1E4WH

Crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
213
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGFTFTNYWMHWVKQRPGQGLEWIGEILPSNGRTNYNEKFKTKATLTVDKSSNTAYMQLSSLTSEDSAVYYCARSPSDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAB2
molecule tags Immune system
publication title Cross-Reactive Binding of Cyclic Peptides to an Anti-Tgf Alpha Antibody Fab Fragment: An X-Ray Structural and Thermodynamic Analysis
pubmed doi rcsb
total genus 44
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4wH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4wH02
3L9RB 5HDBF 2VABB 1ZGLB 5EDXA 2Q6WA 2OL3A 5HVFB 1XGYH 1CCZA 3TLRA 5IJKC 1WSST 2QSCH 3CSYB 3DTXA 1X6LA 2E9WA 5JOFB 5LGHL 5B8CA 1X5HA 4MJIE 1XIWA 5KVFH 3MRHB 2G60L 3KYKL 3DNKA 1V05A 1HQRB 2BY2A 2NZIA 4BZ1L 4D0DA 1BBDL 5DJCB 1Y0LA 2KKQA 4PV9B 3O3DB 4PJXA 4S1QH 5HHMB 2H1PL 1I1AC 1K8IB 2XTJB 3O81A 5E6IA 5I74B 5MEOB 4LRNL 4N68A 4U1LA 5BQ7B 1NGWB 1CGXA 4JFOB 4LHUG 4NZUH 1N6UA 5JHDD 3AU1B 5DD6B 1XF5A 1T1XB 4XBGB 1RUAH 5CD3A 4HT1H 5FUOH 5SV4A 3GJFH 2PR4L 5KS9E 2DLFH 3LKNB 1RUMH 3QDME 4MWFA 4GQPH 5C08D 2R69L 4OGZA 4RX4A 4TULL 8CGTA 1J11A 3WLWD 3VWKB 1Q9LB 1YJDL 2IGFH 1KUMA 5E99H 5KG9B 3U30C 3K1DA 4JY5H 4LCUA 5C0AE 2A6DA 3D39E 1QR1A 2P5EE 1MVFA 1S7QA 4DJMA 2NPLX 1D5BB 1ZT1A 5D7LB 1KJ2H 2MNUA 2VXQH 4PJAE 4M6NH 1F90L 3RWEA 3AREB 4KVNH 1KGCE 1QLRA 4MQTB 1BAFH 1ZHBB 4O5LL 4XVJL 2D0HA 5IHBA 2NY1D 3C5JB 4R2GC 4F57L 4Z95H 3OKOB 3FJTA 1LEIB 3U2SA 1JIBA 3DECA 4PG9B 3QQ4B 4JPIB 2YBRA 5CS7A 3ALPA 5CD5C 1H3XA 2D7TL 3LV3B 2QADB 3D0VA 3ILQC 5K9KB 3C6LA 1DSFH 3V6OE 1U8OA 4UT7L 3ZDZF 1KTRL 3QFDA 4YK4B 5GISH 4OJFL 2VLRB 4FG6C 3LRSA 4HGWB 4UQ3B 5B22A 3WE6A 2NXZB 2W92A 4AQOA 1QLRB 4M1DH 2A77H 1SYSA 5DDHA 3GJEA 1MHEA 1EO8L 3UJIH 1P2CA 2OR9L 4PTUB 4DQOH 1CICC 3GSRB 1EAJA 4G6JL 2BNQB 5DFVC 5B8CC 4DEPB 1V3LA 3WIFA 4FQXD 3VG9B 2BSSB 4MNQE 3BEWB 1ZE3C 2D0FA 3GSUB 5I73C 4R96A 4EBQL 1Y18A 3MUJA 3FRPA 1LO0H 5IK3A 2X89A 3U48A 5IFHH 2ZUXA 3GSVA 2HKHL 2LAGB 1L0XA 4QRUB 3MLPA 3CDGB 4OI9A 3TT3L 5D2LE 3ZLQC 1A6ZA 2UVFA 4EI5A 3UTTB 1DE4B 2PXYD 4G6MH 4QYOA 4KH2A 1B2WL 1KCVH 1G7PA 1FGVH 1NFIA 3C8KA 2NW3A 2XTJD 3CXHK 3V5DA 4PGBA 4E5XB 5JW4R 1F4XL 4ERSL 2Y6SD 5IHLB 5HVWA 5KJRL 3HG1D 2NTFA 1FFRA 2JJTC 5DZNA 3U7YH 3E3QC 2ARWA 4Y2OA 1MWAA 4NQED 4YXHL 2MKLC 1KENH 4FFWD 1WUNT 4P4KB 1X5JA 4PJ7F 5GGSY 4OD2B 4AENB 5CMAA 4Z7OE 3TO4B 25C8H 4PRNA 2AK4A 3RTQC 1U6AH 1KCUL 4R7DB 1N5AA 3P40A 4HX1A 1NMBL 1D9KD 4W6WB 3O8XB 3U4EA 4OIIH 4EUPH 4JFYA 4Z0XB 4RISH 3FB7A 2IGFL 4PRHA 1IM9B 4BQ6A 4XXCC 1NC2D 2CKBH 2E7BA 2A0LC 2Y36L 4YDIH 4JFOA 3AMLA 4DGVH 1EHNA 1FNGB 4YH6A 4PRDA 1GGIL 5E56A 5C0BB 3MACL 1OP5K 1I8IB 4AEHH 4UNVA 5I2IA 4PGEB 5T5NG 2VDKH 4EN3B 4OZHA 2RAMA 1OSPL 5C2BH 2X4TA 3WS3A 5FGCE 3TWCL 4CW1A 35C8H 3EZ8A 3VGHA 1I3UA 4PY8J 4C56D 2XFXB 3MV8A 3RGHA 3V4VL 4TYUA 4WIQA 3V5DB 2AK4E 3D6GA 3HLAA 3U4BL 3X14B 1JFQH 4XXDB 2EYTA 3PL6B 4IJ3B 4M8QB 5IROC 2XA3A 4YFLI 1AC0A 7FABL 3ZTJH 1BFVH 4L4JA 1AO7B 4P5TB 4WDIA 4UV4H 3VWJA 1CT8B 3QUYD 2E9IA 3BGMA 1JFQL 3J7HA 4JJHA 3KHQA 4U6YB 2APWA 3RWIB 2AK4B 3ULVC 1PYWB 4PRBB 2VXSL 3H7BB 4OQ1A 1IEAA 4ZPVA 4L5FL 3TBVB 1JHKH 3RGVD 5HPOA 1KCRH 5E8EB 3FQUA 4X6DB 3VGAB 1INQB 5E5MB 4V1DD 1WZKA 3QDGD 3NN8A 2FYYA 5IB1B 3OQ3B 3BZ4B 2PW1A 1FPTL 4J3TA 5HHXL 3BD4A 5HHQA 4HJGB 2MCPH 1ROWA 4LLVA 3OB0K 3MV9E 3S7GA 4MQSB 5DHVB 2ZUWA 2J2ZA 1UWEH 4WFFD 1Q9OB 1FZJA 3AB0B 2MCG1 3LRSB 1ZGLP 4Y4KC 4HLZH 1TQBB 4MD5A 5DRWA 4OZ4B 1RK0B 3G6JF 4AIZA 1FBIL 4ZFOA 1A6ZB 4LQFL 5JQHC 2R29L 3N85L 2XY1A 3MRJB 2X40A 2JELH 3B43A 3SDCB 4KK8D 4I0PC 4KTEL 4LEXL 4IMLB 12E8L 1I1AD 3VG0L 4FN0A 3RNQB 5C2UB 1NUGA 3TIEA 1T7VA 5FYJE 5TQ2H 2FIRT 3VXQA 2ARJB 1RIUH 3MUY1 4ONGH 3L6FB 1UKQA 1FVDA 1U8LB 4GXVL 4XPBL 3UEZA 5GRVK 4AEIL 1Q1JL 5K9JL 1TETL 2VQUA 4YXKH 1CI5A 2HWZL 2V5RA 5T5FL 2ZKHH 1K6QH 3QFJE 2GJ6A 2VDNH 1CL7L 5EZJB 3BKCH 5JR1H 1NMAL 1G6RH 5ILTL 2ESVD 4UDTA 4MNGB 4JB9H 5GS0L 1BEYL 1G6VK 3DV6A 3IAQA 5IP4A 4JHWL 1IGIH 4Y4KA 1FZJB 4OGYH 4L8CB 5LBSH 3TNNB 1J12A 1JGVH 3MRNA 5I75C 4M7LT 43CAB 4TNVK 1LEIA 3HMWL 3KPPA 1INDH 4FQLH 3GB7A 2PR4H 1VGKA 5E95B 4K3HA 4XCEA 1FZMB 2FYYB 1NQBA 2BJML 5TE7L 4WTXA 2EKSA 2CO6B 3NFSH 4MAYD 3ULUL 4F2MA 3ROLB 1D5ZB 1BD2A 4LCCA 3T8XB 3TN0A 5I1EL 1KB5B 4GMSH 4BJLA 4A2MA 4CMMB 5L2KD 1S7TB 3SGJA 5FO8A 2Z93B 1TNNA 5C7XH 1U8JA 2R4RL 3EW3B 4F9PC 5GSVA 3ELAT 1QFWL 4Y89A 2VJXA 1CLYH 2CLRA 3OKNB 4NC0B 2QADD 3QUZA 4XX1E 3RWIA 4JQXA 4PGCB 4P2QB 3HLAB 3OR7B 4JM4L 1QSVA 3GSNB 1VFBA 1UA6H 3ILPB 1LK3H 5FUZH 5D1ZB 1LNUA 4LAJH 4V1DB 4KK6C 4NRXB 3V0VB 4G80A 5A2LH 1X5FA 5D96C 5CILH 5J1AB 3NMEA 4K94H 1EFXB 3X13A 3DX7A 3LVEA 1X5IA 1A7QH 3BN3B 4P2QE 3NBNA 4LKXA 4KDTA 4CNIB 4PV9A 2FHFA 4XMPH 1ZV5A 2F5AL 1NMBH 3P4NA 4IRZL 1HEZA 3UTQB 2FDBP 3KS0H 2OTWB 1MWAH 3M8OH 1I1AB 1DBMH 5FM5O 1YMMB 2HWZH 3TBWB 1KXVC 1YNLL 5H94B 4KHTL 1JPFA 4Z8FH 5FO9B 3I50H 1I9IH 4ZUUB 3UTTD 3AC0A 2UV3A 3MOAH 5FO8B 1N7MH 2I24N 3P4OA 4WNQA 1DUYA 5CCKH 2HT3C 4HUVA 4O2FA 1FZOA 4OCYL 5HPMB 3O3AB 3W11D 4ZS7L 1I7TB 3HNSH 4YDVA 1L7IH 4K7PX 2NX5D 3MOAL 4QRQA 5JW5B 1I4FB 