5B7EA

Structure of perdeuterated cueo
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
501
structure length
477
Chain Sequence
RAVFAAERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVSAWSHPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical, spectroscopic and X-ray structural analysis of deuterated multicopper oxidase CueO prepared from a new expression construct for neutron crystallography
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase CueO
total genus 138
structure length 477
sequence length 501
ec nomenclature
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7eA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7eA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7eA03
5TK2A 1L9TA 1TKWA 3UACA 6PCYA 1DYZA 3ABGA 1BEXA 3X1EA 1ZIAA 5PAZA 4DP1X 1J9RA 2X87A 1GS7A 1RZPA 1ILUA 1L9OA 2UX7A 2FNWA 3FU7A 1WS8A 4BWWA 4YSEA 1PMYA 3EHBB 5B1AB 3HEIB 4CSPA 2XX0A 1FA4A 4NAJA 2PPFA 1TU2A 3EH4B 1E65A 2IDQA 2VSKB 4EF3A 1RCYA 2OJ1A 3T6VA 4HAKA 2YQBA 5B1JC 1ADWA 1CC3A 1AZNA 2VW6A 3IEAA 3EH5B 3ABLB 4BWUA 3X1FA 1HAUA 2IDFA 3MBWB 2GHZA 1JZJA 4QLWA 2AFNA 4HCIA 2GSMB 4DP7X 1ZV2A 1DZ0A 3N55A 1EZLA 3NSCA 4A2GA 2XUWA 2I85A 3TBBA 2FT8A 2FWLB 3FS9A 3S3DB 3EF4A 1M9WA 1PZCA 1MZYA 2BP0B 2BW5A 1SHXA 1PCSA 2RACA 2GC7C 4X4KA 3RYMA 2IWEA 4KOBA 4AKOA 1TEFA 3UADA 1JXDA 4WTQA 3SBRA 1NIEA 3FSZA 3X1BA 4AZUA 1AZBA 2XVBA 3S8GB 4W1TA 2GBAA 2MRYA 4UF7C 8PAZA 1X9RA 4QKTA 2W88A 3SBQA 2AZUA 2BO0A 4Q89A 4BDVA 1ET8A 2H3XC 3ABMB 2J5WA 2PP9A 2QDVA 1PNCA 4HZ1A 1J5DA 1PZAA 4YSCA 3ZDWA 1X9UA 4A66A 1AS7A 3NJHA 2Q9OA 4GYBA 2VM4A 3NYKA 3QJUB 3CVBA 4GY4A 1A65A 1BYOA 1ZPUA 4N8UA 2BP8B 3AZUA 2XXFA 3OMAB 2J55A 2FQGA 3IE9A 4M3HA 3FYEB 3GYRA 1CYXA 4JKNA 2QDWA 3WI9A 1PAZA 5LDUA 2DY2A 2YXWA 4A2DA 4DPBX 3AG4B 1XB3A 2IDUA 1RKRA 3UAEA 2HX7A 4MFHA 1N68A 1B3IA 4UAHA 3NJKA 2YXVA 3WNJA 1GY1A 2EINB 5E9NA 1L9SA 2AZAA 3CZUB 4A68A 1M56B 3T6XA 4JHVA 3S3CB 2JFCA 6PAZA 1R1CA 5B3SB 2LLNA 4AX3A 4F7KA 4DP4X 4E9VA 2P80A 3FSVA 4G71B 4YSPA 1JVLA 2YARA 1HFUA 5D4HA 2UXGA 4HALA 1OE2A 2P80D 1NDTA 3NT0A 1SDDA 1V54B 4PCYA 1W6WA 1JZHA 4TXVB 1MDAA 4KO7A 4K9JA 5D4JA 1AR1B 5I6NA 2YAOA 3QPKA 2EIMB 1GS6X 1W8EA 2X88A 1E30A 1URIA 4KNTA 2TSAA 2EIKB 3ZX1A 2CALA 5I6MA 1CURA 2IH9A 1E5YA 1SJMA 2YAEA 1QNIA 4L0PB 4AKPA 5B7MA 2WO3B 4GP8B 2Y1AA 1IBZA 2CCWA 9PCYA 3QJTB 4A2FA 4KNSA 3NJGA 3AG2B 3SBPA 1NPJA 2J57A 1BXUA 2WSDA 1KGYE 2R7EA 4FA7B 2ZXWB 1NTDA 3QJRB 1OCCB 2OCCB 1JXFA 1AAJA 1BQ5A 2A3TA 1W6LA 2BP8A 3JTBA 4P5SA 3H4FA 1E67A 1XMEB 3FQ2A 4JHUA 4GP5B 4HCFA 2R7EB 1VLXA 4N4YB 2DYRB 5AKRA 2GC4C 2UXFA 5B7EA 2Y69B 2JXMA 2BWDA 1J9SA 4YL4A 1AOZA 3OD3A 3TASA 3S3BB 3AG1B 4HHWA 2HXAA 4BDVB 1NWPA 3UGEA 3ABKB 2OV0A 3AG3B 2IDTA 4HHGA 4YSSA 5I5IA 1T5KA 3NP4A 2GIMA 2IDSA 2ZOOA 1WA2X 3QJQB 4KO6A 2ZONA 3QQXA 4YSRA 3ASNB 2H47C 1J5CA 2VMJA 3QJVB 3EH3B 2FTAA 1AZUA 3WNIA 3GDCA 1PLCA 3GXUB 2W8CA 4HIPA 1SDDB 1NINA 1QHQA 7PAZA 3DTUB 4KO5A 1A3ZA 3V9CA 1MG3C 4G70B 2QPEB 3WKPA 1CYWA 4BXVA 1OCZB 2I7SA 2UXVA 4DPAX 2YAFA 2CAKA 2XV3A 1NWOA 3IN0A 2GB2A 5AZUA 3UAAA 3DKHA 4ZK8A 3CDZA 2FQEA 2AANA 1MG2C 2XYBA 3NJNA 1SNRA 1J9QA 1NPNA 1L9RA 1N70A 3BQVA 3CDZB 4E9QA 4NB7A 3PAZA 3ASOB 1PNDA 4AI7A 3G5WA 2TSBA 2EILB 3X1GA 2PCFA 2JKWA 2BHFA 1L9PA 1ASOA 3TBCA 1PZBA 2DYSB 2J56A 2PLTA 2B3IA 2N0MA 3NSYA 2FQDA 1WS7A 1BQKA 4GXFA 1XB8A 3OQRA 2ZWNA 5F7AA 1UATA 2H5UA 1JZIA 4DP0X 2UX6A 1OV8A 1PF3A 2PPCA 3PAUA 1AG6A 5B1BB 3FPYA 1MZZA 4DP8X 4NERA 1KYAA 2B08A 1IC0A 1V55B 2VM3A 1E5ZA 3N2JA 2Q5BA 3NSDA 5I26A 4KOCA 1AZRA 3C75A 5PCYA 4A2HA 4PAZA 3FU7B 1XB6A 1JOIA 1GY2A 4G72B 4G7SB 1BAWA 1JZFA 3NSFA 3T9WA 3H4HA 1YLBB 1BQRA 2FT7A 2BP0A 4WKXA 1RZQA 4P5RA 3SQRA 4E9TA 3IN2A 4W9ZA 4YSDA 5I6PA 3CVCA 1KDJA 3QJSB 5D4IA 2IWKA 1NIFA 1SFDA 1KV7A 4HCGA 5IY5B 1EHKB 3S8FB 4F2EA 1SF3A 3IBOA 4GP4B 2VW7A 3PCYA 2I7OA 3JT2A 2BW4A 2HRHA 1KDIA 2E86A 2MTAA 3ERXA 5I5MA 4YVUA 1AANA 1GW0A 1OCOB 3FT0A 5I5JA 4YSQA 1JZGA 3T71A 2CJ3A 4DP5X 3TA4D 1IUZA 3X1NA 3NJMA 4YSTA 3CG8A 1GS8A 5B7FA 1WA1X 2CBPA 3NJFA 1FFTB 3UABA 3X2QB 1ASPA 3NJJA 1GYCA 3ZIYA 3FQ1A 2PPAA 1A4AA 3FSWA 2PPEA 4G7RB 2UXTA 2HLEB 2XX1A 1OE1A 1AS8A 3ZBMA 2HZHA 4KO9A 5EHFA 3FSAA 4DP9X 3OM3B 4YSOA 1FWXA 3AY2A 2PP7A 1ID2A 4E9WA 1KBWA 2XXGA 4YVNA 3FYIB 3OMNB 2HRGA 3D12B 3T6WA 1JERA 3U25A 5F7BA 1AZCA 1KBVA 2XU9A 1AIZA 1SF5A 1ASQA 1NIDA 1ZDSA 2VSMB 2AVFA 3FU9A 4M4RB 1A8ZA 4UANA 1V10A 2PPDA 2XWZA 2YAPA 5I6KA 2IH8A 1ILSA 1HAWA 3DIVA 1NIBA 3CVDA 3WIAA 2IAAC 4YSAA 3MX0B 4A67A 3PPSA 3PXLA 5I28A 1GSKA 2BWIA 4YSUA 2DWSA 5AFAA 1WAEA 5ANHA 4BXSV 1BXAA 2BZ7A 2XV0A 1J9TA 1AACA 1GR7A 1OF0A 2CUAA 1AQ8A 1I53A 3KW8A 3WKQA 1ET7A 2WO2B 2DWTA 3FU8A 3NJIA 2VW4A 3NP3A 2PCYA 3V9EA 1SFHA 5I6OA 1TEGA 1CUOA 1JZEA 4CSZA 4RH4A 1AG0A 1PLAA 3WG7B 2QT6A 2FT6A 3NJLA 3T6ZA 1ZIBA 4E9RA 2QPDB 4FAAB 4Q8BA 1OE3A 3FQYA 1KCWA 2HX9A 5B1KA 1IBYA 4KNUA 5FC9A 1KCBA 3L45A 4BK5C 3PAVA 5TK4A 2PP8A 4G7QB 2YAQA 1WA0X 4E9YA 5I6LA 3FPXA 3AW5A 4F2FA 1PLBA 5A7EA 2FJSA 2FQFA 5B1JA 1AS6A 1SHWA 3HB3B 1QLEB 3OMIB 1OOWA 1ZDQA 2BZCA 3PLYA 1A4BA 1M57B 1BYPA 2GI0A 2XLLA 4BWTA 1NICA 3TU6A 1NZRA 4A2EA 1NIAA 1F56A 1A4CA 2XV2A 2HX8A 1BXVA 4DP6X 1JXGA 4E9SA 4ENZA 1IKOP 4DP2X 1ET5A 2IWFA 3KW7A 1OCRB 3BVDB 2YAMA 2YAHA 4DPCX 2EIJB 2VN3A 4E9XA 7PCYA 1ETJA 3H56A 4AKQA 2DV6A 1L9QA 2NRDA 1PY0A 1JVOA
