4H26B

Tcr interaction with peptide mimics of nickel offers structure insight to nickel contact allergy
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
188
structure length
188
Chain Sequence
TRPRFLELLKSECHFFNGTERVRFLERYFHNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGQVDTYCRHNYGVVESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title T-cell receptor (TCR) interaction with peptides that mimic nickel offers insight into nickel contact allergy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 188
sequence length 188
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h26B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4h26B01
5L0QB 5IB5B 2CKNA 3MRLB 4X6FA 5KS9B 4AEIL 5GZOC 4LIQL 4APQB 1T1YB 1A9EA 3AB0C 2QADB 4NFCA 4HMEA 5TGBB 3W5NA 4AENA 4POZD 4PLOB 4X9IA 1AKJD 1MFBL 4XP1L 1MCBA 4OQTH 1EK3A 1AGCA 4XPBL 1AP2B 2F58L 1QSVA 2VN7A 3DMMB 2WWKT 1YN6B 1AJ7L 1U8HA 2G5RA 4MD0A 3S4SB 4F7CA 1FH5L 3O8XA 3AY4C 3GJFK 5CHNB 2VXVH 2XA8H 4YHPB 3T77B 1AC6A 1P84J 1FNEB 1IEHA 3TNMB 3MV8B 3BKCL 1O5DT 2JCCE 3MJGX 5I30L 3QG6A 3VFRB 3O4LD 1F11A 3U4BL 1BZQK 2NY4D 3NTCL 5CP3H 3CDCA 3QUMH 4MCZB 2BVOA 1CFSA 1QSEA 4HBCH 4XP4H 3ZSSA 2XRAL 3SGKC 1KJVA 3RY6C 5DMGD 3QIBC 4DGVL 5GPRA 3U1SL 2HJKB 5TDNA 2L0DA 4K3DL 4M7KH 3IXAA 5F9OH 4YXLH 2PTUA 3NAAL 5LGHH 3CDGA 3V5HB 3QEGL 4ESKA 1HHHA 5C9KA 4YEFA 2ICWI 4WO4D 2ZUTA 5C6TH 4R8WL 3SOBH 5M95B 1IKFH 1UZ6F 2BNRB 4ZS7H 4N8VB 4NP4H 4JFQB 1Q72L 1R3IL 2NY3C 3V6OA 1FORH 5E2TL 5E0QA 4FA8A 1TCRA 5EZIL 4PJAB 5FFLA 1Q9LB 4A2LA 4DGYH 3SQOH 5LG1A 4MJ2A 4NRXA 3BKYH 1PG7X 3EOAA 4HIXL 4OD3H 2DI8A 1YNTA 2IFFH 2KDGA 4GW5B 3BT2L 1J86A 4JRYE 1I1AA 3PWNB 3MLWH 4R9HA 3ARBC 4Q9RL 4F9LC 2JTDA 4LSVL 4NO2A 1WUNT 2VDMH 2R8SH 4JO3L 1XF3A 4XNUH 1HIMH 1DSFL 2VDKH 2VZ3A 4X7FC 1R3HA 2LVEA 1XEDA 3VWJC 4UV4L 1OLZA 4KKLD 4PJXE 1I1FB 3ARGC 4PJ9A 4JFHE 1NGYB 4PRHB 1BIHA 3TF7C 5E2UL 4YX2H 2YXFA 4RFNB 4GG6F 1X5GA 4JLRB 1UJTA 1LDPL 2NY0D 1JZ7A 3B6SB 3LPFA 4UAOB 4Z7OE 4F7MB 4JY6A 5EO9A 1KLUA 1OVZA 4O2FB 3QO0A 3UTQA 2HYMA 4PRPA 1T4KA 3EOBA 