2VWEC

Crystal structure of vascular endothelial growth factor-b in complex with a neutralizing antibody fab fragment
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
214
structure length
214
Chain Sequence
b'EIQMTQTTSSLSASLGDRVTISCRASQDISNFLNWYQQKPDGTVKLLIYYTSTLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKTLPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR B
publication title Crystal Structure of Vascular Endothelial Growth Factor-B in Complex with a Neutralising Antibody Fab Fragment.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 214
sequence length 214
chains with identical sequence J
ec nomenclature
pdb deposition date 2008-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vweC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vweC01
3E3QC 3L5WB 2DMCA 1GGBH 1R5VA 4TSBL 4HJ0D 5I1JH 3HC4H 2BNUB 5DHXB 3H9SE 5DUML 5GJTH 1H3XA 4O58L 5FIEA 1IFHH 5F3BA 5D7JD 5I74B 1J8KA 1AI1H 4X8XA 1HK6A 4RAVB 5IB2A 1OTTC 4L8SB 1BM3L 3HI6L 2AJSL 1S7UA 5F9JB 2GT9B 3SCMC 3QFDB 5K9KB 3ZKXB 4P9ML 4JRWA 1CN4A 4X5LA 1S7XB 1A1OA 5DD1H 5IB1A 5JIKA 1MIML 4QF1B 3TBWA 3MPCA 5D7SH 3BIBX 4ZTPL 2OTUB 4KZDH 2NXYB 1KULA 5AWNH 3O11A 1I8MB 4LSPL 1J1OH 4B7LA 1X9QA 1ZKAA 5D96C 4JN2B 1L0QA 2AK4E 3PWPE 1ADQH 1IM9D 4I9WE 4I3RH 1G1YA 1KB9K 3MLZL 3P9MA 4M7ZC 3GMRA 4ZSOA 1C5CH 2XQYG 5GGVY 3ZKQD 1MI5D 1E28A 1ZA3A 4P2RA 2ICES 2ITCA 2D0GA 5DUBB 3FZUD 1QSFE 3BHBA 4PJAE 1IKFL 4GG8B 3GNML 5DRZB 3SDCD 4M1DH 3MCKA 4JPVH 1HHIA 1H0DB 4K8RL 2GIYA 1UWXK 5AAWA 3GSQB 3JTSA 4HUKB 2DLIA 4XZUA 1KLUA 4HAGA 4D0CA 1IAOA 5ISZD 3V0AC 3ZSSA 1CDHA 2K1MA 3G5YA 3WN5B 2WNGA 4MNQD 4JANB 1DLHA 1JPGA 2HT3D 5FA4A 4EBQL 4DUXA 4KJPC 2D7TH 3QUXD 4HQQH 3BZ4A 2HMID 5LWYL 2NW2A 3N9GH 1FDLH 4Y16C 3ARDB 1G7HA 1EHLH 4WFGD 3MYJB 3KXFD 4N1CA 4Y5YA 5CEXB 1IGJB 4QRSB 1LEIA 1I9EA 5TPWL 4CMHB 5JPMB 3PDOA 5GIRA 2XWJB 1NCAL 1A5FH 4CL7A 2HRPH 4DZBB 3INUL 5DD6B 5IBTL 2MCG1 5E5UB 3WD5H 4NQVB 3Q1SH 4OZFA 3U30C 4KRPB 3ARED 4PV9B 4G6KL 1U3ZA 3HI1B 3JUZA 4I2XB 2HN7A 1OVZA 3S8WA 3FT4A 3LAFA 4H5SB 4OV5A 2VDRH 1E4WL 3MA7A 2XG4A 4D9LL 1VKXB 5GPRA 3P0YL 3DROB 2W9EH 2DQEL 3RP1A 4P5KB 2ADFH 4Y19B 5JUEL 5MENB 3QB7C 4LNVA 3V6OE 4M7KH 4G9FD 3H7BB 3C8KA 1HHJA 4PB0H 3BJLA 5T1KD 1K3ZA 2FO4B 2A6JB 5F7FA 3CDGB 1BPVA 1KG0A 5ID1A 1CU4H 5A3IC 5BV7C 4CN4A 2YXFA 1JMXA 5DWUL 3U7YH 4TVPL 2IG2L 5I1HH 4NO0D 3WXVH 4CJ0A 5D8JL 3F7VB 4RWYH 5EZJA 3GZKA 1T1ZB 1UJTA 3NN8B 5ERWA 3BRDA 5F3HB 3BXNA 2V9TA 4WO4A 3VFPB 4ODVL 1B0RA 5D1XD 2VDNH 4PJBA 3OG6B 1FVCB 3OKNA 4KMTL 1FJ1A 2E5EA 5F1KC 4PRHB 6CGTA 1LNUA 5CAYB 2IFGA 1F58L 3O8XB 4JRXB 2RQ8A 2PYFB 4IJ3B 3O6LL 4OZGB 4QXGL 5CHNB 2P5EE 4AMKH 1QRNE 1UT9A 3SDAD 4JVPA 3UTSE 1KPUB 4MQSB 4UIKL 1T83A 1YECL 1LHZA 2QKIB 4JFDA 4Z7VE 1HIMH 4JQVA 1CD8A 3CSGA 3TVMA 4Q9RL 1Q9KB 5I8EB 5DJCB 3DVFA 5IB5A 3O3DA 4KGLA 1DQQB 4DKEH 4UV4H 2YKLL 2A83B 5CIPH 2J88H 3KHQA 1EHAA 3TH2T 3OKMA 3FQUA 3MV9A 4QXUH 1JFQL 3IF1A 3RHWK 4P49A 1A6TB 3QZWA 1BAFL 4KXZH 5IG7A 5FYKL 3FQXB 1RJYB 1ZE3C 2ZWLT 4X5WA 4ZO8A 2YHGA 2Q8AL 3QNZA 3K8LA 2ARWA 4MA8L 1N6QL 1MREH 1AGEB 3FFCD 4HUWA 4R6UA 3RUGF 3TPUB 5A2LH 4NQXA 4BKLB 1WCBA 4DK3A 4DCQA 4FQ2L 3DX9A 2A6DA 1CYGA 3FN0L 4JDVA 5DGQA 3LSOA 3I6LE 5HVHC 4W4OC 2IWGA 1KC5L 1FFNA 1IGCL 3CX5J 3MREB 3S3SA 3TJHC 5I1DB 2HJKB 1X5YA 5FEBA 1FFQA 2AQ3A 1Y6MR 4X5XA 5CEZL 1F45A 1IVLA 3K46A 1FL5A 1BD2E 4KJWC 3E0GA 5IGXH 4RMRA 4U3XA 1T7VA 5EU6B 2AGJL 3KS0J 5JW4N 3VD9A 2BK8A 3O9WA 5C0GB 5CCKH 4G7VL 4ZFGH 4X6CF 2E3VA 3ZKNC 1QFWH 3AXLB 2GTZA 3B9KB 2BP3A 4OLXL 4EXKA 5I19H 3Q5TA 4Z0XB 4O51A 3SE4C 3W0WD 1A9EB 4ZUSB 4MXVF 3KPMB 1YEIH 3BQUC 5FHAH 2L7JA 2Y7QB 2Q86A 1HYRC 5KZCB 3WV0A 5TE7H 4K2UL 1INEH 3TP4A 3O3AB 3H9SB 3ZLQC 5GQBA 5TDPB 1KSRA 4L1HA 2YPVL 1I4FA 3VXRE 2Z91A 3HLAA 5E5MA 1R5IA 5F9DC 1Q94B 3OAYK 3CGTA 2H1PH 3MUY1 1AHWB 3NCEB 3DRTB 5L9DL 3I84A 4XTRD 2I26N 1A4JA 4DKFH 3S97C 4JM4H 3VW3H 3Q5OA 4PRNA 3MRPA 2J8OA 3D39B 5ALBL 2R69L 4O02L 1M05A 1D9KC 4GW1B 1N8ZB 4NBZB 3O41A 5IJVB 1DBBL 4M02A 1X5LA 3G6DH 1QLFB 8CGTA 4J2XA 2AK4B 4L3CB 2JJVA 5IHBA 1CFQB 1QQDB 5EBGA 2P44B 4TUJA 1Q72L 4OFIA 1D5IL 1ZLUK 3UTQA 1H15A 1N2RB 1QSFB 3DSFL 4J4PC 4EKXA 1KCUH 4I0KA 4LQ1A 4PJAB 4Q6IC 2ZKHH 5J11B 5CEZE 3BP6B 3KLSA 2HLAB 5AYUH 1I9IL 4HJJL 5T33L 1KIRA 1V7MH 1PDKA 3U7WL 3IAPA 4KK5C 1CXFA 2HTKC 5IK3A 3LS4L 2VZTA 3SPVA 1Q9LA 2EKJA 3GRWL 4X0KB 5EU5A 3HC3H 4WHTA 4EI5B 3T0WA 2X4PA 4GXVH 4U33A 4NHCH 3NZ8B 1SEBB 2XYCA 1J0IA 2WANA 5HHVL 2BVPA 4YWGH 4I0PD 5EG6C 3UTTE 4P0DA 1YPZE 2L0DA 1LO2L 2X1OA 1HOCA 3GSNB 3MV7E 3PQYE 2NY0B 5A2IH 4XHJC 5D7LA 1YEGH 1FSKC 4Q9QL 2N1KA 3DTXB 3O2VL 4GLRH 1AGCB 3MZTA 5M7QA 5J57B 2FRGP 2FJFA 5DJ0A 1HHHB 3GBNH 1EGJL 3VXQB 3W5MA 5SX4H 4LSQH 5C6TH 2R1WA 5E00B 1OGAE 2CIKB 2B39A 4JFEB 3TYGH 1JYXA 2VWEE 5HGAB 3MGTB 5EBMA 2PXYB 4NWUH 1HYSD 4G6FB 3IS0X 2FLBT 3QJHB 1KBGH 1MLBA 1YEKL 1J8HD 3LN5A 5D1QC 4PYHA 1V3MA 3MRLA 4MAYC 3MFGB 4JY4A 4J23A 2FX7L 3RVUC 4GXUN 4H20H 2VLLA 1D6VL 2O5ZH 3VXOA 2FIKB 3MX0A 4NRYB 3CFKA 2D03L 4N0CC 1EFXA 3D85D 4EOWL 1VFAB 1RZJL 3KPLA 3P4LA 1EJOH 3VA2C 4ZO7A 4AH2A 5C0IB 1KCSL 4O2CB 4X4ZA 5IVXF 2VSDA 3LKNB 4J8RB 