chains in the Genus database with same CATH superfamily
2WXQA 1ULVA 4G59C 1PIGA 4MA3B 3FO1B 1RZKC 2IWGA 2RALA 5FUOH 2DTSA 1ZIAA 4ETYA 3IMBA 4M61A 4FQHA 3VD1A 2IPUG 1UTDA 1DCLA 4HK0A 5BQ7B 3T3PF 1MCOL 1T21A 1BYNA 4J4PA 2BVPA 3MGOB 3QJXA 1K6QH 4ODSL 2XCMC 4Y16A 1KJVB 4NN5B 2KC0A 5FUCC 3QIBD 1IZJA 5H8DA 4PY7A 2CSPA 3TN0B 5TE6H 4HIEA 1TU2A 3EH4B 2HT2C 4UT9H 2NY1B 2VLJB 4N1CA 4C56D 4M5SA 3BIKA 4N0YL 1QSVA 2CLVA 1BMZA 3QI9B 1BVZA 5GRYA 1YEJL 3R06B 2DMHA 4P48A 1HAUA 3PFUA 5JZ7D 5IB1A 5ADOH 1JNNH 5J11C 1IM9B 3PHOB 2EDXA 4Y89A 2OK0L 5F3BA 4HWBL 3TWCL 5KN5A 2XUWA 4L3ED 4EI6A 1SXZA 1L9NA 3EF4A 3V0VA 4R9HA 2JIXD 1IAKA 2BW5A 2IPKA 3HHMA 3HMXL 1NFDB 4ODSH 4PH8A 1THCA 5ERWB 3RYMA 3SDCB 1D5IH 5CZKA 4KTEL 1H6EA 2P5WE 1TJIL 3MV9A 1Q1JL 3RE0A 3WHXA 2R1YB 2EO7A 2WXRA 2LLGA 3VCLB 1SPDA 1T89A 2P52A 2R1XA 1F3DJ 4OKVB 4QRPA 4DAGH 2ZCLH 3PG2A 3ZU8A 3MUZ1 2ZG1A 5HVGB 3O9WC 1PZUB 4M1DL 5B8CA 5KG9A 4RA0C 1NKGA 3ARDC 5JXAL 2MSPA 3UPAA 1YY8B 4E2OA 3TONA 2BPBA 3BHBB 2BO0A 5LBSA 4BQ8A 2C3XA 3OKMB 1A9EB 5E5UB 3RGVB 3OAWA 1HK6A 5CJ8A 1TVHB 4ZBJA 4NRYA 1TTAA 4RMQA 4AZ8B 4XPFH 4N86A 3B2UD 3C8DA 3MV7D 3TA3A 3OJ2C 4PRNB 3B7UX 4Q6IB 3MXVH 4MD5A 4CVXA 2OMYA 1EK3A 2QMKA 2X41A 1RJCA 4X5QA 5D2LF 4IOSA 3WEMA 3SE4C 2VWEC 1E4KC 2D3JA 5IQ9A 4U1IB 1L0XA 4GS7C 1L3NA 1EDQA 3KPSA 3O2VH 3C6LC 2OXGB 4IJTA 4LSPH 4MMXC 4QEGA 5KYWA 3BUPA 1LO5B 3RUGB 1OGTB 1ZSDB 5FLUA 1G7QA 4BHUA 3WTSA 1UB5A 2PYFB 2A2QT 4YNYA 2ZQKA 4N25A 3CSYA 3LIUA 1V7NH 3V4VH 5BUPA 3QFDA 1IAIM 3CGTA 5I8KL 4KX9A 1MRDH 3VRIB 1AP2B 4KKNA 2G0LA 4JVPA 4NKDB 3P9LB 4O02B 1LK3L 1LTXA 2ZNXA 2EE6A 2FWOB 1GVIA 2Z8RA 3ML8A 4Z78A 1DO5A 1NCCL 3O8XD 4J6RH 1UD6A 4Q2ZA 2F19L 1OY3B 5I16A 2P80A 2NUTB 3NBNA 4GSXA 4YFLI 32C2A 1MFCL 2CDFB 2O6FA 3QIWD 4PJ9A 3JV5A 3EF7A 3INUH 1QTPA 5DFVC 1KJ3L 2G2PA 4U7MA 4RWHA 4DKEL 4P4RA 4JO2H 1QLRB 1HEHC 5AKTA 5DD6B 2ZIDA 2DQTL 5SX4I 3HS0A 3SD2A 4R7XA 1AD9B 4AK1A 1XIWB 1G1KA 1U93B 2WK2A 4JFYA 1KCRL 4NS0A 4PGEB 2VQUA 4JFPA 4R84A 1JDCA 1IFRA 4IJ3B 3F5WB 4GNKB 4X0KA 5DUMH 4MYPA 3V5HA 4ZMAT 2P24B 3S36X 1XCWA 2NUPA 3OVUB 3N1PC 3GSVA 4P2RD 2F5BL 5G5DA 1ROWA 3D0LB 5T5FH 3X3FH 4ZFOL 1HHKB 4XOBA 3WUWB 1S9VB 1QO3B 4WFHD 4KKRA 1M53A 4GG6E 5AOMA 3WIFB 2F7QA 2Y6SD 2DWDA 5BUAA 4YE4H 4QD2E 4WDIA 2L7QA 4PRHA 5GSRB 2DKSA 1NL0L 2Z31C 2J57A 3CDYA 2QGCA 3RGVD 2XZQH 4PG2C 4FA7B 3EXJA 1P9MC 4JQIA 4K7FA 1MJJA 2ZYRA 1INDL 3T08A 1DFXA 1I3UA 2DMCA 4Z0XB 5JHAA 5CEYA 1NC4B 5DJYA 5KSBF 4DOHB 1RFDH 2JXMA 1M7IA 3U9UB 1AI1H 4LOUD 1N3NA 2Y3AA 4WLCA 4JFDE 4IBVA 3JUZA 4PJ5A 4HCRA 2E47A 3UTPE 4MLIA 2P8MB 4K23H 4PPTA 3IFNL 1DVTA 1NL0H 4PLKD 4NQDB 3RZCB 1KLFB 2DQJH 4YSSA 4ZW3A 3O6KL 1MJ7H 2HFEA 2YD3A 4P3DA 2WTOA 2R56L 1ACZA 1BFTA 2YOCA 4IIQC 1WA2X 2NY0C 2R0ZH 4Z7AA 5I1CH 5SWSD 4PUBL 1J5CA 3CH8A 4Q74A 5JHDD 1Q0EA 1T0NA 3QZWA 1OPGH 1NSNL 2NY6D 1LE5B 1SY6A 3QNXB 4Z1PA 2PNDA 2IPTL 3HNTL 1SDDB 4FABL 5BS0E 2FAUA 4JFEE 4JFED 4S1RH 2QPEB 4MSWB 4JFZH 1PFCA 3EDFA 2DQFA 4U2YA 5E08H 1K5NB 5DRXA 2XQ0A 1IT9H 1HWGB 1JUFB 8CGTA 5CD3A 2ITCA 3QDMD 4WFGE 4ZUVB 5CEZH 5GZND 5D7SH 1QOKA 5T33L 2NY7L 4W4NA 1U36A 4KHXL 1PEZA 1T2QH 1UZGA 2XFGB 1NDMB 5HJBA 4HUUB 3SGJC 3ZDYF 5K59F 3QQ4B 1QYGL 1X5ZA 4W9HC 1YRKA 3RWJA 2J7LA 3L7FB 4JRXD 1ACXA 3EJZD 3ZTJG 1FO0H 4G1EA 5E2TH 2HG5B 4HULB 2HTLC 4M5TA 2BNRA 3NCYS 2J56A 5D7JB 4XO5A 5J6HB 1M2OA 4K94L 3SE8L 2F8IA 3HBZA 1CLCA 4TQEH 3WHE0 2WXHA 1FC2D 3QR1A 5D7SL 5E1IA 3ZUCA 2WCGA 1BD2E 3VGAB 4DP0X 1NM4A 4XVOA 3HE6A 5DRWB 4DP8X 4D9RE 3PXJA 1MH5A 3UJIL 2CRZA 3D08A 4OZFA 2PCPA 1S9YA 2CPUA 5KOMC 1F4YH 3VXUA 1NC4D 3CHXA 5E51A 1D7FA 4IRZL 1SOXA 3HAEA 4LPUA 4WUUD 2E7LA 1ZJBA 5FKAA 2GTWA 3H4HA 3KWTA 3HC2A 1SMDA 3MRKB 5IV2A 5FLVA 3L6FA 1CYGA 2ZOKB 1I7ZA 3DXAE 2Z6FA 4UZGA 3T0EA 3MGAA 1WZKA 1XL6A 5EOCL 5F1KC 1E4XH 5I19H 3UC2A 3LIZH 2VWEE 4OCSH 3LZOA 4X6CF 5CINH 1XGPA 2ATPB 2V3EA 1ZXKA 4LIQL 3F7YB 2F19H 2FIRT 3K1KC 4P57A 1I3VA 4J3OG 1N64L 5D71L 1Q90A 5LXVA 4AJVA 4WEMB 1I4FA 4KGJA 4PR5B 3CC5B 4F33B 3GI9L 2HB0A 5C8JB 5L6YH 3IMWA 1OCOB 1UVQB 4YSQA 4YHIB 4G8EB 5EV7A 4JO3L 2BOLA 5J06A 4JRWA 1NCWH 1RIVL 1UJ3C 2W07B 2X6UA 5E4EC 3GZOA 3AWEA 1LE9A 5LGHL 1E8ZA 3BH8A 4KITB 4LCYA 4U0RC 4O2CB 1R3IL 2NY4D 2XG5B 1C5CL 1EBPA 3Q0HA 1BQHA 2UXTA 4G6KH 5KBMA 4QY8A 2SEBB 2NNXA 2Z7UA 2PUQT 1SJVA 2WOBA 4S1DC 2VLKD 1XF2B 5FX3A 1P5UB 5EC1B 3QRGH 1KGCE 3L4XA 4PJHE 1NGYB 1FDLL 3T6WA 1ZLVH 1Z32X 3HG4A 4N8VB 3GXTA 2Q8AL 2NLJB 3IU4L 3HUJF 1QVOB 2UV3A 5TQ2L 3M8OL 2XWTA 2JI1A 4HEPA 4NPKA 4RZCA 5FFGA 2RA1A 3ZR6A 4UV4H 4NQCA 3KYNA 5CIPA 5EBMB 5IB2B 1GSKA 4KPHH 3CBJB 3HG3A 1TLMA 4NHCL 1S9WA 1T22B 2DWSA 1DVUA 3FQRB 1U3JA 2I60H 3PDOA 3KLLA 4HUCA 2ZX5A 3A6CL 5DJXB 3H9SB 2CO6B 3WMSA 1AQ8A 1AE6H 1GAFL 1S7WB 3KW8A 1JPTL 4H8QA 3FOLB 3AAZA 5GS0H 5C0CE 3T65A 3HG1E 2NNCA 2OXHA 3DVFA 2ZUQB 3AGVA 3QRLA 1UWEH 3RP1A 1AG0A 1QSZA 3R4RA 2V2WA 5IR1A 4L9DA 4WF7A 3ULSA 3ZRFC 4H8WL 4Q9QL 5IHBA 2HJKA 1QHOA 3HZYB 2IADB 4LL9A 4LSPL 