87A 3AQZA 3PHSA 3QFJD 3C6LC 3QDMB 1JWMA 4OZHF 4Z78A 1PZUB 3DX6A 2H32B 4HC1L 1X7SA 3O0RH 4TPRL 2G30A 3P0VH 5F9OH 4KZDH 4NN6B 3QCUH 4ONGL 4UV4L 4WFFD 1ZVSA 2I60H 3MNDA 5AW2B 2ZUQC 3RAJL 4YDMA 1EVUA 2OR7A 5FUZH 3RVTD 2TRYA 1FWXA 5CLWA 1JYNA 2LR4A 3RI5F 4N5EC 2VO5A 5C07E 4ZFGH 1A1OB 1H3GA 4D9QE 5CEZD 5AAMA 5FC9A 4O2CB 1BEYH 4PGEA 1N0LA 3M8OH 5F3BA 4YBLC 3R1GL 5JOFB 4MDJA 2V7NB 4XBPB 1JZEA 2NX5E 3NCXA 5CM1A 5AALA 3HCVB 3IKKA 5F1SA 4YBLB 4G6ML 3CSBA 3VFSA 3MCYA 4L4TE 3QUZB 5JHLL 3TVMB 1J0IA 4JCLA 3T6XA 4LKXB 4NC0B 4ZZFA 4H88H 3T2NL 5FUCC 3P77B 5E6UB 3LN5A 4ZQKA 1LE9A 3DX6B 2AEQH 4L3EB 4R2GC 1BDYA 3GUFA 3QIBD 4WLCA 3LAFA 4FFZL 1QSED 1OAZH 4LBEB 3RIAF 2VQTA 1RFDL 4QHPA 3RIKA 4HG4K 4NENA 3BGFB 4M62H 4ZW6A 5JHLH 8FABB 2Q8BL 3L7FB 4AKQA 2CKNA 4MQSB 3KPRD 3WXVH 4Y9BA 4CVXA 5E8PB 4F8LA 2GJ6D 2UWEB 1CDGA 3ORJA 3D69B 3FU6A 4N28A 1RZJC 5H2BB 5EIIA 1VFAA 4OJYA 4QKXB 4IGBA 4LZKA 3CVHB 3ZT6A 1AJ7H 2QTEA 4ZFGL 4WHYH 1MY5A 4HS8L 4GSUA 1N3NB 3OGCB 3HRZB 1DLFL 1AR1C 3V4VA 2BSRB 3V9EA 5BCAA 1A4KB 4F7CB 1KEML 3MJWA 1TF4A 3HN5A 4J28A 2CBOA 3LXBA 4XCNB 1NCUA 3ZKSD 4XZUB 1KGCE 1OB0A 1YYMH 4XO4A 2FIKA 3ETTA 3NPZB 2IFFH 1QFUL 2ENYA 5E8DH 3QFGA 1AYOA 1IBZA 1UFUA 2CNZA 3OHXA 3K91A 4RFEA 4TNGA 5HJDA 3SHSA 2VQ1B 1NKRA 1YN6B 2V17H 1I9RH 3CDGA 4PIRF 2XZQH 2YQ2A 4XXDB 5ELIA 3FFDB 3U46A 5DZOA 1WDAA 1NCCH 4PJFF 1IFGA 1U6AH 2CDEB 4V1DB 3RUGE 3BWZA 4YDKL 5E2VH 4FFZH 4JE0A 2Y6TE 3ZMRA 4OM0L 1L6ZA 1USZA 5T1LD 4HSQA 1B4JL 3IVKA 5GJSH 3VD7A 3P4OB 1DP0A 4RDBA 3FO1B 3CC5A 4PD4J 1OARL 3Q9QA 3S34H 1COBA 4KPHL 4LSTL 5D55A 1MJ8L 5BPPA 3BWUF 4G8IB 5HYJA 3IFPA 2QR0B 2UVFA 4UYPA 1HXYA 2AC0A 1DTUA 2HT3C 1PSKH 