1E4WH

Crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
213
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGFTFTNYWMHWVKQRPGQGLEWIGEILPSNGRTNYNEKFKTKATLTVDKSSNTAYMQLSSLTSEDSAVYYCARSPSDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords TAB2
publication title Cross-Reactive Binding of Cyclic Peptides to an Anti-Tgf Alpha Antibody Fab Fragment: An X-Ray Structural and Thermodynamic Analysis
pubmed doi rcsb
total genus 44
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4wH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4wH02
3O2WH 3ULSA 1GGBH 5HY9B 2ZUSA 1UM5H 1XIWD 4XNYL 2O26U 3QDJE 5KVDL 4GG8B 1QRNA 3D1MC 3GI9H 1A7QL 1H3XA 1S5IL 1NANH 2DKSA 1WC7A 4XC1L 3SE3C 2VLJA 3QIUB 4NZJA 4LLYA 4ODXA 1KN4H 2P5EA 5ACZB 5FUCC 2H3NB 4PRAB 5L88H 1N5AA 2NY2D 3B43A 3CK0H 4JB9H 4V2BA 3WFBL 2HKFH 3HE6C 5F7LB 4IOFD 3MJ6A 2QADC 1QA9B 5KW9L 3EGSB 3EDFA 3OKKA 4OM1H 2HN7A 1SM3L 5GGRB 2M26A 3QUXA 1BFVL 4YPJA 4LSVL 5JXEA 4HQQL 2C3XA 1IARB 1FNGB 3BQUB 5EOTA 3CFDB 4I0KA 1TCRA 4LAQH 5ESAB 1U36A 1T83A 2R2HA 4RMTA 2H1PH 4F7CB 4OGAC 4YXKH 2VKXA 2KDGA 4ZFOA 4CDHA 4NBYB 2EIZA 3OKEB 2V5MA 2NY5H 2ATKB 3NACH 4IJ3C 3SJVE 4Y4FD 1ED3B 4MNGA 1WWBX 3SDAC 5I74B 1J0IA 4HV8B 3TJHC 1U8IA 1LP9E 4QOKA 3PGCB 1D5MB 1BQHG 2MSPA 4J6RL 5SWSB 2X4UA 3GUTB 4PJ8C 4XVTH 4P4KA 4PGEA 1NUDA 1UB5A 3TNNB 1TIUA 3D85D 4OCLC 3MNWB 4C56D 5F1NB 1BGXH 4M6ML 1RJZB 4DN3L 3E1F1 4GW4B 5LJYH 3UBXB 5C6TL 2V7NA 3B2UD 3ZE2F 1AGDA 4PJBF 3U1SH 4YX2L 5HPMA 2ZUXA 4WFHD 4RDQF 1NGYA 1V5JA 1S7SB 4Q6IA 4ZTOL 1DLHA 1S7VA 1OTUC 5D5MF 4RDQG 4Z5RA 1G9NL 1FLTX 5T3XE 2OI9C 5MERA 3TIEA 3C5ZA 4JO2L 2ERJC 3UTPE 1YYMH 3CCHB 3N85L 4ERSL 5DJ0A 1FNEA 4YHNB 4YHIB 5E4IA 3LD8B 1EFXB 1ZHNA 3N1FC 4HKJA 2BOCB 1KEMH 3TN0C 3DTXB 1DQDL 3MYJB 3C6SB 4TULL 3EO1A 3QEQD 5KZCD 1U93A 3HNSL 4U1KB 4GW1A 4UDTB 3D69B 5F9DC 3EHBD 2Z8RA 1GC1L 4UT9L 1CU4H 5HGHB 4O02H 4BFEA 2AK1H 2FH6A 4AEIH 4S2SA 4G8GE 5EUKB 3WFEL 4XNZB 3SQOH 5KSAD 1BFOA 4JVWA 1IGIH 3U2SB 2ICEA 3QUYC 1C12B 4AQOA 3BSZL 1NGWA 3KJ6L 4DGIH 3HE6A 1J1PL 1F4WL 4Y1AB 1TQBB 3FQXB 3WIHA 1U8LA 4G6FD 2W92A 4LCYB 2IG2L 3RUGB 1SBSL 4ZSOB 1RZJH 3C08H 1AKJA 4APQC 1J88A 2DJSA 3DRTB 3RWDB 5I16B 5IGXL 1CFBA 5A3ID 4IHOB 2Q7YB 2HLAB 4Z7OE 1EX0A 3O6KL 1RUQL 1JYWA 2PTUA 4FFYL 3LN5A 5IVNA 2V9QA 3K2UL 2VXUH 3MXWH 3VCLB 2G2RA 3H3KA 4JM4L 1XGQA 1CICD 3PG2A 3DRQA 4U6TA 4W6YB 2EE9A 4A6YH 1IQWL 1M7XA 3CD4A 1KPVB 2HJKB 4QNPE 4G43B 1LDPH 4XTRD 5GSVA 1ZHBA 4I9WE 3C5JA 1NGXB 4PJ8A 3RPIB 1KT2B 2K9UA 1LEGB 4D9RD 3H3PL 5C9JA 5F96L 3EDDA 2OYPA 4JM2D 5EPMA 2D0FA 4RMRA 4BKLB 1NBVL 1WITA 4LMQI 1L7TH 2YPVH 4CMMB 5HDOA 3BP6B 1FN4A 4LPVA 4M8VA 5GXBB 4ODUA 3ESUF 3L3DB 3T0WA 4M1GL 1JTPA 2HP4A 2VE6B 4GMTH 4TN9A 3QDGE 3HRZA 5I1IL 5ISZB 4I8DA 3R0NA 1UQSA 1B0RB 1J10A 2PO6B 3LH2L 1NGQL 3U6RB 1IM9D 3F6IA 15C8H 3HNVH 3PWJB 4LQFL 3RA7H 4G6JL 1FNFA 3DROB 5FDWA 3DUUB 2B0SL 2VQUA 1RZ7L 5FKAB 2I07A 1G1YA 3P4OA 3TA3D 3E6FA 3HC3L 2ZSWA 1NLDL 1QO3B 1RZGB 4NQEA 4KAQL 5BQ7B 4HPOL 1FFNB 4IS6B 4C83B 2UUDH 1ORSA 1M7DB 3TN0A 1C7SA 2PYEE 3FT4B 3TBYB 4FG6C 4U1GC 3WBDA 4XVJH 5D5ME 5IMMA 2NLJB 4CMHC 5LWYH 4EIZC 4YIQA 1KJ3L 1NEUA 3I50L 4F2MB 1IC7L 4ZFGH 4ZAKB 1GGCH 2H26A 4NN6C 5L7XH 1YECH 1TZIB 3NTCH 4LNRB 3RNKA 4HS6B 1DQLH 3C09C 2EYRA 5LGJB 1G84A 4XCFH 5I30L 2OQJB 1ZLSH 2YKLL 4NC0B 3HKFA 1MFAH 3NFSH 5ESVA 1JZ3A 4ONFH 1KCUL 4PJHF 5D9SA 5CJXA 1AGBB 2LU7A 4ENED 3HPLB 2XZCL 4GBXD 4HT1L 4X5WA 1NC4D 2Z4QB 3RVTD 1I3GH 3KPOB 3C6LB 4APQA 3RIAF 1B4JL 1S78C 3GM8A 4O00A 4WW1A 1IAKA 2X89A 5J12C 3G6AB 3RAJL 1H3UA 3ES6A 5SX5H 1F3JA 1IGFL 3GSNA 2GUOA 3K1DA 1I9RH 1T22B 1XMWA 1T5XA 4D94A 5AUMB 2ZUQB 5EU4A 4OJFL 2BX5A 3G6JE 2P49B 3DGGB 3ZTNL 3LQAH 4BZ2L 2DICA 3QCTL 5AYUH 1O0VA 2YHGA 4UT6L 2WBKA 2ARJB 1A1MB 3SKOA 1FZKB 2GITA 1A7PH 2VDNH 2A1WL 3P30L 4P46C 3MRGB 4HUNB 3JV5A 2XN9D 3PV6A 1CGUA 3UC0H 1LNUA 4K71C 4EDWH 5E8PA 5EZOH 3GJEB 4NQUA 4FTVA 3SPVB 4OT1H 2PW2A 3FFCD 4KGLA 3MRQB 2APWA 5TDOA 3C60B 4P3CL 2WNGA 2XKSA 4JRXA 3ZYJA 5B38B 5DYOA 3IVKA 2F74B 2DBLL 1ZWIA 4CKVX 5J13C 4WUKL 5FO9A 1IGJA 4OF8A 3CFBB 2DDQH 3HE7B 3NA9H 5I1LB 4JN2A 5GGVY 1BVKA 5KS9B 4X5LA 4Z7VA 2CDGA 5FGSA 3O2VH 2FBOJ 3QWRA 4R4NC 5DVKA 5C09D 1H8NA 1N64L 3DO3A 5IFJB 3TCXA 2OCFD 4KKAC 5HI3D 1MWAA 1QHOA 2AJZA 2HG5B 4U33A 3MPCA 4FQXB 4LK4A 3F5WB 4NJAH 5L6YH 3MRNA 3HMXH 3KPSD 1OGAE 4UTBH 2FO4B 4L3EE 3KPTA 4QRUB 3T4YA 4N0YH 4U6YB 4OLUL 1IEHA 3O6FC 2LABA 2YWYA 5DRNB 1F8TL 4JFPA 5T3ZH 1U58A 3V9FA 3SKJH 4HCRA 4GRMB 2FB4H 5HHPB 5ETUA 4KK6D 2ATPB 1A4KA 4R97C 3R0MA 2NX5B 2HT2C 2FO1A 4N5UA 4CVXB 3CNKA 1TNMA 2BY0A 5MI0C 3MUGA 4KK9D 5I66B 5FYKE 4OV5A 1OTTD 5D2NC 1RUMH 5JHLH 5I1HL 1ZSDA 3DX7B 3VJ6B 4J7RA 4HH8A 1IQDB 2AJSL 1BBJB 5D7IB 3O9WC 3LS5H 3VFMB 4DFHA 3U9UB 5C0CA 2NXYD 3C2AH 3OG6B 3K3QA 1E27A 4NRYB 3BZEB 3EOBA 1Q8MA 4P2QD 4TUJA 3CPLB 4Q2ZB 2W0LA 3QHFH 5CEZL 3UTSE 4Z95H 3REVA 4DGVL 2DLFH 3NIDF 3BZ4A 3KGRA 1ACYL 5IW1A 2DQEH 5BZDB 3KNBA 5FOBB 5I1JL 4M5ZL 2ADIB 5EB9A 1J0KA 4I5BA 2J6EA 4GQPH 5EUOE 1BOYA 3GRWH 5FUZH 3KR3H 4P46A 4RQQB 4B41A 5A2JH 1LO3L 5FO7A 3PP4H 4OIBA 4P4RA 2GJ6E 1OARH 5DRXA 