4BA0A 3ZTDC 1JCVA 2VXQA 5DZLA 3V5KA 5C09A 2BY3A 3AW5A 3T2NH 1OK0A 1RZJC 5TFSL 1U3NA 1XGYL 4BSVB 3VTAA 1P7HL 3MUHL 3WSQL 5B1JA 2VDLH 3QA3A 5DO2C 1A6UL 2ZYHA 1QLEB 4WI0B 2WXIA 3WNOA 5E08L 4NEHB 2VL5B 1YQVH 2F53B 4E0RB 3QEUB 3L3DB 5D1ZI 3LXBA 4AWJC 3W39B 1CD9B 5DTFA 4RGNE 3MLUH 4PJDF 1NIAA 3MBEC 5FHAL 1CI3M 3OTTA 1TTFA 4HIXH 5JNYB 2GHWB 1WD9A 4AM0B 1JXGA 3KJ4C 5HGDB 2YPLA 4UMSA 3LHPH 4I89A 5DJ2A 1ET5A 2BVYA 4HS8L 3KW7A 2QLVB 1J0YA 3MOBL 2X09A 3WEAA 2WQWA 2HJFB 5IBTL 4DVBA 2QELA 4E42B 5JR1H 4Z8FL 3GJFH 4X4ME 3Q9QA 3MRGB 1L6PA 3LN5B 2CO1A 4NHUB 3MV7B 2VE6A 2W5PA 4UMGA 2NRDA 3P9MA 1QR1B 2IG2H 4XX5A 5JQIB 3CDZA 1DLHB 1SOKA 4NYLB 4PJBB 3UACA 1KSRA 3FT2A 5K9KA 2NX5E 3VFRA 1DHKA 3RFRA 5HYQB 2JTYA 4JO1L 5MEPB 3TO4D 3IU3B 3JWDH 3L54A 4AY0A 2L8AA 4OF6A 3LEVH 3P0YL 2WTPA 1BGXL 4PB9H 2GABA 4U6VH 5E8EB 2AI0L 5A2KH 2PPFA 4GW1B 5CSBA 3S37L 1OT4A 3G5ZB 1BVNT 5ADPH 3CIAA 4ZO7A 3Q1EA 4JLRB 2FGZA 3WKMH 4WKZB 1FNEB 4B7LA 2OZ4A 5DVMA 3GSOB 1DSFL 1VPOL 1FFOA 4XPGL 1S9XB 3WGUB 3BKYL 2ZWLT 3DRTA 1V7ML 2YLKA 4EVNA 3RDTB 3T77A 2IFFL 1S8DB 3MXVL 2VM9A 1VFAB 4LSVL 2VLRB 3N40F 1SOSA 3QWQB 1NMBH 5CJQH 3BDBA 1MZYA 1CZ8L 2BP0B 2FHFA 3GK8H 3JBG7 3MUJA 2XQBH 2ZYIA 3S4SA 3L1FA 4KVPA 5TE7H 3WLWD 5EO1A 2CA4A 3KLAA 3RTQC 2GC7C 4ES9A 5DS8A 4MNHA 3GB7B 2QQNL 5BZDB 4PS3A 3RVXD 4KAQL 2R23A 1IEHA 1PD0A 2WLZA 3BP7A 4IRJC 4P3WA 4UV7H 4XXCC 1A6AA 2WIIA 1UEMA 2FWUA 3MRFB 4B9ZA 2EDDA 2D8KA 1WIOA 3V0HA 2JELL 3Q1SL 1X4XA 1CLYH 2EYTB 4XHJD 2HLAA 5TE7L 3TP4A 2H3XC 4NRXB 1A6ZA 1CFQB 2XQYG 3U0WL 3T3PB 1BZ9A 2CGRL 2FUTA 4O2FA 5CKGA 2Q10A 2WLLB 4HOZA 5I66A 5EZLB 5EU7E 1KPRA 2FJHB 4L8SC 3ZDXF 35C8H 3HPLA 3KYOB 3Q13A 3DMMD 2LAAA 5ICXB 1RZ7H 1U8LB 3F2LA 3Q44A 4HGWB 2Z8VC 1JTTA 4HJGA 2Y3NA 1DVFD 1QFPA 4UTAA 3VXMD 3MXWL 1E4XI 2AABL 1DSFH 5FO7B 3VI4B 2CIIB 2WTRB 5AOIA 4M3HA 3L2MA 4JFXB 5GHWH 4NO2A 5J11B 3Q1SH 2YUWA 1O6SB 4KGLA 2FRGP 3BWUF 4QWWD 4R2GC 4Y1AE 4CVZA 4DPBX 2J4WH 4X5XA 3SJVB 1Q9LB 1REIA 3AABA 1Z5LA 3LD8C 1XB3A 1IGYB 4HX1A 1RKRA 3W57A 4HU8A 1B3IA 3HFMH 3NJKA 3UIZA 1S4IA 2JV6A 1L0PA 2FBOJ 5AW2B 2B14A 2YD5A 4NC0B 4HJJL 4D3CH 1MW2A 4H20H 3D9AL 4LBEB 4Z3TA 1CL7L 3BZDA 3NOIA 4H13C 3ULVE 3LRMA 2H0JA 1OAXH 4U1LB 1WSST 5CHNA 4QAWA 2BRQA 3QO1A 3MJ6A 2ZKWA 1NMBL 4A7GA 1HFUA 3F62A 1MF2H 5JPMB 2AVGA 1FIGH 4WK4B 1OB1B 5J6GA 3L4VA 3GSNA 4MA1B 1M05A 3DX6B 1MDAA 1QSFE 3UO1H 2CLRB 2WVTA 1GYAA 2OZNA 5TFSH 2VDPH 3EYSH 3GMPA 5EZOL 3LCYA 3MUGA 2WN3A 2BX5A 2FATH 1J8HD 3AADB 2CRMA 3L4UA 4L8SA 4B9FA 1UEYA 5D1ZA 1TTUA 2FR4B 1V5JA 4NZTL 4OIIL 5EU6E 4A38A 4EKJA 4D9RD 4W6WB 4MQ7B 3F6LA 5CJBA 5I1IL 2W0KA 5AUMA 5I9QB 3MA7B 3RB5A 4G6MH 3CXFA 3N43B 3ZTNL 5JQ6L 2C4FT 1OAJA 2OL3A 2Y2WA 2UYLA 2HFGH 5JMRA 5JHLL 3BVUA 3RRQA 2G75A 2NW2B 1RK0A 3R7QA 1P1ZB 2PWGA 3Q3GA 1FZOA 4XXWA 5D7IB 1RUKL 3RBGA 3V55A 4DZ8A 1QSED 2K0RA 2X4PB 1CD0A 1QQDB 2OCCB 3KPRE 4UQ2A 1QFWI 3VFTA 2UY7B 2WBJB 3AXLB 3QAZC 2D0HA 2VZTA 4OTXH 1FNHA 3L1GA 2H26A 2M8XA 5ANMB 2PMZA 4JFEA 2EDEA 1QRNE 2FO4A 25C8H 3CBRA 5AKRA 3SDYL 1AQMA 2EABA 3IGUA 1PG7L 3L5XH 3MUY1 4ELMB 2W1NA 3MO1A 4JHAL 3QWNA 4QXWA 4YHNA 1IGML 3GF8A 5KAQF 5EU5B 3Q9PA 4MCNA 5SX5K 2WVSA 3Q5TA 3QJOA 2F7OA 2J5LB 3FHEA 1MLBB 3BPNC 3PNWB 3MV8B 3C12A 4HK3J 1EJOH 4RMBA 1A7PH 5EUOA 3LQMA 2IBGA 1JPTH 3OKEB 4GUPA 3FMGH 4PGJA 3MLWL 1HNYA 5L4IA 4EMZA 2XA8H 3EFFA 4CC4A 5DMYA 3SGEH 2BY0A 1LWHA 2FTAA 3EOYG 3IDIA 5I18L 1HEJC 4FLQA 3LS5L 3LIZA 4HBQA 2K4WA 2XSKA 5FR3A 5JDSB 4NPJA 4KKAC 3HN5A 1QHQA 1F4YL 1QP1A 3GSUB 2J25A 5INDA 3PP4H 1DQML 2VDQL 3BKYH 1F4XL 2BIOA 3Q8EA 4FNQA 4BINA 3V0EA 4YGAB 4P2AA 3D30A 3DUUB 1TENA 1WDAA 5T1KB 4ELKA 4KKQA 2CRYA 4XNUH 5IQ7H 3OGCA 1ITBB 5DJ8A 2QADB 3SE4A 4DNLA 1FVEA 1PW3A 4AYBA 1FVCB 4Y9EA 1RQ5A 5HYSG 5ISZD 4XMPH 1ZEAL 3NG5A 3TJEH 1G6RB 1P6AB 2VNCA 1JFHA 1JPEA 4XMKL 2XYBA 3KD4A 1XWVA 4N6RB 2ICCA 4PJDA 4XVTH 3K4DA 1MCRA 2DLEA 3MRLA 4H0GA 3V95A 2DMGA 5DD3L 4UTBA 5JPMC 1AXIB 5GRXG 1JVKA 5KBLA 4ES8A 3FUIA 4V1DD 2ICWB 2DYSB 1XSOA 4WWKB 5HDQH 1IV8A 1ADQL 4J3OH 3VXRE 3IAGC 3HG1B 2ZXDA 1DBAL 4TLTA 4JPWL 4NWUH 1XVSA 3QYCA 3QHZH 2X1XR 4JO3H 2NX5B 4YDKH 1SDYA 2P5ED 3MRRA 2PWHA 4Z7VB 2X4TB 3FUNA 1I1AA 3U36A 3EYVB 1X5JA 4OAWB 4PJAF 4GRMB 1N64H 5D71H 5KJ4A 2CCLA 1EHLH 3H3PH 1BAWA 4ODHL 1OPGL 1D6EA 2X7LA 3MBWA 3N44F 4WWID 1D5ZA 1JV5B 5IMOA 5ITBH 5C0EA 5CWSA 4MAZA 2Q6WA 4URKA 1YC8A 5E6IC 2VR3A 4NT6A 2YGNA 1S2EA 4DO4A 4QRAA 4ZQKB 4KK6C 1ZRUA 3VVVA 1KDJA 2PTUA 2AJXH 4Y2NA 2WYHA 2YEZA 1UYWH 3QH3B 4GLRI 3E38A 3BVVA 1U8JB 3GMNA 3FUEA 3UZEC 1NBCA 3AREB 3PCYA 4CJ0A 3W37A 2X4SB 1T20B 5DYOB 1QYGH 4FQLH 4PJFA 2BSSA 3UJIH 4PRIA 3WJMB 3L7EB 2IFGA 2ADGA 3FT0A 4YHYC 1CLZL 1K2DB 4JREB 1QWHA 2ZE0A 1YECL 3IJYA 1JTOA 3CG8A 3PHSA 5I6XC 1WA1X 4Y4HA 2D3LA 4R7NA 4IMLA 1UT2A 3ZHLA 4CAGA 3GMOB 3FU0A 1QD0A 2XN2A 4PJIF 1UWGL 3FCSA 2JCCA 2DIAA 5FKPB 3JYBA 3IMSA 2PR4H 1TPXC 3F7VB 4WSKA 3N6YA 2DN7A 4PVNA 5ELIA 6FABH 3ATEA 3KAAA 1ZT4B 1H0DA 1BAFL 1T0MA 3RVWD 5A2BA 4LVOC 1FE8H 1AIFB 3VX1A 4H2AA 3R0MA 4E9WA 4W9IC 4ZAKA 4JHWH 1U8NA 2BNQB 4M43H 1KCUL 1R5WA 4BYHA 1QBMH 3QDGB 3B9EA 4D0DA 1CU4H 3D39A 1NJ9A 5E23A 3UBXG 1L5GA 4Q9RL 3L9RB 1NUNB 