4H88L 2OJEB 1IGMH 4TVPD 3GSVB 3IFNH 5ITFA 3O4LA 2H2PD 1NCNA 4XWOC 5DHYA 5EPMA 3EOYG 1NCBH 1CF8L 3MUZ1 2QSCH 4L4TD 4WW1A 1P7QA 1AGBA 5FGSA 4M9OA 4KJPD 1G9EA 4JLRB 2WM0A 2CDFB 4DTGH 5MEPB 2FD6L 1JV5A 2CK0H 4Y89A 1I3RB 3VRLF 2ADJA 1JCKA 2P5EB 2F8XC 3UPRB 2ZCKH 3UTSB 4K7PH 3BN9C 4Z7VB 2GTWA 1FNEB 4XCEB 1BQHA 4IOSD 5F8QC 5EUOB 1JGEB 5LGJA 4UINH 4K7FB 1G7IB 2VE6A 4BFGA 4JAMA 2DM4A 2IQAA 4N8VG 4X6EA 4MJ6A 3T77B 1CGWA 3FO9B 1MRDH 1IAIM 1F3RB 3VD3A 3LEXA 4NSKA 1NMBL 3GEWB 2WIMA 1LK3H 3X12A 2B1HL 3OJDB 5T1LB 2A9NL 4OUUA 3RWDB 4OZGF 2NZ9C 5FYKD 5LBSH 4JB9L 3HPJA 4EIGB 1NDMA 4N9OB 1XR9B 4OF7A 5GZOC 1G7JA 1T2JA 5I2IA 4G8GA 4ODSL 3V6FB 5A2JH 2FECL 1FV1A 2CQVA 1VEPA 4HKXB 2Y4SA 5TGBA 4GMSL 1WFUA 5KSAA 4TNVF 2Y1VA 3VWKC 4PG9A 4X6FB 1E6JL 4QHNB 5KSUA 3HRZB 3L7FB 5A3ID 1BD2B 1NAKH 3ARVA 3LQAH 3B43A 4NWTH 1UB5B 1W2KT 3RAJL 1EX0A 3QWOB 2HFGH 2FB4H 2XICA 3GSOB 5I6XC 5GISL 3V0WL 3MV8A 2OR7A 5HHPA 4M61B 4BH7B 4KVNH 5DDHB 4UDUA 4Q2ZA 3TA3B 1WAAF 2WK2A 2BNRD 4UNUA 4JFYA 3V4PL 1EXUB 1NBYB 4XNMA 5DJZA 4F7PB 3HR6A 1A3LH 4YK4B 3FMGL 5DZLA 3OJVC 4EI6A 1QSVA 1T3FA 1JI1A 4OAWA 4X6DB 3MMEB 5TDNB 4PV8B 1S3KL 5I74C 1U8KA 3ZDZF 1FPTH 4YHMH 4L8SC 1NBVH 2NX5D 3B2UC 3LOWA 5EOTA 3I6GA 1LE9A 3BMVA 4KKCC 5EORH 5LGHL 5TE4L 3DIFA 2FO1A 3VXRB 5C1MB 2CDEA 5T1MA 4MD0A 1JNNL 2DM7A 2E7BA 2OZ4H 5FK9A 1M1SA 2LU3A 5BQ7A 3T04D 5HVWA 4JJ5A 3IXAB 3STZB 3P4NA 3BISA 4X7SH 5AG9A 3ZSTA 5EBLB 1XZ0B 2NXYC 1XCTA 2V5MA 4LAQH 3VXMD 2RAMA 3LMJH 4OF0A 1ZLWH 4NNXB 2UWEE 4PJIA 1UXWB 3P11H 1XGTB 3P73A 4K94H 3CU1A 4DW2L 2P48B 1A6WL 2V7NA 2I5YH 4HPYL 4XXDA 1CE1H 2CKBH 2VAJA 3P30L 5FCSH 4HPOL 2I25N 3EDJA 2D0FA 1G9ML 5HI3C 4RMUA 1HDMB 1T7XA 4LU5H 3KPPA 1WZKA 5DRXA 3BP5B 3LD8B 2ID5A 1U8JB 1ZAGA 3RWIB 5F71A 2DYPA 4MA7L 3UPAA 1L6XA 5FGBC 2WUCH 1DUZA 1FAIH 3O45A 5JXEA 4WHYG 5C6WH 4P2RE 3B9AA 3DHJA 1X6LA 1ZLVK 1OPGH 3BD4A 4XPFL 3FONA 3UC0H 3VFWA 4GAFB 1QSZA 4AM0A 3MRCB 5GS1A 1KFAH 4TQEL 3TNMB 3QDHA 4XP5H 1UWXH 1YEHL 1T89A 2Z4QB 1V05A 1W72A 4NQCA 4MXQC 5ENWA 4W81A 4XNZB 4S10A 3R8QA 4LEOA 1NFDA 5DHVH 1DZBA 3T0DA 4PJEE 2IH1B 2DDQL 1RY7B 3CVHL 3EHBD 1OSPL 4MSWA 5E2WH 2VL4A 4MNHA 4QHUB 4ONGH 5AEAA 3S4SB 1BBJB 3MCG1 1JPTH 3FB8A 1KENH 1PVHA 1YEFL 4CMHC 5EWIH 2DM2A 4PJAF 4RDQG 1LD9B 3MV7B 3ROOA 1P9MA 3MLVH 4LVNB 4Y5XB 2JJSA 5DSCB 5TJWK 1YY9C 1C16A 4CADB 3TFKC 5EIIB 4HC1H 5CWSB 1U8MB 5INDA 4YAQB 3V5KA 3HC0A 4ZPVA 3LKQA 1NUDA 2DQUH 4PJDA 3V7AG 1G84A 5I9QB 2VUYA 2R2BB 2X9XA 1FFPB 1OGAB 4X9GA 3WSQL 3QFJD 2ED7A 4WWKA 3U48A 5K9OA 2EIEA 5JDJA 1DQDL 3SN6N 5LXGL 4AJ0A 1HZHL 3RWGB 3MLTA 2FBOJ 4PS4L 4EN3A 4G8EA 4UT9H 4Z7NF 3H3PL 2J7LA 1AIFA 3CFCL 2FATH 1SM3L 5HYJD 5HGDA 4LVOB 1A3RL 1QUNA 2D7NA 1BF2A 3BKJH 4O9HL 1L0XA 4D3CH 3DRQB 3ALPA 5ELIA 1ZGLM 3G08B 3MLXH 4JM2B 1OB1B 3A6CH 4NQDA 1P7KB 3F5WA 3WNKA 5FF6B 4CMMB 3IDJA 3SO5A 1E27A 5DJ6B 3TCLB 4NO3A 5AUMB 5GRVK 2AEPH 5DJAA 2VDMH 3QDGA 5MP6H 4N8VA 2J12B 1SYSA 3TIEA 5DT1H 5J0BA 1F3JB 5I1LB 4JREC 1QYGL 4F7CA 5JXAL 3H0TB 1F2QA 4P3WA 1H8SA 4JFFD 3VXSD 1HWHB 5FYLD 1A14L 2VLJD 5ESAA 4NKIL 1BIHA 5AG8A 2BHYA 2C26A 3QG6B 3IXTB 3MRHB 1I9RL 3M1BB 2BY0A 2VXSL 4LDEB 4EXPX 3C5JB 1U3YA 5HGHB 3O8XC 4RISH 4IJ3C 4JZJA 1NMCB 5DRWB 3HZKA 5E1AA 3ARGA 4U1KB 4OIIH 1C7TA 3C60B 1B4RA 2XXMB 1EA9C 1I1AA 3UMTA 4ZXBB 1PLGH 4PJBE 1JHKL 2I9TB 4PJ8A 4XPHH 4XI5D 2HP4A 4N5UA 5CMAA 3G9VA 2O61B 4PP2A 5ADOH 1TTGA 3S9DB 1MCKA 4M9PA 3QEGL 3TBVA 1TVHB 3Q3GB 2BXZA 2YC1A 1AKJD 4YBLB 2UY6A 5EOCL 3TO4A 3VFTB 3I9GH 3IJYA 1LDSA 1DSFH 1N3NB 4JFDE 5FUOL 3VXUA 4MJID 3O2DL 3QIWB 4GKSA 5SX5H 2A6IA 1PYWA 3E6HA 2DLFH 5JW3H 1UM4L 5LAXB 2YUXA 3T2NH 5C7XH 5BVPL 2X4TA 1HH6B 4OFYD 1NLBL 5CZXD 4KROD 4M8QB 1GC1L 3SDXA 5F1NA 2C1OB 3TWCH 5IESH 4CVZA 1SVZA 2BOBA 2PN5A 5J4MA 4NUJB 4FA8A 5E2JA 1YQVH 3CFBB 1NKOA 3BKYH 5EUOF 2FIRT 1QLEL 4FQXD 5BO1L 3SOBL 1YN6A 4JVUA 5CZVH 2H2SC 4KI5E 4U1GB 4LBEB 4EZMA 4N0CD 3GMLB 5FO7A 2FZ3B 3OHXA 5EZIL 3MROA 3SKOB 3IRZA 3CFDA 1S9YA 4Q6YA 4GOSA 4LARL 4BSJA 5CGTA 4EUPA 3WHXA 1U95A 4HIEB 3PHOB 1IQWL 3B9KC 3ZE0E 3HUJA 4S1SH 4FTVE 3WFHA 3CFJA 3O3BA 5IW6A 1JWUA 2V7HB 1QOKA 2YD1A 4HH9A 3GHBH 2DLTA 4M5ZH 3MUHL 1VFOA 2CLVB 1S9WA 2IPUG 5C0AD 1OOAA 5B4MC 4FFVC 4L9DA 3FHQA 3ARFD 4FXLA 1CGYA 4HS8L 2G2RA 5GGUA 4YDJB 1ES0A 5E99H 4G6MH 3JUYA 4J3TA 4DKAA 5GHWH 4Z77B 3NAAH 5IROC 2EDXA 2ICWJ 1S7VA 2JCCA 4PJGE 4ZAKA 3WS3A 3JWDH 1P5VA 3RVVC 1G6RL 2F54E 1T0PB 1U8HA 3HNSL 4G6AC 3RBGA 1P2CA 3WIHL 4PJ9A 4WGVB 4LHUG 3N50A 2MPAH 3WJJA 2AQ1A 1OAYH 4XVUC 6FABH 5IB2B 5E1HB 3RNQB 2NY3B 5I76B 5GRUH 1ZT4A 1S7UB 3CIQA 2NR6C 1UH3A 4WW2A 3K8MA 4X6DF 3JWDC 5H2BA 1QLRA 4GAYB 2UYLA 4XX1E 1ACZA 5IB1B 2BHUA 3C6LC 2Z8RA 3ZDYF 3TBWB 5GZOD 1FRGL 1WEJH 4IRZL 5J11C 2X4RA 4WCYL 3A6OA 1I7RA 3O11B 1I9JH 3K81A 4TSBH 4X98A 3IAQA 3ZYOA 4FNLL 1ZLUH 1YC8A 3IB4A 3P9MB 5DUMH 2RB8A 3GMRB 3IDNB 5T3XE 4O58H 4P2RB 4Y4FB 2ITCB 4OF8A 3BHBB 2XKNA 3EW3B 1H5BB 4F9PA 1Y18A 3WJLA 4HKJB 4X9HA 4EI5C 5DD5L 3V6ZB 4NRZA 1BM3H 3HI6H 3MRMA 2AJSH 3MCKB 4PD4K 1HHIB 4QTHA 3WFZA 3JTSB 4RAUA 2IBZX 3BJ91 4R0LC 4Y1AA 5HI4D 2IPTL 1KLUB 3V79C 4D0CB 1IAOB 3AMKA 2CLRA 4POZD 3QUZA 1MIMH 3JWNC 3RGVC 4LMQI 3QXAA 4QNPF 