5E1AA 3N06B 1GHFH 4OF7A 2WWMD 5IV2A 2VABB 2VDPL 2YOCA 1KB5H 1AP2A 5C0JA 5H94A 3OR6B 5D7KE 5MEOB 1FL3B 2J8UB 1KCVL 1GAFH 4BYHA 3DVNB 1G7LA 5C71A 2VN4A 1MHCA 5DUBA 5H37G 4OGYH 1RMFL 2FECL 4E41E 3I3DA 1RVFH 4L8SB 1SMAA 3MRHB 4Z6AT 1C5BH 3QRGH 2ITCA 5IR1B 3CFKA 1EGJA 2ILLA 3GKWH 2GTWA 1D5XA 3D3VE 5C2BL 2XFXB 3I02A 4F15C 4EBQL 1CFSB 4JDTH 3ZT7A 4NP4L 5ILTH 2XTJB 4Q9QH 1ND0A 1GPOH 4NJ9L 4XX1E 2FEDC 4ZUVB 5JR1H 2F54E 1N8ZB 5FDYA 3WL9B 1J8HD 1DQQB 1IAIH 1VA9A 4NUGL 3VD3A 1YN7A 1IAMA 3CZFA 4FFWD 5E8DH 4DVRL 2EDTA 3FO9A 3MBXL 2H9GA 4B50A 1P1ZA 1N6VA 4Y4FC 3MLVH 2VWEE 3BH8A 4PTTB 5MP6L 4KKNA 2L7JA 2FBJL 2EH8H 4XHJD 1KIUA 4ZQKA 4POZC 2HVJA 3SKUD 4EN3C 3SY0B 2H6PA 4BM7A 3MRPB 2BC4A 3VXMD 3WHE0 2O5XL 4WW2A 4QXWA 4KDTA 2XWJA 5BW7C 2E5EA 5DEFA 5J9PA 1RI8A 1GGIL 1ZKAA 2BNRD 1BX2A 2AJYH 1G9EA 5GJSH 2CKBB 1BZ7A 1OF2B 3JV6A 4M1CD 1QEWA 2QLVB 4HUWB 4Q74A 2A83B 3UTZA 5I1DA 2IAMB 2N7AA 4LRNH 3QH3A 2AEQH 4UUJA 5DT1L 2XKUA 5CEZE 3MV7B 1S7XB 2VLJE 4OLVL 1RK1A 3P9MA 3ROOA 3INUH 4WTZG 4YFLF 5HHMD 3N50A 1LE5A 1LK3H 4MA1C 2OSLB 1LEKA 2FCBA 2P5EE 3FT3B 3C87A 1V7NL 1VEOA 1AY1L 3BGFC 3EOYG 3FRUB 2R2EA 4Y5XC 1WUNT 1KLFA 4X6CB 5D96C 4ZYKB 4ZG1A 2OK0L 2C7UB 4MHHG 1MJUH 1SMOA 1PZUB 4QT5B 4NM8L 3REWB 4K7FB 3I6LD 3RWGA 1OAYL 4NCDA 5CBAA 5C0IB 3WIHL 3FQUB 3TPUB 4OFYD 1YY9D 4QXUL 3U9PH 2OJZH 1L0YA 3MJ9H 1B2WH 3CVHB 1U2HA 1ZT1A 4JFED 1I1YB 2H2PC 4TNWK 3BRFA 5KVGL 1QFUL 1VGEH 3MA7A 3KPLB 3UO1H 4JVUA 3UYRL 3NIDE 4YHOH 1BFSA 1E4JA 4TVPD 1FNHA 1BM3H 5EU7C 4MNGE 2YBRB 4OUUB 3V52L 4X98A 1ZHLB 3ARQA 4X7TB 3A6CH 2C5DC 4AM0A 1BIIB 2W59A 2AGJH 4JDZB 1S9VB 4WY7H 5INDB 1A02N 4PRPA 2P24A 4IOIA 3GO1H 4RMQA 3AAZA 4L4VD 2QKIB 1F3RB 3DVIA 1CFQB 1J0HA 2CUMA 5C0RH 3GBML 1F5WA 2AXHA 4R7NB 5GS2D 5CINH 4DW2H 4LP4A 1P6AB 3O4LD 5I17B 4BK5A 5L8LB 4N9GB 3U30C 5EA0H 1X5FA 4HZLB 4ORGA 5C0FB 3GMRB 4DVBA 1TENA 1U8HA 1NSNL 3NCJH 5JMOC 1R3HB 2JB6A 4RISL 1HZHL 4M1DH 2Q6WA 5FK9B 3CXDH 3F65A 1UXSA 2FNBA 3HHRB 3OJVC 5DEZA 4EN3A 5AAMA 3VFOA 2GIYA 3MBEC 2A9MH 3IDGB 4JZNB 1W72A 1B6DA 1UGNA 1MHHB 3PDGA 4M48L 3IU3B 4NNPL 5T1KD 4AH2A 4DZ8B 3LEVH 1OWWA 4GO6B 2X1OA 2ZJSH 4PJBB 4X6BA 1P4LB 4I18B 2VZOA 5T1MB 3OXSB 3U7WH 1NCCL 4C4KO 3HB3D 4XXDB 3BIBX 2OTPA 4OAWA 4KK5C 3QJFB 4E42B 5E2TL 3LDBC 4NFBA 1Q9KA 2JJWA 4UAOC 2ZZUT 5GGSB 2LAAA 3QNXB 1PZ5A 2P43B 4O2CB 2W0FA 4Y5XA 4NQTA 3RGVC 2QQLH 3QJHA 4JKKA 3GMMA 3WFDL 4RMVA 3STZA 4HWEL 1FGNH 1KCSL 2IQAA 5F1SA 5CBEA 4FXGB 4XP1H 4S1SL 1OAKH 5GS1B 1KIRB 5H2BA 3L5IA 4KKBC 1T03H 5KANG 3X11A 3IU4L 4Y19D 1OTSD 2DWEB 3DBXB 4R0LB 1U91A 4WU5B 5KVEH 5JOFA 2HRPH 4MJID 4OZ4B 2X70A 1K6QL 3MLUH 2HTKD 3IDUA 3MODH 1HKLH 1TJHL 2Q86A 4LL9A 3P4MB 2VDOH 1MH5A 3O2DL 3GGWA 2AS5M 3TYGH 3ECBB 3DUSA 3VFPA 3ZMRA 4XP6H 3BFOA 5HDBE 3GSNL 1A6VL 2DQCH 5IWLA 3QIWC 2FIRT 4ZTPL 2Q8AL 5I2IA 2C3VA 3QULA 1WT5C 1NFIA 1GZPA 3S34H 2N1KA 1AR1D 2AI0L 4KK8D 2DYPA 4HZAA 3MREB 5GJTL 2X4QB 4U6XB 4HXAH 1Y0LB 2E8ZA 5GGVL 4GKSA 3PIQB 3VGFA 1GRWA 5CKAA 5HBBA 3VG0H 3S88L 5LGHL 5ITBL 1LO4L 3CDGB 1ZT4B 2ICWB 25C8L 1J1OL 2YSSA 5JW3H 3QWOB 1SJHB 3UYOD 3MC0A 4HGKC 1MFCL 3L5XL 3AREC 3TT3L 2VLMD 1F6LL 4JY6A 5JQHC 1MF2L 3I84A 4HUUB 3MBEA 5FUOL 2AQ1A 1UWXK 3DMMC 1C08B 2MOVA 2VXSL 4NQEE 3MJGX 5B4MC 1A1OA 4TOYL 5BS0E 4M8QB 5F6IC 2A9NL 4HXBH 3MV9B 1V3JA 5FYLH 4PY8I 3MRJB 4XZUA 3MLPA 4X9HA 1QFWM 2J12B 2V17L 3FO0L 1RY7B 1FFOA 3BHBA 3T0EE 3QB7C 3Q48A 2ZPKH 4L3EB 5A16A 3HZVB 5HHQB 2R0WH 3HZYA 4S1QL 3P0VL 5HGGS 2D7MA 4F9PC 2MPAH 3VXUD 1ADQL 4K3EL 3DURB 5ADOL 1SQ2N 5D2LB 1CQYA 3HUJE 5AD0A 1CGXA 4PJDE 3LKOA 1IAOA 1I1RA 1NCBH 3JTSB 1HK6A 4Q0XL 3KYAA 3RGVA 2BVQB 3SE8L 1LO0L 3QFJB 4QO1A 4WWKB 5CJBA 3RRQA 4LSQL 2X4SB 3PGFH 1HOCB 4WO4D 2NR6C 1ZT7A 5E6ZA 4NWUL 4WI3A 5GHWH 1I7ZB 1YC7A 2HT3C 3RI5F 1YEJH 3H6JA 4R90L 1JRHI 3WN5C 4MGXA 5E99L 4JY5L 3BRGC 3HAEA 3WNPA 2I9TA 4RWYH 3FB8B 3GI8H 4AT6A 3CH1A 4PJIE 4FQJL 2UZIL 3PL6B 4NQDB 3BWAB 1DEEA 3MLSL 4P5TD 1KENL 1MI5D 1FG9C 2OZ4L 3PWNA 4U49A 4RSVA 4OD3H 1K8IB 1JUFA 4BSVB 5CIPA 4PJHB 3QIWA 1DBKL 1RSFA 5E9DB 1F13A 1DEDA 1JYNA 2BXZA 3NIFF 4ZFZB 3WIFA 2NY0B 2DI9A 1WT5A 1BREA 4QRRD 3SN6N 5BV7H 4Z0XB 4OZHA 2HT4C 4RZCA 2I60L 5JXAH 1P5VA 3S98A 4PBVC 2J6EL 2UWEA 1YPZF 4OLXH 3GHBH 1NAMB 2AEWA 4M00A 1AQKL 4MAYD 3ARFD 1QFWI 3GMLB 4FTVE 1V7ML 4PGBB 3R06B 5FA3B 3VRLF 4TSCH 1Z3GL 3IJYB 1CLOH 3QIBD 4OCNC 4CVZA 1QLFA 2XA8H 5DR5H 4I13B 1YNTB 4JRXE 5CCKH 4JFFB 4D0DA 1TFHA 4HUXA 3VXNB 4G6AC 3AREA 3QZWA 3MZGB 4LEXH 4Y2DA 4YHLH 3ARDA 3DYOA 4WDIB 2OP4L 4Z7VE 5EBLB 2EDFA 2VOTA 3OAUL 3MRIB 3DMMA 4NPYB 1ZANL 4JPKH 1H5BC 1CVSC 3IDMA 4YBLB 3EUUA 4FNLL 3A67L 1U3ZA 4ELKA 1BOGA 1P7QB 3F58L 4P5MB 1M71B 4YBQD 3ARTA 2AABL 4GKNB 3GBNH 1IT9H 3DWTA 4U2ZA 3T4AA 1G7MA 3O4OB 4H8WC 4HS3A 5T1DL 5HHOE 2IBBA 1D7FA 4XMLH 3W81A 1JGEB 3NCYS 1VADB 3NCYP 5EBWA 4KVCH 4UTAH 5K9OB 1CLZH 5D70L 3UTTE 1T1ZB 1M6OA 5HYJB 3LOWA 5C07A 5DSCB 5IHUH 4XPFL 1FFPB 2YPLD 3BGMB 4F7MA 1FDLL 1A6PA 1CGSL 2QR0B 3D9AL 5E6IA 3GNML 3X13A 1XF4A 3LKNB 12E8L 1X5ZA 1OM3H 3IRZA 3DNKA 1GOFA 1K8DA 2DQGL 3AVEA 5EU6D 3ULSB 5E2UH 2CRIA 3TZVD 3ZZ1A 4C58B 1A14H 4OCMC 1QRNB 4QHLB 3LSOA 