1I1CA 2XICA 3CVHA 4HUXA 4RGOH 4HZLB 4S10A 1MWAB 3SOBH 3IXTB 4CDHA 1KPVA 3OWEA 4ZUVB 3BYYA 4JLRA 4NQVB 1BIIB 3Q6GL 5A2KH 1P1ZA 1VKXB 1BZ9A 4FZ8L 1CFVH 1JNLL 2QSCL 5JDSA 5EUKB 2F5AH 4PUBH 1GZPA 2BNRB 1NH6A 4GS7B 3VXSE 3RI5F 5CFHA 3KPQB 1KT2B 4X6BB 3M1BB 1P6AB 4HCRH 4NO0D 1P5VA 4RGNC 3VFVA 2VLMD 5DO2C 3JWDH 4FZ8H 1TPXC 1FYHB 3LZFH 3NZ8A 2DKMA 1MELA 1ZKAA 3O45B 3FHAA 3JV4B 4LVNB 5DK2B 2HVKB 1A1NB 3UDWA 4WI7A 3L1OH 1B0WA 3NGBB 4PLKC 1JTOA 3BDXA 4RGNE 5FK9B 3C87A 4J4PA 2VXUH 1FGVL 2VO5A 5L2KA 3QNZB 1E4WH 3LN9A 3W0WE 2ADIA 4LLQA 1I8LA 3E6HB 4DGIL 3BDYH 4QXGH 4PJIF 5IFAH 2FZ3B 3PL6D 3VD4A 3D0VB 3UTSD 1XMWA 4U6HA 2FO4A 1LHZA 1R24B 3EYFA 4ZYKA 1E27B 1XF4B 2B4CH 4MAYA 1NGPL 1WBZB 2IPTL 5D2NB 5EZOH 4JDVB 1MJ8H 2EC9U 1MRFL 2FJFB 1PQZB 2Y07L 5ISZD 5D1QC 3V7AE 2QL1A 2Q76A 1F6AB 4LVEA 2V9TA 3WNPA 3PHSA 1A7PL 1FL6B 1GAFL 1MRCH 4P59L 5J13C 1TVHB 1J1OH 2Q3ZA 4PJCB 4Q0XH 3OKKB 2HJLB 4TOYL 3ZZ1A 5IB1A 2JJVA 2MJWA 3RX8A 4LSRH 1OSZB 4X6FB 1OF2A 1TZIB 1CLOL 1OHQA 2E9JA 5F7DB 2BVPB 4L4VE 1QFWI 5D2LF 5BRZE 2YD8A 1EO7A 4YHZH 1OM3H 2A6JA 2XNAB 3ARFD 3VA6A 2R2CA 3L5JA 3P9LA 3WJLA 2FJGA 5KG9A 3HI1A 4L1DA 4OD1L 2HFGL 2V17L 3T4AB 4PJHF 2D31B 3MRFB 4UT7H 5B38A 3S36L 3O6KH 2J5LC 5HHPB 3TH4T 3STLB 4OCWH 4JPVL 3DGGB 2GT9A 4FABH 4I5BB 1I1AA 4H26B 1MFBH 3NPSB 1KJ3L 3O3DA 4PR5A 5F97E 2BRRH 3ALWA 3QB7C 2DQJL 4U1LB 5F6HI 4LKXB 4P5KB 4Z7WA 4NNXB 1E6OH 5HPMA 4HKZB 1UC6A 1OB1B 2YK1L 5EOQH 3X12A 3FL7A 5FYLL 3K4DA 2QSQA 2OTUB 4NO3B 3C08L 4JFZL 3RJDA 3A6OA 3TBTB 2BDNL 2NY2B 5L8LB 3WBDA 2Q8BH 3IF1B 4XAKE 3HNSL 4NIKB 2J7LA 1OARH 3WSQH 1W0YT 1UG9A 3KLHD 3SDDC 1YJDC 2E6PA 5GS0C 5HI3D 3LN4B 4JFEE 2GSGA 4E9LA 2DQEL 2J1KA 1PEZA 3HZMB 3AS0A 4MAUH 5JPNA 4IDJH 5ICZB 4MNQD 3GSNA 1B0GB 1ZMYA 4L3CB 4M93B 5EG6C 3TESA 1OP3H 3ARGB 4G80B 3MBEB 5DJZB 1I8MA 3KPOA 2R8SL 5D93B 4M62L 43CAA 5FA4B 5JA9A 1D5MB 4XWOC 2NYYD 1T5WA 5KVGL 1F4YH 1BAFL 2YSSB 3RWDA 3IJHA 5HHPA 4CN1A 2H32B 4Z7VB 5JLZA 3NIFE 3FT4B 3OF6A 4R96B 1OAKH 3TO2A 5FB8A 3VWJD 3IKCA 1F8TH 1FG9C 3DO3A 4P3CL 3RGVC 3IDNA 2OR8A 4JHBA 3LEXB 1NC2B 5ECJE 3IFNH 3T0EA 1D9KA 4JRYE 4G6AC 3BZFB 3FOLA 3VDAA 4JPKH 1KTKE 3FQXB 3L3GA 3U7WL 1JUFA 2EDFA 1WT5A 4D3CL 3QXDA 3KLAB 4FQHA 4I48A 4R4BB 3K46A 4OQTL 5C6PB 1R0AH 1FAKT 5CBAA 3VXME 1CGTA 1DANU 1J05A 4DOHB 2V17H 1F4AA 2YA0A 2L7UA 3WHE0 5IF0A 1T1WB 3BN9C 4P49A 5KVDH 1FIGL 5CJOL 1QSEA 1M05A 5FECA 2VTFA 2UWEE 4EUPG 5E1HB 1F3DH 3BPLB 2DF3A 3I6KB 1EJ6A 3KJ6H 1IEBB 5F1SA 4HKBA 5HI4C 15C8L 1KYOK 3O11B 1HXYB 3BH9A 3HCVB 5KOMC 4U1MB 1ZT7B 1JYNA 4GRLA 1EIBA 4M61B 7CGTA 5ID0A 2PCPB 5HYJA 3F7YA 3IFLL 3PWLA 2VLRA 1XCQB 3IDNB 4HC1L 3NIDF 1B6DA 2R0KL 1EHAA 5ILTH 5IMMA 3I2CL 2FCBA 1QFOA 2VNCA 3FT2B 1M05B 5D1XC 4JHWH 4OBSA 3JBG7 5H2BB 3HZVB 4F9LC 4PJ9B 3O2WH 1IC5H 3V6FA 3UYRL 2MPAL 2GAZB 1J10A 2JIXA 3TZVC 4JKMA 3SDCD 3ZKMC 3E6FB 2DQGL 2WBJD 3DSFH 2DQTH 4GG8B 4GRMA 3C09B 2KZWA 3KLSA 4HAFA 3HS0B 4HH9B 3DYMA 4OZFB 1BIIA 1LK2B 4KVCH 5HYJE 3I9GL 4FQXA 1M71B 3OTTA 4XPFL 2DQGH 4AH2B 3PIQA 4N0CD 3P0GB 3FQUB 4X6DA 3CX2A 2FNBA 5KVFL 3EJYC 4LCWE 5FKPB 5DFTA 4MCYB 5KSVA 1MHHA 2PYED 4I3SL 4RCAA 1OGTA 5C08B 2GSGB 1FORL 1CZ8L 5F9WC 1KJ2B 1IEHA 5IFHL 4ONFL 3O2VH 1RZIA 4OFYA 4NYLA 2AJSL 4LPUA 3RDTB 3NPSC 5DTFB 1YY9D 2K3TA 2ED8A 3MBEA 4WVRA 3C09C 5JNYB 1WF5A 3ROOB 4MA1B 2FO1A 2Z8RA 3ARDD 2Z35B 5E9DA 3WV0A 4NQXB 4KKNA 5KBNC 1FNSH 4I2XB 1DQML 2OTWA 4WUUA 2W9EL 4KV5F 3ORJA 2BVEA 1P84K 3IJYA 5GZOD 4FQIH 1AY1L 1RUML 3EYOB 3GGWA 1I7UA 4YDKH 1QBBA 2FL5A 3S5LB 3WFCL 2BMKB 2BRQA 1ACYH 1EO5A 1I1YA 3LQZA 3P0YH 2OYPA 1ZVYA 1BF2A 2OZ4A 4BZ1H 3KPSD 1FSKC 5JNYA 5I19L 3KYMB 4G8EA 4N8CL 3RUGA 2VQ1B 4P46A 4ZSOA 2ZNXA 1TVDA 1K8DB 3BXNA 5C08A 2LU4A 3C5ZA 1MEXH 5E2TL 1LP9F 2FATL 2VIRA 1QFUL 4X7FC 2G75A 4QCIB 4XVUD 5ANMB 3PHOB 5CGYC 4I77L 1M1SA 1YQVL 3WLWC 5I16B 3NIGF 4HG4J 3OF6D 2FBOJ 3FAXA 4QRRD 3RVXD 1AXTH 4GAYA 2X7LA 3JV5A 1ZAGA 2ORBH 3FQTB 1ULVA 1SEBA 5KSUB 4OT1L 3QFDB 4UBDD 3GSUA 4M1DL 5B4MD 3MLXL 2BNRE 5M95B 3LEYH 3QIUA 3FZUC 3ZKXB 3GSVB 4XGZA 2Z0BA 1S8DB 1YY9C 4KKCC 4HUWA 4MAYC 3VGDA 3BUYA 3GNML 2F54A 3MRGA 4LLQB 5F1OB 5F3HA 2VZTA 3DX8A 5GGSB 4J3SA 1QP1A 3LN5B 3K2MC 5ESAB 2B5IC 1RZFL 3PDGA 4HK3N 1R24A 1JF1A 3HI5L 3IU4H 4XPGH 4YC2C 4JR9L 5E1AB 4ZYKB 3VFOA 3ZT5A 4U1MA 4G8IB 4CJ1A 5EU6B 1L9MA 2VMFA 2K7QA 1FC1A 1QFHA 2DJUA 2LFGA 2PYFA 1J1XH 5F7UA 3SCMB 1MLCA 5KZCB 3MRCA 4RZCB 3ULUH 3TFKD 1A2YA 1IC5L 1PLGL 4K7PL 3U2SB 4LLAA 3ZKMD 4L8BB 1XGYL 4PGZA 3F7RA 5C09B 2RIKA 3FN0L 3WXWH 4BQCA 1YEIH 4POYA 5J11B 3PDOB 2R69H 1SEQL 5CJXA 3F5WA 5DHVA 1X6NA 2BNRD 2DQCH 2FSEA 4WW2C 4R9HA 3T2QA 4KZEH 3C5JA 1LE5A 2NY2C 2IBBA 1OWWA 2VWEC 3QIBC 2R23A 1OTTC 3CZFB 3QIUD 4P57B 4PRPB 5I9QB 2VLLA 4PJXB 4GG6E 4IOFD 1Q94B 1FZOB 4FTVD 2KPNA 4MCZB 5JTWA 4JE4B 4HAGA 5IV2A 3JV6B 5B4MC 2DQEH 2AABH 1I4FA 2W1NA 4OZFG 3HZKA 1RZKH 4EKXA 4JREC 3MNVA 3VRLF 5J8OA 1F45A 4LEXH 4U05A 2I5YH 3CCHA 4JQVA 4O58L 2D4DA 3U7WH 3SQOH 3RKDC 4I8DA 1YEKH 4LVOC 1A3RL 4BSVA 1CXFA 1OAUH 1UT9A 2IAMA 2R1XB 5EOCJ 1IQWH 3QDJB 1XGTB 2V9RA 4F7EA 1GVIA 4MA8L 2W9LA 2D9QB 1H5BC 5BQ7A 1G0YR 1U91A 1WWCA 4XXDA 1AGFA 1CXHA 