3O2WH 2XWZA 3L5IA 3DOSB 3KCPB 5FHBL 4UUJA 5C0BB 2Y7SA 5HHXH 4RMSA 3BFWA 3NRFA 3HE7C 4HUMB 5A1AA 5JPNA 2K6ZA 4GXUM 4ODUA 1R5IA 2YGOA 5I28A 1CJYA 5C2BL 1BIIB 3GJFA 4AYFA 3GBNL 5AFAA 3VD0A 2EUWA 2D2OA 4LHUB 3DSFL 4JM2F 4CU8A 4Y1AB 1XSJA 4GRLD 1C5BL 4L9LA 1LO3L 4JUSA 3WE1A 2R56H 5J89A 3BKMH 5KSVA 5ACMA 4PYHA 1I53A 2ZCZA 2GJ6A 1RUAH 3NP3A 3VXSB 3P2TA 1JNLL 1XEDA 4U1HB 5HYIA 3C87A 4YK4C 3J8F7 5BNXD 3L13A 2AHIA 4A7UA 2AMUA 4RGOL 5ACLA 2CLZA 1EVTC 4H40A 5FWQA 4Y5XB 5KVGE 4ONFH 2WKLA 5CUSL 2C9PA 1AQDA 4FFWD 1TCRB 1RP9A 4P2QD 1KCSH 4PRBA 4CW1A 3PDGA 1ZMYA 1FYTE 4Q9RH 1EEYB 1B9KA 4PJBE 3V6OA 3IB4A 3HI5L 1ECZA 4GEIA 5D7LB 1IBFA 1F00I 4AMKH 4H88L 4PJCB 4N2OA 2RGSA 5ISZE 1EAQA 2BZCA 5F9AC 1KTLB 1NICA 1I75A 3CN1A 1BV8A 2O30A 3NCEB 3CCHB 1UOVA 1S5IL 5F71A 4P59H 4W9FC 1Q0YH 3L7EA 5EA0H 3TF7C 4FP8H 1G6RH 2YBRA 3DV4A 4NO0A 3OQ3B 3WMPA 1Q1JH 4ZUSA 1YN7A 1F3JA 3IPFA 2ITFA 4MKTA 4XBGA 5IB4A 1PD1A 4HPOH 4E9XA 3H56A 4ONGH 1DQLL 1NKOA 3CVHA 4NUMA 4F9PC 1XT5A 3HE6D 3BO8A 3D3VE 3KBFA 3IVKB 2ZUQC 1MLCB 4Z23A 2JI2A 1R3LA 4TQEL 1LJMA 2Z1KA 1F42A 3ROOB 2YFNA 1E50A 1EXGA 4AENB 4P3CH 1JV5A 5IMOB 1D5ZB 3TX4A 1ZK5A 3RNKB 2C3WA 5T5FA 3V8CA 1YA5A 1V3JA 4WV1A 4LEXH 2ED7A 2EIZA 2RFXB 5J6SA 2NY3D 4NQQA 4ECNA 2ZOLB 1FL5A 1GKEA 2NY0B 2FIKB 3O6FC 5C0FB 1N6UA 4Q56A 2W0FB 1YSOA 2YK1L 2PF6A 3EGXB 3T8MA 4GO6B 5E2UH 4KJQD 1NSNH 2X4TA 3FU3A 3MLRH 1K4CB 4OF7A 4NC1E 2IDQA 3VXSD 1HI6A 3P3RA 2W9EH 1OCWL 3SGEI 3E3QC 5B1JC 3DSNA 3BH9B 1NFIA 1YPZE 4NFCA 2OX5B 4YIQA 4EZJA 3CN2A 5LB1A 1DN0A 2FJGA 4P46B 4DJMA 5EZJA 3RWCB 1T83C 4QLWA 4PV8B 3IFNH 4N2HA 2ZWSA 1WYJA 4UTCA 1Q0XH 1G9MC 1FFNB 4AYDC 1BZ8A 2A6IA 3BQUA 2IPTH 4W9EC 4QRSB 4N6RA 4F7PA 3NIDF 2Q76B 1BF2A 3QORA 1ZE3C 4NKIL 2XQYA 5TQ0H 3RX7A 3HZMA 3EADA 1KJ2H 4URTB 2X4OA 3B56A 4HIQA 4PJEB 4XOAA 2WUBH 3UJTH 2AK1H 3JTSA 4EZLA 3Q2VA 1KMGA 4AE1A 3HI6L 3MKGA 4Y4FC 1MAML 3HN8A 2WB7A 4OGXL 3RWFA 3LKPA 2VABB 5F1OB 1RZJL 3MA9H 4AYMC 4HBCL 1WCQA 2J21A 1BQLL 4OLEA 4FJ6A 1G9ML 8PAZA 5IHZB 1X9RA 4XCYB 1U3HD 4APQB 1SEQL 1VCAA 4DEPC 4RIRA 4WFFE 4PGCA 3JWNE 3OAUH 4XNBA 4BIKA 3MMEA 3N0AA 2OR8A 2AQ2A 3FONA 5CP3H 1Z3RA 1PZAA 5E6ZA 2WD0A 4IKNA 2WLJA 1HINH 3BVXA 4ANKA 3FB5B 2P8PA 3P9WB 5J12B 3BEVA 1K6QL 2Q9OA 3SGKA 4GYBA 4ZOAA 2Y07L 3CVBA 4J12A 4K7PX 4FERA 5FGCE 3DMMB 4I85A 1D5BB 4XOEA 4I1PA 2V0AA 4ZYKA 3NA4A 2FO4B 1WPCA 2GJPA 5FM8A 2NNAA 3ZJAA 5DGRA 3AXLA 2AEIT 5FV2A 1V3KA 3RVVD 3S48A 3V0WH 4TOYH 4QXUL 1JD9A 2QHRL 1JPSH 1A6PA 1Q9KA 4M6ML 4O02L 4HD9A 3ZE0F 2JJSA 4G7VH 3GSQB 1KLUA 1RIHH 3GWJA 4UI2A 4MJIE 5C7ZA 1P1ZA 3VG0L 4WI5A 2XWCA 4JB9H 2IANB 1MEXH 3KPPB 3BDXA 2XQBL 3KBEA 2OL3B 3QO0A 4OZFH 3E6FB 1GZHA 4WI4A 4WHYG 1BM3L 2KL6A 5D96B 2P28B 3GKZA 1MY7A 1U3ZA 4XPTL 4LXFA 5ISZA 3QFJE 2YARA 3GINA 2MNWA 3LZLA 3LXCA 5D1ZB 1JP5A 3ZGHA 3KM1A 4L3EB 5SWQA 1QFWM 1N2RA 5HD8D 1CTOA 2GK2A 4LQFL 2V4LA 2K7QA 2FDBP 3S35L 3SE3A 3SYCA 1C12B 1U8HB 2V5YA 1RZFH 3IGFA 4LOVA 3STLB 4PJIA 1A7QL 1JWUA 2CLRA 3ET9F 5J8OA 2SODB 3GMRA 4OZIF 1ECYA 5H4YA 1ESOA 3ZX1A 2ZOWA 4O5LH 4XPHL 1CE6B 4FNLL 1SJXA 1M1XB 2XBDA 2E0PA 4WW1A 1J8HB 2BVOA 3EYOB 3QO1B 2WXOA 2VISB 3HUJE 3NA9H 4MJID 1KGCD 5BRZD 1IBZA 4GI9A 1UFGA 1LP9F 2A1WH 3T5WA 3NCXA 1DANU 4CSSA 5JIKA 4PFEA 4FA8A 1ZE3H 4WI7A 1HINL 3RWGB 1LXMA 3BVNA 3IJ8A 2WSDA 5JHBA 5L88H 5E6UB 1IKNA 3MNWA 1F4AA 1IAOA 3UGXA 4N85A 4UBDC 1UJTA 2FH8A 3BD4A 3I9IA 2N4IA 3MNWB 1FHGA 1T1ZB 4JJHA 3REVB 3CD4A 4OM0L 4Z7UE 1EERB 2GC4C 4UQCA 4AEIL 2DMKA 3OSKA 2B77A 2EDQA 3D3VB 1AOZA 3R1GH 3MRCA 4LO9A 5JORB 1LWJA 1QPXA 2I32A 4Y5XC 3WNKA 4FG0A 2Z0UA 1LNUA 2NY1C 1U8LA 3O4LD 3OZKA 4M5ZL 2BVOB 2VN5A 3EYOA 1R24B 2EIEA 5ADOL 2D3VA 4QXTA 5CAYB 3M45A 2FJHA 4B5ZA 5I5IA 1M1XA 1T04B 3BSZL 3PGCB 4O2FB 1LD9B 2WJ5A 4YEEA 2EEFA 5J3HC 2OMVB 2JI3A 5DZPA 1FAIL 2EXYD 4YSRA 5IT2L 5DVKA 1T7ZA 1CF1A 3GIVB 3QR0A 3NSJA 1JXKA 2MPAH 4PP1C 1XGRA 4K0OA 1G9EA 3STBA 4HIPA 1OTUC 1TITA 3VXRA 3LPOA 1A6AB 4LAQH 4R3SB 2R23B 1TQSA 3S7GA 5ISZB 4XPBL 4MBOA 4TUKH 2XV3A 4N0UE 4JKLA 4KKCD 5DS8B 1U95B 3B9AA 3KPPA 1D6VL 1G4MA 4GAJL 1C08A 5L8LB 1BD2D 4YJZL 3WDHA 3RJQB 1BEYL 5HDLA 5DT1L 3S4SB 4NDMA 4HPYH 4YHLH 5DK2B 5GISH 3T77B 2AJYH 1BFVL 4NB7A 3LN9A 4ZS6C 4AI7A 3G5WA 5FUZH 5LG6A 4PGDB 5AVWB 4H1LH 4NGHH 1VSCA 2IGFL 1YNTF 3BAKA 5D8JL 4OCRH 4ZSOA 2OTPA 1FFOB 2DDQL 3TBCA 1P6WA 4Q58C 1NCTA 3L9BA 4YDZA 2DJSA 3VXSE 2G3MA 2N0MA 4GXFA 5AL8A 3CH1B 2H3KA 1NEUA 4H1LA 1D5BA 3QPQD 5F7AA 4XP9L 4N28A 1SHMA 5DZNA 3X12A 4AIXA 2A9BA 3MNMA 1I85A 3HBQA 4WWKD 2FEEL 4PCSA 4ZMYA 3VFGH 3ZOAA 3EXLA 3A4EA 3HFFA 4M8VA 4EBQH 2UY6A 1ZHBA 3MMEB 2DI7A 4HXAL 3T4AA 1MWAA 3B7RL 3SO3B 3D3VD 4M29A 3HI1A 4LSDA 5HHVL 3SQRA 3GSRB 3AREC 3FT2B 3GBEA 3BKCL 2A38A 5IHZA 1JRHI 4NOBA 1DLHA 2YPLE 3D5OF 4IK6A 5B3NA 4DH2A 3DV6B 3V4PL 1EHAA 3GBLA 3VE0B 3HR6A 4DKFH 1A7NH 3OJDB 1X7QB 1I8MA 3VFOB 3S37X 4KV5E 3GMQA 3N9GH 4JO1H 5J56B 2O61B 3BDYH 1N12A 3N42B 4HFUH 2FE0A 3CFEA 4TSCH 1RZ8A 4MXWL 2CE6A 2HP4A 5J1AA 3HRPA 4HJUA 4M48H 4CGTA 4G9FA 4AH2B 1XSIA 1FVDB 1NCNA 1T1XA 1KB5L 4OFDA 3TYGL 4G7YL 4GW5B 5JNYA 2V2XA 1VKXB 4WWPA 3PWUB 3T71A 1JDAA 2O6EA 4IGBD 4QXGH 5KWYC 4J3OF 1FFNA 1ZLVK 