1YEHL 4HMEA 5C0CE 4A2MA 3WN5A 3LZFL 2VO5A 1PDKA 1H8SA 1TETL 3B5GA 3IF1A 4QY8A 1YMMA 3ZKXC 4I0PC 4G6KH 5F9OL 5D1XD 4ODXB 1OAXL 5IB1A 5IW6A 2OL3A 3MX0A 2JELL 3TIDB 1WBZA 4J4PD 4NN7B 4Y16C 1N0XL 5C0BD 1D5BA 4YR6B 4LPWA 3G5YA 3BUYA 1H8OA 2HN7B 5TQ2L 3QUXB 2X1QA 1AD0B 2AJVL 1YEIL 2VLRA 5EOTB 1YJDL 4O9HL 3G6DL 4PG2C 3UAJD 4MWFA 2AJXH 4OCXL 3S4SB 3G5VA 4DTGH 4NN5C 1MIEH 3W9DA 4ZFOB 2ZOLB 2IMMA 1BAFH 2EIZB 2YXMA 5FKPA 1F90L 2BNQD 5ID1A 2Y07L 3JWDL 1RD6A 1C5DA 3NIFE 2IGFL 1KPRA 2APXA 3VRIA 4X0KA 4KROC 2NW3A 5CHNA 5MENB 1U8IB 3BKJL 5FXCH 4KQ3H 4QOKB 1KLUB 1MAMH 2X4UB 4YK4B 4JZOA 3N1GC 2HLFD 4P4KB 4PGEB 1UB5B 2CUHA 1CE6A 3RVXD 2H32H 3VXOA 2XQYK 3KYKH 1I8IB 5EZLB 3UPCA 4LPTA 4UV7L 4NKDA 1AGDB 4J12A 1JMZA 3ARBD 4QF1A 1NGYB 1MCBA 1DLHB 4Y5YB 3VFSB 2DMKA 4X6EA 5C08D 3OKMA 4HG4K 4L9LB 3AM8A 4M5YL 4X7SL 2VDQH 3VD4A 2YR3A 4M7LH 3TIEB 3C5ZB 3PQYA 1X5GA 3KYOA 4G9FA 4RGMB 1CFVH 4X83A 5CJQH 5DJ0B 4JR9L 1FNEB 3QNZB 4P99A 4AIXA 2IH3A 1MEXL 2R2BB 1ZHNB 1Q9LB 3QIUD 2G75A 3LHPH 3MJ7A 1PY9A 4JHAL 2JF1A 4M7ZC 1ZA3B 2V5YA 3EO1B 3SDYL 5IW3A 1U93B 2XOTA 5E08H 3VGBA 5I18L 2OS7A 3AU1A 1FVDA 1T5WA 4L8BA 3HMWL 3IFNH 3FTGB 1CFNA 3QBTB 3X3GL 2Z31A 1BFOB 3U82B 1NGWB 3BQUD 3VXRA 1JFQH 4P3DA 3HE6B 5D6DA 5D1QA 3QXWA 2QADB 1OAUH 4OLEA 1B0WA 4AEHH 4MVBD 4UT7L 3QXAB 4X4XA 2LQRA 2K7QA 3PXJA 1RK0A 2EDOA 2R0ZH 4D8PB 1G7PA 5T33H 3MQIA 1FVEB 4GRLC 4GAYA 1ES0A 4PG2A 3MTRA 1KTRL 4NO2A 4XBGA 1CBVH 4FQQB 5DMIH 2Y06L 2VERN 3T77A 4J3OC 1NCUA 5CS7A 3F7PC 4JGMA 5DJ8B 4OCYH 1RZKH 4IJ3B 5E2JA 4Z18A 4WTWA 3UZQA 4BFIB 1CXLA 3IRPX 4XB8A 4LF3A 3LN4A 4QRPE 5TFSH 3SDAB 3OR7A 1A3QA 4ZDHA 5GSVB 2BOBA 4LPUA 5EORH 2HKHL 1ZHBB 2K1MA 1JV5A 3C5JB 4L8DA 4GSDH 4PJ8B 5IM7A 4CU8A 3OGCB 5C9JB 4ONHB 1AXSA 1JNHA 1S7UA 3BESR 3WNLA 3SE4A 1EO8L 1Z6JT 1MCNA 4EUPH 1FN4B 2QBWA 4ODUB 3T2NL 4KV5F 4PJGA 5K9KA 4PJ9C 2IEPA 3GZKA 3P77B 1K4CA 5HYIA 1A9EA 2WMPA 1RUKL 3HRZB 4P2OA 1MRDL 4XPTL 1FE8H 2Z8VC 1UQSB 1KJ2B 1ROWA 1EFXD 4LVHC 3FOLA 5HPOA 1UWXH 5FDWB 2OI9B 3W9EA 3WFBH 1TJGH 4U7SA 2I07B 2A0LD 4HFWA 2ERJB 3RDTC 3P4OB 5KW9H 4DKFL 1MNUL 3QQ3A 4HKBB 3VA2C 1FYTE 1SM3H 4MJ5A 1BFVH 3VFVB 4NZRL 4HQQH 4EI5C 1ORSB 5ALCH 3AMLA 3TN0B 4PLJC 1EZVY 3CIQA 4A6YA 5CSZA 1U3HC 1WWWX 4XBEH 1BJMA 3HG1A 1S8DB 3V8OA 1FL5B 1MJJB 4YIQB 5J8OA 1RJYA 5EU3A 5DUML 2HH0L 2Y4SA 3WXVL 1X3DA 2VH5H 5FIEA 4ZFFB 5DQDL 3S36L 3T2QA 4Y1AD 2H26B 2NY1C 2IWGA 3NGBC 2F19H 1N26A 2EYRB 3BH9B 4YDKL 3HAEG 1ORQA 4D0BA 3QUYB 5DD6A 3QG7L 4HIXL 1P7KB 3KLDA 1JGLL 3MOAH 5C0AA 3V6OE 5D8JL 4LLVA 5DVMA 2VXTL 1JNNH 4EOWL 2CO7B 4DN3H 4WFGE 4PGCB 4M93C 4X5WB 5C6TH 2QEJA 3ULVF 1V3MA 2PTTA 1F00I 4H20H 1DBMH 1FV1A 4NHUA 4OZHF 4APQB 4E5XA 1CF8L 3ZSSA 3FQTA 3SO5A 2UWEF 4ZTOH 4WW1B 1IAKB 1IBGL 4ZUUA 1GGTA 4GFTB 3ES6B 3P11L 3UDWC 4HBCL 4KRMB 4XP9H 3K4ZA 1YN6A 2GUOB 2ZUYA 1H9VA 3PWLB 4LVEA 1REIA 1GIGL 1J9CT 2DMCA 3TT1L 1J05A 1T5XB 1FAKT 1EUUA 4GAGL 1QBLL 5EU4B 4ZXBA 1JRHH 3SCMC 3TP4A 4JO2H 5IMOA 4Z7WF 2J7LA 3TH3T 2A6KB 4ODTL 3SKOB 2O5ZH 2YD2A 4YGVB 2FX8H 3EW3B 5EC1A 1KNOB 2DQDL 2KZWA 1ONQA 4Q58C 3RY4A 3BEVB 5ISZD 1DQDH 1FC2D 3PDDA 3QZWG 4TULH 2PO6D 3PV6B 1LNUB 4TTGA 3HNSH 2DQTL 3EOAA 2P8PA 1EBAA 1IEBA 3IGAA 3HCVB 4UT9H 4F7TA 1NMBL 1GJIA 2A6DA 3QXVA 1A21A 4XRCA 1GOGA 2N4IA 1JK8A 3UBXI 3MA9L 4IMLA 1EAJA 4UDUA 1IE5A 3IVKB 1ZWIB 4XH2A 1IGJB 2F53E 4NNYB 2BRRH 4CVWA 4JN2B 3BSZH 4N1EA 1BVKB 1L7IL 2R1XA 5EOQH 3ILQC 4DKAA 1J1PH 1F4WH 4HF5L 4LCWA 3LB6C 5ICXA 2YD5A 5LQBH 1BBDL 4KHXL 2R4SH 2IG2H 4HMDA 1SBSH 1JJUA 4I2XA 4ZAKD 4I3RL 2QTEA 4LNVA 3FO1B 4RAHA 4WCYH 4XAKE 1IVLA 4U1GB 5IGXH 4KZEH 1U3HA 3WJJC 4MNHB 4CMHB 1MQKH 1LO2H 3O6KH 4PJ5A 3KDMB 5I71C 4MCYA 1KELL 1MCJA 1MFEL 2DL2A 5I1AB 3CDYA 3ZYZA 5IB5A 1I9EA 4JG0L 1KF9B 2EC9U 2QHRH 4JFPB 4NN6B 4JM4H 3VDBA 1U58B 4OD1L 3C09B 2D9CA 1IQWH 3B9KC 4WI9A 3BVNA 5ETUB 1WBYA 3H9SB 2H8PA 1A4KB 3O3UN 4JHWL 3QPQD 3C6LD 2DQUL 4MCZB 3EYVA 5D6CA 2X9YA 3OKOB 4XPBL 3WXWL 3H3PH 3GEWB 3MUGB 5F96H 3QUMH 5E00A 2YPKB 2XWBB 1NBVH 5GISH 4IOSD 3AROA 4YFEA 1O5DT 3NFPA 4LCIL 1E27B 3BKMH 1U8QA 3EOBB 5J12B 4AENB 3UDWA 3VG9C 2GFBA 3G08B 3W0WB 3LH2H 1NGQH 4JFQB 5F7UA 1D3CA 5JIIA 2Z8WC 3UJIL 3OXRA 4G6JH 4XGZA 3DVFA 4N0UB 3SCMA 5GRVL 5HD8C 1RZ7H 3BZ4B 5H8DA 3EOTL 1XGPA 3HMXA 4AG4H 3S35L 2YEZA 1NLDH 3ULVE 2RIKA 4I5BB 4KAQH 4PLNC 1XF1A 4YUEL 4OZHE 2LV4A 3C60D 3FZUD 5FV2A 2YK1H 4P46B 3KXFA 3CH8A 4EEEA 4OCRL 4P4RB 1ZVYA 4ACPA 2CK0L 4Q9RL 4K71B 1JYXA 1WEJH 5IV2B 1TDQA 1VFUA 1OPGL 3HE7D 1OB1B 5HGDA 1AP2B 5C0JB 5H94B 3FT2A 5FGBA 2EYSA 2D2OA 4KTEL 5DFTA 1URLA 3ULUL 5IJKC 1G7LB 4JPIA 1MHCB 4JQVA 5J13B 3O2WL 1GGBL 2BSTB 2YKLH 5E7FA 4FQXD 4JKPH 2E9WA 2VISA 3CFKB 3MNVA 4YC2C 4XP4L 4JJ5A 1KCUH 4OCWL 1YPZB 4FHBD 1I1AC 1U8NA 1D6EA 1CDIA 1S9YA 2ZNWA 3RHWK 2XZCH 2AV7A 3OB8A 2IADA 4G42B 1KN4L 2FD6H 3HN3A 1CG9A 3UAJC 4YDIH 3BI9X 1B4JH 4X5XB 3WHXA 3B4NA 1D9KA 3WJJA 5L88L 1CL7L 3RAJH 3WMSA 4JB9L 5HTSA 1AD9A 2HKFL 3TFKC 3FN0L 2BVPA 3CZFB 4QEGA 2NX5D 3O6FB 4HMCA 3FO9B 1QTYT 1RFDH 3GRWA 2H9GB 1P1ZB 2EIEA 3BH8B 4OLYH 5BVJA 4OJFH 4K9EH 3A6BH 1LEIA 1F3DJ 2HVJB 3QCTH 2H6PB 5EIQA 4R97B 5J9PB 4UT6H 3VXQA 4LAQL 