5B7EA

Structure of perdeuterated cueo
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
501
structure length
477
Chain Sequence
b'RAVFAAERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVSAWSHPQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
molecule tags Oxidoreductase
source organism Escherichia coli k-12
publication title Biochemical, spectroscopic and X-ray structural analysis of deuterated multicopper oxidase CueO prepared from a new expression construct for neutron crystallography
pubmed doi rcsb
total genus 138
structure length 477
sequence length 501
ec nomenclature
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7eA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7eA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7eA03
1KYAA 1SJMA 3AZUA 4DP6X 4YSSA 5I6MA 2BO0A 2CUAA 2QT6A 4GY4A 5I5JA 3CDZA 2A3TA 2PPAA 2GC7C 5E9NA 3T6ZA 1A8ZA 3QJRB 1PNCA 3WNIA 1NWPA 2WO2B 4A2HA 1E5YA 6PAZA 3IBOA 3NSCA 2PP8A 4W9ZA 2I7OA 1XB3A 2PP9A 4JHVA 3UADA 3AG4B 1PAZA 4E9VA 1ID2A 3FQYA 4NAJA 9PCYA 3NJHA 2AZUA 2FT8A 2IDQA 2XWZA 1M57B 1IUZA 1BYPA 2NRDA 2PPDA 4G70B 3UAAA 1UATA 1AS7A 3S8FB 3N2JA 4WTQA 2TSBA 2CJ3A 3V9EA 3FSWA 4DP5X 3FU7B 4W1TA 1CURA 1B3IA 4A66A 5EHFA 2FQDA 1NICA 2OJ1A 3EHBB 1JXFA 4AKQA 1AACA 2CBPA 3PCYA 1JZIA 3ABLB 2PPFA 1HAUA 2JKWA 5D4IA 1ADWA 3BQVA 3N55A 2GB2A 3CZUB 4GP8B 4KOCA 4DPCX 1A4AA 2BZ7A 2IDFA 2N0MA 3T6WA 1AS8A 3NJIA 3X2QB 1T5KA 4BDVA 2IWFA 1TEGA 3WIAA 4E9XA 2GSMB 3TU6A 1NWOA 3FSAA 1ZIAA 4KNUA 4E9TA 2FQEA 1JXGA 3T71A 2BP0B 5B7EA 3X1NA 4RH4A 1WA0X 3ZBMA 1KDIA 1ASPA 1OOWA 1FFTB 3ABMB 4L0PB 2VM4A 2UX6A 3PLYA 1NPNA 2VMJA 1J5DA 3FSVA 1JVLA 3H56A 2GBAA 1AZUA 2MRYA 1PLBA 2FWLB 2Y1AA 3OMIB 3TBCA 3CVDA 1QLEB 4DPAX 2IH9A 1URIA 1W8EA 3T6VA 1ILSA 1SFDA 2H47C 2EILB 3QJVB 4FA7B 1W6WA 2DY2A 1AIZA 1HAWA 2JXMA 4UF7C 4ZK8A 2CCWA 4X4KA 3OQRA 5B1BB 1KV7A 1ZV2A 2EIJB 3X1BA 4YSOA 2PPCA 2B08A 2HXAA 1GSKA 2BW4A 4PCYA 1BEXA 3PAVA 4BWWA 2ZOOA 1SNRA 3HEIB 4AKOA 5B7MA 3NJLA 1A4CA 3WKQA 4JHUA 3CDZB 4YSUA 2HLEB 3JTBA 3UGEA 1L9PA 3ERXA 3SBRA 1EZLA 1PZCA 1AQ8A 4M3HA 1I53A 2PPEA 1J9SA 2PLTA 1NZRA 1RZPA 2GHZA 3IN0A 1KBVA 2Y69B 4G71B 2H5UA 5I6LA 1SF3A 2BP0A 1GS7A 1JZEA 3CVBA 1L9QA 1IKOP 5B1JC 2MTAA 3QJTB 3ZDWA 1W6LA 2JFCA 3IE9A 4WKXA 1BQRA 5I6NA 5I6KA 3DTUB 1ZDQA 5D4HA 5I6PA 1AS6A 3CVCA 4DP2X 1M56B 3SQRA 1OCCB 1X9UA 2VSKB 4Q8BA 3NSYA 5I5MA 4GYBA 4P5RA 1L9RA 3OD3A 4AKPA 3H4FA 1CYWA 2QDVA 2YQBA 1MZZA 1V54B 4KO7A 4DP9X 1AANA 5B1JA 4ENZA 1AG0A 4HAKA 1L9TA 2BWIA 1JZGA 1DZ0A 1NPJA 1R1CA 2UXTA 2YAQA 1WS8A 3FQ2A 2BP8B 1PMYA 1L9SA 3QJQB 5F7AA 3NJGA 4A2GA 4AZUA 4F7KA 2OCCB 4YSEA 1JZJA 2DV6A 2YARA 4HIPA 2Q9OA 4BXSV 2VW7A 2YAFA 1E65A 3PAZA 3WI9A 4G7RB 3X1EA 1A4BA 3ZX1A 1PLAA 3OMNB 4E9SA 2VW4A 4AX3A 2DYRB 3BVDB 1E67A 5I28A 5B1AB 1KBWA 1AZRA 5AKRA 4F2FA 4G7QB 1NIFA 2QDWA 1JZFA 3NSFA 4YSRA 3C75A 4HHWA 4BK5C 8PAZA 2W8CA 3NJJA 2J56A 1PF3A 1NIBA 3GYRA 4DPBX 3S3DB 2P80D 1J5CA 4DP0X 5TK2A 4A67A 3NJMA 2HRHA 2WSDA 3FQ1A 3UACA 4E9WA 2BW5A 3DKHA 3NP4A 1OCRB 1CYXA 1QHQA 3TA4D 1HFUA 4YVUA 4KO5A 3SBQA 2J55A 5D4JA 4HZ1A 4E9RA 1GS8A 4UANA 5B1KA 4P5SA 2OV0A 4A2FA 1YLBB 2EIKB 2FTAA 2LLNA 4K9JA 2J5WA 2AZAA 2IDSA 3V9CA 2VM3A 3FYIB 1GR7A 5FC9A 3KW7A 1J9RA 4BDVB 4CSZA 3WG7B 1OE1A 1OE3A 2H3XC 3AG1B 3PXLA 2ZONA 2YAMA 2QPEB 1KCBA 3FS9A 4YSPA 4DP4X 2PCYA 1J9TA 2UXGA 1AR1B 5I26A 6PCYA 3T6XA 1NDTA 1PCSA 2GIMA 4HCGA 2IWEA 4YSDA 2XX0A 2BZCA 1NIAA 2J57A 1NTDA 4N8UA 1XMEB 1XB8A 3QPKA 3ABKB 2PP7A 4QKTA 1ILUA 2IDUA 4E9QA 3T9WA 3PAUA 4YSAA 1AAJA 1TU2A 4Q89A 4TXVB 1RZQA 1ASQA 4KNTA 3GXUB 3U25A 1NINA 3X1GA 4E9YA 5PAZA 1GYCA 1N70A 3ASOB 2XV2A 3ABGA 4HCIA 2ZWNA 4G7SB 1ET8A 4PAZA 1ET5A 3S8GB 2XV3A 1AZCA 3QQXA 1ZDSA 1SDDB 1XB6A 1GY2A 1OF0A 1NIDA 4NERA 3S3BB 7PAZA 1FWXA 2E86A 2W88A 1WA1X 7PCYA 1GY1A 2I85A 3MX0B 1SDDA 2QPDB 3PPSA 4A2EA 2UXFA 3KW8A 3CG8A 3S3CB 4BXVA 1BAWA 4MFHA 2DWTA 2VN3A 3NJFA 1N68A 1JVOA 5I6OA 2DYSB 1IBZA 2PCFA 1MDAA 3JT2A 4EF3A 4N4YB 3FYEB 1SHXA 1CUOA 3TBBA 2IWKA 1ETJA 4HHGA 1BQ5A 2FT7A 3FPXA 1DYZA 1KDJA 4YL4A 1ASOA 1V55B 4G72B 2P80A 3OM3B 3TASA 2BWDA 4JKNA 5AZUA 1RCYA 3SBPA 1MZYA 4DP8X 1IC0A 4YSQA 5B3SB 5IY5B 3FU8A 3WNJA 2YXVA 3GDCA 1BXVA 2BP8A 1BXUA 1V10A 2CAKA 1JERA 2R7EA 2X88A 1GS6X 3NJNA 2XVBA 1JXDA 1EHKB 3WKPA 3ZIYA 1KCWA 2VW6A 3FU7A 2HX9A 3QJUB 3L45A 1A65A 1AOZA 4YSTA 5B7FA 2BHFA 2HX7A 4GXFA 4KOBA 2GC4C 1E30A 5A7EA 1J9QA 3AW5A 2X87A 4KNSA 1MG2C 1RKRA 2EINB 5PCYA 3MBWB 2RACA 2AFNA 2XU9A 2Q5BA 3EH5B 1BXAA 2FQGA 2YAEA 1QNIA 4KO9A 1PLCA 5I5IA 1L9OA 1FA4A 5F7BA 1A3ZA 2FT6A 4GP5B 2YXWA 4DP7X 1ET7A 3AG3B 4AI7A 4HALA 1TEFA 2TSAA 2XYBA 2ZXWB 2DWSA 3DIVA 4A68A 2HRGA 1NIEA 4HCFA 1AZNA 4YVNA 4GP4B 1BYOA 3NYKA 2WO3B 1PNDA 2I7SA 2YAPA 1AZBA 1E5ZA 3IN2A 4BWUA 2YAHA 2CALA 2IDTA 2AANA 1PZAA 3IEAA 2XX1A 3OMAB 5ANHA 4DP1X 3EF4A 3NSDA 4F2EA 1GW0A 1BQKA 2IH8A 3HB3B 2UX7A 2GI0A 4CSPA 3NJKA 1TKWA 1PZBA 2XXGA 5TK4A 1AG6A 4NB7A 4YSCA 4A2DA 1JZHA 2FQFA 2YAOA 1SHWA 1ZIBA 3FPYA 3FT0A 3NT0A 3AY2A 1JOIA 1WAEA 2XV0A 1OCZB 2VSMB 1MG3C 3H4HA 3AG2B 3QJSB 2EIMB 2UXVA 3NP3A 3FU9A 4M4RB 3UAEA 5AFAA 2HX8A 1IBYA 4KO6A 3EH4B 3RYMA 2XUWA 3FSZA 3D12B 2FJSA 2IAAC 2R7EB 1OE2A 1X9RA 1SFHA 1KGYE 2XLLA 3ASNB 4FAAB 5LDUA 4BWTA 1OCOB 1CC3A 2FNWA 4QLWA 1F56A 3UABA 2XXFA 2AVFA 1WA2X 1VLXA 3EH3B 1SF5A 1ZPUA 3G5WA 3X1FA 1OV8A 1PY0A 4UAHA 2B3IA 2HZHA 1M9WA 1WS7A