5GGRA 1DLHB 4ZTPH 1JPGB 5FA4B 5CJOL 3ESVF 4ZFZA 1FN4A 1RZGA 3BZ4B 3WUWG 2NW2B 1RJCA 2ZG2A 4X6BA 3MLZH 4K3DL 4YDIL 4F3FA 4AQ1B 4D9QE 5DJXA 5F1SA 1G7HB 1N5YL 2A73A 1CIDA 1DBJL 3ZO0A 1AO7D 2JKXA 3B2UD 1AH1A 1AY1L 3F12A 1IKFH 1TITA 4Y5YB 2YRZA 3GNMH 1HXMB 2B0SL 3DMMD 5D7LE 2QQKH 2ZUWA 4WI8A 2PXYC 5CKAA 4A6YH 3UPCA 4KKLC 5MHSD 3PDOB 5GIRB 1I3UA 2EDTA 3UYRH 3MRRB 2NY6B 1RZFL 3JZ7A 5E70A 5EULV 2AI0L 3MJ9A 1N7ML 2DL2A 2HN7B 3LB6C 3V6OC 1UVQA 3FT4B 4EBQH 4IRJD 5TQ2L 1N26A 1QEWA 1Z9MA 1IILE 4OV5B 5HHNA 1XF3A 2C1PA 2MQ3A 3CXHK 3WNLA 1J9CT 5EO1A 2ATPA 1CDBA 5E2UL 3VFNA 2XA8L 4HF5L 3PUCA 4LLVA 4K8RC 3IDYB 1JMZA 2BMKA 2B1AL 3JV0A 1MRCL 5IOPA 4L8CA 2P4AB 3NFSL 2NY2C 2MWCA 5TPWH 3RWHA 3C8KB 1KTLA 1NCAH 1WBXA 5B39A 1KG0B 5ID1B 2YWYA 1GGCL 3INUH 2J8UA 5IBTH 4G6KH 4DGIL 5DMKA 1B0GA 5EZJB 3WYRA 3DURA 5CZKA 3AS0A 5ERWB 3BXNB 3FCTA 3O4LE 4JM2F 3GSNL 1E4WH 1WT5C 4LLWA 4D9LH 3ZDXF 3QR2A 1B0RB 3ARDD 3P0YH 4Y2OA 4PJBB 5D7KD 1IC4L 5JMOC 1U8QB 2DQEH 5C0BD 1FJ1B 1P4IL 1DBKL 3H2WA 1ZV5A 5JUEH 1VGEL 4NT6A 1B6DA 4YQXL 3W11C 1MRFL 5IJKA 3UJTL 3RQ3A 1VSCA 4ODWA 3REWA 1CBVL 1MH5A 3EIFA 4KRPD 3K80A 3UBXI 1HINL 3TYFA 2ED8A 2WUBL 4JFDB 5DWUH 3JV4A 4TVPH 2IG2H 5ICXA 1G7PA 4J3SA 2QQNL 4RX4A 5D8JH 15C8H 5IB5B 3O3DB 3DUUA 1LP9E 1M7XA 1U58A 5HHME 3OKMB 3FQUB 4ODVH 1RZ7L 4HUUA 2DBJA 3MV9B 4MYWB 3IF1B 4KMTH 3S7GA 4HT1L 1JNLL 3QZWB 5MEND 2NY1B 3JSSA 4G43A 5IG7B 4X99A 5GGSA 1F58H 3QNZB 3MACL 1K4CA 1YEEL 4A2LA 1QA9A 1KJMA 4XWGL 4HUWB 1FYTA 3O6LH 4QXGH 3ULUL 4OD2A 4NQXB 1MCNA 4W68A 1OW0A 3QWRA 2R56L 1BJ8A 4DVRL 1WCBB 4UIKH 5D9SA 5D5MF 5DUPH 4ZNCD 1WQVT 1YECH 4DCQB 3DX9B 4G8GE 4JDVB 1NC4D 1UKSA 3C6SA 3LSOB 4MJ4A 3V2AR 3UDWC 4Q9RH 2D7QA 3HG1A 1FFNB 5I8CA 3T0BA 5EZLB 1BVZA 2A6KB 3VI3E 3TA3C 2YKLH 2BSSA 5C0NC 4X5XB 1FL5B 1JFQH 3BESR 1BOYA 1BAFH 3O8XD 4JRXD 4R26L 3O9WB 2O5YL 3NOIA 4DOHE 5FYKH 2Q8AH 5M94B 4MQTB 2VLRE 3MV8E 1N6QH 3C9NB 1S5IL 3MRGA 2R4RL 4JZNA 5JW5A 3GSRA 4S2SA 4G3YH 5DC0A 3BFOA 5CS7A 5ETUA 4O51B 4FQ2H 3FN0H 2YD9A 2ICWI 3QNXB 3CCHA 3GIZL 3X17A 1KC5H 1IGCH 2Q86B 2F54B 4H26A 5FDYA 1MEXL 5JHDA 1IGTA 3KPRE 2R0WL 4WV1A 5CEZH 5EU7E 3I6KA 5FV2A 5E08L 2W9DL 2WP3O 5CD3A 2ARJQ 4UQ3A 2ITDA 2EE2A 1I4FB 1M6OA 4JPKL 1MCCA 2Z91B 3HLAB 1R6VA 1R5IB 5E5MB 5J8OA 4G7VH 5HYSG 1YA5A 1UACL 3ZTJG 3T0VA 5IQ7L 4YBQD 1IC7L 3MR9A 1A4JB 4OLXH 5BXFA 3K4ZA 2XT1B 4HWBA 3VG9B 1X7QA 4CVWA 4PJIE 4PRNB 4NN7B 1JZ6A 3MRPB 4NDMA 3ARBA 5DTFA 4IEFB 1VEOA 3ULUE 1M05B 4YC2B 3O41B 5B3JE 4IRSA 4TNVK 3SEPA 1Z3GL 4K2UH 4R90L 3NGBC 1EEQA 5EU6D 4M5YL 4TUJB 3CZFB 4TPRL 1NAMB 1T0MA 2CSPA 2YPVH 3UTQB 1H15B 4XNZC 5K9JL 1ZLVH 4NNPL 2HVJA 2DQDL 1RUPL 2OTPA 3B9KD 4BFIA 4YO0B 2APXA 3OF6D 5L9DH 3SCMA 4PGCA 1PGRB 4GAGL 2VXUL 2X9YA 5F7HA 5IK3B 2FHCA 4RMQA 1CDIA 4NKQB 5ALBH 3SPVB 2R69H 1Q9LB 5B4MD 4O02H 1ZVYA 5EU5B 4TUKL 2QQQA 4LVNC 4Y5XC 2DQJH 4WHTB 1DBBH 1TTUA 3HPLA 3ILPA 3O2WL 5C0FB 2BVPB 1FNGA 1ZT7A 3ROLA 3QCUL 1Q72H 4LSVL 5I9QC 5HHXL 2EC9U 4TVSa 2VERN 1D5IH 2C3GA 3DSFH 1FORL 3UEZA 1YZZA 2VWEC 1IRAY 4FOMA 4OQ1A 1IEAA 5D7LB 1MNUL 1FZJA 4QXWA 1JL8A 4LLUA 1ED3B 4HJJH 2VYRE 1HQ4A 4Y2DB 1JIBA 5T33H 1KELH 5FUCE 3D39D 2FJFB 3BKCL 3U7WH 4ZFOA 4LVOC 1IKNC 1ULVA 1DP0A 4KKAC 5DURD 3LS4H 5GXBB 4GRLC 4QWWC 4LFHG 3CVIL 1LE5A 4JM2C 2JB6A 3GRWH 5ESVA 4HK3N 5DD0L 2UZYB 1B3JA 3IAGC 5EBMB 3JV6A 4PBWD 4JRYE 3P0VL 2ENSA 1SY6A 4R7DA 1QFUL 4N5ED 2YD8A 5HHVH 2VDPL 3EJJX 1AJ7L 1N59A 1MLBB 3LN5B 1A6UL 1LO2H 2VZSA 4Y16A 3BZEA 3MRLB 3S34L 1FG2A 4NQDE 2D4FA 4CVXB 4RGNE 2VLLB 3A0OA 3DV6A 3QDGE 1G9NL 3VXOB 4Q9QH 3PIQA 4FFYH 3O2VH 2VRAA 3CFKB 4G8FB 3UAJC 4BFEA 1BLNA 1EFXB 4OT1L 3KPLB 4LNRA 1NMCC 4M3JA 1EGJH 3QIBA 1V7NL 4ZUVA 3C60C 1DN0A 4WUKL 1F6FB 3L1OL 4PTTA 1ZANL 5D4QA 5CD5C 1NUNB 3MUGA 3O4LB 3C8HA 2Q7NA 3TIDA 4HULB 2A2QT 3GI8L 5DHYB 5EPMB 1NGPL 3T4AA 2WP3T 4ISVA 5DI8A 2OCFD 5F9WC 1RFDL 2Z9TA 1P7QB 1YEKH 1AGBB 3IU3A 4NNYA 4WW1B 2NY0D 4MX7A 1SJEA 2MKWA 1GOFA 5A43C 4F37F 3H8NA 4YBLC 1F4HA 2FX7H 4FS0A 1JV5B 1D6VH 3GJFA 4XGZA 2ADJB 3D9AL 2D03H 3QIWC 4ORZC 1JGVL 1TCRA 4EOWH 1RZJH 5DK0A 4NCC1 5I17A 5FYLH 5EA0L 3FT3A 4QKXB 4KXZI 4JFED 1KCSH 1GGUA 3ABZA 3VRJB 2GTWB 3AUVA 1BQHB 4H88H 3BZDA 3IYLW 4PYGA 1IGYA 2PXYD 1KTRL 3CSPA 4P2QE 4G6FD 2W38A 1K6QL 4D0BA 4H8WC 2VE6B 5F96L 4JAMB 5FDWA 2IQAB 4X6EB 5HHMB 4PJBF 4MJ6B 1CF8H 1H3WM 3BPOB 4JGUA 3EYFA 4KK8D 4JFHE 3TT1L 4OCYL 1IQDA 4NSKB 4P3CL 3RU8L 4JO2L 2PW2A 3S5LG 3X12B 2XN9A 4OUUB 2JB5L 2FD6H 3HPJB 1QZ1A 3SDXE 4BFBD 1NDMB 1TQCB 2DOCA 3LRGA 4YHPA 1G7JB 5I2IB 4KTDH 3BPCA 4TUOA 4G8GB 5ICYA 2YPLD 1FV1B 1U3HA 3LHPL 1KOAA 2VQ1A 5TGBB 4MQXD 3FQWA 5KSAB 5F7YC 4CBPA 5IVNA 2VOTA 4PG9B 5H8DA 3Q6GH 5KSUB 4PJCA 2EC9T 4N1EA 2IADA 4KDWA 4NCC2 3HUJE 5FO9B 1H3GA 3DHMA 1NMBH 4DOHB 3BGFC 2B1HH 2VLRB 3DYOA 3MV8B 4M6OL 5HHPB 4JB9H 2Y72A 3P0GB 4UDUB 4IBLT 4Q2ZB 1CGTA 4YHZL 4M4RA 4JFYB 3NFNB 4KI5F 4FABL 4JKWA 2VR4A 4ODSH 4EI6B 1F90L 1ND0A 1T3FB 3W11D 5CIPA 2CXKA 4LCWA 1OF2A 2I07A 4GMSH 4OAWB 4XT1C 4W4OA 4GRWH 3OZ9H 3ZE0F 2FLRT 1L7TL 4CN1A 1U8KB 4U3HA 3KPRB 3BEVA 1E6JH 2R1YA 2R2EA 2VIRA 2B2XL 3HE7D 5EOTB 3CX5K 3QA3A 3I6GB 1LE9B 3BKML 3DIFB 5T1LD 3RAJH 5T1MB 3IKCA 