5HHOD 3S3PA 1GXEA 4UIKL 4F7EB 3LN9A 2XTJC 1RULL 2GUOA 1FCGA 3BQUA 2Q6WA 3FQRB 3WS3B 4ZPTB 1L7TL 3AROA 3VXMA 1OARL 5E8OB 4F57H 2IALB 3IKCA 1UYWH 5CEXB 2FNBA 4QOKB 1N26A 4WV1B 4L3EB 4BZ2H 1GZQA 4X8XA 1Q9OA 5GRJL 2DWDA 5JPMB 4M1CD 2CO7B 3VA6A 3T0WA 3B9DA 4NJAH 3SDAC 1TJHH 3ULVD 5KS9F 4JM2B 3C9NB 3MRNA 5T1DH 4NN5B 4YDLB 4KRPB 1K4CA 1KCKA 1VEOA 2NPLX 1ZLWK 4EI5D 1L7IH 4KMTL 1OP5H 1MRCH 3EAKA 2DYPB 2BVTA 5J1SC 1EO8L 5IOPA 3V2AR 1ZHBB 4PJBA 5CZXC 2SEBA 4IM8A 1BD2D 4I77L 5C1MB 2OM5A 2IH3B 2ZSWA 4MGXA 5JLZA 1IL1A 2NZ9D 3FO1B 3NFNA 1CG9B 5D7SL 2E27H 3FRPA 1FL5A 3BZFA 1WAAA 1RIUL 3DI2B 1EDQA 4HUXB 4NQVB 5JDSA 3BVNA 5A16A 3IDGB 2B2XH 3IDXL 1KTDB 2E9IA 3D39B 5JR1H 2V6HA 4MA7L 2BFVH 1IAOB 5GGVL 5IGXH 4G8GA 3MGAA 1U6AL 3FT2B 1IFHH 4NKDA 1FBIL 2R2BA 4J3UA 4XVTH 2GW5A 4FQHB 4IDJL 3QAZC 1E6JL 2FL5B 2OZ4H 2PR4H 4XMPH 3V0VA 4WCYH 3VXTA 4FFWD 4TSBL 3RHWF 4L4VA 4WWID 5T1KA 3STLA 3EFFA 1NCBL 5C8JB 4KQ4L 3RL1B 1HINL 1LO2L 4TVPE 4OZGE 5DEFB 4XX1G 1IE5A 3LZFH 1UVQB 3M17A 4YGAB 3AU1B 3TO2A 2CLZA 3LIZL 2H2PC 1G7JA 2OR7A 4PIRF 3UC0H 4K94L 3D85A 5DRWB 3T0EA 4HCRL 3UX9B 4MJIA 3G08B 1T83C 1WBYB 4G6AC 3KG5A 3U36B 3C2AH 1B2WH 4U1HB 3DVNA 4LCIL 4XX1E 4C55A 4PJ7E 2JJSC 5IBTL 1HN1A 3GJFB 3L3IB 4KMQA 1BX2A 4LL9A 4TULL 1KJ3L 1JNLH 2IAND 3DHMA 1IKNC 2PCPA 4WRLA 5SX5K 3QFJA 5KSUB 4WFFE 4HHAA 1OWWA 5C6PB 3DUHA 4FQ1L 3BP4A 5F96H 5DURD 3MJ8B 4K3JL 4NQDA 5AZEH 1ADQH 2EC8A 4LEXL 1S7UA 3MV9B 4HC1H 1KCRH 5EWIH 5DQDL 3NGBB 2XN9D 4J2XA 1N0XL 2DQEL 2J8HA 3GMMA 1DVFA 3LS4L 4R4BB 5ELIA 1FIGL 4U6XB 3TM6A 1VPOH 2KBGA 1LDSA 1ZLVK 2AJ3B 4OBRA 4EN3D 2C3VA 3PDOB 5KSBB 1T22A 4CGTA 2R1YB 3LB6C 4FXLA 2FZ3A 5EC1B 4R0LA 2Y07L 3CH1A 3MRFB 4Y1AB 2CRIA 4YHNA 2WANA 4NJ9H 5J3HD 1J1PL 4FFVC 1DDHA 4LSRL 3ROOB 3QUXD 1PFCA 2H2SC 5AG9A 2HVKA 3MZGB 2CK0L 4F7TB 3O45B 1RZ7H 1K8IA 4XCCL 1YMMB 2WLYA 3KPSA 2BP3A 3WUWB 5F97E 2EE9A 3EOTH 3F7RA 4F37F 2ERJB 3BDYH 4G9FA 5KAQF 4HUVA 3ES6B 4RWYL 5K59F 4X7TA 4JHAL 2AV1B 1Y0LA 1FO0B 3H0TA 4PLKC 5T1LA 3IXTB 5ALCH 2G9HA 4O9HH 3FT3A 2GAZB 2BNQB 1ZVSA 4YPGB 4XC1L 1T1ZA 5D6DC 