4HKZA 1SEQH 1FE8H 1WC7A 2B20A 1EZVY 3VH8A 1CE6B 3BH8B 5CJBA 5EU3B 3C6SA 1XAUA 2ENYA 3P30H 4QRSB 1MCDA 3A6BH 4NQCB 1HQRA 3P77B 3HNTH 3Q3GA 5HGBA 5GRXG 5FO9A 32C2A 4PJ9D 5JOFA 4WHCA 3EO1A 3QHFL 4NDMB 3UROR 1MCWM 3MRDA 2WQRA 1E6JH 4J4PD 4TVPH 4Q97A 2VDMH 4OM0H 5A16A 5J13B 4KTDL 1A14H 1A6UL 3QXAB 1F3JB 1ZANL 3MREA 1T7ZA 5DQDH 5E8DH 5ACMA 3MODL 2C3XA 5C0CD 2DLGA 3WNOA 4KPHL 4KXZH 4Y16A 5TF0A 2G5BB 3B9KC 3RU8L 3GRWL 5DD5L 4G5ZL 2QR0A 1T0NB 4GSDH 2DQUL 3STBA 4ELKA 5BZDB 4AG4L 4Y2DC 1TJGH 4BK4A 1HH9B 5GRWA 1AQDB 4QEGA 3HPJB 4PJEA 2XXCB 4J8RB 3TCXA 1T20B 1RFDH 1OAKL 3S35L 5DVNA 1WZMA 4HGMA 4Z7VE 5ESQB 4GW4A 3TBSB 2NX5B 1CG9A 3HMXA 4LU5H 3IDYB 2D7MA 2VXVL 4FTVB 4HUNB 3SDCC 3O4LE 5DT1H 1JF1B 5E1AA 3GSWA 3MLUH 1CGSL 5DEGA 1G7LA 2F19H 1JK8B 4RNRB 3DSFL 2XN9E 2XQBL 3UO1H 3OKLA 3KJ4B 2GTZA 5EU6A 5C0CE 1FVCA 5KAQF 5K93A 1J5OL 5JZ7C 5KSAD 2X4NA 1R5WA 2AXFB 5FOBB 2C4XA 4LLMA 4HKBB 1HIML 4OV6F 2DBLH 4FNLL 3VGAC 4LCCC 4MJ5A 2EO9A 1LEKB 2FD6H 5CJ5A 1T2XA 4GRLD 4EQ2A 2VDOL 1DQTA 5DSCA 5C07A 3TN0D 1HHHB 1AGFB 1UM6L 1YEJH 4O9HH 3MCKB 3D2UD 2UZIH 5HHOB 2EICA 3QIWD 3SGDH 5JORB 1N4XL 1U58A 2OJZH 3O6FB 4OF3A 5F9DC 4BSVB 2BFVL 4OZ4A 1TTGA 1P7KB 3UTSB 3EO0A 4PJ5A 1I3GH 4HIHB 5HHOE 4AIOA 3I84A 4P5MA 5IB2B 4WHTB 1NEUA 4PJ8C 1K8DA 3BXNB 5HHME 3DXAD 2DQIH 4LSTL 3R0NA 1N2RB 5MEPB 5EU5B 3BAEL 2PKDA 4QT5B 2V5YA 4CGTA 4L9LA 4R2GB 4NCC2 3WD5H 2XN9B 3SE4C 1RK0A 5C86A 3L3IB 1RZGB 4YGVB 2EH7H 1JZ4A 1UGNA 3C60D 3QUMB 2VR4A 4HXBH 4F57H 3MROB 3WFDH 5E08H 1CDCA 1W0VB 5IQ9B 2YOCA 1YUHB 1L7TH 3G5VA 4H1LG 4YUEL 4UDUB 4Z9KB 4NCC1 1HHIA 4RRPA 1KSRA 2DIBA 1MFCH 2B39A 4HUXB 5FCUL 3ALXA 3AS2A 1GGCL 1A4JB 1ZHKA 5E2WH 3VXMD 5KANI 3MTRA 4XNQB 2RCSH 3BMVA 4FQLL 2YS4A 4BQ8A 1TZHB 3HA0A 5FYJL 3CK0L 4RGMB 1U8IA 2K1MA 4ODXB 4WEBL 2P47B 3MLWL 3IFNL 2OSLA 4PJGA 4LASH 2Q6WB 1AXTL 3L3OA 4NQXA 1QUNA 3G04B 4HT1L 4HWUA 4JFFB 3NABH 2FRGP 2YEZA 3VFOB 4PP2B 2PETA 3D39D 5ESAA 1XGUB 5I9QC 1N5YH 3DYOA 3NFNA 3RL2A 3GJFB 1ZANH 3DPBA 3TBYB 4CU8A 2XOTA 3UYPA 3MV9D 3QCTL 5F3BB 4D0BA 1WBYA 5DYOB 3S4SA 1RJZA 1CLYL 5AZ2L 5IBLC 5HI5C 5J9PA 1WTLA 4CMMA 3RWHB 2HA1A 2EEDA 4EN3A 3RGVA 4OTXH 1S78D 2XZCH 4WW1A 2ADFL 3E2HC 4PJHB 3SKMA 1E4KC 2EYRA 1U8MA 3L7EA 4NKDA 1MPAL 2CGRH 3QO1B 3OXSB 3D39A 1PKOA 2W60A 2MMXA 3JWOC 4GRMB 4YHIA 3TZVD 3KS0J 4JRYA 4HH8A 1OSPH 5C2BL 1XH3A 3SKJL 3FT2A 4OD2A 5CZVH 2DJSA 4RDQF 4HD9A 2EDHA 1NAKL 1T89C 4J3OC 4LDEB 5IV2B 4YHML 1NAMB 2R0WH 3WS6A 1A4KA 1HOCB 4Y19D 3VXUA 4M61A 1OLLA 4QGTA 1IJ9A 4NKQB 4Y19E 3T04D 5J3HD 3I3DA 1G7MB 4ZD3H 4U1JB 4UQ2B 1L7TL 4LSSH 5K9JH 4WTWA 1PY9A 2CQVA 4N5UA 4RGMC 1N6QL 4M5YL 4Y5XB 4HWBA 3MV9A 4P9HC 5SWQA 4XCNB 2PO6D 3TCLB 5MERA 1U58B 2FX9L 5IESH 4WU7A 2XI9A 2H6PA 2VLJE 3L3JB 3L7FB 2E27L 4HBCL 2CUMA 4DCQB 5AYUH 2HFFB 4GJTB 5BVPH 2Q87A 4JAMB 5FYKU 4Y5VA 4Z7WF 1IEBA 4HUUA 1KLUB 3BGAA 1JF6A 1ZXQA 3U30B 1QTYT 2J4WH 1QRND 4G8FB 2X09A 3JZ7A 4PJDA 4MXWL 4KUCD 2X4NB 3CC5B 3SJVE 1U8NA 1U8HA 5FYJU 1T03H 4Z7NE 5B3JF 4DTGL 3K1KC 2HRPL 3PXJA 4ODTH 3UPRA 3DUSA 3CFBA 4LLYB 4EI5D 4JO1L 4NRYB 4XCYA 4PJ8B 5T1DL 4TRPL 5IIEA 3IDMA 5C71A 3VW3H 2JCCB 5GZND 4XT1C 5IJVA 3GSNH 1JPGA 3DI2B 2UZIL 2GFBA 5I8CB 5K9OA 1V7NH 2RR3A 5F89B 3MSPA 4OI7A 2DS4A 2P49B 1CK0H 5HGHB 4K3JH 3OG6B 4LPCA 6CGTA 3QQNA 1A9EA 3QI9B 1BFTA 4X7TB 2GSIB 4MXQC 2DIAA 4HLZG 2IPTH 5I19H 4XCCL 5CUSL 3KAAA 3MOQA 4CU7A 4ISVA 2Q1EA 1TVBB 3KWWB 4TVPL 1GCFA 5DD6A 1W8NA 4HJGA 3L3DB 4C4KT 1ZT1B 1ED3A 3V8CA 4NQEE 2BZDA 5EBLA 1N8ZA 1S7SB 4GAJL 4LU5L 3ZE1F 3TO4C 4HKXA 2H45A 5GJSH 1MAKA 3WEXB 4RBPH 3M8OL 5HYSB 4JQIL 3QT2A 4PV8B 3JWDC 2I60L 5DJDA 3ZKSD 5T1MB 5IW1A 1EHLL 4PJIA 3DUSB 2E6JA 1CGYA 4LMQI 3N50A 3G5ZA 3WDIA 1H3PH 3CAFA 1EX0A 4FMKA 4R4NC 2AJYL 3B9KD 4WI4A 3HHRB 4NDMA 1U95A 5E00A 1XGUA 5IMLA 4PLOB 3IDJB 1QEWB 2GK2A 3IAGC 4GXUN 4XCFL 4AENA 1GGCH 4YNYA 4TVPE 4ZODA 3RI5K 3D0LA 5GJTH 4YBLC 2F53B 5KVMC 5I71C 4MMZC 4LARL 3SE3A 3M45A 3Q6FA 1MI5E 3MJ9L 1YECH 2QBWA 1MIML 4PJHE 5MEND 2M1KA 2V5TA 3GI9H 3O3EA 3L3JA 4Y0GA 1HKLH 3RIFK 4RMRA 5BV7L 2EE9A 4XPTL 4XVUC 4GBXA 3WO4C 3MZTA 3QHFH 5J89A 1INEL 3MGAA 3TIDA 4R97B 1QG3A 5DTFA 4U1JA 4WO4A 4H26A 3RPKA 4OM0L 4PBVC 4YAQA 1URLA 3LB6C 2OTPA 4UI2A 2VDQH 3G9AB 4IRZH 2D31A 1P7QD 5C09E 3CH1A 4MCYA 1GL4B 3MLXH 3VXRE 4K8RL 2VB5A 2G60H 3KYKH 4HHAA 5EZLB 3FRPG 2DTSA 2HG5B 4PJ8D 4Y5VC 2X9YA 1VSCA 3REWB 2R2BA 3WL9A 1S5HA 4XI5D 4HCRL 3FO0L 4OIIL 2AERT 1CDBA 3GJEB 2X5PA 1IC7H 1TZIA 5GGQH 3TIDB 4DAGH 4XZUA 1U3HB 3HUJB 4OI8A 2Y36H 2XWJA 4W4NA 5ANME 4U7KA 3SKJH 4OKVA 1UJTA 4W4OC 4GKSA 1BLNA 4HULB 1H8SA 5MHSD 4N90D 4NO0A 4HV8B 4O02H 4G8GA 1MHCA 1IM3B 2PTTB 5GS1B 5GRVL 2WINA 4PJ9A 1FVEB 1ZWIA 5D1QD 3SPVB 4W6XB 1AHWA 1IAKA 1AI1H 1MUJA 4O51A 5ICYA 1OGAD 4W4OA 3VJ6B 4E42A 4D0BB 3FO2B 4U6XB 4X4MA 1HZHL 1MCOH 2WLZA 1WAAF 4G42B 1FNFA 5FYJD 3SKOA 3ZSSA 3MLUL 3QNXA 1R5WB 3EJYD 2VLKE 3C5ZC 3OKDB 4ZO8A 3G04A 4QRPB 4UUJA 4JKLA 1JNJA 5DK3A 5DJ6A 1MCHA 4ZFZB 4JQXC 5IEKA 3BRDA 2ESVA 1BWMA 1FJ1A 4KJYA 1BJ1J 5I1DB 1U8OB 1AH1A 1IE5A 1V7NL 1UH4A 3RWJB 1CR9H 1BEYH 4WFGD 1ORQB 4S0SD 3LDBC 1WBXA 1UM6H 4XMLH 1T1WA 4XP5L 4YBQC 1J1PL 