1J0ZA 2HLFC 1HQRA 4J1UB 4JFXA 3VFUA 2BJML 2ZCKH 3IJHA 3IFLL 1TMCB 5MI0B 2A1WH 1NDGA 3ET9F 5D2NB 1H3GA 3RFZC 1GSMA 1Q9OB 2NY5L 3NACL 3UTZB 3ZHLA 4I0CC 3H9HA 2BVEA 3O9WB 4YXHL 3KPNA 4UUJB 1VGKA 4P3CH 3RQ3A 5HYEA 2EKSA 3SDCA 5KSBE 2VQ1A 1LE5B 2DBLH 4NKIL 2YZ1A 4XVTL 4KMTL 1I7TA 2X4OA 2VXVL 5DZNA 2VLKA 3GMNA 3QXTA 2BSRB 5T1LA 5FHBL 2MTPA 3BPCA 3RWGB 4JO4H 1J87A 4ZD3L 1XGYL 4JQXC 3S37H 2BY1A 1D5ZA 1PKOA 2MQ3A 4HD9A 4HKZB 2VLRE 4I77H 1W0WA 1FO0A 1U9KA 4ZPVA 4L4JA 1ZT1B 3BP4A 4UMGA 3ULUE 1UEYA 5I0ZA 4OLUH 3MA7B 5DJ6A 1YYML 1DANU 1F8TH 4LIQH 4PJGF 5TGBB 2NZ9D 2Q3AA 4QRTA 4EI6A 1C8PA 4JN1H 3Q1SL 5ALBH 2XTJD 4X98B 4F7PA 5IT2H 5L2KE 5CSGA 4N8CH 3FB5A 4HFUL 1UVQA 4PRPB 5E56A 1I1AA 2P24B 2XKNA 4IOIB 4F15B 5HHNB 1OGTA 3E0GA 1KXQE 3T65B 4AEIL 1U95A 2MHAA 5T3XD 1SYSB 3SQOL 2Q8BL 2F8XC 5DFVD 3T09A 1HDMA 2CUIA 5ELIA 4O2EA 5FYKU 1W8NA 3TYFA 5GRUH 1SJEA 1VESA 3BIKB 4Y4FB 1U8HB 1TCMA 2IANA 4DGVH 2JB6B 3MJ9A 3EYUL 4BSJA 1Z9OA 2Q6WB 5TH2B 1XIWA 3V7AG 1RZJL 3PQYE 3MNZA 1NPUA 1UXSB 4PB9L 4EN3B 2Z93A 2IAMD 3VFOB 4M5ZH 2H45A 1HH6A 4XAWH 2XZQH 2WBJC 3MV7D 3UZVB 3EJYC 2IMNA 4X6BB 3IYLW 4J23A 3L7FA 3TO4A 1TJIH 2VXUL 3KG5A 2BDNL 4NCC1 4RNRA 2VZUA 4PYGA 2YD3A 4XB7A 2VDPH 3GSXB 5DJYA 4NUJA 3EO9L 1AGCA 1EMTL 4M7JH 2EDXA 1RMFH 4MA1B 2R9HC 4M4PA 2BVOA 5E8EA 1NAKL 3GK8L 3BGFB 3MOQA 5CZXD 1UCTA 1N6QL 4PP1D 4Y5XB 1EEZA 5D96B 2ESVA 1J5OH 2YPVL 4L5FH 1WBXA 5C2BH 4WU7B 1CDHA 3QYCA 4GMTL 1WWAX 4AL8H 2Z9TA 4JQXA 4NP4H 5H2BB 3ZDYE 4OLWH 1JI2A 4JDVB 3BP5B 2C1OA 2NY6C 4PRIA 3HNVL 4PGDA 3RA7L 2X70B 4PRNB 3H42H 3HPJA 3WLBA 1MFDL 5EO9A 4PUBH 2FLBT 5EIVA 1FG2A 4PJFF 4DVRH 3SGEI 1ZE3C 2RBLA 3GGWB 4GW5B 2LU3A 1YUHA 3DUSB 3VFPB 2P7TA 5MP6H 2N56A 1PX4A 4R4FH 3U46A 4C56A 1GOHA 1FZOA 4KI1A 2XIDA 1X7QA 1GGIH 5I2IB 3DLQR 3MJ8B 2C3VB 5DVLA 1NFIB 4NO5A 4TYUA 4XVJL 1HSAA 1GZPB 1J12A 5LWYL 4PRDA 3S3JA 1CIDA 1FCGA 4ZFGL 3FQWA 4JEGB 1YECL 3NTCL 1K3IA 5IMKA 1X4ZA 2GI7A 3BMWA 3KPPA 4PJGE 5DT1H 4OLVH 5F88B 5JPMA 1F2XK 5IEHA 3U30B 2DF3A 4L4TE 3NFSL 5EN2A 5KSUB 1NFDE 4PLOB 3U7AA 2JK5A 4PRHE 1AY1H 2IPUK 4F8QA 3I75A 2OK0H 2NCMA 2OMBA 3AY4C 3RY6C 4NM8H 2DWDA 3MBEB 2V7HA 1QRKA 3WUZA 3RWJA 5DK2A 3MGOA 3E6HB 2WBJA 5GS3A 1FQ9C 1F3DH 1M05B 2EE6A 1I9RL 1EEYB 1T66D 1U8OA 3IDNA 1FFOB 4OV6F 4Q97A 32C2A 5D93C 3RU8L 3HG1E 1HHHA 3LQAL 3TJEL 4JPWL 3QI9C 3UYRH 2M8XA 2P46B 1G7HA 3WS6A 1RQ5A 3LDBB 3RVVC 4YXLH 3OAYK 4UAOB 1A7PL 2VDNL 4FQCL 3CFEA 2EXWC 4OI7A 1FP5A 3V4PL 3UC0L 3PWUA 3PWVA 3GSWA 5EZOL 2FX9L 5F3BB 4OZGA 1QSFA 3SKMB 1JF5A 5F7YC 3AS0A 2JJTC 4FA8A 5IIEA 1ZT7B 4OGZA 3T1FB 2A38A 3CFCL 1MCOH 2AK4B 3QDME 1S5HA 4U6HA 3ZKMD 2VDML 1CICA 5GS0C 5I8CA 4PJAA 1B0GB 2DDQL 2R1WA 3HAEB 3NA9L 3NBNA 2I9TB 4NNXA 3MXVL 3CH1B 1AO7E 2G60H 4G80B 3WUWB 5A2KH 5EBMA 1ZGLA 3IKCA 1I8KA 4HWNA 5DHVH 4QWWC 3KPRB 5IB2A 1QACA 3QIWB 1OCWH 3QUZC 3EKCA 2AXGB 1UCBL 4NJAL 3QAZC 2XICA 4M48H 4NNPH 5D7LE 1MRCL 4OZHB 1V8HA 3EJZC 4OZIE 2UWEB 2FHBA 3LQMA 2JJSC 5M95B 2VJXA 5T3ZL 1IM9A 1L6XA 3BO8A 1YNLH 3WFHA 1NCCH 2FB4L 4CVZB 1QLFB 5L2JA 1KFAL 1EA9C 2XA3A 2E3VA 3DXAA 1H3TA 4U0QB 2IJ0C 5E2TH 5GIRB 4Z7WB 4HUXB 3AREB 2GSIA 3MV9D 5JHLL 3FCTA 1HXYA 2GTZA 1BVZA 3PWPA 5CGYD 3WFDH 4QHUA 1KCSH 4LCWE 3LS5L 3DMMB 3C2AL 2P5WA 4G3YL 4S1SH 1R5VA 4L3ED 7CGTA 4YGAB 5F6IB 3IDMB 3QQ9D 3QXUA 4MD0A 3QHFL 5A2FA 4V1DA 1N6UA 5E94A 4HJGA 4ELKB 1G7QB 3WNOA 3GSUB 5H35A 2HMID 3IDYC 1K6QH 4L3AA 1G7MB 3PHQB 4M7LT 1TJHH 4HS3B 3PE9A 1A9BA 4ZO9A 4XPAL 3QI9A 2DQEL 3QFJD 4LLUA 5IEKB 4FFZL 4PB0L 2AV1A 3G9VA 4WWKD 5EBWB 3P9LA 3KPMA 3STLA 2FWOA 1R3IL 1NQBA 2VKWA 5DK0A 5EWIL 3C8KA 1M6OB 5FUZL 5F8RC 5IJVA 5C07B 4ZTPH 2C3WA 3PP4L 4GBXA 2JJVA 2W0KA 2UY7A 4F7MB 2V2WB 5IKCA 1GHFL 4JY4A 2HTLD 2AI0H 5J1TC 3SKNA 1I4FB 1KB5L 4NFDA 2JJTA 2W0PA 2R15A 3PL6D 1GAFL 4N1HB 4NQDD 4HIJB 5BMFH 5I6XC 3FQNA 4WUUA 1OP5K 3VE0A 4QHMA 2Z92A 2X7LA 5F70A 3LSOB 1I9IH 4OGYL 3P2TA 1MQ8A 4M3JA 2WSKA 3S88H 3C2SA 3JUYA 5GGQH 1LO4H 4FABH 3QRGL 4WHCA 5E9DD 3TGXA 3VWKC 1WJ3A 1XR9A 4QY8B 1YMMB 2NY0D 1WCQA 4LASH 1MFCH 5IB1B 1RAMA 2OL3B 3TT3H 4JDTL 4YZFF 1KSRA 1WBZB 4I3SL 5KVFL 5EDXA 1WICA 4Q9QL 4IMKA 2IQ9H 1MF2H 5IBLC 3HNTH 2XN9A 1GPOL 2JCCF 3QUZA 4JREC 2F9BT 5FUOH 3G5YB 5JR1L 4K7PH 4NC2B 3BPNC 2VXSH 4CGTA 4K8RD 4TOYH 4ZOEA 4HUMB 4QRQA 5T3ZE 3KXFE 3VH8A 4F33A 5E8DL 2OJEB 4JFFD 3RL2A 2COQA 2EH7L 1N4XH 3DUHA 4PGZA 1NJ9B 2CLVA 2EH8L 2FJFA 4FFVD 3G5VB 3THML 1EXUA 3P0VH 3W9DB 5FM8A 1D6VL 3UJTL 3D5OF 1JZ7A 2Y5TA 3MROA 4Y4HC 5FKPB 2ZUUA 5KOMC 1WAAF 5CJ5A 1ADQH 5ADOH 5C09A 1SJXA 3ALWA 4MQXD 3T08A 4M6AA 1T0NB 1PBYA 1KPRB 3IAPA 3VRIB 4X0KB 1G0YR 3X17A 2NW3B 1HHJB 4Q0XH 4F37F 3OF6D 1JWSA 1WK0A 1QR1A 1N3NA 2QV2A 1P7QD 4LPYA 5F7HA 4CVUA 3D2UB 4GKZB 3FKUS 4P2RE 4JZOB 2Y36H 1FL6B 3T2OA 2AEQL 3ARSA 1CE6B 1MCQA 3DHJA 3GMOA 1H5BB 1WCBA 4NWUH 3INUL 1FH5L 3DSNA 3I3EA 2IALB 3LKPB 1SY6H 4R2GC 2ICCA 2XTLA 4NKDB 4NRXA 2DN7A 5E99H 2Z91A 4JY5H 4QF1B 1BQUA 1KXTB 5LKNA 1S7RA 43CAA 1KLGA 4FXKB 4LOUC 4RIRA 5DI8A 3MLSH 3MMEA 5C3TA 2FL5A 1KENH 2NYYC 3OKMB 2OZ4H 3UYPA 5HDLA 4FZEL 4WNQA 5HHVL 4NQCE 1HQ4B 5HI5C 4PJXE 5J6GB 1DBKH 4LPXA 2YRLA 4Y0GA 4LLAA 