2VWEC

Crystal structure of vascular endothelial growth factor-b in complex with a neutralizing antibody fab fragment
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
214
structure length
214
Chain Sequence
EIQMTQTTSSLSASLGDRVTISCRASQDISNFLNWYQQKPDGTVKLLIYYTSTLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKTLPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR B
publication title Crystal Structure of Vascular Endothelial Growth Factor-B in Complex with a Neutralising Antibody Fab Fragment.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 214
sequence length 214
chains with identical sequence J
ec nomenclature
pdb deposition date 2008-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vweC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vweC01
3FRPA 2BCKB 3VXUD 3BKYH 3LH2L 5I1CH 3QPQC 4HFWB 3G6DL 4RIRB 1PG7L 1MCKA 2VXQH 1HXYA 2YPLD 4KQ4L 4X4ZA 5I1IL 4D0CA 5DR5H 3SKNA 3ZDXE 4LKCA 5E08L 5E2UH 1WWWX 4QHUA 4EN3B 4KUZL 4S0SD 5GGRB 3SGEH 3DTXB 1KG0B 3MNWB 4N1CA 3DX9A 3EUUA 1DLFH 4HV8A 3TH2T 3FO1B 1FVEB 3V7MA 3JV5A 5D7JB 1IKNC 1UWXK 1FYTE 1NBVL 1EO8L 3GKWL 4XPBH 1DUYA 2R0WL 5HPMB 5LXGL 2OP4L 1CGVA 2WIIB 4LVOB 5K9OA 1BX2B 1CXIA 1P69B 5D9SB 1AGBA 2L4OA 5F9JB 4MXVF 2X40A 2GUOA 4RQQB 5AG8A 2DMCA 2X89D 2DWDA 4PGZA 4JM2D 2WLZA 1W0YT 1TLKA 3VD4A 4O00A 4EZMA 4ZFZA 4PPTA 5I1LA 3DXAE 1F13A 1GGUA 3FB7A 5ADPL 4LRIA 5INCA 1UB6B 3AUVA 2VLKD 2YWZA 1AGFB 1KB5L 2EZ0D 1KENL 2C1OB 4QRPA 3WFHB 1RZKC 3TA3D 1OHQA 5DJXA 4N5UA 4P2RB 3ABZA 1S9YA 3QUZC 4YHML 1ZKAA 2AJSL 4HPOL 2DLGA 2W60A 4R0LB 3D39D 1XGTA 4JCMA 4RDQG 4JRXE 4YHIB 3GJFH 1FNEA 3SKUD 2IQAA 2YPVH 3GMOB 4HUWA 2P43B 3WMSA 1KCUH 4JZNA 3SCMB 3BZEB 4UUJA 5TDNA 1DBML 3PE9A 4Z7NE 3C5JB 4LSRL 1NGPH 5E2WH 5EZJB 5A2FA 3HPLB 5GGTA 3LOWA 4OGAC 4MHHI 5DMGC 4RAUA 5C0IA 1RIHL 3HZVA 2AQ1A 2CKBB 4MWFB 4TPRL 3PF2A 3TJEL 2VABB 1OARL 2FO1A 3MOQA 1OPGH 2RQ8A 3NPSB 3WHXA 5IV2B 1A4JA 5KAQF 3C5ZC 1U3JA 4L4VD 4OCXL 1F11A 1QSEE 1DR9A 4NUJA 3T4YA 3V0WL 2EIDA 3RDTA 3D48R 4KJYB 2F19L 3VMNA 2UZYB 4PG2A 32C2A 4ZAKD 2DQGL 2HJKA 1S9XB 3HFML 5D7SL 4G43A 4DGIL 2PCPB 3P0YL 3MLWH 2Q6WA 1EBPA 1ZLUH 3S5LA 1MJJB 5F3BA 4HKZB 4LVHC 1AR2A 4OZFB 5F7UA 1A5FH 1RJLB 3MLTA 3NCCB 3X12B 2PO6B 3VWJA 2YK1H 3ZTJG 2PYFA 3NCYP 2CH8A 4NO0B 2X2YA 2EECA 4FZEH 2EDKA 1RVFH 1U8JB 1I3VA 3PJSB 3HZKA 3DUSA 3IDJA 2OQJB 1QBBA 2JCCE 4L9DA 1L7TL 4NZRH 1VACA 3H9YA 2ZUYA 4GRLC 4W81A 4NKMA 3TO4D 3MGAA 5ID0A 5IHBA 1FVCA 3H42H 5I1EH 2H9GA 2R1YA 4BSWA 2WP3O 2FRGP 4OBSA 3T0EE 1SJHB 2BMKB 3M1BA 2BX5A 2JKXA 5ACMA 1X5KA 3MGTB 4NC1E 1X5JA 3QB7C 4BZ2L 3V6OC 1IEBA 1RU9L 2YS4A 3BEWB 1KULA 3VW3H 1XGQA 3S37X 2MPAH 3TT1L 1CL7I 1J1OL 4Z0XB 4DAGH 4EOWH 1AI1L 2G60L 4K7FA 3VD3A 5JIHA 1KCVL 2Q3ZA 1YEHL 3O9WA 3MA7A 4UQ3A 1KTDA 2Z31B 4M6MH 1NCBL 5I8OL 5CSZB 4DKDC 4MVBD 4TVPH 2ADGA 2EDEA 1G9NL 4Y4KA 4XC1L 3WYRA 3DX7B 1KXQE 5T3XH 3TBYA 1R5VA 1G7MA 2ORBH 3RY4A 5KW9H 1UWGH 3MLYH 1FHGA 1K6QL 3OAYK 2ATPB 4JO1L 4PJ5E 2EDRA 4FG6C 3UBXG 3UC0H 5JIKA 3VFNB 4RGND 4YGVA 2V5TA 5DEFB 1S7XA 2C1PB 2DRUA 2ZP0T 5E00A 4M6AA 1LEGA 1M4KA 1BFOA 4F58L 5JDSA 3LN5A 1Q8MA 2YPVL 4ZS6C 1YC7A 4MA1B 25C8H 3BEVB 2BNRD 1UJ3A 3OBAA 5JOPD 3ORJA 3BQUD 4NRZA 5HYQB 4JY4B 3ZKMD 2DQFB 2W65A 1I8LC 3QO1B 2GITB 1DANT 4E5XA 1JIBA 1GOHA 4G6KH 3W0WD 3AREB 4R97B 4M43H 4P2OD 2HWZH 4H1LA 1KSRA 5HHQA 2DN7A 5TF1L 4HWZB 1XF4A 4QHKI 1DEEB 2ED7A 5D5MA 2R69L 1AGEB 3QUXA 4PY7A 4QWWC 1A6VL 5C70A 3O4LB 1T20A 2NY2D 3KGRA 4LCCA 3U2SA 2BP3A 4C56E 3WIFA 3MRIB 4XH2B 3TBWA 2B0SL 2GK2A 3VXUE 4HX1B 4QTHA 2NCMA 5A2LH 4UV4H 1MI5E 1X4ZA 2H8PA 1YJDH 1BOGA 3TBSA 3FQWA 4G7YL 2YPLE 4OCYL 3WHE0 2FGZA 1JGEA 4EKXA 3FRPG 5D1ZA 5F7YC 1LDSA 1T04B 3P9MA 4NQDB 1XGPA 2XI9A 3BP6A 1MY5A 1WVZA 1QEWA 2UWEE 2V5YA 1ZWIB 2FEDD 3MCKB 2FECL 4OD1L 3RWCB 1JV5A 1YC8A 5GSRA 1SY6A 3RNKB 2VIRA 2DYPA 4AMKL 3T77B 3QCTL 4M1CC 4PRIA 2MHAB 3QJFB 4HUMB 2B4CC 4WTZA 4WUKH 5FO7A 4NWTL 2WBJB 4HC1A 2CDFB 4WW2A 5JPNB 5AZ2H 5DSCB 4XBGB 1XH3A 5TPWH 4TULL 5BRZD 2OR9H 3IXTB 4X8JB 4XPHL 1F42A 1J7VR 4RDQF 5DD1L 1QBAA 3IKKA 1UQSB 2VZTA 4XP4L 4KI5C 4I2XE 2VLKE 1I9IH 3WJLA 2EKSA 2JTDA 1WLHA 5L0QB 2X42A 4WWKA 1IAKA 3BAEL 5J6GB 2BVPA 5KSUA 2XKNA 5GRUL 3ELAT 4JRYD 4CUCA 3HG1A 1KJ2B 1Q0XH 3LRSA 5IW6B 3D39E 4Y2DB 4I48B 5FYJU 1V7NL 3LQAC 1IM3B 1KPVB 1S5HA 2LE9A 1A9BA 4PS4H 1CFTA 4YFLF 5AD0A 1FYTB 4Y19A 4GRWH 1M71A 1ETZB 4CAGA 5A16B 3PDGA 5ALBH 1P9MA 2A83B 3C09C 4R26H 1NDGA 4W4OA 5FHBL 3H9SD 1QKZH 1T5WA 4PV9B 4MA8L 4DQOL 4PJDA 4ZXBD 3QQ3B 2IBZY 3SGDI 5IJKC 5GGUA 1IM9A 5E1HB 5IMKA 1ZMYA 4MD0B 4L3AA 5EU7C 2HKHL 3Q6FA 4L4VE 3DMMC 2VN4A 1OSZA 1HHKB 3BD3A 3FTGA 5IBUG 2IFGA 5JLZA 4ZNCD 3U0TB 2NY1C 2KPNA 1Q1JH 4A6YB 1AFVL 1EUTA 3MRFB 4YHKL 3RL2B 1CXKA 2D4DA 2EEDA 1KJ3L 1TZHA 3SN6N 3TO2A 3AS1A 5DJCA 2HFGH 4C59B 1T0MB 1N7MH 3FAXA 4QO1A 3BKML 2VZVA 3TYGL 2V7HB 5C0CD 4LAQH 4P0DA 4ZUUA 2XQBL 7CGTA 4AQOA 1OB1A 4Z7UA 1K3IA 3REWB 4YDJB 4PJCF 5HJ3B 3EHBC 3S5LG 1D5IL 1NC4A 4TVSa 4PRBA 3ZE2F 1D9KD 5A2KH 3OKLA 1HQ4A 4PIRF 5IT2L 4M62H 3HI6L 5FUZL 3G6JE 1V3LA 1YEDB 1VGEL 4YO0B 2XFXB 1E4JA 4W6YB 1KTLB 4KROB 1LK2A 1I4FA 1FYHB 1I1YB 