4H26B

Tcr interaction with peptide mimics of nickel offers structure insight to nickel contact allergy
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
188
structure length
188
Chain Sequence
b'TRPRFLELLKSECHFFNGTERVRFLERYFHNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGQVDTYCRHNYGVVESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title T-cell receptor (TCR) interaction with peptides that mimic nickel offers insight into nickel contact allergy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 188
sequence length 188
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h26B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4h26B01
4DN4H 2EDJA 3L1OL 3A67L 2F58L 4DW2L 4FQXB 1N3NA 5ESVA 3IKKA 4HFWB 1O0VA 3HHRB 4YHIA 4PJGF 5B3NA 3SDCB 5L0QB 3AFLA 1XH3A 4CGTA 4JR9L 1QBMH 1QFUL 3AY4A 5EORL 3MODL 1G7MB 1NSNL 3PNWB 2OI9B 3RIAK 1EEZA 5I1EL 1VEOA 2ZCLH 1F02I 1QHPA 4LLUB 1XCQA 5GGSY 4KK9C 1JGEA 1I1YA 4LKCB 3C2SA 1CR9L 3N50A 1UADC 3DIFA 5CGYC 3OKDB 1PQZB 3FQRB 5J4MA 3MLVH 3QHZH 2R15A 3AM8C 4KKBC 2XG4A 4PFEA 3S3JA 4MA7H 3SDXB 4H26B 4ZSOB 5HGAB 4RAHA 4OFIA 3TA3B 1CE1L 2BVUA 4Z0BH 3M17A 2CKBL 1F3DH 3MOAH 5AYQA 3WO3B 1X4YA 4U1MB 5IB5A 5D7KD 4Y19D 1WK0A 1Q9OB 3VFVB 3IVKA 1EGJL 3ECBB 3QI9D 3LD8C 4UU9A 1I9RL 4RFEB 1NMAL 2YMXH 2BHUA 5E5MA 4G9FE 2EXWD 1U8NB 4KI5C 3QAZB 3HB3C 1AC0A 1QYGH 4L9DA 3HZKB 5IB1B 3B43A 3IDIA 4J3UA 2H26A 4LHUA 5T3ZH 3VXSD 2FL5A 2KKQA 3MRMA 3GSUA 1JHLH 4U7SA 1JHKL 3VXQB 3HRPA 3V8OA 4NQCE 4OLUL 4ZUVB 3WJJC 4MDJA 1A7NH 3U46A 1A6WH 5DO2C 3V4PH 5IMLA 4JREC 3IS0X 5E9DE 4DOHE 4L29A 1AJ7H 3F5WA 5IM7A 5L2JB 2NY4D 3CLFL 4U6VH 2D7TL 4HGWB 1HILA 4L3CB 3U9PL 5BV7C 4M6NL 1N26A 5T3XE 1DQTA 3FT3A 2ESVA 4ODWB 1WBXA 3MJ8A 4QXUL 3IETA 2EDBA 3TH3T 2X4UB 2IBZY 5I66A 2VQTA 1OAZH 5IR1B 3LVEA 2VOTA 1AXTH 4G9FB 5DA4A 2J8UE 1GOHA 1DBKH 4U1HA 2FWOA 2VLJA 4HMEA 1I3RA 1JPGA 4Z18A 1A14H 4LLVA 4O9HH 3GK8L 1RHFA 1D5BA 3D39E 1XF2B 5I71B 2ITDA 3IGAB 1P84J 2LU3A 1W8OA 4MGXA 4NQCB 5C07A 1BEYL 5T3ZD 2IPUG 1DSFH 1XGTA 3S4SG 5KSBE 3KAAA 5E9DB 4DOHB 2CK0H 1S7RB 5EBMA 2G5BB 2ZUUA 1MHHA 1PG7H 1XR8A 2EEDA 4A6YA 4CL7A 4OAWA 2GUOA 3SY0A 2ATKA 3V5DB 4KJQC 4NQSA 3MRHA 1G9NC 4K9EC 4WI3A 2C4FU 1FNHA 1FNSL 2IJ0C 1FAKT 1SJEA 4CN1A 1JP5A 1RZIA 2J8UB 1MEXL 5F7LB 5B3JF 3BKJH 3MOBH 1R24A 4U7MA 1WAAA 3HNVL 2PO6A 3UDWC 1YYLL 5FCUH 3MBXL 1JK8A 1MJUH 2OL3B 1U8HA 2DQJL 4YDKH 1ND0B 1ZVSB 1ADQL 3MCKA 4NC0B 3D39B 3LKPA 3UJIL 3GBNH 2MOVA 3WXWL 5HHQB 5EU7C 1F2XK 4L4VA 4FA8A 4MD0A 5CSZB 3PL6B 2MQ0A 1N5YH 1M05B 5DRWA 1N4XH 3QB7C 1B6DA 1U58A 5KSBB 2NTFA 3UJJL 3HFML 3NA4A 1A2YA 5T33L 5HHVL 3MOQA 2DL2A 4F57H 4HULB 5EG6C 1CE6A 3BW9B 4MJIA 1EMTH 4YR6B 5TDPB 1CU4H 2FJFA 3RNQA 3AS2A 3QEQE 1K4CA 2Z8VC 4M7JL 1DTUA 1FLRH 4YE4H 5IWLC 4LRIC 3QIWB 5D2LF 1J87A 4NPYB 4G80A 4PJ9B 4QNPE 4H25B 1BGXH 3OKLA 5T1MA 4MD4A 4BYHA 5DD1H 4WU5B 3F7YA 1FVEB 3RU8H 3EDEA 5CFHA 3GMQA 4PYGA 4H0HB 3FQUB 4L8CB 1T04B 4FQQA 4KUCF 3WFDH 4AENA 1MQKH 1WBYB 2CMRH 4ZFFA 3BFOA 2ZOLB 4XPAL 4NT6B 5CBEA 4XPFL 5F1NB 3DJ9A 2FBOJ 2NNAB 5DEGA 3TIDB 5L9DL 2UZYB 3CVIL 4PJFA 4XRCB 3A67H 5B38G 1BVLB 3N9GH 4XNZB 4E0RA 4NP4L 5IJVB 5JW3L 3IDNB 3GIVA 1J86A 3WJLA 1WBZA 5D7SL 4XZUA 4F7PB 1CBVL 1JCKA 4W6YB 5JW5B 3QEQB 5E94A 2FHFA 4U0QB 4JR9H 3WDJA 5EORH 4WV1A 3MODH 1Y6MR 3QHTC 3HE6B 5C8JB 1NSNH 2UZIH 4NFBA 5GS1A 5I1EH 1IBGH 1G1YA 2X89D 1U3HB 1ZAGA 5DDHB 2HVKB 1KPUA 3W5NA 3HC4L 2VITB 5H94A 3QIUA 1TZIA 3MO1B 5LQBL 5SX4H 1EEYB 3RJQB 4U4BA 3T4AB 2AKRB 3OV6A 5EU3B 5T5NF 5HHOE 4KZEH 1G7HB 3PWNB 2VR5A 4WJ5A 1MHEB 5I16A 2BSTB 1A6TA 2CKBH 3O6LL 4PRHE 1K4DA 4DUXA 4PJBF 1Y18A 4HIIA 2BXZA 3OJVC 3OKMB 3IJYA 1G9ML 3PG2A 4L1DA 2DRUA 4YBLB 5JLZB 2PTVA 5MI0B 2EDYA 3OKKB 3EKCA 4XBEL 1P2CB 4YIQA 4ESKA 1YY8B 5DS8A 3ARFD 4XXDA 3UTPE 4ZPVA 3GMMB 3QQ4A 3BI9X 4NWUL 3UBXB 4C56A 1W72A 1HINL 3S36L 1BLNA 5E1HB 1LDPH 4K71B 2JIXD 1EERB 5EB9A 5DO2D 4XX1G 1NCUA 2GAZA 2XXCB 5DI8B 5I8CB 2DYPA 3MRCB 3FAWA 2QJDA 4GXVL 3BAEH 3VXME 1G9NH 1T7XA 5C0FB 2AXFA 3WFHA 1DE4B 4F37F 3LKOA 1T20B 4PD4K 5BO1L 3IU4H 1CYGA 3R06A 4LPTA 8FABA 4PRHB 2Z31B 2WBJD 1T80A 3MX0A 3U9PH 4WWKC 1AHWB 1KG0B 1U8IB 4E42A 1LGVA 4J3XA 4X6DE 4QXUH 1XIWC 4PJIA 2VR4A 4Q9QH 4AQOA 1XFPA 3OAYH 1BZ9A 2DS4A 2ZSWA 3OB8A 1SMAA 2GHWB 1WT5A 3E2HB 3RUGA 4DEPC 4JY4B 5FM5M 1TPXB 4LEOB 3QUXC 4PD4J 5LGKA 5BRZA 1SYSA 2IAMD 5ESQB 5CINH 2P5EE 1WCBB 3GK8H 1ZA3B 1DUZB 4WUKL 3KYAA 1NGQH 3MYJB 1FNGA 1OTUD 1U8JB 3VXMB 1IKNA 4Q6IB 5T1KA 1YN6B 1BEYH 3Q0HA 4PJEF 1C16B 1QLRA 3G5YA 1NC4B 4LMQE 1X5FA 4WO4A 1GZQB 2BY1A 2DLIA 5J8OA 5GRUL 2IBGA 4D9LL 1NCCL 3VXTA 5K9QG 4JB9L 4YHZH 3GI9L 2BNQE 2UVFA 1AE6H 4FN0A 2C7UB 3AVEA 3TBSA 5FUCC 2HLFC 2R0KL 1Q0YL 1IM9B 3QO1A 3TGXA 1CFBA 1U9KA 4UIKL 4X7DC 4YFDB 1ACZA 2DTML 2ZKHL 3FO0H 4G6ML 4XWGL 5TE4L 4JY6B 3O2DL 1Y6KR 5C0CA 6FABL 1NGYA 3CZFB 2FATL 4JGJA 1HI6A 5E8EA 3MC0A 2DIJA 4YEEA 2P5EB 4LSTL 2OXGA 2DQJH 4WHYH 4OZHF 5EOTB 4P59L 3VG0L 3NPSC 2DQCH 1IGTA 4CJ0A 1ADQH 4QY8B 5JIIA 1CICD 5ETUB 3BXNA 5CD5C 3T0EE 2Z93A 3WXWH 1NCBL 2FD6L 5F6HI 4IDJL 2D31B 3JXAA 5SV4A 1SY6L 1ZWIB 3MZTA 1CZ8H 4MNQE 1A64A 