4JM2F 1TZHA 3DPBA 1UACH 3OBAA 3T4YA 3NACL 1CDCA 3T4AB 5EU7C 4MHHI 5MP6L 5T33L 4OTXL 3AM8A 3HZYA 3JTSA 4LRIA 2QSCL 3FCTA 4G8IA 5LWYL 4P3CL 5IHZB 1FNSL 8CGTA 4H8WL 1MSPA 4RSVA 1KB5L 4X7SL 1P9MC 4WWKD 5H2BA 5C09E 4ZUVA 3C60A 3K2UH 3LEYH 1H8OA 4RGND 3FB7B 2GK2A 4I48B 4S1QL 1JWUB 3CFCH 4WEMB 4HK0B 4YUEL 5BRZD 2D7MA 1XZ0B 2ADJB 1A4KA 4IIQA 4BSWA 2AJSL 4M4RA 4ODUB 3WEXA 4NHUA 1YPZB 5IB3B 1X5XA 4FS0A 3VFOA 5CD3A 1X5ZA 3CC5B 3WHXA 4JN1H 5I15H 4X7EC 1S8DA 2IEPA 5EU4A 1OGAE 4DJMA 3Q3GA 4M3JA 3V6FA 4FMFA 1RZ8A 4XP6H 1KT2B 4UQ2B 3RKDD 2W1NA 1UEMA 2DL9A 3OTTA 3FO9B 4WUUE 3O2VL 1PZUB 2P24B 1F6FB 2EH7H 1EGJL 3QDGD 3U7WL 5JDJA 2X4UA 2AGJH 2R23B 4DKFH 1SVZA 4I5BB 2APBA 2F5BL 3O81A 4V1DA 4EUPG 1OAYH 3B5HA 4JN2A 3RA7H 4A6YA 3WFEH 1KNOB 2E9BA 1LVEA 2G2RB 1J8HD 4Z76B 4X9BA 2JJVA 5F88B 1U8JB 3MCLL 2EDYA 2GCYA 2F9BT 1QFUH 1QR4A 3TVMC 1JF5A 5EDXA 1EZVX 3JWDH 1BQLH 1D9KB 4E42A 3K46A 4HGKC 4L3AA 1A4JA 4GBXD 1DN0B 2B4CH 3MC0A 3ILPA 1DBJL 2OTPA 4S1DC 2DL2A 4XTRC 1MVUA 4ELMF 1H3PH 5BO1L 3TH2T 1F3JB 4E5XA 4M1DL 5FF6A 2NQCA 3FTGB 4LCWA 5HYEA 5GRXG 1C7SA 2IFGA 3E1F1 3REVB 1JPSL 4LSTL 3PL6D 5MEOB 5KSBF 1A14L 2PF6A 4M5ZL 2A83B 2ILLA 2MPAL 1H0DB 1W8OA 4KK9D 1OAZL 3DUSB 5DD1L 3QUZC 4G3YL 3MRBA 2ITCB 3DRQA 4Z7VB 3TESA 4PYGA 4BZ1L 2PO6D 3X3FH 4POYA 4OI8A 4AM0A 4HUKB 2AJVH 3HNVH 3PGDA 4JKPL 2V2TB 3B2VL 3O3DB 4RGMB 4LVNB 3TBVB 4TTGA 1MJJA 5FXCH 3HE6C 3HPJB 2BNUA 3GSUB 4LBEB 1BPVA 4PRIA 1HHJB 1JPGA 2ADFL 2XNAA 4L8CB 5D9SA 4DW2H 3ARWA 5EBLB 4YE4L 3SDDA 3G9AB 1J05A 3PABA 2BY3A 4LNRB 3O9WC 2AJXH 1LE5B 3EYQD 1RAMA 2ICWB 4U1KA 3SKUD 4ODHH 2ICEA 4HWBL 3QA3A 2Y5TB 3IDMA 3WBDA 3PWVB 5KSAB 1R3KB 3G6JB 3EOYG 4UTAH 1TETL 3A6BH 1D5IL 1KPUA 3B5GA 4K7PX 4KZDL 4YHIB 1YEKL 3T3MF 5D72H 3L5XL 4L5FL 2NY6C 2O5XH 4PJDB 1YNKL 4NQCA 1PKQA 2E7HA 5TDPB 1NMAL 4IOIA 4NHCL 1IC5L 4LCCA 3QIUA 3RUGB 4UT7H 3LKNA 5TQ0H 1IARB 4Q0XH 1I7TB 2OI9B 5I1KL 2CLVA 4U2YA 4Z78A 2W65B 4HKJA 2CDGA 5D7IA 1CFTA 2VO5A 2A73A 4CVZA 1S9VA 5SWSE 5JOPD 4YBHA 3RTQB 5KTEH 2ZJSH 4O5LL 4U3XA 3ZHLA 5MEPA 3TT3H 2A9NH 4RFEA 5BS0E 