4M7JH 5MHSD 3VRIB 3QG7H 4U1LB 4E0RB 1KIPA 2X6MA 3IU4L 2HG5B 5FXCH 5LQBH 4G9DA 1U3ZA 1R3LB 4Z18A 1QSEB 3QI9A 4PJGA 3GIVA 2XIDA 1NSNL 3MYJB 1UYWL 1GC1C 1JWUA 3NFSL 3CPLA 1A7PH 1OL0A 4KV5F 2CO6B 4RMWA 1RHHB 2QHLA 1ZSDA 4HIHB 3PNWA 4KTDH 4OGYL 4OIIL 4Z5RB 4GMTL 4HUXA 4Z95L 1WBZB 2VR9A 3TCLA 5E8DL 2DQTL 4GKNB 3NBNA 4JPIA 2YD4A 2XWJB 1OTUC 4U31A 2P24A 2GJ6D 4RGNE 1N4XL 1OAYL 1MWAL 5BOZG 2FGWH 2BVOB 3HR5B 3PGCB 4TOYH 1UXSB 3T8XA 2EDWA 4KGJA 2XTJC 4JDTL 2BOBA 3T0EB 5E99L 5C9KA 3HE6C 1G6RH 1DQMH 1NJ9B 3OKMA 2BNRE 3QJHA 4JFYB 2QQKH 4XI5C 5DD5H 3N06B 5JOPE 2A9NH 4BZ1L 4P57B 2XG5A 4HIJA 4GRMA 4ZUVA 2PTTA 2HT4C 4XXCC 3F7VB 4WTXA 1E4WH 4N0CD 4FFYH 3L7EB 4OB5L 3WEXA 3B9KC 1ZS8A 3V4UL 3W0WE 4DK3A 1TVHA 1JGUL 4AYFA 5ABDE 4NHUB 2NY5L 5F1IB 5GHWL 1CE1L 4F3FB 1QHPA 4APQA 2F54A 3FQTB 1JYVA 5F7FA 3FQUB 4HF5H 4PJ5B 4ZUTB 3VFGH 3AY4C 3MJ9H 5IEKA 3VRLF 2WWMD 1D5ZA 2COQA 3K46A 4H1LG 4QTIL 3CVHL 5IVXF 1PQZA 1ZA6A 1CL7L 1PEWA 2C7UA 4PJXA 1X5YA 4QRSA 3WUWB 4WEBH 2GAZB 4XNUH 3P0VH 5GZND 2R29H 5CEXA 2MQ0A 5KVGH 2BNQA 1RUKH 4F7MA 3E3QE 4GT7A 4HFUH 2YC1A 5JIIA 2CRZA 3FT3A 3ZTNH 5GGQH 5L88L 4LNVA 3E6HA 2EH8H 5DF0A 3MBEA 2H3NB 4BYHA 3VRJA 1EZVY 3L3GB 3SJVD 1Z2KA 3HMXA 1P2CB 1WFUA 3DV6A 1NKRA 3SE3A 4QY8B 4HSQA 4HGWB 3VCLA 1IGIH 2NX5A 5I19H 1UCBH 1WIOA 1M05B 3N9GH 4QRPD 1T0NB 2A73B 4U0QB 5ESQB 1G0YR 2HRLA 1IL1A 1JZ7A 5I2IB 5BRZE 4BKLB 3CFDA 4CVZA 3RRQA 4PRDA 3PWNA 3CFEA 3PHQA 5T1MB 5ITFA 4WTZG 3SGDH 1ZHNA 4UIKL 1MI5B 1MJUH 4NCC2 4LGSB 3GBNL 1K8IB 2YPLB 3HC4H 3R0MA 1ZEAH 4JRYE 3C6SA 3AAZA 4XNXH 2XN9A 4Y4FC 5CEYA 2E27L 5IMLA 5E8OA 1DUZB 3O2DL 5DS8A 3I2CL 1SJEA 1MH5B 1H3PL 2KBGA 1JPTH 2C3XA 2JIXA 1MFBL 1F90H 2UWEB 3KPLB 1R0AL 1CN4A 3RPKA 2Q76A 1T3FB 2VAAB 1CLZH 1T66D 3W9EB 1X5LA 5IMMB 3RDTD 5F7EH 1NH6A 2K3TA 2Q8BL 4MX7A 1GGYA 1HIMH 3H9SE 2BHUA 4NRYA 2P5EA 1SY6H 4PRNA 4R0LC 4JM2B 5C08D 1NBQA 3GHEH 3VWJD 2IPTH 4R4FL 15C8H 1U6AL 4OLVH 3GSWA 3SGKC 2OM5A 4Y5VB 3W39B 1L6ZA 2EDDA 3LS4H 1R24A 2EC9U 2ZUXA 5CGYC 3VD7A 3SCMC 4KZEL 4BFIA 5CEZL 2V6HA 4I2XB 2VLKB 3CZJA 4UMGA 2H41A 5IKCA 5EG6C 1T22B 3KPQB 4X9FA 3T2QA 3C9NB 4JQVC 3BIKB 4YQXL 4DCQA 3MRRA 3JVGC 3U9PH 5C0CE 2DQDH 4MNQA 3PWJB 2VLMD 4JHWH 4UU9B 1FSKC 1OLLA 3RIAF 3UROR 3NPSC 4G42B 5EFIB 3D0LA 4KK5C 1TJGL 3MZGB 5F9AC 2XWTB 4NDMB 1CGTA 1JUFA 3MUJA 4HT1H 1PSKH 2FZ3B 4R96A 3GRWA 1KB5A 4YEEA 3WIIL 4RGOH 2XKUA 2PTVA 3WFBH 2YD6A 3IDMA 4G6JH 5IM7A 3TN0A 2Z35B 1N2RA 4K07A 2R1WB 4MAYD 3MUZ1 3TJHD 4MD4B 2PO6C 3KLHC 4OD3L 5MHSE 1GGCL 5DEGB 2EO1A 2BSTB 3A67L 4Y4KD 3LSOA 4JFFA 1AGDB 4L4VB 4YGAB 5ACLA 1S7RB 4GBXA 2P5WE 4Q2ZA 2JLLA 2E7BA 1RUAL 1ZTXH 1NCAH 1NMBL 4ZAKB 1CK0H 4O5LH 1MHEB 1U8LB 3QULB 3BXNA 4ODHH 1K9TA 1T1WB 2GTWA 3JTTA 2P4AB 5FHAH 3CK0H 4FS0A 1FFOB 3MJ7A 3E0GA 5JPMB 4PJBE 4R90H 1FV1A 1Z0MA 1V7ML 1SMAA 2PYEA 5H35B 2GFBA 5BV7H 3GSUA 2VDRL 2HRPH 2GJ6E 2BDNH 3L95B 1D6VH 3TO4B 5LGHH 4QOKE 4B7LA 2VUYA 3G6JB 3BGAA 3D9AL 3SHSA 5IEHB 1HKFA 1UWXH 3WSQH 3KYKH 2DQCH 3EFFA 1MCIA 3ZT5A 1T1YB 1LO5B 1S9WB 2H26B 4JDZB 4MS8D 4S11A 5IVNA 4G6AD 5ITBH 2A0LD 4MQ7B 4XWGL 4FP8L 2ICEB 5EUOE 1ED3B 2FWOA 3LVEA 3QUXD 1EDQA 4J2XA 3OKKB 3CUPB 3NAAL 3N1GC 4R3SA 2AVGA 3RU8L 4ETYA 1X5GA 1T6VN 1RK0A 3STZB 3D3VA 5ESAB 3WNMA 3D69B 1XF1A 1TXKA 3IGAA 4IS6A 5SWZA 5IFJB 2UZIH 4ERSL 1R3JB 3W11C 2CRIA 1J0IA 4ONOA 1CGYA 5D5MF 4Q7DA 2Z0BA 4DKAA 3KJ6L 2WW8A 1JPGA 4KK8D 3S3JA 2C3VB 4RGNB 4P2QA 5D1ZD 4LSPH 4PUBH 1J5OH 4L29A 4JQXA 4L4JA 1GIGL 1WUNT 4KQ3L 1T1XB 1A8JH 1VFOA 1I8MA 2BNRB 4F7CB 2DYPD 2JELL 4CNIA 4PRID 3DVIA 2FX8L 4K23L 4AIOA 1AKJA 4LHUA 3TV3H 1HHIB 5T3ZH 3BQUB 4LLVB 4JDVB 3VFRA 3KPOA 2FX7L 4U1HB 4EUPB 3SJVE 2A6KA 3OKEA 1WTLA 4BUGA 3HLAB 4TRPL 3W0WB 3CFJB 2DIJA 4KMQA 1YYLL 4PP1C 1MAML 4AH2B 4P2OB 1CDIA 5B8CB 3GMMA 1NLBH 1PY9A 4XVJL 4AL8H 5F1OB 1CYGA 2IJ0C 5DJYA 2NY4C 4QRPE 1CBVH 3ARDB 3L3OB 4WWKD 5E8EA 3IDXL 1JZ6A 1CZ8H 4TQEH 1QLRB 4MB3A 1PGRB 1JRHI 3MRMA 4IMKC 2X4NB 5IW3A 3VFOB 1NFIA 4CJ0A 4E41D 1BVLB 1K5NA 1MEXL 5TE6L 3V0AC 5IG7B 1S7WB 3MGOA 3ULVL 5KSBA 4V2BA 3MLUH 1C5BL 5JMRA 1W0WA 4Y19D 5HYIA 1U0QA 4MD5B 5HYFA 3IDNA 1WBXB 1ZGLM 2BRQA 4OI9A 5SX5K 2R2HB 3B6SB 3ZKXB 1NCNA 4GSDH 2Z8WC 3QDHA 4WDIB 5D8JL 4HEPG 1GZPB 1WWCA 1DQLH 3LN4A 3EOAB 4PLOB 1PYWA 4LBEA 4LOUC 3VFTB 4PLKD 5HBBA 1UVQB 4PJ8A 2D3VA 1SYVB 4WNQA 3WCYA 3K81A 1S7TA 1VADA 4OF0A 4BA8A 3OHXA 2IG2H 5DURD 5CP3A 3QUML 1YN6B 2GI7A 1C5CL 2V9QA 1ZOXA 3MFFB 1OSPH 2AXGB 1A14H 1KIQA 4Y2DC 4NIKB 1PJ9A 5BRZB 5C08E 1FLRL 1T7WA 3P4OA 1QVOB 3TBTA 2I60L 4DGVL 5F7KC 3QEQD 5EU4B 4Z7OF 4F33A 1T2XA 2IBBA 4F9LA 4W4NA 4C83A 3WV0A 4QYOA 2J4WH 3Q3GA 5T5FH 1QRNA 3U9UA 2YN3A 2FNBA 3TM6A 4CN6A 3ARWA 1OGAA 4U6HB 1A4KB 1EFXD 5EO0B 1DLHA 3PWUB 3SKJL 5E4EC 5DVNA 1FE8L 2G5BA 2A6JA 1GOGA 3M17B 2VLME 1KLFA 2VLJA 3ILQD 2F58H 1QQDA 1X44A 1VPOL 2EIZB 5DC9B 2EEAA 3BZDA 1S8DA 2AJUH 3IDUA 1J88A 1KTRL 1ZT4B 2N4IA 1RPQA 2CIIB 3EJZC 3H9SB 5T33L 2ZWLT 2DQIH 1I8KB 2NZIA 2ITCB 3BRGC 4X7FC 2CXKA 4FQ1H 3D85D 1QPPA 4KJWD 1OAQL 2DJSA 3WLBB 5I8KL 1TPXB 2DL9A 3OAUH 4TTGA 3ZKSD 5DQDH 1R3HB 2WZPD 1MOEA 4KTEH 2C4FT 4L8SC 4PJGF 3O41A 1GGIH 2YN5A 3BT2H 4HBCH 5KVEL 3H3BC 1BIIA 3WL9B 