4G9FB 1QRND 4LGRB 3C8DA 1B2WL 2L0DA 4GRWF 4JRYE 3LKRA 4HHAB 2X1WL 2PW1A 2E6JA 2V2TA 3MRKA 4D9QE 4JVPA 1KJVA 5GGTA 4MZ3A 4P2QA 4LCCC 5I75C 3UO1L 2G75B 4RGNE 2FR4A 3SDXA 2E6QA 2FSEA 1AQKH 5DJDB 4G6MH 2BFVH 3QISA 4ZS6C 1BM3L 4MA8H 5IFAL 2A74A 3AU1B 1FVDB 2FJHA 3A6CL 3VWKA 2C26A 5JHDA 2NNAB 3BT2L 3ZKXB 2X44D 3EZ8A 2FJGA 3L5HA 4I0PB 2H2SD 3KLHD 5TQ0L 1YQ2A 5FECB 1VFAA 3QUXD 3GO1L 2VLKE 3CFJB 4Y16B 5IQ7H 4O2FB 5CD5C 4B0MM 3VXRB 5C0RL 1HHKA 3OAUH 4DW2L 4AMKH 3TWCH 4X4XB 1TVDA 3B8SA 4LHUB 3DO7B 1UACL 3M17A 1RK0B 4MNQA 3SGKC 1ZVSA 5EA0L 4GXVH 4FNLH 3A67H 4BZ1L 4WFFD 1JTOA 4GAYB 1ES0B 3NCJL 4OD2B 1XCTB 4NO2B 1CS6A 3V79C 4FQ2H 4M1DL 4PGJA 3P0YH 2G9HA 3CXDL 2VDKL 4NN5B 4QOKD 4YDVA 5DJ2A 3DECA 5I1EH 4N0FB 2A9ML 2AJUL 4Y4HA 4P4KD 1XGRB 4WI4A 3O0RL 1WTLA 1IRAY 1OLLA 1QFHA 3LEVL 5FYJU 2ZJSL 4KROB 3FN3A 4CW1B 3BIAX 3OR7B 1MCEA 4N0CD 1T21B 1U8PA 4XI5C 5JMRA 2BOBB 2PKDA 1NBYB 1JV5B 3HI1A 4ZPTA 1BIHA 4OLZH 3UJJH 4ZOCA 4OM0H 1J8HA 5IM7B 1A5FL 1T3FA 2DQGH 3RIAK 5F6HI 1BLNB 2CLRA 4DOHB 1AXSB 1JNHB 3SJVA 2AXFA 3LPFA 2GHWB 2B4CL 2JB5H 3C5ZD 1K4CB 4U7KA 3VXMA 1LP9A 4PREA 2V5TA 5DRWA 4GUPA 4O51A 4F3FA 4JFDB 1FGNL 3W82A 2FDBP 1KPUA 4RAUA 4U1JB 3FOLB 1T03L 2XWTA 4H26B 3W9EB 1QLRB 2ICWJ 3VD7A 4HFWB 1NUFA 3ZKSD 4WEBH 3OV6A 5KVEL 2HRPL 3QQ3B 4DCQA 5TE4L 4MJ5B 5TQ2H 3MLUL 5HYSG 1G9NC 3MODL 1HKLL 4MQ7B 1O7VA 1CXFA 2B1HH 4LCCA 1YEIH 2VDOL 3D18A 3GSQB 5DJCA 1IKNC 5KG9B 4OZGF 1YJDH 4O9HH 3TYGL 3G6DH 4M7ZB 4XP6L 1F11A 4OCXH 4YBHA 1MY5A 1PYWA 2DQCL 1RJYB 5EU3B 3OAYH 3HE6D 2QADD 3CUPA 4HEME 4PJAF 3W11C 2P4AB 5L8KB 1IC5L 2DKUA 3OPZH 2X10A 3S34L 1DQTA 2Y07H 1OSZA 3JWDH 5K59F 3DV4A 2FGZA 5D7SL 1H3PH 5FCUH 4OFYA 4D0BB 4EUPA 2CKBH 2UZYB 1AKJD 1S7QB 2VDRH 1GC1C 1W2KT 1ZTXH 5C0AB 3VG0L 5I0DA 4RAVA 4OGAD 1I1FA 5BVPH 5LG1A 4HIIA 3I85A 1PX3A 3SGKA 2DJUA 2ADJA 2FYYA 4LMQE 5GRXG 3OG4B 4LKXA 4NHUB 5C0GB 4PRIE 5JW3L 4GRLB 2E7HA 4E5XB 4KFZC 1C7TA 3UMTA 3MV01 4EQ3A 3FQTB 1LDSA 4QHKI 3WV0A 4NHCH 3SDAD 3TO2B 2VAAA 3DX6A 5GGUB 4ZUUB 3TJHD 2DQHH 2QSTA 5IVXE 4ODVL 4M6OL 5DRZA 4HEPG 3RJQB 2R0KH 4X7SH 4YDJA 4PJ8D 3U79A 4YO0A 3RKDC 4L4VA 3BXNA 4C56E 3ZTJH 1PG7L 2B1AL 3DETC 5IMOB 1HEZA 4JLRA 4JR9H 3H0TB 5ENWA 4ELMA 2V5RA 3CVHH 4WFHE 2CH8A 1F42A 1XZ0A 2ZPKL 4NQXA 3RZCC 1DN0A 5LVEA 4R96A 1OTUD 4RFNC 3EYSH 2MPAL 3EOAB 4GXUM 4PJFB 2BVUA 1MUJA 4OKVA 1IEBB 3TH2T 4NQVA 3EFFA 4F7TB 4PJ9B 1NCBL 1PSKH 3QFDB 4XRCB 1JK8B 2IPKA 1E4KC 1PEWA 2P8LA 2L4OA 4XH2B 5AZEH 3KAAA 5T1KA 3PGFL 1CN4A 2FHCA 4LVHB 4YEFA 3TN0D 1FVCA 2ZOKB 2UVEA 3RZWA 3RDTB 1AXTH 1YEJL 4UT7H 1JHKL 2FRGP 3KYMB 4U1SA 4LSTL 5IG7A 5F6HJ 4RWYL 4I2XB 3ZLQC 5J11C 4YH6A 4EI5B 3F7YA 1R5IB 2QQKL 5EC2B 4B5EA 1IKNA 4E0RA 4HS8L 3RNQA 2DIAA 4OD3L 5E5UB 1U3HB 2EDNA 4PJ5B 3QUYD 4UQ2A 4X4YB 5IB5B 1SVCP 4WVRA 1LE9A 1AFVH 2VITB 2NY1B 9CGTA 5BV7L 3NGBB 3ARGC 4XVUC 4AIZA 4R4BB 3QUKB 5JXAL 3BVNB 5SWZA 1MRFL 4H0GA 3GHBL 4OLXL 4Y19A 3OHXB 3HFMH 5C8JA 4APQD 4MA3A 4KGJA 5J6HB 5GRYA 3QDAA 1OP5H 4UB0L 5D6CB 1YEFH 1CLOL 2X89D 2LVEA 3OKLA 4BZYA 2XA8L 5DR5L 5E00B 1JF1A 3MO1B 5L0QC 1Q9WB 1T1XA 3BYYA 4M93B 4X6DA 5JORA 4MXQC 5CJOH 4S0SD 2YD1A 3KYNB 2Q76B 4LEXL 3O11A 5K59E 4JGJA 4J3UA 4PY7A 2GFBB 4WGWB 3VH8G 5FB8A 4KRPC 4YFLI 4PTUA 5DHXB 3B3IA 1OP3K 1KGCE 1XF5A 5FYLE 3OXRB 4LSPH 4JPKL 4XGZB 4D9RE 4MHHI 3SCMB 4O5LL 3ELAT 5C92A 1I7UA 4DKFH 2YEZB 1DSFL 3GBNL 1RHHA 2J2ZA 5DEGA 3QO1A 3QG6A 1LK2A 4WV1C 3RZCA 4XMLL 2Q87A 3ZE1F 5DMJB 4PLKC 2VL5A 5J1SC 4B7IA 3VGEA 1CLZL 3GKZA 1T1WB 3G6JA 4CJ1A 3TVMC 5HGDB 3WXVH 5FGCE 3FT2B 1MCWW 4NM4H 3B9VA 5DQDH 3S36H 1JHLL 5GZOC 2F5AL 3DXAE 3MGAA 4MXVF 4N8PA 4RA3A 4JPIB 4QGYA 3QUMA 3MV11 5F72S 1MCKA 3GSVA 1E4KA 1RU9L 3QA3B 4JJHA 4YDKH 5AAWA 1K4DA 1OM3L 1I7RA 5E2UL 3QG7H 4HIXH 1A14L 2GK0A 5FYJD 4Z7NF 4FG6D 4WHYH 4JJ5B 3HZKA 2P5WE 1U8NB 2VXTH 1D6EB 3ZDXE 5D1ZC 4U1IA 1S9YB 2RHEA 3NMEA 3OWEA 1PLGH 4G6KL 2EXYC 4KI5F 2IADB 4HAGA 3VXUA 1CG9B 1CF8H 5IESL 1IMHC 1A6ZB 3CU7A 3WHXB 1A64A 4JPVH 1JCKA 1NMAL 3SDXF 3H9SD 3P11H 4HBCH 5I71B 2BVPB 1A6AA 3G04A 3KJ4C 2RCSL 3TBWA 4NDMA 1QSEB 4LDEB 5DD3H 4P23C 5CAYB 2I5YL 3B9KB 4N5EC 4U0RC 1I85C 3VXQB 2IH1A 5J3HC 3V0VA 1OGAA 5C6PB 1NGPH 4JFXB 3VFUB 3IJHB 4X99B 1S78D 1MJ7L 1MIEL 1NDGB 2V2XB 4B7LA 4KQ4L 4WUUE 3W0WD 5I8EA 2VWEC 5F7DA 3H9HB 2YRPA 5LBSL 1B3JA 1NMBH 2AW2A 4IRJC 1I3RB 4KKLC 2WLZA 5ESQA 1J86A 2EKSB 3RWFA 4HJJH 5DVOA 3VG9B 3GJFH 4UIMB 1MHPH 2X4OB 1HXMA 3M8OL 4P46D 4YHKH 2XN9E 5C2UB 3KYKL 4HF5H 1CQKA 4Q6YA 1W0VA 3ARFA 3FL7A 4MAYA 1BBDH 4KHXH 2XQBH 3HI5H 3MRRB 5KANI 3FFCE 3O3BB 3PABB 1D5ZB 1DZBA 1A8JH 3KWWB 2PN5A 2Y9RT 1HYRC 1W0WB 1FO0B 2C4FT 3UTSA 1ETZA 1IEAA 1A6WH 4ZPVB 2CIIA 1KELH 3U4AA 1CFVL 1PQZB 1S7TA 5CJQL 1Q94B 4R4ND 1P9MA 4OD1H 5C09E 5EUOA 3N0PB 1LP9F 1UC6A 2JCCB 5JXEC 2I9LA 4KKAD 3VFNA 3LHPL 4F7PB 4JFYA 1EEQA 3U4EB 2OM5A 2DQUH 1E28B 5JIKA 3X3FH 3ZE1E 4YC2B 4Z8FH 1UVQB 3L6FA 1NAMH 3WXWH 4XPBH 3T2PA 1I1AB 2XKNB 4HK3N 3RWCA 1WZLA 2WZPD 1TVHA 2BHZA 2H41A 3O6FD 5E8OA 3ZT6A 1U95B 1RZIA 2C4XA 1TTUA 4LCIH 4NT6B 1Z9SA 1IL1B 3V6FA 1T04B 5E5MB 1HDMB 1CK0L 3NZ8A 2YPLA 5MEPA 3VDAA 4U1LA 2HT2D 2F58H 3PDOA 4EDXA 