3O4OB 3UJJH 3HFMH 1QRNE 1L0QA 4M1CC 4D0DA 4GG6E 3RZCD 2X1PA 2BNQB 3VD7A 4KJYB 2VL5A 2JJUA 2WLYA 2WP3T 1CGTA 4P9HC 5DMKB 4M7JH 2N4IA 4Y0GA 1ZHBA 1XF5B 2YD6A 1FZKA 2FX7L 1PKQA 2IH1B 2COQA 3ULVL 4RFNC 2OK0L 5DJ6B 1P4LA 4WI2A 3U1SL 3I3DA 2QQQA 2DICA 3LQAL 4NQDA 2HG5B 5C2BH 2W60A 2YA1A 3P4LA 3FB8B 1DLFL 4CMMB 9CGTA 4HX1A 5T1LB 4NBZB 2DIAA 4J12A 5FK9A 3U0PB 3T0EB 1YJDL 1MFDL 5C0AE 2PYED 4H1LH 3TWCL 5L9DH 1HH6A 2K7QA 3HUJE 4OZFH 2V5SA 4MNQB 5HHPA 3PIQA 3CDFA 3RY4A 5ERWB 1BZQK 1QRKA 3GUTA 3CFIC 1QRNB 4NP4H 2NLJB 2VIRB 5JW3H 3IDYC 3ZE1E 1XF4B 3AM8A 1NGPH 3MV7A 5IB3B 5D7SH 4PJHA 1CBVH 1HEZB 2B1AL 5JZ7C 1IAII 4QTHA 4DUVA 4CW1B 3HI5H 1ZT1B 4DQOL 1YEHL 2DJ4A 5DVNA 3T08A 4XTRD 4OLYH 1JF1A 12E8H 2VDPL 3V6ZA 1H15A 1PJ9A 2R0LL 3D0VA 5A2KH 5CWSA 1HHGA 1UZ6F 2Z91A 1MPAL 3PQYD 1KACB 5DJ8A 5GRJL 1KEMH 4QOKE 5IB4A 4HK3N 5LQBH 1Q9WA 3WUWG 4DKEL 2Q6WB 4KZDL 2VXVH 3MTRA 1NGWB 4TUKL 3VRJA 4MYWB 1NGZB 1DQQB 1SYVA 5C0AB 2A6KA 35C8L 1T2QL 2W9DL 5LKNA 5B39G 4E41D 3HUJB 1T2JA 4B7LA 1OQXA 4WI7A 3LAFA 4HGKC 4F9PC 3WD5H 5HGBA 4K8RH 1S7WB 1UEMA 4LBEB 3WJJA 1QFWH 1AO7E 3QWOB 3EYFB 2APTA 3FHAA 3BZ4A 1A6PA 1S8DA 1V7NL 4XBEH 4TNWF 4O51A 3GMRB 4P2QE 1FZOB 4ODBD 4WW2F 1WIUA 1M6OB 4RRPA 2FHCA 2X4OA 3RHWK 4YZFE 1UYWL 4PJXA 1HINH 2XTJC 4R2GD 3S36H 5JHDD 1SEQL 5EU6D 3JUZA 5EWIH 4IOFC 1B3JA 1MHPH 1JFQL 4QOKB 1BMGA 2CJUL 4XP5H 1MFAL 1KIRB 4GXVH 4UZGA 4MHHI 4JG1L 5E8NB 4KK8C 5C2UB 5C70A 4JFYA 1ZGLB 3MQIA 2R2BA 2YEZB 3MLYH 3CDCA 4YAQA 3MRNB 1FSKB 2GSIA 1LMKA 1M7IA 4EI6B 1SEBB 4OCRH 5HYJA 2GFBA 2ADIA 5HVWA 1JIBA 2DD8L 1WCQA 3KJ6L 2OMBA 1AIFB 1AO7B 4NZUL 5F3BB 3E6FB 1MAMH 2XWJA 3QUXD 3L3KA 4K8RD 3ZSTA 4P2QB 2F53E 4O2CB 3KS0J 1HHJB 1A6AA 4NQXB 5CIPH 1VGEL 4X7FC 4L3EA 3VG9C 3NGBC 3L3IA 2IPTL 2Z9TA 5BS0D 3U7YL 1MUJA 5DT1L 3SKUD 4RISL 4PUBL 5GJSL 1YEJH 3B9VA 1JYVA 1QSZA 3GMNB 4R96B 2W38A 4MX7B 4QHKI 1EO7A 4LCUA 4EI5C 4U0RC 1FORL 3UTQA 2VLLA 3KPOB 3MMEA 3L9RA 3HZVA 4NZDA 4UTBL 3THML 4HAGA 3UDWA 1PGRB 3GJFB 4EXKA 5GRUH 1HHIA 3TNNB 4C58B 5ESAB 1NCCH 4BQ8A 1HN1A 1LD9B 4ISVB 5JPNB 4RAVB 4ZNEE 4G5ZL 5HYSB 5GGQL 4CJ1A 3F6LA 5LCVL 3RWDA 4HJJL 4JZNB 5DD3L 1U8KB 1ZVYA 4OFKA 4UT7H 4ZOCA 1Z9OA 4UIKH 2F53B 4IRZL 2ZKHH 1JHTB 1FN4A 2DB8A 4GH7B 5F1IB 2X4PB 2B5IB 5M7QA 1NJ9A 4NO5A 4L9LC 4AIZB 6FABH 3NCBB 5L7XH 3KDMA 2FATH 3RX8A 1DFBH 5DJAA 4M61B 5ANMA 4LSTH 3VG0H 4P59H 5IWLA 4WFEE 3F7PC 2F5BH 4LRIA 3HC0A 3ZE0E 3QP3A 4Z7OF 3DROA 2PW2B 3DARA 4NO3B 3K74B 2FD6H 2VH5L 4JM2F 3BP6B 3N85L 4Y5VC 5I8KH 4LVNC 3BDYL 4PTTA 4J7RA 4GRWH 4S1DC 3KPNB 3GSOB 4N90D 3ARPA 3E0GA 2A83A 4OCLC 2QLVB 1GGIH 4BFGA 5IFJA 4O02L 1HKLL 2A6IA 3A6BL 1QFHA 1UCBL 1K3IA 2ED9A 2Q3ZA 5FKPB 1FG9C 1QFWI 4NRXB 3TM6A 2H2SD 4UAOB 1U91A 5IMOB 4FQ1L 1CQYA 5D93B 5GGSB 2H6PB 4TNVF 4JJ5B 1MF2L 3QFJD 1I1FB 2PYEA 1MVUA 2BX5A 3U1SH 5FFLA 4OI7A 4DAGL 3STBA 4ZO6A 3K80A 3LQAH 5EO9B 1L7TL 5IHZA 1RZFL 4Y5XC 3SGDH 1DLFH 4X99B 5HY9B 5AZ2L 3NCYP 2D7OA 2A9MH 4G6FB 3DRTA 2VABA 7CGTA 1T1WB 1EZVX 3FRPG 3KGRA 5EUOA 4I5BA 4Z77B 4XNQA 3TWCH 1K2DB 3QHFL 3HTLX 4MA1B 3SGKC 1T5WA 5DK0A 1PX3A 1A6UH 5IBTL 1Q0XL 3WNKA 4DKFL 1VCAA 2M2DA 5E8DL 3KXFE 1YNLL 1CFSB 1NLBL 3LZFL 5KTEL 3MCG1 2VDPH 5DZNA 5LAXA 4PY8I 2R0LH 1NEZA 4X8JB 2V6HA 1YQVL 2P4AB 3HRZA 1MPAH 2N7BA 4MA8L 1AGEA 5D6CB 4GLRI 5GRJH 5HI4C 2VSCA 2C26A 3ORJA 5D7JB 1R3IL 5A16A 2M26A 3IFNL 1AGBA 4UIMB 5T5NG 4TUKH 4V1DB 3OB0H 1JGDB 5MENE 1XGYL 3O6FC 4AEIL 4UUJB 2H1PL 2W9DH 2O93L 2G60L 4P5TC 3P11L 1QBAA 3HS0A 5DYOB 1NDGB 3HZMA 2VDNL 5CS7A 1Q72L 2VLKD 5JHDA 5EU6A 2PW1A 1FNFA 1S3KL 5HGDA 4NKOB 2Y25A 4OB5L 3MRJA 2FSEB 2GTWA 3V4UH 2KPNA 4NQVA 5CAYB 1V7NH 4P46C 5I1KH 2GSGB 2EDLA 3HI6H 3L5IA 2UV3A 1ZT7A 4HUWA 3FCTB 1G6VK 3KXFB 1LEKA 4WWKA 4NO0B 2W0LA 1KN4L 4WUUD 1XIWA 5FECA 2CUHA 1AGDB 3RGVC 5TGBA 1B0RB 1NMBL 2P8PB 3QQ9D 3DUUB 1JFQH 4WGVB 2CJUH 3MBEC 4HWZA 1MFAH 1FFOB 3RWJB 5IMKA 4LSUH 4PGBA 2ZOKA 1CK0L 1HSBB 5MENB 1UM5H 3QUXA 3D87B 4GS7C 4LCWE 3BUTA 3K2UH 1F4XL 5JXAL 3NABL 3L3OA 2LVCA 1QR1B 3GM0A 1FPTH 1N2RA 4U6HB 4HIHA 3QQNA 5BS0A 4B5EA 3T2NH 3VJ6B 3SN6N 1R3LB 4GRLC 3MGOA 4Y4HB 4LL9A 4MNGA 2FIKB 3MFFA 1SQ2N 3WXVL 2HLAA 1KV3A 2ICWB 1L6XA 3SDYL 3MJ9L 1NLDH 4NN7C 1GVIA 5F9JB 3RBSA 1MRDL 3L5XL 3U7YH 3SE8L 3MNZA 5DT1H 3LQZB 4PP2B 4RISH 4PUBH 1CLZL 1WJ3A 1LNUA 4MSWA 1ZSDA 5FM4A 3QXAB 4HLJA 2HJLA 3MFGB 4M62L 4J8RA 5E0QA 3ZKND 1G84A 3CUPB 4HWNA 2GJ6E 1JGVH 2OJEB 4WFFD 3V79C 1RUPH 4K23H 4UTBH 3DURB 3ULUE 3KLAA 3GSVA 4LCWB 3D85B 1ZGLP 3TBYB 3G5VB 3HAEG 1FG2A 3B9KD 1VGKA 3PHQB 1QBBA 4OGAD 3VA2C 4TQEH 3W81A 1MCOH 4Y4FD 5EOCL 2PTTB 1S7XB 4LSSL 3MRPA 1BOGA 3GJEB 5CGTA 1I8KA 5LCVH 2H2PC 4PJ8C 1HHKB 4POZD 4I4WB 1A4JB 2NPLX 2IBBA 5TPWL 3VWKD 4YFEA 1CDBA 3AREB 5HGHB 4IRZH 3T0BA 1FL5B 3IAQA 3TPUB 4OIIL 2HAZA 4R4FH 1UH2A 2BSSB 4WY7L 5ID0B 1TIUA 2QSVA 2YR3A 5FUOL 1FNEA 3QULA 2WMPA 1NBVH 5AEAA 2OL3L 1KYOK 5EFIA 2DBLL 3ZYIA 2VH5H 3S4SA 2GJ6B 1FCCA 1WFOA 3P0GB 4NN5C 2DLGA 1DQML 5GGUA 4M8QA 1TZHB 3RWFB 3BQUC 3TJEL 2GTZB 1QSEE 4LQFH 4BSVA 4O02H 3VMOA 1HKLH 4PJ5D 3WHE0 3WNNA 4BKLA 5DJCA 3A6BH 4XMKH 1UCBH 1WSST 4NOFA 3KYOB 4F8TA 4LSQH 1K8DA 1KYOJ 4FQ1H 1H5BC 