3FFCA 1HWWA 1P5VB 2CBPA 3SE3C 4C59B 3V4UH 4JG0H 3WNPA 1QI4A 2E7MA 3CXDL 4P46A 1T03L 1MCPL 3FTSA 3W3BA 4YIQB 3SDCC 1D3CA 1HEZA 5GRUH 4J3WA 3QUMA 4A37A 1DQTA 5IMKB 4WY7L 3FTGB 1WFOA 3PUCA 2OYKA 5EU3A 2NXZB 2CKBL 1BZDA 4PV9B 4OGAC 1RIUH 3WXWL 1W72L 5TDPB 1AO7B 2XXGA 4YVNA 3GBDA 3OMNB 2HRGA 3OX8B 3JQOB 5DD5H 2VDRB 4MZ2A 3BWAB 5DR5H 5GRJH 2Y06H 3CHRA 4HQQL 3HRZB 5KYXB 3BUYA 4ZAKD 3S9DB 2X05A 1V10A 2F7IA 3BAEH 2GBTA 4R83A 2C1PA 2IH8A 2CO7B 1A6VL 1ILSA 2WJ7A 4ZUUB 5GGRB 3HW7A 4LU5L 4BGLA 4FTVA 3UAJD 2GTZA 3BO8B 1P7KB 4JW3A 3VRJB 3AAZB 2YJLA 1HL9A 2CJUH 3H8NA 3CVHB 2Z7YA 3MR9A 4EE2A 1DN2A 3H9SA 5F0LB 3PGDB 4GIPD 1GJUA 3TBTB 1NCAL 2D7OA 2AAVA 1S6NA 3PV7A 5KBKA 2V8MA 4TS6A 1Z9OA 4LLWB 2H1LM 3N1MC 5CIPB 4GRLA 2CXKA 3ZVVA 4NQCB 3R4DA 1MUJA 1SFHA 4KHXH 3POHA 3RWHA 4HUKB 5B38B 2XWTB 1TQVA 3P77B 4XB3A 2R2CA 1TCMA 5EZIH 3WKNA 3MGTB 3MRIB 4L3CB 1YECH 3QHFL 4FKEA 4GG8A 4Y19A 4N8VA 3VFSB 3T6QC 1NUGA 1X6NA 3CQFA 3OPZL 4RGNC 4Y4HD 1RERA 2UWEB 3IFLH 5D1QB 5IF0A 4PHZA 2OMUA 5F7DB 4DN4L 3O81A 5CLWA 4NCC1 3P0VH 3CFMA 3MJ9A 2HUEA 2O26U 4FGMA 4OBRA 2KPNA 4X8JB 5LLIC 1GCFA 3UPRA 1XH1A 4QRRE 4YDLB 1BQUA 3MX0A 2X3CA 5A7EA 5K69A 1HKFA 1X7TA 1SHWA 3AMKA 1FCCA 2DS4A 1S78D 4HH9A 2VGLM 4QTHB 1QUNB 4LCYB 4G80A 1OOWA 1ZDQA 4RRPG 3PLYA 1A4BA 2ENPA 3JTTA 2WZ6A 3UTTB 1MHCB 1BYPA 2HKAA 1UXWB 1TZIB 2XLLA 4XP1L 3A6BL 4HUWA 1ND0B 1UM4L 4G8EA 4LHJB 3IJEB 2WQSA 2MOGA 3SDDA 3DGCR 4L29A 2YR3A 4XMWA 2GJ6B 3MLSH 3A0OA 1BBJA 5EIVA 4P46C 2QFPA 2Q2EB 5FO8B 2JKXA 3GTNA 4DN4H 5C6TH 2BS71 2H32A 4JPVH 4Y1AA 1WTGT 3SKOA 4AKQA 2QZQA 6CGTA 3REWB 3B5HA 5LHDA 4ZO9A 1P9MA 1CXIA 3Q5YA 3QAQA 5JDJA 3FTVA 2WQUA 1JVOA 2PPCA 4GINA 3K6IA 2VRAA 1TJHL 5IV2B 4RFOH 2QPSA 3X1EA 3IPEA 2XVKA 2VO5A 4QTIH 5D1XE 3Q8BA 2NXYC 1GS7A 2H2PD 2HT3C 1SN2A 3IS0X 3VXUB 2G5BB 2H45A 3DRQB 5I1LB 1R5WB 2ZWZA 1YN6B 3IDJB 1XH3A 5FOBB 2B4CL 5E9DB 5IB3A 1KPVB 3WJJC 3RZCC 2ICWI 5F7NC 4M48L 5T1DL 3V5DB 3M17B 5IHUH 3A4AA 3EH5B 1MRFL 5FO9B 5FKPA 1DVFC 3HS8A 4G5ZH 3WCYA 2GHZA 1W0VA 2QQLH 3HCVA 3RWDB 3K2UH 1FPTH 4M1GH 4Y4HB 5KZCD 1HSBA 1ZV2A 4C47A 1DZ0A 2PYEB 1QABA 1OLZA 4DWHA 2Y2YA 2A9NL 3IYLW 3CSTA 1RL1A 4PY8J 2XA8L 2BSSB 2D03H 4PTUA 4UM9A 4ANUA 3L5JA 1DQVA 3ZPDA 5JOFB 3UPCA 2XWJA 5DEGB 5L2KA 2GFBA 5IFJA 2KHAA 2PETA 1IE5A 5AVZB 3PWLA 3WNNA 2ITCB 1K85A 1TEFA 1E4WL 3I84A 2Y1ZA 1EGJL 3O4LE 2YEZB 3DHUA 4AVIA 3TVMD 3QEQE 1IKNC 1U41A 2VR9A 3BP5B 4F5CE 3DDGA 3D18B 4ZQKA 3VW3H 1ZANH 1R0AL 1XIWC 3QZWB 4N9OB 3K3QA 5C0EB 4NXSA 3SYAA 3FB8B 3NH7L 1P0SE 5EUKB 5BXFB 1DUYB 3WYRA 4F2ME 3PL6D 1B2YA 4AEHL 4GRMA 2Y0SA 1NCUA 2HFEB 2JK5B 1GHFH 4KI5C 5D5ME 2AITA 4J1UA 3OZ9H 4Q9BA 1H15A 4RFOL 3UDWC 3MRRB 3SN6N 2DOCA 5IW1A 2NX5A 2LT9A 2IBZY 3NYKA 3OJMB 1JNLH 1E8XA 2WC7A 2MCG1 4PJ5B 2NYKA 3HG1A 1M7IB 2JXMB 2E7LC 1R6VA 1DQJB 2BOBA 3QNYB 3V79C 1UUSA 5EN2B 5DJYB 3RWIA 5DHVB 4HDIB 4J23A 3RY6A 3SGJA 1ACCA 3AG4B 3VMPA 3HE7B 1GC1L 2V5SA 3UAEA 1N68A 1TJIH 4RVBA 3L4CA 3II1A 3ARFA 2ID5A 3MV7E 4K7FB 3T3ME 1AI1L 5HDWA 3QSKB 3IFPB 2NSQA 1J48A 2AKRB 3CZUB 3Q06A 4QRTB 4XMLL 4B0MM 4WDIB 3D25B 3QQ3A 4TNVK 1FVCA 3ZL2A 3OWRA 1TTGA 4PJEF 4WO4C 1LEGB 3KJ6H 4JFQB 2B1AH 1ZOXA 3FB6A 4YZFF 2X9YA 2EZ0C 2HPOA 1HYRC 4Q9CA 3PQYD 1S9VA 1SUHA 2GIXA 3LSOA 4PJGE 5KYUA 3DUUA 5KZCB 3D0LA 5G5DB 4N2KA 1XF1A 4XGZB 2C26A 3ULUD 1OE2A 1UOWA 5IEKA 1ZJAA 4PJ8D 1UD3A 4R6UA 2FX9L 1A4KB 3OKYA 1AD9A 4K9JA 4YHZH 3RVWC 3C60C 2YAOA 5D1ZD 5I1DB 3BAXA 1BD2B 4TLSA 4GUOA 1Z9NA 2HJLB 1QPPA 3AITA 3L08A 1XEUA 3LHAA 3HHRB 3OKEA 5E95B 3BZEB 1KYOJ 3WTXA 2CDFA 5BV7B 5IESH 2BNUA 2R4RH 3D69A 2NUTA 3IDXH 5H2BA 2WWKT 4JPVL 4RISL 5TPWH 5FFLA 3QXDB 5C08A 2L0DA 2CCWA 1S3KL 1B4JL 5I8CB 1XFPA 2FWOA 4I48A 3F00A 3K6DA 5L2KE 2DL2A 3SDXE 4OIFA 2KBGA 2QGBA 5JIIA 3ZE2E 5JXEC 2PW1A 3QFDB 3CU7A 2GJZB 2M1KA 2NOYA 1JXFA 3AJ7A 2NQ3A 4N2DA 2UY7A 2WBJA 4WWOA 3L3JA 2UUDK 3JTBA 4GT7A 5KOVC 3H4FA 3HS9A 5LN4A 3WEBA 4BZ1A 4JHUA 4GOSA 1PFOA 1RUMH 1MIEH 3ARWA 1ZLEA 2E8ZA 1KGXA 4ORGA 4PWGA 5D7IA 4BQ6A 3KPSB 3NUKA 2J88H 3MRJB 1DSYA 2A77H 1RK0B 3D51A 3O4LB 2QSQA 3QUML 5JW5B 3V0FA 1R33A 3GS4A 3OD3A 2UYLB 5IMMB 1C9SA 4KJPC 1G0DA 1AKJB 1OAZH 2CM6A 2JKNA 2VTFA 4GMSH 4UAOC 4FQXA 5I1KL 4BDVB 2CKBA 2Y06L 4N0FA 2BSRA 4GI8A 1NWPA 5SWSA 3UCQA 4B9CA 3B2DC 4DGYL 2GT9A 2RIKA 4MTMA 2K9FB 3SJVD 4XN9A 4FLHA 2Z9TA 4M6AA 3EHBC 2IDSA 1MCIA 1FIGL 5F9JA 3IKCB 4NKMB 3QHZL 5LAPA 3U46B 3GGWA 1MCKA 5GGTH 2QPFA 2DW5A 3GDCA 4K55A 4PP2A 4HZLB 1M05B 1DSWA 3TO4B 1OAKH 3T09A 4S1QL 2R1XB 2YSSA 3G5YA 1T1WB 4G70B 4OKVA 4UQEA 1B9ZA 3PUUA 5CZVH 3VCLA 4BXVA 2WLNA 3M86A 4GRWE 2F74B 4Y9FA 2ADFL 3GDBA 4Z77B 2IO5A 4PJ9D 1I9JL 1E9PB 5LCVH 3DYMA 4WZ9A 1G9NH 1FV1B 5KJ7E 1A9BA 5FYLL 4LOEA 4ZK8A 3VA2C 2ZCLL 4G6FD 3H2WA 2IC2A 1EIBA 1IAKB 4LNRB 1A7RH 2EXTA 2YWYA 1AHKA 4N9GA 2Q86A 5FGBA 5SWZE 3BQVA 4NNPL 4TSBH 3CXHK 3N9GL 1ETZB 3T04D 3ECBA 3ZIMA 2E9WA 1F58H 2JCCE 1ROCA 2QZ5A 2PCFA 3WOVA 4F7MB 2VC2B 2MPAL 4N87A 4U1NB 1R4XA 5CZXD 3U79A 5A43C 1XF3A 2WXPA 1TVBB 2XN9D 2GTQA 4GMSL 4WO4B 1IL1A 4MZRA 2YZ8A 1CFSA 5HHNB 3VI4A 2O5NA 3BSZH 4QRRA 1HNGA 3U1SL 2EDFA 1JYNA 4HGWA 4AIOA 1CF8H 5C7XL 1TU2B 3LPFA 5ICXA 1UKQA 5HXMA 