1MFNA 4XVTH 1CLVA 3UG4A 1CFVH 4N3UA 1MLBA 3APFA 2X3CA 3MKGA 4F7PA 4F7MA 3BSGA 4HFUH 4GOSA 2WKLA 1KNOA 1Z9LA 2WWOA 4UU9A 5SWSD 2YA1A 4M6MH 4NCC2 2HWZH 3CFDA 3C9NB 5DHEA 3QO0A 4S2SB 3IN0A 3KYKL 1D5RA 1A22B 1W15A 1I8AA 2N4IA 5CJ8A 5GHWL 3BLPX 4G7SB 5AVZB 2YAPA 1JWUA 3DSNA 2G75B 1M9SA 3PL6C 3G5ZA 2ZXDA 3MLRL 3MLZH 3O2DA 5ITFA 4OZIF 1UZ8A 2OCFD 1KBGH 4N90E 3ENEA 4OGAD 5CLZA 5DUPH 4I77H 1H15B 3PUCA 4JFQB 3LV3A 1B0GA 5IOKA 1DBKL 3DGDA 5I5IA 4H40A 3KPOA 5JUEL 1SJHB 5KWYC 4GQPH 4X7TB 3SGEI 1NAMH 3BQUC 4PSRA 5EUKA 5HHOE 4Q2ZA 3NJNA 3VGFA 3J2PA 1HL4A 2KZWA 4YNYA 1W0WB 3LKNA 3VW3L 1BVKB 1ZHKA 4QT5A 4XNYL 3ARQA 1H3XA 4L8CA 2H32A 4PM1A 1KFGA 2G9KA 5K33A 4AL8C 5F1IA 1X5JA 2UZYB 2D7MA 3F2LA 1CGSL 1IFHL 1N19A 1P5VB 4U49A 5F7KC 4MFHA 3TVMA 3FU5A 2XNAA 1Z7JA 4M48H 4JVPA 1M7UA 2W9DL 4M5YH 1JS4A 4QGYA 5D7HA 3PQYA 4DO6A 1B4JH 2MQCA 3KLDA 3IF1A 2F8IA 4UV7L 4X2UA 3K5RA 4BXVA 5I9QC 5I6NA 2FYYA 2NYKA 2ZUUA 4ZOEA 2ZG1A 3WFEH 4N2NA 3UMNA 1YJDH 4ZX5A 5KS9F 3LQAL 2OL3B 4G5AA 5KVGL 1KYAA 1AVAA 2BCKB 5BMFH 4MCMA 2JCCE 1B3IA 2F68X 3ABMB 5HGBA 1ZGLM 3B9KC 1F8TL 2XLLA 3K4DA 4OJCA 5I1GL 2P3YA 5FGCB 2XU9A 4YZFF 5EN2A 1YYML 2A6JB 4AOFA 1JGLL 2CLZA 1GGUA 3PWJA 4PLJC 4FA7B 4OVVA 4AKOA 3L16A 1SJVA 1E5CA 1QEWA 4QRUA 4AUJA 4W4OC 3MV8D 2HAZA 4UF7C 1MVUB 3L3GB 3QJHB 1YNKH 4MA3B 3G6AB 4P46D 4WUKL 4LPCA 2EDNA 3QUYC 4Y2DD 4KNTA 2MH4A 2WQRA 3C6EA 1KCKA 4IBQA 4EI5C 5TDPA 5KJRH 3ULVH 4N0FA 3BW9B 1E4XI 2CCWA 4U6XA 5A1AA 4Q97A 4X80H 3DO7A 2VLRA 5E4EB 3V4UL 1FNEA 4TUUA 4HS6A 3SGEH 5C0CE 3O9WD 3ULUF 3DX9A 4OCNC 4Y89A 4PRIE 5FOBA 1I8UA 3FK3A 5DJ6A 4DVBA 4OGXL 1O6SA 1Y6MR 4LDOB 4NQVA 2ARJA 3RJDA 5HYSB 3VXPA 3V6FB 