chains in the Genus database with same CATH superfamily
1RUAL 4LAQH 1N9PA 1TZGL 3MLXH 5IVNA 3GBLA 4LEEA 4QKXB 1O7VA 5I82A 5CN3A 5AVZB 3SDAA 3KBPA 4EJ1C 4YSSA 1T1ZA 2BO0A 3KLHC 1U8CA 1NL0H 1ZLUK 2CE6A 5HDBB 1IX2A 1T03H 1X5KA 1NWPA 3RZCA 4GAYA 4UDTB 2FWOA 3SDYH 3VXMB 4UM9B 4LPXA 3BWUF 4H0IA 2V5RA 4X99B 2QGBA 5C0BB 4OGXL 2FSEB 1MFUA 4JPIB 1GIGH 2XIIA 2GCYA 2OJEB 4NEHB 1OALA 1RZ8B 3NJHA 5JQ6H 3DSNA 4NQEE 1H9DA 2EACA 2XWZA 4K2UL 4PYGA 5DLMH 1KWKA 4BE6A 5CJQH 2NR6A 1UATA 3Q2WA 3KR3L 4Q14A 5D7LA 3UBXB 3E9TA 2APTA 4IQHA 2IG2L 4HLZG 4L0ZA 1KTCA 1NBCA 1MFAL 1R5WA 3K3QA 2OQJB 4NUPA 4XMLL 3ZDYE 4KZDL 3MJ8A 3TCLB 3P11L 1IGCH 1KELL 2WQAA 4PRPE 2YK1H 1X5MA 4X2UA 1XT5A 1JGVH 1WD8A 2NOYA 1DBKH 2Z0UA 3PCYA 4NQVB 1JZIA 4OD2A 5D7JA 5GGQL 3U83A 3CSYA 3UXFA 5BS0E 3KDPB 1M71A 5E8PB 5IG7A 5H2BB 3ULAB 4IBLT 4RZCB 2VDLL 3RWEB 4TNWF 3IU4L 3MTXA 1KIPA 2IDFA 5L4MA 1BJ8A 1HN1A 3CHQA 1EEZB 1QNZH 1TJXA 3ALXA 2PUQT 4X7CC 5IB4B 3WIAA 5EO0A 1P4LA 3TPUA 2F68X 5JXEC 1NCBL 4NC2B 3M8OH 4P5TB 5GRYA 4MJ6B 5CILH 3QR1A 2QEJA 4KX9A 4H0GA 2AAVA 1ASPA 3THMH 4KK8C 3VFPB 1OOWA 3D2UB 3L3JA 4Z7VE 4AIOA 5CKGA 2GYSA 2ZKHL 3BE1H 3DROB 3MUJA 5KANG 3WLBB 2ZSVA 2A2QT 3CHSA 3VYNA 5L4JA 4ZSOE 3ZYZA 4ZZFA 3ZL4H 3TBCA 4DPAX 2E7LA 3FB6B 1KSRA 5EPMB 3ZUCA 2TAAA 2QADB 4KUCD 3T0WA 1XH3A 4N2AA 4HUVA 2FO8A 2DLFL 1CFTB 4HBCH 3MRLA 4D8PA 2Q3XA 2VISA 4L3EB 4KI1A 2Z8VC 2OR9L 2R51A 1CXLA 1CGUA 2QSCH 1DEDA 4Y2DB 5DD5H 3BD3A 4ZUTB 4H25B 1RUQH 4LOUD 3KJ4C 4JO5A 2K6ZA 3NCYP 3W0WB 4FA6A 1QFWH 3TCTA 3TURA 4LBEA 5CD5C 5CR1A 1A66A 4RX4D 4ZNEA 4MB4A 1CXKA 3SJVB 2F5AH 2VISB 2AGJL 1FFNA 2P28B 4TUKH 5IEHB 3FT3B 3PWNB 3OKKA 5C07B 2HCZX 2KI6A 5IMLB 4FC3E 4FLOA 1A6PA 3GGWA 1GS7A 2ZNXA 4LARH 4BA0A 1IKOP 1J5OH 4NN6C 3GSWB 5M7QA 5CZVH 1KN2H 3SKJL 4IBWA 4WTWA 1Q9OB 3TBTA 3TIEB 1V7NL 2CHDA 5JW4R 4A6YA 3IJYB 5I6PA 5A2LH 1T04B 4BK4A 2AJVH 2XBTA 4DP2X 1RLWA 3HI5L 2DWYA 2DF3A 4I89A 5M94B 3CIQA 3GJEA 5D5MA 4XNXH 1EK3A 4E36A 1QSEB 4LCIL 2W5PA 2EO7A 4PD4J 3D0VA 2G2RB 2CK0L 1SRDA 4I77H 4CSSA 5C0AD 5I16A 1ORSB 4TMPA 2R59A 5B22A 3BAWA 4OJFH 5DD5L 2ZCHL 3TP4A 5HHOE 1I4FA 4HAKA 2PW1B 4K9EH 1EGJA 5CMAB 3VRIB 3BMVA 3PGCB 3DBXB 4P2QA 4Z76B 5T1KD 5T3XH 3DX9B 3EOAB 5E51A 5F9OL 5J57B 2AXGB 1CK0H 2E27L 3SD5A 3UG3A 5EU5B 5IBLC 3ARGC 3MODL 4Y4KA 5D2LE 3RL1B 4MJ2A 4P9ML 2YAFA 3FQTB 4FNTA 2IAMC 2HUHA 2ZPKL 4TNFA 4A7TA 5EEZA 3ZE1B 1UM6L 4XCNA 4QRQA 4AUJA 3E6HB 4HFUH 1T2XA 2JKRM 3WFZA 1CVSC 1I9JH 3L4XA 2NY2B 2F7RA 4NSKA 1E67A 2AW2A 1F3JB 4DVRH 5IW1A 1AZRA 5ICUA 4U6HB 2WCSA 1UZ6E 4JPIA 3NSFA 4F3FA 3MFFB 4JFZH 8PAZA 3R8QA 1WBYB 4PJ5D 3WDHA 1K4CB 1HI6B 1KXHA 3CC1A 3D1MC 3MCG1 5TK2A 3GXNA 2IXQB 3KJ4B 1PPIA 2OL3B 4FQIL 1I7ZA 3B43A 1NGZA 2ZCLH 3QUKB 2DQJL 4FFZH 4L8SA 5GISH 5LG6A 1E9OB 4YVUA 5B4MD 4ANUA 1CDHA 2F15A 3ARDB 1BG1A 4MXVE 1EHAA 1H3PH 1XAKA 3T8XA 2A7BA 4FP8L 1LO4L 2J8UA 4UANA 1Z9MA 4ZAKA 4M9PA 1KG0A 3G5XA 5EBLB 5SWSA 3OAYH 4Y16B 5DLLA 3ARGB 2OMTA 2QSTA 2ZP9A 2FTAA 4YHPA 4EO5A 4BCXA 2P5EA 2FUTA 4RX4A 4N68A 4MNQD 5E6IA 4L8SB 2IOMA 3A67H 3FT3A 3Q9QA 3TOPA 5D1XD 3KPNB 3TT3L 3ZL1A 3UPRA 1T2JA 4M5SA 1RPQA 4CAGA 5GRVL 4PRHB 1NFAA 1EZSA 5TQ2H 4S1SH 3W0WA 4JHAL 4DK5A 3SCMB 4BD4A 2EECA 3IMTA 4HC1A 4P5TC 5B8CA 4HXAL 5K59F 1F00I 4ZPVB 2HJLB 3BGAA 2NY0D 2J43A 1IAKA 2DM7A 3GB7B 4X8JA 1PCSA 1MIEH 1YYLH 2Z35B 4C56A 4R4BA 2P49B 1F4HA 1QBML 4ELMB 4Y5YC 5HGBA 1P69B 3STZA 1A7RH 2PCFB 1SZNA 3NGBB 4RWHA 3T9WA 3QZWB 4TXVB 1QHPA 2Z65C 2YC1B 3KHOA 2L3BA 4ZUTA 4ZUWA 5LBSH 4NYLA 1ID5I 1KACB 5F93C 1VERA 3ZE0E 4ZW5A 1CLOH 3ABGA 4UNVA 3L3OC 3MCKA 2UY7B 1ZHNA 2C4XA 4JRLA 2DTSA 4D8PB 3V0VB 3D8MA 1M9SA 1W0WA 2VC2L 3ARWA 4JFED 4PVLA 2NUPA 4A6YH 4OD1L 3O6FD 3X3FL 5IB3A 3QDJE 5D70L 4AEEA 1OD7A 4LLMA 4HDIB 3KS0H 1JWUA 3PPSA 3FTSA 1RQ5A 3W56A 4HIEA 3O3AA 3DOSA 1SXNA 2VDOL 4WI7A 3SCMC 1A1MB 4PY7A 1YN7B 2Y1ZA 5FIEA 3EYOA 3TH3T 3T3MB 3JQOB 3GBEA 1XV8A 3NJFA 1ZVSB 4PG2C 4OQTL 4AEHH 3BUQA 1ORQB 4OLXL 3GUTB 2NY1C 5TF0A 1NCJA 1P7QB 2I07A 2SEBB 3NZHL 2W0KA 2WCPA 5BV7C 1NC4D 2WXLA 3GSWA 1JPFB 3G7TA 4RGMB 4JAMB 4ODXB 4TPRL 5FXCH 1ASOA 1RUML 2QKIB 1FLRH 3FH7A 4G6KH 4IGBD 2ZX6A 1G5AA 3FTVA 1S7VA 3K2KA 5C07A 5IMLA 4YMPA 1FO0L 1F86A 1QG3A 3V4UL 3FO0L 2EE0A 1BXVA 2K8QA 1NLBH 4RNRB 4DEUA 2P5WB 2GIXA 4OF3A 3SE8H 3SY6A 5L88L 2Y7LA 1QOKA 3ZIYA 1J5HA 1C5BL 2VGLM 2A6DB 2IPUG 4WWKA 4YZFE 2VMCA 4G7YH 1KCWA 3F7VA 2Q76B 5INDA 2GT9B 5GS1C 1KPUB 2EE2A 4Y9BA 4WNSA 3ZKNC 5C0AA 1NBVL 5JDSB 1HEZB 3H1ZA 3CCHB 3SZ6A 4XNQB 4R6UA 4PJBA 2P5EE 4LSRH 5GGTH 3FCBA 2EINB 5L4FA 3H53A 1GMEA 3RRQA 3K91A 4M5ZH 4HX1B 1N5YH 4LT7A 2Y7NA 3MCLL 4TSAH 2ITEA 4TRPH 4CN4A 4X4YA 2P5WE 1NFDE 4WO4A 2GTWB 2PO6B 5D1XC 2ZKYA 4MSWA 3RDTB 3GZQA 4NKQB 2CKBB 4I18A 1UH4A 3MAWA 3WFHB 4B27A 4GO9A 5CJ5A 2C1PB 5DUBB 1SUHA 2DWSA 1LK3L 3K2UL 2Q2LA 3FQNB 4S1RL 5K9OA 4JZJA 3D18B 1NIEA 1JIBA 1IC4L 5F88A 5F6HJ 2DWXA 1A5FH 2QVTA 3KL3A 3QJHA 