3SKOB 3HPLA 1MF2H 1Y0LA 3U4EB 3ET9F 2W9EL 4QF1A 4JAMB 5DD5L 3IS1X 4RDQG 6CGTA 1Z5LB 5J13C 1L7TH 3DSFL 3H0TA 4TN9A 1FYTE 4PRAA 3QDJD 1FJ1B 3CSBA 4KKAC 5AZ2H 4MA3B 5DJZA 1T21A 4XCEA 4M93B 2KZ1B 3GIZL 2YOCA 3E6HA 2DWEA 1GOFA 1GJIA 1T22B 5J9PA 4LLDA 1VESA 2FJGA 3QHFH 3SO3B 4PGCA 1DANU 3V5HA 1T5XA 1QSEB 2A9NL 3CVHH 5JORA 3BKYH 5H35A 2NXZB 3EJZD 3NAAL 4IIQC 4KJWD 3CFKA 5C71A 3SE9H 5CILL 5T1DH 4KDVA 4NBYB 4XBGA 2YSSB 4QCIB 3RQ3A 5MEPA 1XGQA 1Q0XH 2DM3A 5F8RC 1JN6A 2ICEA 3SQBA 4DKFH 5E7FA 4ZS6C 4GXUM 4CNIB 5GGRY 4F9PA 1YNLH 4Z7QE 1NLBH 4FXLA 5KTEH 3OJ2C 4X80L 1AKJA 5KSAB 1ROWA 2BCKB 3ROOA 5F6IB 4MA8H 1FYTB 3BZDA 3D3VE 3NCYS 4YHML 3VFUA 3ARYA 1S5HA 2XZAL 4FFWD 1KELL 4LPWA 1YDPA 3IFNH 1BVKB 5DSCB 5IQ9A 1B2WL 4H8WL 3O4LE 1UEYA 1E6JH 3BP4B 5IBLC 1XGYH 2I5YL 5ICYA 3VD3A 3ALWA 2H1PH 4XNYL 4GG8B 1CFVL 3BIBX 5EBGA 2GIYA 1PD6A 4YJZL 3V7AG 3BT2H 5J0BA 1S9VB 4EN3C 3DYPA 2OJZL 4HS3B 4WUUA 3QUYC 2FDBP 4NZTL 4OB5H 2AJ3B 2XA8H 4LVOB 5JQ6H 1M1SA 1DLHA 2F19H 3ELAT 1A4KA 3UTSA 2P5WD 3C09B 5FOJA 5DEFA 2X6MA 2XNAA 4QXTA 3V6BR 1L0XA 1GC1L 3WIHL 5SWQB 2FCBA 4GW5A 2G2RB 1KFAL 1JNNL 4F7MA 4J4PC 1G0DA 4HKZA 2CGRL 4KROB 1BM3L 4OBSA 3NFSL 1WUNT 3OSKA 3D3VB 2N7AA 5K9OA 5EBLA 3T3ME 1KCSL 2R0ZL 2BVOB 3L3DB 2ID5A 5HI5C 5C09E 5C0NC 3LSOB 1IQDB 3O4LB 3O3AB 2R2EB 3ZDYF 1YY9C 5JXAH 4GRLD 3CFJA 2FR4B 4XC1L 2Q8AH 2YD3A 4PG9B 3RPIB 4YHYB 3EYUH 1TCRB 5JUEL 2XTLA 1N59A 1SM3L 4KI1A 2CD0A 4BZ2L 3DGGA 3H9YA 4M6OH 4MAYC 4EI5A 1V3MA 2X9WA 3AS3A 1BP3B 4YDJB 3QEUB 3NFNB 1BFTA 2ATPA 5TDOA 3SJVE 3WXVH 4JRYD 5FYLH 4NM8L 1MFBL 2D3VA 1QA9B 2PCPA 1D7FA 3NCMA 3Q3GA 4GFTB 1QKZL 1S7SA 2BOCB 1K6QL 1ZHNB 4QRPE 4BH8A 2C3VA 1MRDH 2FEDD 1BF2A 4G3YL 4R8WL 3SE8H 4X6CB 1FVDA 3VDBA 3TN0C 5LGJA 4X6CF 3D25A 4WFHE 3HLAB 3LRGA 3QQ3A 4M62H 3ZKXB 3VMNA 1T0NA 4OUOA 1RZJC 4TSAL 4ZDHB 4ZFOL 3S35L 5C09B 3DO7B 4L9LA 1F6AA 2CR3A 4U1NA 1J88A 2VWEE 3LB6D 3VWKA 1CL7I 1HXMB 1FC2D 4PREB 3WIFB 1D5ZB 2RCSL 4FQIL 1KIQA 2HKHH 2I07A 3G6DL 1LK3H 2FZ3A 3OKEB 3PP4L 3BEVB 3MRKB 5F7UA 5HSFA 5EOCH 2RAMA 1WZ1L 5GRVK 4FP8L 1EFXD 1NMCC 4Y5VA 1MI5D 1R3HB 3V0AC 4EUPA 4NZJA 5MERA 3SJVB 4X6FA 3MLXL 4H0IA 5F7KC 5TPWH 3QG6A 4UNUA 5FF6A 1XGUB 3MGTB 1Z6JT 5ALCH 1K9TA 1A3LL 2LTQC 3SKNB 3QUZD 4QRPB 5FYLD 3TVMC 4QRUB 4FFZL 5CD3A 4CN4A 4WY7H 3LEXB 4RMWA 2H8PB 5FUOH 2V2TB 5C0GA 1CXEA 1C08B 1MCSA 4PJ5A 5CJBA 3RDTC 1FFRA 4JM4L 3VGEA 2BNRE 4I3RL 4L3AA 1OOAA 1U92A 5FDWB 2OX5A 5FV1L 5DJDB 1KB9J 3SPVA 5D1XB 5CBAB 3DYOA 4LNRB 3TJEH 3B2VH 2MKWA 4X4YA 4RX4A 2VXSH 5I1IH 2HKFL 2R9HC 3OGOE 1MJ7H 3R1GL 4D9RD 5JR1H 2E7BA 1IAKA 4BK4A 4OZ4A 1GPOH 2YUVA 4WEUD 3FRUB 2C9AA 3FTGB 3GJFK 1IC7L 3REWA 2D0GA 3DMMB 3SGKA 4NNXA 3CFDA 4JLRB 1UGNA 1ZLVH 1KXTB 2W9EH 3MV9E 5CEZH 4NGHL 4JRXD 1HWGB 2ADFL 2DQFB 4F80A 2HT2C 4OD1L 1UXWA 2XQYK 1YEDA 1KLUA 2NY7L 3ILQC 5IGXL 3BMWA 1RJYA 3DUSB 3X3FH 3MUGA 3OR6B 2BNRB 1CDYA 5I1AB 4OI9A 3LHPH 1JPST 5I75B 3EYOB 5FUZL 1HQRA 5C6WH 2F74A 4FQ2L 5DVKA 1NBYA 4HKJA 4M5ZL 2A9NH 3NAAH 1IZKA 4G8EB 4LEXL 4KPHL 1OGAE 3VFPA 1VACA 5CILH 3O6FA 3PWLA 4W6WB 4G42B 3W9DB 2XZQH 3TBVA 4XH2A 3U36A 1DQDL 3KPPA 5E08L 4OD3H 5IVXF 4P5TA 3G5XA 3NCFB 4YK4B 4YHIB 1NAML 5ILTL 4X80H 2AEIT 3MV9B 4RQQA 5BZDB 1OAUH 3WFBL 3C6SB 1OGTA 1QSFD 4ZUWB 1EJOH 1FAIL 4FQHB 5D1QD 2WZPD 1U8QA 2CSPA 5E2UL 5EZOL 5CEZD 2VKWA 1KELH 1RMFH 3D18A 4JQIL 2UYLB 1HK6A 1B4JL 3BPNB 3WYRA 1YN7B 2X44D 3BIKA 3IXTB 4EN3D 1JGEB 1NC2D 2I5YH 2WIIA 3CVHA 4R6UA 3U2SA 3T2PA 4PGDB 5I74C 1CFVH 2E8ZA 3QUYD 2WWKT 3JWOL 4YXHL 3RGVA 4PJGA 4NZRL 4KUCD 4RNRA 4PLNC 4HFUL 3O8XC 2R1YA 4P3CH 3MBEA 4KVCL 1F13A 3WL9A 3U4BH 2OJZH 1XF3A 1IKFL 1ZLWH 1U93B 4PR5A 4DKDC 4QXGL 1R5IA 1OGAB 4X9FA 4NZTH 3UPCA 2MMXA 5LGHL 5JOPE 5DC4B 3C9NA 5FYKE 4OZGA 1T1YA 5AZEL 5EU4A 1GC1H 3WIHH 4CU6A 2A74B 1KFAH 2ERJB 3IVKB 1QACA 2P8LA 3U6RB 2Y6SC 4KQ4L 4QHMB 4GRLA 3RWEB 2VLRD 2CGRH 4PJ7A 1BM3H 1JPTL 1BFVL 2NXYC 5E5MB 3LN4A 3I2CL 5EU5B 4OF7A 2R0ZH 3ARDB 3S96A 5JMOC 1JRHL 3ARBB 4ZO7A 2G75B 4P2OB 1ED3A 3P2TA 4NO2A 4AH2A 5I9QC 5EBWB 5B39A 4JRYA 2GK2A 3V7MA 5DQ9A 4XC1H 4P2RA 3R8BB 3GSUB 4OFYA 1MY5A 1BQHB 1FIEA 3C8KA 3QUKA 3NIDE 2MWCA 4BK5A 5JUEH 1G6RB 1SM3H 4BZ2H 4QWWC 4RGOL 4LF3A 4MDJB 2OR8A 3MLSL 3CLEH 2VDML 3BZFB 5IMLB 1LO5B 1BFOA 5D7LD 4JFQB 3VE0A 1ZMYA 3NVQA 1CCZA 2DMCA 1QKZH 2ZUXA 4FFVD 4RMQA 5D7IE 5ID1A 1K6QH 4DZ8B 3WN5C 1FE8L 3DRQB 4G3YH 4YQXL 5BCAA 4FQPA 1NCAL 2MHAA 2V5YA 1F6FB 4KRMB 3JWDL 2Q1EA 4URTB 5I1DA 3RI5K 5DC9B 5MHSE 1EFXA 3S35H 1G9MC 2OMNA 1UKTA 1WITA 4ZUSA 4YEFA 1JPGB 1QUNA 4OT1L 3ROLA 1BD2D 3JV0A 2ITDB 4HWUA 4FQIH 1NQBA 2J5LC 3G6DH 3ZMRA 1GGYA 1MLBB 3PP4H 5B8CC 1NBQA 4YXKH 4PRIE 3HAEH 3VCLB 4ZNCD 1ZLSH 4U6YB 4X7EC 2NY3C 1QLEL 1BIIA 3BQUA 3SGEH 3FHQA 2I9TA 4XGZB 3QNXA 4MJIE 4KRPB 4ODVL 5C0BA 4JO1L 3RDTD 4NQSB 4Q9CA 3MRHB 3U7WH 4RGNC 3OPZH 4RWYL 5I17A 1YECH 1H5BA 4O5LH 1B9ZA 1RZIB 1WFTA 3OJDA 1UVQA 5D72H 4I3RH 2GYSA 3GEWB 4I18B 1GSMA 1TETL 2PO6B 1ITCA 1WAAF 1ONQB 4YXLL 3KVQA 4F9LC 5GQBA 4GQPH 3EJYC 4WNQA 5FKAA 1JVKA 1BX2A 4DZBB 4MD5A 1FZJA 3MCKB 1IQWL 2O61A 3LKPB 5FYJH 4KGLA 3O2VH 2I26N 2ED8A 1K5NB 4XPTL 3C60C 5HJ3B 3BHBA 1X5JA 