5CP7A 3AGVA 4MD0B 5E4IA 5GISH 2VITA 5FK9B 3NCYP 5BQ7B 4JJ5B 3WLBA 1ITBB 3SKJL 3P4NB 3C5ZA 2HKHL 1XCTB 5JNYA 3QXDB 3V4PH 3L3HB 1I8IB 1QVOA 4PJIB 4HJGA 3T3PE 3P73B 5IB4A 5F88A 3FMGH 2EYTB 4MD4A 1CICC 3SE4A 2V7NB 4QRRD 1R3HA 2B8OT 3LEVH 4Y4FC 1FC1A 1PJ9A 3B6SA 3DYMA 3QDJA 3M17A 4XXDB 1S3KH 4WUUE 1H5BC 2DI9A 3U0WL 1BD2D 3PGCA 4W4NA 1UA6L 1NFIA 1CDYA 4ZS6C 3AS3A 3KPPB 5DRXB 3T8XA 4U6HB 1NEZG 2DYPB 2NPLX 1UZ8A 1DUZB 3O45B 1QBAA 2J4WL 2XFXA 1F8TL 2PO6A 4KWUA 4LCIH 1CK0H 1ZGLP 1U0QA 3FONB 4WNQA 3VFWB 3QBTB 5GS1B 5FB8A 1QFWM 3UZVB 2HFFA 1SYVA 1W72B 4XP1L 4KMLB 1QPXA 2FH8A 2ZUUA 5ENWB 5C0EA 3O6KL 4LEOB 1NFDB 4DW2H 1A6WH 5J7CC 1MHHA 1D9KA 3U82B 4HPYH 2IF7A 2WWMD 4HPOH 2G9HA 3Q0HA 4GLRI 4B50A 4ODTL 4MSWB 2RIKA 5C0RL 1G9MH 4MNHB 4BUHA 4Y5YC 1AQKL 1CVSC 1DL7L 3FB8B 2HAZA 2KH2B 3QEQA 2CGRL 3WXWL 2P5WA 4MA7H 1J0JA 1EUTA 2ESVA 3ROOB 2NY6C 1EFQA 3BOVA 1ZT1A 4Q6IA 3WFCL 1C16B 2AXHA 4LKXB 4XPFH 1FVDA 5INDB 3V5KB 3HC0B 1NCTA 4TQEH 4ZPVB 3LKQB 4Z9KB 5E94A 1PW3A 4AK1A 4PJDB 1YEHH 5CBAA 3OXRA 2WQ8A 4ZDHA 4RGMC 3KLHC 1NH6A 2XTLA 4WWKB 3GKWL 3KPSA 5K9OB 5C0CA 4WENB 3IDYC 2HFEA 3CVHH 1OSPH 3PG2A 2HT4D 3MLTB 1PAMA 4EN3B 4G8EB 4LPVA 5F93C 1AIFB 1YEFH 2DTML 1I85C 4D9RD 5D2NA 4KKBD 4NQDB 1U8PA 3HN3A 1YYML 1J87A 2IC2A 4RGNB 3IDJB 5DJDA 5ACZA 4NO3B 3QDGB 4Y4HD 4N8VB 1SYSB 3TIEB 3FOLA 2NW3A 1TJHL 5IEKA 1AC0A 1AP2A 1AQDA 5GGQL 4F7CB 2IAMC 4HXBL 4LDOB 4M7LL 1I7ZA 2EDHA 3B83A 4E41E 5ESAB 4JHWL 1I3GL 3ULVE 4XRCA 3WSQH 5C08A 3EGSA 1K85A 4XAKE 1DQDH 2LFGA 5LXGH 1HZHH 4KK9C 4PS4H 3H3PH 2XZZA 3CFCH 4JZJB 2X1QA 4AG4L 4MB3A 1SM3H 5FM5O 3HZKB 4PJ5A 5E1AB 1A3RH 3ARGB 3EBAA 4O9HH 5F7UA 4OM0L 1I1AB 1P1ZB 4FZEL 1ZK9A 1T83C 1QTYT 4MAYA 1DANT 1OGTB 3HMWL 5E56A 4PJ8B 4JQVC 5DQJA 1IARB 4PP2B 5C09E 2BSRA 5JXAH 2DLHA 3NCJL 4NPYA 1A14H 2YC1B 3OB0K 5F7DB 4NKIH 1FG9C 1LO3L 4P2QB 1MCJA 3I3BA 2MHAA 3TO4B 2NY1C 3IJYB 1I9RH 5SWSA 2VXSH 4HGWA 3IDGA 3NA9L 5GGTL 3VXUB 3AS2A 4APQD 1TJIL 2ERJC 2EC8A 2F74A 4KKAD 4GKSB 2A6IB 1PYWB 3RNKA 3E6HB 4OLYL 2MSPA 4JM2D 1RK1A 4CU7A 2EYSA 2X4TB 1MQKL 5GRZA 1KN4H 1JHKH 3DYPA 4OD1L 4KI5C 3OAZK 1P53A 1UEMA 5H37G 1IC5L 3SDXB 2VR9A 1FQ9C 2YUVA 4AY0A 1J5OL 5F1NB 3WNNA 1FYTE 4CVZB 1CD0A 2BOBB 3BX7C 2J1KA 4P5TD 4EQ2A 2OLDA 3ILQC 1YN6B 4NGHL 5EOCH 4P9HL 1DBMH 5FUOH 1J1PL 1SBSL 1S9YB 3BZFA 4EUPB 5F9OL 1U95B 3MLRL 4ZXBD 1UM4H 2CIIA 2QADB 3HUJB 4OCXL 4L8BA 3HR5A 5EU4A 2CUHA 1J11A 3WFHB 5BVPH 2FHBA 3CFJB 2AK1L 3O3BB 1NLBH 1EAJA 5IW6B 3ZYIA 4HH9B 1GC1H 1S9WB 1RQ5A 1GXEA 4I3SL 5DLML 5A16B 1NEZA 4OBRA 2HG5A 2BDNL 2G2RB 4PJHA 4YGVA 5GGUB 4X7EC 5HYQA 2BVTA 4OB5H 1G7QA 1QLEH 5BO1H 2EH8L 3SOBH 4DN3H 1OAQL 1K2DA 2DBLL 1Z6JT 1S7VB 3LKOA 3MOAL 4F58L 2JIXA 1ZLSL 1AI1L 1BX2A 3IFPA 4ZAKB 5EZIH 5FYKU 1OTUC 3WS3B 4LARH 1IQWH 1U8HB 1BJ1J 2GJ6A 2BSTA 3VG9C 1NANI 4NN7C 4XPTL 3D2UD 4PJ9B 4BK5A 2X44D 4BH8A 1JHTA 1OAZL 1KXQE 4YC2C 2EEDA 4N0UA 3OTTA 1ZT4B 1PKQA 2CMRL 4PY8I 1KLFA 1XMWA 4HS8H 4X9IA 1ADQL 4GW4A 5H2BB 1QLRB 5L2KA 4LK4A 2UYLB 2ZSVA 2XZCH 3NTCL 2WQRA 1X5FA 3BDXA 2BNQE 2X4RB 2EDEA 1QR1A 2IBGA 3OJ2C 1I7RB 3QUMA 1G6RH 4FRWA 1R3IL 2GT9A 4X98B 3O81A 2EZ0C 5DVLA 3HNSH 2YRLA 4FP8L 3QIUA 1NCWH 1L9MA 3WIHH 3ARPA 5HHOD 1IE5A 1ODAA 2HVKB 4MS8C 4E0RA 4RIRA 2XKNB 4QF1A 4MA3A 2R0ZL 1Y18B 4WTWA 4Q97A 1OT1A 4U0RC 4NRZB 3WIIL 4PJIF 5D93B 1WWBX 3MRMB 5HD8C 4QTHB 4JN2A 4O5LL 2H3NA 4RAUB 4Y1AB 1UB6A 3B8SA 1SEQL 2CLRB 2KZWA 3QUZB 5KG9A 1P69B 1U2CA 1EHLL 1FRGH 2P24A 3QXAB 4IRZH 5GGRB 4WCYH 3HZYA 4ZFZB 1FN4B 1RZGB 2H41A 3PL6A 2KL6A 2WBJA 1UQSA 4M6ML 2OZ4A 2RCSL 2HTLC 4Y2DC 5BOPA 4FNLH 3JTTA 4QHLA 4X6BB 1UWEL 4F3FB 2HRPL 2XI9A 3N1PC 3RX5A 4BUGA 5DJXB 2A73B 1RUKL 4KTEL 2NY3D 3F12B 4JANA 2VAAA 4OZ4A 2FEEL 1PBYA 9CGTA 2CKBA 4R97C 1NFDF 1K5NA 2DMKA 3KAAA 2IPTH 4OGYL 4NQSA 4BYHA 5HXMA 2WWKO 4YXKL 4TN9A 1UVQB 1VEMA 5CJOH 3I3EA 1QEWB 5GS0L 1A1NB 1VGKA 3KJ6L 5D7JA 3LRHA 5HHNB 3DUSB 1XF3B 2C1PB 4P2RD 4LQFL 1EIBA 4R9HA 5EO1B 2ATPB 4K3DH 4YDIH 3MO1B 3PHQA 3VFNB 3CLEH 5DD6A 2XRAL 2VLKA 4LLVB 1A6ZA 4M6NL 4MWFA 1DBJH 4ZS6D 1N5YH 5F9AC 4PJDF 2BMKB 1AY1H 5IOPB 4L8CB 1ROWA 1J0ZA 2B0SH 3ARQA 1LK2B 2J5LB 4WFHE 3FQNA 3RWHB 4NJ9L 2DQGL 4E41B 4R7NA 1WBXB 1S8DA 5B39B 1VKXA 2VDNL 1T1YA 1RZFH 2X4SB 2J8UB 1FFOA 4U6YA 2W91A 3PDDA 2EXYC 2AI0H 1EEUA 1MJJA 1N7MH 3FT2A 5DMKB 3BE1L 1B0GB 5TQ2H 4BA8A 3DURB 3FCTB 2AJZA 3H7BA 4GQ9H 3LEYL 4FG6D 4LLWB 4P5MA 3L3DA 4AL8L 4HC1A 3SDCA 5C2BL 3SY0A 4FXKA 2EDOA 5E2UH 2ZUSA 5INCA 4HF5H 4ALAL 3OKOA 4PLNC 4ZUWA 4DGVL 2B1AH 1MRCH 4NT6B 5ISZA 3NFSH 1PX3A 5C09B 1T03L 2VZVA 4MNQA 5F3HA 5E0QA 3VCLA 5I73B 3REWB 1MH5B 4GRMA 3BPOC 3O6FA 2OXHA 5B8CC 1JGUL 1GGCH 2AP2A 5HI5C 3TYFB 3WNPA 3JV4B 4DGIH 5ICXB 1G7PB 4PGJA 1Q0XL 2ZUQB 1WJ3A 2NZIA 2ZNXA 1BIIA 1N64H 2OSLA 4PR5A 2APTA 3DUUB 3QUKA 3ZZ1A 1U58B 3RZWA 3RJDA 1TQCC 3VA6A 3GSNH 5SWZE 4NYLA 4HUUB 1CD9B 1IC4H 2LABA 2HWZH 1P4IH 1DBKH 2QHRL 4F7TA 4G43B 4PPTA 2YA1A 4X99B 5E8DL 5GGSB 1VGEH 1K4CB 3X11A 2XN9E 1QA9B 1KJMB 1MRFH 3NCCB 1FYTB 2Q6WA 4OD2B 4HCRH 3UJTH 1KIQA 1G0DA 5FXCH 1CBVH 1S7TA 1AXIB 3ZKMC 3F7YA 4R4NC 5D9SB 3RZCD 1FZKA 1HINH 4KRMB 4EEEA 3C6SB 3L3IA 4S1QL 2QQNH 3HG1B 2QR0A 4WO4D 