3CFBB 1BBJA 4WUKH 5E9DE 3ZKMD 5DK3A 5L8KB 2D0FA 5IMLA 2F54E 4R97B 5L2KB 4YNYA 2DIBA 2HFTA 2AS5M 5C0CD 1AGFA 5CCKL 3MRQB 5AZ2H 3WXWL 3BEWB 4YLQT 2Q7NA 5GGTA 2HJLA 1MI5A 1EFXA 3CSYA 1HNGA 2QKIA 4UV7H 5DGQA 3T1WA 3AREB 2WBJA 2UZIH 4MJ6A 5F1OB 1FLTX 3U7YH 3AMKA 1DBAL 1FVDB 4OSUH 3P9MB 5ACLA 5I1GL 1RZKL 4UNUA 3HG1B 5ISZA 1JTTA 4KDWA 4QY8B 3UTTB 1QA9B 1FNHA 5SWZB 4GT7A 5F7UA 1PSKH 2Z31B 1YYML 1F97A 3EJYD 4JO2H 3C5ZC 4MXWL 4KHTL 4Z7UE 4DEPC 2NYYD 1QQDB 1FN4B 3MFGB 4KJYB 1WZKA 3DO7B 4LSSH 3DVFA 1IGFL 2VLRB 2E9JA 1JI2A 4HS6B 4KU1A 1KTRL 3EW3B 4M7JL 4G8FB 4M93C 3WSQL 3DOSA 5HHPA 2QL1A 3OR7A 4NNYA 3CMGA 4HAGA 1A3QA 2Z93A 4EZMA 1ZS8B 4Q7DA 1NUGA 4KJWC 1K2DA 2JE8A 3QXAA 4D8PB 2H41A 4CU7A 1ZVYA 1JPFB 4Y4FB 1XR8A 1FGNL 5BMFH 5B39B 1U3HD 5IMOA 5F9AC 3DURB 4BA8A 4M4PA 2X4PA 3K1DA 1DEEB 3ECBA 2IJ0C 2QQNH 1ZT1A 2NR6D 3U4EA 4HGWA 1AKJA 2B20A 2N4IA 1JN6A 3KPNB 1RU9H 4JFED 4PR5A 4HMDA 1G0XA 5CJXC 2BRRH 2VC2L 4OKDA 2XY1A 2EH8H 4Y5VA 2B0SL 4ZD3H 1IM3A 4XPHH 4I9WE 2H32A 8FABA 4IMLB 5ANME 3BUTA 4HS3B 5DK0A 1RZFL 4CU8A 3IJYA 1UCBH 3ZKND 5I18L 1QVOA 3IVKB 5J8OA 3O4LA 5L7XL 2JK5B 2D7TL 3GIVB 4WTZA 1NUNB 3PQYD 5F70A 4G6FB 1YEGH 3OR6B 4Y16D 3ULUH 1TVBA 4JDZB 1WZ1L 2AK4D 2QTEA 3EYVA 2A0LD 2HH0H 4C56B 1DQJB 2X42A 1RZJH 2VAJA 4YXKL 2X40A 5T3XH 4I0PC 4KI5F 4LDOB 1E4JA 4N5ED 4PP1C 2X70B 4U1SB 2I5YL 2YK1L 1NJ9A 1MAMH 1YEDA 3L3HA 5FYJL 1ZAGA 3P40A 2X7LB 4WO4A 3TIEB 1U8LB 2NX5B 5ERWB 2B1AH 5C0AE 3F5WA 1CE6A 1NGWA 4MLIA 4JFXA 1OTTD 4HLZG 3DROA 5EIIA 2OL3A 1RY7B 3HUJB 3MRHB 5IEHB 2CIKB 1MPAL 2ZUVA 3CK0H 2OTWB 3MXWH 3HE7B 4OGYH 4LLUA 3QDJD 4NT6B 5DMKB 3Q48A 1OAQH 5GS2D 3CD4A 1N5AB 5ICXA 2IADB 3RJDA 1HXYA 1JP5A 1AGEA 5DD3H 1Q0XL 5FYKD 3BWUC 3W11C 4LLMB 1CLOH 3IF1B 3SO3C 2FDBP 1UA6L 4YHMH 4PB0H 5D1XB 4ONHB 2M1KA 3GIZH 3PHSA 4DN4L 1Q9KA 5CD5C 2QSVA 1CDIA 3LRSA 1R0AL 4YO0A 2OJEA 3ZTJG 5I76B 2VSDA 2EYTA 1X4XA 1I75A 1HDMA 4M7LL 3TJEH 3UO1L 2DQGH 1S7RA 4MA1C 1RVFL 4QRRE 1Q0YL 2Q7YA 2YD4A 3FFCB 1BWWA 3J8F7 1J5OH 1X5AA 3HZMA 3UJTL 5C0ND 3VFPB 3OPZL 3ZTNL 4Y19D 3AB0B 1DUZA 3VFUB 3NZHH 