3U1SL 4JFPA 3BJLA 1Q0YL 4QKXB 4X4XB 1P1ZB 1VKXA 2F53D 1UM4L 2YZ1A 1F58L 1HINL 2BHZA 3WKNA 5ALBL 3M1BA 1YPZB 3ZE2F 2R0LL 2QV2A 2YR3A 2AXHA 3Q5YA 1A7RH 2DJ4A 3CVHB 1QSFE 3UXFA 5JW5A 3ARED 3EO9L 3SCMD 5GJSL 1PD6A 1NDGA 5KZCD 1MRFH 1JP5A 4QT5A 3NIGE 3BOVA 4K55A 1OWRM 4KDTC 1KPVB 2PO6B 1A14L 5CLTA 4CVUA 2AJVH 2OQJA 1FNHA 3IKKA 2HT4D 1T66D 3ZYIA 5KS9F 1YEFL 3FO1B 3MX0A 5D71L 1IEAB 4ZPVB 3BQUD 3IF1A 1PYWA 4PRBA 3NIFF 1X5GA 4MA3B 4PRIB 2BC4B 2EIDA 1FJ1B 2RQ8A 1T1YB 2GYSA 1T5WB 2UY6A 2IWGA 4QTIL 3LIZH 5HBBA 3BN9D 5DXWA 4CVXB 5GJTL 3L3KB 4Y4HD 1KB5L 5ADPL 5F7HA 2NZ9D 3VU2A 3T65A 1F8TL 1K5NA 1JZ3A 2IFGA 3PGFH 3WNMA 5DUBA 1KOAA 1NBYB 5F93C 4FQPA 4QHUA 3UC0L 2PO6C 3KVQA 1MJUH 2EDTA 1K8IA 3EDFA 5BRZD 3DX7B 4D94A 3S35H 1LE9B 1RK1B 3QUYA 4F80A 4GKNB 4JGJA 4NO5A 3R06A 5TDPB 4OZHB 1EHLH 3MOBL 3GMRA 4P9MH 3BGFB 4XC1L 4APQD 5GS1A 3MODH 4OCMC 5DA0B 3S4SG 2HTLD 4H8WC 2OM5A 1BFOB 3DIFB 3GMLA 4PRDB 3G6JE 1S7UA 4IMKC 1P4BH 4L4TA 2ILLA 2Q8AH 4KJWD 1U8QB 5TGBA 4H0IA 4EOWL 4LKCA 4LHUA 2GJ6D 3O8XA 5E5UB 5E70A 5EC2A 4U1IB 3HAEH 3H0TA 4HX1B 5I1EH 4YPJA 5BVPL 1UJ3A 1BM3H 1MCFA 4EDWL 5IGXH 4U1KB 5HY9B 4BM7A 5MP6H 5L9DL 2YUXA 1WZLA 4NQCD 1G7QA 5A1AA 5IKCB 5T3XD 1G84A 2EKSB 1KIRA 3N1QC 4HMCA 4M5ZH 3O41B 3HC0B 1V3JA 5F8RC 3TVMB 4Y1AA 4XRCA 1MLBA 1LO0L 1KB5A 2AEWA 1EBAA 4YHIB 3C60A 3T8XA 4RMQA 5C0EA 1FL3A 3H2WA 3SDXF 2EDQA 1T6WA 4GUPA 4R6UA 5TDOA 3K2UL 4B53A 1MCQA 2XZQL 3LPFA 4QYOB 3RPIA 3UTPE 2XTJE 3FHQA 1VGKB 3PWJB 3RL1B 1REIA 3EIFA 3DRQA 1RUQL 3CFDA 4JZJC 1EO8H 1OAQH 2N4IA 3BVNA 3D85B 3UJIL 4X6DF 5FYKL 3ARVA 1CD9B 1KEMH 1OD7A 2CXGA 2X4QA 1FNEA 3EOBA 1TTFA 4HQQH 1UB5B 4JM2C 1U3HC 2C3VB 4O4YH 1HSBB 1NCBL 1DQLL 3WXVH 4DKFL 3RZCA 4Q9QL 3C5SB 4XPHH 1JPST 1OTUC 1MCCA 1SJVA 1UXWA 2AJVL 3ZO0A 3BIKA 5EPMA 3WNKA 3WIHA 1EEZA 2P5WD 4XHJC 4JFFA 3WFDL 2NX5E 5DMKA 5D71H 5JIKA 3S96B 1HXYA 5BV7C 2ZG1A 3T0VA 4Q9QH 3MV8E 3CPLB 1X5YA 3DRTA 3GSQA 4UT6H 1QRKA 4XX1G 1RJLB 5JO5A 2O5YL 4EI5C 4L29B 2B2XH 4JFDB 1QA9A 4JDVA 5D7IB 1AD9B 2EKJA 2QQKH 3U9PL 4FFZL 1BQLL 1SJEA 1S7VA 3D3VB 5C8JA 1S8DA 1IMHC 4BH7B 1WCBA 3MUZ1 2MTPA 2R0KH 3WO4B 5DZLA 1OAZL 4F15B 3MRJA 2VLME 4IEFB 4PJIE 3B2UD 3FB5A 4LAQH 1KCSL 3IDIB 5DVMA 1BQLH 4G3YL 1T1YA 2BOCB 1CFQB 4I2XE 1KLGB 4WI5A 3SGEH 1ZHBA 4JFFE 2HTKD 3T65B 5KSAB 3RWEB 4U1GC 3LPGA 4EXKA 3HRPA 3D3VE 2FH6A 1F97A 1MI5B 2ED7A 2H3NB 2VLRE 4YBLB 4OF6A 2XKNB 3HZYB 4NC1E 3OAYK 5BS0D 4V2BA 1MREH 5KOVC 5IOPB 4EQ3A 1MAML 4PRIE 2DBLL 1QBLL 2Y4SA 3PDDA 1U2HA 2XXMB 2YD3A 4CJ0A 3QUYC 1JHLL 4ODVH 2RGSA 4BFIA 4FFVD 2IALA 5CUSH 3FQRB 3IAPA 2D7NA 3OSKA 2GJJA 5SWSD 2ZCKL 4OCLC 3WSQL 1Q9WA 4H25A 5HXMA 5D5MA 2EE6A 4AK1A 4FQIL 4D9QE 4OAWB 5B39A 3G6DH 1UACH 3NCBB 1Z3GL 3FFDA 2B0SL 3O2WL 4LGPB 4X99A 2W91A 3S98A 5F7EH 1I3GL 3T1WA 2XYCA 4IHOA 3S34H 2UYLA 3BWAB 4Y2DA 3GMMA 1KFAH 2ESVB 4OT1H 3KXFA 4JM2D 3V4PL 1DEEA 1YQ2A 3GKZA 1CYGA 1LO5A 2YA1A 4RFEA 4L5FH 4NSKA 5HGAA 5A2IH 1OCWH 4Y16C 5SWQB 1A21A 3TBTA 1AGCA 3LKPB 4N0UB 4OZGE 4JVWA 4EDWH 3LMJL 5J56B 1SYVB 3SE8L 1Y6KR 1IL1B 1S5IL 2XQYG 1BVZA 1UEMA 4AIXA 4FQ2L 5BW7C 4I0PA 5LVEA 4M5ZL 2XWTB 4L3ED 1EDQA 3RWCA 3IU4L 1U8PB 4NZUL 4F7TB 4U0QB 4KK5C 2DL2A 5I75B 3TA3C 5D93C 3CMOH 3P4MB 1T20A 2R1YA 1NANI 2VN4A 4MD5B 4P4RA 5DQJA 4GAGL 2O61A 2HFFA 4TTDC 4EOWH 4NJ9H 2VXVH 1FNSL 3GEWB 5F7KC 2YKLL 4PGBB 2NY5C 1IGJA 3QA3A 3PABA 4PY7A 4BKLA 4LFHG 4PJAB 5IHZB 3GBMH 4OZFH 4TPRH 4XH2B 5B3NA 2WAHA 3T4AA 3JUZA 4M7ZB 3QDJD 5CWSA 1RUPL 3G5XA 3BT2H 4LL9A 2G75B 4QCIA 2HMID 4XTRD 4HUMB 2IQAA 5I8CA 3PG2A 2P45B 5D1XD 1S9VB 3AMKA 3SO3C 4HMDA 2HTLC 2W0FB 2ZUQC 4HPYH 2JCCE 4UINL 4X98B 4Z7VF 3LIZL 1WIUA 1PZUB 4DWHA 4YXLH 2DI9A 5DDHB 4JREB 3U9UA 1SYVA 4JRWA 2LVCA 2GUOB 5JHDB 4R90L 4U7SA 4IM8A 1EHXA 3QXWA 5T1KA 1JRHI 4ZFGH 4UTAH 2XWBB 2A83A 4Y5YA 2XN9D 5DJAB 1BX2B 3L5WA 2DQDH 5IFAL 3VFPA 3FFCD 4I4WA 2EIZB 4KMTL 3LSOB 5F70A 3CU1A 4P4RB 4YHOL 4KRMB 1CE1L 2APVA 2F53A 3PV6B 4M1CC 1E6JL 5JDJA 4Q58C 5I18H 1HK6A 4DN3L 4PIRF 4XP4H 2QHRH 4GBXC 3ARDC 3K4ZA 2F9BT 5H37G 1TJIL 3O0RL 1SHMA 3WIIH 2Z8SA 1BVLB 1C7SA 4NC2B 2WIMA 2NY6D 3ES6B 1IC7L 1G6RB 3QPXL 5DMJB 1QYGH 5IVXA 5EOTB 2X4OA 5EIIB 3SCMC 3U6RA 2DRUA 4O9HL 4P5TC 4BFEA 3AXLA 4QNPF 3N9GH 5CMAB 4MX7A 4F58H 1A8JH 1VFAB 2NY2D 3Q2CA 1X5KA 4YXKL 4NKIL 1RJYA 4JHAH 4OJFH 2CDFB 4XVSL 5DWUH 1IZJA 3DX6B 4U1HB 3I6LD 5BO1L 1XF5B 4PLKD 1E0OB 1A4JA 1ZHKB 5D4QA 2F74B 5D1QA 4Z7VA 4WV1A 2EYTB 3PL6A 2GIYA 4WFHE 5F88B 3P4LA 1DN2A 3OKEB 4TTDD 1RURH 4JVUA 4M9PA 3PP3H 1ERNA 1UYWL 1A3LH 3WS3B 4M6AA 1SJEB 3GMPA 3ULUE 3AAZA 4G9FE 3V7MA 4O00A 4YDVB 1EERB 5GS0D 5FYKD 5DJ0B 3MGTA 1CICA 2J12B 1XGPA 3GSQB 4FQXC 5CEZL 1Q0XL 3OBAA 5J4MA 2IANB 3PJSB 1YEHL 1GGIH 4P5TA 1NLDH 1OGAA 5IW3A 1G9MC 2R0ZL 3INUH 4WO4C 1OVZA 4DZBB 3VFNA 3GM0A 3RY4A 5FYJH 1UQSB 4NRYA 2Z91A 4YJZL 4WTZG 4X6EB 1II4E 4XMKL 5I1KL 3K8KA 4A6YB 5TDNA 1MEXL 2MCPL 4NZTH 5E99L 3DUUA 4KPHH 1DL7H 3MR9B 1QRNE 2KL6A 1AHWB 4WUKL 2NNAA 5E8OA 3IXAB 4XI5C 4I0KA 1JMXA 2I26N 3MNZB 5E08L 4KHXH 3VFPB 4IDJL 1MVUA 1QA9B 3GJFK 3GK8H 3ZSTA 3X11A 3BRGC 4Z76B 3KPSE 4H8WH 3MJGX 5DK0B 3RAJL 3I3EA 4YHPB 2F8XC 4X6DE 1A6WH 