1UA6H 2W59A 5JOEA 3BZ4B 1BJMA 4PJFF 4DKEL 3KDMA 4LDEB 1F4XL 5C0CB 4BH7B 2GTZB 3I84A 3W5NA 3MO1B 5IB4B 4QXTB 3A6BH 3I6GA 3JSSA 1WIPA 2FATL 1DQJB 3FO2A 4P9HC 4WUUA 5GRVL 3OV6A 4S1QH 1D9KB 4ZUWB 4OCWH 2VMFA 1J8HA 5I16A 4LVEA 1ZLSL 5EBLB 2J3SA 5EWIH 3HMWL 5F6HJ 4LCUB 1AHWB 3RY6C 4ODXB 4YHOH 2X7LB 1IVLA 4NZUH 4NYLA 4J3VA 3RP1A 2AEIT 2ZUUA 3NZ8B 4N9GA 1AD9A 3S96A 2I9LA 3RUGF 1K2DB 3DPBA 5FKPA 4APQD 4AY0A 3UAJD 1EGJH 5D5ME 3SO5A 2P5WB 4Y5YA 5GIRB 4CJ1A 1JF1B 1OT2A 2P47B 4X6DB 2NNAA 5MEPB 2R0ZL 3NABL 1A6UH 1NFDA 1ZK9A 4M48L 2O61B 5C0JA 2NW3A 4JZOB 1JI1A 5KS9B 2ICWB 1NGYA 4PJBB 3OB8A 5K9KA 4NC1C 3LKNB 1WITA 2BNQD 5CJ8A 4HKJB 4D2NA 1XR9B 2QV2A 1I9RH 2GJ6B 3UEZA 1GHFL 3GBLA 5SV4A 1NEZB 4QOKB 4OT1L 5DHVA 1RJZB 1ZVYA 1JRHH 4FQLH 2FH6A 1IT9L 2AEWA 4OZHF 1EMTL 2DLEA 4ONGH 4KZDH 2E9WA 4HGKC 2NX5D 4PRIE 4U2ZA 5EULV 5EUOB 1QLFA 5DJ6B 1YEJL 3ULSA 1AXSA 2BFVH 2W07A 4UTAL 4M5ZH 4U0RB 3DX8B 1MCHA 1WISA 4UV7H 4ZQKA 3QXAB 1TDQA 3SQBA 3ARGC 1JGLL 5CKGA 1IEHA 1FZKB 2XWBA 3WKMH 1OF2B 1RZJC 1XGYL 2CLZA 3CU7A 2XA8L 1KEMH 5JNYA 2DTSA 5FYLD 4LHUG 3I3EA 2DM7A 4RAVB 3MV11 1HXYB 3UTTA 3SKNB 4N5EC 2A74B 4FABH 3PGFH 4K8RL 2XN9D 4JE4B 4E41E 4FFZH 5GS3A 4OFDA 2FJGB 5KVFL 4DN3H 3D2UB 4HJ0C 5IJVA 4XVSH 4HV8B 3MRBB 1P5VA 4S1DD 2JIXD 1FIGH 4MGXA 4J4PC 4Y19E 2VXVH 2MCPH 2Y5TB 1DUYB 3BGFB 4PR5B 5E7FA 3SDDB 1B2WL 5CILH 3MLRH 4KGLA 3LZFH 4LLUA 1Y6KR 2P42B 3NMEA 4XPAL 3BHBB 2H32A 2P5ED 4PJDE 3SJVB 4Z7VF 1NMCB 4DZ8A 3CVHA 4IOFD 4ZFZB 5L7XH 2BVYA 3FB7B 4M4RA 4DUWA 3MRQB 3DGCR 3DYOA 5INCB 4YXHL 2X4PA 5IESL 5KSVA 1U8PB 2V17L 4QRPB 1DBKH 4U49A 1VHPA 4X6BB 2XRAL 4P3WA 4XNMA 3TLRA 4N1EA 2LAGB 3S37L 1S9YB 2NY3D 2BY2A 1XGTB 2LAAA 1RD6A 1FNEB 4Z8FL 4WV1C 4XBPA 5IWLC 2IQAB 4PRPA 1XIWC 3QEQE 4AEHH 4MNQD 4HUWB 5H2BA 4JZNB 4Z7UE 3VFSA 3PGDA 2E7HA 4XP9H 5IQ9B 3RKDD 1RZ8A 4NNYA 1AE6H 4LHQB 3RWDB 4ESKA 4QCIA 3TN0D 3LCYA 5I17A 4IIQB 2Y6SD 3UO1L 1FNLA 4JM2C 4OKDA 1OT1A 4N0YL 4TNWF 4M6OL 4JKPL 5C0BA 1CFNB 5K59E 4K71B 2R39A 1JGVH 3EYVA 1IGFL 2W0FB 3MV8A 3UDWA 2VDLH 4NUJB 3T4YB 3RDTB 2EZ0C 4GBXD 4LQFH 4KH2A 3TA3C 32C2B 2HJKB 3FB8B 5DD0H 4G43B 2Q6WB 5MEQB 3S5LB 4KRLB 4U1NB 5FYKL 5F3BB 1URLA 3K4ZA 3MXWL 4ZO6A 1HI6A 4ALAL 3RTQA 2B1HL 5C07A 5C08B 3MLTB 3O2DA 3EKCA 3VWJB 4P99A 3F6IA 1I3RB 5CP3H 3V5KB 2FO4B 2PYED 3U7WH 3IDJB 4DVBA 2D03H 1RY7B 5GGSA 1DL7L 4GO6B 3CSBA 4OIAA 3WFEH 1OTSD 5ID0B 1FVCB 2H9GB 1BFSA 3KNBB 4KRPC 3FT2A 4OCRH 3ES6A 3SKOA 5CBAA 2LABA 3CX5J 3M1BB 1CD1A 3WS6C 3SOBH 3OKNB 4GMSH 4ZTOH 1IEBB 2FL5A 1RUQH 3WO4B 1XGQB 3VXQB 1H3UA 3PHSA 3PWLB 5DVOA 4YWGH 5AYUL 3HC0A 3ZYJA 3UTZB 4MAYB 3MA7B 5DJZB 1KTDB 5HD8D 4XVTH 2O5ZL 2AK4A 1PEZA 2VDOH 1R5VB 3J8F7 3KXFA 1X5IA 3PL6A 3STLA 3LEVH 4ZTPL 3MJ8B 4YGVB 3GM8A 4P2QD 5GGSY 4HKBB 4DZBA 1S7XB 4NQUA 1ODAA 2APWA 5EOQH 2FIKA 3UJTL 2AV1B 4P4RB 3QXDB 4U1MB 4PJXE 1A2YB 1BFOB 4P5TA 1T89A 5JDSB 2YD3A 5KBNC 4X98A 4LF3A 1NAMH 4QXGL 3QAZB 1G9MH 2BNQE 2QBWA 1UJ3B 4X80L 5EC2B 4L9LA 5HYJA 1TZGL 3ARFA 4BJLA 1AKJD 4LHUD 3LKPB 4LPUA 4Z7QE 4YDLB 1XZ0B 2Q7NA 3VI4E 4Y89A 2W65B 2ZSVB 1IQWH 4LPYA 1P4IH 4E5XB 3D18A 4H0IA 1UM5L 4OFPA 1CDJA 2NY6C 4MVBC 1AQDA 3HPJB 1E6JH 4HS3A 4BSJA 2NX5E 4L3EA 1XF4B 3DVGA 5GXBB 3MACL 3DO7B 3QUXB 1QNZL 1V3JA 5DC4B 1B4RA 2E8YA 1HKLL 2R0LL 4PJ9B 3WXWL 1MRCH 4RGNC 1WT5A 3IFOA 1T20B 4JR9L 2W9DL 3NIDF 3H7BA 3DSFH 3N85L 1S78D 1KGCD 3TBWB 1SEBA 5K9JH 1MIMH 2BVUA 5FYLE 3ETBF 3G6AA 5F71A 35C8L 1W72L 4I13B 1IGCL 2H8PB 1FZOA 3FQWB 3Q5TA 5E6IA 5GGVL 1SHMA 3MPCA 5JW4M 2EYRA 3O6KL 2JJVA 4R4BA 1A7QH 3BQUC 5C0GB 3OKOB 5I1DA 2XN9E 3UYRL 3BE1H 3ZKMC 3S8WA 4QGYA 2PN5A 1FGVH 1GOFA 5EIIB 4O02H 3BP6B 5GS0C 2BVTA 2V5MA 5J13B 4LLMA 5LJYH 4GH7B 4P2OC 4JG1H 5GSRB 1GYAA 2VR4A 2ZUQB 4CMMA 1N8ZB 3Q1SL 4PRIB 3G5ZA 3I3BA 1GAFL 4J3WA 5FO7B 2CK0H 1FO0H 3X11B 5IMOB 4WW2B 2NY2C 2P5EE 4HH9A 1GSMA 1XH3B 5E8NA 1T2QL 3V6ZA 1DVFD 3NN8A 4WW1B 3VXTB 4BQ6A 5INDB 1DQDH 2BSRA 1YYMH 2R4RL 4LSVH 4OM0L 1BVKA 2YUWA 2D0HA 3M45A 3PWPE 4JKWA 3MOAH 5FGBA 3SY0A 1G0DA 4WWKB 1IAKB 4FXGA 4Q97A 3JV6A 1LP9A 5KSUB 2VLLB 1OGAD 4YHNB 1A1MA 1AQKH 1LDPH 2OK0H 3VH8A 2QEJA 3GB7B 4JFEA 4DUVA 4E41B 1WQVT 4AQ1B 2J7LA 1A9EB 5JHDE 3L9RA 4QRRA 3EIFA 1RUPH 3EO9L 4MNQE 3MLZL 4ODWA 2VLJD 1S5HB 2FEDC 4A6YL 3F6LA 3GHBL 3L3IA 4HJJL 2J8UF 4Y19B 3ZE1F 2OLDA 4DFIA 1M71B 4N8CL 3WDHA 4UT9H 3CSGA 3FMGL 4H8WC 2YXMA 5ALCH 5E6YA 3IRPX 1NFKA 1JNNL 1M7DB 3K2UL 3FRUA 4P5KA 3VGBA 2FJFB 1J05A 4PJDB 1C08A 1INQA 5GGUB 2EDOA 5IMKB 3GUTB 5CJBA 4Z7WA 3GGWA 2X1PA 5DUMH 2P7TB 2YD2A 3FFDA 5E1AA 4NO2B 3HR6A 4F7EB 3QG6A 4DGYL 2OJZL 1ZV5A 1ORQA 3FTGB 3NGBB 2ZKHH 2ADFL 2VC2L 2D9QB 4YHPB 4HUNB 5DURB 5L8LB 4TUOA 3ULUH 1YEIH 3AU1B 5CUSL 5HHNA 3VFWB 5EZLA 1FNSH 3BH8B 4OTXH 5E0QA 3BESR 4OLXL 3BI9X 5DJCB 1QBML 1TMCB 4OLWH 5E5MB 3C08L 3KPRA 4UOW0 4FFWD 2YMXL 2RFXA 1MFEL 1OAZH 3QEQB 2ZCHH 4PYHA 4ZUUB 4MCZA 4JHBA 4Z7UB 4NKOB 2PYEE 2MMXA 1Z5LA 4RISH 4IHOB 4WUUD 4MNGE 4HIXH 4XP6L 4XRCA 5JO5A 1KBGL 3GSNL 5EOTA 4UAOC 1S7SA 1DFBL 1J1PH 1KXVC 1WJ3A 4ODBD 5ISZB 4M1GH 4ZPVA 1J8HD 1EFXB 4XNYL 4POZC 3V4VL 1I7ZA 5DJDB 5ETUA 4X5WA 4OZIF 2VDQL 4ZXBC 3O3BA 1LK2B 4QLRA 1BWMA 3VI3E 2MNUA 1KIPB 