1F6LL 4RDQF 3N1GC 2DIJA 5T5NG 3OG6B 1G1CA 2F15A 1R5IB 3MRRB 5HHOA 2DQFA 3ZYIA 4RCAA 3BUYA 3O0RH 5K9KB 1VFBB 5C0GA 1D5ZA 2V9RA 1TZGL 2AQ2A 4ZTPH 4OCYH 4ZTOL 2QADD 4PY7A 2VXSH 1LK2B 1E4WH 4N0FA 5I19H 5JOEA 3B8YA 5GGQH 5FYJD 1NCCL 4YZFE 3MRIB 3UZVB 4P4RA 1T6WA 2AJYH 1SBSL 4GFTB 5JHLL 5FGBA 1C5CL 1QLRB 3ARFB 1DCLA 4EI5A 4PJFE 4QXTB 4OF0A 5E2JA 3U82B 3UJJH 1U95B 3IFOB 1N3NA 5I66B 2FH6A 3QJHA 4P2OC 4P46C 1CU4L 2F5AL 5E99H 1BD2A 1MUJA 2MQ0A 4BFIA 3FQTB 3GSXA 5L88L 4LCYA 3STBA 1BQHB 3CFKB 35C8L 3QIBB 1MCJA 1S7QA 4K8RH 5L9DH 2FX7H 2R2EA 3Q0HA 2OK0L 1LEKA 2FX8H 5CGMA 1P2CB 1WICA 4O4YH 3EO9H 4UILH 4LSUH 2VDRH 4N1EA 1UFUA 4EVNA 4HX1B 4YGVB 1I7UA 3EHBC 4KTDL 4MXVE 4GRWF 4QTIH 1WWCA 2VDPH 2JJTA 1A7PL 2R0WL 4OZIE 3LH2H 3DHJA 4OM1H 2NW2B 2NY3B 5TE4H 4OUOA 4F2MA 2IC2A 3IYLW 3CMOL 5I2IB 4M6NH 3SBWC 2M2DA 1KUMA 4RAVA 3TWCH 1BVLA 4KVCL 5E8EA 1ZT4B 1X7QA 2BNRD 3GMQB 4PJIE 5IESH 3OJ2C 3BZEB 2IGFL 1UC6A 2WP3T 1Y18A 1XF5B 4KGJA 4MNHA 4PG9A 5DT1H 4ONGL 3P4NA 5GSRA 4G80A 3SCMC 3TC9A 1YY9C 1W0YT 4N9GB 3H42H 1CGTA 4BM7A 1SYSA 4YHYB 4MX7B 4GO6B 4JCMA 3HAEA 4G43B 1U8NB 5HYJE 1TVHB 2HTLD 3VWJB 3D69A 1ZWIA 1C08B 2J6EH 1W8NA 3NFSH 3RL2A 4U1LB 4X5XB 3HUJF 2VL4A 5B22A 4MJ5B 1GOGA 4XMLL 1WLHA 4X80H 4MSWB 2IANA 4KFZC 1MLCA 1RPQA 3V0AC 4CDGC 3KPRB 5D8JH 4ZSOA 1N2RB 4HIJB 4XWGH 5EUKB 1CIDA 4OI9A 2VOTA 4KK6C 1UG9A 4N68A 1I7ZA 1WK0A 2XN9A 3P4OA 1AXSA 2ZWLT 5HDOA 2VE6A 1P6FA 43CAA 5GISL 1NC2B 4ZPVA 4Z7WE 4ZNCD 3OXSA 3UJIL 2EXWD 3WD5H 1LP9B 2BERA 3TBTB 4E41B 4EN3A 1KULA 1P7HL 1C1EH 3MBXH 1HXMA 5D5MF 3MLZH 4HGMA 5EU3B 1C16B 1FNFA 4GRLC 4XNYH 5FGCB 3SDAB 3BO8A 4OLWL 4G42B 1IQWH 3L5WA 3OXRB 2H6PA 3CSPA 5JQHC 5DYOB 3QUXA 2D7OA 3BYYA 1DANT 5CILL 4JPIA 5DZNA 1A7NL 1ES0B 1KB9K 5I74B 1BGXH 3CU1A 3FN0L 4JG0H 3S37X 4OCXL 4PJ5D 5FGSA 3TO4C 4OT1L 3JTTA 1HI6B 4J3SA 4JM2D 4I8DA 2B8OT 4KRPD 1AGBB 1NFKA 3KLHD 1I4FB 4DOHE 3BRFA 4FQXC 4Z9KB 1JL8A 4K2UL 1QFWL 1F8TL 3HPLB 3FJTA 5DHVB 5CIPA 1ETZA 1DL7H 2IMNA 1GGBH 3NA9L 5DJAB 15C8H 3GK8L 3CVHA 4Z0BH 2GJ6E 3CX5J 3MUY1 3QXDA 4HH9A 3QAZB 5F7EL 4EBQL 