4JPVH 3CV5A 5GRWA 5JXEC 4KK9D 2PTUA 1DVTA 1KFAL 3HHRB 1KTDA 4XPHH 5SWZD 4AYDC 1XB8A 2IDQA 3D3VD 5F88A 1CO1A 1XH3A 3IJSA 2B59B 3QFJA 5E7FA 5AKVA 1J9QA 1CFTA 3ILDA 4I48A 4PJ8A 3SYCA 4IQHA 4MJ4A 2D3VA 3T0EC 1SLVA 2YPLA 4LNRA 4JKKA 4ZUTB 4ALAL 4EO5A 2CDGB 2WJ5A 4L8BA 3MX0A 5CUSL 3M17A 2F7OA 1TJGL 4QRPE 1IQWH 3CFEB 3U4AA 4Z7NB 2OXHB 4G8GA 4MS8D 1T7XA 4E0RB 3FKUS 4FGMA 3KLHD 1Y7VA 4G5ZL 2DYSB 3DSNB 1G1YA 4EZJA 3PPSA 3BZ4A 3SOTA 1NMAL 3UABA 5D4QA 3HG1B 3MV7E 3T4YB 1E65A 3QR1A 4F8QA 4AVIA 4F8TA 1JD7A 4ODXB 5JXAL 2L8AA 2RBLA 3EBHA 1KTDB 2O6DA 5BZXA 5IHLB 1B4LA 1TVBB 4ZOBA 1MCKA 4KKQA 2ZOLB 3UEQA 1TJMA 3VXPB 1I8KB 3LEXB 1UYWL 4APQA 4DP7X 1VCBC 2YZ1A 4RGNB 4X6EA 4AG4H 2F1BA 3BUIA 4EN3B 3FMGH 1QSVA 1WWCA 3DGCR 3IAPA 1R0AH 2CRIA 4PY7B 4LPXA 1BOYA 1UA6L 1YUKB 4WTZG 3MRIB 2VUKA 3MOAH 2A9ML 4G6FD 3FW6A 4WW1A 1CZ8H 4X5LA 4G8GB 3DHMA 1NGYB 2P46B 1ZV5A 2CHDA 3B7TA 2FSDA 4NKDB 1T22B 3DHPA 5KVGH 4XBGB 5D2NC 2Z8VC 3GTNA 4FFZA 4Y19D 3MRQB 4R5VA 5E4AA 3TN0A 4Z3IA 1VA9A 2WCSA 4RH4A 4C4KT 2OK0H 2IWKA 3O8XA 1H19A 4HUXB 5KG9A 3KEHA 4DOHB 4FZEH 3WNMA 5T3ZD 2LABA 4PW9A 5CJOL 3JV0A 3KYNB 1KYDA 3QJFA 1XFPA 3MNVA 3R18A 1GZPA 4EI5B 4GUPB 1CIDA 2DQCH 4Y1TA 1J5OH 2K3HA 3QUYB 1GHFH 2A4ZA 1WZLA 4GP8B 4X5WB 2FUTA 2ZOLA 3HN8A 3N40F 4JO1H 2KERA 1SBSH 2MNUA 4R4BB 1Z9MA 2XBTA 3WLWC 2WNKA 4UIMB 4F9LC 3N42B 4X6FA 1WCQA 4F9PC 3FRPB 5ANMA 1T1WB 3E6FA 4Z7WA 3TASA 3MRDA 1ED3A 4X9BA 2Z7YA 2K6WA 1I9JL 2PPFA 4P48A 1KTRL 2FQGA 4JN2B 2I7OA 4PH8A 3BKYL 4TQHA 3UG3A 5DD1L 2AERT 3BP6A 5T3XD 3O9WA 4BFFA 2Z0UA 1MIEL 4N0CD 2D31B 2LTQB 5EZIL 1IAKB 1IAOB 2ICCA 2B1OA 1VF5C 2AEPH 2Z93B 3DO3A 4LPTA 3BP4B 4PJEF 2K8QA 1T1ZB 