5CJQL 3FFCD 2ARJA 1I1AA 1IJ9A 1QD0A 4P48A 4MA7L 3TEUA 2K9UA 5CLTA 5D2NA 1JWUB 4KDWA 3HAEB 3NTCH 3K8LA 1I85A 5D72L 3CPLB 2I07A 3U1SH 5I1JL 4OD2A 4NKIL 3D85B 4Y1AA 4NCC1 5D2LF 5JXEA 5DD6B 2I25N 4HUXB 3PV6B 4JFDA 5HHOA 3R0NA 1F3RB 1YNTA 2HA1A 4LSTH 3WBDA 2E7LC 1Q9OA 4M5YH 3S9DB 3O6FD 3H8NA 5FKAA 3MMEA 4H25B 4HAGA 2PXYB 2I5YL 3S34L 2JJSC 1D9KC 4P2QE 1RIUL 3FOMA 1HEZA 2V5SA 3PP4H 1Q0YH 1TITA 1AHWC 3GMPB 4PJEA 2O5YH 1SVCP 3O0RH 4FTVA 3UPRB 2FHBA 3TWCL 3IVKA 4I1NB 3OKMB 1VEPA 4ZS7H 5SX5H 2WQRA 1F3JA 3ARRA 4H26A 5ANME 3DI3B 1RZIA 4ZPTA 4ZUVB 4LSSL 2QSCL 4QNPE 4JG0H 1C5DA 3BGMA 3O3EA 3WEXB 3UZVB 3QDMA 1ZS8B 2D7MA 4OLUH 1FAIH 1DSFL 1A6TA 3F7RA 1RK1B 3JV0A 4PJIA 4P23A 5FK9B 3EJYD 1ZVHA 4PB0L 3O11A 1QFOA 1JHLL 1CXFA 4HS8L 3Q5OA 4UT7H 1XF3B 3WD5H 4APQB 1PAMA 4M00A 3CLFH 4Q9BA 4BSVB 4XXDA 2I9TA 5C9JA 1BPVA 3FZUC 1N0XH 4KFZC 1T03L 4P5MB 2J8OA 2BC4A 1D5ZB 1KGCE 3RWEA 3KG5A 1JCKA 1TJIH 1U8KA 5EORL 1ZA6B 5KSBE 2C7UB 4PJXB 3JWDL 1AJ7H 4GG6F 2CPCA 4WO4A 4NHCH 4PV8A 4XB8A 4AT6B 1UZ8A 2H45A 3MCLL 2B1AL 4AM0A 1HHJB 5I0DA 2FD6H 4WHYH 2BNQB 1P4LB 2YC1B 2BVQA 3GBMH 1CFSB 3DURA 2Q8AL 5EBWB 3E6HB 4EIGB 1QBLL 4P9ML 4XC3L 3VRJB 4MDIB 1RZKL 3VG9C 5IR1B 1UB5A 3V6FB 3VG0H 4LARH 3LRHA 1UWEL 1HH6A 3IAPA 4Y16A 3VCLB 2NX5B 2IGFH 2IQ9L 4GW5B 4H0GA 4Q74A 3OZ9L 1FVDA 3TH3T 1QFWM 4PRHA 2Q3AA 1JTOA 2BCKA 3OGCB 2PR4L 4HFWA 2EDNA 4QHNB 3WNLA 3ULUF 4RFEB 3KHQA 2WLYA 2W0KA 2WM0A 5TE7L 1KLGB 4QF1B 4PRDB 3RY5A 1C12A 1G7JB 1IFHH 3CFEB 3DARA 5GZNC 2VDKL 4EN3A 4OUOA 3BGFC 5GGRA 1LK3L 2CJUH 4M6NL 4OI7A 3GMNB 5C1MB 1CVRA 1VA9A 3DTXA 2HFTA 1KG0A 3RGVA 1FZJA 3MNWA 5J3HC 5FYJH 4L8CB 1MCCA 1OGAE 5HHMD 3C6SB 2XN9B 2DQHL 2ZZUT 2VRAA 5D7JA 5CEYB 1CCZA 4BZYA 5E8OB 5DS8B 4O58H 2DBJA 2X9WA 5DMIL 4L3CA 5F1SA 5SWSB 5HPMA 5C0BD 2JIXB 2KQNA 2VLJE 2WIIA 3QWRD 1EJ6A 4WIQA 1CD0A 1UENA 4U6YB 4LRIC 1P1ZA 4NZTL 5CS7A 1PY4A 2P48B 1H9VA 4G8FA 3MV8D 5E7BA 2BRRH 2V9TA 3K8MA 4FZ8L 3BRFA 3VH8G 5GRJH 2A38A 3S88L 2EXWD 1HINL 2WUCL 4MX7B 4GAYA 5I74C 1A3RH 1ND0A 1MQ8A 3BUTA 4EBQL 2P5EB 1TQCC 1RULL 1IAIL 2E3VA 4PRNB 5EBMB 2E5EA 5C07D 3RTQD 2OZ4H 4JGJA 3WLWD 4ZOEA 1UB6A 2B2XL 1BQSA 1AGFA 2QQNH 4MA3B 1PLGL 3GSWB 2FIRT 3WFHA 2QQLL 4P2RA 3EFDL 3PWPB 4TSAH 2OL3L 4M4PA 5I8EB 4NWUL 3UPCA 3KYOB 4YHIA 5E5RB 3G08B 4JO2L 2B4CH 2NY3B 1A6PA 5T1DH 4HMDA 5C0RH 5MI0B 1JFQL 3OR7A 5I18H 5JHDB 1LO3L 2XT1B 4D9LH 4MNQB 4JEGB 4IRZH 3C5JA 5C0ND 1WICA 5IBLD 3EBAA 3D0LB 4YHYB 1JHKH 1U3HD 4WUUE 1T66C 2NTFA 3IFLL 3MLVL 3RDTC 3K1DA 2C4FU 5CEZD 4R96B 5I73C 4PG2C 1KB5B 4ZUSB 1P4BL 4FQQA 4GXUM 1J8HE 1P7QB 3IDMB 2C3WA 4F7PA 2Y5EA 3TN0B 5IV2A 1WCQA 3DVNB 3RWGA 3VWJC 3RVXD 5DD3H 2NZ9C 1MCPH 3B8YA 4KJYA 1HK6A 4LCIH 2AK4D 5B39B 5DFWH 2IALB 1S9XA 1D6EB 3LQAH 5JQ6L 2DQJH 2PCPA 3FFCE 2ADJB 5AZEL 4F57H 3KXFD 4NP4L 3PL6D 4Q2ZB 3RHWF 3WFDH 5JW4Q 4OZFA 1RJLA 3F7YA 3BXNB 1VFAA 3VWKC 1NFDE 3ZKQD 4FFVD 4PJHF 4PGJA 3R8QA 3JTTB 1U8JA 1HSAB 3CFKB 3PJSA 3MJ7B 4JPVH 2OQJA 4P5TD 5LGKA 1HH9B 4HQQL 4DVRH 4M1DH 4L8DB 12E8L 5BJTB 4GS7C 4O4YL 3VGAB 3HI1B 2NMSA 2PYEB 5DC0A 5JW5B 2HMID 3DJ9A 5C7XL 3WDJA 3MQIA 4MNGB 3GSUB 5I1AA 4FMKA 1MUJB 2BMKA 1FFPB 3T0BA 1WWBX 1AXIB 2BHZA 5BS0A 3O9WC 4GKZA 3TJHC 1IC5L 1CGSL 1F4YH 2AKRA 4GXVL 1D5MB 1FJ1B 4Y4KC 3LHPL 4X7DC 2IF7A 1F02I 1RIVL 3CAFA 4L3ED 4X7SH 5DLMH 1UZ6E 1WFOA 4TTDD 1MNUL 5FUOL 1DBJH 5FM4A 1IZJA 2Z31A 2AGJH 5CSZA 3DYMA 4R3SB 3DX7A 1SM3H 1RK0B 4ONFH 2IMMA 5AAWA 4IS6B 3IGAB 2ATPA 4GQ9H 1JBJA 3BKJH 1REIA 5D70L 3ZDYE 4F8TA 4B53A 1UJ3C 3FN0L 3VFNA 5M94B 3U0WH 5DEFA 2IBGA 4X9BA 1WZKA 5E6ID 3SE8L 4GRWE 2C1PA 5HHVH 4MAUL 2BNUB 1JPGB 4ODVH 5E2JA 2KKQA 1YEKH 4P2QB 4YHZH 4FQIL 4U4BA 1FL5B 5CZXD 3CFIC 4HXBH 4L29B 3BPOC 4F2MB 4MS8C 1IC4L 4HCRL 4C55A 4G6AC 1I8MB 1R6VA 3DHMA 5IBTL 5HYQA 4OI8A 3EYQD 5ANMB 2DQFA 3QO1A 3QUXC 2MSPA 1AKJB 2GITA 4LHUB 2DI7A 4EXPX 2AJ3B 1WAAE 3VFRB 4NM4H 3KPOB 3AREA 3B2UC 3EYUH 4J3OC 4LCCC 1PKQA 2BOCB 1BREA 1PVHA 2W38A 4LEXL 2XZCH 3CLEH 4HWZA 4L8BA 1MCBA 1I3UA 5E2TH 5I15H 1DEEA 4UTBL 5HYEA 6FABL 3GJFB 1TJHH 1PG7W 1NCCH 3GMMB 1EIBA 3RAJL 1J8KA 1QUNA 1OCWH 1RZ7H 1OM3H 1B0RB 4L5FL 1JWMA 1GGBH 4XH2A 3MRMB 1ACYH 5ESVB 5D1ZC 4JFED 1A47A 1BQUA 3MLSH 1OQXA 3V4PL 4JY5L 1K5NB 2M1KA 4LSQH 4QRRD 1XT5A 3MGOB 4U6VL 1U8IA 5J13C 5KSBB 3AFLA 3ALXA 1YECL 5DUPH 3QXTA 2ZUQC 4LPWA 1QLEH 3LEYH 1BZ7B 5F9OL 2F8OA 4NQDA 1CXEA 1NBYA 2D31B 1LP9F 5HHME 4Q9RL 4KRMB 4WCYL 4WW2C 5MERB 3MCKA 4UBDD 5HI4C 3LN4B 2X9XA 1FQ9C 2Q86A 3KR3H 1W8NA 4KI5F 5C0BE 5HVHC 1M7XA 1PYWB 2MHAA 4LBEB 1FRGL 1KCSH 3W2DL 3QJFA 1MLBB 1YPZA 2J12B 3TCXA 5B38A 1C8PA 3QCVH 4K9EC 1YEGL 3MV8E 4FXKB 2WBJA 5TE4L 1SBSL 3OHXB 3WJLC 5IHUL 5DSCA 3SDYL 1W72A 4NC0B 4WWKC 2WUBH 4JGMA 2QR0A 3IXTA 1FG2B 1T21A 2W9EH 4ORZC 1A21A 5IHLB 1MHPL 1KIQB 3G5YB 5C07E 3QEUA 1DVFB 1UQSA 1J86A 3P4OB 1FL3B 1UC6A 4HWBL 3KPRD 4ORGA 3T08A 4POYA 4R7NB 3ULVF 1CLYH 3P11H 4KMTL 4F33B 3I9GH 1R3IH 1NCWL 1FIEA 1F3DH 4C83B 1KJ2A 3LD8C 2GW5A 1P9MC 2MTPA 4I48A 3U9UB 1GPOH 3L5HA 4W4OC 4DKFH 3OL2A 1IM3A 3PP3K 5JA9A 3I50L 1L9NA 4ZD3H 1DLHB 2DTMH 1UH4A 1WC7A 2UY6A 1QFUL 2G5BB 2HVJB 1GC1L 3UXFA 1ETZA 4YIQA 3OPZL 2VLJB 4XWOD 5A16A 5IHZB 