4OLWL 5DYFA 2F53D 4I5BB 1EJ6A 3IYLW 3IN2A 1G5GA 1N6VA 4KX8A 4UM9D 4AYID 5JHLL 1MLBA 4P46A 1TVDA 4XN4A 5CGMA 4P5KB 1TETH 1YJDL 4Z7UF 3MLSH 1MVYA 5HHNB 1SBSH 3DUHA 4F9PA 3R0NA 3HC3L 3QFDA 3PHSA 4I0KA 3VI3F 5D1QC 3F7PC 4BHUI 1FRGH 4TVPL 1NBVH 2RAMA 2HVKA 2X5PA 5I1HL 4OLVH 4QF1B 1SOXA 3B2UC 3F84A 1AP2B 2ADGA 3O6FC 3MV7E 2F53B 3KPLB 3ARPA 1DTUA 4M3KB 4AQEA 3FT0A 1T20A 1U6AH 3BQUA 1HYSC 1OT2A 4NFDA 3KPPB 4GSUA 2A73B 2DYPB 4IHOB 1CXIA 3GO1L 3HN5A 2GK0B 5DFVD 4PTUB 4PS8A 4A7GA 1B9KA 4B9ZA 3QEUA 3JYBA 3R06B 1O6SA 3RYMA 3SDCA 3CXDH 3L5XH 4LHUA 4Z5RA 2R7EB 4HIIB 5DI8A 3FT1A 1TQUA 2EDEA 4G82A 1LP9F 5E2JA 3BO8B 5TE6H 1TTAA 5CGYC 1YQVL 4KRNA 2QPUA 2AVFA 3ILEA 1WH0A 3QWOB 5FKPB 1A5FL 5L2JA 2E0PA 1M2VA 4N2GA 4UAHA 2E6JA 3CLFL 3FU0A 3HZKB 2LFGA 2FBOJ 3UYOD 2FX9H 1AY1H 1S5HB 1ZEAH 3ARZA 2X4PA 3V7MA 1KXQE 4FRWA 2B2XH 1AHWC 2WXIA 3FUEA 3WNMA 4NLAA 4BZ2A 1U8NB 2C7UA 1LO0L 4GY4A 4UDUB 3D39D 3DRQA 1G1CA 2F7IA 1YEJL 4OZGB 1RUAH 2Z7ZA 5EZPA 4MS8C 3FAWA 4JM2C 5L2JB 1SJXA 2F2HA 2C9AA 3IGAB 5BS0B 4X7SL 2QV2A 4WJG3 3DX6A 2HFGH 2HT4C 3JSSA 2CU9A 2Y24A 5GSVB 1YJDC 1JK8B 2BM3A 4PHZA 3FQXB 1PLGH 1RZKH 4U7SA 4MX7A 4KUZL 1XZWA 5DJZA 2Y25A 1G7LB 3FQWB 3QZLA 3UTTB 4JZJC 3VGAC 1EDHA 2HKFL 4PR5A 2PPDA 2ATKA 1NFDA 4OR1A 3UYRH 4NZ8A 3VGEA 5ALCL 1A7NH 2NYKA 2YGOA 5K9QG 4P4KB 1YPZE 4H0LC 3CPLB 3UG5A 4N2CA 1AO7E 1ZK5A 2FQDA 2YKLH 4FFTA 5T8IA 1NA8A 4MLIA 1JV5A 3QIUC 5J56B 1OT4A 2WXHA 1AACA 4L4VA 4FXKB 2BOBB 1TTCA 2VDPH 1G6RA 4NQXA 4YE4L 4MCYA 5FHAL 1WTLA 3OR6B 4LPTA 4P2QE 2KBGA 1I82A 4XB7A 2AXGA 1DQJB 4TF4A 1QO3B 2YBRB 3QR0A 3T6WA 4TNGA 1XGTB 1BVOA 3D9AH 4H5SB 3CNKA 1JGEA 4PJIE 4WV1B 1NDGB 3LKPA 3QYMA 3FSAA 3E8VA 3MJWA 4ZNEE 4OQTA 3HE6C 3L4WA 3NFSL 4JVWA 3HI1B 2KQMA 5LGJA 3Q6FA 1HZHH 4J3TA 4AL8C 1MCWW 2H0PA 4JE0A 2A4CA 3QPQD 2G2RA 5C0DA 4QXGH 2J12B 3HCVA 4Y2LA 3S96B 1YEWA 2WXOA 4HKJA 2FJFB 4PREB 2MRYA 1D2PA 3QRGH 2XWTA 3M86A 2X0VA 4WWKD 4L5FL 1HYSD 3UYRL 3DC0A 3X13A 4EI5D 4WUUA 1G7IA 3FCTA 3INUH 4JY5L 4OZGF 3MRPB 3E38A 2R29A 3VRJB 5DFVC 1AIZA 4PJEA 3QNFA 5T1KB 4PJBB 3OAWA 4MJ4A 2OM5A 4X4KA 3V0EA 5SWQB 3CVHA 3K71B 2EIJB 3CZKA 2EIBA 3M07A 3X1BA 2RMNA 2IEPA 2XVGA 4RNRA 4TLSA 3UTZA 5J6HB 3IDXH 1BEXA 2NY0B 3GRWH 3JWOC 5B39G 1L6ZA 4YE4H 4OI8A 2K4WA 5MEOA 4WWKB 3NJLA 3MLTB 2G0LA 4PWFA 4PWKA 3WKQA 2XSKA 2X4OB 3NDYE 3KGSA 3MQIA 4LDEB 1IGFH 4HIXH 3OG6B 3F7KA 3ARFA 4I88A 4KXBA 4P2RE 3TWCL 1NGYB 1JPTH 1DJWA 1PZ2A 4H25A 4WF7A 3LDBC 1NC2A 4G9DA 1LEKA 1MELA 2J44A 3L4CA 3MUUA 5CZRA 3ZL2A 2WP3T 5F96L 3PUUA 3VD3A 3OHXA 2WUCH 3WTVA 4W68A 5BMFH 2VITB 3GSNA 3W2DL 5L7XH 4WKXA 5GS0H 2R1XB 3VXOA 2MKLC 3BP4A 4QTIH 4L5FH 5HSFA 4X5WB 3A0OA 1Q0YH 3UTSE 2A9ML 1M56B 1QTSA 1DCLA 1FV1A 4KKQA 3SQRA 2GJ6A 4DQOL 4ECNA 3UAFA 4LE8A 3ZKXC 1CU4H 2VSKB 2E9IA 4XC3H 4Q8BA 4CC0A 5I5MA 4JO8A 1Z0MA 4R8WL 1PIFA 4E5XG 5K9JH 2I27N 3I02A 2WXNA 4AKPA 4ANVA 4FQHB 1RMFL 3L3JB 4H8HA 4LEBA 3STLA 2AEOA 4DESA 1BD2D 2EDRA 2NSXA 2NUPB 1ONQB 2VXSH 3BH9A 1JD9A 3F85A 4DUXA 2IANE 3QDHA 3WD5H 5I1LB 4M9OA 5IF0A 1FNHA 2N59A 3LNDA 4JKWA 5BV7H 1PMYA 2OR7A 1L9SA 5C9KA 2ZUYA 3N1PC 5JW3L 4A2GA 2A5UA 2LABA 2BNRD 3V6FA 2YARA 2VZ1A 4DQAA 1AO7B 2DWEB 4K3JH 5FGCE 4ZTEA 5CZVL 2XKUA 5EOTA 5IVZB 1NGQL 1MJ8L 4YZWA 5I5RA 3WFCL 1K6QL 3UZVA 3X1EA 2N56A 2LVEA 1ED3A 3QQ9D 4QD2E 3TN0A 3CFKB 3BQUB 4JDZA 2OMXB 3LEXB 4DN3H 4RMWA 1EMTH 5FA4B 1WIPA 3K4ZA 1KUMA 5BRZB 4BSJA 3T2OA 1YN6B 1X4XA 4OLUH 3AUWB 2EDLA 1WP6A 3L3DB 4FD0A 1YYMH 4FI7A 4PSRA 5HGDB 3AABA 1QASA 2QTVA 4OTXL 1MLCA 43CAA 4DP0X 3G5VB 1MCHA 3UC2A 1W8NA 2K6WA 4DGVH 1FFRA 2UWEF 5LHDA 4PJEE 2YLKA 2HLAA 5K9KB 4G5ZL 4OLEA 2ZXQA 5CLZA 1WT5A 3PABB 1DFXA 1MRFL 3SBQA 3TXAA 3JYCA 2Q7NA 3KGUA 3A23A 5C97A 3GLDA 4PCSA 1K4CA 1THAA 1MW1A 4LLYA 1AR1D 2VDML 3CFMA 4PJAE 2WXRA 4PSPA 1F3DJ 2EEAA 1JL8A 1VADB 2X09A 3WJMA 4KVNL 1XD1A 1UUSA 4HZLB 1T6WA 2F54E 3OR7A 4LHQB 3IVKB 5AB1A 1UURA 5J6GB 2G3MA 5I15H 3SDXB 3FAXA 4EN3A 8FABA 3IKKA 5CEYA 4G1EB 3MOAH 4I3RL 5DJAB 3R7QA 4XP1L 1FH5L 3CHOA 1QI4A 3CMOL 4JO1L 3F6LA 4X4YB 3PL6A 1E28A 2D0GA 2DI8A 1HL9A 1I7RA 1OE3A 5D7IA 2QR0A 1DUZA 3SOBH 3GJFB 4LCUB 4QYAA 4RAVA 4YSPA 2YPLB 2IH3B 4L3ED 3EYVA 3HE6B 5JDJA 3WY1A 5ACZB 2CMRH 3WLWD 3KXFB 1IB5A 3ZK0A 4ZMNA 3ETSA 4XWOC 4YDLB 5DJ2B 1IEBA 4CKVX 3KPRD 5KSBA 2G9HB 3FU5A 4S1SL 1JPEA 3CLWA 1J8KA 2BZCA 3QIBA 5AB2A 3TZVD 1QEXA 1PG7W 3MA7A 1ZLDA 5BVJA 3PAUA 2A83B 3P3TA 4ZUVA 2CNZA 4YHMH 4ZMQA 3V6OA 4KJYB 4APQA 3EYSH 2CGZA 3QXVA 4R83A 3GSNL 1CFNB 3H7BA 3VI4B 5FECB 1KYUA 3NRQA 5CAYB 2G5BB 3K46A 4WW2B 5HHQA 3QQ3B 2E86A 3B8SA 4JFDA 1QYGH 3DJRA 3QI9B 2DPKA 4G42A 3RDTD 3S2AA 3U1SH 1TENA 3NDZE 2IXQA 5SX5K 3VSQA 4GUOA 3ZUNC 1HHHB 5IB2A 3F6JA 1VFAB 5HDQH 4KROD 1TTRA 5HPOA 1K4DA 2OI9B 1P1ZB 1U8NA 2C7UB 4ONHB 1ETA1 1P53A 1KPVA 2X44D 3DOSB 4P23B 4LOEA 5JO5B 4AYSA 1BZOA 1AFVL 1RZ7L 4LB8A 1E2ZA 2GVYA 4MQXD 5LBSL 5E1HB 4GIAA 1OCWH 2MMXA 3VAEA 5KYNA 4UT6L 4YBQD 3O4OB 3QWOA 5FKPA 1LDPH 2OX5B 4G2AA 1BP3B 1P9MA 1QW8A 5L0QC 4BELD 1Q38A 3BLPX 2DBLH 4KROB 3GDCA 2OMBA 3IDJA 5TPWH 3BSZA 3LS4H 1DEEB 2VH5L 1SOQA 4U1JA 4G6KL 3OLIA 2VLRD 1A7OH 3KE0A 4L9DA 3GSNH 3WKPA 2VLME 2GUOA 3U6RA 4AQ8C 5BOPA 