1G7JA 2IANB 2G5RA 4UQ3A 4P23A 3D0LA 3LRHA 3TZVA 2Z93B 3S35H 2OXGA 1M7IA 2F54A 2E7LA 3O9WD 4P49A 3FOMB 1UKTA 4Q6IC 1CBVL 4KI5E 4MS8C 4YUEH 1P4BH 5DMIL 1P7HL 1XT5A 2A77H 4P2QE 1U92A 3L7FB 1I8LA 4P5KA 2CK0H 4LEOA 4EUPG 2WIIA 4OCYL 1RZKL 4RNRB 1HHIB 1OPGH 1Q72L 5SWQA 3AS2A 4YWGH 4NUJB 3WO4C 1X9QA 4IRJA 4KTEH 1E4WL 5C0BA 3T1WA 2KL6A 1AGCB 3ULUH 5JHDE 4BQ8A 2HWZL 1AGFA 1KJMA 2DLHA 5F7FA 4HC1H 4H1LB 3RVUC 4H0HB 5B39A 3ARXA 4GSDL 4RBPH 1Y6NR 4MD4A 2K3TA 4GRWB 4ODWA 2BVOB 5E8EB 4JFZL 1U8KA 1FPTL 4FS0A 3CFIC 1EEZB 4ALAH 2GSGB 4HULB 2ESVB 5GRJL 4XP4H 4OCWH 1WBXB 1JWMB 3HC4H 4EXKA 5JZ7C 1Z9LA 4MNQE 2B8OT 3VRJA 1FE8L 1GL4B 4ELMF 4Z7OF 1TVBB 5DF0A 5EFIB 3H9YA 2C1OB 4PRIB 5JQ6H 5BJTA 5E6YA 4OI9A 3WLBB 4TVPL 1ZA6B 1CL7H 1EZVX 4BFGA 2CLZA 1TJGL 1P69B 3FN0H 1FG2B 5DO2C 1YUHB 5ANMB 4PRPD 4QNPF 3DI3B 3LRSA 2K7PA 4G7VL 3WCYA 1OT2A 1DBJH 5ALCL 1DUZB 4HGWB 3VFRA 3WEXA 3C5SA 2FEDD 1NC2B 1JGDA 4NO5B 1HSAB 1YEDA 2BJMH 2V9RA 3IFLH 1J8HE 1R3LA 1MVUB 4HWBL 3RI5K 4XBEL 4UNVA 3Q6FB 2VH5L 4PV8A 4N0RA 1CDBA 3FQWB 4QGTA 1T7YA 2CDEB 5C08A 1KTLA 3IFPA 4N90D 4XNQB 2F19L 4YXHH 1X4XA 3T0VA 5C0DA 3K2MC 3KPPB 4QTHA 4WHDA 4R3SB 4RWHA 4POZD 1L4IA 5JPMB 3VXME 4EN3D 2QQQA 1QG3A 4GG8A 1X5LA 3V95A 4F9LC 1NCAH 1EAPA 5IEHB 4Z77B 4X80H 4NKIH 3MOAL 4KMTH 3V0WH 5K9JH 2VXVH 2JK5B 4LAJH 1JNNL 1EO7A 5HGAB 2HJLB 4XCYB 4G8IA 5FHBH 4H20L 2EKJA 1DBML 1FZJA 2V7HB 2H3NA 2ICES 5H37H 4D3CL 3RWJB 4ZD3H 1XGYH 3PV7A 5DK2B 2LU4A 2BSSA 2WBJB 4H25A 4PRBB 5HHME 4XP9L 1K2DB 3HR5A 2J4WL 3EGSA 4XVSH 3VXSB 1GYAA 4RGOL 4JGUA 3RJDA 32C2B 1BHGA 4LARH 4OFPA 2DB8A 1JRHL 3NIGE 2A73B 2DIBA 3GSRB 3BQUA 5ICYA 4GQ9L 3VXPB 5DMYA 3I6GB 4M61A 3I6LE 1BP3B 2O5ZL 3VWJC 5HYSB 2D7PA 2FX8L 1U41A 1CZ8H 3WFZA 3Q1SH 3SGDI 1WTGT 3CFEB 1KG0B 5HHXH 4L8CA 1VFBA 1UEMA 4NKOA 4HFUH 3PWUB 1CDGA 3PWVB 1VACB 3T0EC 4IRZL 3MFGB 4JFEE 5GGRY 4OZGB 2H2PD 5DUPL 4AEEA 1QSFB 4U3CA 1X5YA 4X8JB 1D5MA 2XNAA 5SWSA 3GUTA 1PEZA 4TVPE 1GCFA 2NTFB 43C9A 1S5HB 4U6HB 2Q8BH 2NY6B 3TNNA 1BD2B 2OTWA 4ESKA 4PJAB 3MNWA 3D87B 2BRRL 2R1WB 4HJ0C 1BPVA 1QFWL 1RJZA 1OP3H 1X5HA 2DMBA 5EOQL 1JL8A 3G6JF 1VPOH 5LQBL 2XZAH 4X7EC 5CJXC 2R4SL 4Q7DA 1I8KB 3EYUH 3GSOB 4LHJB 4L4VE 3UXFA 1XCQB 1C1EH 5IB2B 4PB9H 3ZYOA 4WCYL 5DJAA 4KZEL 3OX8B 4ELME 2VZSA 1MQKL 1LO2L 2BERA 2VC2L 3CCHA 5D4QA 4KXZI 5J06A 2QHRL 3OJDA 2BDNH 1MCLA 4YHNA 2DD8L 1P6FA 3BO8B 1JE6A 1LO5A 2YZ8A 3EO9H 4IRSC 5IHBA 3DTXA 4X6FB 3MYJA 2O93L 5L2JB 4F9LA 1EMTH 3MBED 3DXAB 3D69A 1Z0MA 3RWIA 1NAKH 5IB3A 3GK8H 5CP3H 3QUML 2GSIB 3L3GB 1N6QH 2Y6SC 1C5CL 1HXYB 3PWPB 5EUKA 3RWHB 5GISL 4OZFA 3T0XA 1MHEB 4TSBH 1F4XH 3NN8A 3U2SA 3AXLA 3U36B 2P5WB 3TBVA 1R5VB 2X2YA 2GJZB 1C12A 3BKML 1AQDA 4ONGL 4Y1AA 3MLXL 4V1DB 3FQXA 5DHVA 4KK5D 5E94B 4OIIH 3BKYL 1KJ2H 1MFDH 1LILA 5D93B 4TNVF 1BECA 1IC4H 3B9AA 3RGVD 1H15A 4AG4L 3QI9B 1JN6A 4LLUB 3EDEA 2AV1B 4IHOA 4K3GA 3VWJA 1P2CB 2HLAA 1NUNB 5KTEH 4WENB 1PKQA 4NO3B 5BS0A 2FWOB 5DK0B 4YAQA 5SWZE 2RJMA 4KKBD 2ZG3A 2YK1L 5AG8A 3FQRA 5IJVB 3X14B 2AK4D 4Y19E 3VCLA 1QSVA 3T04D 2D4DA 5IKCB 2HA1A 1WEJL 4MJIE 3QSKB 5ID0B 3T0EA 4QXTB 1MCHA 3H7BA 1KPVA 4HW6A 3V6ZA 4OI8A 1MCRA 4JCMA 4MB3A 3RGHA 4CAGA 3FQNB 4WUUB 4X6DE 4YHPB 4QHMB 1NGXA 2P45B 2X7LB 3HUJA 3KPRD 4MXWL 2UZXB 2ORBH 4PJDA 3IDIB 3QIWD 4DGYH 2APFA 5D72L 4JKPL 4NZUH 3CLEL 3V5HB 1XR9B 4CMMA 3MUZ1 3BP6A 3CX5K 3L3DA 3ULVD 2VE6A 3IDXL 5MHSD 4LBEA 3EDKA 4FXLA 4YNYB 3O45A 2GAZA 2W07A 5ISZA 1EERB 3QO0A 1B0RA 5EUOF 3RP1A 3QUZB 5DD1H 2FD6L 4YDIL 2E6PA 2KQNA 3D39B 3QAZB 3DROA 3O2DA 4PJIA 2CIKA 5FKAA 4QRQB 1Y6KR 2BK8A 2RQ8A 1RFDL 1RZGA 2YS4A 4OTXH 4OLYL 3RPKA 2ED7A 3RU8H 4K9EL 3A6BL 3ARED 4Y8DC 2GJJA 4C83A 2AXJA 1JPFA 4HWZA 4IRSA 4JPWH 3TJEH 3QHZH 3LKQB 4XMPL 3D0VA 3DX9B 3FJTA 2Y5TB 3MROB 1QPPA 2DLGA 3DMMD 4L29A 2ZCKL 4NO0B 2VZTA 4X4MA 5B4MD 4FQCH 4XNMB 4U1MA 1G7IB 3FAXA 4X7CC 3V4PH 4F2MA 4QYOB 1FNSL 1QR1B 1J18A 4HS6A 2D7TL 5F9JB 2FX9H 1T7VA 4CUCA 3TPKA 1X5AA 3MLRL 4U1HA 3JV4A 4NOBA 2OQJA 4ZUTA 3RX5A 1QNZH 3CFCH 5TDNA 4XNUL 2VUOA 1CD0A 2C9AA 2VDMH 3VXUE 1QFPA 4XX1G 1JWUA 2Z91B 3IDYB 4JANA 3MXVH 5C07D 4HDIA 1S7RB 43CAB 3KPOA 3C6LA 4RIRB 3MMEB 4KJQC 4JO4L 4HX1B 5BRZA 3WSQH 4WNQB 4DWHA 3S37L 4KKCC 3G6AA 2NR6D 4PJEE 3DSFH 3PNWA 3ILPB 4I77L 1UCBH 1T22A 2YD6A 2HT3D 5AUMA 5IHLB 4BUGA 2HVKA 2PW1B 3IAGC 4KJPC 5FYJH 2V2TB 1MRCH 3DGGA 5B39G 5K9QG 5HHOA 1ADQA 4K7PY 1YMMD 4OCSH 2G5BB 3SDXB 2FR4B 2ARJA 4LIQL 5DQ9A 1FAIH 2FSEB 5I6XB 3U83A 3L9RA 1CFTA 3NH7L 1ZK9A 4JN1L 3UTTA 5ALBL 2A74B 3MRGA 2SEBA 4G5ZL 4WW2C 1OW0C 2FJHB 4KDTC 1KFAH 4PIRF 1CDCA 2R0LL 5IT2L 3VWKB 3DJ9A 1UZ6E 5JHDB 4N8CL 3GJEA 2ENSA 1R24A 3SPVA 4QRRE 3GDBA 1VFAB 4TSAH 2HT4D 4BQ6A 1TITA 1VFOA 4M3KB 1HYSC 2BY2A 1IZKA 2CGRH 3QDJB 4RMSA 2FLRT 1S9KC 4JREB 1S3KL 4K94L 3CX5J 1INQB 5JW4Q 3WDJA 1G9MC 3BPNB 4G3YH 1HHGB 3HE7A 2R4RL 4G7YH 1N2RB 3M17B 1QBAA 5INCA 4FQPA 4S1DC 5KS9A 1UB6B 3D6GA 4PPTA 2OZ4A 4LLMB 4AQ1B 2DLTA 5GRUL 2XPGB 5GPRA 3BPOC 1LD9B 3T3PE 2BXYA 5IFJA 4DKEL 4G6AD 1QZ1A 1BEYH 2HG5A 4XXCC 1XGUB 3T8XA 4XPAH 1MJ8L 4YDVB 4NRZB 3JBG7 5DJ2B 4FFZH 4PB0H 3D2UD 3F5WA 1NCWH 2R1YB 4Y4HB 1XFPA 4XAWL 5JIHA 