1HQRA 4PJGB 3GBNH 4JPWL 5D7KE 2VR9A 5GRWA 1S9XA 4P57A 3VDBA 4WWKA 5FGRA 3UAJC 1MFDL 5I17B 3DX8A 4NWTH 1SJHA 3F58H 2AXHA 2WM0A 1NFDA 1Z0NA 4JY4B 4FABH 3FONB 5DD0L 5BRZA 2DF3A 1RIHH 2KZWA 3I9GL 3HZKA 1BECA 2FIKB 1QLEL 4ODWB 5EUOB 4NO0D 2BSED 1C5DB 2VZ1A 3FRUB 3B5TA 4YIQA 1F4AA 1IZKA 3OAZK 3N85L 4QHNB 5JUEL 3WIIL 4EOWL 1V3MA 1G9NC 1P7QB 3ALPA 4X6CA 4IRSB 4KROC 3L7FA 2VIRB 3GO1L 5C0DA 1Z9MA 3RZWA 3KPPA 4NOBA 4NGHH 3QDGA 1ORSB 3IAGC 3NZ8B 3VI3E 4PG2C 3C09C 2D7QA 4OFIA 1MCLA 3CDFA 4LHUB 3IFNH 2FO4A 2YOCA 1DQQB 3GSOA 4TQEH 2HAZA 3F7VA 3LKSB 1J8HA 2C7UB 1VGEH 1AQDA 4WENB 3BD3A 3VGBA 4Y8AA 1MAJA 5J1TC 1U92B 1YEIL 4HUUA 2JB6A 5SV4A 3MV9D 4ISVA 5E1HB 5FM5O 3RIFF 3PHOB 3GHBH 4XAKD 3DRTA 5EOQL 4KJQD 4GBXA 3VXSD 3MLSL 3PGCA 1QFOA 1UEYA 2IF7A 2MKLC 3TBWB 3UTPD 3I02B 1S7WA 2CMRH 4J3OC 3ME0A 1KB5A 2AXGB 5IR1B 3STZB 1ZGLP 4ETQB 1D5BB 1MJ7L 1CD0A 3G5XB 2FRGP 1U91B 2D31B 3ZDZF 4JQVC 2J88L 5I9QC 4R4ND 1AXTL 3PL6A 1MFEH 3IDJB 3QZWG 3I75B 4N9OB 2Q86A 1XCQA 3EYSH 2DKMA 4YJZL 1W0WB 4RFOH 2FGWH 4TVPL 4FXGB 1HILA 3LKRB 1QBAA 4YFDB 1EMTH 2ARJA 1H3XA 4G6ML 3G5VA 4UI2A 1MCEA 3HHRB 2OP4L 1LHZA 4MB3A 4NUGH 2PO6A 1Q1JH 5DUBB 3CH8A 4ORGB 5I8KH 3MCKB 1O7SA 4G7YH 4F7PA 1EEYA 5J6HB 4RGOL 5EO1A 5DD5H 5E2WL 1EGJA 4MD4A 3QDAA 1N6QL 2FR4A 1V3LA 1ODAA 3NIGF 1FPTH 2XZZA 5KVFL 1CGVA 3PP4H 3HI6H 3PIQA 4PUBL 2NY1B 4U2ZA 3PWPB 4L8DA 3O11B 3SN6N 5F93C 1CVSC 3IGAB 1QSEE 4PRDB 3S3SA 4TRPL 4O58H 1MRDH 3FMGL 5IT2H 4PJGF 5EULV 1FIEA 3MLTB 4XB8A 2XZAL 4QRPE 5C70A 3DIFA 4NIKB 3VRIB 1FE8L 4Y4HD 2ADGB 2BK8A 3MV7D 1PLGH 3SGEH 1AHWC 2V2WA 4NN7C 4OUUB 1BFSA 5D71L 1F5WA 3RWEA 4ZXBC 3QT2A 4JRXB 4MCYB 3V6OE 3RQ3A 3UTSD 3VFMA 1CXLA 2AXJA 1T66C 4D9QD 5JHDD 2DJ4A 5DLML 1RJLB 1MHEB 2DQTH 3KWWA 1NBYA 3BHBA 4QT5B 5ICYB 3LDBC 4XPTH 3MGTA 1UT9A 4Q6IC 3MJ7A 2OS7A 2FJGB 4LSQH 2YWZA 5GGTH 5EB9A 1A7QL 1F3DH 3DXAD 2IPKB 1NAMA 2XICA 4O2CB 5CEYB 1X44A 2VABA 2EKSA 3HC0A 1S9YB 3VMPA 2XACC 1SM3L 4FNLH 5C0CA 2FX9H 1OD7A 4OZ4B 3ZKXC 4H20H 1MQKL 1UB6A 1LE9B 5E8NA 2X1PA 2CGRL 4ZUUA 4OD2A 1EA9C 5HBBA 4WJ5A 2D2OA 4X4YA 