4JN1H 5CEZE 2EYSB 2J88H 1EV2E 1I1AD 2YXFA 3V52H 3QQ3A 4MQXD 2YD9A 5J7CC 1JPST 3DIFA 2ZJSL 3G04B 4I3RL 2NY7H 2XY1A 2FSEA 1EPFA 5GGVY 5BV7C 5BMFL 4LDLB 4Y1AD 3WFCL 5JXED 4PLJD 4JFDD 3N1FC 1Q94B 3KAAA 4A6YA 3RJQB 3MRFA 3RL2A 3KXFE 3FJTA 4NUGL 3O4OB 1T0MA 2YD5A 1P7KA 3O41B 3BIAX 1BM3L 3OQ3B 1GZQB 2V7HA 5TF0A 1A7NH 4X6CA 5A3IC 1YDPA 2WANA 1QFPA 3KDMB 2X09A 3HNVL 4YDJA 5BO1H 5HJ3A 2BZDA 4FTVD 3ILQC 8CGTA 2L7UA 4HK0A 4OZFG 1MIEL 4WUUB 3S35X 3QI9C 4FOMA 3H2WA 4YO0A 1EEQA 2XYCA 5I76A 1IBGL 2AXHA 2XFXA 2HKFH 5CFHA 3TIDA 2OTPA 3CFCH 1I1YA 3MOBH 1J8HB 3QDMD 4PTTA 4P4KA 1CT8A 4U1LA 4E0RA 2HG5A 4FQCL 4PJEF 4RWYH 1R3LA 1QSEA 4JPWL 4KJWC 1FZMA 4LP5A 5IVOA 1HILA 4HPYH 2CKBH 4N8PA 3MYJA 4N9GB 4L3EE 1NCDH 1AD9B 1WZ1L 3FFCB 5FKPB 3IFPA 1FGNH 3DBXB 4Y5YB 4HIHA 1BMGA 4Z5RA 4ZG1A 1RAMA 5HGDA 3ZL4L 1NFDB 3ZSSA 4YUEH 2Y36H 5C0JB 2NW3B 4PJIF 1NQBA 1HDMB 4WO4D 4K3EL 1UEMA 4XBEL 2XWJA 3O6FB 3ILPA 5E70A 2FB4H 1UXSA 5F6HI 5C86A 1CGXA 3SE9L 3T0EA 3P30L 2EKJA 5DHVB 5E9DA 1NBZA 3RNQB 2O5XL 4HK3N 2B5IB 1JNLH 4P57A 1BGXH 4Q9QH 4KVNH 4AEFA 2YA0A 3B9AA 4Y16D 4WI9A 3QHFL 3F7VA 4HJGA 4APQC 2VSCA 1T80A 3L7EA 4JO3L 2F53A 1AXSB 5IGXH 1OTTC 4LPTA 5HDQH 5BQ7A 2FJHB 4TN9A 4PRHD 4YXLH 4PJ7A 1ULVA 4ZQKB 2ZG2A 1KPRA 4DN4H 1F2QA 1MWAB 2YBRA 1L7IL 2EDJA 2F5BL 3VMOA 2VERN 3I75B 2QQQA 2XWBB 4F3FA 4JN2A 5JHLL 4O9HH 2VXTH 3FQTA 1N59A 2A77H 5DWUL 4JKMA 4PJ5A 4ZUTA 4YDKL 1EO5A 5B3JF 2CRYA 3NFNB 5CIPA 3ESUF 4JLRB 4S1SL 2VDMH 4GRWB 1S7QB 3RGVD 3ECBB 1I1RA 5TQ2L 2XPGA 2MOVA 4I3SH 4JFEE 4LASH 3MBEC 3WUWA 5D7JD 1LO4H 4UINL 4XMPH 5IJVB 2NLJB 2GAZA 2DQUH 4QRRE 1TETL 5I1KL 4FQJH 1OVZA 2LU7A 3OTTA 2QSQA 3KPTA 4J3XA 1NLDL 3LY6A 3SE3C 3BP4B 3L5XH 3JWOH 5DJAB 4NM8H 4CDHA 4LLUB 4XMLL 2VXUH 4ISVB 1T5XA 5EA0L 1P2CA 5GRYA 4K8RD 3DO3A 4JPKH 3QNYA 4QY8A 5HVWA 3U83A 4G5ZL 1PZUB 1KB9K 1M05A 3CDYA 4B0MM 3CVHB 4Z7WE 4F15C 1N3NB 3DETD 5ESQA 4RX4A 3HNTH 2BJMH 3E6FB 3MLXL 4P2RD 5KSVB 3IKCB 1RZFL 3RWHA 5HHXH 5DK3A 5I2IA 4XHJD 3O6LL 5KANI 4PREB 4LSDA 4OKVB 1F45A 4CU8A 5F97E 3S36H 1NMAH 3VXMA 4L4TE 3FO9B 5DFVD 5FA4B 3BSZH 5B38G 2WK2A 3KPRE 4XBPB 5AG9A 1MI5A 1CFQA 2C9AA 4S1DC 5JW4R 3WIHH 1MJ8H 3ARBB 1K8IA 2YPLA 5H2BB 3VFSB 5J1AB 3PGDB 5J6HA 1EHNA 2R23B 5CZVL 4Y0GA 1RZ8B 4XVUD 1DUZA 5KJRL 2I26N 1MH5A 2AK1H 2EE6A 5HHMB 4QCIB 2AXFB 1A6WL 3KPLA 4PJAF 2B39A 4WWID 5EZOH 1T3FA 4RGMB 3S4SB 4WFHD 1J18A 5C0BB 5IMMA 4IOFC 1XMWA 3UJIL 3VFMB 3EO0A 3EYVB 5TDPB 4ZFGL 3C6LA 3MV8B 2N1KA 3FOLB 2X89A 3ME0A 4XCYA 1JNHA 5D2NE 5EB9A 1J0ZA 4XGZB 4YBQC 2NY3C 2VXSH 5TGBB 3QEGL 3RVUD 4Y5VA 1NAKH 5DVKA 3UP1A 2D0GA 4Y1AE 5C07B 3RTQB 3QPXH 4JFDE 1ZXQA 3T3PF 3MRJA 5EOCH 3CDFA 4PBWD 4NN6B 3F58H 3KPQA 5KOMC 3U4AA 4Y4HD 1G6RB 4RRPA 4OQTH 1DDHA 1FC1A 4C57C 3C9NA 3RKDC 4ZFFA 1LO2L 5GGSB 3BIKA 2VH5H 1F6AB 1FORL 2Z8SA 4KK6D 4XP5L 3PWJA 4KVCH 4UU9A 3TN0C 4B7IA 4X9GA 5BS0D 3QFJA 2Y6SC 4PB9L 3FT2B 5D71L 5EFIA 5FYKD 1NL0L 3ES6B 4JHAL 3HB3D 4NDMA 4FMFA 1KJ2H 5CBAB 4FTVE 4KHTL 2FZ3A 4ENEC 2MQCA 4U3XA 1CD1B 3FO0H 1UM6L 2DIBA 3WS3A 1BVZA 1U3HB 2D7PA 5DDHA 4HLJA 3GSRB 4GBXC 2Z35A 1F58H 2AERT 2H2SD 4U2YA 4KY1L 1NKOA 2G5RA 3HC0B 3QDME 2BSTA 1T83A 1RJCA 2CDGA 2DLIA 4HXAL 2CGRH 1AGDA 1AY1L 1MPAL 2EYTB 3QRFM 2HJLA 5DFTA 4GKOA 1YNKL 2EH7L 1SMOA 3ARYA 3W82A 1HOCB 2DDQL 2CRMA 1MHEA 1U8LA 1OP3K 3VGAC 3KXFB 4NN7C 4GW1B 1T1WA 3PL6B 4HEME 3LKOB 5IROA 4LPCA 3VXNB 4ELMF 2AEQH 5JPMA 1OTSC 2Y06L 2HTLD 4DZBB 4M7ZB 5HDBF 1B4JL 1RMFL 1T7VA 3RJDA 3VXPB 4XCEB 2QHRL 1UFUA 4QT5A 4TUJB 5H35A 4P5TB 3Q5YA 2JB5H 2MJWA 1FNGB 1BJ1J 4X98B 4OCSH 3BKCL 3TO4A 5DJ2A 2DAVA 1INDL 3QZWA 1YEFH 1FH5H 3DI2B 4LCWA 4YJZL 2F5AH 1CG9B 4K7PL 5DI8A 3LDBB 4WU7A 1LO5A 2H26A 3ARPA 5EZIH 4YX2H 1CR9H 3D18B 5JUEH 2ICEA 1ED3A 1H8SA 1ZLWK 3WXVH 1AQDB 3BDYH 3B43A 3NVQA 3H9HB 3MRLA 1ADQL 4IJ3B 5H37H 4NO3B 2W0PA 3O8XA 4HS3B 1VESA 2VQUA 1S5IL 3OKKA 3U30B 1YNLL 4NJAH 3O3DB 2J1KA 4PRHE 1DJSA 4Y5XB 2HT3C 3IFOB 3D69A 1RUMH 4KK9D 3H7BB 1AH1A 4N68A 3MUGB 3UTOA 1AIFA 5D1QB 4JQXC 4Z76B 1SEBB 2OJEB 4CVWA 3G6AB 1G9NC 1MFCL 2XG4A 2C3VA 1FZOB 1R3KB 2Q1EA 5E6IB 3PXJA 7FABL 2EYRB 4NQDD 4R4BB 4RMSA 1QSFB 3QHZH 3TBVA 1YN7B 2D0FA 1IKFL 3R06B 4F7CA 1ACZA 2JJWA 5F93C 5LWYH 4O2CA 3MZTA 4LLMB 1TNMA 4X4XB 4CMMB 2D7QA 2WBJD 4JDVA 4EUPA 3U0PA 1KXTB 2AJXL 2DBLL 3WUWG 1MAJA 1INEL 3HLAA 4M8QB 1MFAL 2NXZC 4AH2A 4WU5A 4K3DH 2AS5M 2XXCB 4G6FB 2FBJL 3OJDB 2VUOA 3ARDA 4KJQC 4I8DA 3DWTA 2BSRB 1JPFA 4HCRA 1QLRA 5FB8A 5J11B 4W70A 1BVLA 1O0VA 4U1JB 1UH2A 4YDIL 3JV6B 1TZIB 2QTEA 1A0QH 5IG7A 1A1MB 5E2VH 1MCJA 2XZAL 4JFEB 4G7VL 4KHXH 4X9HA 4MYWB 1IGMH 3L9RB 3QNXB 2OTUA 1MELA 4QRRB 4U7SA 4M02A 4ODWB 4PJ8C 2OR8A 4JREB 3IAGC 3RIFK 2AJYL 3L3IB 4JQIH 4DFHA 4WDIA 3NCJL 1X9QA 3GI8H 5HDOA 5M7QA 3MBXH 1YY8B 3EOAA 2YRZA 6CGTA 4AEIL 3GSQB 3VFTA 1UVQA 4RA0C 4CN4A 5DO2D 4P5KB 1J05B 4WFHE 2J6EA 4BQ8A 2P8PB 5HGBA 5JR1H 3NACL 4F9LC 1VFBA 1KEGH 3FFDB 1YN6A 5E1AB 3VFPA 3QG6B 3MFFA 3T2NL 4P59H 3HI5H 3U46A 2GKIA 3DYPA 3U4BH 3K80A 3UTSA 3BW9A 5HHNB 2X4RB 5EZLB 5GSVB 4P9HL 5HI3C 4L4TB 4UT6L 2DQEH 3KPRB 4BFGA 1CLOL 2OMNA 4G6ML 2X70B 3MA9L 1MVFA 4MCZB 2C26A 1VFMA 1SYSB 1A4KA 1H3GA 4G3YL 4XRCB 5BXFB 3L7FB 