3O41B 2OSLB 2X5PA 5DRWB 4PRIB 1R5VB 4B7IA 3WKNA 4D8PB 3CX5K 1U58B 2ICWJ 1QOKA 3ARQA 4AM0B 5D96B 1IC7H 4ONFL 4AJ0A 4L8DB 3BGFC 4TVPL 4N0UA 4JFHE 1VFOA 4MJIB 3RNQB 4MXVE 4IIQA 4OLVH 4L8SB 1RULL 5F7DA 4NGHH 4U1JB 1G1CA 1HZHL 4X83A 1C1EL 1DR9A 5AUMA 1IC4L 1I9IL 2R1WA 4OD1H 5J1AA 4DN3L 4G80B 2NY7H 3NZ8B 4HS6B 3EOAB 4FXKA 1EO8L 1F45A 1CG9A 3OKLB 4MD4B 5IQ7L 5E95B 3F7YB 3N1GC 1KENL 4WDIA 1EHLL 3MRRA 3KPRE 3S5LA 3VFMB 2YUXA 3EYSL 3J7HA 2YHGA 3OG6B 4FQ2H 4Y19E 1BECA 4WU7A 4AENB 4M5ZH 1FIGL 1KCVL 4XWOD 4AEEA 2YD9A 2WINA 1FLTX 3MRGB 5D2LA 5DEGB 4XVJL 5ISZE 5FYJD 2EO9A 4K94C 3JZ7A 5E08H 1DQDH 4BZ1L 4PJFF 4UOW0 5DC0A 1YEEL 4EN3A 1NC2A 1HIML 1NAMH 2LU4A 2GJZA 3VXSE 3QUYA 4UDUA 3RNKB 5J12B 3NCJL 5HVFB 3BE1L 4WI6A 5K59E 5DRNA 3BH9A 5E2UH 1G7QB 5GS1B 5CP7B 1D9KC 4ZAKC 1URLA 3TO4D 5SWSA 3ZL4L 1UJTA 4LSVL 3ZHDA 5I76A 2W9LA 4I2XA 3CXDL 1CD9B 4GBXC 4I0KA 4J4PA 4NRYA 3VU2A 4HUVB 4LOUC 2IADA 1TZIB 2DLTA 2DN7A 4P4KD 2OS7A 4YXHH 5E5RB 3ULVC 1RZGA 1TLKA 4KQ3H 1HYRC 4HFUH 4LCYA 4RBPH 3BO8A 4Y19B 3AAZB 4KVCH 3QI9B 2GW5A 2VLRA 1GYAA 3G08A 2YPLD 2KBGA 1M71B 3OX8A 4EEEA 1AQKL 3FB5A 4QRQB 5LGHH 3F7QA 1WISA 4U6TA 3FQXB 1XAUA 5AZEH 3RPKA 3SKMA 1XF1A 2P47B 2VKXA 5FAAA 5JW4M 4JGMA 1YJDC 3MV01 4MAYA 1AQDB 2XRAL 1BWMA 4JFFD 5LG1A 3VXSB 3GSWA 3S35X 4PP1C 3VFOB 5DVLA 4HHAA 1JPTH 4YIQB 5JOFA 3PHSA 4EDXB 2GY5A 2VE6A 2XPGB 3NN8B 3I2CH 3X3GL 2ICCA 5IF0A 3RUGE 1CDGA 1L9NA 3I84A 4MAUL 4R3SA 1TQCC 5T3ZE 5E6ID 3R8QA 1W8NA 2WW8A 1IRAY 4JO2H 1JRHH 3FB6A 4QWWD 2BFVL 4U1SB 4W4NA 1FFPA 1VFAA 1JBJA 2R2HA 4HBCH 3QWRD 1OM3H 2XI9A 5DHVH 3I50L 4WI8A 1J0KA 3G6JA 5MEOA 3IF1B 4QHNA 4JVPA 4LGPB 4RGOH 2AGJL 1YQ2A 2FEEI 3MLSH 4APQC 1DBBL 2VDMH 2APFA 1P6FA 3LKOB 1K85A 3R06B 5DUMH 3LEVL 3EOYG 5C0RL 1HHHA 4DGVL 2Q3AA 4PTUB 1MCWW 2BOBA 3LH2H 5TE7L 5FHBL 4IMLA 4Y4KD 1FE8H 2VXQL 3HE7C 1JWUA 2BK8A 1BD2A 4YO0A 4PJIF 3O45B 2DWDA 1NCAH 1T3FA 3MRLA 5KN5B 2DI9A 2HRPL 2JJVA 3JWDH 1MFNA 3RUGB 1YEGL 2EDDA 4N8VA 3X12A 1MCRA 3M1BA 3T8XA 2QQLL 4YHOL 4OT1H 1JPFB 3TVMA 2VAAA 4DGIH 1GIGL 1C5DA 3FO1A 3N1PC 3P9MB 1FNGB 3FQNA 3RDTA 2NY3D 4OCWL 1N6UA 3MNVA 4X98A 3G5YB 1I3UA 3BEWA 4YHLL 5KW9L 4FTVE 2VDKL 4I3SL 4HC1A 2HTLC 4G7YL 1NL0L 5C08A 3ARGC 1FFNB 1G7IA 1QLEH 4RGND 3VXTB 3CIQA 2DQIH 4NC1E 4R0LB 3DI3B 5J3HD 3BH8A 3TYFB 4IHOA 4MQ7B 4HKBA 4LIQL 2Z4QB 3T2QA 5EZJA 5JMRA 3Q5YA 3QO1B 3C5ZD 1DEEB 2BY2A 2V2XB 4DFIA 2YKLL 1UJ3C 1TETH 1OTTD 2CRYA 1P7QD 4YXLH 1LVEA 2BERA 1P4BL 1IGTB 4Y88A 3H2WA 4CMHB 1IQWH 4JKPL 3ULUL 1QO3B 4KKCD 4NCC1 4ZUUB 3FFDA 5ENWA 4QRSB 3T77A 5C6TL 1KULA 4XPHL 3IFLH 3QIBD 4LK4A 5D70L 5GGRB 1A0QH 1IC5H 2D9CA 4TVPH 3S37L 4YDVB 3N06B 4D0DB 5F9OL 2ZSVA 4KFZC 4XVUC 4MXQC 3DVIA 3FO2B 2VL5B 1BBDL 3QFDA 1RULH 1N7ML 1OW0C 2BVPA 3CMOL 3KLSA 2C1PB 3SHSA 3MRDB 2YD5A 5LXGL 1HZHH 1NGXA 1UKSA 5KANI 1FZKB 1UA6L 4HDIA 2ADGA 4UINH 1IILE 5ECJE 4XVTL 2K1MA 1U2HA 5IQ7H 4NUJB 2V7NA 1FFQA 4ODUB 3SCMC 1EHLH 4Y2DD 2W07A 2VZTA 2LFGA 3GHEL 3EYSH 2AJVH 2QR0A 1D3CA 3QXUA 4UILL 4MJ2A 1TITA 4CU8A 1FIGH 4TUJA 4ZXBC 1HYSC 3P4NA 4JM2D 3SDAC 3GNMH 2DQTH 4XVJH 4XI5D 2DM2A 4OM0H 3NIGE 2FECL 3FO9A 3PIQB 4HPOL 1A21A 3QEHA 1Z3GL 2XOTA 1A6VL 4R97B 3O8XA 1YEEH 3ZKMC 3PE9A 2WLZA 3RWHB 1G9EA 1TVDA 5E00B 4U05A 4ZAKD 3RKDC 4Y16D 1U8PB 4PJHF 4FMFA 4M7LT 4OGYH 4LLMA 4P4KA 1CXHA 4P0DA 2XFXA 4PRBA 1IGCL 4X5WB 3EYQD 3B3IA 5F7YC 4HZLB 3ZL4H 4PJXE 2KDGA 5FGRA 3FJTA 1MWAH 4Z8FL 4MS8D 4LSVH 5CWSB 1JF5A 1HHGB 2OQJA 3DX7A 5DHYA 2FHBA 3QUML 5I1HL 3OAUH 3VFSA 5IIEB 2J2ZA 5IB4B 3WNLA 3P4OB 3D5OF 4CDGC 4Z5RB 4WEBH 3B6SB 5IV2A 5DQDH 2HVJA 4KI5F 4BQBA 5ACLA 3VRJB 2OTUA 4XCFL 1LP9F 4P9ML 1YC7A 1SYVB 2YC1A 4JFFA 4PLOB 5D2NC 3MGAA 2JK5B 5IMMB 4KRLB 3ARFB 1VB9A 1T7VA 1I8IA 3VXRD 2FH6A 5D5ME 4PP1D 5IB2A 2XQBL 3U83A 4RAUA 5F71A 1I1RA 1LO2L 1U95B 2JIXB 2XRAH 1RURH 4U1IA 3HMWH 4JREB 1WLHA 4O51B 3LKQA 4B50A 3X3GH 3HNSH 3H9SA 4GXUN 3L95A 4NNYA 1RUMH 4MAUH 3HPJA 1FGVH 3T3PE 1BZ7A 4PJXB 4FQXC 5F3HA 4NKDA 1GAFL 1KBGH 2EIBA 2D4DA 4RFOL 3WN5A 2HN7B 2BFVH 5DTFB 3C5JA 3TBWB 3SDCC 1MCNA 5L0QC 4LHUG 1WIOA 4N0RA 2WBJB 3K8KA 4K07A 3QPXL 3CFCL 2EYSA 3KLHC 2CKBB 1AR1D 5DR5H 2DLFL 2OI9C 3OKOB 3HCVA 2J3SA 1FNAA 1JWMA 2VXUL 4G6AC 3QCUL 3HE7D 3F8UB 3WNMA 3X11B 3PABB 3LEVH 32C2B 1INEL 5C0RH 3QNZB 5D5MB 3D1MC 5GZOD 2IAMB 1CIUA 3PWPA 3CH1A 2DQGH 5FCSH 4E5XB 2VC2L 3MA7A 5CCKL 5B8CA 3EIFA 1PSKL 5HYQB 3L3KB 4Z7VA 4WGWB 3KPLA 4Z0XB 3TA3C 1H3PL 2HRPH 4JN1L 1A6AB 3H3KA 3T09A 1RY7B 1YEGH 1ZKAA 5CJQL 4BQ9A 2CDFA 4IRJD 5DHVA 3UZEA 2QQLH 2ITCB 3GMOA 3O6ML 4NYLA 5C0IA 4YHOH 2EO1A 1A9EB 1GIGH 2YWYA 3B8SA 4P5KB 5C0EA 1KGCD 2VLLB 2AV1A 5I8EA 5A2FA 3SKJH 3L9RB 3CDYA 3HZVB 4XP9L 3QAZC 2APVA 1VFUA 5GHWH 2P43B 5C9KA 1ZV5A 4F9LA 5DMIH 4G7YH 1HHIB 3GI8L 4Q7DA 1WWAX 1I8MA 1T1XA 2NQCA 1XT5A 4W4OC 1P7QA 5I8OL 4K3HA 3KNBB 1S7VB 4QTIL 1PAMA 1J8HD 3I6KB 3I75B 3M8OH 4KHXH 4KTDH 1CICB 3MR9A 3WS3A 2MCG1 2GK0A 2ZJSL 2QKIA 4TOYH 1FN4B 5D4QA 3CSPA 3G5ZA 2EC9U 2CIIA 1CQKA 1E6OH 3MCLL 5CHNA 2EDQA 3DHJA 1I85C 5KS9E 4FABL 1A1OA 4OQTL 2O5YL 1V05A 2FRGP 1P4BH 1HXYA 4QGYA 3A6CL 3HC0B 4IMKC 4MB4A 4AYFA 3RZCB 3HG1D 1IM3B 3IRZA 4F2MA 4HJ0D 