2BDNH 2HA1A 3QCVL 5TQ2L 5MEND 4PP2A 5FO9A 4P2RD 1A9BB 3GGWA 3S96A 1BF8A 1JZ8A 4X4MA 1I85C 2V2XB 3NFPA 5IBLC 1NGPL 3HFMH 5FA4B 4YH6A 5EFIA 5GS3A 2I60L 5HGBA 5KN5A 1A6VH 3E6FA 5HDBE 5LXGL 3BW9A 3FB5A 4PRPE 1CICD 5D1QD 2XKNA 5IW1B 3QXTA 4HWBA 2APTA 3QSKB 5FV2A 1BFVL 3DV4B 3KPLB 1MCKA 1PVHA 3VXME 3D0VB 4PPTA 3O6FC 2W0FA 2HRLA 2Q3AA 5IG7B 4DKEL 2P8MB 3MNWA 4OF5A 4WHTB 1QLFB 2XWJB 3UYRH 3QWOA 3RVVC 3CFEA 3FRPG 3EO1B 4FFZH 3VFTA 5DI8B 5DRXB 5GS1A 2FATH 3GI9H 4MYWB 5IB4A 2GFBA 4L8SB 3OMZA 1CL7I 4XHJC 1UKQA 3B2UD 4PJBE 5HHMD 3O9WB 3P0YL 1B4RA 4JO4L 5F89A 1U3HA 2IQAB 2YD2A 4NFDA 1G6VK 5GRUH 1H3WM 2E7LC 2RBLA 1BVZA 2WQ8A 5K9JL 1QSFD 2H32H 3QXUA 2WBKA 1VFUA 4BQBA 3IJSA 3LOWA 1MY7A 1MIEL 1U58B 4R2GC 4R6UA 3SY0B 1OF2B 1XAUA 4X4XA 5HI4C 1VKXB 2APXA 2ESVB 4KK5C 4JFEA 3OKKA 1U8OA 2AQ1A 4G8GE 4MQTB 5CJQL 4OM0H 3VE0B 5FKPA 5HHVL 3VFWA 3IU3B 4R4FL 4PGJA 1P53A 4Y4KD 1IAKB 2CRMA 3MLVH 2FECL 2R4SH 4F15C 4PB9L 4AH2B 1UB5A 2Z8WC 4L4VE 4U1NA 4KI5D 1WSST 4K71B 1CBVL 3PQYA 1I7RB 3TV3H 3EJJX 3W9DB 4Y16A 1VFAB 3X13B 2NLJB 2VQ1A 3IJHA 2AK4A 1LK3H 2GK0A 4KDVA 1CXHA 1X6NA 4P49A 1TMCB 3RWCA 5BJTA 3JVGA 5I0ZA 2ATKB 5JIHA 1MREL 3DO3A 2ZNWA 4MXQC 1OD9A 3T0EE 4GW1A 4MJIE 1LO0L 2AEPL 4LLDA 5GSVA 1JGEA 1KJ2L 1UZ8B 4I4WA 5I1CH 2C4FU 2ZCHL 3LSOB 2OL3H 2WLZA 3T2OA 4ZFOA 1XR9B 2CUHA 1H5BB 1WZLA 2BC4A 2I9LA 2YPLE 3VH8G 3QFJE 4NZUH 2D03L 2YBRB 4HJ0D 5BV7H 1DFBH 1INQB 2XWBA 3CPLA 4TNVF 3PWUA 3TNNB 4CRPA 4NQDE 3ZE1F 2HTKC 3FQNB 43C9A 4OLYH 4OLVH 3QDJA 5CJ5A 4GW4B 4JFFD 3SKMA 4ZYKB 3C5ZB 3QQ4B 2F58H 4DEPB 4IOFD 4PGCB 4OQTL 2FBJH 4NCC1 1AO7D 3EZ8A 2I9TB 1YDPA 5IV2A 3UTTD 4LVOC 3TBYB 1U8PB 2E6PA 5D96B 4HG4K 2NXYC 2VXVL 2XA8L 3S35H 4EDWH 1X5JA 5I30H 2H3NB 1I3UA 4UUJA 5FOBB 1DR9A 1AD9B 3JSSA 3C5JA 3MLXH 2MCPH 4Q2ZB 1FZOB 3MACH 4ODXA 4ZUSB 3OKLB 3QUML 4HS8H 4XBEH 3U46B 1SEBB 5F3BA 2IAMD 3CSBA 5GGSB 2WWMC 1G7QB 4HBCL 4XP4L 1SHMA 2DWEA 3KPSE 3M1BA 4HMCA 4Y19A 4G9FE 5IW6A 1MCIA 1CXEA 4KK8D 4WGVB 1FFNB 1S5HB 4M7KL 1WIUA 5F9OL 4YXLL 2CIIA 5JORA 5LGHL 5KS9A 4YHLH 3ULVH 4YXHH 5C0IA 3SO5A 5C6TL 