1FYTB 4HS3A 2NY1C 1XT5A 4R2GD 4ZOCA 1IGJB 5INDB 2IPKB 5HDQH 1JV5A 2VXTH 1DBML 3ARDB 4LEOA 5L6YH 4Y5YB 4P2QA 5MI0C 2VDKL 2D4FA 5SWZA 2EZ0D 1SMOA 3BX7C 3CZJA 5J3HC 2UWEA 3G6AB 3W39A 3RKPA 1OW0A 4HEME 4XCFH 3ARFC 4ONOA 2WUCL 3SDXE 3VDCA 2H32H 2XV6B 4LSVL 5JIHA 1YEDB 4P3WA 2JKXA 2O5ZH 4X98A 2BFVH 1A6AB 5F9WB 3PQYD 3QZWB 4L4VB 3I6GA 5E0QA 4R26L 4E5XA 5E2WL 3VXOB 1NAKH 3DRQB 4HS3B 4Y8DC 4QRTA 1M7IA 4KC3B 1HYSD 4NKDB 3QXTA 2D7PA 3QEGH 4MVBD 2BSRA 2GW5A 2ZUQB 3NH7L 1FG2A 1ZTXH 1VGEH 1IKNC 2AQ2A 3QIBD 5E94A 1S78C 1K2DB 4PLJC 1IL1A 1BFVL 3ARQA 5D1ZC 1NFKA 3U4AA 1IZKA 3V5KB 5CSZA 3WLBB 2BNQA 5JXAH 2GJ6B 2NNAB 4JFXA 3VXUD 1QSFA 1IAIL 3H9SE 4S1RH 4J23A 1Z5LB 2Y1VA 2JIXD 1LD9B 5F9OH 5ABDE 1RZIB 2AP2A 4HGWA 4R0LA 4OGYL 1JZ7A 2CK0L 2P1YA 3O4LB 4MA3A 3I3BA 4XNZC 1UCTA 3M17B 4JCLA 3TA3B 5TQ0H 3LOWA 4XP9H 2RBLA 1C12A 4NPYB 5E2UH 4YX2L 1QLFB 4P48A 2ZUVA 4OB5H 3EDJA 4ODTL 2VDLL 4I3RL 1KPRB 1QRNA 3GMRB 1Z0MA 4MHHI 4O2CA 4H0HB 3QWOB 4MCZA 4Z7UB 5IQ7L 1MF2L 1KF9B 4IIQB 5DC4B 2A77L 1T04B 3H9ZA 3KPRB 4RISL 4EI6A 2FH8A 4HJ0D 4QHUB 1X5XA 5E2JA 4H0GA 4PJEB 3OKEA 1IVLA 3G5YB 1Q9OA 4LPTA 3B3IA 1NMAH 5BOPA 3S37L 4LRIC 1QACA 4QHLA 2SEBA 1K4CB 2NY6C 1FYTD 1S7QB 3ARTA 1OL0A 3NN8B 4UT6L 1QLEL 4PJ5E 4XNYH 2FBJH 3OAYH 3OR6B 2AABL 4JFHE 1EGJH 5KVEL 2AJZB 2IANE 4PREB 1FP5A 2M8XA 3EOAA 2ATPA 3VFMB 2F19L 3NIDE 1AI1L 4JDZB 1U36A 1WFOA 4XC1H 2NW2A 3MRLA 3VXSA 4DN4L 1I3RA 1IFHH 1B6UA 5GPRA 3L9RA 4FQJL 4MNGE 4JFXB 1N0XH 1U2CA 5EPMB 5C92A 3LN5A 4KDWA 4RFOL 3MA7A 3DX8B 5LBSL 4C83A 3SJVA 3SBWC 2K9UA 3CH8A 4LSUH 4JKKA 3KPRA 5T3ZE 3EJZD 1KCRL 4X8XA 3H7LA 1YEEL 4NQCA 2Z31A 4EVNA 1YEJL 2VDQL 2VL5B 2AJUL 1FPTH 3VD3A 1IQDB 3PV7A 4MJ2A 5D7IA 3HE6A 5F7MC 4OLYH 4ZDHA 3TCLA 1BLNB 1FCGA 1TETH 1MI5D 2C26A 1JPSL 1UJ3C 3SGKA 2ATKB 3VGBA 3QXDB 1RULH 5KSUA 3AVEA 2ADFH 1J0JA 4K94C 3L5HA 4G7YL 4DVRL 2Y5EA 4F15C 2XT1B 3IFOA 2VDPL 1EH9A 1P84J 1S9XA 2Z92A 1ACZA 4KFZC 1KV3A 2JK5A 3LEVH 5EN2B 1EGJA 3UBXI 4P23B 4RAVB 2XZAL 3O41A 4KXZI 2BHUA 2P4AB 4NP4L 3OB0H 2X10A 2ADJB 1HDMA 2DYPB 2LTQC 2Z93A 4XVTH 3MRGB 3WIHH 2W9EH 3AUVA 3DVFA 3QRGL 3RNKA 4HIXL 5D70L 4YBHA 4D9RE 4ZOEA 5C9JA 1Q94A 2AI0H 4LOUC 4QHMB 5BV7B 4X9BA 2VLLB 3OMZA 4D8PB 3BZEB 2P24B 3VW3L 3SDDD 1KG0A 4LAQL 1BQHB 5FHBL 1WIPA 1BVKA 1BHGA 1KULA 1AIFA 3T3ME 2YD7A 3KPRD 4L4TB 3ARFA 5F8QC 3QIBA 1MRCL 3SJVD 4Y16B 1RUPH 2FL5B 2NQCA 4ZOAA 4LCYA 5BMFH 5JPMA 2VDOH 4M7LH 1GYAA 4Z0BL 3Q6FB 5IM7B 1A5FH 2G9HB 5JW4N 2CJUL 3ZL4L 1JWUB 1CFNA 2GKIA 4PB9L 3QFJB 3GJFA 4ELME 2BP3A 3T0DA 5IMOB 3SQOL 3VWKD 5JHDE 4MJ4A 3TBWA 3DX9B 3DO7A 4F3FA 4DZBA 1LWRA 3CMGA 4HWZB 1EGJL 5HYIA 4X6CB 5GGRY 3UYRH 4S1DC 3EYUL 3SN6N 3OKMA 3GSNL 3K8MA 1RK1A 3QUYB 5C0JA 2YZ8A 4F37K 2DOCA 4P5KA 2QLVB 1T2QH 2BY1A 2VL4A 5FKAB 5AZEH 1HHKA 3FN0H 3WXWL 4E0RB 5BRZB 1N8ZB 4PD4K 1K5NB 3C6SB 1GZQB 2LE9A 4KK9D 1CLOH 1RIVH 1LK2A 4X7EC 1JNNH 1ORSA 4M3KB 3OKOA 2APBA 4DUWA 1G1YA 4LIQL 4U1GB 1K4DA 4XMLL 2VZ3A 1A9EB 3QI9A 3QUXD 5I73B 3DVNA 3O2VL 3VG9C 5BJTA 1VESA 1KB5H 5ADPH 4OZGB 5GGVY 1MCRA 5DHVH 5C0RH 5E5MA 3IDUA 4X80H 2D7TH 2ICWI 3BEVA 3H42H 3TN0B 5I71B 3FOMA 1DBJL 3CMOL 4MX7B 2QJDA 1TNMA 4BA8A 2NXZC 4XBPA 3EYUH 4NQTA 4B0MM 2ADGA 4H1LH 3KPNA 3Q48A 1RURL 4XAKD 5J06A 5HVGB 3RUGB 2FWOB 1W72A 2I9LA 4HKJB 4A6YL 3FN3A 4MQ7B 1ZTXL 3BE1L 5E4EC 2C7UB 2BOCA 1HHKB 3V7AG 5I0DA 3ARBB 1X4XA 5EU6D 2CJUH 4HIIB 3ZL4H 2VRAA 4PS4H 2P5EA 1XR8B 4PJ7B 2F58H 5BS0B 2W65B 4OLUL 2AXGB 3GHBH 4FXKA 1WCBB 3O6ML 43C9B 4B41A 1WAAA 4TVSa 5LKNA 1NLDL 1DLFH 1C12B 3EOTH 3QNYA 4NPYA 2F58L 3QSKB 4TUOB 1H15B 4X7SL 2J8UA 1VA9A 2XWBA 5I1DA 1KIPA 4WO4D 3V95A 2X4SB 1EXUA 5DEGB 3H9HA 1JE6A 3HI6L 4NP4H 5FF6A 1M7DA 2Z4QA 2ED9A 1U92B 3IS1X 4EIGB 3FN9A 1U8HB 3BKMH 5FUOL 5ICYB 2QQLH 4HIXH 5IBUG 3CFKA 4RGOL 2KZ1B 4XPTH 5TH2B 4S2SB 5JIIA 4KTYA 3BW9A 1I8KA 3CH1B 2G2RB 2G9HA 1JYXA 4UIMB 3REVA 3OL2A 5I6XB 5GGTH 5LWYH 2BNRA 1AY1H 5EOCH 4Z6AT 2R15A 4OM1H 3QA3B 4BKLB 4JKPL 3F58H 1EEQA 2HLAA 3I50L 4GQ9H 3D39B 4O4YL 1DQDL 2VC2L 3HS0A 1R3JB 2ITCA 3BPLC 5E2VH 2EH8L 4JN2A 5DK0A 1X4YA 3HUJA 2CIKA 2GITB 3SKMB 4KJWC 2AJSH 3BZFA 1FFOB 3OAUH 5FM5M 4YX2H 4JDTL 3BZEA 2R56L 4L9DA 1DVFD 3MLWH 3OG4B 3IDGA 5IG7B 3ZE2E 4P5TD 4BFBD 4PJBB 3EAKA 1CBVL 2E7MA 1BBJB 1I9RL 1NCAH 3LH2H 4FQJH 4XP4L 1CICD 5FA3B 2FLRT 3FT3B 4CU6A 5TH2A 4MDIB 3GSRA 4F37F 5DD3H 3VFNB 2ZCLL 3HC4L 3UP1A 3MNWA 2VLJD 5FO7A 5L9DH 1GHFL 2ERJB 2KH2B 5DURB 5DJZA 1DBBL 5EA0H 3KYMA 4G8EB 2BX5A 3IB4A 2FHBA 5CCKL 1RZ8A 3ARXA 1G9MH 4UIMA 2I9TB 3ILQD 3Q5OA 5E8NA 3MGTB 3DIFA 2ZCLH 4YIQB 2R9HC 4E41E 1C5DB 5GZOC 3LEYL 4FQ2H 2R0LH 4NQSB 4ZTPH 3CVHH 2DM3A 1FNGA 4HS6A 2KBGA 3ZKND 2D9CA 2PXYB 4LRIA 3DWTA 4HCRA 3W9EA 3RFZC 1B0RB 2IAMB 2R1XA 5IQ9A 2H26B 1RQ5A 1JBJA 3F7QA 3JWOL 3NABL 3RZWA 4A6YA 4AMKL 2R56H 3KPNB 4FZEL 5DGQA 1P53A 4HZAA 1UEYA 4MJ6A 3BDBA 4Z7WE 3PNWA 3NACH 4LSUL 4TUOA 2I9LB 4HKJA 4UT9H 3FQWB 3TC9A 5FKPA 5B3JE 3VA2C 4CVXA 3BD3A 4J3XA 1F3DJ 1DEEB 4AEFA 1NJ9B 1J87A 1TMCB 1A7PH 3UPAA 1LP9B 4PREA 3LDBB 3QDMD 4OZFA 1VFAA 5DJ2B 1LO2H 4HFUL 4NHCL 5ICXA 1XF3A 5T1LD 2BVQA 2UUDH 4F8QA 1ZA6A 4HGKC 1FZMA 2VXUL 2JTDA 5GGRB 