1WIUA 2FO4A 2XZQL 1N5YL 1R3IH 5EWIH 1UWGL 1HILA 3AUVA 1YJDC 1UH2A 2CDFA 4H5SA 3LV3B 1TJIL 5DRNA 3O6MH 1U8PB 4Y5VC 1T1YA 2ADFL 1CT8A 3HI1B 1KB9K 4FQHB 4ZPTB 4GRMA 1OWRM 2GYSA 5HVWA 2PCPA 3JWDC 2CLRB 3MLWL 4M7JL 3SJVB 2AXFB 4LKCA 4CVXA 5C0NC 4R2GB 5I66A 2Z8SA 2A6IB 3QQ4B 3HRPA 5C1MB 3CLFL 1LP9B 3GIVB 4G9FD 2YPLE 5DRWB 3VJ6A 4GUPB 1J5OL 1IQDA 1RJCA 4O51B 4L5FL 4C57C 4CU6A 4F3FB 3VFMA 3U9UA 4DZBB 3MSPA 4NRYA 1KPUB 4RAUB 4I3SH 4AL8L 5KVFH 3CPLA 5EU6E 1AJ7H 2XWTB 7FABL 3T3ME 3DI2B 4KTDH 1U8MA 4OLWL 1CXIA 4YLQT 3IJSB 5EO1B 2KZ1B 4DCQB 3H42L 3GMPA 3BN3B 2Q20A 4PUBL 4LIQE 3B8YA 3RKPA 1KCLA 4LCCB 5I75B 5BZDA 4ZUWB 3LVEA 4I0PD 3FHAA 1WLHA 2EH7H 3EYQC 1Q38A 3GHEH 1F11B 5IVZA 4R4FL 3U0PB 1DR9A 3THMH 1PYWB 4RQQA 3MRMB 4Y16D 3LPWA 4YE4H 1D6VH 1OW0A 5C0BE 3UJTH 2FGWH 3VXRD 3JUZA 3MR9B 5KN5B 3CUPB 3RIFF 1G6RB 2VABA 4MB4A 3BE1L 4LHUD 4CNIA 5MEOA 2J8UA 1XGTA 2ENYA 3DVNA 1L0QA 3R1GH 5DK3A 1J0JA 4W4OC 5TF1L 3L3IA 3RL1B 4LGPB 1I1CA 4L8SA 4RAVB 3IFOB 1CTNA 1T7XA 1K5NB 2W38A 2AJ3B 3H9ZA 1WV7T 1JI1A 1FH5H 5IR1A 3SGDH 1EHLH 2ADJB 2FYYB 3LY6A 4G8GB 1NCNA 1DDHA 5DD0H 4LKXB 1XF3A 2BNQE 2OTUB 4JG1L 2XXCB 4Y7MA 2FIKB 2Y7QA 4KROD 2VAAB 4XXCA 5HDBF 2DTSA 4P59H 5DRZB 1IGTA 3V6OC 1FIGH 3Q5YA 4FZEH 3L3HB 5HHVH 4YO0B 1CD1A 1QYGL 3BXNB 4KH2A 3MRDB 4S1RL 1HEZB 4PTTA 3JXAA 3HI6H 4Y5VA 4JLRB 4Z7QE 5ENWB 3OAZK 4ELMB 5JLZA 5C6WH 1XZ0B 3SY0A 3MRPA 4NQXB 5JOPD 2EIDA 3E2HC 3L95A 3MRBB 4JFDD 5C08E 3TBTB 1A7OH 4BQ9A 5T5FL 3ZKNC 4OZFG 4PG9A 3CU1A 1KB9J 3I9GH 4OKVB 3MRCB 4YXLL 5IFAH 3RVWD 5JW4R 4J8RB 4QRPA 5IWLC 4NQVB 3EFFB 4K3HA 3BJ91 4HUWA 4NFCA 2DLIA 3BT2H 2IAMA 1NBZB 2IPKB 1N59B 2P8LB 5TQ0H 4CU7A 4KXZH 4K55A 1FFQA 2OR7A 3O3DB 1FVCB 5FGRA 1MCOL 1UENA 4U1NB 2KPNA 4Y88A 3FT3A 3Q2CA 3WYRA 4P0DA 5J57B 2P8MA 3K7UA 1JGVH 3QDGB 1UACH 4YJZL 1BQHB 4CADA 1S7WB 2C7UA 3H2WA 3MUHL 4WEUD 3R4DA 3SOBH 4QT5A 4BZ1H 2G60L 5FM5O 5IQ9B 4K7FA 4CN4A 4ISVB 3RNQB 4MMXC 4WGVB 2DJ4A 3G5XB 3W2DH 3FQUA 3TPUA 2VDKH 4H0IA 1H0DA 1OCWL 3CVHA 2AJUH 3HUJF 2EO9A 5J0BA 3HLAA 5C0AD 4PJDF 1KCKA 4NC1C 2UY6A 1FYTA 3O0RH 5I8KH 3B9EA 2NMSA 5JNYA 3F7VA 3RTQC 2R29H 4MJ6A 2PYEB 2PXYC 3JWOC 4KVNH 4GRLD 4W4OA 1U8JA 5C8JB 2YN3A 4MA3B 1SEBB 4C59B 5D5MB 3OGOE 1KV3A 4W6WB 4WIQA 2MKWA 5DGRA 1A5FH 1YNLL 2IBGA 2J88L 4OUUA 1ZHLA 4LSSH 4X7TA 3OKLB 1BIIA 3L5WA 3WKNA 5SWSE 5EIIA 1DFBH 1T1XB 1S9VA 3F7RA 5HYQA 5INDA 1HE7A 4KJYB 4PJIF 4YHYC 4FQIL 4G8EA 2B4CH 2PUQT 1CFQA 4X8XA 3O11B 3QCUL 1FZMA 3BD5A 4PY7B 2CO6B 5FB8B 3V6OA 3SDDC 3WD5H 3B3IB 4UIKH 2YUZA 1MLBA 2P47B 1A47A 4HZLA 5C0FA 1QKZH 2YXFA 4YHMH 5D7JC 4NOFA 1R3HA 1NGZB 4UU9B 5TE4H 5DEGB 1MVFA 4GAFB 5I76B 4PJ9D 3FO2A 3QG6B 4ZS7H 5KAQF 1LK2B 3RZCB 1G0DA 2DM4A 2E8YA 2VL5B 4RFNB 4JZNA 4D9LL 5KAQG 3G6JB 1U3JA 5F9WC 1DQJB 5E03A 3RDTD 5T1MA 1IC5H 3ULVC 5DMGC 3IT8D 1T80A 3GSVB 5D7SH 1K4DB 4XXDA 4Z7VF 2DL9A 4KHTH 3OBAA 4TUOB 4YQXL 4EI5D 4PLJD 5BMFL 4XCNB 1BQSA 4E42A 4HKXA 5A1AA 1I9IL 3HR6A 1MFBH 1U3HD 1MOEA 5DJXA 3QNXA 3O3AA 5HI4C 4PJ5D 5GGQL 5JO5B 3ZO0A 2RFXA 4U1IB 3D25A 4FABL 5J11B 2NY7H 3L3OB 4Y1AE 2LTQC 2NY1D 4FXGA 2F53A 1INEH 4LASL 5DHYB 4OFDA 5GS1A 1KIRA 3K4AA 4Y2DC 4ZSOE 3ARDC 2IQ9L 3HNTL 2VNCA 4ODVH 4M6OH 3DBXA 4R0LA 4F7EB 4WU5A 3CMOH 4OZ4A 4K7PL 1KEGH 4NDMB 4HIEA 1T6WA 3OKNA 5GGSY 5FF6B 1PKQE 2YD8A 4U05A 3ARGB 1PG7H 5KSVB 2B1AH 3RTQA 3PUCA 4YHZH 4KMQA 4WWID 2PXYA 3ECBA 2X4TA 2IH1B 1N4XL 2A6JA 1OGAB 1NL0L 2QL1A 1XR8A 1VB9A 1O7SA 4W6XB 1R5WB 3KPQA 4WEMB 1WF5A 4XWGH 3L1OH 4HGMA 1UZ8A 5L0QB 5I8EB 5F7DB 4NQSB 1M1SA 5CILH 2OXHA 1KIQB 2PR4H 1KC5L 4X4ZA 1JPGA 4PJCA 3SCMD 4MJ4A 2X4QA 4U6XA 1Y0LA 5E6IC 4JFHD 5F89B 3RWFB 4DUWA 4RX4D 4U31A 2QQNH 2Y36L 3CSBA 4KRPB 3SDDA 1HH9B 4LSRH 1ZT4A 2J1KA 5JW5A 4YDLC 5ISZE 2ICWA 1NH6A 1ZS8A 1SY6L 5D7JA 1JHKH 2DQJH 5EOCJ 1W0VB 1Q0YH 4LSTH 3X12B 3VD5A 2BRQA 4Z0BL 3TCLA 3HAEH 4WV1B 2QQKH 5EZIH 4LSUH 4HS8H 4M62H 5ICZA 3TH4T 1C08A 3MUJA 4GG6A 3UTSB 1ETZB 1IEAB 3Q0HA 1BWWA 2FHFA 2BMKA 2YUWA 3VI4F 5FFLA 1YMHB 1A6TB 3MV9A 4XC3L 3TVMB 3FAWA 3DHMA 3ILQD 3BRDA 1RUPL 3LB6D 2UUDK 2HFFB 5EUOB 1FNLA 3RWEB 4X4ME 4WI5A 1WFTA 5HHQA 5JDSA 2I9LB 5DJZB 2CRMA 1A3RH 1CE1H 1MRFH 4JFYB 5GSRA 4E9LA 5IP4A 2GJ6B 4ZO7A 4G6ML 1CYGA 2BFVL 4LLWA 1E6JL 3L6FB 3VGDA 4UB0H 5D2LA 4MA8L 3ULUC 3GJFA 2ITDB 5D1ZB 1TVHB 5FO8B 1I3VA 3QFJA 5E8OB 2KBGA 2CSPA 3P4NB 4CJ0A 1QSED 5A40E 4E41B 3S8WA 3B9KD 4BJLA 5IQ7L 4JZJC 1IM3A 3NZ8B 2CPCA 5MEPB 1I7ZA 5CSBA 4LU5H 4U1LB 4MD5B 3P3YA 3KJ4B 2XY2A 3D3VB 3MOBH 4AMKL 4EDXB 1G7JB 4L3CB 5AZ2H 3TWCL 4WW2F 5BRZE 2V5SA 2YC1B 4P23B 3PL6A 4O5LH 5CD3A 1BF2A 3BWAA 3D0LB 4GXVL 5JDJA 5ITFA 4BELD 3WKML 4U0RB 2F54B 3U0TA 1YYLH 1DSFH 2FEEI 3PGDA 4LLDB 4R6UA 1OY3B 1TZGH 4OB5H 4FQ2L 5IK3A 5LAXA 3P0YL 1U92B 1M4KA 4P5KB 5I1EL 3AM8C 4LEOB 3SO3C 5I15H 4Z0XA 1QHPA 3V6BR 1MSPA 5SWQB 3OKDA 3PJSA 5HD8D 4IRJB 2D7OA 4KUCF 1NAMA 1JHLH 2F5AH 3G9AB 2QSCL 3MCKA 3MLTB 3QXDA 5FA3A 4PGBA 3R06A 4JRWA 1RU9H 5DLMH 3UJJL 4OLZL 5B39B 2APTA 4OM0L 3IJYA 2NY5C 4ODWB 1DP0A 1U8KB 4OIAA 1HKFA 4PY8J 1YNTA 2VLLA 3F7QA 5E4EC 4K23L 1OL0A 1CLYL 3VXNA 1BVLA 3P73A 1E4XI 1WC7B 4PP2A 1YEEH 2JB5L 3KLSA 1FRGH 