3OHXC 4UIMB 3DBSA 2W91A 4GIPD 1TCMA 4IBYA 4X5XB 1Z66A 1BGXL 1Q9KA 1OP5K 2VLMD 4UT6A 5L88H 2OP4L 3V5DB 4H1LA 4KZEL 1F18A 1MCIA 2CD0A 2CLZB 2G2NA 2X87A 5I1JL 4S0SD 1AIFA 4NOBA 4HFUL 1WQVT 1M2OA 2Q5BA 5KSBF 4LCWE 3FB6A 1G4RA 1OSZB 2A6IB 3F7QA 4WWID 1FA4A 2PXYA 5SWQA 4K23L 2B4CH 3QUYD 1ET7A 1RULH 1UEMA 2P43B 4HWNA 4K94L 4M6OH 4MCNA 2IGLA 1CIDA 3TV8A 2MOGA 1UQSB 2NLJA 4MJ6A 2JKNA 5E5RB 4XWOD 3C6EA 1FFNB 2NY4D 3K8LA 4B41A 1DVFB 3TEZA 4J3OH 4JUTA 1MCBA 3TN0B 4Z77A 5J1SC 1JNLH 1ZJAA 5IV2A 5CLYA 4PRIB 3FMGL 3WJLC 1IVTA 3DO3A 5GS1B 4KRMB 5FFLA 1AXIB 2OMUB 2G5UA 1FN4A 1PGRB 2B77A 2KERA 5DJ0B 1U3NA 2EKSA 4JFHD 4K5PA 3LZOA 4LSRL 5GGTL 4H2CA 4WV1A 5IF0B 2Q8BH 3TO4B 3NJKA 5FHBH 2UWEA 2W9DH 3ZJAA 4FXGB 3FQ4A 2NY4B 3IMUA 1JPGB 1GGYA 4LOVA 3OJDA 2YRLA 4A7SA 4APQD 5E8EB 2G60L 1KENL 2AJYH 1U93A 2OTWA 3ML8A 3PHOA 3IFLH 4PJAA 2H6OA 2PETA 4WO0A 3MSPA 5F1SA 3QG7H 4X6CF 3MU3A 4FLSA 4Q9QL 3QIBD 1IJ9A 2D2OA 4JY6B 2EIMB 4NZFA 3UAEA 3EGSA 3QW9A 3KWTA 1CD0A 1YYLL 1CIUA 2XUWA 1QFWM 3P73B 3D12B 1X9RA 3AWEA 5B39A 1GJIA 4Y9GA 4WLCA 4XPBL 3QCUH 1CTMA 3LPWA 4PJDA 5C0CE 5CEYB 1YYCA 1LNUB 4I9WE 1BZQK 2J2ZA 5LG1A 1NUNB 4CNIA 3IFPA 4XMPL 1SF5A 3S3PA 4Z1PA 4MAUH 3FRUA 4NRXB 4M61A 3N6YA 5ERWA 1E4XH 3WS6A 1TJIL 1T1WA 2B3IA 5CF3A 2G5BA 4WW2A 5HHQB 1BM3H 4JB9H 2YAMA 3KHQA 3MLWL 2FAUA 3WFEL 5JW5A 3GIZH 2ODHA 3B9AA 3ILPA 3VU2A 5D70H 3V6OE 4ELDA 2WKGA 1BIIA 3K6SB 5E9NA 4M6AA 1TPXC 1WFUA 1YEEL 3DPBB 3QJRB 1NGPH 4NNPL 3QORB 2XI9A 4TN9A 3WY3A 2OK0L 1R46A 1LVEA 4A6YB 25C8H 4BSVA 5LQBH 3HG2A 5IWLA 4Y8DC 1D5MA 2Y3AA 4UQIM 5HHME 3U46B 5FYJD 4ONGH 2XZCH 2PCPA 4OF8A 4JFWA 1CICB 3OKNA 4P9HC 2ZYHA 1E3FA 5EO9A 5GJTL 3FN3A 2JB6A 3MNVB 3IE4A 5E6ZA 4IJTA 1WZKA 2FSDA 4BH8A 2CLZA 3ESUF 1TTBA 4RGNE 1IUZA 4DKTA 3UAAA 1EFXB 1PDKB 4M6NH 2NYZA 2I26N 3N9GL 4F27A 3B1TA 1B0RA 1S9YB 3NCYS 2EXTA 4ONFH 3ZMRA 2CZNA 3BRDA 3AROA 5E9DB 1QPXA 4XNUH 4HWBL 1EGJL 4G6AD 1U8JB 4AG4L 5HHVL 1MPAH 3C8DA 4HZLA 4LQ1A 1JHTA 3V4PH 3TNMA 2QKIC 2GI7A 5E4OA 1AXTL 2VDNH 1KJMB 1HAUA 2AV1B 5D4IA 1E3ZA 2GB2A 3KJ6L 2EC9U 4DVBB 3T0DA 2QVMA 4D0CB 1CFTA 4IS6A 4DPCX 3EJYC 1NC4B 1DQIA 1D5XA 1U8QA 4OIBA 5CHNB 3GXMA 1TEGA 5HYJB 3KGTA 3ZDZE 3RWJB 4MCYB 4YUEL 3U7WL 4AMKL 3WKML 4BUHA 3MRQA 4G7VH 5HGDA 5CR8A 5AD0A 1MAJA 3X1NA 4GO6B 5F70A 4F7CB 2X4QB 3B3IA 4HK0A 1BF8A 3EBHA 3RVXC 4GSQA 2P44B 3HN8A 2YSSB 4F33B 3VRLF 3FCSA 3O45B 4P59L 5EZJA 3MRGB 2VAJA 1CGYA 5B1CA 3RZWA 4OFVA 4K7PY 1NFDF 5SV4A 3D5OF 2R1WB 4YX2L 2G5RA 1E90A 1YEKH 2XN0A 2DLGA 5AW4B 2HAZA 5CD3B 4GRMA 1MOEA 1QLEL 1AO7D 4HXBL 2X4UB 3LNHA 1U8KA 4TSCL 4X6EB 4KK9D 4QRPA 3EJZD 1W91A 1E9PA 2YD5A 5J11C 4A63A 1OARH 3ZE0F 4OCMC 3FFCA 2V3DA 3D25A 2H0FA 4P05A 3WUZA 3B2VH 2R29L 4QWWC 2XZAH 1MCEA 2Y06L 4HC1L 2UVFA 3DV4B 4X4MA 1A25A 4NAQA 4Z7IA 2JKTM 5DA0B 3NMEA 1FL3B 1NZRA 4IRSA 5D7LD 3ARQA 2K7QA 4NKMB 5IW3A 4LRNH 4OH2A 4RAVB 1IC5H 4WI3A 2KUTA 3SGJC 3IDUA 2BSTA 4MHHI 4POZD 4TVPD 3UTPE 3TESA 3PWUA 3D4ZA 2V5MA 3CHPA 3EFOA 1QZNA 2DQHL 4HKJB 3PDOA 4KHXL 3Q13A 4OZIB 4G8EA 32C2A 1BZ7B 3DTUB 4ILDA 1O6VA 5DCCA 3MLVH 3Q8AA 3DUSA 3BZ4A 5E1QA 5E2WL 2HWZH 3QNZA 3S36X 3MBXL 2H1LM 3PXJA 5SX4H 3TVMB 5DHXB 3HW7A 2B59B 1AE6H 3GRWL 4HEPA 5GS0L 4GSRA 3VGBA 3SDXF 1EBPA 1TZHA 1JGDB 4MVBD 1A7PL 5CLTA 2FB4L 1WFNA 1FVEB 3K6FA 2QDVA 4V33A 5DHDA 3TA3A 2VDMB 3GTNA 1DBBH 3ILDA 3INOA 4L29A 2ED6A 2Z4QB 2MHAA 2RTTA 5DRZB 2W9LA 4NZUH 3HZYA 4G9FD 3HC4L 1WZLA 3HUJA 4U0QB 4E68A 3C87A 4X6DF 3VXUE 3NJGA 3OC8A 3T0EB 2XZAL 4G9FE 2Y72A 3QBTB 3MI6A 5D6DC 4K73A 5EH1A 3SKNA 4POYA 4B3EA 3V5HA 5HYEA 3H0TB 4G7RB 3KWXA 2Z8SA 1TPXB 4LRNL 3EJPA 1ZS8B 1U95A 5BO0D 1HH9A 4P5MA 1FZMA 5DJCA 5ESVA 4ATTA 4WW1B 5A3IC 2EH8L 4OZFA 4E0RB 4DZBA 2UUDK 5I28A 4AW4A 3RY5A 2OYMA 2X2IA 4PP1D 3L5IA 4Y2DA 4R7XA 1A3LL 4OV6F 3DURA 4KJWD 1RJYA 5E1GA 3RHWF 1U2HA 3RA7H 2BY1A 4PJ8C 1A9BB 5D71H 1G1YA 3BZDA 4UCFA 1A3QA 1OK0A 4XP9H 1SLUA 3WN5C 4H5SA 5ESQB 3JVGA 3FOLB 2WAQA 1CYXA 1HFUA 1DLFH 3STLB 2JKSA 4L3AA 4J3XA 2I25N 3EYFB 3WUWB 3CFUA 5B1KA 4UBDD 1BVNT 1E2WA 2A9BA 4G8FA 3P4MB 4A2FA 3WFBH 5ISZD 3LJ3A 2EICA 3VD7A 3MBWA 2B1AH 1MWAA 2CDGB 3MLXL 5MEPA 4J12A 4DWHA 2OMTB 4YNYA 5I30H 1GGUA 1IAOB 1M1SA 2ZNWA 4QWWD 4LPCA 4LLQA 5LUMA 2DJ4A 5C09D 2A6JA 4LARL 5I9QB 1QRNE 3LY6A 3U1PA 4AH2B 1ZCRA 1QPKA 1EZVY 2RQ8A 1ZLEA 4J3BA 4PBVC 4CADB 4Y2OB 4YSDA 4YDVB 4POZC 1NIAA 4GW4A 2EDFA 3IDGB 5JLZA 2WXPA 1XGYL 5G2NA 4FQJL 1KC5H 2CM6A 2CO7A 2K0RA 2OZ4H 3SE4C 2IBZX 2Z93A 5AL0A 2YD4A 2OQJA 4NO0A 5BRZE 3A22A 2WIMA 5BXFB 2YGNA 3QDGA 3UYPA 1I9EA 2FIKB 3U0WH 3SKOA 1YN7A 3I6KA 2OTWB 1JNHA 5D8JL 1D6EA 4ACTA 3NAAH 3DYPA 4XXWC 5A2KH 3P3YA 1I1AC 4PJEB 3ZU8A 1NC4A 1H5BA 2F61A 1ZSDB 2E9GA 2Y07L 5T1LB 1Z5YD 3DXAD 1ES0A 1SHMA 2FR4A 1GIGL 1XIWC 1U9KA 2VUKA 1QSEE 1GYUA 4JRXB 3WHE0 4ZUUA 4W4OA 4FOMA 4NRZB 5BJTA 4MFHA 3L3OB 2K7PA 3HRPA 4C4KO 4ONOA 3HNSH 1U8JA 2CHWA 1OM3H 5C70A 1XGQB 5DZ9A 1I8KB 5E9DA 2DYPA 1SHXA 4IHOA 4XOCA 2WLLB 1NMBH 3DGDA 4E41A 2YRZA 5CJ8A 4UMSA 3TBBA 1WTGT 3E6FB 1PSKL 1JN6A 2EE9A 1F45A 1KDJA 4YL4A 1XSJA 3T0EE 2VXVH 3VFUA 4UYPA 1XGYH 4IMKC 3EW3B 3HS8A 3NTCH 4JKNA 3DXAA 4GRWB 1FHNA 2DICA 3VU1A 2DKUA 1HEZA 