1CXKA 1EAPA 4S1QL 1YEFH 1KJVA 3KWWA 1TVBA 1N59A 3S3PA 3G9VA 2HFEA 5ITBL 1D6VH 3W0WB 1YEGH 1JPGB 3STLA 3C2AH 4Y4KB 3DV6B 2XN9A 1FBIH 4L8SA 1CBVH 1FZKB 1VADB 3PWPB 4GKZA 1A2YB 4PJEF 1A0QH 4V2CB 4ZAKA 3R1GL 4M6OL 3WS6C 1T3FB 2OR7A 1RJYB 4JFDD 4JFQA 4DCQA 1XR9A 1MCBA 3E3QE 3ZTNH 5GS1C 3E6HA 2AJYH 2C3WA 3MV8D 4NGHH 1BPVA 4I0PD 4NJAL 3RUGF 3MLVL 4L1HA 1AO7D 4WFHD 1AO7E 4JO1H 4G5ZH 4JHZA 3ARUA 4UBDC 5DEFB 1PJ9A 4C54A 1FDLL 3KPSA 1ZGLA 5FECB 3MCLH 5DHYA 1RHFA 5LWYL 1K6QL 2XA8H 1A64A 1F6AA 3BP7B 4M4PA 4IMLA 1GGYA 3SDCA 2VYRE 1DQDH 4M62H 1PGRB 4XPAL 5I66B 3AY4C 2A74B 4KVCL 3PWJA 3RL1A 4CVWA 2A1WH 2P8MB 4NWTL 2WIIA 3P0VH 1E27A 5D7IE 3CPLA 1BQHA 3ARRA 4N5EC 3GNMH 1J8HA 2H1PH 3LB6D 3WFHA 3SQBA 5C0EB 2V5MA 2QSTA 2A1WL 4NWTH 1HXMA 4ZUSA 2PNDA 3SKNB 1UXWB 5SWSB 3GBNL 2VWEE 3REVB 4Y4FB 5IB5B 5I8OH 4KI5C 3SE9L 4HHAB 5I17A 1GRWA 5A3IC 3VXRD 1EZVX 2EDJA 3UBXB 1CXIA 3FT4A 4NGHL 4K3DL 4XXCA 5I30L 4G3YH 1OT2A 4AL8H 4NZDA 4PJ5D 1X7QB 3LKNA 2P5WA 1CGUA 2HN7B 1TITA 5F7EL 3MRPB 1HDMB 2DYPA 3KJ4C 2R1WA 4X9FA 2P46B 4G43A 2HH0H 1AD0A 4OZIE 5HYSG 2O5YH 3PWUA 4TNWF 2AGJL 4ODWA 1E4XH 4R4ND 4U1NA 3I75A 3IXTA 4GS7C 3IJYB 4H20H 2AXGA 3CXHJ 3OZ9L 3P4MA 3PQYB 4L4VD 1XR8A 4Z7NF 3LKSA 4UU9A 4U3HA 4YNYB 1FFPA 4BSJA 1KN4L 5GRJL 5AUMB 4J3VA 1WBZA 1IQDA 1YEGL 3K4AA 4QLRA 4EVNB 4MNQB 1PDKA 1NUNB 4ELMB 4GKNA 1Q9KA 3CFCH 3Q1SL 4JJ5A 2ADIB 3HMWH 4PJGB 2H9GB 3G5ZB 1NCDH 3MCLL 1OB1A 3QIWA 2JJWA 4LCWA 1DCLA 4UINH 4G6KH 3ARYA 3B9KB 3HB3C 5E00B 2HT2C 3QI9C 4ODSL 2IAMC 2OZ4L 1A3QA 1H8NA 1OGAB 4NJAH 1IC4L 1RHHA 4YLQT 2E7CA 1FGNH 1KXQE 1IGFH 4NNXA 4YE4H 4CDGC 3VFGL 2VZVA 5I1HL 2RHEA 3DVNB 3GO1L 5MENB 1NFIB 1DVFB 2NW3B 2DN7A 5DVKA 2GJZB 5EO9A 3QP3A 2DMKA 4POZD 1JGEB 1QVOA 3ZE0E 5B38B 5DFVD 2GAZA 5ISZB 1BJ8A 5IVZA 3BDYL 3H8NA 5K59E 3HNVL 1LVEA 1T5XB 4LPWA 3CDGA 1S9YA 4GMTH 3FQRA 2A38A 2JCCF 2ICWA 1UCBH 2AVGA 2I5YL 2GFBB 5HYJD 5F44A 2FEEI 2VLJB 2BVQB 1OW0C 4KI1A 1S7RB 3T4YB 3FFCB 2BOBB 5EU7C 4FG6D 2FR4B 4AEEA 4TUKH 3TA3A 3UTZB 3P9LB 4ALAH 2WK2A 1YZZA 3RVXC 1LO3H 1V8HA 4M1CD 1GC1L 3NTCL 3MO1A 1QQDA 3F6IA 5DD3L 3GHEH 1RFDL 3B8SA 4JKWA 1AGEB 4IS6A 4NQCE 4XWGL 2AEPH 5CGYD 3ZYZA 5FGCB 5HHOA 3DX9A 3DO7B 3G5YA 1KLGA 2X4OB 5EIIA 4LSRL 1KCKA 1N3NA 3I6KA 2R0ZH 1AFVH 2DMBA 4L4TE 4PJCA 2OJZL 4CN4A 1ZVSA 1WVZA 4I3GA 5BS0E 1OP9A 2A9MH 1FAIH 1RUKL 3E8UL 2AK1H 4PRID 3S3SA 1GPOL 4WCYL 2OK0H 1CTOA 1I8LC 3RQ3A 4NQDB 2A83B 2X41A 1NLBL 2BVOB 3MA9H 4YHKH 4HXAL 5D7JD 2VZUA 1YNKL 3TP4A 4G8GE 2PYFB 4PB0H 4OCWL 4ZXBC 5MHSE 3PE9A 4X6CA 5KW9H 5I1CL 3QYCA 1FL3B 1ITCA 2YPVH 3OKDA 5C3LD 5TQ2L 1A4KB 1HOCA 5AG8A 4LPXA 4P3DA 3QUZB 4FP8L 3KXFE 4LDLB 4HF5L 2Y25A 2FX9H 4UQ2A 2EIBA 3TT3H 5IKCA 1DQLH 2VAAA 5IG7A 5JLZB 1FO0L 2WP3T 4W6YB 4ZNEE 3EYVB 1AQDA 5DJ8A 1XIWD 2VLJA 1OTTD 1J0YA 5D8JH 1CFSB 4POZC 2V2TA 3VRIB 5HI3C 1XGRB 3VDBA 3HMXH 4EJ1C 1SY6A 5GGQL 1NGWA 1WFUA 1GGBH 2A6IB 4K2UL 1T2JA 3BPNC 5ICZA 1KBGH 3IDYC 2YUWA 2EDWA 3OHXA 3U9PH 3HZMA 1XF1A 2Y6SC 5L0QC 3D69A 2VZOA 3RWCB 1LO3L 5C0CB 1CU4L 2NXYD 3HB3D 4HZLA 1NGPH 1CXEA 1RJZB 3GKWL 1HCFX 3CD4A 5H8DA 1SJXA 3WN5B 4EUPB 1J5OH 3HC3H 1P4IL 2V7HB 4K23H 5GGTL 1GXEA 1U91B 1VDGA 4O2FB 2QQNH 4PP2A 4W70A 1DUYB 2ZWLT 1NBZA 4YXHH 2CRZA 1I3RB 1U9KA 3V9FA 4L3AA 2E5EA 3KXFB 3GSOA 2XACC 1E28B 1QR4A 1EXUB 4UB0L 4M5YH 1RULL 1UXSA 1YNLH 1L6ZA 1BFOA 3VXUE 4NSKB 4ZTOH 5HGAB 4YHNB 3OB8A 3UJJH 3WKML 1F90H 1I7UB 4RIRA 4ZO9A 2D2OA 2VL5A 4AH2A 1AGDB 2FEDC 4MXVF 4U49A 4UNTA 1YMHA 5FV2A 3R06B 1CDIA 5EO1A 3VXTB 1YUHA 3G5VB 2KDGA 5TQ0L 4JZJA 1S9WB 1VEOA 1W0VA 3QCUH 1AFVL 5D9SB 4U1SB 3PWUB 2OR9H 4C83B 4K7PY 1FQ9C 2V2WB 2O5ZL 2RJMA 5DRXB 3JTTA 1KIUA 1NC4A 3IDJA 5EO0A 5EC1A 4APQB 5DUBB 2A73B 4HJJL 5EWIH 5DHXB 1QNZH 2EDLA 3ZHKA 5IR1A 3MNVB 3V0WL 4DTGH 3MQIA 1DBAL 4JFPB 1QKZH 4X4XA 4AM0B 3QIWC 5F21B 5KVDL 1BM3L 3D25B 5E8EA 4WHTA 3ULVD 1NL0H 5BVJB 5I1AA 4F2MB 5C0GB 2XY2A 3DROA 4XPHL 5MEPA 3U0WH 3B5HA 3FONB 3ZDXF 4MA1C 5DQ9B 2X4UB 2PTVA 2VOTA 3MXWH 3RDTC 3VCLB 5EBMB 1XGQB 5D2NE 4GG6A 1U8NB 1UH2A 4FQQA 3VWJC 4BK5A 4G7VL 3U6RB 4HPOH 2AJXH 2H41A 3VI3E 1TQCB 5JIPA 5CSZB 4LDOB 1UZ8B 3DXAB 5K59F 5IBTL 3W9DA 3QJHA 4M48L 3CNKA 4LSSL 4Z7UA 5C3TA 1XF4A 3S97C 1YQVH 1KFAL 5ACZB 4TTGA 2EIZA 1JTPA 1HKFA 5T1DH 3CFIC 2MOVA 5FYLD 3ZKNC 3NPZB 4G8IA 4WI2A 2AEPL 2GTZB 4F7CB 4GOSA 1IQWL 3EUUA 1TJGL 3UJTH 1G7HB 1I1FB 2EIEA 2XWJB 4OGAD 3C5SA 4IOIB 1SVZA 3WUWB 2X7LB 5IEHA 3FOLB 1P2CB 1MJJA 4G9FD 5DRZB 3UCRA 5J11C 5D7SH 1BMGA 3OPZL 1ZLVK 4H8WL 3OX8A 3R4DA 2Q86B 3WLBA 1CDUA 3IKCB 1CTNA 5IGXL 3RVVC 4UZGA 4DGIH 1BFSA 3WDHA 1MRDL 3X3GL 3MA9L 4YHKL 1R5VB 3B9DA 4OGXL 3EFDH 1RSFA 3KYOB 4JRYB 5C0RL 3LQAH 1X3DA 1F13A 1JWMA 4LGSB 3NFSL 3W11C 3QEUB 4Y4KD 3MACH 3TNMB 2DI8A 1HSAA 2GITA 3C8KB 1I9RH 1T0NA 4X5LA 3ULUF 1UM5H 3MLVH 4WUKH 4MXVE 2OL3L 1J8HE 4FTVE 1INQA 3F7PC 4D0CB 3MFFB 1VHPA 4GG6F 2R1YB 3LS4L 4F9LA 1IGCL 2HVJB 2IADB 5EBMA 1VENA 3T77B 1HWHB 4LSQL 4GW5A 3NAAL 4XP1L 5EBWA 3O3BB 3FB6A 3QUXB 1NBQA 4KKLC 5DJCA 5E8OB 1NGZB 2Z31C 3G08B 5I8EA 4BQ9A 3UTTE 5EC2B 3WIIL 4LKCB 4QWWD 3DI3B 1I8KB 4MZ3A 4MNHB 1Q1JH 1N26A 3NCYS 4Q2ZB 3OX8B 1MFCL 3RWDB 