4KHTL 5I8CB 4HGMA 1Z9SA 5I15L 1CLOL 4OZIE 2BSSB 3L5IA 4XVJL 1QACA 4PJCE 1AFVL 2E6QA 1RZ7H 2YWZA 2EDKA 2GAZA 3U83A 4ERSL 1KJ2L 4LCCC 4HT1H 1JNLH 3SDXF 1Q9OA 4F37K 1GGYA 3PWJA 3MACH 1YEEH 4XWGH 2A9ML 1WZ1L 3MRGB 4WU5A 3EOBA 5TE7L 4NO0A 4JZNB 3ZT7A 5JW5B 3GSRB 3GDBA 4S2SB 5EU7C 2OQJA 4ZOEA 4JFDD 4DVRH 2R56H 3TVMD 5ETUB 2IQ9L 4Y4KC 4U1SA 5DO2C 3CCHB 1PEWA 1GPOL 5KTEL 3HUJF 3MGOA 4H26B 4NFCA 4QHKJ 3MV9D 1IGTB 1OLLA 4WV1B 3LZFL 4Z7WE 5CUSH 5T3ZL 3I6KB 3ZYJA 3PABA 5ADPL 2QBWA 5CD3B 4UQ3B 2ITDB 1OLZA 4JG1L 1M6OB 3ULUC 3I75A 4R26H 5E6ZA 3I85A 2O5YH 2V2WA 3DXAE 2IMMA 3KS0H 3TO2B 35C8L 3T0AA 4JKPL 2ICEA 2B4CC 1NJ9A 2R4RH 2VDOH 3ZHKA 5KVMC 5BXFB 4JKKA 3CX2A 2R2CA 4MLSA 3V4UL 1X7QB 3H9SA 3BUTA 2WINA 4OBSA 4FQLL 2JCCF 4YXLL 2X4NA 4NDMB 3ARBB 5DTFB 4OQTA 3F8UB 1L6ZA 1TZGL 5JXEC 4IRSB 3GIZH 2UUDK 2VDQL 1PY4A 3HMXL 1MEXH 2R0WH 3BPLB 1T89C 1U92A 5E08H 2EDWA 3NIDE 3O9WD 3D0LA 4QCIA 4JPKH 4MHHG 2Y9RT 1X4XA 3NIFE 2AQ2A 1UACH 5DJ8A 2FWOA 4WW2F 5IQ7H 1IC7H 3VMPA 3E1F1 3PWPA 4PGCB 4Q9CA 3QEUA 1YMHA 1OWRM 2EDQA 5IT2L 4XCCL 1CD1A 2KDGA 4HLZG 5GS2D 3C6LA 3D25A 1W8OA 1YJDC 2HLFC 3CC5A 5KVFL 3ILPB 1Z3GH 1TZHA 2HLAA 5B22A 2EDNA 1I1FA 4DFHA 4R90H 5D96B 1FNGB 5FUCC 1ZT7B 3ROLB 1WITA 4KUCF 4M5YH 2DI8A 4M7ZB 4TPRH 2P5WE 5C92A 5K9JH 4NNPH 2WAHA 2ESVE 4WWKC 4X0KA 3H3BC 1FO0A 2DQDH 5A2FA 2E27H 5D2LA 4EI5A 4KFZC 4BELD 4YXHL 1FZJB 4LLUB 1HQ4B 2XQYK 4QRPD 1B90A 4EN3C 5JHLL 3MFFA 4F80A 5CJ5A 4NM8L 4R0LA 5GGSY 7FABL 3VJ6A 1OM3L 5DK2A 25C8L 3OL2A 5ESVB 4TUKH 1WTGT 3RGVA 4RGNC 2DLGA 5FO8A 3KLAA 3JV6B 5BOZG 4Z8FL 1HILA 3O2WH 2FCBA 5GS0D 3SJVE 4Q9BA 5T3XD 4R7DB 3N85L 1AGCA 1MCWW 5I18L 3QCUH 2F53E 4LSVH 2A0LD 3KPTA 4M93C 5HHXH 1UFUA 1CDUA 1N59B 3VH8A 3KR3H 1FORH 4Y16B 3BZEB 5D2NE 5E00A 1FG2B 3VFRA 2D9QB 5DZNA 1ETZA 2H6PA 1MNUH 3DV6B 5J3HD 3PIQB 1BLNB 1QSEE 2XG5A 4LNRB 2OI9B 4JZJC 3BKCH 4B0MM 4I5BB 2BJMH 3QIBB 4ZUVB 3RPIA 2ATKB 4C55A 5E8OB 2G60L 2E7CA 4PTTB 4K7PX 1I1AC 4HSQA 3U30B 3FTGA 5C08E 5DD0H 4UBDD 3RL2A 1JUFA 3MUGB 3P0VH 3TIDB 5JW4Q 3GMMA 1QFUH 3EYVB 2XIDA 3T4AB 1VFAA 4YUEL 2VDPH 2VLME 1AJ7H 4PLJC 4PJ5E 3S4SG 4NNYB 3IU3B 3MOBL 1A6UH 4O2CA 4MX7B 1SJEB 3S34H 2AJVL 5D7LD 1W0VA 4LOUD 3TO4C 2HTLD 4MZ2A 4F8TA 2P8PA 3QULA 3FRPA 3GJFB 3QRGL 1G9NH 4XGZB 4MXWL 3ULVF 4OT1H 1TCRB 3DLQR 5DK0B 2J8UF 3FT3B 1JZ8A 1V7NH 1N0XL 4WUKH 3L1OH 1ZTXH 2OM5A 4TTDD 1ZANH 4YZFF 1IGYB 1S7WB 4UOW1 3QHZL 4LVEA 4D0BB 5FDWB 4QTIL 3GI8H 1NGPH 5SWZB 2P5EA 1QRNA 3EYFB 3UPRA 1D5MA 3UTSA 2LTQB 4Z7UE 1RFDH 5K59E 2XQBL 5D7IE 4AEHL 3OAZH 1IQDB 2R2HA 3EFDL 4Z7VA 2PW2B 3R0MA 4LPYA 2XN9B 2Z92B 1FNLA 5IMOA 1EFXD 1G7IA 2DI7A 3D9AH 1DCLA 3VD7A 2UVEA 5F7NC 4YFEA 1JGVH 4S1DC 4KZEL 5EA0H 1AXTH 1U8IA 2QADC 4TUOB 5ICYB 1JVKA 1U3HB 1XGYL 2VQ1B 2XNAA 2VDLL 1XGQA 3FQWB 5EC2A 3TZVC 1MJ8L 2IAND 2PTUA 1K6QH 2W0FA 4WHCA 4OZIB 5JZ7D 4KVNL 5F96H 3K3QA 4RMSA 4Z18A 1EEZA 1NMAL 4PJCB 1CR9L 2IADB 1YDPA 1BQLH 3VD4A 2YS4A 4Z78B 3TT1H 4OCYH 1JZ2A 1HSBA 2UY7A 3I2CL 4P3CH 3RU8H 4JO2H 1JYWA 3D3VE 4C58B 3IT8D 2JB5H 2AERT 2FSEA 1FL3A 3IDUA 4ZAKC 5IBLC 1SHMA 1Z0NA 3KDMB 4P4KD 1F2XK 2AS5M 2WBKA 2GHWB 2IGFL 3QDMD 4DVBA 1ND0B 3QWOA 5CIPB 4ZNEE 4LCWB 1OF2B 2I07B 3UDWA 5HVHB 4NO2A 3R06A 4ONHA 1JNHB 3PDGA 5HHMD 5T5NG 2W59A 3WJJC 2NYYC 3SBWA 4PJFE 5E9DE 1RZKC 5IUSA 4PRBA 2R2EB 4OCWH 2VIRB 4Z7OF 4PRDB 3QA3B 5T3ZD 1RPQA 4RNRA 3QH3B 1MCDA 3IKCB 5CP7B 4O4YL 3X14A 2VITB 2IPKA 1B4JL 3L5HA 4UIMA 4XBEL 3WLBB 4M6OH 1VPOL 1XIWC 4XC3L 3IVKA 3IS1X 4EJ1C 3C5ZB 4N0UE 4YHZH 3RKPA 5JNYB 1PKQE 1QVOB 4FABH 4HJGB 1RUML 2XA3A 5F88B 5KSAD 2H9GA 1JN6A 1R3JA 4MD4B 1HSAA 1AD9A 5L2KE 1FAIL 3B6SB 3QDJB 3M17B 4WY7H 1XF1A 1S7QA 4NZJA 1L7TH 5F1IA 3PGCB 3UC0L 2UV3A 3ZKMD 4W6WB 4XHQA 2PTVA 4LPXA 3WKNA 1NGWA 3T8XB 2Y6SC 5IHZA 3FRUA 1XGTA 3BKMH 4U49A 3MV8D 4GBXA 5IEHA 1UZ8B 2Q3ZA 1UZ6E 4YHYC 1H8NA 2PO6B 3B5TA 3SKJH 4WNQB 2P8MA 3ZL4L 5FB8B 2HFFB 1SYVB 4YHLH 2YD6A 1EAPB 3W5NA 5C0EB 3VWJB 1MCLA 5DMGD 1F5WA 4CNIA 2KQMA 2WLZA 2G9HB 1Y0LA 4LEXL 1KPVA 4KK6D 3U0WH 2C4FT 1UA6H 3D18A 3RFZC 4GW5A 5DR5L 3WBDA 3GSUA 3LKSB 1U8NA 1B2WL 2P5WB 2ESVB 4HFUL 1ZT1B 2J4WH 1F8TH 4Q6IB 3ORJA 2IH1A 2LAGB 1GRWA 2BZDA 4U7SA 1FVDB 3EO1A 1DFBL 2DLEA 5D70H 3UTTA 3QPQD 1YPZA 4XP1H 5CBAB 3G5VA 3BKJL 3OXRB 4ZDHB 4OLWL 3O6KH 4OLVL 3MV7A 3PQYA 4JFZL 3KPSB 5DFTA 1AD0A 2HFEB 4RFNC 4ODTH 5C0RH 3RWJB 5DYOA 1KGCD 1AQKH 3LV3A 1DL7H 2J5LC 4BSVA 2CGRH 3WXWH 5D2NB 3ULVC 4JY6A 4ESKA 4GMTL 1U8PB 4JQXA 1EEYA 4HGKC 5ACZB 4H0HB 2X42A 4ODHL 2VLKE 3HAEH 3GSXA 4K9EC 1YNTA 4NQCD 5IEKB 3FOLB 2NW3B 4QRQB 3WNMA 1AP2B 2EXWC 1AQDB 1H9VA 4MMXC 3E8UL 2I24N 1IGIL 1T1XA 2BFVL 1I7ZB 1LEKA 4GRLA 4XRCB 5C08B 3EGSB 3GKWH 4DGYL 4XCYA 2WSKA 3HA0A 4ZTOL 1BBDH 2BY2A 4OCSH 3O3EA 4XVTL 1AR1C 5IJKC 2DTMH 5I1LA 4PJ5B 4YEFA 5I73C 2GJZA 4LP4A 1RJLB 3IFOA 4U6TA 4MAYB 1JRHL 5BMFL 5HDBE 5DQJB 2ZUQC 1MJUL 1REIA 5ISZE 1TJHH 3IJHA 2V5TA 2GKIA 2D2OA 4LIQL 5GGQH 3SGJA 2BSRB 5DRWA 4J7RA 4M4PA 2DIAA 2V6HA 4MNQE 3EDFA 4WWKD 5GJSL 1FL6A 4NPYB 4M7LH 1LDPL 4XPBL 1UCTA 4JHWH 1I3GH 2O26U 1TNMA 2GY5A 2MHAB 1GZQA 5SWSB 4EN3D 1A7PL 3IDGB 4HGWB 5CJBA 1YUHA 2F19L 5KW9L 5I1AA 2NCMA 4AG4H 3EZJB 3RNKB 5IHUL 