4IU2A 2J20A 1KXQE 2DQCL 1IGFL 5FO7B 3B9EA 2I7SA 3QCTL 4FCAA 5E00B 4BA0A 2QVIA 5LNGA 3QFDA 5T3ZE 5IBLC 3FBQA 4YHIB 4HCRL 4XMTA 2B9AA 1T2XA 4LKXA 4YX2L 1E9OB 2VDML 1MELA 3W2DL 4QO1A 4NQVB 1U8CB 4OF0A 4GAYB 1HTYA 2H6PA 4P2QD 3LY6A 1A6UL 2HX8A 2PCXA 4HIIA 1BA9A 2GBTA 3D85B 3X1EA 35C8H 2J4WL 4F58H 2WANA 2HT2C 2O6FA 3BZFB 5GZOD 1RZGA 4J1UA 2ESVB 3D1MC 4PJXA 5ILTL 1I8LA 4X5PA 3H7BA 5DMKA 4MJ2A 3NVQA 2DQTL 3ROOA 3HG4A 4M1CC 5IY5B 4AEIL 1KC5L 4B9KC 1DUYA 3HLAA 3CHXA 2IOIA 2W0FA 3PAUA 1B9KA 4PG2A 3GBEA 1PX4A 2H3NB 3C2AL 1RZ8A 3PHQA 2VRKA 4MZIA 4G6KH 5H35B 1A7QH 4OLZH 1P7QA 3T6WA 4KX7A 4IRSB 4XMWA 3C6LD 1KIRB 5E00A 4AIEA 5FM5O 3BFOA 3HZYA 4A38A 3SDDD 4NT6A 1AKJD 3SCMD 3TA3A 3L4XA 1G1KA 2H2PC 1X4YA 4LE8A 4HDIA 3CSYB 5CZXD 1E4KC 1V27A 2RD0A 3EGSA 2DWXA 3L48A 3LSOA 5DJAB 3ZL2A 2ADFH 1OO2A 4N22A 3QK0A 1HYRC 3OC8A 1AC0A 4Y19A 3CZSA 3T4AC 3TA3D 3ZIMA 3O2DH 4MD0B 5D7LB 3QIWA 1BW8A 4ZJ9A 4Z8FH 1LO5B 3O41B 1YEEL 3U46B 3STZB 2VR7A 1BEXA 4Z95L 1FH5L 1PW3A 2H1XA 2WQVA 3KH3A 3V52L 3H2QA 2I27N 4QNPF 5JDJA 3EOTL 5CHNA 4F7KA 1SYVA 1D5BA 2W95A 4GXUM 4U6TA 5F6HI 1D5XA 1K4DA 2X28A 5I17A 4H0HB 1LP9F 4KK5D 3QUKB 1YQVL 3QXVA 2BC4A 5IMKB 1IBGL 4NZUL 3AY2A 2CCVA 4JY5L 4R7DB 4A2DA 1IGML 3BVNB 4EOWH 4EQ3A 1IILE 5FPIA 1GZQB 3SGDH 5L88L 2CO2A 1WAAF 1G43A 2C9QA 2XWTA 2BFGA 4DKEL 3BEVA 2W65A 3EYSL 2BZDA 1O75A 4H20H 1BZDA 2AJSH 4DTGH 4PHXA 1F0LA 1G9ML 2R23A 2VISB 1MIEH 5DHVH 1XCTB 5EH1A 2WVVB 3OKEB 4UT9A 3M6DA 1KLFA 4U3HA 3MROB 4HEPG 5A2AA 1X3DA 5B38A 2GVYA 4JFZH 5C0JA 2OAAA 5JA8B 1UACL 3BZ5A 3WDJA 3FJTA 4UQ2B 2Y7OA 1U4EA 4L4TA 4ZBJA 1EEZA 4LCIL 4FE9A 3SPGA 5HP5A 5KN5A 3QUZA 3QPKA 4R0LA 5FAAA 3LZNA 