2EDBA 3LY6A 3TJHC 1O0VA 1L7IL 3DGCR 2HFGH 3ZMRA 3TBYA 4LNVA 1UCBL 4OBRA 2EE2A 2NLJA 5TJWK 3ARGA 5AEAA 1QO3B 4PJFA 2DQIL 3ET9F 1UB6A 1TZHA 4JY4A 5I2IB 4OF0A 1IGYA 4LPYA 5BZWA 4JFEA 3GK8L 4DK6A 2XTLA 4UILH 5CEXA 3PIQB 4P2CG 3MV7D 3ZHDA 2B1HH 5DC9B 1CF8H 3O6LL 1QHOA 3GMMB 4I18C 4X80L 5HD8C 3W0WA 3WMSA 1CDYA 3PWNA 1IM9A 3L3DA 3NCJL 5JOPD 1HILA 3GRWA 5F3BA 4HS8L 3SDAB 4YHNA 1NFDE 1LDSA 3O4OB 4OV5B 3GI8L 3U0PA 5K9QI 4QHKI 1MCJA 4FQQB 4ZPTA 1D9KC 3CVIL 2Z31D 1XGQA 5LCVL 2XG5A 4F58L 1FFNB 2CDGB 2FD6L 1IBGL 3QG7L 1FLTX 5C07E 4XTRC 5DJDB 5CEZH 2BCKA 3GUTA 3ULVL 2VLKA 4ONGL 5IB2A 1LK3L 4QTHB 3T77A 1JYWA 1D5ZA 5I1IL 5AAWA 2QQKL 3MZGB 1AKJA 4Y8AA 4HK0B 4N0FB 4WWID 1AXIB 2R2EB 1Q72H 1A6TB 1LE5B 5AD0A 3FCTB 4EI5B 1M4KA 5I1CH 2DAVA 1DDHA 3W9EB 4JRYD 2MFNA 3OGOE 5LXGH 3TZVA 4PG2A 4CAGA 1KNOB 1I1RA 5C0AD 5ITFA 1E4XI 4JG1H 3LKRB 2UVEA 3EO9H 1F11B 1W8OA 1OAQL 5EU5A 2E3VA 4Y2DD 5HHVL 4NKOA 5DJYB 4MAYB 2Q86A 4I1NB 1XCQA 5BRZA 3A6BL 3OJ2C 2F5BH 5T1LB 4I4WB 5FGSA 5HHXH 1IGCH 4KRPB 4KKCD 4YXLL 4M6NL 1YA5A 4QRPA 3D3VD 5DEFA 3D2UB 5L2KB 3V4UL 2X4PA 5FK9A 3WFBL 4RAUA 2NR6C 5IEKB 1GOHA 2AXFA 5FOBA 3MLYL 3W0WD 1B4RA 4Y5YC 3L3HB 5ENWB 2H9GA 3AS1A 2DWEB 2H8PB 4GQ9L 1U8KA 2MKWA 5TF1L 3MRKB 3B9AA 1D6EB 4QF1A 3IDGB 3EFDL 1TCRA 2ZCHL 4C56A 3N0PB 2AI0L 3F65A 3KPMA 5DJYA 5DURD 1YC7A 5E2TH 4KQ4L 1JZ5A 3UDWC 1U93B 4GKZB 1HSBA 5FOJA 5BS0A 3EBAA 5DD0H 1DSFL 1FZKA 2X1OA 2VDRL 4ZFOB 1YN7B 5F1NA 3U4BH 1UADC 3RDTD 4LLMB 5D2LA 5JMRA 3UZVB 3VFUA 2C4FT 4FA8A 5IW6B 1SQ2N 1KJMA 3BVNB 2XKSA 1IM3A 4L8DA 1EJOH 1PG7H 1KCLA 3HRZB 1ACYL 4NOBA 2DQHH 2R2EA 1VFUA 4NBXB 2FEEL 3DMMA 4Z7OF 1OGAE 4XBPB 1YYLL 2H2PC 3EYQD 3G6JB 1BIHA 2X6MA 2HN7A 1CFSA 3T0EB 1T1ZA 2W0FA 4HWNA 2BDNH 4HUVB 3UMTA 2XG4A 1IKFH 4AM0A 1FAIL 1JWSB 1RUKH 3E8UH 5GIRB 4YZFF 4OFVA 4LHQB 1RIHL 3M07A 5MENE 4PS4L 1DEDA 2VITB 4LASL 1CR9L 4LOUD 4PTTB 4YFEA 1ZVHA 5F96H 1RZJC 3BIAX 5KN5B 3BD5A 3H9HB 3W39B 4WI3A 4G7VH 5F9JA 4X5WB 2BRRL 2X4SA 3BP4B 3O6MH 1S7UB 3GMNA 4K94L 5EU6E 1WAAE 4F7PA 4NO3A 3WFHB 5DUPL 5JPNB 4QOKB 5HHVH 3CFJB 2RFXB 1KELH 3O6KL 3G6DL 2P44B 3EO1B 4D9RD 3HAEB 5C09D 5E24E 4IRSD 1DVFA 1TPXB 4ETQA 4ZDHB 5I66A 4I2XA 4NKMA 4WUUB 3ETBF 3LPWA 5EIQA 1XZ0A 4L3EB 4X99B 5JZ7D 5LXGL 1UWGH 4MJID 4XHJD 4NRXA 2EXWD 3ME0A 2Y7QB 5JQ6H 4F7PB 2IAND 4LLDB 1RY7B 3EJZC 1UQSA 5L8KB 1K3ZA 2IH3A 4LVHC 5C0IB 2A6KB 4PGDB 3R0MA 3L3OB 4C59B 3QG6A 1XR9B 2VABA 3JWOH 4AMKH 1JL8A 2IPUK 3IVKA 4S1SH 4KZDH 5J6GB 3BPOB 5IQ7H 3BO8A 1UKTA 2FX8H 4POUB 1R3LB 3HUJE 4H5SB 4GW5B 5EBWB 3UX9B 5F7DA 1EFXA 2GT9B 5ERWA 4ZXBB 4DN3H 4GG8A 2CMRL 2DQHL 3NCFB 4OCRH 3BE1H 4R8WL 4F7EB 5EZIH 3RWFA 3TNMA 1T0MA 3HFMH 3FZUD 3CFEB 4MD0B 5AYUL 1VPOH 1MFDL 4HBQA 1O7VA 1TZGL 2J6EA 5CJQH 1D5IL 2BVPA 3BEWA 2V7NB 4MNGA 4JRXD 3HR5B 5JO5B 4EDXB 1RJLA 1DBBH 4BZ2L 1MLCB 3CSGA 3PWLB 5D96B 5JA8B 4O2EB 5A43C 4OQTH 3KNBA 1RUQH 3NA4A 4UUJB 2P7TB 1F2QA 3EO0B 3QNZA 4MLIA 5D72H 5EORL 4TSAH 1IKFL 1PX3A 1YPZA 3HRZA 2ZJSH 2NY6B 4P2RE 1ZT7A 3JWNC 3ZTNL 4FTVA 2DQFB 3CLEL 4M48H 4CADA 3W2DH 4OZGF 1N6VA 3VMPA 4MA8H 1E4JA 2ARJQ 5DRNB 3DXAE 2XZQH 2Z31B 3AM8A 1IILE 1ORQA 4RMVA 1GIGL 1ES0A 3F58L 4GW4B 4TULH 3NCJH 3DMMC 2H6PB 4YHYB 2IBGA 5DQDL 5E8DL 4WU7B 2E7LA 2P8LB 5CIPB 1NCWL 4FQ1L 4QHNB 1KXTB 4AIZB 2EH8H 4IIQC 4XNMA 1CFTB 3VXPB 4KUZH 4Y5VB 3HR6A 4ORZC 2YD1A 5INCB 1G7IA 1KNOA 4HXBL 1R3IH 2ZPKH 1VEPA 4ODWB 1D5IH 1QHPA 3BKYL 2FB4L 1KPUB 2IF7A 4XPAH 4YDKL 4YZFE 5D7SL 3CUPA 5HGDB 3PXHA 4N0RA 4XRCB 4PRHE 5FA3A 4G43B 5DI8A 5JXED 4LFHD 4PJFE 3UTZA 2ADJA 4ONHA 1NEZB 5DD0L 2ZG2A 3MJ6A 5J7CC 2Q8AL 4JHAL 2YSSA 1DJSA 4IRSA 1VERA 2HG5A 5D7JB 1M6OB 3GFUA 3IFOB 2PTTA 3CFDB 2YD5A 3I2CH 4NHUA 3RTQD 3TH2T 1P6FA 3J8F7 1G0DA 1ZHLB 2Q3AA 4KRPD 4PUBL 3GMLB 4LLDA 5TDOB 4Z77A 4YBQD 1OAUL 3QUZD 1J8HB 3V8OA 1DDHB 3Q3GB 5HGBB 4IMKA 2YRZA 1ODAA 5D6DC 3MLRL 4M43H 3RJQB 2X4TB 3PGDB 1RJCA 2DMCA 1F00I 1ZT4A 5FV1L 4FOMA 5EU7E 5FCUH 4B7LA 5C1MB 2XQYK 2GY5A 3GDBA 4QXWA 1CL7I 1R3LA 4TNWK 4OGXH 3TT1L 2CUHA 4G9FB 1LQSR 4P2OB 5IMLB 1FL5A 3TJEH 3VWJB 2J88L 2VH5H 2OTUA 4H1LA 3T2PA 4LNRA 5E5RB 4KROC 4ZPTB 5C0IA 4N8PA 1U8IB 4ODXA 3BPOC 1ONQB 1D3CA 3X14A 3SHSA 1H15A 1YPZE 3QO0A 3IFPA 4N1CA 4PRAB 5T3XH 3GSXB 1HILB 3VD9A 2MPAH 3PWNB 3X12B 2NY1B 2ORBL 3JV6A 4QXTA 2ITDB 1XGPB 3QFJD 1MFNA 2EXYD 3V0VA 1C5BH 3GM8A 2Q7YB 2ZUYA 2YD4A 1T6VN 3FO0H 5EU3A 5HYSA 1IARB 5FYLH 3MRRA 1YJDH 3QR2A 4MSWA 1RZJH 3MROA 4LIQH 2ZP0T 4NUJA 4XP6H 5DF0A 2K7PA 5F6IB 3PGDA 3CJJA 2C4FU 3V79C 1DZBA 1CD1A 3SKUD 5I76A 1YEHH 3KXFD 2CKNA 1FN4B 3FB7B 2VITA 4PTTA 2R4SL 4MQXC 5TPWH 4I3SH 3RY5A 4BFIB 3GMQB 2EE3A 3QXVA 1ZLSL 2XZAH 5T33H 2ZUSA 4DGYH 1S3KH 4RQQA 3F8UB 3EHBD 3V6OA 1AJ7L 5F72S 5BV7H 5C0DB 1TJHL 1KN2H 4FQXB 4YQXL 1UZ6F 4YHOH 5CZKA 5FUCC 2B1AH 3F12A 3OKKA 3OZ9H 5JOPE 1QSFB 1E4KA 1A22B 5IIEB 1JMZA 3HC3L 3HPLA 3MFFA 5D1XA 3FRUA 4U3CA 1BGXH 1R6VA 1HHHA 1C1EL 3IRPX 5I1JH 1G6RA 5FIEA 1PX4A 3QEGL 5GS2D 3ISWA 4E42B 3QG7H 4WEUD 4M7LL 4HUWB 1G9NH 4LVNC 2VN7A 4QRRA 1C16B 4UNUA 5L0QB 2N7AA 1YN7A 2YN3A 5DUML 4L8BA 5F1NB 4OQTA 3JV0A 2OZ4H 4YIQA 3WIFB 5C0FA 4XNXH 4F33A 4HWEL 1RI8A 4I48B 