1MIEL 4GFTB 1CIUA 3KXFE 4NQDD 4Z7UB 5IESL 5D7IB 4OM0H 4FZEH 1G7LA 1CZ8L 2EYSB 4YFDB 2Z93A 3QDGD 1G6VK 1VCAA 1EO8H 3HMWH 1EGJA 4RA0C 4YNYB 1FNHA 4PRIA 4JG0H 1QNZL 3QIWA 4MCYA 4AYFA 4OGAC 4WFFD 1IGFL 2VABA 3NCJH 3OGCA 2QSQA 4OZFH 2DWEA 4X9BA 3PWNA 2Z31B 4QXTA 1LO3H 3Q5YA 5HYJA 4FQQA 3R4DA 2YBRA 3IGAA 4MA1B 5GGTH 3SGEI 1TJIH 2CDGA 3ARGD 3BZFB 5E7FA 3FB5A 2EDRA 2R0LL 3WEXA 2CIIB 2F5AL 5HYFA 1S78C 4L8BB 3HR5B 5E99L 5EU4B 1EPFA 4NQEA 4NUJA 3DVNB 4G9FE 1MQKH 2X1WL 3AFLA 4PJ8D 5GHWL 1D5ZA 4M7JL 1M7IA 4JFFA 3VXSA 1OARH 2OL3L 5T5FH 1W0WA 1IC5H 3DARA 2YXMA 3QJFA 5MEQA 4XMKL 4M1CD 1J5OH 2IFFL 2XV6B 1RUAL 2HG5B 4HIEA 4WV1C 1ITCA 4PJHB 4N90D 5HYQB 2RGSA 4UOJA 1G7QB 3VXUD 4NGHH 3TJEL 1K2DB 3QSKB 1JJUA 3EJZC 2MNUA 3LKOB 5E9DB 2BRQA 2JIXB 1LEGA 1BX2B 3IFPB 5IW1A 1JZ5A 1J1PH 1SBSH 5GRUL 1UH2A 3MLRH 4P59L 3L95A 2BSTB 3BRGC 3ARYA 3ESUF 4YDVA 2AK1H 3FQTB 4J3XA 4BH8B 1JHTB 2D3VA 3ARBC 3MSPA 2EDJA 1TVDA 2KZ1B 3O0RL 2F8VA 4N0UB 4I3SH 4F8QA 5DLMH 3HHRB 1PKQB 3RKDC 1I9JL 1FNFA 4P9HC 2BDNH 2ZCLL 3TCXA 5ALCL 3VFMA 2HH0L 2W60A 4GW4B 4KV5E 3BPLC 2NXZB 5L2KB 4LLMB 2ZSVB 2EH8H 5CLTA 1HCVA 1OAQH 2DBLH 4PJ7A 4YJZL 4F58H 3MOAH 4TNWK 1ZLSH 2UUDH 4S1DD 1F11B 3EFFA 4LSRL 1QR1B 3CXDH 3QUMB 4Q7DA 3RNQA 5I76A 2UWEA 3T1WA 4OCRL 2X05A 3QIUB 4XPTH 3FFCE 1P4BL 4GAYA 2AEIT 1PX4A 3WDJA 4E0RB 4RIRB 1G0YR 1OAZH 4MA3B 3DOSA 2YD4A 3N1GC 2DF3A 1ACYL 1CGSL 5BW7C 3P77A 2CMRH 3WO3B 1Q0YL 2Y36L 4GUPA 1XGRA 5JA8B 2H3NB 3LIZL 1UB6B 1HQRA 4BQ9A 1CICA 4LGPB 3H42L 3IDNA 3NTCH 5KG9B 4Y4FA 1TENA 1Y6NR 4XC1L 2YN3A 4R4BA 1H5BA 2P24B 3F65A 2Y23A 4HKJA 3HZYB 1ZHLA 3V6ZA 3QQ4A 3PL6B 4D0DA 4JO3L 2WBJB 1UQSB 2QQKL 5J1SC 1R3IH 4KUZL 5DJ2A 3ZE1E 1NUGA 1CLZL 4A6YL 5JLZA 3J8F7 1TIUA 3NABL 3JTTB 4IMLA 4PJ9D 4QHLB 3MJ7B 4PBXA 3UYRL 4FP8H 3WIFB 3ARFA 4YPGA 4PJEA 3EYQD 2R0ZH 2VAAB 3D69A 1ZMYA 5LG1A 4OZ4B 3WIIH 4HWBL 5D2LE 3S36L 5C9JA 4PG2C 3QUYD 2CKBB 1CDCA 4PGDB 4O5LH 1A6VL 4QO1A 1K5NB 4HMDA 3BSZL 4FQJL 1H3UA 2H8PA 4NQSB 3T0EA 1SEQH 2BHZA 2LE9A 1WZLA 4HIIA 1ZHKA 4XX1G 5E8EA 4EDXA 1FNAA 3IDIA 1VGKB 1HXMA 1V5JA 5D7JB 4M6MH 5I75C 2RCSH 1RV6X 3EOAA 3PHSA 4KUCD 5L6YL 2OI9C 5EBWA 4UI2A 4ELKA 3MRRA 1RIUL 1UWEH 3QIBC 2X1PA 2Y5TA 3PHQB 3GIVA 2K7PA 2VLKB 1A6ZB 1RUKH 4MWFB 3KWWA 4J3OC 1MF2L 4KTEH 5FGCE 5KANI 3EYOA 1YY8A 5EU3A 5DHVB 1CLYL 4Y1AD 3FQNB 3DWTA 4JZOA 2YZ8A 3KVQA 1EJ6A 4PP1C 5BVJA 3BP4A 4R7NB 3QUZD 3S96A 1S8DB 4K7PY 4OGYH 1DDHA 1T1YB 2DKUA 3RVXC 1FFOB 4U6YB 4YXKH 2YA2A 1IM9B 4TULL 1MJJB 1NDGA 1F4WL 3FT2B 4P2YA 1C08A 5GS0H 3B9VA 3KJ6H 3BGMA 4NBYB 2AJZB 4W6XB 1I85A 1BVLA 3VI4E 4LQFH 1A6AA 4P5MB 3L3DB 1ZVSA 3SDCB 3SY0B 4FXKB 3MRQB 4F15B 5INCB 2XRAH 4WI7A 4M6NH 3ISWA 3OKOB 4ZUWB 1IAMA 2M1KA 3GGWB 5ISZB 1OP3K 15C8L 4CU6A 4ZFOL 1MCHA 4H1LH 3FL7A 4MVBD 1S9XA 4JREB 4MNQB 3VCLB 1A7RL 2IAMA 4NJ9H 1DQLL 2DQGH 4GRMB 3O6FB 3OXSA 1MWAL 5DEFA 2LTQC 1U8QA 3UXFA 2V2TB 4V2BA 4S1RL 1UC6A 3D0VB 1MLCA 1BIIB 3BE1H 3DETC 2OSLB 4P2OD 4PR5B 4HS3A 2HKFL 3QUKB 4KJQD 3FN3A 2V9RA 3KXFB 1AO7A 3LRSA 3IFLH 5DA0B 3LEYH 4NYLB 4WJ5A 4AL8H 1N5AA 2BRRH 5C2BH 3W82A 1T2XA 1XR8A 4LAJH 2DQFA 5DUPL 5JTWA 1U3HC 4JGMA 4ALAH 4F7TB 3M07A 5E6IC 5DXWA 3DX6A 4OV6F 4DGVH 5E6YA 3X11B 4HIJA 2EICA 1CG9B 2AAVA 2GYSA 4AIZA 5JPNA 5KVEL 4WVRA 1T03H 2Q6WB 4ETQA 4XAKD 1KIQB 1S7TB 2GSIA 3F7YB 3KYMA 4LRIA 4NN6C 1JGUH 1FZKB 4KVCL 4UMGA 3L3IB 2D31A 3MRJA 1Q0XH 4HD9A 2QR0B 4LLQA 5SV3A 3TPKA 1KCKA 1J8HE 4J3WA 5K59F 2J3SA 1N6VA 1JPFA 4FQHA 5JQHC 4NC1E 1SJHA 4G3YL 2GAZB 4P46A 3V5DA 4KDTA 4ZUTA 3CZJA 2QHRH 3OGOE 1TQBB 5HTSA 1Q9OB 3LKPA 4JO4H 3H6JA 5E8DH 2BXYA 2LV4A 3P4OA 3PWJB 4ZPTA 5BS0D 5CJXA 4U1HA 5EZLA 3SQBA 4WU5B 3R8BB 2A6KA 3EOBB 4FXGA 4NO0B 5BV7L 4FTVA 4TVPE 2OQJB 4RX4D 2ZJSH 4U1SB 2VQTA 1OWWA 1NCUA 4S1QH 5D1XB 5AYQA 1BQHG 4U1IA 4KHTH 2EDBA 4L4TE 3OKLA 3MGOB 3C9NA 5I15H 1OP9A 2G75A 3C5ZC 1CLOH 3VXNA 4IMKA 2BVQA 4XVJH 1NGXA 1AFVH 1DEEA 3PABB 5KSBA 4JO1L 4ERSH 1KJ2H 3I75B 1YNLL 3MA9L 3SDAB 2V2WB 3JWOH 4PJGA 1ZHBA 3QNXA 1FYTD 4HKZA 1T04A 2A9MH 1WZ1H 1A22B 4LGRB 2F54A 4PJHF 2ICEB 1NJ9B 1IAIH 4LHUD 4PY7A 3O2DA 4F7EA 2B5IB 4LKCA 2WINB 2PR4H 2OBGA 1OAUL 1YYLL 2X4NB 2IQ9H 2IPUK 2HT2C 3HG1D 3QCTL 2V5YA 4BZYA 1UYWL 4N8PA 4QRUA 1GPOH 2PO6C 5KTEH 3TN0C 4EQ3A 3LZFH 4JCLA 5T3ZH 5FYKE 1U92B 3ZHLA 3FFCB 5ADPH 1S9KC 4NUGL 4JG1H 5TF0A 3RI5F 3UTZA 3D0LB 3VWJC 4QCIB 4TSAL 1UJ3C 35C8H 2DQJL 4WWID 5DJ8B 4YR6A 4JKPH 2FWOB 1S78D 1NC4A 1OD7A 4B41A 3NIGE 3PWPB 3QEUB 1YMHB 3SDDC 3V4UH 3O4OB 3CZFA 1T21A 4FQLH 1NAMA 4YXLH 4RSVA 3ARTA 3OJMB 1CD1B 4ONOA 3U4EA 5DVNA 2AABL 3C6LB 1WK0A 4OLZL 1TZGH 3D25B 5JHDD 2PYED 3CC5B 1TZHB 2VDQH 1I1FB 3HMXH 4YO0A 4O2FA 3TGXA 2UZXB 2ZUTA 1U2HA 1KELL 2X1XR 1X5ZA 2PW1A 2BNRE 1XH3B 2GEEA 1FO0B 2QEJA 5D2LB 2HFTA 2X6MA 4HK3J 1I8LA 4IIQC 2CJUL 3GJEA 5C0FA 3QI9C 3MFFB 2XWBB 3ARBD 1MSPA 4R0LB 5DQDL 2GSGA 3RIAF 1JPSL 3VJ6B 5IT2H 4XCCH 1G6RA 5DK2B 3ALWA 4IRSD 5D2NC 2OP4L 2NX5E 5GRVL 4HUVA 4D94A 3RGVB 5FO8B 2Q8BL 1FYHB 2UVFA 5KVFH 3KLAB 1HILB 4LLYA 1ED3A 1PFCA 3EDKA 3QQ9C 4Y2DA 4FFYL 3WFBL 1HKLL 2APVA 3RY4A 2N7AA 5I71B 3VH8B 3VXME 1OTTD 4OLEA 3VFRB 3TNNA 1ETZB 3SCMD 2H6PB 2R9HC 4YXHH 1X4ZA 4HS6A 