3OC8A 3HPLB 3KYOA 5GPRA 5PCYA 5H37H 4NUQA 2NX5D 3V0WL 1JOIA 3DJTA 2UZXA 3CN0A 4HUXA 4LOFA 4NRXA 3MSPA 5LBVA 4ODVL 3GKWH 4QPEA 1T5XA 4QRQB 5DFWH 3CLFH 5CFHA 4JNXA 5TE6L 1ZLUH 4LGRB 1T4KB 5F7EL 4QXGL 3PXHA 2EVIA 4AG4L 4BZYA 2YD2A 3KVQA 43C9A 1YPZF 2AQQA 4ATWA 1XGUA 1E42A 1KV7A 5E4IA 2EDLA 2AXHA 3NIFE 4Y2DA 2C9SA 2X4QA 43CAB 1GTNA 1R5VB 4JL1A 3DK0A 1NC2B 3LRSA 4MJHA 3EBIA 3A22A 4MNHB 4CNIB 5ECJE 1KXQE 3PJLA 3W0WE 2HN7B 4M4RA 3KLAB 2J6EA 2YOAA 1M3IA 4L8CA 4ZXBA 4YDNA 4JPIB 5JHLH 4FLRA 2WKOF 1MI5E 4FQIH 4POYA 4ZNCD 2FX9H 4YHZL 3NQIA 2AJVH 5CR1A 1S8DA 4OD1L 4YDMA 2G9HA 4UQ3A 2PO6C 3S35X 4O5LL 1PKQE 2QHLA 5IROD 1GH7A 1IKFH 5CU9A 3NJFA 2F54A 5T1KD 3BWUC 2Z34A 2DICA 2HTLD 2J1XA 4KKLD 4GO9A 1UWXH 2FATL 4PW3A 3IK2A 5IVXB 5F88A 5KJRH 4BEIA 1TJMA 3DPBB 5F9OL 3FQ4A 2XX1A 3GXFA 5EH1A 4ZFGL 3O11B 4O51B 4M7JH 5D2NE 3ME0A 5HDBE 3TT3L 3MJ8B 3G5ZA 4KO9A 4TVPH 5TQ0L 4C57C 3IMVA 2BHYA 4UIMB 2OR9H 2FNBA 5ICYA 1HQ4B 3DHMA 4JFDA 1OAZL 1PZ5B 2GSIB 4WU5A 5I1KH 2IQAA 4WI3A 2XU9A 4KQ0A 3PHQA 4K9EH 4MBRA 1NIDA 1U8IB 2VR6A 2XIBA 3IF1B 3ULUE 3ELQA 5D5MA 1S5IH 3W9EB 3BLPX 1KIQB 1XBRA 3Q43A 1U2CA 5E7FA 4DVRL 2AQPA 4FQ1L 4U3XA 3ES6B 2A7BA 1F1AA 3GJFK 3RI5K 3MV9E 5C0IA 4XWGL 2JKJA 2H6PA 2WKOA 4QGTA 5A2CA 4PJAE 3ECVA 3BUDA 4NHUA 2IAMB 4ODVH 1DQIA 4AMKL 3MRGA 4K7PL 2O6PA 1AJ7H 2XV0A 4Z7UA 2R83A 1KTBA 1GR7A 4I0KA 4XXDB 2YMTA 2EUXA 2YPLB 3WKQA 3NH7H 4JAMA 2DH2A 4ZX3A 1YC7A 2DWTA 5C3IA 3HE6C 1F8TL 4U31A 3GTVA 1FF5A 3F7QA 1H3GA 1M71A 3QIUA 1JZDC 2J5LC 3L3DA 4P2QA 5C9KA 4QUOA 2VL5A 5EF3A 2CGRH 2NTSP 2L7JA 3GXIA 4D94A 4J4PD 3WKYA 3QA3B 1BVKA 4NNPH 3U0TB 4XHJC 3O3DA 1YJDH 4BK5C 2NDFA 2VXVH 4OSUL 1WT5C 1C8QA 4N2BA 4O58L 4J8RA 5CBEB 1VDGA 5DVLA 2YQ3A 4XP5L 1KIPA 3ZR5A 4YDVB 1G0XA 2X2JA 3KYAA 2HLFD 4OLWH 2R8SH 1BFOA 4L8BA 1XR9A 4O4YH 4AT6B 2HJKB 2ZICA 3BMWA 5ESVA 1A3LL 3UBXA 5LVEA 3NFSH 3QRFM 2XKNB 5KSAB 2AC0A 2LABA 1JGVH 4K3JH 3J27A 3MKKA 3T0DA 4LSRL 2WINA 1RIHL 4P0DA 4IRZH 3SZKC 3WJLC 5DD0H 4R96B 4OCYH 1A3QA 4XBPB 4HKBA 3L3KA 1XGTB 5GGUA 3WFBH 3NZ8A 3HTLX 2R69L 4DW2L 3GXMA 1KPUB 3PL6B 4KZEH 1N0XH 1KYDA 4DPCX 4AG4H 1CDHA 4HKXA 3BN3B 2XJKA 2Z31A 1T22A 3FKUS 3QR2A 4RGOH 1AR1C 1M3JA 2Q0ZX 1HXMB 2QSVA 1NLDH 5DFAA 5TGBB 2R39A 4FI7A 4UINH 5T1LD 2V3FA 4RZCB 4U0QB 2OKMA 3BVWA 2A74B 3H7BB 3X13B 4PD4K 3DI3B 2WXMA 1BEXA 3BPCA 2MCMA 4DEWA 2GUYA 2VDKH 1RUML 4LHUD 3QFGA 5C0AB 1S7UA 1ILUA 1HZHL 1E2ZA 2XPGB 2FNWA 2UX7A 3FU7A 1N10A 3L4TA 4RMWA 4HEME 5LAXA 4YSEA 4PD4J 3M7FB 3B8SA 2VUKA 3LN4A 1NOFA 1F4HA 1LO4H 3VNZA 3MRBA 3QWOA 4HKZB 5H94B 5LGHH 2SEBA 2ZX8A 1D7DA 1K4DB 1FZMB 5TTRA 4OCWL 2VW6A 5AVRB 4XBEH 4OT1H 2QQKL 2DJ4A 1DBML 4XP1H 1UT9A 1TF4A 5EC2A 1RPQA 4E68A 4MMXB 4A6YB 2OTUA 1P7BA 1EJFA 2QTEA 4P5TD 4O02H 2W07A 5BW7A 1JZ7A 5F3FA 2VITB 3N55A 4V11A 3NSCA 4JE0A 4NM8H 2NW3B 3TH4T 5JMOC 3ZE0B 5FB8B 3O2DL 3MNDA 3GS0A 4N8VG 4UILL 3WY4A 4XE0A 4QMEA 1HHGA 3FQTB 3KWWB 4PR5A 2JQAA 3UTZB 1TPXB 5FPIA 1PJ9A 3MREB 1CN4A 2D7MA 1OTTC 5JYMA 4TKWA 4PV1C 3F7YA 5C0BE 1KEGL 3IMRA 2JCCF 3D39E 3QIWA 2EKSA 5BV7C 4OU3A 1EHXA 1AZBA 3L95B 1TQCB 3O3AA 3VI3F 2RJMA 1BZ7A 1NGWB 1I7ZB 1BG1A 2ZX6A 1KBGL 3EJQA 2XRAL 4UCFA 2X2HA 3ZDZB 5FKAB 3D09A 3MTXA 4KI5F 4R97B 3WEXB 4OF5A 4RX4D 1KGWA 5D2NC 4LGSB 2VERA 1AKPA 2WAQA 1N5YH 4KK5C 4X7EC 1X5YA 1OP3H 1JE6A 1S9YB 3UTPD 4AQ1A 2ZSVA 1MH5B 2BJML 4OH2A 5D1ZC 4NUGH 4PG9A 4Z7VF 3F12A 3HE6B 4WEEA 3O3BA 1AZZC 4WCYH 4PJ8C 3ULVH 3CPLA 4AMXA 3B2VH 3KPSD 2XXFA 2XFXA 3AXHA 3WIHL 3ULUC 3VDBA 1DBMH 3P02A 2NMSA 1LO3H 1AC6A 4M1GL 4KMQA 4YHPB 4F37K 5LGJA 1WITA 3DROB 4J2XA 2HG5A 1LEKA 4K07A 4OZHB 3DUHA 3L7FA 5E8PB 5F89B 5AENA 2ESVB 1GGTA 2QEJA 3QIBC 1ZA6A 2ZSWB 4JS7A 4G9DB 3SBWA 3WE6B 1EZSA 2RTTA 2P4AB 4P59L 1L9SA 2AZAA 4WFHE 4EEEA 4MJ2A 1ZS8B 5HYFA 3P40A 4H8PA 5CUSH 3UP1A 4IKKA 1RJZA 5EZIL 3PWJB 1BCIA 2BINA 2MKWA 3PY9A 1GA2A 4E9VA 1T03H 5I1HH 4CMMB 1UCBL 3L16A 3ILQD 3H9YA 2DM2A 4NQED 5DMIH 2G3ZA 4UYQA 4D9LL 1B0RB 1NDTA 3PQYA 4I3SH 1SDDA 5E8PA 2QADD 5F89A 1QACA 4YFLF 3RAJH 5GS1B 5J57B 2CDEA 1A7OL 3B9KB 5C0RH 5I8KH 5DRZA 4OZGF 4MRCA 4WV1C 3RU8H 5KS9B 5D2NA 3US0A 3I6LE 4BRVA 3PL6C 3RL2B 2XXCB 3DC0A 3K7UA 4NN6B 4YH6A 1TZGH 4Y2LA 5F3HA 4MWFB 1HKLH 3BSGA 1XIWD 2GYSA 2XDHA 3SYOA 3RZCA 5BRPA 1DQMH 2VDQH 4FXTA 4BH8A 4A2MA 4FFYL 2JWYA 1ZV9A 1FLRH 4JVWA 5AL0A 3O2WL 1BA9A 1USZA 3LRHA 5T1DH 3LX9A 4HXBL 3TNMA 1UGNA 1OSYA 3LNIA 1YEGH 2W0LA 2R2BA 1SOQA 5K9JL 4KH9A 2HLFC 1CDBA 2HWZH 3KE0A 3IDYC 2ZXWB 1EFXD 3ESMA 1BZ7B 2ED6A 5HHOA 3TZVA 5I0YA 4FLSA 2XY2A 3LPPA 4HSAC 3SD5A 4P5SA 1J1PH 5M94B 3TCLA 1MJJB 3EOBA 5CIPH 1QLFA 1CFTA 3EYUH 1MCPH 2Z64C 3TIEB 1F4XH 2HKHL 3W9DA 4OIBA 2PR4L 1QKZH 2ZYSA 4ZUWB 1ZLUK 2V37A 3JYCA 5EWIH 2X0VA 1XGQB 1WIUA 1QO3A 2XXMB 2C9VA 1Z2KA 4L37A 5EFIA 1JK9B 2CRIA 2WPGA 2YMXH 3VGAC 4FQPA 2WP3O 3QAZB 1M7UA 4P2OB 2FO1A 2R1WB 4H20L 2ADIB 2F8VA 4KV5F 1A8JH 1QX1A 4MMXA 2F7PA 2IH3B 1QLEL 5F6IC 4DUWA 3FQNB 3D33A 5FUCE 3OR7B 1RJYB 3TWCH 4TRPL 3O2DH 1FZMA 1IGMH 3EJTA 1J8KA 2CJUL 3BD3A 4GI6A 1H8OA 4P5KA 5DHXB 2CMRH 4HPHA 4E5XB 4LEBA 1IM3D 4U6YB 2D31B 2LFGA 1J12A 2Z8WC 3D52A 5C0AA 4Z78B 2UZIL 3FCBA 4D8PA 3P9LA 4GQQA 