4I48A 4HIXL 3DX9B 3BIAX 1WGOA 4YGVB 4H20L 3WDHA 1LE9B 2YK1H 4L8BA 4PTTB 3HZYA 5C6TH 3IDXL 1ZA6B 4XPHH 4XVUD 1HH9B 1CFTA 1NAKL 5LBSL 4F7CB 5D70H 3QEGL 1F4WH 2DI7A 1MCPH 1JPSH 5IFHL 1QPPA 1RK1A 5IK3A 3OAZK 5DFVD 3PQYE 3O0RL 5GSVB 3MA9H 4Y2DA 2BSRB 3AB0B 4PLKC 1U6AH 1N7MH 3UYRH 4BM7A 2AI0H 2VDRL 4POUB 1U91B 4LPCA 1TJGH 3LV3B 1UA6H 2X4TB 2L7JA 3HKFA 4TULL 1ZT4B 2UWEA 2AEWA 1MVUB 1I3VA 2R1XA 1R5WB 4E41E 4X4ME 1AXSB 1IJ9A 1SY6A 2A0LD 3SDAD 5KS9B 2OP4L 4B41A 3DXAE 5IEHB 3GHEH 3NA9L 1HOCA 4HD9A 3AS1A 3DRTB 5C3TA 2VABB 1D9KA 4ZAKA 2EH7L 1RFDL 3QXTA 2P42B 4U7KA 4J3WA 4NDMA 2P24B 3TFKD 3I3BA 5EUOF 1B88A 3ZKMD 4GBXA 5CEXB 5SWZD 1KNOA 5LWYL 1T66D 4LFHG 1MJJA 4XCCL 3RKDD 3E1F1 3RTQD 4AK1A 2F15A 2J12B 1A6VH 2HH0L 1FGNL 3QA3B 3RX5A 1HSAA 2Q7YA 3QRGL 3PQYB 1DZBA 1KUMA 1VFMA 1KPRA 4HW6A 4GQ9H 1IGFL 1AGCA 4D9QE 3PL6C 4KVNH 2ADJA 3CSYB 3VFWB 2A38A 3LIZH 5SV3A 5LAXB 1R0AH 3BP7B 3QDMD 1NEZB 3TJHD 4E41B 1SVZA 3VXRA 4ELMA 3QJHA 3QUMH 3HR5B 4H1LB 1NUDA 5F1OB 3DXAB 1NUGA 3GMLA 5KZCD 4LVHC 4MJ5B 2DDQL 3TT1H 4OZFB 4PRPD 4PLJC 4CDHA 2F8VA 5FEBA 2EIZB 2ZPKL 4PJCE 4M1GL 4HUUA 1JV5A 5DMJB 4PBWD 2XQBH 3B2UC 2HWZL 4R2GB 5F7HA 5JHDB 4GAYB 5A3ID 1KB5H 1OP3H 1PYWA 1WWWX 3FN9A 3RA7L 5E99L 4NQVB 1MWAA 3CDGA 2QV2A 1ORQA 3WEXA 1AI1L 2X2YA 1ZT7B 2NY5L 4O2EB 3UTTD 5J11B 4Q2ZB 4F7EA 2C1OA 5K33A 4HAFA 1GAFH 5E8PB 4RFOH 1QHOA 3HE7A 1PY9A 2B8OT 2ZWLT 4DWHA 4G6AD 1TCMA 4MVBD 5F44A 1OB1A 3MV8D 4U2YA 1QBLL 3L3JB 3QJFA 3CFCH 3HE6C 3QR2A 4YWGH 5FGCE 3MNWA 1VPOH 2VXUH 1U3HC 3KR3H 4PB9L 1HDMB 3QCUH 3L3OB 3C6LD 5HI3D 3HI1B 4KY1L 4U6XA 5TF1L 1N2RB 4PJCB 1UT9A 5HYIA 1INEH 4PJAA 2Q20A 4U1KA 5BS0B 3FQWA 4MXWH 4IRJA 4UNTA 5EIQA 1D5IL 5JA9A 2I27N 4DTGL 2EDWA 3UC0L 4JCMA 4G8GE 5CCKH 3EYVA 3VD9A 4MNGB 4F7TA 5CJXC 4CVZA 3BZEB 1PSKH 1KOAA 3V0VA 4PJDA 4NNPH 4P3DA 5EO1A 1H3PH 1YEKL 4HG4J 2V5RA 3ARGA 4JN1H 3W39A 5I1LB 3O3EA 5CJQH 3CZJA 2D7QA 3MNZB 1IMHC 4N90E 2OR9H 3EFDL 1YNTA 4MJ6A 4UMGA 5DJXA 4OLEA 3W9EA 1ZSDB 3I3EA 4PBVC 3CU7A 3UPAA 4YBLC 2HJLB 5MI0C 1TJHL 3UO1L 3MJ6A 4LCIH 5F96L 1S7TB 2AJZB 4OGZA 1UJ3A 4XP9H 3UPRA 1TMCB 1J8HA 5FGCB 1RZ7L 5IT2L 4N0FA 4DGYL 4CVXB 5E7BA 3BGMB 3QFJE 1T0MA 4K71C 5ACZA 4Q9RL 5J06A 1ORSB 2J6EH 2WNGA 5FO7A 4HCRA 2JB5L 4QT5B 4S1RL 1EJ6A 1MHCB 3P77A 5ABDE 1Z2KA 1Y6NR 5CIPB 1BOGB 4G8GB 1G7JB 1FO0H 4XP6L 4A6YL 5I8OH 2QEJA 4QTIH 1LEIB 3OGCB 1N6QH 1INDL 3HG1A 4GKSA 5FA4A 3FFCA 4N5EC 3G04B 1DUYB 2RQ8A 3GBLA 2Z31C 3MCLH 1AHWC 5AD0A 1FL6A 1IEAA 1OW0A 3KPTA 4Y89A 5KSVA 4OQTH 5FOBA 3MACH 3A6CH 2ILLA 1A9BA 4GRWE 1N64L 4ZYKA 1F3DJ 4FS0A 1CFQB 4QYOA 2FIRT 3FOLA 1FBIL 4D0CA 3X13B 3S4SB 3RKPA 3RL2A 3E2HC 4H20H 4KTEL 5ELIA 2F54A 3SCMA 1TPXC 2HTKD 4M8QB 3UAJC 5LBSH 1NAKH 2AK1L 1FV1A 3VFGH 2NMSA 2NY1D 3QFJB 3B5GA 4NQCD 1X5ZA 2AK4D 4BKLB 5ICXA 3T65B 5J57B 4ZXBA 3HC3L 3SDAA 5I73B 2I60H 5E2VH 1KF9B 4Q74A 3STLA 3MPCA 1OLZA 1QFOA 2CDGB 4JFOB 5T3XD 4ONHB 3VFRB 3DVNA 1X7QA 4JVUA 3RWCA 5BJTA 5F89A 1A1MA 3BKML 1DVFD 3RL1A 4JFDA 2OP4H 2XXMB 3NA9H 2VLKE 3UYOD 1KPVA 1TXKA 1U8MA 1KT2A 3FN0L 4GRWB 3CPLA 5IOPB 1PZUB 4AEFA 4NKQB 1NFKA 1RFDH 2NZ9C 3REVB 4S2SA 4OLZH 4LLDB 2FJGB 4X4XA 2W0KA 4PGCB 2WV3A 2CDEB 5LWYH 5L6YL 5IG7A 4BUHA 4XCCH 1VHPA 2Q8BL 3TC9A 4HQQH 4IBLT 2NX5E 3V5HB 4WHCA 1VFBA 3X17A 2YD1A 4Z7UF 5JORB 3MLZH 5H35B 1UB5B 4XMPH 3U7AA 2HH0H 3I02A 4WUUE 4NFCA 3VD5A 1EX0A 3BP5B 4XBGB 1U2CA 3LMJL 4YBQC 5D2NA 4GAGL 1XGQB 1IGFH 1JN6B 1JUFA 5C0DA 3TZVD 5L2KD 4M5YH 3O4OC 2QTEA 5BQ7B 1T03L 1YMMD 3KWWB 4OI8A 2H45A 2BVQA 2HT3D 1FNLA 4I0PD 3VFUB 1S5HB 1NFDE 1S9WB 2DDQH 2VLKB 3DECA 2NY0D 4Z7WE 4UV4L 3GO1H 5IFAL 3GKWL 4FQXA 5DJ0B 2ZG2A 4HFWA 5B38B 1AD0A 4KK6C 3SDCA 1F58H 2W59A 5AAWA 2ZCKH 4M1GH 3IRPX 2NX5B 3KYNB 2I25N 3GGWB 2HWZH 1LO3L 4WUUB 3DETD 3T0EC 1MCEA 5E99H 4XNMB 5KVDH 3NTCL 4LLUA 1QVOB 3EFFB 1A4KB 1AI1H 5DEFB 2ZCLL 2XNAB 5GXBB 4GW5B 2VDQH 3OKDA 2HMIC 1RQ5A 4XX1E 3HE6D 2CLVB 5DK2B 5FA3B 1W72L 4H26A 3D69A 3SDXA 4ZSOA 5IVZB 2HFGL 3TA3A 1NFDB 1QBLH 1L9MA 4LAJH 4MA7L 4Z7WB 5DMGC 3LRSB 1NBZB 2APXA 4P23D 4U1MA 2DMKA 1EXUB 4PB9H 3MOAL 1Q9OA 3VXNB 3EUUA 1KB5A 1N0XL 1OD7A 4GJTB 1U8NA 1P5UA 2FX9H 3VGHA 5CZXC 2YMXL 1HCFX 4LDEB 5DHXB 4K3EL 2ATPB 1OVZA 5TDOB 3EO1A 4MQTB 3JWOC 2B2XL 4KMQA 3HZKA 4RWHA 1YEKH 5IB1A 4CKVX 1S7SB 5JW4N 5JIPA 1OSZA 2YPVH 3H8NA 4BH8B 1D6VL 5EUKA 4U33A 4W4OA 5SX5H 3VXQA 5I30L 3V6FA 5T3ZL 4LCCB 4D94A 4FZ8H 4ZUVA 3TV3L 4UQ2B 1JHLL 3B9KB 3QQ3B 3UO1H 4Y4FB 5F96H 1A7NL 2ARJB 5L2JA 4HK0A 4P57B 5JNYB 1MNUH 4L3CA 1PLGH 1T7YA 3QNYA 1RZ7H 3SBWC 2P8MB 5IT2H 1I85A 3VWKB 4U6VL 4LHUD 2EKSA 1J0IA 4IMKA 5HHOD 2I07B 3JVGC 5IR1A 4GSDL 4KC3B 4X5LA 4MCYB 4S1RH 1PZ5B 3QDJE 4J3VA 4XP6H 4TSCH 4A6YH 4LVNB 1F00I 3W5MA 1AXTL 1P9MC 4X6FB 1FSKC 2XZZA 5FF6B 1MCKA 3HNTL 5HVHB 1UWXK 1N5AB 1AR2A 1XF2A 5DXWA 3IGAA 3ABZA 4NFDA 1REIA 4NQCA 3X14B 5C0GB 1KLGA 1BBJB 1YC8A 2AK4A 1GGUA 1MLCA 3DI2B 25C8L 5E9DA 1MH5B 4FQLH 4H5SB 1S7RA 2Q87A 2VXTH 1U92B 2G5BA 1ZXQA 3LN5A 3LCYA 1DSFL 2JJTA 2J6EA 2CK0L 4I1NB 3SPVB 3BKCL 3IDJA 1LQSR 3VXMD 2OTPA 3CK0L 3RVUC 1FO0A 4ELKB 3KPQA 4X4YB 4TSBL 1S78C 4O2FB 3HC3H 5C07D 1IAKB 1UH3A 2R29L 4OZ4B 2J8UA 