5JHLH 3SQOL 1HNFA 5J12B 4NM8H 5J13B 7FABH 2D9CA 4JFOA 1R3KA 1OM3H 3RPIB 3UYPA 25C8H 5GZNC 2G5BA 3FTGB 1MHCA 5FKPA 3RL2B 2AJ3A 4CVXA 1JUFB 4YE4L 4IS6B 4Z8FH 1DQJA 3GMMB 3EUUA 3N85H 4G8FA 5I18H 1X5IA 5FYLL 2NLJA 4O2EA 3V4VH 1T0NA 4F7MA 5HSFA 4UT7L 1W0VB 1A3QA 1K9TA 3NFPA 1LQSR 1ZA6B 3TBSB 2P8PB 1QP1A 3QULB 2NY2B 4IOFC 4X7CC 4CRPA 3RGHA 4XCFL 2AKRA 3P40A 4FFWC 2A38A 4LHJB 5BCAA 1RZIA 3MJ8A 1VACA 2G60H 4I0PB 2M26A 2NY4C 2ENYA 3HI5L 4KPHL 4CDGC 3EO0A 1GHFL 3ULSA 4LSTL 1OAKH 3RRQA 5LQBL 1TETL 3RVWC 3SGKA 3OKYA 4AEFA 1QRNB 2E8ZA 4Y16D 4YUEH 1D5MB 2ZUYA 3QEHA 5HDBF 4KTDL 3MRFA 3MOBH 2R2HB 4WI9A 3VRJA 1Q1JL 2CUMA 2Z31C 3RDTC 2AJVH 1MY5A 2DN7A 1SQ2N 3NCMA 1T5XB 5IMOB 1C5BL 2FX9L 4MA1C 3QRGH 5IKCA 4DZ8A 4PRIE 4MXWH 1LP9A 2IMNA 3QFJE 3QIBD 3L9RA 3Q6GL 1NGZA 3V5HA 1DQTA 1U8IB 3KYNA 2IALA 2VKXA 1N0XH 5B8CA 1YEJH 2EDDA 2LVCA 2VN7A 1CXLA 4N0RA 2XNAB 3VGHA 1XGQB 5EC2B 5HYJE 1NCCH 5EUKA 3QHZH 1M7DA 4PP1D 2W0FB 4GSDL 3VMNA 4QTIH 1EEZB 4XAWL 3HFMH 1INQB 4G80A 1YDPB 3RVXD 5J06A 3NMEA 1QBML 2XQBH 4AEHH 1HSBB 3D85B 1DN2A 1E4XI 4NQEE 3EFDH 4Z6AT 2ZUVA 3CSBA 5K93A 5GGVL 1NLDL 1P4LA 4Q0XL 4JFFE 3VXSE 1EMTL 5FYLE 3OZ9L 4U6XA 2FSEB 1FL3B 5CP3H 2VLJE 4JKLA 3ARUA 3KG5A 4KZEH 2CRZA 2X41A 5FO9A 1NEUA 4DVBB 1XGYH 4KGJA 1INDH 2VDLH 1CT8B 3B3IA 4NO2B 1NBZB 3R06B 3R1GL 4ONHB 2VLRA 1MJ8H 2EDYA 1WCQA 2VN4A 4JEGB 1YMMD 2EYRA 2QSTA 1NMAH 1CR9H 4PRBB 3NFNA 4M8VA 4OCLC 4RNRB 5JMRA 4LCCA 3I2CH 2V17L 4NKDA 2NXZC 2L7UA 3QG7H 3X14B 4C57C 3LEVL 2IPKB 4UIMB 3GJFK 3LQAC 2NY7L 4HDIA 3IVKB 3W39B 3KPRA 2X7LA 1XGPA 4OD3L 4ZO9A 3BD5A 3N06B 4OKDA 1LO4L 3T4YA 2C3VA 4MJIE 1VADB 3I50L 4C56A 3RHWF 3CLFL 2H9GB 2IGFH 1JN6B 1R3JB 1HSAB 1KB5L 4G5ZL 2PF6A 1AD9B 1H3VA 3QIUC 4Y4KA 5FECA 4HZAA 4HIHA 4X7TA 5FAAA 1NL0L 3MV11 4PJ7E 1S7QB 5F1IB 4L3EA 5TE6L 4LCIL 1CK0L 3WLWC 1BGXL 4OF5A 3QXDA 1BFVL 1NGWB 3L3HA 1I8IA 1ZEAL 2VKWA 4XB7A 5IHZB 1OD9A 3FRUB 4EUPG 43C9A 4GBXB 4N9GA 5IEHB 2EYTA 1I75A 4O4YH 3MOQA 4K3JL 2OK0H 2APFA 32C2B 1B4JH 1NANH 1IMHC 4XBEH 4MHHI 3S35L 4HEME 1VPOH 2YPLA 4XC3H 3KNBA 1QRKA 1MJ7H 2P8MB 2D0HA 3PL6C 2WBJC 5FYJL 1CTNA 2JF1A 4U6VL 1RUMH 3DX8A 2QLVB 1IL1B 4GRWE 4U6HA 4LCWD 3TJHD 3KYKL 3V0VA 4S11A 4CNIB 1Y0LB 4U1LA 4MD5A 1KPVB 4K94C 1L7IH 3D18B 1K8IA 3MRKA 4KJWD 4GW5B 4XNYL 4BZ2L 1M4KA 3GSUB 3NGBB 5FUZL 4M7LT 1U8NB 4RQQA 5C0AE 4I13B 2DICA 3ZKND 3RUGE 5BZDA 4HJ0C 2Q76A 1BQUA 3GKZA 1IAKA 3EO1B 4ORGA 1PG7L 5GRWA 5L88L 3ZL4H 1A1MA 1KPRA 5IV2B 5D7JC 3UTTB 2N4IA 1YPZB 3G5VB 3QDJD 1GYAA 1LGVA 1BWWA 3BQUD 3VDCA 4MNGA 3HE7A 3PQYB 4X7DC 3T0EE 3WKML 1PZ5A 3QRFM 3QUML 4POUB 1AD0B 1RURH 3H9YA 4LEXH 4LKXA 5DYOB 3Q6FA 5DR5H 1PSKL 3LV3B 4LFHD 1MFEL 4BSVB 3SKNA 1B2WH 3VXMB 4JR9L 4JY6B 2PO6D 5D2LF 4HFUH 4OI7A 1EEYB 3V9FA 3FKUS 5JOPD 1A9BB 4F2MB 3GSXB 4JRYA 1YNTB 1DFBH 4JHAL 4QRRA 3QNYB 2C9AA 3PP3K 1DR9A 1MUJA 3FZUC 4E9LA 4MXVE 5BZWA 1C8PA 1T1XB 4Z7QE 1D9KD 4HXAL 4M43L 4OLWH 1UWGL 1LEKB 4OLVH 3SDCC 4GRLB 4AENA 5IW3A 3OR7A 1DE4A 4JFZH 4KHXL 4F15C 4XCYB 3CFIC 4YPJA 2ZPKL 3PNWA 1CE6A 3VGAB 3QEQD 4OFKA 3O3EB 2XOTA 3VDAA 2P5WD 4JPWL 1KIUA 4J4PD 3ARZA 2B7DT 2ESVD 2GJZB 2DJ4A 2HT3C 3O6FC 4WHDA 2E9JA 3IFOB 4GMTH 2HMIC 1XAUA 2LAAA 4ODHH 2P46B 5ACLA 3LQMA 1X5GA 3FO2A 3LDBB 2A74A 5ITBL 3IJHB 1JTTA 4KK5D 2HTKD 3E8UH 1IGIH 1RIVL 4QEGA 2NY5H 4ODUA 1FL6B 2BFVH 4KI1A 2DAVA 3KPSD 5C0CD 1P1ZA 1UM5L 3ZKSD 1KN4L 3WE6A 5JO5A 3PV6A 3SE9L 4DGYH 1GZQB 3N1QC 1OGTA 3Q2CA 3MLPA 3MV01 4OFPA 4HW6A 5IWLA 2VNCA 1YUHB 1KEML 4ZTOH 3T08A 5MI0B 5I1AB 3BN3B 4XVTH 1P84K 2C4XA 3AREC 1IC1A 2Y06H 1AO7E 5F9WB 4L4VA 5F7DA 1G7LB 3MLYL 2Z93B 4XHJD 1JRHH 2Q7YA 4P2QA 1JTOA 5BMFH 3BP7B 3U7AA 1DBML 4PRIB 2E6PA 5C07A 1MJUH 2VISA 5KAQF 4MCYB 4L9LA 4TRPL 4LIQH 2VABB 3OGCB 5GJSH 5C08D 2EIZA 2YD7A 3SE3A 2DWEB 1LDPH 4XPBH 3PWNB 4QXTB 3BH8B 1YN7A 5HYJB 5B39G 4YFLF 2P7TA 4FQQB 3C5SA 1F13A 1EVTC 5JIPA 1TQBC 1A7PH 2YBRB 3IGAB 3T09A 2IEPA 5IBUB 2F19H 2VLMD 2CDGB 4PJ5D 1EHXA 4PFEA 1U6AL 5KW9H 1I1YA 3FB5B 3WEXB 4LDLB 4F9LA 1T66C 4U05A 5D1QD 1UG9A 4JQIL 1FP5A 1MIEH 3IJSA 4Y4HA 5IHUH 1JYNA 4Z7VF 3OAUL 4MAYD 4NQEB 4OB5L 1CZ8H 3RVUD 1D5ZB 1M7IB 4DN3L 4JFFB 5EO0A 3VXSB 1W0WB 5D1XC 4AEIL 4R4FL 3QJFB 1AGFA 1QNZH 1ZSDA 3D87B 1QHOA 5MEQB 1F6AB 3HKFA 5DVOA 3TF7C 4UQ2A 4HUMB 1IGFH 2R8SL 1TTFA 2F8OA 1MCFA 4I3GA 1D6EA 1JHLL 5KS9A 1KT2A 5SWSD 3OKDA 3L7EA 3DECA 3TZVA 4XWOD 4POYA 3SDAC 1LEGB 5IW1B 5D7KE 3T2OA 3DO7A 2EKSA 1SBBA 2R0LH 5C0BE 3LVEA 1UGNA 1SJXA 5LCVL 5A16A 2D7MA 4X4XB 1RMFL 2F5AH 3L95B 2B5IC 1R5WA 4YDVB 4HX1A 2ZNWA 4M7JH 4ZMAT 5KSBE 2XZCL 3BGFB 4FQ1L 5BJTA 2OL3H 2ILLA 1TZIA 1AKJB 3OSKA 3PWUA 4XMKH 4I2XE 5HJ3A 2IFFH 5IVXE 5BRZD 5L8LB 5C3TA 3BN9D 1RUAH 3CSYA 4NM4L 2O5XL 4APQA 3VFMB 2W60B 5IIEA 3EDEA 1J1XH 5A40E 2AXJA 1NCWL 3TJEH 4PRPA 2PETA 3OAYH 4PJ7B 1GIGL 3RL1A 5ANMA 2VL5A 3HNVL 3EFFB 4XB8A 2UWEB 4KROB 3BW9A 3SHSA 4P59H 3MODL 3O4OC 2NZ9D 1GVIA 1BJ1H 2EO1A 1HHGB 4WUUA 1XIWA 1RK0A 3O0RH 2ZG1A 4C83B 4FQXB 1NC2A 1WVZA 3X3GL 3P77B 5TH2A 5J1TC 4GRWB 4GUPB 4QT5A 1XGRB 2ZCLH 5FYJD 1OAXL 1NSNL 5ALCH 1HQRB 1MCOL 2HH0H 3FB6A 2F9BT 1CICB 3GBML 2JIXD 3U9PL 5TQ0L 4QOKD 3VWKD 2X4UA 5SV4A 5A1AA 1F42A 