3P4LA 4IBLT 1ZVSB 2AANA 1G4RA 1AP2A 1JGUL 5DUPH 3RVTD 2DQIL 2IALB 4JG1L 2A9MH 3QDJD 1J9QA 5ALCH 3RFZA 1OT2A 2WUCH 4TM9A 3PAZA 12E8H 1GGYA 1PZDA 4IBQA 1THAA 4HG4J 1UB5B 1QZNA 1BREA 3QHFH 4XN1A 2YD6A 4IQHA 4LLYB 1OGTA 3FH8A 5DJAA 5DRNB 2H1PL 4NO0D 5KYWB 3P4OA 1D9KD 1PZ3A 5I1EH 1NA8A 1E90A 3PL6A 2BSTA 5DZAA 3EOTH 2ZWNA 1UFUA 3NZ8B 3OR6A 4JDTL 5E94B 4EN2A 3CNKA 1H19A 4HKBB 1DJSA 3H2PA 3F04A 4MD5B 4Q6IA 3KGTA 4R96A 3PAUA 2WNXA 4WW2F 4KRLB 4M93C 3UYPA 2OMXA 1KYAA 4KQ4L 5I5RA 3H0TA 4M6OH 3UMTA 1CFNB 3QUYD 5F7KC 1XB6A 1TVHA 1ZPLA 2GG1A 5EOQH 4WGKA 4G7SB 1BG9A 3OKMA 2HT4D 2IOIA 2XKNA 3HUJB 5FYKU 5KSAA 1S7SB 1CL7I 4TPRL 4KBPA 3TNNA 4XPBH 5AKVA 3JVGC 3P69A 1RZQA 3QT2A 1VERA 4Z7WA 1OSEA 4YK4B 3BVTA 3B3IA 4LOUC 4RGND 1FNGA 3DMMC 1XR9B 1JMXA 1CO1A 4QJ4B 4NKQB 1KN2L 4UM9D 2CBTA 4U6XB 1KIPB 4NM4L 2Z1PA 5TH2A 5AB2A 5GISL 1X5XA 3FQUA 2C3VB 4X6DF 3P1VA 5DR5L 2YD0A 1D5MB 3KPRB 2WAHA 1SXSA 4FKHA 5AVSB 2B0SL 2XWBB 3IBOA 1JCKA 2VW7A 3P2DA 4GAGL 5LKNA 3RBSA 4QT5A 4HV8A 4P2QB 4EDXB 1VADB 3N0PB 4MHHG 1ORQA 4NQVA 4APQC 2AK4D 4L4JA 3NPSB 4JANB 1OP3K 3RFZC 3P0YH 4DP5X 1I9EA 4JQIL 1IUZA 3NJMA 1TTBA 3IRZA 3PREA 3QORD 3IRCA 4JAMB 1KCVL 4R7LA 3B43A 1QBBA 1R3JB 5E1GA 4XXDA 4MNGB 3NTCH 4ZMZA 5DS2A 3GLEA 2QFRA 2N59A 4WTZG 1A4AA 3BP4B 4PSRA 5ILTL 3TV3H 2DDQH 2VZUA 4O00A 5IFHL 2IAMA 1FFPA 2KZ1B 5EIIG 1OP5H 1B0GB 4TNWF 3FSAA 2V5RA 3VD9A 2JELH 1O5PA 3IMTA 2A6KB 2D7TH 1T21B 2NY2C 3A67L 1KBVA 2I9TB 3IWUA 2YS4A 4X9GA 5E00A 2XI9A 1U8IA 1ASQA 1J0IA 1F2QA 1T83A 4PB0H 1A8ZA 4IKJA 2M26A 4AEIH 3S3PA 4PG2A 3MROA 1LDPL 5EORL 4YSAA 2IAAC 3HJ0A 2GAZB 2Q7AA 3TO4A 4G7YH 4DK5A 3BW9B 1NCDL 2OJZL 2BWIA 2ZUWA 4KU1A 5GGSA 1JHKH 1DDHA 4KY2A 5L4FA 2LLLA 3MLVH 5DHMC 1CS6A 2QVFB 4QNPF 1M6OA 2AK4A 2K6YA 1E6JL 2PCYA 4AQEB 1G7PB 2AV7B 4TULH 1YNKH 2V9UA 4XC3H 1E6OL 4PJ7E 1G7PA 2AV7A 2Y9RT 2IG2L 5C09D 1QRND 4CSZA 1OGPA 1A2YA 3WG7B 5I18H 4JPIA 2YXMA 2IGFH 1V3LA 3VD2A 2EVHA 1IKFL 1BJ8A 1JIBA 2YJQA 1UXMA 1A1NA 1N67A 1TKWB 2DIEA 2RBLA 2L7EA 3AM8C 3DJ9A 3MOBH 1XL4A 4ISVA 1EJOL 3V2AR 2X4QB 4ODXB 5I23A 5C0AE 2PP8A 5DJCB 5DMGC 3JWDL 1BF8A 1GAFH 3T2PA 1G43A 2KKQA 2C1OB 2YAQA 3A67H 3ARDD 4WFFD 5DLML 4BQBA 1QASA 5E1HB 2I25N 4MD4A 4FFVD 4WWKC 4XP4L 4H8VA 1MFBH 3I2CH 1S3KH 4OCMC 4UOW0 1I1AD 4UV4L 4X5WA 3ZKNC 2DQUH 5DDHA 3VSVA 2ILLA 3IXAA 2AJYL 1NZRA 4X4XA 1CVSC 4Y5VB 4DF9A 5DZJA 2BHZA 3MV01 4FEMA 4LLUB 3FT4B 5CXPA 1AJ7L 1UQSB 1U3HB 1AGDB 3K2KA 4K7PH 2E6QA 4XCNB 5KVMC 4QRRB 1YYLL 4IGBA 2PCXA 4F15B 5C97A 4L18A 3VFNB 4WO4A 4B9JA 3V6FA 1U4FA 2IH1B 1XF3B 5ACZB 3L1OH 4MAYD 5CCGE 1K72A 2PCFB 3BP6A 4F7MA 1TETH 3W1ZA 3C5ZD 1UWEL 5TD4A 3KLQA 3H9HA 5EBLA 3CZKA 1MAMH 1OSZB 2AERT 1DLFH 3BYTA 3MNVA 1KXQA 1XZ0B 4JCWA 3W0WA 4BCZA 1DYZA 3L4ZA 1ORQB 2GJ6E 3B1TA 1Y0LB 4G6AC 4YHOH 3BIAX 1J9RA 3DDFA 5FYKH 3SCMD 1VACB 3JT0A 5EU6A 1WZLA 2VL4A 4MHHI 1E9PA 1TVDA 2WBXA 3HC0A 5C0JA 4YLQT 3O0LA 1WD8A 5CJQL 5IW6A 1QI5A 1EFXA 3FQUB 1WBZA 3EUDA 1BMWA 4EF3A 4U6XA 1NFDF 1L6ZA 1ZTXL 1HN1A 1ADWA 1CC3A 4B5EA 3IEAA 3B3IB 3ABLB 3ZDZE 3I3DA 5T3ZD 3NCYP 5AALA 2NNRA 4FYSA 4JG9A 3IKCA 4F7TB 3EJRA 3NJVA 4MQXC 1KZYA 2Y5QA 2Y7LA 3FZUC 2D0GA 4Z5RA 4F8QA 4HIXL 3BZ5A 4KI5D 2R0WH 2I85A 2FWLB 3FHQA 3H0TB 2QSCH 1JHLH 5SWSE 4ZZFA 3GUTB 1AXTL 2OQJA 1AO7E 1X9QA 4FNUA 3DTDA 3JWOC 1G5GA 2CIKB 2XKSA 1F1GA 4X83A 1GRWA 3A47A 1U91B 4X4KA 5IMMA 5HTSA 4G8GB 1GL4B 5EEXA 1U8OB 3HB3D 1HJBC 2EVJA 3LH2H 4GKZB 5I30L 5CKAA 4YDLC 2X6MA 1NIEA 1F4WH 3IT8D 2VDPB 2UZIH 4LIQE 4NQXB 3L3JB 3FDWA 3ISYA 4MAUL 1MJ8L 4MJIB 4QCIB 5FF6B 1FBIH 1K9TA 2B39A 3LMJH 3NPSC 3RFZB 4RGMB 4YLCA 4XN5A 2JCWA 1AYOA 3IXTA 4U33A 5K39B 5TJWK 5CLTA 1RUAL 1ET8A 4FC3E 2WN2A 2AQNA 4QR7A 4MCYB 5DUBA 5LCVA 2ZOUA 5KEZA 4E5XA 3WTTA 4R0LB 1X9UA 3VAEA 1UA3A 5T33H 3JWDC 3AU0A 2LU5A 4XPTH 3C5ZB 2KT6A 4OUOA 3ETSA 3AXIA 1OB0A 5I82A 3BE1H 1ICTA 4AQAA 3QS2A 2OSXA 1G7LA 4Z7UF 4UOQA 3T4AC 3COOA 5DCCA 3ZT6A 3KBHE 1I7TA 2V6HA 4NZRH 1VEMA 4HH8A 3DX9A 3VFVA 3CZFA 1A4KA 3VDAA 1CFBA 1JN6A 5LDUA 1FFQA 1JBJA 1WWWX 3VMNA 4MXVF 3U9WA 3FQXA 5HPMB 3Q6FB 1NAMH 4P2OA 2FB4L 2YXVA 2VDML 4BZ2A 1KY6A 5IB5B 4DETA 3X11A 3IFOA 4ELMF 2BOCA 4LEEA 4QHLA 1SRDA 3KR3L 2FEDC 2X44D 3ETBJ 4UQDA 3S3CB 4FZEL 1P4IH 3I6GA 5H37A 4QRTA 5DQDH 2NXYB 3E9TA 4F7KA 5LJYH 2GSGB 4P9HC 4OLUL 4Z18A 2JB6A 3TEZA 1JF5A 2VAAB 3TCLB 3EW3B 5F0PB 4CDGC 4JZJA 4OLZL 2WZPD 3OBAA 4LCVA 3UJTL 1AH1A 2QSTA 4HWEL 1GGIL 4M6NH 1DQJA 2Q20A 5MEQA 1JWMB 4I0PB 5I75B 5M7QA 3OKNB 4JJOA 5CEZL 3C09C 3JSSA 5DJ6B 4AQ1C 1UXSA 2CALA 5I6MA 1VGEH 2QV2A 3LYRA 4QOKE 4XPAH 3VM5A 1Q9OA 5F1NB 4U6HA 4HHAA 4KX7A 2NY6C 1CWVA 4LCWB 4OLXL 4NNYA 4QGYA 1MHPL 1JPSL 3UROR 5EU4B 4KNSA 5AZEH 4WGVB 1BVOA 3GZPA 1NPJA 3B9KA 2W9DH 4YXKH 5C2BH 2R0KH 1D5XB 2KQMA 4LRIA 3VFWA 4S11A 3I02A 1AAJA 3BP5A 4GKNB 5CLZA 4FG6C 4JKPL 3ZZSA 4MASA 1VLXA 4LCCB 1IFGA 4CMMA 4IIZA 5MHSE 3HZKB 2EADA 1KGJA 4JG1H 5CILH 3TASA 1JGUH 5DUPL 2GFBB 5IFJB 3G6JF 3TT1L 3G04B 2E3VA 3K72B 4WNQA 3VWJD 4KH2A 3DO7A 1L3WA 1DTUA 2DQCH 3PQYE 2NZIA 1SJHB 3CPUA 4HJSA 4OQTL 4E41A 1G7JB 3HBPA 3APNA 4KDWA 3WE6A 1AKJD 3MHZA 4HHGA 2Z31D 1ZA6B 2ZSWA 3ULUL 2GIMA 3TPUA 2KDYA 1HXYA 