3QDJB 4TPRH 1UM6H 1IFHL 4IOSD 4X9BA 3DUHA 3REWB 2XWTB 2NYYD 2NY6D 3MLRH 2RB8A 3H3BC 3MOBL 1J0HA 1W0VA 4HUXB 3BD4A 1ND0A 3UBXI 1T7WA 1ZVSA 3OAYK 5FCUL 1H3UA 1MJUL 4XB7A 1C12B 3BKMH 3D39A 4YDKL 1JI1A 4MHHG 1C5BL 5HHQA 4HGMA 3BDXA 3S98A 5IW6B 1KLUB 5CSZA 1H0DB 2Y36H 1JYWA 1MRFL 1F4YH 2X1OA 5KSBA 4M7LH 4LLYB 4GAJH 3NFPB 4PGZA 3BN9C 4MQSB 4MJ4A 4ZUTA 2P5ED 1N5YL 1N4XL 2WWMD 3HR6A 2P5WE 5HXMA 3BW9A 5TDPA 3RVXC 4PJGE 1J10A 3OWEA 5L6YH 1N0LA 4GW1B 2Q8BH 4JANA 4F57L 1NBYB 3LKNB 5HVGB 5KBNC 3MREA 1Q9LB 1VACB 1FLRL 4H25A 4YE4L 1FDLH 4WU5A 1A02N 3MRIB 4N9OB 1FVEA 1BGXL 5DD1L 1MREH 4L8CA 3GDBA 3RU8L 4NJ9L 1T04A 4RQQB 2PUQT 1OGTB 1WBYA 4I9WE 2XZCL 2ZOLA 1U8QB 4NT6A 4N9GB 4UAOC 5F1NA 2GCYB 3TIDA 2NNAA 3RGHA 4GW4B 4XRCA 5IFAH 5D93C 3GKWH 1JF6A 2AJXH 1BVLA 4OUUB 3U2SB 3CVHB 4JRYE 5IJVA 5IVXA 3DO3A 3QCTL 2P5WB 1CT8A 3N9GL 4DCQB 4F7PA 3TIEB 4J6RH 3T0ED 4PJGB 4RNRB 2B7DT 3QEQA 5JW5A 4S1SH 2R1YB 1S9KC 1OP5H 3WL9B 1WWBX 4RGMB 4JFZH 4PGJA 1F6LL 3HE6A 4OM1L 4PR5B 5BOPA 5C8JA 4R4NC 1LO3H 2Y7QB 5JIKA 1R5IB 3GHBH 1DEDA 3ZTJG 3OXRB 3J8F7 1U3HA 3NTCH 2IG2L 5CKGA 2UZIL 4LFHD 4OZGB 5DDHA 2A1WL 1IBGL 1EIBA 1WQVT 4OZGF 2HVKA 2QADC 3BPCB 4MA1C 4CADB 4P23A 2WBWB 3MO1A 4GRLB 1EEYA 4P5MA 1GXEA 3T4AA 2AKRA 5CJXA 5EU3A 4PJ7F 3LN4B 1W72H 3WUWB 1G7HA 1XMWA 3PWNA 2HFGH 3ZYJA 4KJPC 1MHEA 3S96B 4KZEL 5CZVH 2BSTA 1MI5E 2VLMD 4YHKH 1OAXL 1IGYB 1TDQA 4NO2B 2KUTA 3WE6B 3OKMA 4JRYB 5B39B 3FT4B 2H32H 4LMQI 4PV8B 1VENA 2FO4B 3QIUD 1N0XH 3QUKB 5JLZA 5FYLE 4LF3B 1P2CA 1YY8A 4X0KB 5D7JC 3PJSB 1MFEH 3O6KL 5JIHA 3GMMA 2IALB 3UBXA 4K3EH 2DLEA 1F2QA 2B2XH 1CVSC 2DI8A 2UUDK 1A7OH 1INQB 4YPGB 1GGTA 4XHQA 5ID1B 1FYHB 1LDPL 1D6VH 5DI8A 5JTWA 3GB7B 3MRCA 2WK2A 5I30H 5DWUL 3MLUL 2YA2A 4G8IB 4M7KH 2DQUH 2X41A 3TV3H 5HHOA 1YUHB 3BAEL 5CMAB 5C0FA 1ODAA 1KXQE 1DE4A 1G9NL 1T20A 3I9GH 4K9EL 1EFXB 2XG5A 4C56D 5C7XH 4NSKB 1MI5B 1V3LA 4PRHA 2X4SB 3H7LA 1ZANL 2Z31A 5B21A 1KEGH 1U8IA 1KG0A 3IU4L 4UDTB 4BFIB 4LASH 4JO3L 1BREA 3OMZA 2DYPD 3N1QC 3ESVF 3EDKA 3QUZB 4JRXE 4GSDH 5DRXB 1P84K 3UYPA 1W2KT 3L3GA 4LGRB 4Q9QL 2YPKB 3GBML 1IAIL 4JY4A 5B3JE 1QQDA 1BJ8A 4LEOA 4TTDD 4N0UE 3HNTH 4OZIF 1I9JH 3QNXB 5ICZB 2CQVA 1WCBA 1DUZA 1TVHA 4RMSA 2C3GA 4O58H 2R23B 5CINL 1E4WL 4XHJD 3MYJA 5GS0C 2E7MA 3VXMA 5FHAH 1NGQL 4J3OC 4Y4HC 5I17B 1C16A 5GZND 2RFXB 25C8H 1NC4A 4OJFL 2X70B 3FONB 1GZQA 5LVEA 5AWNH 4YHNB 1MFCL 3VXUD 1KIUA 4X7TA 5BRZD 2BRQA 4LARL 4JDVB 3BKCH 5FKAB 4MD5B 3E8UH 3CK0H 1E4XI 4X6DA 1SMOA 4YHZL 2C7UA 4TSBH 5T1KD 1QSFE 4JRXB 1AE6L 3ZDXF 3BPOB 5D2LE 4G7VL 2R29H 4NQEE 4ETQB 1HE7A 4WO4D 4JY6A 1IFHH 1CFNB 3FO0L 4N0UB 3WNPA 5DLMH 4GUPB 3DX6B 2PXYC 2P5EA 5EOTA 3PGCA 1NUFA 1IGJB 4QY8A 3W2DL 2Q76B 4S11A 1U8OB 3BN9D 1C5BH 2DQCL 2R1WB 5J1AB 2D31A 2FB4H 5EN2B 1NANH 3WS6C 1MRFH 1CG9B 1P7KA 1ZWIA 4KK5D 4DFHA 2NR6C 3AREC 1JZ2A 5C0CD 4C55A 1CZ8L 3MRRB 5J56B 3OKNB 4P4RB 2BNQA 1JGUH 3G6AB 4HXAL 2X10A 2VO5A 3EOBB 3W11C 3DVGA 2VLRE 4M03A 3GSNH 2AEQH 2IPUK 2WINB 1QSFB 1LILA 2IH1A 4NRZB 5J6HB 5D1QB 1A7RH 2FBJL 5D2LB 5DJ6A 4PY7A 1U3YA 3GMPB 4NQEB 5F72S 1UZ8B 3ULUC 2HG5A 3DLQR 3FB8A 4JCLA 1PEWA 4CMMA 1NC2B 5T1LA 4NJ9H 5C2BL 2CLZB 2GJZB 3QUYB 4UDUB 3HMXA 3T0EA 3Q6FA 2XZCH 4JZJB 3PGDB 4F33B 2JB6B 3PWUB 1H9VA 3EGSA 4MNQA 4TUOB 5I76B 5D7LE 1FVCB 3HA0A 5ERWA 4NQDD 1QRNA 2NLJA 2VIRA 4PJBE 4WIQA 1I3GL 1XF4A 3QCTH 3TYGL 4GG6A 1CD1A 1NUNB 1HEZA 3O3BB 4X4ZA 3BO8B 1JZ8A 1NGPL 4RMRA 4K3JH 5HHME 2QADD 2VLRB 4OM1H 4CW1A 1ZT1A 1KTLB 1TTGA 2E8YA 4G9DA 4KK9D 1YNKH 2DTSA 1BIHA 2O5ZL 2IG2H 1AD9B 3HI5L 1PFCA 1E27B 2A1WH 3SO3C 5CGYD 3S3PA 4OLYL 2R56H 12E8L 1KTKE 4KKBD 3L5WA 4HKXA 3MV7D 5HHNA 1A1NB 3VRIA 3I85A 2NXZC 1KEML 3GSWB 1NGWA 5BV7H 1NGZA 1RJCA 3PXHA 4Z7NF 3O2WH 4O4YL 5IF0B 2VXVL 4R3SB 4HV8B 1JTPA 4HXBL 3DV6B 3EDDA 3VGAC 3HUJA 3FB6B 5D7LB 3PDDA 1OAXH 3TBTB 1PG7W 4Q0XH 4PJBB 1VFAB 4OQ1A 5JA8B 2R2HB 5KSAC 4LBEA 4OGXL 3QWOA 3WD5L 2HFEB 5F6IC 4K8RL 3EYFA 4KI5D 4QHNB 3G6JF 1QFWL 1B0GB 4Y8DC 3WLWC 5GS0H 3HB3D 3VXPB 5EZLB 5HHMB 1FZOA 3O6KH 1EAJA 1M6OA 1Z9SA 2H9GB 3FMGH 3G9AB 1P1ZA 2R0WH 3JVGA 1TQBB 4QOKA 3DVFA 4XNXH 5EWIL 5DWUH 3MLUH 1BD2B 5E8NA 1MHPL 4YO0B 3F6IA 1ZGLA 1ZHLB 2Y07H 3D48R 4MZ2A 2YEZA 3ZE2F 4XP5L 1NANI 1P9MA 4LVOC 4PJEE 3JWNC 5F1KC 2H32A 3S34L 3X12B 1XEDA 3P3YA 4K9EH 5KG9B 2JE8A 3MLYL 3C09C 4EI6A 1SEBA 3QDGD 5JW4Q 1ZANH 4HIJA 1EH9A 3FN3A 1NCNA 5F1SA 1XGRB 4Q9BA 5CJ5A 3LPGA 4OCRL 4OSUL 3OB0K 4XAWH 5TDNA 3FO1B 5E8OB 4JO3H 1AIFA 4YDLB 3T1FA 3E6FA 5DURD 4EVNB 1OAKH 5IHUL 5JXEC 3RDTB 5TQ0H 3ZT6A 2AEPL 1CN4A 2UY6A 4P2QA 1A3RL 4X98B 4O2CA 1MAML 4Q6YA 1KTDB 1HHJA 1P4IH 1MOEA 2YZ8A 4CN6A 3GBMH 3BEWB 1MCCA 1IAIH 4EUPG 1F11B 4XP1H 4GKNB 1V5JA 1X44A 5GS0D 3RIFF 3I6GB 5HYJD 3VXUA 5E5UB 3V5KB 4YHYC 2WUBL 3EOTH 4H0GA 3VI4F 4R96A 2OZ4H 3BH8B 4MX7A 4OZHE 5HDBF 3WKMH 1YEJL 4IHOB 1E4WH 4HKBB 2V9TA 4ZFOB 2VZUA 4P2CG 1WIPA 1CDIA 15C8H 4FQCL 3ALXA 4WFGD 3OZ9L 4X5XB 3A0OA 3IFOB 1F4AA 4OJFH 4P9HL 3GJFA 4PJEB 4L3ED 5GGTA 1MFCH 3DBXA 1OCWL 2CIKB 4KJQD 5ESAA 1LD9A 4ISVA 1HCVA 5JPNA 4LARH 4LAQH 1Q8MA 4ERSL 2QQKL 3HAEB 3MRQB 5HYSA 3ULSB 3H3PL 3P4MB 3IXAA 3QO0B 4JZNA 