5BOZG 2BP8A 1A64A 1FVCA 4JRYA 1JERA 1DO6A 1U8HB 3OKEB 5G5DB 5DVPA 3QCVH 1UXSA 1LDPL 4H2AA 5DJ6A 3ZTEA 2FZ3A 4X6CB 5AVWB 4P23C 1BVKA 1PAMA 1OGSA 5F7LB 4XAKE 5F9WB 3QFJE 1BIIB 3WUWG 4WFFD 1C12A 1XFPA 1KJ3H 2B0SH 3QFJD 5K33A 1AOZA 2UYLA 3FZUD 5GZND 3EJSA 4KOBA 2AJUH 2YEZA 2YJQA 1J9QA 1OGTA 1WAAA 3U6RB 3A24A 2AJ3B 1RKRA 1A3RL 2R69A 4PJHE 1IC7L 2IGFL 3FQRB 1DJXA 1TOXA 4GG6A 5JZ7D 1XX9C 5IHBA 3VJ6A 3VXQB 4AJYV 3EH5B 2H3NA 4HQQH 2HKHH 3G9AB 4OZHB 4PJ9D 2E9JA 1B88A 3I6GA 3EFOB 3VB9A 2XQYA 2R23B 3IGAA 3P2BA 4LBAA 4DP7X 4N6QA 1DVYA 1M3JA 1ZT1B 4AI7A 2LLGA 3MBED 5DQJB 3U30B 5F9JB 3BWSA 4YBHA 5IBUG 3SPJA 2R9HC 3CFDB 5TPWL 2WZ6A 2Y4SA 2IFFH 3WXVL 4PVMA 2BNRB 4P2RA 1TVHA 5AW9B 4YHZH 5GRUL 4TTDD 1ZHKB 4K94H 4P8QA 5HYJA 2D7PA 2DBJA 3L3HA 4TUOB 1MRFH 3HZKA 2PTTB 4PWHA 2JIXB 2QQNH 4BM7A 2CALA 4ZZKA 2ZP0T 1ZT1A 3BQUD 1H3VA 1Y07A 4IS6B 4JCLA 1GGIL 4ZD3L 4F2EA 2VITA 3GSNB 3RVUC 2PABA 1GW0A 4FJ6A 5I1JH 3Q1EA 3MRDB 1W15A 5IB4A 4DNLA 1M7XA 5I74B 1LEKB 5I1GH 1N8ZA 3VTMA 3SDCB 3EDKA 5KZCD 4JDEB 1AXSB 3QUMH 2OMUA 2GAZB 1SYVA 3ALPA 4YSCA 5EEXA 1I1AD 2BNRE 4YFEA 5KOVC 1SHWA 1MRDH 1IC7H 1ZIBA 2IGFH 4MJIE 1RZJH 2V2TB 2WYHA 5JOPE 1EEUA 2ZUUA 1MCPL 2IO5A 1XIWD 1YY8B 2WVSA 4L2LA 3EXJA 2BFVL 3FCSB 1NAML 3ATEA 4FGMA 4NQQA 1MG3C 4Y4HA 3AG2B 2B5IC 2J5LC 1BCIA 4K7PL 1FGVL 3P0YL 1IBYA 1U4EA 4PGDB 1PZDA 4PV8A 4D9RE 2I69A 1KF9B 3LNFA 1UT1A 4X6DA 1H0DB 4FAAB 3LNGA 3AM8C 4WK0B 4GAFB 4KKBD 5IJDC 4N9GA 5IQNA 4GKZA 3X11A 1FIGH 4MKMA 1ZOXA 4NNXB 2YPLA 1RZIB 2W60A 3IK2A 4AITA 1EO8H 1PY0A 1A22B 1J86A 4RGNB 3T4AC 1I3RB 2HJKB 1DO5A 5AOJA 3SE8L 4PGJA 4TM9A 5CD5D 1DJGA 4UTCA 2E27H 3DO4A 3GBNH 1SGKA 2IC2A 2CLVA 3O4LE 4DP6X 4HIJB 4NKDB 3BVNB 3TYGL 3MV9E 1TSRA 4XX1G 3VFOA 3IFLL 1GC1C 4NRXA 4CDHA 5BJTB 4Z78B 2CJTA 1XR9B 2WVVB 1QR4A 5GGRY 4F80A 2E4FA 4A2HA 2CG9X 1YY9C 1DQDH 5EULV 5JUEH 4JDVB 5INCB 3QT2A 1XB3A 4Y0GA 4QMEA 1XF3B 1ZAGA 4ESKA 1SMOA 1QO3A 2YBRA 5F1IA 3UPAA 3N91A 2IPKA 2OX5A 4W6XB 4AIXA 5C2UB 2D7TH 4RVBA 3HE7C 5CP3H 5A40E 3T0ED 3PGFL 1MLCB 4NQXB 2P7TB 5D7KE 1ZPLA 2DQJH 2NZ9D 3BZEB 7FABH 1EVTC 1MHPH 2IMNA 3ULUC 2CUMA 4N2DA 4KJQC 3E6HA 1KLUA 4YIQB 4JDVA 2D9CA 2XV6B 5DD0H 1T2QL 1A14H 1LDSA 1IC4H 3MV8E 2A9NL 4DZBB 4P4KA 1MQ8A 4Y5VB 4I9WD 3UDWA 2CO3A 2O72A 2VXTH 5AKVA 1E6OH 1WWCA 3NH7H 3OGCB 3QUZD 1L4IA 4L37B 4LSQH 3PGCA 3RAJH 2OPCA 4AM0Q 5HJDA 5EDXA 1NMCB 2I9LB 2IAMD 3BP5A 3BUIA 1RP8A 3BQUC 2ICWA 1AS8A 3NCWA 1T5KA 3P4LA 3KLKA 4JRYE 1MEXL 3CVIL 4FNQA 4MZ3A 5I1HH 2EVJA 3IU3B 4Z0XB 3BH9B 4A6YL 1NCAH 4E9TA 4NPJA 1JXGA 3D09A 1R33A 1WA0X 2BIIA 2K9UA 5LVEA 2DH3A 5BUPA 5CEZD 3ABMB 3TA3B 2OSLA 1J5DA 1QUNB 3SYAA 5IWLC 2VDOH 4Y4HB 1AZUA 4BH7B 4K23H 5C0NC 1T0OA 1H6FA 5D7SL 1RULL 3L9BA 5K39A 1DVTA 3T6VA 3VI3B 5DJ2A 2BRQA 2HKAA 2H32A 1JDCA 1IFRA 1T89A 1G9MH 1WLHA 3NSXA 3CE1A 4PJIB 2ZXDA 2ENYA 2CCWA 4BZYA 4HH9B 1DUZB 2AEQL 3DTDA 3DWTA 5LBSA 3UZQA 2KZ1B 4P3DA 4BV1A 1A4KB 1CTOA 4I9XA 2HFFA 5CIPH 1KBKA 3B2DC 4MMXB 4MA1C 2E56A 2VC2B 3Q44A 3RAJL 4RDBA 4M62H 2WBJB 3BWAB 1KFAL 3QIWB 2JIXA 1E2VA 2V5SA 4F2ME 5LO7A 1FPTL 1N2RA 4R3SB 1EZLA 2P5ED 3TX4A 5FEBA 2IMMA 5CGTA 4UWQB 1HTYA 2E7DA 2MNUA 4YZFF 4ZUSB 3LN5A 1PKQE 1L5GA 2L7UA 1I1FA 1R4XA 4FXGC 3LKNB 5ELIA 4KI5F 5CINL 2EEBA 5HGAB 3CVBA 2H6PA 5DK0B 4L3CB 1JV2A 4PRBA 4D8OA 2J73A 2L4OA 4NQSA 5ECJE 2WNXA 5IQ7H 3BFQG 5FA3B 4ZFOL 4N2LA 3VQ1C 4RWYL 4GQRA 3F58L 5CCKH 2P5EB 1QLEH 4AUUA 4H0HB 1T0MA 3LZQA 2D7OA 3QCUL 1QWNA 3IPBA 5GRJH 3W5MA 3HE7D 3VCLA 2CRZA 5B38A 4O5LL 2XKNB 4GYBA 4HPYH 4P5RA 2H2SD 3QDJA 3MACL 5FO9A 2D3VA 3B3IB 3FRPA 1KCRH 4NUJB 4KO7A 1TTUA 4XNYL 1FZKA 3GD1C 5TTRA 4WNQA 3UGUA 5B1JA 5EC1B 2G0KA 3BEVB 1L0QA 4GUPA 4EDXA 1K5NA 2NNAA 1SHSA 1JZGA 2BWIA 4ANXA 5KVDH 1IILE 3FJTA 2ZOLB 3N44F 4MNQE 1JXJA 4WVRA 1FFOA 2QVIA 4ANKA 3G6AB 3KLSA 4XMXA 5SX4I 1SOKA 2E7BA 2OL3L 5HTSA 4YO0A 2BS9A 3HKFA 3R4RA 4X98B 4IRSB 3OLDA 1J1XL 3KLDA 4O2EB 1BEYH 1PL3A 3S37L 4K7FA 4CVUA 5CCGE 5F0LB 3BJLA 4Y5XA 5D7LE 2IANA 3WEOA 1PJWA 4E9SA 3UYPB 2QKSA 1U8PB 2VDQL 5ECGA 5L0QB 5ENWB 1QLRB 4XPTL 4UIKH 3KPQA 2HRPH 1OAUH 3J27A 3KS0J 4IU3B 1UG9A 5C0ND 4H8PA 3RWDA 2XKSA 3LCYA 4GQPH 4N0YH 1NCDH 3BVWA 5KUMA 1TLMA 2H3NB 4NKOB 1EEZA 5HVWA 4OGYH 4Y19B 3HZMA 5JOFA 1MCCA 4OCXL 2J55A 4ODHH 1ZT4B 3TV3L 1F8TL 1FRGL 4TVPH 1BFVL 2VXQA 3WTYA 2JMRA 1BDYA 2DQ6A 5T5FA 3FTWA 2X4SB 2W94A 4HUKB 4F7CA 3P69A 1HL5A 1HK6A 4QUOA 4URKA 4XGZB 2K1MA 3VXUD 2EIZB 4MHHG 1X7QB 5MERB 1EPFA 1JPTL 2C26A 4CDGC 4EVNB 1BEYL 4PVNA 1YMME 4FERA 4YHIB 2EYSA 2EO9A 2WJ7A 2NXZD 2B1AL 5ERWB 4WDIB 4XN1A 2DAVA 3GGWB 4HUWA 1FDLH 3PP3K 3WFDH 4XP9L 4RCAA 2QR0B 2GIMA 1D6VH 1Z7JA 2R2HA 4LLUA 5GS2H 1Q0YL 4HJTA 1RU9L 3E6FA 5AW3B 4KUZH 3VXME 1FZJA 5E23A 4YEFA 1HHIB 4AYGA 5ADOH 8FABB 4B9YA 1B2YA 4TL4A 4XC3L 4JMXA 1TYEB 3CSBA 5EFIB 4IK7A 1CQYA 5DURB 2GJ6D 4R4BB 3SQOH 4H8WC 4H8WH 1CDGA 3KYOA 4AQEB 3U48A 3JV4A 2H2SC 1HZLA 1HKLH 2NUTB 1BFVH 4J6RH 4UYQA 4AIZA 2AXHA 1IM3D 4C83A 4JFFE 4ALAH 1HH6A 3K8MA 4X7SH 4Q7DA 3V5KB 2FHFA 1YAZA 4QO1B 3P40A 4JQIL 5ETUB 2EC8A 3JWNE 2GQHA 1JNHB 1NC2D 1EDYA 4HCRH 5DJ0A 1R3JA 1K5NB 3MGAA 4GRWH 4BXVA 1EWHA 1IC5L 4H8UA 1OGAB 4XNZC 3ARGD 1OSPH 