2X4UA 3X14A 4KROD 3M17A 1JHTB 3QUMB 1U8MA 2AEPH 5BS0E 1IC7H 2R0KL 4YC2C 5FYKE 4P4KD 1S3KL 2EIZA 3T0VA 1P5UA 4HWBA 4RRPG 4Z7NF 3JTSB 5FCUL 4F8QA 2ZG1A 1EJOL 1KCRH 3EYSH 3H9SA 4IRJA 4H0HB 5FUCE 2ARJB 1D5BB 4K2UH 1I1AB 1I8KA 2ITCA 3EDFA 5C0EA 4ZMAT 3PHOB 4J6RH 1OGTB 1G9MC 3AS0A 4KKAD 2RB8A 2OYPA 1T1ZA 2YD1A 5GJSL 2VWEE 3WLBA 5IIEA 4FFWC 2R4SL 4NGHH 1RQ5A 1YNTB 3G5XA 1DZBA 2F9BT 2IPKA 1U36A 1N6VA 4Q0XL 1K85A 5FKAB 4OFIA 3DNKA 3WL9A 1HHHB 2R1XA 4XMKL 3BZ4A 2VLRA 2V2WA 3EGSB 3KPPB 5C0CA 4X6FA 4LIQH 4LLWA 3MRHB 4BH7A 5E9DD 3MO1A 4KPHL 3RBSA 1G7IB 2ICES 2VISA 3CD4A 1LD9B 1UKSA 5JW3L 5ICXB 3EW3B 4OGXL 3F12A 3MRKB 2JCCF 5EO9A 5A43C 5CD5C 2LV4A 3QIWA 2J5LC 3NCYS 3I85A 2VE6A 3QIBA 4ZUWA 1VFUA 4H26B 1RZJL 3NA9L 1KELL 4ZPTB 2F53D 1BHGA 1UACH 1J0YA 2CMRH 4Y5YC 5IP4A 2A9MH 3IJHA 4WY7L 1IGTB 4LCUA 1YEEH 3L6FB 4ODXA 3BGMB 1PKQE 1QYGH 4HLZG 4X4MA 3QDMB 3NZ8A 3VDCA 1KJMB 1A6TB 1H3WM 1RHFA 2OS7A 3IFNH 1FPTH 1WGOA 1A7OH 1XCTA 3UX9B 4XPGH 4HUUA 3CJJA 2P5WA 5GIRA 1N5YL 1JF1A 1EX0A 3QZWG 4P3CL 4X6DA 5MEPA 3GJEB 1HN1A 3ARVA 4IDJL 3INUL 2I9TB 5KS9A 2H1PH 2ICWA 3QPQD 3C60B 4XTRC 3T2PA 2BC4B 4MJ2A 1DE4A 1OP9A 3RWEB 5IFAH 1MFDL 4YXKL 4LHJB 5TQ0L 1A1NB 4WO4B 1W2KT 3MODH 1UZ8B 1OOAA 4OJFL 4U1GC 1L9MA 2XZQH 2GJ6A 4BELD 2QSVA 4WHDA 1E6OL 3QXWA 4KKBC 1NEZA 4QOKA 3WJJA 3X3FL 3HTLX 2BVQB 2KUTA 3GI9L 1RJZA 4NQDE 4XNZB 4Z9KB 4HLZH 3MRPB 1J9CT 1VGKA 2ZOKA 4XAWH 4DW2L 2DD8L 4PY8J 3OR6A 4F9PA 5GISH 1EZVX 4IOIA 3I6KA 4K3HA 5J8OA 3EJYC 2EDBA 1YPZE 1UB5B 4LL9A 4NKDA 4XCFL 5DJ6A 3X3GL 5C2BH 1HH6B 5HY9A 3SBWA 4Y16B 2W91A 1E4KA 3QXAA 2C3HA 2IH3A 1FVDB 2E6PA 3TGXA 3FHAA 4O2EB 4K3JH 1IEAB 3EJJX 4NNPH 4PRHB 1HSBB 1DN0B 2AQ3A 1OF2A 4EDXB 3VXMD 4O2FA 2CUHA 5F89A 4JFQB 3F7PC 1MI5D 4RAVA 5EUKB 1DQQB 4M7LL 4PTUB 1C12B 4GAJH 3QUZD 4EUPG 2A74A 2NY5C 3B3IA 2NY0C 4JVUA 2HAZA 4TUKL 4LU5L 2FJGA 1CFVL 3RGVB 1FZJB 3D2UA 1BQHB 3BPNB 3LS5H 3MV01 3MRBA 3UJJL 2VITB 1HWHB 5D6CA 3UBXI 4GXUN 3DHJA 3BN9D 1H5BA 4P46A 5DGQA 4L3CB 3ULUC 2Y5TA 4PR5A 1OAKL 3SDDA 1J1XL 4PRAB 1I9JL 1P1ZB 1U8QA 5DMGD 3GNMH 3C6LD 4G8FB 3BHBA 4HDIA 3KYMB 3DRQB 5CJOH 5E5UB 3SJVA 3DUUB 4GAYB 4OSUL 5TFSH 3CMOH 3R1GH 1ND0B 4V2CB 2UWEF 1YUHB 5I1GH 3ZDZE 3S7GA 3MRQA 3RWIA 1U8PA 5ADOH 1BFVL 4XPTH 5GS0H 4X6BA 4GLRI 1E4XH 1CF8L 4JM2F 1A7RL 4X83A 4N0FA 1I75A 2ARWA 3UZQA 2HH0H 1SJXA 1ZANH 5I75B 4ZO8A 4X6CE 3QFJD 3MXVH 3HNSL 1RZGB 1AC6A 1EVUA 3OR7B 4RGMC 5FM8A 1AR1D 5IQ9A 4GRLD 3THMH 5JIPA 3RWDA 1VEMA 3UDWC 2NTFB 3L5JA 3QDJD 4IIQA 3QRGL 4JO4L 2H2PD 5DMJB 2EXWC 5KVDH 3D0VA 2APXA 4FQQB 4R4ND 2R2BA 1CFNA 1NUGA 4Z0BL 4F7PB 1RFDH 1Z0NA 1T4KB 1G1YA 5HI5D 3BMVA 1BAFL 3IDYC 3Q6GH 3RTQC 2EDXA 3RWGB 1C1EH 2W0FA 3QEHA 3CC5A 3O2WH 4NN6C 4LVNC 3FB8A 3VA2C 5MEQA 4U1NA 4JAMA 4MXWH 4XP1H 3KPSA 2J6EH 1U93B 5C08A 5B3NA 3TVMA 3RWFA 2IFFH 3F7YB 2QKIA 1I3RA 1VFAB 3SE4A 4H8WH 3ARSA 3BKYL 3V0VA 2QADD 4Y8DC 3V5KA 5I1CL 5CJXA 2FO4A 5ILTH 3H3PH 4RZCA 4FG6D 5AUMB 5C0NC 4NT6B 1N6UA 5IBLC 1QTYT 2VXQL 1ZVSB 5DR5L 4Y4HB 5E2UL 2IAND 2JJTA 3KNBA 5I1AB 1VKXA 1MRDH 4W68A 5H8DA 4LCWD 3E2HC 2OSLB 2WP3T 5ICZB 1DLFL 1N6QH 5E9DE 3LRGA 5BS0B 4G8GB 1U95A 3OKNA 5CCKH 4GKZB 1JI2A 1QFWI 3LQZA 1QRKA 5C0AA 2R56H 2AKRB 5F7WC 4XPBL 5IQ7H 4TSCH 3O8XD 4BFBD 3VXQA 2SEBB 4A2LA 3PWLA 3S35H 1XGUB 3PL6C 2F53E 3UTZA 3G6JF 2VDNH 4MAYA 5DJZA 3ZTJH 1FBIH 4PJ7E 4FFVC 4JM4H 2RAMA 3BISA 3EOYG 4LEOA 5JA8B 4KC3B 4CMHB 1ZHLA 5C6TH 4P5TC 2R8SH 1T89C 1ZT1B 5F8QC 3SPVA 3MJ8A 4L9LC 4DEPC 1H0DB 4HKBA 1MCNA 3ARFC 3LKRB 1U42A 1YY9C 1JYNA 2AV1A 4P4RA 4UI2A 3QXDA 4U1MA 1A2YA 5FFLA 3LDBC 2R9HD 3O3AB 4WENB 1KCUL 3VGGA 1BBDH 4JKKA 2X4SA 5EC2A 4L1DA 4IJ3C 3LKPA 4DJMA 3VD9A 3BPLB 1XZ0A 4WI4A 1WBYA 1NGPL 5E2WL 1X6NA 2ZSVA 4TTDC 1U8NA 1XF5B 1S9VA 4OZGA 1AO7A 3HPJA 4HWEH 1NUDA 1PKQB 4M1CD 4D9RD 1OPGL 4MCYB 2X4QB 4L8BB 4S1RH 4H5SA 3WFZA 3DO7A 3ARDD 3S6CA 5HYSA 1NEZG 3IU3B 4PJ9A 5DQ9A 3GIZH 3OWEA 4JVPA 3MLWL 5E6IC 5LBSH 1U91A 1JWMB 2APTA 3G9AB 2GCYB 1HXMB 3L3KA 3VXME 1A5FL 5DHYB 3CCHA 1BFTA 4N0RA 2YK1L 4P3DA 1KCKA 5L2KD 3P9WB 5CZXC 4FZEL 3F8UB 3GMRA 1RVFL 1U8IB 3MFGB 5L6YH 3HUJA 5C0GA 5ACZB 5C92A 1ADQA 3OKOA 4NZRL 4C4KO 4XPFH 5I6XB 3H42L 2F15A 5I1EL 1NBYB 2X44D 5EIIA 1B88A 4GLRH 4PLNC 1P6FA 1OAXH 1UT9A 4PGCB 3D1MC 2Q86B 3TNMA 1N8ZA 1V3KA 1YPZB 5B38B 2ENSA 2KL6A 3X11A 3VW3L 2EC8A 2MPAL 3EDJA 5IMOA 5FGBC 4DAGL 4EOWL 1W72B 3KPMA 3H6JA 3O2VH 3WDIA 1JWSB 3IETA 3UTSD 4R7DB 2QR0B 1T21B 1AC0A 4WW1A 3VXTA 4GAGH 4M6ML 1FCGA 1Z6JT 5INDA 1CD8A 4BUHA 2DKMA 4K94H 4TVPL 3QEUB 1DBBH 2VAJA 4ORGB 1NCUA 5T3XL 4FA8A 3RKPA 2ORBL 3EO1A 4K7PY 5KW9L 3LIZH 1UWGL 4Z77B 2Y23A 3MLYL 2YSSA 5DMYA 4DUXA 2VLLA 3WE6B 4NJ9H 4YHNA 3QUYB 3GB7A 3UC0L 5MP6H 3REVB 4E41A 1JPSH 1HHGA 3M07A 1A9EA 4N9OB 2W92A 1U8OA 4YAQA 3I02A 5D7LD 3UZEA 3QFJE 1Y18A 3L1OH 4UBDC 1WC7B 1MJ7H 4FQ2H 4RBPK 25C8L 4YIQB 4MNHB 5I71B 5CLWA 1XCQA 3ULVC 1A3LH 4HULB 4IRJD 4OF6A 3MSPA 5IB2B 2JJUA 2A6DB 3QDJE 1M7DA 5L2JA 2VDPH 2FJFA 1LO0H 4M61B 1A6AB 4G6KL 3DIFB 3GUTA 3QT2A 1ZLWH 3T09A 3V6OE 2VL5A 1UKQA 2FSEB 2P7TA 3VJ6B 2VYRE 1H3XA 2ZCKH 4M43L 4NO2A 4F7EA 5FIEA 3D6GA 2HWZL 5AEAA 3SDXA 5F96H 4ZYKB 4YHPA 4CGTA 1MCOH 