2EC8A 4P48A 3FFDB 2PXYD 2DKUA 5ENWB 3O9WC 4LKXB 3ZKXC 2Y06H 2UY7A 4OD2B 2F53A 3T77B 4G7VH 3PWVA 1JHTA 2GJJA 2ZUWA 5GSRA 4UT7L 2B0SL 3QYCA 4GKOA 4NUGH 4M4PA 4XCNB 4FG6C 4M61A 1VSCA 2ZSVB 2EECA 1I7UA 5L7XL 5GIRB 1UACH 2ZG3A 1DFBL 3W2DH 4OZHB 5DD6B 1NGXB 2FLRT 2PW2A 3QRFM 1MCIA 4NO3A 2F5BL 1KCUL 5DZOA 3BP6A 4NKMB 2ADGB 2P7TB 3ZSSA 3VRLF 3U30B 3GSOA 3CH8A 3U0TA 4KXZI 2YPLE 2V7NB 5I8KL 2CLRB 4I77H 2C3WA 2IEPA 5CJ8A 4X9IA 3FOMA 4JFEE 1GGIL 1L6ZA 1I7TB 4HXAH 4LP5A 3C08H 4D0BB 3RY5A 4NRXA 2APBA 4K55A 5IMOA 4JFFE 4RIRB 5GGSA 3RIAF 2H6PA 3NIFF 2FBJH 1I1FA 3S7GA 3VGDA 1PEZA 3VXOB 3TO4B 2ICWI 5D1XC 5EO9A 2NY2C 3BVNA 1KJMA 3R4DA 2VWEC 2Y1VA 1UZ6E 4X99A 5HY9A 5FB8A 2HP4A 2YUZA 4RDQF 5I1CH 4P4KB 1T1WA 4PRBB 4YC2B 2A9ML 4UI2A 5E1AB 1PY4A 4Z77A 3B3IB 1K2DA 1MCLA 4XXCC 3ZHLA 3IDMA 3DMMC 5IBUG 2YPLB 1S7UA 5BXFB 2OQJB 3DX7B 2BNUB 4PS4H 3V7AE 3GSNA 3W9DA 1I3GH 1MCBA 1UKQA 1A6ZB 4JFEB 3TYGH 5GRZA 4AG4L 1A6UL 4JFFB 4ENEC 3BD3A 3KJ4B 1CFSA 1UQSA 3N0PB 3ETBF 2O5ZH 2YD4A 1NAMB 3RVTC 1I8IB 5I75C 5E6IB 4D3CL 3QCVL 3ZTJH 4X8JA 2E6PA 1BF8A 5EO0B 5D6CA 3OR7B 2BC4A 5A2LH 2PN5A 1JMXA 2F5AH 5D7JA 4DJMA 4UIMA 1JGDA 3MRFB 3GFUA 4JDZB 4O4YH 1LP9A 3N1FC 4UUJA 5K9JL 2YS4A 4HXBH 4X6BB 4WTZG 5JOEA 1QLFA 2YZ1A 3WN5B 5FO8B 4YK4C 5DYOA 4ZTOL 1NDGA 3R0NA 3JTSB 5TFSH 1T1ZA 2DQHL 4RMTA 4J3SA 4OGXH 4NKOA 3AY4C 1EK3A 2AQ1A 4Y4KB 5IVOA 4NCC2 2GSGA 3SGJC 3V4UL 3BPNC 3FCTA 2R4SH 3KXFA 4KMTL 2X4RB 5I1KL 4WW2B 1D5MB 3HI6L 2XV6B 3F12B 4NO0A 1EV2E 5KSUB 3CGTA 1U42A 4MB3A 2DM4A 1V8HA 2MPAH 3QDGA 1AGDA 1B0RA 1LO0L 2P8PA 3PDGA 3DUUA 1S5IH 2VYRE 4OIBA 2AJYL 3C5SA 3VI3F 2EXYC 1F90H 4Z7VF 5MENA 2NY3B 4LSUL 3S34H 1QR1A 4NHUA 2KH2B 4EQ3A 1UM5L 2BHYA 4WWKD 5DHVB 1UWEL 4U6HA 3K2UL 4WTWA 4NYLB 3GMOB 5C0IB 2ERJC 1FPTL 4OCXL 1T89C 4LPUA 1XIWD 1Z0NA 1R3LA 4LRNH 4OSUH 2NY5C 4Y4HA 3T2NL 1AGFB 1ETZA 1GZPB 5IHUH 5I8EB 2AEPH 1E28B 2ICWA 2EYRA 4F15B 1A3RH 3ARDC 3ARBC 3ALPA 4P2OC 3C5ZB 3CFEA 3VDAA 5GPRA 2X1QA 4DVRL 1NLDL 4LPXA 3BOVA 1J8KA 3QXAA 2WUBH 2G9HB 4C4KT 3JSSA 4XC3L 2JCCF 4FFYL 4BFBD 2D4FA 5MEQA 3JUYA 4GLRH 2F8XC 4Z7OE 3CUPA 1GH7A 2OJEA 2GK0B 1XR9B 4FQCH 3JV6B 4JFXA 4Y5YB 2EDOA 3DURA 3OZ9H 2EH8H 3BGFB 3H6JA 4LCWA 4P9HH 2MQ3A 1JGVL 2PXYA 1CLOL 3VFNA 4CBPA 1RUPL 1T83C 4J23A 4K23L 1A5FL 1X5KA 4Y2OA 5CP3A 1I1AC 3TBYA 1OCWH 3QIBB 4NN6C 3G5VA 3UXFA 1X5YA 3PHQA 1D5XA 1N6VA 3KYMB 1T4KA 3O9WD 3RVWC 4ERSH 2PTTA 1HXYB 3ES6B 2QQKH 3CJJA 2HLFD 3H3PH 3PGFL 4M4RA 3GJEA 1Q1JL 4TQEL 1MCOL 1HHKA 4TVPE 4I4WA 1KJ3H 1OAQH 3AREA 4L8BB 4CVUA 3DSNA 1ZS8B 2B4CC 2AJSL 1DBML 1FL5A 2B0SH 5DFTA 2OZ4A 3TPUA 3MJ7A 4PRNB 3WDIA 2BSSA 4BQCA 5ID0A 1IL1B 2O5XL 2HJKB 3BJ91 4OKVB 4R4FL 5CD5D 4Y2DB 3ARUA 2DOCA 1YMHB 1QG3A 1OAYL 2Z8WC 2DKSA 1WC7A 2VDLL 1KCUH 1NBVL 1UB6B 1IEHA 3WLBB 1KCRL 4JM2B 5JO5B 1TZHA 3RWFA 2G5RA 4M1CD 3P9LA 2UWEF 3L7EB 1LE5A 3ZO0A 5E2WL 3MLTA 3MROB 4KRPC 4WFHD 3VXRE 2N56A 4QRRD 3FQTB 3S5LG 1DBJL 4LQFL 2PYFA 1J05A 2Q86B 1HOCB 1J9CT 4XMKL 3LRHA 3MJGX 3WIIH 4Y16B 2NY2D 3SKOA 2YRZA 4LSQL 4K7PL 4BSJA 4ZS7L 2IGFH 4I18C 3U4EA 2PO6C 2XY1A 1MJJB 4KH2A 4JAMA 2IH3B 1Z5LA 4IOIB 1P6AB 3ULVF 5BVJB 1FJ1A 4LLQA 4JPVL 4MA3A 5FYJU 3DMMD 2J1KA 1BQLH 5E70A 1JNHB 4X6EA 4V1DE 1RZKC 3ZDZF 4KKLC 4NQTA 1OSPL 3UJTL 5EOCJ 1MCHA 1CL7L 4ODHH 1UXSA 3JV4B 3BMVA 3VXRB 4L8SC 4KV5F 5KVEH 4ELMF 5JZ7D 1HQ4B 2FX8L 3CVHL 1JI2A 2HRLA 2WBKA 3BKYL 5FV2A 4M3KB 4QCIA 2VUOA 1U8LA 2IFFL 2Y5TB 3KLDA 3SE9L 1YEIL 4AG4H 5T1DL 3T4YB 2BVYA 3IKCB 5I18L 4CNIA 3QZWG 1MJ8L 2HFTA 4R4BB 4HUUB 4D3CH 3QCVH 5KSAA 2BCKA 1FYTA 2FGWH 3KPMB 4S0SD 2EKJA 5TQ2H 1BVKA 5ADOH 5DSCA 5KVFH 3CDGB 1ORQB 3PUCA 4PGEB 4PG2C 1KGCE 2GY7B 2W1NA 5K9JH 4GG8A 3NCEB 1E6JL 2NW2B 1AP2B 2C1OB 4Z6AT 1IAMA 2E7CA 1AKJD 2WIMA 4RZCB 1NFIA 4ZTOH 3OKYA 5CSGA 4HS3A 3TH4T 3DTXA 1F5WA 3BT2L 2DQHH 4N8CH 1RHHB 3S3SA 1OB1B 5DUBB 5J12C 2AJ3A 3QJFB 1KCLA 1TNMA 5GS1C 1J8HE 2CUMA 2XA8L 3IFPB 4R7NB 5EA0H 3WHXA 5JQ6L 5SWQA 2F19L 2XTJD 4KMTH 5F93C 4GMSL 4JZOB 1KN2H 4IOFD 4ZPTB 3U0WL 1JNLL 2EXYD 4IRJB 4LQ1A 4PJAF 1KCKA 5JXEA 1LO0H 4KK8D 3MV11 3WSQL 2W65B 3L3DA 3QI9C 4FXGB 2AJYH 3MRBB 3HG1E 3O4LA 4PJDB 3O3AA 5EO1B 3UTSD 4PJDF 2EXWC 4N8VG 2FR4A 4PG9A 2VISB 3RPIA 1E0OB 4PRDB 1UWEH 4IS6A 5DJXB 3WFCH 2EE2A 2Q8AL 4OCXH 4MNHB 3EYUL 4PV9B 3L5JA 4YDJA 3F7VB 4M6OL 2RBLA 2V5TA 5D9SA 2VN4A 4E9LA 1UJ3B 3TNMA 1QA9A 1J8HB 5C9JB 3E3QE 4N0FB 1A22B 2BOCA 1YPZF 5FYLL 1ZHNA 4OCMC 1T0MB 1MCQA 4DVRH 1FQ9C 1RK0B 4LIQE 5FO7B 1EUUA 4EUPH 3PDOB 3WBDA 3BYTA 4M00A 3HLAA 4EI5D 3P77B 4F3FA 4XC3H 3O9WA 4FFYH 1NCWL 1I1AD 1EBPA 3VWJC 3DO7A 4OTXL 3HG1B 1F42A 5FA4B 3OL2A 2V7HB 3BDBA 2A6DB 4AZ8A 1HXMA 1CLOH 3WIFA 3WHE1 5EC2B 1A5FH 2MKLC 5SWZE 4M48H 1FL6B 1ITBB 1IVLA 4DKAA 4B53A 5KSVB 3OKEA 3BEVA 2YWZA 1ES0B 2HKHL 2X7LB 1WZLA 1LK3L 3PGFH 1Q1JH 4OCYL 3SJVA 2Y23A 3DYMA 3RVVC 4F37K 3NACL 3MGTA 1A47A 5H8DA 5CJOL 2AJSH 3SKNA 1DBMH 4QRPA 3L6FA 1SJXA 3K7UA 5ALCL 4P3WA 4OFVA 4HEME 3LEXA 3QDME 2O5XH 4OF6A 2H8PA 1SJHA 2V2TA 1IGIL 1O5DT 2OTWB 3K1DA 4QRRA 1EHXA 3AU1A 4BA8A 1OAYH 4S1DD 3STLB 2VDLH 4NJAH 4PRPE 3IDGA 3DVNB 3ZKQD 5D1XA 1KCRH 3H7BA 2AV7A 3O3DB 3RWCB 5BJTB 4GRMB 