2VXQH 3BKYL 5DYOA 3JT2A 4MWFB 1ERNA 1UD6A 1WBZB 2PW2B 3FYEB 3CGTA 4EN2A 1JGDA 2LGNA 5F2FA 1RK1B 3NFSH 4EZKA 2YKLL 3HNTH 1SEBA 4S2SB 4WW1A 3DVGB 3GXDA 2WMPA 2OBGA 1EZVX 5AVTB 2VR5A 1LE5B 1KTLB 2DOCA 5DMIH 2Z31A 2R2EA 3RPIB 5EUKB 3WFHA 1NC2B 1DZBA 4MD0B 4GW5A 1WSST 3EFDL 5B3NA 1XZ0B 3EYQD 1LNUA 5DMGC 2R8SH 5DUJA 4ZMZA 1HNYA 4PMEA 3SJVE 3CXHK 3HUJB 3ZE1E 1WT5C 4L3CA 4UZSA 3OKLB 4FKEA 2X88A 3C12A 4N26A 4X6BB 2Y07H 3DTXB 5I19H 3ZDXF 2JK5A 5IR1B 1GCYA 1EXGA 4I4WA 4DUWA 4Z7VA 4FMFA 3VXRB 3P3UA 5HJBA 3UEZA 2VDMH 2VLJD 4R26H 3IDXL 5DZAA 1A1OA 4P07A 5IM7A 4UQAA 5DT1L 1ND0B 3FU3A 1KPRB 5E8DL 4OFKA 5EO1A 1DBAL 4X5XA 3CZFB 1OB0A 4XXCC 2H9GA 4JDEA 2NNXA 4GRLB 5IJCC 1N6QL 1H3XA 5DK2A 3DVNA 3TN0C 2LE9A 3C9NB 1EAOA 4OM0L 1E4HA 4G8EB 4IMKA 1PLCA 1A9BA 3LZPA 4ZMAT 4MZ2A 4RFEB 2D7QA 4GAYB 3PL6D 1J0YA 1T80A 3CN0A 3QZMA 4GG6B 1TEFA 4F58H 3MUHL 4JR9H 1T83A 3V7AG 3Q6FB 2BSEA 1Q0XL 4UZGA 4WEBL 3DIVA 1OF2A 3JUZA 1F11B 5A2IH 3DV4A 3H6JA 3S34L 5JORA 5CCHE 1AQKH 2OJZH 2KDGA 2WLIA 4N0UE 4NC0B 5HYQA 1QHOA 5BZXA 4AM0A 1PTZA 5E6UB 3ZR6A 3LN9A 3CBKB 1MXDA 5F3FA 4JPWL 4NBYB 1NFKA 5JR1H 5AOZA 5EZLB 1VFAA 5DZJA 1NAMB 1VESA 1ZSHA 5ANHA 2KT6A 1VGKB 1SLXA 1I1AA 2UX7A 3BN3B 1QAWA 2CHNA 4LF3B 4PVBA 1J0KA 3LRGA 3KPSD 3DK2A 3RTQB 3VXSB 2XTSA 4HPOH 1NSNH 1AG6A 1BG9A 2J1KA 2JCCA 4KQ4H 2VKWA 4D0CA 3GI8H 3VRJA 1XD0A 3HZVA 3LSOA 4Z9KB 4D3CL 1DANU 5BV7L 1SM3L 3FPYA 4ZQKA 1SJHA 3VI4E 2A99A 3B7YA 3KBHE 3SE4A 4PRIE 5D4QA 1BSIA 4HG4K 4HWEH 2F7QA 1L3NA 3H3BC 1JGLH 1VFUA 2Y5TA 3I9GH 3I2CL 4ZX3A 2R27A 2NY1D 5KG9A 5I1EL 1O7DE 5IOPB 5I73B 1SFHA 5EUOA 2Z4TA 1KC5L 2OZ4L 5LKNA 5GRZA 4NI3A 4WRLA 4LSDA 5E6YA 1NFIB 2NY3B 5E8NA 1GGIH 2NW3A 4ZBJA 3S5ZA 5T1LA 1AQKL 3MRIA 1KTBA 2PO6D 2ITFA 4F1ZA 1N7MH 3T1FB 3B5TA 3LN5B 1II4E 4DOHB 1FORL 2DL9A 3CIAA 1REIA 4M93B 4PS4L 4YBLB 1MCOH 3E9UA 1AD9A 4MXWH 6CGTA 2D4DA 4JO2L 2J4WL 2Q86A 5EZOL 1G6RB 3UOAB 2YPVA 1OP4A 3IWVA 4LASH 3HHMA 3GSQB 3A6OA 2IVFC 1VADA 3WJMB 1ECYA 2BDNL 3JV0A 4ELMF 1A8ZA 2K70A 4DJMA 5J4MA 3FT9A 3CH1B 2ESVD 2J8UF 4Z23A 4X6BA 1DVUA 2WOBA 4MKTA 1TQTA 1E5YA 3SZKC 3GHBL 3UIZA 1HQRB 5CU9A 5JMRA 3ZKND 5LCVA 4O2CA 2PP9A 4JHVA 4F7MA 5GS0D 5E2UL 2AI0L 4P2OB 3A21A 1LD9B 2Y7OA 2R2EB 2VWEE 3L2MA 1R19A 4RRPM 3SKUD 5C08B 4Z7UB 1JGLL 1A21A 2K78A 4NQCA 5DVMA 2OMVB 5HDBF 5F7KC 5C2BH 4X6DB 2Y2YA 5C9JB 1QSVA 1DVQA 4TQEL 3FU7B 1B3JA 3RWFA 4D7PA 1B3IA 4QRPD 4EI6A 1EVUA 5GGSA 2G3NA 1NICA 5KBLA 1WZ1L 3O9WB 4PJXB 4QHMA 2RA1A 4PB9L 1JNLL 1YY8A 4LCWB 4FXLA 2DW5A 3FHQA 4AV4A 4PRNB 3FXIC 2IWGA 1VFOA 3CZUB 4MXWL 2NNCA 2Z0BA 4W4OC 5GQBA 4U6XA 3MOAL 2QPSA 2DQIL 3QO1A 4P2RD 2N0MA 4Q6KA 4LASL 2E4TA 5ADPL 1MI5E 2DMHA 1XTLA 5HDWA 1FYTD 3PWPB 3VXPB 2W9DL 3FRPG 2CQVA 2CHZA 2H1PL 1T5WA 1XGRA 2FIRT 4PJDE 3WO4B 3BO8A 3RZCB 4FFZA 4KNUA 4FZ8L 4IRZH 3K7UA 4DK3A 1GPOH 3VNZA 1DDHA 2H0JA 1MCJA 2DIAA 1F58L 1RP9A 1FFTB 3O6LH 1I9JL 1NCTA 3KYMA 3FSVA 4L8CA 5C7XH 5KBNC 4B9KC 3QDGD 4M43H 2F0CA 3SPHA 1IQWH 1KXQA 3LZRA 3BRFA 2IH9A 4KMTL 4G43B 3KCWA 1MXGA 1QACA 3IDYB 2G3ZA 1SFDA 1A7QH 1FO0A 3CZSA 5L8KB 3EYSL 4JVUA 2BVPA 3QEHA 2NXZB 1OM9A 1UB5A 3HZ3A 4UNUA 3TEYA 1FQ9C 3IS1X 4XODA 5F7NC 4CSTA 2XN9D 4OT1H 4MCMA 3SDCD 5KZCB 1EXUB 1ZRUA 4N0CD 3UTTD 3DURB 1HYRC 4IRSD 4EVNA 5CGYD 3KPSA 1MJJA 2BIHA 3NIDB 3PHQA 4ZSOA 1IAII 3A47A 1S8DB 3VFRA 4BFNA 2MHAB 3HEIB 4ZD3H 5AB0A 1GOHA 2BIQA 4H8VA 5CN2A 1PZ5A 3IMBA 4R7LA 3AB0C 4WSGA 1HE8A 4TOYL 2UYLB 2VH5H 5T5NF 1HEHC 5DHMC 2UV3A 2XIBA 1NBZA 1S7QB 1AQ8A 2ADJA 2L04A 4YXHL 2R83A 2IQAA 4L9LA 4M3HA 4DKEL 1KEGH 3VA2C 2PN5A 3ESNA 4L4TE 4IOSD 1RZPA 2R0ZL 1AO7A 1MRDL 2DWEA 5TD4A 4BUGA 2Y69B 4FZ8H 1UCBL 5I74C 1X5ZA 3H9ZA 3LIZH 2QPFA 4KFMA 4ZO9A 5FO2A 2OXHA 3QUMB 4JRYB 2HRLA 4LP4A 5B1JC 4LLVA 3V6BR 2YMOA 1VKXB 2OXGB 1ZK9A 2JLLA 2OYPA 4U33A 3WNNA 1ZDQA 3ZT7A 3VD0A 3RGHA 4F3FB 4FQ1H 5T5FL 5KSAB 3VQMA 1N64H 3LKQA 3AUVA 3L2LA 5ID0B 4FYTA 2W80C 3T3PE 2VDNB 1UYWL 5JW4Q 4G6MH 4Y2DC 2AQSA 5C0AE 5HHXL 1OWRM 1L9RA 2W1NA 3TVMA 4WU7B 4NOFA 1C16A 1X5IA 1PG7H 1YUKB 2EDDA 3CX2A 4S1DD 2APFA 4DP9X 3BP4B 1PW3A 3MNDA 4X98A 3ZW3A 4NCC1 3T0AA 3RDTC 1L9TA 5C1MB 2VC2H 2IPTH 2QADC 3BHBA 4JFXB 1MCFA 3AY4A 4U1KA 2ESVE 1KCRL 2NQCA 4GKSB 2FX7L 4TNEA 3PWLA 4CW1A 5KYXB 2ZZUT 4KROC 2A9DA 1S5IH 2BVTA 2PW1A 1JZJA 4ZUWB 1I8LA 4ERSL 1KMGA 1DVFC 4NHUB 5EC1A 4WNQB 4F8NA 3WEXA 3WDJA 2KDYA 1PG7X 2DQEL 3WI9A 3IJEA 3EYUL 3MOBH 1C5CH 3D0VB 5CXPA 1HOCA 3HC0B 4QR7A 5CSBA 4QCIA 2PR4L 3MN8A 2R39A 1WV7T 5ALBH 5I0ZA 1KBWA 1VCAA 4GG8B 3ZTDC 4RMQA 5GXBB 1NIFA 3LXAA 3MRJB 3QPQC 1T04A 4M3JA 3OKEA 3FT2A 3ASWA 5HYJE 1YMMB 4TPRH 1T89C 3A6CH 3NACL 4EE2A 4Z7UA 4PJ7B 2HN7B 4WWKC 3UIYA 1CD9B 1QW9A 1R3LA 3NJMA 2V9RA 4WWNA 4XHJD 2QQLH 4O2FB 3WOVA 3BP5B 4NP4H 2ISDA 1RUKL 4ES8A 2RHEA 4Z7QE 4BGDA 1IGIL 3V4VB 2WC7A 4QAWA 3BEWB 5CWSA 2YEZB 2PKDA 3M1OA 2YD6A 1CTNA 1RUQL 5IK3A 5GJSH 1OKEA 5I8KL 2PW2A 3B9KC 1KT2A 2BHZA 4N0CC 4W81A 5IFJA 3X14B 4YGAB 1JAEA 3GHPA 2VDPB 3QNYB 4ODHL 4LNRB 4JB9L 3TBVB 5L2KD 1F8TH 3BT2H 4DIXA 2CR0A 3MKGA 1U8CB 2J5WA 1HHJA 2IDSA 1A1NB 2CUIA 2OL3A 5HJ3A 3S88L 1CF8L 3MC0A 3QIUA 1OAZH 3MUGA 5CS7A 4AC4A 5IUSA 3GSUA 4X8JB 4Z7NB 3BD4A 