1VERA 4LK4A 4LSUH 1QFWH 3AU1A 3VFWA 5KG9B 3BH8A 5FGRA 5D7IA 1P7KB 4PD4J 5E5MA 2VLRD 4MDJA 2C5DC 5BW7A 3QEQA 5KSAA 4X6CB 1YDPB 4NKOA 1QACA 1OTUD 2FX9H 3QCUH 4IHOA 4LRNH 4UV4L 5EDXA 1YJDL 1IAMA 3MCG1 3QIWD 3TPUB 4HK0B 3A6CH 5ISZA 3NZHH 3QIBD 2IANE 1EFXA 2AJZA 3LPGA 5DJDA 1I1AC 5J9PA 3VFVA 5DTFA 5I76B 4LCWE 2X05A 4KU1A 4DTGH 5D2NC 4W6XB 4LNRA 4MQXC 1I85C 3K74B 3TIDB 5LVEA 2R2CA 1G7HB 4WRLA 4PTTB 3TT3H 5GGTH 4P4KB 1CT8B 2R2EB 5JXEC 3GK8H 3ZE0E 4XB7A 1FZMB 2P5WD 1HILB 3B2VH 4WUKL 2JE8A 3HAEA 3IFPB 2B20A 4QXUH 4F7TB 5AZ2L 2XOTA 3RA7H 3D85A 3GSNB 2CLVA 4JB9H 5TPWL 4Z78A 4JFOA 5DD6A 2OR9L 3GJFK 3PV6A 5HGDB 4DWHA 3U79A 1UM4H 3W81A 4U33A 5EU6A 1HZHH 4H25A 3SQOH 2PXYA 4NN5B 1I9IL 3KWWA 4RFNB 3IAQA 2EIEA 4LMQE 2E8ZA 3ILPB 2DLHA 4QOKD 1OW0A 1ZLVH 2MKWA 3NH7H 1Q0XL 2RGSA 1E28B 5GS1B 3P9LA 3GMPA 4PFEA 4PJBF 1AXTH 3UPRA 3DROB 4D0DA 3CSYB 5E9DB 1NBZB 3B4NA 3B9VA 5IW1B 4EDWH 4PS4L 4Q6IA 3IDGB 4P23C 3BH9B 4D3CH 5FF6B 4MZ3A 3S3PA 43C9B 3LV3B 1NGQH 5MEOA 5ALBL 1KLUA 1S7VB 4R26L 4HJGB 2DI8A 1UKTA 3U7YH 3UMTA 2DKUA 1QKZL 2F53B 1DP0A 3FQXA 5BQ7B 1RK1A 3C2AH 4PJ7B 3IF1B 5FK9A 1KPRB 4NQEA 2XKSA 4WFFD 2YBRB 4D9RE 3VXRB 4GG6B 1GVIA 1UG9A 2BSSA 4AIZA 3ALPA 5C09A 1UGNA 1XF3A 2X1XR 5EUOF 4JN2B 4UDTB 4WO4C 1N59B 4BSVA 2Y07H 4YR6A 1Q1JL 2AW2A 5AYQA 5CIPB 3VA6A 4P5MA 2VZ1A 2AV7A 2DOCA 4GJTB 4XNZC 3D2UD 2HFGL 2XPGB 1N7ML 2KZ1B 3ZKND 4AT6A 5L2KE 4LAQL 5HYSG 3PQYA 1G7QB 1WEJH 2EDLA 1HHJA 4P46D 5GZOD 1I1CA 3V5DB 1P4LA 3SDDD 1PKOA 1FDLH 5TDOB 4Y16C 2D2OA 1CFSA 4Y4FD 5EBWA 1X6LA 3PDOA 5BVPH 2LFGA 3L3DA 4ODTH 4JFXA 4M62L 4N0UB 3C8HA 3BP7B 4MDIA 1N0LA 2UVFA 5IR1A 1T5XB 4GG8B 3V6FA 1BP3B 5JORA 5K9QG 3QNYB 4M7JL 3QG7L 2GIYA 4GW5A 3HC3H 3JUYA 5LQBL 1MRFH 3JWNC 4TYUA 3NIGE 5CHNA 5F70A 3QISA 2P49B 4EN3C 3DRTB 5AWNH 3OGCA 4MQSB 3RWHB 4H1LH 4HHAB 3UTSE 3LAFA 3RGVC 1A7PL 3KLAB 5DK2A 4QHNA 5EU7E 2Z8VC 4RFEA 4KTDL 5E94B 3PWVB 3VXMB 1KLGA 4QF1A 5D7JC 1G7JA 4GAFB 1IRAY 4EI5A 1CFQB 1OAUH 3GMNA 2K1MA 4W6WB 1FG9C 1BQLH 1YQVH 2CDEB 2A1WH 4LVOC 4CU6A 3QUZB 4L8CA 5J6HB 2RCSH 2KZWA 2Y72A 1NGWB 4WGVB 3BPCB 2FGWL 1XF2B 4TOYL 1FCCA 1IGYA 5SWSA 3JZ7A 5D7LE 4KK5D 5FGSA 4UDUB 4U6YA 4K8RC 1G6RL 1DQML 4I0KA 4UILH 3CXDH 1C16B 2QQKL 5ENWB 5DD5L 1BEYH 4AENA 2I27N 2A9NL 3DETC 3EO0B 4NFCA 1KN4H 4Y7MA 3EYFB 1QR4A 3C6LB 5T1LA 3ZT7A 2P1YA 4XHJC 1E4WL 3KPSD 2KH2B 4FFYL 4NPYB 4XCYB 5EBMA 3KLHD 1JNHB 4FQXA 4KAQH 3TVMD 1LMKA 2VZSA 5F1KC 3LMJH 1CIDA 5I75C 2UY7A 4MA3A 4PYGA 5DFVC 4XCCH 3AM8A 3L3HB 4HC1H 4KKNA 43CAA 3HHRB 3PWPA 3MRJB 5F7HA 5I8EA 4P49A 5D96B 1F3DJ 1EHLH 1EVTC 1F4WH 3KYOA 2E7MA 3Q48A 3G08A 3T04D 4LVHB 4HF5L 1DDHB 3VFGL 4ZFFB 3MJ9L 4XVUC 5IFHH 4K9EH 2VLRE 5JHDA 3O3UN 3BWAA 3QFJB 3B5TA 3WNNA 1F4AA 1I3GH 3GSVB 5JTWA 4WEBL 2WNGA 2D7OA 3P0VL 4XNUL 2R29L 5C0AD 5KVGL 4GRLB 4M7KH 1RUKL 3UPAA 4HFUL 5IOPA 5IB3B 4FNLH 3QIUA 5KZCD 4ZUSA 5FGCE 5GJTH 3WS3B 5DDHB 3RIFF 1P7QA 3ZTNL 3N0PB 5GGQL 2EH8L 3QDJB 5T5NG 2OL3B 4KI1A 1MREH 4I9WD 2BY0A 3DVNA 2ZPKH 1ORSB 5EN2B 4N90D 4X9IA 2F8XC 2APBA 4J3UA 4Q6YA 3RVUC 4X4ME 1AP2A 5B39A 1N64H 2IALA 2CDGB 2AJVH 1D6EA 2D7TH 1KCLA 1Z3GH 2ADJA 5A2IH 2HJLB 1IGIL 5I19L 1UCBL 3N9GL 3U36A 4X6DE 2DWEA 5CBEA 4RFOH 1EEUA 3DX6B 4HIIA 1HSAA 3CFKA 5KS9E 4H20H 2BVEA 5A1AA 1HH9A 4CRPA 3ZYIA 1PD6A 4L8DA 2QADB 3HB3C 5BJTA 3QWQB 4QT5B 3LQMA 3HI1A 5JW5A 3HAEG 4KJPC 4MNGA 3CSPA 1MJUL 4E42A 4M9PA 1MUJA 3HC4L 2X4TB 1I7RA 2IANB 1FFPA 1ZEAL 2YHGA 5DJ2B 3VDBA 1GGTA 4XNXL 2H2SC 3QZWB 3M8OH 2Z31C 4LCWB 4YHLH 5DT1H 1AO7D 5DI8B 4WU7B 1JPTL 1D5MA 4WVRA 1FJ1A 1KN2H 5HGHB 1F90L 2VWEC 4CMHC 1TCMA 2XZZA 1CDBA 5LCVH 1IARB 1CLZL 3MRLB 4C54A 4U7KA 2IADA 5F7NC 5F7EL 3O8XB 4PJ9D 4CBPA 2HTKD 1HIML 4H88H 4JCLA 2HLAA 1SY6L 1RURH 3GHEL 4WFFE 2Z92A 4LLAA 3JWOC 4C58B 2IPTL 4MA1C 15C8L 4OLVL 2UUDK 1AIFB 3LS4L 1KC5H 5CINH 2BNUA 3AS3A 2P8LA 4WI2A 1A1OA 1FL5A 4I77H 2ZCLH 4F2MA 3AREC 4R97C 3U9PL 1A7BA 3TBVB 2DQDL 4JHWL 1JZ8A 1MF2H 3EOBA 4UB0H 4OLYH 2ARJQ 2YKLH 4FQHA 4HT1L 4O2CB 5ANMA 1PSKL 4RMTA 3K4AA 1LEKB 5I1HH 2AJ3A 1IE5A 2F74B 1CU4H 4RGOL 2YEZA 2BOCA 3WFBL 5CJ5A 3U0PB 4LOUD 4XHQA 4G6JL 2OXHA 5FYKU 5DRZB 1ES0A 1JN6A 1BBJB 2W1NA 4WU5B 3GJFA 3GO1H 5I30H 5J12B 1EA9C 4NQTA 1B0RA 3KS0J 1JZ3A 1JPFB 5FB8B 3E8UH 1ZTXL 1NCAL 1CK0L 5ESVA 1F8TH 4WW2F 4O5LL 4R8WH 4ODHL 3AXLA 4PGBA 5KTEH 5JZ7C 3CDGA 1SEQH 1T7YA 5FHAL 3CK0L 1ZAGA 4GUPB 2YWYA 4R90L 3ARXA 2LTQB 5JXAH 4OM1H 5L2KB 1WSST 3WNPA 2OTUB 2AP2A 3QXVA 3SDAA 3MRDA 1BZ7A 5E56A 5BV7L 4MQTB 2D31A 2HRPL 2WBJC 1YMMD 2BDNL 1NCTA 3EOTH 3CVIH 5MERA 1D6VL 1MHCA 4LLYB 5LGHL 1DBAH 3MR9B 2WINB 5EU3B 3WSQL 1MLBA 3KYKL 2DQCL 2DS4A 3EAKA 3QA3B 4BH8B 3P73A 4FXKA 1CD9B 3C09B 5ITBL 3T4AA 5D4QA 5DXWA 4ODSH 4YE4H 5F9DC 5HGBB 2CLRA 3EJZD 4JJ5A 2FCBA 5C3TA 5L0QC 1P7HL 1VFBB 1FG2A 2LVCA 4KUCD 3VFPB 3HMXH 3LKSB 4OLZH 3U46B 4V1DD 3KPSE 3G5YA 5C0FA 1LWRA 3UTSB 3BW9B 4GW4B 4PJDF 1DVFA 3V2AR 1FL3A 3OG4B 2AI0H 4NBYB 5KSAD 4R7NA 3AGVA 1H3TA 3OAYH 5DGRA 1RSFA 2NY1B 3V9FA 3SGJA 2GSGB 2UZIL 5I71C 4KUCF 2AABH 4S0TD 5ISZD 5CWSA 1U58A 1Q72H 5FYLH 2X4UB 3X14B 4TNVK 4AG4H 3K8KA 4LSPL 2HVJA 4PUBL 4TSBH 1J5OL 2DLFH 4JFZH 1U8MB 3JBG7 2EC9T 5D7LB 