5I6XB 1EUTA 1FH5L 5E2WH 5SWZB 4D2NA 4XMLL 3WUZA 4R0LC 3RTQB 2BVEA 1ZEAL 1X5IA 3EAKA 1DBJH 1UH4A 3B2VL 3D9AH 2P49B 2VXSL 4BJLA 1U8MB 5I1IL 3FRUA 1MJ7L 2AQ2A 4UOJA 5JR1L 1J7VR 5DJ2A 43CAB 4XXCA 3DMMA 1GPOL 4K7PH 4POYA 1DN0B 2HJFA 4P49A 4ZS7H 3F58L 3I6LD 3IJHB 3UTTE 1ZTXH 4W81A 4RX4D 4IRSC 3QDMB 4CMHC 5CEZL 4JPVH 3NH7H 3ZZ1A 3DUSA 3MV8E 2A73B 3OR6A 5KZCB 3EO0B 5I1AA 1JUFB 3X3FL 4LDOB 1EAPB 3PHOA 4PRPB 3EYOA 5I15H 4BSWB 3LHPL 2V5MA 1N8ZB 3RWGA 2XN9E 1OSPH 3P30H 3UJTH 1CL7H 4NC1C 2VJXA 3JBG7 3K4DA 2AXGB 4Z7UA 1DP0A 7FABL 2FX8H 3EJJX 2IFFH 1TZGL 1KJ2H 4JG0L 1YEIH 4LHQB 3OXSB 5L88L 3H9HB 4EOWH 2XZQL 5I18H 1RVFL 1MJ8H 4OD3L 3RHWF 1AD0B 4AEHH 4OV5A 3UEZA 1CIDA 3UTTB 1CDJA 3MV9A 2Z35B 5BZDA 3JTTB 3C6SA 5HI4D 4ODXB 4FNLL 4ZUWA 5C86A 5INDA 2NW3A 4FQHA 3TCLB 4AMKH 1OAUL 5JHLH 2R39A 1EJOL 4LSPH 5BZWB 3SGJA 1CI5A 3O6FD 2UYLA 2FYYA 1YN7A 1Q9KB 1PDKA 4MMXC 3IJSA 3MV8B 3IXTA 4JFHD 3RP1A 4JY5L 2FO1A 1RMFL 3CC5B 3N1MC 4P5TD 4PGDA 3ARZA 3QUMB 3ZDYE 5BOZG 2E6QA 1JGLL 5DEZA 2D03H 1AY1H 2XN9B 1X5GA 4MLSA 4ZFGL 3C6LB 5I2IA 4R97C 2F8OA 2ED7A 4OLXH 4GKZA 4JRWA 1U93A 3D69B 3GRWA 4P3CL 3SDXF 4P46D 1OGAA 4YDIH 3U4BL 1OWWA 2J4WH 4G8FB 3ARXA 4XCYB 1U36A 2L4OA 2UVEA 2P45B 3KPRD 1BJMA 5ADPL 5C6PB 2NCMA 1RZJL 2YN3A 4GMSH 2A74A 3S6CA 1T89A 2XKNB 1KB5B 3U6RA 2Z8RA 3RGVD 4NKIH 4QHMA 3RWEA 4WI5A 2IAND 3U0WH 2JJWA 1JNLH 3NMEA 5CUSH 3MBED 5KANG 3BRGC 1FL3A 2K3TA 4X6CE 5EU5A 5ISZD 3O3UN 5E4EB 3WSQH 5A1AA 3ARDA 1VKXA 2BHZA 3ARBA 1WV7T 3EO1B 1S7QB 1I7ZB 2G75A 2W92A 4P2OA 4KAQL 4WENB 4BELD 3UTZA 3ARFC 4RA0C 5K9KB 5EBWA 5EOQH 4N0YH 1OSZB 2IF7A 5GRXG 43C9B 5EUKB 2D7PA 1BQHA 3V6FB 1G6RA 4TTGA 2HFFB 2AK4E 4OBRA 4ODTL 2YBRB 3BZFA 3HN3A 1LO5A 3GKZA 3CLEL 4HK0B 3TPKA 4JFQA 1T83A 1I1AA 3QNYB 4KWUA 4RBPK 4N0CC 2SEBA 1ZHKB 4DZ8A 3DRQA 2GT9B 1G7PA 4P2RD 2EKSB 4OFYD 5F21B 3VWJD 4HC1L 1J0JA 2WBJC 5ALBH 2IMMA 3PWJB 4TNWK 3ZTNL 1NCWH 4LSRH 2WM0A 4OTXH 1JYXA 5EIIA 1IAIM 3H42H 1E4JA 5DK3A 5DD0H 3L7FB 2LE9A 2IAMC 4JN2B 2NY1B 1D6EB 1MLBA 3PV7A 3RVVD 1KLGB 4UQ3B 2AK4B 3CFBB 2H2PD 1MLCB 3AXLB 4PJ8D 4K7PX 3VCLA 5E2JA 4HJGB 5EPMB 1LEGB 5EC1B 3QG7H 4YXKL 4HH9A 1OF2A 3LN5B 4OCYH 4U6YA 1OTUC 3A6OA 1IEBB 2J88L 5INCB 3NACH 3DGCR 4XGZA 1ZLSL 3IDJB 3LKSA 5CJOH 5L2KE 5TE6H 1KB9K 5D7IA 2C4FT 1FO0B 1J1XH 3KPQB 4IEFB 1YMME 2X4NB 4HF5H 1DVFB 5I1JH 1IGIH 4HPYH 3U7WL 3K46A 3CCHA 3GSQB 4HWBA 3OPZL 2J8UF 1YECL 4I18A 4O5LL 4OLWH 1RAMA 1ONQA 2IQAB 3BQUD 5D72L 1W0VB 3OHXB 5C0BD 4WCYL 4HMDA 4M43H 4DZBA 1MELA 3LY6A 1RU9L 1FH5H 4YH6A 4XMLH 2ORBH 4Y5XA 1DDHA 2V9QA 1RIVL 3DWTA 2D9QB 4JPIB 1ZEAH 1K5NA 5HJ3A 3LKRB 4QHLB 5FYJL 3O41A 2OSLA 3O2VL 5IEKB 4PRIA 1R5VA 4MDIB 4D8PA 2DQEH 1FZMB 4HZAA 1CICC 4M9PA 2FEEL 4RSVA 4AM0A 5KSBF 4L4TE 4ZUTB 4L8DA 3T0AA 4IRSD 5IVXE 1BAFH 3TZVB 4CU7A 3F58H 5L2KB 4L8SA 4JANB 4KKAD 4U1JA 4LVHB 1O7VA 1U41A 2CRMA 1PKOA 4OLVL 1YMMB 4YHPB 3MREB 4NC2B 3RZCC 3NZ8A 4HS6A 4FTVD 3EOAA 5JPMA 4UTAL 4I0PB 1JWSA 5J6GA 4LP4A 3FB7B 1H8NA 2V17H 2NY0B 4JVWA 2E5EA 3P9WB 2BMKB 1JZ6A 3VFMA 1EHAA 5JDSB 3TH2T 1B4RA 1W0WB 3LEYL 4HIEB 1XCTB 3K8LA 1U3JA 1A7PL 3PP3K 3AB0C 4NM4L 3NBNA 3MRGA 7FABH 4PG2A 4JPKL 1RUKL 4KHTH 3T2OA 4N68A 4ZS6D 3L1OH 1TZGH 2X40A 3BUYB 2F58H 4JG0H 2LQRA 4L4TB 4DW2H 5L88H 1MCJA 5IVXB 1RVFH 1CT8B 3BPLB 4AIXA 1N3NB 2YXMA 1SBSL 5ESVB 4KRNA 3RNKA 1QFUH 4FNLH 2KQNA 3LDBB 1XH3B 3TLRA 5L8JB 1G7QA 5CP7A 5CLTA 1BJ1H 5H2BA 2ZUQB 5IBLD 1T0PB 4P46A 2A2QT 4QNPF 1EEZB 4TNVK 4JY5H 5J1TC 2IFGA 4HUVA 5FO9A 1CR9H 4X9GA 1XCQB 4P23B 3W0WD 1JGLH 3KPRA 4G43A 4XTRC 1R3KA 1I1YB 4ZFGH 4P5MB 4Y19A 3KHOA 4UT9L 3DIFB 3AAZA 1KJ2A 3QI9A 4KQ3L 1NEUA 2IANA 3V52L 3RZWA 1JE6A 1CE1H 1M71A 5ISZA 5SWSD 2D0HA 4QRQA 4ORGA 3FQXA 1LK2A 4MQXC 4J4PD 5ADPH 5FXCH 1RUAL 3M17B 1RZJH 3BESR 1EGJH 1AQDA 5IB5B 3CSGA 5TF0A 1P53A 1I9RH 2ESVE 3VXSA 1NMAH 3VFOA 1UWXH 4EDXA 2XPGA 3NN8A 5HI5D 4UU9B 5C0ND 4BH7A 1QFWM 1YY9D 1CD8A 4KAQH 1J11A 2WAHA 4U1SA 4JO2L 1Q38A 2VLJE 4WTZA 1MCDA 2AVGA 4MAYD 3IDIB 1JHKH 1R3JA 2H26B 4LHUB 4HBCL 3IF1A 4R2GC 4OLUH 2FL5B 1CGSL 1OM3L 3MRMB 1S9YA 1PG7X 1I8LC 4ODTH 5HHOB 5AG8A 4N0CD 3VWJA 3VFTA 5C07E 3U46B 3CLFH 1IE5A 5J11C 2AQ3A 2D7TH 4L29B 1OPGL 4PTUA 3F5WB 4XVSL 5IM7B 5HPMA 4M6NH 3UX9B 5CKAA 5DUML 5C1MB 1T6WA 1HILB 3TN0D 2XICA 3LH2L 4ZFZA 3FT3B 2GITA 2ESVB 4HC1H 3O45A 4YFLI 1WBXB 3MJ8B 5KN5A 3L3GB 3IETB 3RJDA 5I66B 1KIPA 2W0FA 3ZTNH 4PJ8A 3Q2CA 1QQDB 4GO6B 4K8RC 3TCXA 4U1HB 4KMLB 1JPFA 1WAAE 2BRRL 3QXDA 2FWOB 4WI9A 2VLJB 2IPKA 1TVHB 1I3RB 2E9WA 2VZ1A 3VA6A 3P9MA 4LLVB 4DGIL 1D5BB 2RIKA 4L4VE 5C07B 3MUY1 1U3ZA 1CLYL 4Q58C 1X4ZA 1XGTB 2J88H 4X7TB 1FFNA 1EZVY 1OQOA 1OHQA 4IJ3B 5EBMB 3TVMD 4R0LA 2NY6B 3QBTB 4OZIA 1MHHB 1XR8B 3TYFA 3BJLA 4MQ7A 4X6DB 4A6YB 2DQIL 4OAWB 2GUOB 3SY0B 2ATKB 4X6DF 1EHNA 2Z4QA 1FNSH 4BUGA 1DEEA 5I0ZA 2V2XA 1MEXH 5TH2A 5ITFA 4ODSL 3EZ8A 3RX7A 3HNVH 1SJEB 4XBPA 1YYLH 5C08D 3MBXH 1R24B 3SQOL 3PGCB 4K94L 4WCYH 4IRSA 4JO4L 1JK8B 2R9HD 1RU9H 5SX4I 1U8HB 1TFHA 1QO3A 3UJIH 1RIVH 4ZUUA 4UB0L 3IDUA 3STZA 4QRSA 3B9AA 1P7KB 2WWKO 3F65A 5GGRA 4L4VB 4UOW1 4FTVA 4MD0B 3EBAA 5T33H 2M1KA 1CGVA 5HHVH 3IFLL 3NOIA 4PJFE 3F62A