1KN2L 4KI5E 4OGAD 3FS9A 3N1QC 5T1DH 2JB6B 4F8LA 2X3CA 1MJUL 3HG5A 1RIUH 3NA9H 2X0WA 5HP5A 4KDTC 4KMQA 5E2WH 2X05A 2HWZL 4PJCA 2WLJA 4ABUA 1F5WA 3ULVL 2GTZA 2CPCA 2ZSWB 4XVUD 3VFWA 5I6XC 3ZSTA 4E9QA 2R69L 1KJ2L 4FCHA 3D2UA 2NY2C 3ISRA 3U25A 1NINA 3B9VA 3REWA 4QXWA 1MF2L 4H44C 4DEPB 4NKDA 2P9RA 5J7CC 4K9EL 4NM8L 2AK4B 2HJKA 4PRDB 1CLYH 1OF0A 4MX7B 4JJHA 2K8MA 3OSVA 1OGAA 1FWXA 4QDGA 3QO1B 5IVXF 1YDPB 4JFEE 5F1NB 4YFDB 4EQ2A 2MWCA 4W9LC 1Z5LB 3IKCA 4OIAA 1T4KA 3BOVA 4JVPA 1ZLWH 5IKCB 3WCYA 4OLVL 1GTNA 3S88H 2PYEA 1N4XH 4JKLA 1JUFA 5FUOL 3WMQA 2EZ0C 1DN0A 1YEFL 3S98A 5ICXB 4JCMA 1KIRB 2O4EA 4G8IB 3N9GH 2XXCB 3IJYA 4N4YB 2GY7B 1SYSA 3RB7A 4ES9A 3S4SB 4Q9RL 5ILTL 1R24B 3ZTJG 4N25A 1SBBA 3BZFB 5KJ4A 1HJBC 4LSUH 2OCFD 2IIJA 3QXTA 3AM8A 1KTDB 3QPXL 4G72B 4QGYA 4BGLA 1VZIA 4N87A 1RCYA 2GCYB 1S7RB 3GKZA 4J3OG 4BZ1H 1TF4A 3EUDA 4M8VA 3EJJX 5DO2C 1A9VA 3KYKH 2NTFA 1QVOA 3IAQA 5FK9B 4FQ2H 4OB5H 2R7EA 3NESA 3T0BA 4PEEA 4HX1A 4FKKA 4JFHE 4DEWA 3EFDH 2FX9L 3NFPB 5HDOA 1KNOB 4XHJC 4KPHH 1XF1A 1D9KD 2VW6A 4JM2F 3CCHA 2YRPA 4MS6A 3GINA 4G7VL 4Y4FB 1C7SA 6FABH 1KOAA 5J1AA 1BPVA 3LMJL 3KMDA 4YSTA 5I19L 1GA2A 4HKBA 1J05B 3TNNB 1XGPB 4CMMB 2Q76A 3BKYH 1J1XH 3VFTB 3HE7B 3QHZH 2C4FT 4KNSA 1LO3L 4HGWA 2ADFL 1UQSA 2NLJB 4R26L 2DJUA 3UTPD 5DT1H 3GS7A 4BK5A 4JS7A 5T1MB 1ADQH 2Y36H 3KWVA 5EIIA 2R1XA 4DT2A 1J12A 1MHHB 3G5VA 4W9GC 43CAB 1G6RL 3HBZA 1X5FA 4J4PC 3HG3A 2H1XA 4OZ4A 3VD1A 4K5LA 3QE5A 4GP5B 4IBZA 2HRPL 5IREA 5ILTH 3BH8B 4JQIA 4G6FD 1M42A 4HKZB 1MIML 2Y5TB 2N4IA 4L8BA 5D1XA 4HXBH 3QULB 4FNUA 3X13B 3CFBB 1URLA 1MCRA 4A68A 3QPXH 4N0YL 2DKMA 4PS3A 4F5CA 4HCFA 2EC9T 2R1YA 1TZHB 3WYRA 4HJ1A 1X6NA 5IESH 4F33A 2N1TE 2ADJB 4JPQA 1NUDA 3H55A 3KYKL 4MRCA 3HCVB 5DFAA 3SQBA 3P4OA 2AKRA 3AY4C 3VXUB 4WI0A 2GSIB 2ZCKL 4IIQB 3EJTA 5E8DH 1UZ8A 2GUOB 5D8JH 3RDTA 2GTZB 5IBTL 3EF4A 3NSDA 4IBVA 4F8TA 4BKLA 1BQKA 4HSAC 3X3FH 4G6FB 1E50A 2JCCF 5DHYA 3WS3A 3US1A 4TQHA 4XH2A 4KAQH 3BAEH 3KWUA 3AXLA 2XXGA 3NQKA 1CYGA 4RQQB 2EXYC 3K0YA 5KS9F 1HH6B 1NAMA 2ZAGA 5E94A 5E08H 4TLTA 1BMZA 4DOHE 5CCJA 3LD8B 2V7NB 4P4RA 5E9AA 3MLVL 4G8AC 4NYLB 3ARTA 4PJDF 3VG0L 3QJSB 4BBWA 5DD1L 1XF4A 5FW6A 1CDYA 3BPLB 4N5EC 4LIQL 1KB5L 4GAGL 1D6VL 1BVNP 1FAKT 3EH4B 3OBAA 3CX5J 3D69A 4LPWA 4O4YH 5LDUA 2ZXGA 1EFXA 1PDKA 5ADOL 3T2PA 4HK3N 5CZKA 5MEQA 1XGRB 3LRHA 3ESVF 3FO0H 3FQWA 4PYHA 3QYNA 4MQXC 3DVNB 3SCMA 4JFDE 1R3KB 3KBFA 1OV8A 1QRKA 5C08E 2YD3A 4NERA 2GSGB 3I9PA 2D3NA 3BAKA 2ZOWA 4UQEA 3K1KC 3OR6A 4N1CA 3HAEA 1CWVA 2HPTA 5KJRH 3BUBA 1QFUL 4OKVA 5HGAA 1ZGLP 1K4DB 3BAEL 1TVBA 2GC7C 2Q8AH 1OY3B 4TULH 5IR1A 2YD9A 4L4TA 3IJSB 3QNXB 1BA9A 3VFTA 4Z7VF 2EABA 2O6EA 3PGDA 3KL5A 5C0FA 3DJZA 3QEQD 2I7OA 6TAAA 3MYJA 4M02A 4LPVA 3E0GA 2ZUVA 4I7ZC 4PR5B 3R4DA 1ID2A 4N28A 5JHLA 1CFBA 3UJJL 3X3GL 4B9GA 3L4TA 3HC2A 4ZMTA 5DI8B 2GJPA 2ADIB 3MV9B 1ZE3H 5F6IB 2VR3A 2F8XC 3WHXA 4XCFL 2Y1VA 1UZ6F 1RK0B 2CO6B 3UMNA 3C08H 2WBWB 2ODIA 3DJ9A 2JNZA 1VRSA 1NGXB 3MRQB 3LS5L 4XOBA 4NS0A 4KQ3L 4D7BA 4HUUA 4EI5A 4QO1A 4HU8A 2EVIA 5F0JB 1GSMA 3G6AA 4LVNB 1NFIA 2ZWSA 2FO4A 3SD2A 4E42B 1NWOA 4Q2ZA 2MPAL 3ZN6A 1KJMA 2AV1A 4UQ9A 5GRVK 5DZNA 1XCXA 2BP0B 3QUHA 4R2GB 4X4ZA 4P9HH 1ORSA 2EYRA 3C6LC 4I2XE 5GIRB 4CGTA 5DC2A 3ZYJA 4QHKJ 3FSOA 3HMXL 4DO5A 2Z93B 4M48L 4R0LB 3ARYA 3F64A 3CN1A 3FQUA 3LTVA 4PJ8D 5CFAA 1SOSA 1GPOL 3OMIB 5CWSB 4J3OD 2XQYK 2XWXA 4UB0H 4PLKD 5KUKA 1IGJB 1IIKA 2QMJA 4APXB 3QIBC 3L8QA 2OULB 3P02A 4YFLI 4AENA 4B50A 2NY7H 3SKNB 4UV7L 3KPRA 1HWGB 2WQ8A 5KS9A 1NKOA 3KBEA 3GMNA 5T1MA 5ADPH 1NQBA 3PAVA 1MLBB 4P46B 4XGZA 5JQIB 1UB5B 1P4IH 3SY0A 4HJUA 3RIKA 2WK2A 1KLFA 1VGEL 1D5ZB 4KK5D 3HMWL 5E9DD 4W9DC 1MWAH 2X4SA 2E9WA 4FNLL 3BVUA 3QP3A 4YHLL 4GOSA 2WLIB 5HYQB 2WP3O 1V8HA 3QIUB 2C3XA 2ZQKA 4RDQF 4ZO6A 2RR3A 3QEGL 4GFTB 1J9SA 3D48R 4GMSL 3PJSB 4OCSH 5JTWA 4BFEA 4FZEH 2C5DC 3HMXA 43C9A 4JEGB 2XPYA 4FQXB 3H85A 3ZSSA 1L9QA 4LLDB 4OGQC 1A7QL 3O6FB 2VXVL 2NTFB 3FBKA 4FDWA 1E4WH 4UTAH 3NGBC 4X8XA 4XO4A 2BP5M 2CRIA 4L48A 1ECZA 1O7DC 2CJSA 2D73A 5AWNH 2Y6SC 4Z3TA 1TYJA 3QDGE 5D96B 4LGSB 4Q9CA 3U6XA 1PKQA 5KYYB 4NNXA 4JGNA 5F3BB 1XF4B 3L3KB 1XHHA 1M53A 3IBEA 4JFDD 1WFOA 2JQZA 2E3VA 5HVFB 1EEYB 2OMYB 5GHWL 3I3EA 3SIKA 4RMSA 5BNXD 1NBYA 3RPBA 2CXGA 4B6ZA 3QWNA 3GXFA 1MCOL 1AKPA 1MW0A 2GITB 3C2AL 5IGXH 3S0PA 1BYNA 1R1CA 1NEZA 3EO0A 3F8UB 1CLZL 4G8GE 3B5HA 1Z5LA 4R2GC 4M5YH 4XPHH 2WQVA 3PS6A 4U1IA 3L1FA 4MMZC 3U9UB 1AGDA 2V3EA 1YECH 3GTVA 1XVSA 3MO1A 5D2NB 1LD9A 3SKMA 3DX2A 1JWSA 1ML0A 2GAZA 4DTGH 3MV7A 1YEGH 2WIIA 3MV8B 4L4VD 5KVGL 3ROLA 4GQ9H 4WUUB 4GKSA 2DDQL 1LJMA 3CFCH 3Q2CA 4WHCA 1N64L 4JFYA 3PWVA 2DYRB 4MB1A 3BVDB 3S36H 3TCLA 4MNGB 4J4PA 4LCWD 2BFGA 3IPFA 5DJ6B 4GW1B 2BY3A 2VLLB 3C6LD 3BZ4B 4TUOA 3AT0A 2X9YA 1L0YA 2RCSL 4BK5C 4HHWA 4H1LH 3RVXD 3LDBB 3MXVL 1BX2A 4ZS6C 3S3DB 2CA4A 4UNIA 3FONA 4RAUA 5DEFB 1JGEB 1MFCH 3GSRB 4PLKC 3NZ8B 5SWZA 3ATFA 1D5XB 1LE9A 4I2XB 3HB3C 5D4JA 4EMZA 2V5TA 2W0PA 4JZOA 1FH2A 2NUTA 3MV11 1JGIA 1BQLL 3V0VA 3IETA 3QUML 4M62L 4P5SA 3OKOA 4CL7A 1A6TA 3O3EB 2X40A 4ZOEA 1EO8L 2ZE0A 3OXRA 1OQXA 4XPHL 4ZX5A 2PR4H 1OGTB 2E47A 3TZVB 