1S7RA 2HVKA 4FN0A 5L7XL 4R4BB 4LSRH 1ZHLB 4DQOH 1ORQA 2OX5A 1WF5A 3JBG7 3QQ4B 4YHIA 4D0DB 2GJ6D 1FLTX 3C8DA 5DJ2B 5JLZB 5B38G 4KC3B 4IMLB 1VESA 3UBXG 3CAFA 4OCRH 3ARFB 1D3CA 1P4BH 4YPGB 4PJEB 2BVEA 1Z0MA 3DGGA 3WFDL 4OZHA 5AZEL 2X4QB 1CL7I 1EBAA 4MAUL 3D69B 3MNVA 4OFVA 3MRBB 1ACYH 1CGSH 5C9JB 3UCRA 3K0WA 4YDKL 1Q0YH 1Z9OA 1ERNA 2NXZD 2Y36H 4U3CA 3LIZH 4OQTL 2EECA 3SGDH 2H8PB 3A67L 1X44A 1FNSL 3H42H 3T0EB 5I71C 4XVSL 4HIIB 1ZHKB 3CLEL 4XC1H 4XTRC 5E8EB 4HWZA 4EDXB 4ZS7L 3TBYA 2VH5L 3KPOB 3IDIB 4KDVA 3MBEA 4KKCD 4JO3H 1HKFA 5IMKB 1MFNA 3EOAB 4KUZH 1CLZH 4PUBL 3NABH 4AT6A 3MRDA 5EBWB 5J12C 4ELKB 4WRLA 5J13C 3B8YA 2CR3A 2Y5TB 3O3UN 4BSWA 1Q8MA 3GIVB 3RI5K 3KWWB 1RULL 2NXYD 3AS1A 1P7HL 4OSUL 3EYOB 1YY8B 1J05B 4HWBH 5EU3B 2AEWA 3S36H 1YPZF 1A1NA 4JZOB 1D5BA 1A6VH 5BVJB 3BP4B 4GQ9L 3BSZH 3DUSA 2N7BA 4FQJH 5D6CA 3S96B 2JELL 1DVFA 3EOTL 4RGMB 2P1YA 1DDHB 3MO1A 4P99A 3BO8A 5EU6E 5HI3D 1NDGB 2WBJD 3NH7L 4FFZL 3HZVB 1XF2B 1C08B 3T0XA 5K9QI 3BGMB 2JE8A 1LK2A 1BVLB 1JP5A 2VC2L 5L6YH 1A6AB 1FBIL 1PY9A 1ZVSB 1FO0L 4E41A 1RIUH 2FX8L 1JF1A 5HGBA 2X4SA 4I0PC 1MF2H 5TDOA 3HE6A 1KXTB 3HZMA 3JVGC 1N64L 5FKAB 4LLDA 1IEHA 4MXQD 1CLYH 3QT2A 1O7SA 1S9XB 2UZIL 2DJUA 1UM6L 2IAMB 4KTYA 3CVHB 4HBQA 3OXSB 2VZ1A 5LKNA 3RIAK 5DEFB 4I4WA 5ABDE 2HWZL 2E9BA 4U7MA 3W81A 2XZQL 5KSVA 4TULH 2X89A 3LH2L 4QRTA 4LRNL 1F4WH 1MLCB 4G6JL 4GKNA 4HS3B 3FQRA 1A6PA 5C09A 3GBLA 1AO7B 3LRSB 3HAEA 4HCRL 3LS5L 4WJ5B 1N5AB 2VLKD 4UV7L 3DMMB 1ZLWK 3ZYZA 1YY9D 1GGIL 3MLSL 1XR8B 1HYSC 2DQFB 1HHKB 3TFKD 1C7SA 4P23A 4Y5VC 5FOJA 3D39E 4EDWL 3TEUA 3DX6B 4V1DA 3DBXA 5FOBA 4HIJB 5JPNB 1KYOJ 5DC9B 4AIZB 3RJQB 4NC1C 1A7RH 3BI9X 4ETQB 4LF3A 1DQLH 2W0KA 4YHKL 4IRJB 2GSIB 3KYMB 1MWAH 4IDLA 4Y19D 1G1CA 4KQ3L 1OTSC 4S1RH 1SY6H 2D31B 3EYSL 3MRJB 2WBWB 4D8PA 1F4AA 4LLQB 2ERJB 1KN2H 2HKFH 2Q87A 2FH6A 1JPFB 4FQHB 2ED9A 1SJHB 5JQ6L 5T5NF 1WV7T 4P46B 2H2PC 4RFOL 3UJJL 3FB7A 3V5DB 3U6RB 4ZUTB 3LKPB 3P4OB 4ZPTB 1E4XL 5IFAL 3AAZA 2X9WA 3SBWC 4U1HB 5KVEH 3O6FD 4W6YB 4FXGB 4H0IA 2YUWA 1MY7A 4FTVB 5ECJE 4AIOA 5CUSL 4OKVA 5C0JA 2KQNA 2CRIA 4PRHD 4Z7NE 4KVCH 2Y07L 3NCFB 4U1IB 2RJMA 5C0BB 3OKLB 5CLWA 1HWGB 2G75B 3VXNB 2BVQB 2VDOL 4ZOAA 4LCYA 1NGXB 2PCPA 3AM8C 2MQCA 1DEEB 3ARRA 4HIXL 3EDDA 5KSBB 3BIKA 3CK0L 3GJFH 4QGTA 4PJGB 1ZHBB 1EO7A 2EDLA 4HKZB 4JFEE 5IVXB 1T04B 4CKVX 5B38A 5E7BA 5IM7A 2I9LA 5BV7H 2MMXA 3UBXA 3CH8A 4PY7B 3LPGA 4LPCA 5D71L 5GGTA 4F7EB 1BFTA 2E9IA 3FAXA 4LKCB 3GMQA 3STLA 3CMOL 3QPXL 2P49B 4GBXC 2WLYA 4C56E 4H1LG 1KTKE 3QHTC 3TO2A 3D6GA 4QRUB 5C8JA 4ZO6A 5FHBL 4I48A 4L3EE 2R29L 1WTLA 5D72L 4LSUL 4MDIA 2R39A 3J7HA 2EEBA 4JO1H 4WDIA 5E4EB 2A77L 3UTZB 2P47B 1YNLH 1MPAL 3MA9H 4UTAL 4MJ5B 5L0QB 8FABA 1OQXA 2DIJA 4P57A 2BNQA 1T66D 3ES6A 3RZCA 4QLRA 4YLQT 4YR6B 2VZUA 1NC4B 2YPLE 3QXWA 2E7LA 3WO4C 2H2SD 4OLUL 3H9HA 4PJ7F 2CK2A 1T21B 2N56A 3ZTJH 1OAUH 1YYLH 2AJUL 3Q48A 2JK5A 3QCTH 3U4EB 1UYWH 4XXCA 2UWEF 2E27L 5I8KL 4O2FB 3G04A 2F5BL 1LVEA 5JOEA 5D1ZA 2COQA 3B2VL 4NUGH 2PW1B 3MTRA 2Y25A 1T6VN 4NIKB 1UKTA 4TSAH 2GK0A 4FFVD 5EC1A 5KZCD 2IJ0C 4U0RB 4GRWF 2VJXA 5EUOE 5BW7A 4XPGL 2FYYA 2FGWL 3H9SD 3GJEB 1F3DJ 3BT2L 1JGLL 2GSGB 3MZGB 2ICWA 5SX5K 4HWNA 2ZOKA 1G6RB 2BCKA 4PJXA 1CXHA 3KR3L 5A2KH 1A0QL 5GRXG 2AABH 4HUVB 3L3OA 2FEEI 4JQXC 4MNGE 4OLZH 4RCAA 3RVVD 4YHNA 1O5DT 2AXGA 1D7FA 4HLJA 4ONFL 4LLYB 3WHE1 3CJJA 5F21B 4G6AD 2M2DA 3ARWA 1CCZA 1F00I 5J6GA 4IOIA 3U1SL 4PJEF 2BJML 1A2YA 3F7PC 1FIGL 1UXSA 4XVUD 4X9FA 1P5UA 3NPZB 1ADQA 3TNNB 5ID0A 3PP3H 2AK4D 3PWPD 2NR6D 5T1DL 2RHEA 4I9WD 1JI2A 4PG2A 3GMNA 2CJUH 4HS6B 4QRRE 3VGAC 3TBTA 4MGXA 4R97B 3TH4T 1QKZL 5EDXA 5DQDH 1QSFD 4JFOB 1JPSH 1R3KB 1T20A 3ME0A 3C6LD 2OP4H 4N1HB 2J6EL 5F1OB 2G5BB 1MHCB 5FKPB 3KGRA 2Q8BH 2AJ3B 2P8LA 1DQJB 4JY5H 3LDBC 3BYTA 5IQ9A 4QHMA 5HDLA 2FNBA 3WFBH 1HKLH 2DJSA 1T5WA 3SGJC 3EHBC 4I5BA 1CDJA 2NLJB 2R23A 4O2EB 1T0NB 3AY4A 2ATKA 4F7MB 5E8OA 2IH3A 4EI5D 1ZTXL 1FZMA 3NFPB 1MVUA 2KPNA 1E4KC 4P4RA 4X6DE 4Z7QF 4XMLL 1JBJA 5MI0C 1K4DA 3EYVA 3SQOH 1FCGA 4UOW0 3ZDYE 2AKRB 4BQCA 1IM3A 5IMMA 1RZIB 5ILTL 3RGVD 3MJ8B 3WDIA 1VACB 3RTQA 1X6NA 2C7UA 5KVDH 2XZAL 3EO0B 2QJDA 3ULSB 4YE4H 2ARJA 3L3KA 2B20A 2F58L 1AGDA 1CXIA 3G5XA 3KPNA 3MLUL 4G9DA 2AJYL 3QEHB 4UB0H 1AXTL 1TJGL 3MRFB 4MQ7A 5MEOB 4L4VE 4QRPA 3QCVL 4N8CL 4UT7H 3O6ML 4NKMB 1S7WA 1XF4A 5DURB 4KKLD 5B3NA 3QO1A 5IKCB 4DZ8B 3CMGA 1LP9B 5C07E 2XTJE 3L9RB 1NGZB 4XCFH 3V5HB 5SWZA 1BQLL 1S7SA 2PTTA 3MNWA 4UT6L 4QNPE 1TVBA 3CFEA 3KYNB 2IALB 5B8CB 1UENA 1OQOA 1UEYA 3LB6D 3T65A 5HPMA 1IBGL 3HI5H 4KPHH 1RZJC 1GHFH 5EUKB 1M7DB 2Z92A 4LSTH 4D9RE 5K33A 4ZG1A 3QDAA 5LQBH 1M71A 1TETH 4OGXH 4G80B 4B7IA 2YD2A 3W9DA 4K8RD 2X4OA 3BVNA 1AE6L 4H1LA 1KTDA 2ADGA 5HDQL 1Q1JH 5JIIA 2NY2D 5E6IA 1DLFL 1P4LB 1RI8A 1C5BH 4U6XB 2FX9H 4XP9L 1SMAA 3OPZL 5TF1L 4OZIA 3NBNA 1IJ9A 4OCWL 4XI5C 1KNOA 4Z78A 3DV4A 3DPBA 5KS9E 3B3IB 2XPGB 3S37X 2CXGA 1T22A 4Z0BL 2P5ED 1IAII 1QRND 2HRLA 4GSDH 2EYRB 1MCWM 3UTSD 4XAWH 3SGEH 3KDMA 4N0FA 1QBMH 2AV7A 1CTOA 4LCCB 3ZE2E 2RR3A 4NKDB 3BPNC 5GGVH 1NLDH 1JNHA 4Q0XH 1EMTH 1F4XL 2E8YA 2QTEA 4HDIB 4WY7L 2DQTL 5FV1L 3MGAA 3S98A<