3H54A 5HI5D 1Y18B 4PJ5B 5TPWH 2WXOA 3GNML 3UADA 4EIBA 1NDGA 2A74B 1F3DJ 2K70A 4HXAL 5GS3A 1RZFL 1G7PA 1JNNL 3BDBA 2ATAA 3QT2A 3SY0B 1XB6A 3M1OA 1EERB 1J10A 4NQCB 3HE7B 1BJ1H 2LVCA 5T5FA 3BT2H 4XO9A 1XGRA 4KTYA 3W11C 2XG5A 4PV1C 1DJXA 2CO4A 1A6AA 5AQ0A 2GB2A 5L0QC 3DK0A 3U30C 1TJHH 3IWUA 4QGTA 3KYOB 5I2IB 2NW3B 3FTVA 3MGTA 2BVPB 2B1HL 1UH2A 5BOZG 2GUOB 1QUPA 3H7BB 2BZ7A 1FFNA 3D48R 4KJYA 3BH8A 4M93B 5C07B 3IU4L 4D7BA 1JK9B 4JO4L 1A9EB 5IOPB 3TBTB 2JI2A 1FE8H 2J2ZB 2Z1KA 3VFVB 3UC2A 1URZA 3KWWA 2WZPA 1JZHA 3ARPA 2PR9A 4G7YL 4YDVB 4XPAL 2K6ZA 3UAEA 3L2LA 1BZEA 4FFWC 1OCZB 3ASNB 4KUZL 2G60H 5AUMA 3UYPB 5C0FA 3KWWB 4G5ZH 2Y23A 3K6IA 4JHAH 3HLKA 4PWIA 2B2XL 3BP5B 4OLVL 2BCKA 4PREA 4WKZB 2X4QA 4MLIA 5H2BA 5KYUA 3JWNH 3KPPB 4HGMA 3NABL 4KVNH 4G8AC 4R3SB 4KMTH 2X6AA 1GOFA 3FCBA 2OPCA 3SDXF 1S46A 3MRFA 5KSAB 4BHUA 4XT1C 4B0MM 3NZSA 4WI6A 4NQCE 4OLUH 1E3ZA 2IV8A 4O51B 4YQXL 3H9ZA 3UDWA 5KSBE 5FO8A 1TYEB 4PJ6A 3L3OB 5A2JH 3WO4B 3VSVA 4IMLB 3BAEL 5ESQA 4W6YB 3NJFA 2VXVL 4LLMB 1TTGA 3CIQA 3GIZL 2I32A 2FWSA 2BWQA 4NUJA 4U1IB 3W39A 4OV5A 2EE9A 1NINA 1F5WA 1C08B 2IBZY 4NN7B 4PRPD 1HSAB 2WYHA 4OFQA 5LBSA 4BK5A 2N01B 3BVWA 1A6ZB 1N7ML 3HKZA 4OD2A 3VGGA 4YFEA 3B34A 4IBSA 2BY0A 1JGIA 3QJZA 2WD0A 5EZIH 1ZAGA 2ZE0A 1DQKA 1RZKC 1OCWH 1VLXA 2GIMA 1AXSB 2IFFL 4P4RB 3BMWA 1U8KB 3F7LA 4P2RD 4LASH 4FZ8H 4BCXA 1OB1A 3P2DA 2HLFD 1KEMH 4AT6B 3BWUC 1CF8H 2OJ1A 2VNCA 1XGQB 1Y1DA 4PRBB 4EJ1C 2FBJH 3CFQA 4KO9A 4Y2LA 3NEOA 1U8IA 4IKNA 3LKNB 4G8IA 1FYTE 4HK3J 4K94H 3VFMA 3ML8A 4TTDC 4X6EB 1JRHL 3FTZA 4ODHH 1S7XB 4KUCF 2DQHL 4NQDE 4TVPD 2Y1AA 4F7MB 1NBYB 4AEFA 2JNZA 4JL1A 4P06A 4B5EA 5BRZE 3GSXA