2VLJB 1T2JA 1LMKA 5KS9E 3VRJB 1BZ9A 4LLYB 3AFLA 4K3JL 5KSBA 1EHXA 2P5EB 2Z31C 1IKFL 4NPYA 5IESH 4NZTL 1NMAH 4W68A 1B6UA 1N5AB 2IPTH 2MMXA 3I2CL 2CLZB 2OL3H 1F4AA 1DQMH 4UINH 5D1QC 5D6DC 3AGVA 5E24E 2RCSH 1P7QA 1M71A 4LP5A 4WEBL 3OKKB 2X4PA 4XWOC 1I1AD 2I5YH 2B1HL 5A43C 1LWRA 3VFRB 1TCRB 3WEXB 3C5SB 2R2HB 1JGDB 1IGYA 2R23A 4WI8A 1MJ7H 1T1ZA 5HYJA 5T3XL 3S9DB 4HC1A 3MRFA 1J1XH 3BGMA 3TFKD 2NX5E 4KQ4H 3VI4E 1SBBA 2QR0A 1OLZA 1IAIM 2ZNXA 3WE6A 1KTLB 3OPZL 4OF3A 1IGML 5CMAA 5LBSH 3IFPB 2HYMA 5I73C 4MA7H 2IAND 5C0DB 1R0AL 4GMSL 4MNGB 5FCUL 1G6RL 1H3PL 5F97E 4QTHB 4CDGC 3B6SA 3EJJX 2CKBL 4JZJA 5L2KA 4BH8A 1EAPB 2VDRL 4QHLA 3GM0A 5D7IE 2CD0A 5SX4I 1JPTH 1ZTXL 2NY3C 4J3SA 1YQVL 3ZTJG 3N9GL 5BVPL 5E7BA 4J3XA 3M8OH 3VU2A 1QLEL 3TO4D 1UWEH 3VMNA 1JPSH 1T6VN 5DXWA 3SE4C 2JE8A 2V7NB 2D7NA 4G8IB 1FZJB 4KZDH 5HPMB 3TIDA 4NHCL 4Q6IB 1S7VB 2BSSB 4P2OC 1WZKA 4H25B 4YR6A 2DQHL 3BAEH 1FHGA 2FX7L 4H8WH 4DUVA 4Z5RB 3HR5B 2R0KL 1I9JH 1RZJC 3IAQA 3RVWC 3MV8A 1RJLA 1AD0A 5MERB 1KN2H 3WO4B 2ESVD 5ICYB 4K3DH 2F8VA 4M61B 2FZ3A 4NGHL 1CGWA 3CVHL 3S4SA 4U3XA 4HKJB 2ZOLA 1F58L 4NIKB 2J8UE 1X5IA 3EYSL 4L8CB 1VFBB 3P9WB 1ITCA 4NKOB 3S5LA 1XF2A 4PRID 4GW1B 5F7EH 5FA4A 1YEKH 2OBGA 5MENA 5LGKA 1PSKL 2E9BA 5EU5A 1KLUA 2XNAB 4IM8A 4S2SB 1A7RL 3VXTA 3MFFA 1IAII 43C9B 5BO1H 5LCVH 5AZEL 2OTWB 5EOCH 4XHQA 2ICEB 2XTJE 2EDHA 1CK0H 4LVOC 5AEAA 2DKMA 3P40A 5HVHC 1I8IA 2DAVA 5EZLA 1AXTL 1NC2D 4URTB 1U8LB 2DTML 1A6UH 2ZUTA 2CMRL 4Y5YA 2EECA 3VFSA 1MPAL 2ZCHL 4P9HL 2EDEA 1AKJB 4L9LA 4KWUA 5TE6H 2VQTA 3D48R 5DJAB 1SYVA 2O5YH 4WFED 5IOPA 4IDLA 1RUAL 3WLWC 3LN5B 2CJUL 1QSZA 2D03H 3IKKA 2G2RB 3OJDB 5JIPA 1AFVL 3QNZA 1XGQB 3LS4H 2R2BA 1DTUA 4ZXBC 4XP5H 3DRQB 1Q72H 2APVA 1LO5B 1Q9LA 1KOAA 4NCC2 2EDRA 3BJLA 1E4WH 2HWZH 1ZA3A 3MUY1 1NUGA 3HFML 2WUCL 3RWIB 1VKXA 1YEFL 4WJ5A 3MV7E 4JFZH 5IB3B 2WBJD 5ADPH 3EJYD 3SE3A 1FPTH 2P48B 5EPMB 1X6LA 3FTGA 4OBSA 5GRJH 5HGBA 3VXSD 1V3KA 4OZFB 5DDHA 3NN8B 3AXLB 1VDGA 5CJOL 3EZJB 4TRPH 3TBVB 5JOEA 2NY4C 4X6CE 2HFGL 3O81A 1AQDB 4L4TA 4CN6A 1NFDA 3BN9C 2XG4A 5DHVB 4Y4KC 3QXAA 2VZVA 3L3KA 4OGXH 4PRHA 2ZUVA 2R9HD 1G0XA 4LSPL 4TVPH 4WTZA 4EVNA 3J8F7 1MCCA 4D8PA 3VMPA 3ARZA 2GT9A 4NSKA 1FVEA 1H15B 1U6AL 3E6FB 1JN6B 3HS0A 2ZSWB 3L5JA 4HG4J 1YEGL 3EYOA 5TF0A 4PJCF 4F37K 4NQEB 4NWTH 4LFHG 3VWJB 4FQQA 1QSFD 1PKQB 3ARUA 4G7VH 3SE9H 2YD4A 5BS0B 1HNFA 5EBGA 2DLEA 4YAQB 5DJ8A 3FQRB 3MGTA 3TF7C 4WHYG 3LQAC 3HZMA 2NY6D 4BFIA 4CRPA 5IMMB 1BD2D 3NCCB 3T0EB 4HWBH 5GS2H 3H7BB 3SDAA 3V6ZB 1T0MA 3O6LH 4NM4L 4ODHH 4POUB 1N0LA 2AKRA 3RNKB 5CP3A 1SHMA 1KGCD 5FYLD 3OGCA 5I8OH 4JHZA 3HUJB 1TZHA 2NQCA 4PJDB 1DCLA 4ONHA 4GG6F 4UI2A 5ESVB 3VDCA 1EFQA 1KIPA 3S3PA 5D9SB 3P77A 4LBEB 4P3WA 3O45B 3V4UL 5J56B 2GAZB 3F12A 3QO0B 1PLGL 1KJ2A 2VMFA 3QDMA 3V2AR 4D3CH 4JPVL 2GY7B 2CIKB 4PJIB 1F3JB 1AO7A 3GSNB 3DXAD 5D2LF 2EDLA 2J4WH 4HKBA 4RGOH 5F71A 3ZE2E 5DD3L 5F44A 1CDUA 3VFVA 4PJBE 1JPFB 4HWZB 4IRSB 3PWPD 4M6NL 3D0VB 4GQ9H 1NLBH 5CZKA 1ZOXA 1VEMA 3QCVL 1EJOL 4C54A 5DURB 1NGPL 2P5WD 4L29B 2GITB 4UILL 5D7LA 1S8DA 3O8XC 3Q3GA 1FL5A 1MJJA 4OZIA 4U1MB 3HC0A 2UYLA 5EULV 4ZFFA 4V1DD 1ZGLM 1QOKA 4U6VL 5E8PB 2EEDA 1EHAA 4IRZH 3AS3A 4FTVB 2EZ0C 3BH9A 2PW2B 2ADGA 5I9QC 5DUPH 4U1HB 3JV4B 4R8WL 5FGBC 4ZUTB 3QUYA 2BSED 5TDOB 3UROR 1P7KA 3QI9D 2NPLX 2GKIA 4JRXB 1NEZA 4HJJL 5TDNB 5DYOB 4JQVC 4Y4KA 5FO9B 3FMGH 1JWUB 1MHPL 4ODSH 3RVVD 4LLQA 1IGCL 1CCZA 1QFWH 4JANB 3BD3A 4YHKL 2EXWD 2XYCA 4PGCA 1DVFC 1OT1A 4TPRH 1EIBA 5E5RB 1T7WA 4HDIB 1Z2KA 5FYKL 1MCWM 4Z7VB 2CDGB 4OKDA 2ARJQ 4FP8H 2XQBL 4NC1E 2E9JA 3HI5L 5BRZB 1JZ6A 3BW9A 1MWAB 2AJZB 1ZXQA 2L7UA 4M9OA 4UOJA 3PWLA 3PNWB 3QRFM 4WUUD 3QEGL 4I48A 5ERWA 3MRNB 4UBDC 1A6WL 5GS0D 1D9KC 2HVKB 1V3LA 3IDJA 3T4YB 5HHOB 2EO1A 1TTFA 1U42A 2VC2H 2A6KA 5DQ9B 2ZG1A 4YGVA 1CR9L 3L9RB 2DD8H 1CFTB 1ZHKA 1JVKA 1KNOA 2VXQH 3UTTB 1MIMH 4QWWD 2B7DT 2C3HA 5KSBF 4PJCE 2SEBB 3BEVA 1KCRL 5C70A 1F6AA 3QUZD 4KJWC 2DQIL 5IBTH 2CRYA 3X3FL 4Z8FL 2MFNA 1R24B 1KTDA 4FN0A 5I19H 1OQXA 1NAML 3D39D 3HCVA 4OV5B 3EJZD 4RGNC 1C5CH 1ZSDB 4TQEL 1FLRH 4K8RL 5FHAH 3TM6A 3LPGA 1QPXA 1RIHL 4HWUA 5C0CB 4NNYA 1MCFA 2EDDA 3RY5A 4YEEA 4TUJB 5INCB 3SDCC 3JTTA 4ONGH 1JIBA 3MLXH 3ULUF 1P5UA 2F58L 4GG6E 2V9TA 4NO0D 3BKYH 3REVB 3W5MA 2DQFA 4HK0A 3MV9E 5DMKA 6FABH 1E4XH 5E70A 3FO1A 3S37X 1A0QL 5JUEL 5E95B 1VCAA 5IW1B 3T8XB 5FM5M 3KNBB 5C0EA 4MNHA 4J3TA 3OZ9H 3KDMA 1P4BL 4NKMA 1HILB 3O8XA 2R56L 4MMZC 2A77L 2CDFB 5I1AA 4H5SB 5FO7B 1IJ9A 2DM2A 3S7GA 4J2XA 3NABH 5DRXB 5E1AB 1K85A 1T1YB 5GZNC 1CT8B 5D2LE 4K07A 4RCAA 5FCSH 4YWGL 3H9SA 3MCLL 2PCPB 3QFJE 4HC1L 4U2YA 4LKCB 4MCZA 5DUBB 4F57L 3OKOA 2NXZC 1I3UA 2VZ1A 2J8OA 4MXWH 2YPKA 2Z35A 2XWBA 3BPLC 5D72H 4DEPC 1DVFA 3CLEH 4ALAL 2ITCB 1JNJA 2ZSVA 1JNLL 1RZFH 2GTWB 4P2RA 1D5XB 5CZVH 3IDXH 3I02B 3HC4L 3EO0A 4KI5D 3ZHKA 4F8TA 5J4MA 4AENA 1ND0B 4NQDE 3G08A 1U8MB 3W0WA 4M43H 4JFQA 5JQ6L 2WP3T 3GMPB 4N0UA 5SX4H 4DAGL 4PJHE 3S4SG 3I6KA 1YN7B 5E9DE 4XMKH 3VWKD 5CEXA 5JHDD 8FABA 1FGVH 5E8NA 3MLYH 5B3NA 5IVZB 3S5LG 4NQCA 4QKXB 1X4YA 3DIFA 4PJXA 4ZQKB 1XIWC 1DBJL 1A3LL 3QDJD 2BC4B