3V9CA 5A7BA 5IZ7A 3TBSA 2Z8RA 2FR4B 4ELMA 3TBWA 1S7QA 4LVNC 4K7PH 4BDVB 4KRPD 1MFMA 4C56B 2WYZA 1QVOB 3BT2L 3Q2VA 4ODUB 3PPEA 3MRBB 1BVZA 4U6XB 4BH8B 1ZV5A 3RP1A 3B9KB 4ZTPL 1OAZL 4X6FB 5KYUA 1RD6A 2V2XB 3CSTA 5CILL 3DV6A 3D39B 5D7IE 2IWEA 3EO1B 4WI2A 1YMMA 4Z8FL 2BP3A 1RUKH 4DQOH 1DBKL 1ILUA 2EIZA 2MPVA 2R0WH 4IRJB 2X1WL 5DWUL 3VSVA 1YC7A 1BMWA 2EEFA 1SY6L 2FVNA 3GBNL 2VDLH 1RH8A 4NI6A 4AM0B 5BW7C 1GYCA 3RU8L 1OTSD 4HCIA 1A1MA 4PY7B 4TNVK 5EBLA 5IQMA 3QDMB 4HIEB 4MVBC 1AQMA 3ZTNH 1YPZB 5KVDL 2AF2A 3WD5L 1RJLA 4JRYD 3LZFH 1GY2A 4BKTC 1DQDL 5JUEL 5D7IB 1M2VB 5DHVH 3VX1A 2HMID 3ZLQC 2XPGB 3DX9A 4DN4H 4Z7OE 4JBSA 4XO9A 4QNPE 4NBZB 4EN3B 1QWUA 3E80A 3Q1SH 4IU3A 5DMJB 1T6VN 3VFGH 1HS6A 1BAWA 4DEPC 5FF6A 1H5BB 3TCXA 1N68A 1JVOA 2XBDA 3R06A 3CJJA 4IEFB 5KSUB 1G0YR 3K4DA 3SE3A 4UTBA 5EO1B 3JVFC 5D6DA 3ZDXB 5KN5A 3DA0A 3BW9A 3FO9B 1U3ZA 3WXWH 1B90A 5IP4A 3OSKA 2G9HA 1MFEL 4L1SA 1UGNA 3UTQA 2B3RA 3SHSA 4ICWA 4JJOA 1MHCB 2BWDA 1GAFH 5B3SB 3TJPA 2R0WL 4ZFGL 1E5AA 4I0CC 2VKXA 1AKJA 3C60A 1S7TA 1TQCB 3GSUB 3FTYA 2IJ0C 1IQDA 1Q1JL 3PQYD 2CAKA 4L1TA 3TA3C 4RFNC 2EVFA 4ZS6D 5TE4H 5E0FA 3FQRA 3VI3E 3LQMA 5J6GA 4EIBA 4XNXL 1OLLA 4LVEA 4FQPA 1OHZA 4LCIH 2JJSA 4JFQB 3ZE2B 4JY4B 1E27A 1JZ3A 2ZAIA 4XHQA 4LBEB 5DWPA 3VG9C 3BD5A 1J8HD 1F4WL 2ALAA 2YIHA 4KRLB 4UBDC 1XXDC 4N1EA 5I15L 1KCLA 4ZMXA 4Y19E 3CN4A 3MOBL 4P3CH 4D9LH 3MBWB 4IKIA 5AYUL 5IFAL 4JG5A 1S9KC 1G7MB 4ZQTA 2A6KB 5BW7A 4PRPB 1HT6A 4FG6C 3ULUD 1P5UC 5HPMA 4PJ7A 1Q9OA 2IOIA 1RUPH 2CHXA 1ZY9A 1ANUA 3I85A 1ZANL 3P73A 3AREC 4NN7B 1J8SA 3U4AA 4NC1E 5E1AA 3CDCA 1GZHA 3T4YA 4ZFQA 2ZCHH 3Q01A 4GP4B 4LU5H 5IMKA 3G6JE 1NGXA 2YK1L 5EU3B 4JFPB 1ODUA 1U93B 3IMRA 3W39A 2W0FA 1A6WH 1TZAA 5F7EL 5EU4B 3ZHNA 3IDIB 3LMJH 1IBBA 4MNGA 2Z7YA 1QMUA 2PNDA 1GOFA 3TEWA 3O6FA 1U41A 3EOAA 1ICTA 1SXCA 1A4KA 3L5WA 5T3ZL 4DKFL 4JO4L 2EKSB 1F4WH 2Z7WA 1HDMB 4KK8D 1JWSB 5EORL 1NCBH 1DCEA 1JZHA 2E76C 3U6XS 4E9LA 1SEQL 5J12B 2H32B 4MXQC 1X9QA 3LKRB 4Z3EA 4UQ3B 2WOYA 4UUJB 3BAXA 1EJFA 2JJVA 3G6JB 5H35B 3FC8A 4F37K 1QQDA 3V52L 5CJBA 2XV0A 5K1NA 3DUUA 2DM3A 3H4HA 4NO0B 3CZLA 1G9NC 4U1MB 1BQUA 1BJ1H 1YRKA 2D4FA 1IFGA 1IKNA 4JFEB 4JO3L 5AW6B 5DU7A 3CSFA 4P5TA 1Q1PA 2NQDA 3DMMB 5L2KB 3VWJC 5KS9B 3G6DL 3IU3A 4XPTH 1ACYL 3II3A 3K74B 3OHXB 3QORD 4FP8H 2B59A 1PQZA 2OXHB 3QUMA 4DSYA 5LN8A 3MRHB 1BWMA 5E00B 4LOUC 1GW6A 4G9FA 4J5VA 5EU7C 2XWJB 3D0LA 4MBOA 4Z7WE 3ML9A 4K3EH 3BPCA 5CJXC 1M9WA 1WS7A 4L0PB 2XY2A 4YHOH 1KYAA 4PREA 5JIHA 1SJMA 5BS0A 3OGCA 3N85H 2BNQD 3KAAA 4LLDA 5EV7A 3C9NA 3TA3D 5BCAA 1WFTA 3TTYA 3ULSA 1E27B 2J1WA 1ITBB 3TV3H 5I1AB 5IOKA 1XAUA 1FYHB 4Z3IA 3UERA 1TNMA 4WI8A 1U8PA 1S8DA 2CK2A 2WO2B 1O5DT 4RDQG 4X8CA 4YIQA 3NJVA 3QXAB 2X4PB 3UTZB 4NC1C 3N43F 5GGTA 3CQFA 3O8XD 4ALAC 3TBYB 2N7BA 3D3VE 3W9DB 4QRSA 1N10A 4M56A 5JZ7C 4G43A 1XF3A 4L4VB 1AS7A 3CU1A 4U2YA 4L8DA 4JR9L 2TSBA 1T3FB 2CJ3A 4JO3H 5KN5B 2VABA 3MROA 2A1WH 4C55A 1LWJA 1HHJB 3MBEC 4LFHG 2OJ1A 3FRPB 3O8XB 4NUJA 3T1WA 1S9YA 4FNPA 5FW7A 2CK0H 2O1AA 2UZYA 1N19A 4HU2A 2JSFA 3WS6C 7CGTA 2B20A 3NFNB 1FE8L 1YNLL 4AVIA 3H2PA 3RFRA 3BN9C 4YWGL 5IBLD 2I9TB 1K85A 2J7LA 4NZUL 4GG6E 2AERT 2IALA 2HLAB 4XVSH 2EP6A 2E75C 4HK3J 1AHMA 3CVHH 4KQ4L 4G7YL 3TU6A 2ADFH 2I5YH 1NEZG 3QQNA 1DP0A 5IUCA 4TLKA 2PYFA 1RZGB 1YN6A 1RU9H 1JVLA 4RZKA 4MXQD 1JNJA 5D72L 4X7DC 4Q2ZB 2FWLB 4TNWK 3V55A 2MQ3A 1FO0H 3V4UH 3C08L 4UQCA 4JPSA 4GUQA 3EBIA 2ZWKA 3KPOA 5C7ZA 2EILB 4FA7B 4Y4FD 5B4MC 3QCTL 3L9YA 3TT1L 1P84J 3EYVB 3FKUS 3SJVD 2N01B 2ZCLL 3MRBA 4FFZL 4KK6D 4LAJH 1G0XA 1ZV2A 3NN8B 1F2QA 1MFDL 4N6RB 4R97B 2B08A 2AABH 2XDHA 3TBSB 3PE9A 1H3PL 1Y0LA 1OANA 3GJFK 3HR5B 5LAPA 1TQSA 3U36A 5CP7A 3ARBD 4F20A 3OR7B 3IVKA 1A6ZA 3HBPA 2VZTA 2OYLA 3O81A 5D1ZI 1IGYB 2X1PA 4KAQL 4S0TD 4NFCA 2ADIA 3F7RA 5DUMH 4JX0A 3AREB 3LH2L 3MRNA 4M5ZL 1R75A 4DKAA 2ZXCA 3A67L 3NN8A 4GKNB 4PV1C 2NDFA 4ELME 3GJEB 4JFTA 3IN0A 4U3HA 2HUEA 3VUAA 1XBDA 1CGWA 1FV1B 3LIZA 2A9AA 2EYTA 4IRZA 1F90H 1W0VB 2NY0C 4JDTL 1R3HA 5TQ2L 4CKQA 2MNWA 4F7PA 2YZ8A 4B96A 5KSBE 3LKSB 3SO3C 3DX3A 4D0DB 4X9FA 5I6NA 1I4FB 1DUYB 1DLHB 4N86A 4FABL 4MBRA 3GWJA 3TGXA 4JKPH 1ROCA 5BQDA 5TF1L 2FEEI 4XWGL 4BFJA 2CA3A 2H2PD 3IM1A 4HA1A 4QYOB 4WHTA 3QCTH 3C6SB 4AQ8A 4PM1A 3HAEB 2NZ9C 3OAUL 3V4PL 3E7JA 1BMGA 3DI2B 4JFEA 3FB8A 3KLQA 1UD5A 2XZZA 4PB9H 2BSRA 4MAYB 2H26A 5I66B 3QDAA 1G7HB 3QWQB 4ZOCA 1YCSA 2ZSWA 4GPVA 1P9MC 4Q6IB 1L9NA 2R2BB 3NAAL 4P49A 3EOTL 7TAAA 3KH4A 2J8UE 3FUNA 1JPSH 4GS7B 2BC4A 1ZHBA 3IRZA 2HVJB 5F7AA 2PF6A 3JXAA 4LSSL 4YUEH 2XWBA 3MRRB 4IJ3C 4TTGA 3LRSB 4JQVC 3GO1H 4JHZA 1XGPA 4LHJB 2ZKMX 3EIFA 1JG9A 1FFOB 4OQTH 4DO4A 1U8MB 1VFBA 5IB1A 1QKZH 1YECL 2IGTA 3NG5A 3TJHC 3TNMB 2L7EA 2P8LA 2Y7MA 4ODWA 5C0CB 4LESA 3JTSB 2QZQA 4IGBC 4YR6B 5EBMA 1RURH 3EYQC 4PW4A 2QDWA 3DETC 2WWMC 5LGKA 1OT1A 2VAAB 3W57A 1CS6A 3IDJB 1FF5A 1ZLUH 4PJFF 4DPBX 3K72B 2P80D 5B38B 4A67A 2MOVA 1CDJA 1JD7A 5FYKE 2IV8A 2JXMB 4MD4A 1EERB 4WAFA 5EO9B 2AC0A 1XGTA 5CO1A 4Y4FC 4G9DB 1LO0H 5F7FA 3RTLA 2EUWA 2ZXEB 2EYSB 4P23A 4ZDHA 3RFZA 3V0WH 1CE6A 4NQSB 4OZHE 4KXDA 5DFTA 1ND0A 1WIOA 3DROA 2XQ0A 3VFSA 3FT2B 5KVGH