1KT2A 2QKIB 5BRQA 1L7TH 5EF1A 1HSBB 2B5IB 4OZHA 2ZONA 3S5LA 3LEXA 5K93A 2BS8A 3D50A 4JKMA 2APFA 1GZQA 5BW7C 3QDAA 4ICWA 1XD0A 5DZOA 2W8CA 5B21A 3MODH 2NY3C 3RKPA 1EJ8A 3O3EA 3V5DA 1Z3GL 2L04A 4TQHA 4G43B 5TF1H 4H26B 5DC2A 1U3YA 3F12B 4AIZB 4WO0A 4LSQL 4QOKA 3F85A 4PJ8A 1KWGA 1MRFH 5KYYB 4XN8A 5C07B 3TT1H 5I17A 3AU1A 5HI4D 5C9JB 2WVUA 2P26A 4KX8A 2GB2A 5GGQH 1GZHC 3UAAA 4UTAL 4OGZA 3C6LA 3GLZA 3PNRB 5E6YA 4ZMLA 2AK4E 4OGAD 4TTDD 4F3FA 5FDYA 1H9DA 2APTA 1FNFA 1NGWA 1KXVA 2VC2L 3RWEA 3MLWH 5IOPB 3M1OA 3CFBB 3DOHA 4MXQD 1CR9L 2ZAIA 1SGKA 2BDNH 2DQEH 1J7VR 3UZQB 2R0LH 2BH0A 1WHPA 1TQBB 2B3IA 2VDMB 1P53A 4DGIH 4R5TA 5G55A 1XB8A 3C2SA 4NO5A 4RNRA 3MCKB 5D1XB 1CGWA 1NCHA 5IQNA 1U8MB 4MCZA 1MJ7L 3BRFA 2DQJL 1L7TL 3LQZA 2B20A 3SY0A 1MCDA 1MZZA 2FUQA 2PW2A 2VYRE 3ROLB 4J3TA 4M62H 1E27B 1KB5H 3FOMA 3HIZA 4K23L 3TYGH 3VXMA 3T3PE 4HUWB 2X28A 4FNPA 1KJ3H 1TZIA 3LKQA 2XYCA 3JTTB 1K8DB 1Z3GH 4LFHG 3T9WA 1KB5A 5HY9B 5EU7C 3MODL 4GS7B 4JGUA 4LLQB 4WKXA 4BQ9A 3O6FA 1W0WA 3MLXL 4LRIC 1FAKT 3C08H 4TN9A 4DZBB 1E8WA 3PP4L 3RPIA 1K4DA 4N2GA 5DD3H 5ECGA 5B3JF 2X6VA 1AYRA 1IBBA 4I13B 3DVGA 3ZL4H 3UPRB 3ARED 3TYFA 4CKVX 4R0LC 5GZOC 4NP4H 1P4LB 3V4VL 4MDIA 5D1QA 3QCVL 5IF0B 4N0YH 1SF3A 3T2QA 4B9PA 1BOGB 1O0VA 2KMWA 3B6SB 3PWPA 4GG8B 2OL3L 5CJXC 4ODHH 5JHDB 3KPRD 3MRIA 4L3CA 3ILPB 4Y9CA 3NEEA 1KDIA 3SY6A 2IGLA 4GG6B 4JY5L 3RWHB 4X98A 1QFHA 5AYUL 2HRLA 2WW8A 1MFEL 2OFQA 3DWTA 3WUZA 4GSDH 3WIIL 2L3BA 4AUYA 3TFKC 3OHXC 4BFIB 4NZJA 1G0YR 1PKQB 1AGCB 1NGZB 2O5ZH 2NY2B 3FQ1A 2RQ8A 4HKXB 3V4VA 3H9SE 5EN3A 3HKZA 4ZS6D 2I24N 3U4EA 4DIXA 1F18A 5GGUB 1CT8A 2Y7QA 4Z3IA 2BNQD 4R90L 4P5MA 1H6TA 1P7KA 3VRJA 1ZWIB 3RLSA 2R29H 2PP7A 3O45B 4JFSA 1MKFA 4PJ7B 3CFDB 1KBWA 1U58A 3I74A 2RCSL 5IQOA 1QSFD 1VEPA 1ZA3B 1FUNA 3A6OA 3C8KB 5C0BD 3ZL1A 4AW7A 3AQZA 5F7BA 3O6ML 5A7BA 1PQZB 1DBJL 3BUYB 3HRZA 2XTJB 2EICA 2VIRA 3IDMB 4K3GA 5KYXA 3BWAA 1T6WA 2EC8A 5IUCA 3HHSA 3HVDA 1NEZB 5KVEL 1BJ1J 2YLHA 2XRAH 5GIRA 5IJVB 1SJEA 1UGKA 1A6WL 2WB1A 3ARRA 3LVTA 3PPSA 5EU3B 5L0QB 4TQ8A 1EDYA 5INCB 3II3A 5EIIA 5ANHA 1KZQA 4LP8A 1NMCC 1LEIB 2DQUL 5HGAA 3WO4C 2CUAA 2VDKB 4Y1AD 3L2NA 4JY4B 4J3OC 1R3HA 2CHNA 3V9EA 4FABH 1MW3A 1VGKB 2FVNA 1MFCH 5ID0A 2UZYB 2VLJE 3JV4A 3VXME 2E4TA 3VNYA 3AS0A 4F7EB 4BH7B 1NBYA 4G9FB 3T8XB 3S4SG 2Y5TA 1A3RL 1IBYA 2AEPH 3I75B 3TJHC 3KPTA 3BMVA 2A0LD 3PAVA 5TK4A 2O61A 1DJHA 4MJ6A 4RWYL 3FN0H 3GXDA 3VFOA 3L2LA 4LCUA 3H3BC 1JPFA 4XO9A 1L4IA 2EUZA 3G6DH 3DV6A 5T3XD 1J9CT 1PYWB 2WYZA 3INUL 3P4MB 4LSVH 1ADQH 1AS6A 3QCUL 3DO4A 4NQTA 5JO5B 1FH5H 3M88A 3TIDA 5BV7H 1OQOA 2UZPA 4BE6A 2VR5A 4F1ZA 1MWAB 1M57B 2E7DA 3CFNA 2CA3A 2HFGL 5A2LH 1JPST 1PZ5A 2MCPH 4JFDB 5ICYB 2A0LC 3B7SA 3UL4A 4XMKH 1N59A 5D7LE 4NZTH 1YUHA 4MXQC 3MJ8A 4V1DA 3D06A 4DQOL 3EO1B 3X12B 5ES4B 3WL9A 1YEHL 3O11A 4MAYB 4X99A 1CXHA 1C8PA 1TZHB 2MHAA 3CH1A 2NYYD 5F1IB 3POCA 1EUTA 4LU5H 1IJNA 4OFIA 1SLWA 3AQYA 3WN5C 3DVNA 4J3OD 3BC9A 3ILDA 3MLVL 2PXYC 1CICD 3QCUH 4FD0A 5HVHB 3V7AE 1YDPB 5F0MB 35C8L 4GQZA 5DC9B 3W2DL 2X89D 2OMWA 3KPSE 3OC5A 2IAMD 4Q4EA 1U8QA 3WS3A 4L8CB 4IS6A 2NDGA 3E8VA 1GZPB 1RZPA 4NSKA 2VERN 1NBZA 2HT3D 2FD6L 3LRSB 4L4TB 2BRRH 4NN7C 2X4RB 3AUWB 3TBVB 3W82A 3WFDL 3DX3A 2IQ9L 3LHPL 4GFTB 4R3SA 3VG9B 1WFNA 3JXAA 1MI5A 4HWZB 4L8DB 5BS0B 3MRMB 5FEBA 2N0KA 1R9FA 4PY8I 1INQA 3O41B 2BVQB 2WWMD 1ZT1A 3ESNA 2MIZA 2Y24A 3U7YH 2CUHA 1FRGH 3WFEH 3QUYA 25C8L 1KOAA 4G9FD 3A4FA 4YFEA 2DLIA 3ALXA 1V7NL 4OZ4B 1O7DE 4DP7X 3NK4A 1U8KA 1H5BB 3HZVB 1EEZA 1T04A 7CGTA 4KTDH 2FEEI 1A14L 1CTMA 2DBJA 1M9WA 1X4ZA 4W6XB 1R24A 5IVZA 4X42A 2CUIA 4B6ZA 4DFIA 2DQGH 3EUUA 4Q97A 2ZWYA 3X14B 2P44B 1ES0B 3U0WH 3QYMA 2XWEA 1TETL 4ZFFB 1H3VA 1RXLA 1GIGH 1MCCA 1CXFA 4OQTA 5ID1A 1E4JA 1WFTA 3WN5A 1QBLL 2W65A 4CILA 5HHPB 3FAWA 1UD4A 1MVUB 3V6OC 1HHJB 3TGXA 3ZTJH 2MRYA 4N9GB 5AOJA 5TDOB 1SYSA 1BGXH 2R29L 3HR5B 3QUXB 3BVNB 1IM3A 4XB7A 3DX1A 3WTYA 1GJIA 4R4BA 2GPZA 1N18A 4ZOEA 2CO2A 3TC9A 4Z3EA 4JMNA 1J5DA 4N68A 2I60L 2VJXA 4XX1E 2DB8A 4RETB 3VXRD 1RU9H 4BSJA 1RJLA 1RZIB 4AC4A 5JW3H 4ZMTA 5D93B 1CQKA 5KSBA 1T1WA 3IGAB 4GY4A 3ZGIA 4N8UA 2BP8B 4P99A 1E28A 2RR3A 4HIJA 1CL7H 4OTXL 4HZLA 4PVLA 5C2UB 4EIBA 3BKJL 2PWEA 2XQYK 3GMRB 4LP4A 3BFQG 3WSQH 4JKNA 4M03A 3STLA 1NOAA 4YBQD 4GRWB 2G60H 5LNEA 1N2RB 3CV5A 5KVGL 3U6RA 4NKOB 1P4BL 2IAND 4MFHA 5AW5B 1TJXA 3ZTNH 1GY1A 3R19A 4K8RL 1A6TA 3AY4C 1E6OH 2CKBB 3V7MA 3T6XA 3WEOA 3E6FA 1GIGL 5KS9F 3B2PA 5D2LB 2X53A 3P3YA 6PAZA 2IANA 4LLVA 4MNQB 1TFPA 4Q6IC 4R4FL 2GK0B 3BZFA 1LQSR 5JIMA 2QQNH 3QDMA 1B4RA 1IAMA 2GCYA 2WSPA 4GW4B 1QA9A 1XF4B 4KO7A 5HYJD 4RSYA 2VDOL 1IARB 2B9BA 5BRZA 5L6YL 2CO4A 5F7EH 1GS6X 3QJFB 1CG9B 4JFTA 2FGWH 4X9HA 1E30A 2QHRH 4M6MH 4Y9BA 1WBYA 4HLJA 4IBTA 1KXTA 4K8RD 4DTGH 4HEMA 3I6KB 1D2PA 4PGBA 3EJYC 4AE0A 1G84A 2J1WA 3QZMA 5SWZD 3VU1A 5DLLA 1QLEH 2YAEA 1FL3B 4X6EA 1TNMA 3FB5A 4D3CL 4G42A 3CZGA 2XBZA 3MDJA 5BRZE 1JZ2A 4OFPA 1UD8A 1MELA 3ZRCC 3GSNL 4X4YA 5DHYA 4PGCB 3PABA 3EGSA 3ORJA 1UB6B 3F05A 1BD2A 3AG2B 1P2CA 1PDKB 4APQA 2A83B 1BXUA 3Q2WA 1X5KA 4ZTPH 4QHMB 3KGRA 4LMQE 4AXWB 3K1DA 5MENE 2ZUYA 4NI6A 4QRBA 3LEVL