4M3JA 1M7IB 2C1OB 2HJKB 5DRNA 2R9HD 5E9DD 3WO3B 2PYEB 3GMOA 1MIEL 4HWZA 4PY8I 2VDPH 3N06B 5LAXA 3QZWA 3P0VL 4L4VA 4OIBA 1KN2L 4B7IA 3QNXB 2LU7A 4J12A 2W07A 1RZFH 4AYFA 1JUFB 2CK2A 4KJQD 2W0LA 4KQ4H 4NRZA 1Q9LA 5DMIH 3AAZB 4X7CC 2PYEE 4KTDH 3KDMB 1PKQA 3KR3L 4HDIA 1K9TA 3GMQA 3T0WA 3IJHB 4QWWC 5CEZD 4YHLH 1MQ8A 4P2RD 3K0WA 4YFLF 4Y88A 3B5TA 3D85A 1T1XA 4JY6A 4LLVB 1RVFL 1TTUA 3RZCD 3HE7C 4M43L 5AG9A 4I9WD 1CLCA 4M9OA 2GK0B 3BYTA 4S11A 5TFSH 3X11B 5C6TL 4MSWB 4HWBH 4NM4L 5GZNC 4M00A 2B8OT 5FAAA 1CFBA 5J12C 2ZOKA 3R1GH 1ZHNB 4M6OH 4CW1B 4DKEH 3QWOA 4HPOL 1EV2E 3BKCL 4OFYD 3DROB 5DLML 3UJJL 5H37H 2XKUA 3WJJA 1PKQE 2R2HA 4UILL 1FNLA 1EPFA 3KYNA 5EOTA 1C1EH 1DN0B 2BY3A 2VSCA 4YAQB 2Y7QA 4HF5H 4WDIB 1IT9H 4RRPG 1S7WB 3RBSA 4I13B 5BJTB 2L0DA 1B0RA 3E1F1 4Z0XA 3UTQA 4M7ZC 4ALAL 5EA0L 3QH3B 4PJCF 4YO0B 3HAEG 5IW1B 3X3FH 4V1DE 1U8MB 4YQXH 2DWDB 3S37H 2P5WE 5DMGD 5CZXD 1T21A 3RKDD 3LKSB 4OZIB 5C0BA 1C5CH 1LO5B 3GO1H 1MCSA 1UFUA 1QO3A 1KCVL 1TFHA 2DICA 5F7WC 1Q0YH 4FXGA 2DLTA 5L2JB 3O4OC 4NOFA 5LQBH 1FC2D 3D0LB 5DEZA 3SDAC 1B88A 1EVTC 2BHYA 3V5HA 1F2XK 3WCYA 3QUMA 3P30L 4LPVA 3IFLH 3DJ9A 3WNNA 4KAQL 4QHKJ 3OKNA 5C9KA 5BOZG 1DVFC 1JGVL 4MYWB 2ZNWA 4Z7QE 5T3XL 4GO6B 3PP3K 1A1MA 3G08A 3H9SB 1VACA 3MRIA 3KYNB 4QRPD 2B4CL 3O6FC 1S9VA 4PV8A 4H88L 1T7XA 4EUPA 2D03H 2R23B 2VXTL 1T4KB 2CUIA 4XWOD 4Y4FA 4KMTH 4DUXA 1H0DA 3F6LA 1HIMH 4LP5A 3OAZK 4PY7B 2IQ9L 1YC8A 4LCCB 1FCCA 4G6FD 5JW3L 3BH9B 4HFWB 2IPKA 5KSBE 1HH6B 4LBEA 1TXKA 2CIIB 5EH1A 1OAXL 1K85A 1ZHLA 2CO7B 2QQNL 1U42A 3IRZA 3TWCH 3ZDYE 4ODUB 5FDWB 2CRMA 4RFNC 1KJ2L 2VXQL 5JORA 2CR6A 3PV6A 2V2TB 4F7MB 3TYFB 1ES0B 4HWEH 1OCWL 3HZVA 2M26A 1Z9LA 2EECA 1QNZL 5FKAA 4JPIA 4KI5D 1UVQA 4PRPD 3DBXB 1UM4H 2VAJA 1A7OL 3RWJA 1KBGL 2H8PA 4PBXA 4R4BA 5CINL 2C1OA 2I07B 4TSAL 2R0WL 1TQBC 4P59H 2Z8WC 4R26H 4U0RC 3AB0C 2R8SH 3BT2L 4F3FB 3TEUA 1TVHA 4K3DH 5I30H 4A6YH 4KROD 2QHLA 2NTSP 1V7ML 4NFBA 2FLBT 3EFFB 1EBPA 2O5XH 1DFBL 4Y2DB 1NFDF 4F7MA 1WISA 4K9EC 3QHZH 4OZHF 4GXVH 4XPBH 5BVJA 5I1AB 3DXAA 3VXNA 1HNFA 4FS0A 1AR1D 3MV7A 1A7BA 2BNUA 2C7UA 3X3FL 2YXFA 2CIIA 4U6HB 4TNVF 2W60B 3QDMA 4GG6B 3CLFH 5CD3B 5F7YC 3BJ91 1CK0L 3VFTA 5CJ8A 3LQMA 4XCNA 4OD3L 3OAZH 4XVSH 2UY7A 4NQDE 1P9MA 1XF3B 1QSFD 3T0XA 4HFWA 1TLKA 3SBWA 3ARBD 3GUTB 2PW1B 3AS3A 2Q7NA 2FGWH 3NZ8B 4KAQH 3EOAB 4P9ML 4U2YA 1OAZH 1I3VA 5C70A 1MY7A 4UTBL 4RFNB 1CGVA 2BOBA 4PJXF 4PGDA 4JM2B 5AZEL 3B2UC 4MJ6B 2MQ3A 15C8H 5CJXC 4U1IA 2F5BL 3W5NA 4LSPH 2G5RA 4QY8B 2VC2H 2C5DC 4JZJB 1FLRL 3EYSL 2CSPA 4FRWA 4B5EA 4KJPC 3LQAL 5D6CA 2CGRL 5EO0B 5IMKA 1G9ML 4Z7UF 4XCCH 3TF7C 1E4WL 1B0GA 1FFPB 3PQYA 3X13B 1RZ7L 3MNZA 3BKJL 1Z0NA 2Q7YA 1I9JL 3L5XL 4L9LC 3FFDB 1TJHH 1JHLH 1JJUA 4ODVL 1T0PB 3P4OB 1AGDA 3A6CH 1XGTA 4PB0L 4PGEA 3S5LG 4CNIA 4TSBL 3GI9L 1OP3K 1MIEH 2EDKA 5DMKB 1BX2A 3L5WB 3QBTB 4P2RB 3QRFM 2VUYA 2VERN 4G9FA 4Q2ZA 3A0OA 5K33A 2LU3A 3C8HA 2WBJC 4PJEE 5FFLA 1CDGA 5L88H 1AQKH 2I25N 3P77A 4G9DA 3FO9B 4ELMA 4GAFB 5IFJA 3MRMB 1N5AB 2V5SA 1GGTA 4KWUA 4RGND 2A6JB 4RFOH 4PRIA 3NZHH 4ZS6C 2DQUH 1IAMA 1NGYA 3RIFF 4HIHA 1RVFH 4NKMB 5I17B 1F5WA 3ZHLA 1QYGL 4Z78B 2Z9TA 2ZSWA 4BQBA 1G7PB 4UOW0 4DVBB 1UWGL 1DQJB 4OM1L 1CL7H 3EGSA 4HIJB 5JR1L 1BJMA 4X9HA 3CUPB 3O3BA 4ZS7H 4ZUTB 2DD8L 4NHUB 3HE6C 3P9MA 4N8CH 5D1ZA 4I5BA 4OUOA 1NGQL 3R8QA 4L8CA 2X1WL 3QUML 3T1FB 3U7YL 4I9WE 1S7VB 1W72H 4CKVX 1LEGB 1AD0B 1ADQA 3VI4F 1R5VA 4XNMB 1WEJH 4ELMF 3O3UN 1FNAA 1NEZA 1U8JB 4QXGL 4Z7QF 4ZO7A 2X42A 1NGQH 3MBXH 5GXBB 3DRTB 1NCCH 3LKOA 1M7XA 1QOKA 2YA2A 1N5YL 1CLZH 1MCWW 4MLSA 1DANT 2ERJC 3IDMB 4K3GA 2JB6B 4CRPA 2JELL 3BI9X 3LH2L 2P42B 4JVPA 4RZCA 1JK8A 4RNRA 1T7YA 3VXQB 4ZO6A 2IAMD 2BERA 1FE8L 5FGRA 3N9GL 3HE6B 1JGUL 6FABH 1JNNL 1R3KA 3DV4B 5IEHB 2AXJA 3P9WB 5KVGH 2AEQH 1QPXA 3OV6A 4URTB 2IBZY 5F3HB 1OT1A 1LEKA 3E2HB 3Q6GH 3V6ZB 1F11A 3T3PE 5HDQL 3H9SD 2NZ9C 4YUEH 2VUOA 5F9OL 2CPCA 2AS5M 4LRNH 5D2NA 5J57B 1IAKB 3ARBA 4ZTPL 2WSKA 4PP1D 3JTSB 4WW2F 4XGZB 1WEJL 4K71C 3ZT6A 1AE6L 2P7TA 1T0MB 4PG9A 4OGAC 4NZJA 4ZNEA 4NQVA 3KNBB 1FVDB 3BKJH 3N1GC 4GRWH 1OAYL 5GGRA 5AZ2H 1D5BA 1P4BL 2X4PB 1SEBB 5DR5H 4G6FB 1MNUH 3L95B 1SM3H 2VKWA 5EZIL 1T66C 1F4WL 1R0AL 1DR9A 2WLYA 1FSKB 4XNZB 2R2BB 3WL9B 4X83A 2DBJA 3BO8B 1VACB 4NFCA 1FV1A 4R0LC 1NFDB 1KIQA 3PWVA 1YEDA 1MI5A 2H3NA 3INUL 5TF1H 3WDJA 1HHJB 5I76B 3D25A 4P3CH 3GMPB 5EUKA 1GGBL 1RU9L 1BD2D 1NSNH 2NY3C 3V52H 2X1PA 5SWZB 4JZOA 3QQ3B 4JFHD 5E6IB 5CP3H 2JB5L 5TFSL 3MV8B 4CL7A 1HHGA 5CZVL 4NBZB 4P23D 5ETUA 5T1KD 3MJ8B 1EAPB 1OPGL 4ZUVA 4NN5B 5FYKE 2NXZD 4OIAA 5D72L 5EORH 1BP3B 1KB9J 4RWHA 4N5ED 4FABL 5ERWB 2BMKA 4ZXBA 1LE9A 3S5LA 4UU9B 2WWMD 4X7DC 1XFPA 5E03A 3H7BA 5EUOB 1A6WL 2B1AL 4ZSOB 3QDJA 3X17A 3RVWD 1KTLB 4JJ5B 1LNUB 4JFYB 4DKFH 3LS5H 2VDRH 3QQ9C 4Q6IA 4X4ZA 4AJ0A 1AP2A 2DDQH 5GGVL 5KSBA 1J8HD 4P2OA 1QEWA 4GMSL 1DFBH 4OV5A 3CCHB 3C60C 1YDPA 3WN5A 5L2KE 1MWAL 2C3HA 5L2JA 1R3HA 1KACB 4Y4FD 4KK8C 5I8EB 1M71A 4R7DA 1NSNL 3V52L 3MLYH 1CQYA 1HI6A 4M03A 3VFGH 4P2OD 3HMXL 1PSKH 4EIZC 1YYML 3L5IA 1X44A 4I77H 3O2DL 4MB3A 5J0BA 2I9TA 3AFLA 2O26U 4P46D 5CILL 4OCSL