1MQKH 3QNZA 5T5NF 4HMEA 5DRWB 4Z7UF 1D3CA 3PDDA 1KFAH 5IHZA 2DMKA 5C0AE 1IZKA 3RZCA 2EYSA 2OXGA 3U48A 5L9DH 1SVZA 3TV3L 5T3ZL 1JF6A 4IRJB 3G04A 4M93B 2GSIA 2Y9RT 3LH2H 4I9WE 5C0EB 1U2HA 4N90E 3RQ3A 3G6DH 3QR2A 4ZNEA 2Q20A 1PG7H 1Q94A 5K59F 1T1ZB 5IVZB 4PJCA 2IC2A 5EU6D 4KQ4H 5I1IH 1H15A 5E08H 5EOCJ 1NLBL 3SO3B 4KUZH 5IIEB 4AL8L 3G5XB 2CUMA 2PXYD 2IPKB 1CBVL 2E9IA 1PZ5B 4XCNB 5CKAA 1CZ8L 1GZQA 4TQEL 1IC1A 3QDGB 2R1XB 1OWWA 2VLRB 4XX1G 5B39G 2V2WB 4KROC 1NBVH 4J8RA 1EO8H 3GKWH 2R0WH 5LXGH 4X6FB 2OP4H 4LLWB 3MLUL 2VISB 4P4KC 2N7AA 5GPRA 1OY3B 1BJ1H 4MMZC 4OBRA 1CDYA 3F12B 5EO9B 3T3ME 3QIWB 2NW2A 5SV3A 3WHE1 2VE6B 3QIBB 5FGCB 4GSDL 3TIEB 3IJHB 3MRNA 5ADPH 4OZGE 1DQLL 1AO7E 5DRNB 3OKYA 4NQED 3AMLA 3GRWH 1KB5H 4NRXA 1KENH 2UV3A 5C09D 3FFCA 1A3QA 1XCTB 4YHMH 2AJSH 4HPOH 4HUUB 4NN5C 3DBXA 2IG2L 2FECI 3ARGD 3RI5K 1HYSD 3HZMA 1TVBA 1OSPL 1A14L 1DANU 3T0EC 4PD4K 5LAXB 1DBMH 3FQNA 3VE0B 1HDMA 5T1KB 4LSRH 2IAMA 3PQYD 5E24E 1DE4B 3O6FA 3D25B 3F5WB 1FNFA 3DSNA 1CICA 2WQ8A 3HUJE 2J4WL 4WHTB 5T5FL 3QUKA 4NQSB 1RIHH 4TPRH 2GQHA 3L3JA 3TJEH 2HFEA 2B8OT 1KUMA 1OARH 3RNQA 3V7AG 5EU5B 2ZOKB 1VGKB 4OCXH 4PJXF 4AIXA 5DZOA 3V0WH 1GRWA 3DVFA 3OR6B 4IOIB 2F19H 3I6KB 2F58L 2DQGH 3HFMH 5D7SH 4DGIH 3R8BB 3P0YH 3VXOA 3IDIA 4NKDB 4S10A 2NPLX 2ADIB 5HY9B 3U82B 1G7PB 2FJHA 2YRPA 4Z7QF 2AJUL 1B0WA 4POUB 2UYLA 3WO3B 3VI4F 2IH3B 1MWAA 5IVXA 2ZUVA 1QOKA 3I75A 2DQIL 5E8PB 4FQ1L 3IJYB 3CZFB 3T65A 1IILE 4O2FB 1L7TH 5F89B 4EI5D 2FBOJ 1MLCA 1WTGT 3NFNA 4R2GD 3V5HB 3OAUL 4JLRA 4LKXA 5DQDL 2JK5B 3CH1A 1S7QA 3ECBA 3PABA 4KTEL 4Y8AA 5CP7B 2CD0A 3B3IB 4PY8I 1GGIL 3U6RB 3BT2L 4HBCL 1MCRA 1XIWD 2NLJA 1UA6L 3HN3A 5SWSD 4BZ2H 4U6XB 3MRGA 1MAKA 1SQ2N 5D6CB 1RU9H 3BP4A 1H5BB 4P46B 1J1OH 3TT1H 4OFKA 3PXHA 3A6BL 1AI1H 2G60H 1G7LA 5DJAA 3JWDC 1KCVH 4FQPA 1YEHH 1J87A 2AXJA 1U8QB 4Y4FB 1YMME 1S9KC 1NCBH 4ISVA 5I8OH 1WAAA 4S1QL 4HDIB 5T1LD 2ZNWA 3FCTA 4OCWL 1G9NH 2Y1VA 4FQXD 2PF6A 4XC1H 5EWIL 2VOTA 3CX2A 1LE5A 1N3NA 4WFGD 1K6QH 4YHOL 3GRWL 4JO1H 4NZUL 3SDXE 3CH8A 3E6FA 3RWIB 2EDFA 3IKCA 3PWPD 3GMLA 1EGJL 4PREA 5E4IA 3BZFA 4OKVA 2VSDA 3GSXB 5CGTA 4V1DE 3MX0A 2XNAB 2ZUWA 3FO9A 5D7IE 4X99A 4F58H 2DICA 5FA4A 4X6EB 1A6UL 4N0FB 1EHAA 4PJAB 5JHDD 3MC0A 3ARBA 5DRXA 5J1AA 1DEDA 3H3KA 3BN9C 1SJVA 2R23A 4CADA 3FQRA 1P84J 1CE6B 3V79C 1DTUA 3QIUD 4MSWB 5ISZE 3MJGX 4KRPD 1I9RL 3C6LC 4NQCA 1P7QD 2AXFA 1T7XA 5GS2H 2ILLA 3EYOB 1IAIM 5MEND 4X5XA 3ZYZA 1FSKB 3D0VB 5F88A 3S4SA 5TF1H 2R2BB 1MSPA 2Z8RA 1JRHL 2EE9A 5D1XA 4FQLL 3QWRA 3VFMA 4Y5VC 2R69H 2FHFA 1A6VH 1QO3A 5TDPA 3QEHB 3B8SA 4ONGL 4KZDL 1Q38A 3FOLA 4DOHE 1IQDB 3CC5B 5D96C 3VXSA 2BFVL 3KPNB 4M5ZL 4XGZA 3G5VA 4UV7L 2B0SH 4JAMB 2YZ1A 5TGBA 2VQ1B 2RHEA 4U1SA 1Z9LA 4MLSA 3KPSB 5J89A 1EBAA 3TVMB 3C2SA 3RWFB 3UCRA 3HRPA 2QKIB 3WKML 2V2TB 4G7YH 5EU6E 3C87A 1NC2A 4OCYH 5ID1B 3V0VB 1KEML 3GSOA 1AGCB 5DEZA 1G6RA 3OB0K 4UQ2B 1AR1C 2X4OA 4OF7A 3ROOA 5GRVK 4RZCB 2ATKA 2Y4SA 3VFUA 3VWKA 1F6AA 1TQBB 3W9DB 5EO1B 1YA5A 4FABL 5J06A 3PGFL 4OD1H 1VKXB 2H2PC 4FFZL 5D6DA 4AMKH 4R4NC 4DN3L 3QCTH 4XVSL 2FYYA 1EEYB 5HI5C 1T83C 1FIGL 1U95B 4NWTH 3LQZB 1U3HA 3T0XA 2VXVL 4WJ5A 5C0AB 2MCPL 3GSRA 3CU1A 2DM3A 3NIFE 4NKQB 4TULH 4ZAKC 4I18A 4HK3J 5CILL 5KZCB 3MLRL 3LZFL 4XPHH 2IMNA 4ELMB 1L4IA 2NY6D 5DD1H 4PGDB 5IROC 5EIQA 3MJ9A 2EYTA 4XP4H 3FN9A 4NQEE 3VI3F 3LN9A 5DYOA 5L7XL 3BAEH 4LEOB 5C09E 1HOCA 2QADC 1ZHLB 5DJ8B 5GRUH 4GW1A 4MXQD 3EDKA 3LKOA 4WI3A 5EC1B 3SPVB 3S98A 3VXNA 1DBKL 1QSZA 1ZA3A 1LNUA 1QR1B 1V7NH 3TO4C 1S7UA 2JB6A 1U2CA 2OR7A 3VXPA 4XCEA 1I1FA 4YZFE 4TUJA 3SDCA 2YUVA 1UXWB 3RBGA 1FNGA 3AC0A 4AEHL 1MY7A 3PQYE 5C2UB 3D5OF 2BSED 2X4SB 4XP9L 2X1QA 5FHBH 3ZSTA 2ESVD 3VGDA 1B3JA 1KJVB 3O8XC 4MA8H 1AE6L 4DQOH 1EXUA 1WBYB 1CG9A 4PG9B 3BUYA 4EEEA 4S2SA 4F80A 5C8JB 5GS0D 3O45A 3LB6D 1U8NB 2HKHH 1S9VB 4OZGB 1AO7B 3I3DA 3H9HA 3IJSB 4G9FA 4NO3A 1JGVL 2D9CA 1AFVH 4H5SB 4YHKH 1KJ3H 4X4YB 2VDLL 5HYSB 3O3DA 4LQFL 4Y5XA 3BKMH 4QNPF 5DQ9B 3FAWA 1V5JA 3TYGH 5DD0L 2X5PA 4JANA 4M9OA 1U91B 2XQBH 3MUGA 5D1QA 4Z76A 3L3KB 1X5XA 4MHHG 1TTGA 2OJEA 2R9HC 1VDGA 3CCHB 4QRQA 1D5IH 2PETA 3KJ4B 4P3DB 2NY4B 5DUBB 3GMRB 3IXAB 1R3KA 3SDAD 3ARZA 3VGFA 5IT2H 3HI6H 4MXVE 5FUZH 3U7WL 3ZLQC 1VGEH 2D03L 3HUJB 3GM0A 1ZT7A 4TNWK 1QSFA 1KF9B 4PBXA 5IB1A 4ODUA 3WFEL 1YN7A 1R5IA 2Y7QA 3R06A 4YFEA 5SWSE 2CSPA 3IU4H 4IBLT 4OCRL 1G84A 5KSBF 5B8CC 3H9ZA 1NSNH 5J12C 4X4XA 3TNMB 1EHXA 1UYWH 3SOBL 4GMSL 4ZTOL 4KWUA 3NFSH 5DHVH 3ARDC 2VR5A 4QRTB 1FC2D 1GH7A 1KIRB 1RUQL 4OIIH 4OGYH 4M8QA 4GMTH 3S36X 4Z95H 4EI6B 3F7QA 3KPMB 3S97C 3IETB 4YWGL 5FO9A 4EVNA 5E8DH 2DQTH 3OJDA 3DGGA 4XVTL 4O51B 4WFGE 3VGHA 1ONQA 5LGJB 2LTQC 4LIQE 2GY7B 2VDOL 1N4XH 1OAYH 1MWAH 1JGDB 3EO1B 1ERNA 3E3QC 2A2QT 1G0XA 4U1JA 2YSSB 3AVEA 1M7IB 1TZIA 4UNUA 3ZKXC 3LEVL 4JDTH 5E99H 4I0PA 4OGZA 1WCBA 1ZGLB 5K93A 1HHGB 1B0GA 3QNXA 1U8OB 4KDTA 4YAQB 5EOQL 5BVJB 2L0DA 3I02B 4WGWB 4BZ1H 1Y18B 5F72S 5C6WH 2NYYD 4TVPD 1NAML 3RZCD 1G9ML 5T3XD 4OB5H 1XCQB 3V4UH 1WK0A 4POZD 1YY8A 2OTWA 1YMMB 3GSQA 5E4EB 1JGUH 5F7MC 5KVMC 2Q7YA 5MENE 4RWHA 5L2JB 2NY5H 5GHWH 1CE1H 1IQWL 1JTTA 1P4IL 3DUHA 3FB6