3RZCB 3SOBL 1IKFL 1P6AB 2R0LH 1Q72H 3EGSA 5L2JA 4ZS7L 2PTVA 2F74A 5I1IH 4NP4L 4O51A 5GIRA 5D1ZB 1XGQA 3VWKB 1TPXC 4MD5A 4W4OA 5IK3B 3GUTB 4DGYL 3SQOL 5HYQA 4XZUA 3JWOC 1K3ZA 3L6FB 3BKYL 1JRHH 3DX9B 4H1LA 5FO8A 2ZSVB 2EIEA 1K4DB 5DO2C 2IFFL 2JCCF 4RQQA 1BEYH 4FQCH 3MLWL 3DETC 4KI1A 4YHPA 4Z95H 1FNEA 2GSIB 5DC4B 2R29H 3U0WH 5F7FA 2VDML 4Z18A 2R8SL 5EBMA 1BF2A 1JV5B 2Y9RT 5IKCB 3BPCB 4XNUL 2HJFA 1HIML 1XH3A 5HGDA 2LV4A 1HCFX 3TN0D 3D3VD 1LEGB 4ZS6C 3BPNC 1RSFA 3G6AA 3SDCD 3G5ZB 3FO2A 3RI5K 4F80A 4UZGA 1ACYH 4M6MH 4PJ8C 2VUYA 2H1PL 4J1UA 5E8PA 4GQ9H 5DDHA 3CX2A 3KYMA 1WTLA 5K9OB 4YX2L 3MV8E 4P5KB 3GB7B 2YPKB 4P4KC 2I26N 4KWUA 3DX6A 2XZQL 4IHOA 4XXCC 3AXLB 3QNYA 5KZCD 4NYLA 1RHFA 4V1DE 2BNRA 3HAEH 1XF2B 2GJZB 2P4AB 5ICZA 4NZTH 4OI7A 4N0CC 5FV1L 4TYUA 1UYWL 4BQ8A 4BZ2L 1UKTA 5E8DH 4KRNA 4WI8A 4Z0XB 3SO3B 1RHHA 2N1KA 3LKPA 4X6EA 4NJAL 4YBLC 2HP4A 1TJHL 4BQ9A 1T04B 2APWA 3CCHA 1H3UA 3QQ3A 5T1DL 4IOSD 5B38A 1L7IL 1MRCL 3B9KC 4I77H 3IFPB 4LGSB 4QRTB 4NPYA 5D7SH 1R5WB 2VDLH 4PJXF 3U0PB 3IU4H 4X9FA 3WFDH 1RIUH 2E27L 3BH9B 4OV5B 2W60A 1F2QA 2O61B 1NC4B 2B2XL 1A5FH 3GM0A 5MEQA 4PRBA 5JR1L 5FYKU 1N0LA 1HCVA 4Z7OF 5IGXL 2WBWB 3U2SB 2ED9A 3B6SA 1IFHL 3IDYC 2X89D 4XVTL 2VLME 3GBMH 2UWEA 1AY1H 5F8QC 1SMAA 2C4XA 2OZ4L 2PR4L 2FEEI 4XMPL 4U7SA 4WCYL 5B21A 1PKOA 5BW7A 4DZBB 4L29B 3WFBH 4WDIB 5E4IA 1BIIB 1A1MA 1A6TB 4G8EB 4KXZI 4F33B 4PRHE 1AGDA 2X4SA 2Z35B 3HRZB 2P49B 4R96A 4P2OB 3LZFL 5EOTA 3VXNA 5C7XH 4PJ5A 2HVJA 2FJFB 3NA4A 4PRIE 1JVKA 4JM2A 2AJZA 2DN7A 2ARJQ 4FZEH 4CW1B 1S9WA 3C2AL 1B2WL 2J5LB 3CVHH 4HFUH 4QF1A 5CSBA 3KJ6H 1WZMA 1ZHBA 4RWHA 3IRZA 1XGTB 2VWEE 5EN2B 4IDLA 3R1GH 1DLHB 1KTLA 1G7LB 4JZJC 2ADIB 3VJ6B 5FYJU 1JNLL 3DI3B 3H3PH 3WE6B 2PW1B 3CZFA 2HT2C 1Z9SA 5F96L 5GJTH 2YD7A 4NQCE 1ADQL 2P7TB 3FFDB 4U1IA 5AZEL 4HC1L 2FSEB 1KCRL 3AMLA 1QRND 3DVGB 1T7ZA 1GC1C 3GMOB 3NH7H 5MERB 3L3DA 1VPOL 3SCMB 2FEEL 2X4NB 4HPOH 1FV1B 4OZGF 3VMOA 1JF1A 4WUUB 3TA3C 5IEKA 5E1AB 4NO0A 3ARTA 4DWHA 4PREA 1XFPA 1KN2H 3RX7A 3HI1A 4GQPH 3ARBD 3QI9B 5EU6B 3DJ9A 3H3BC 3V6OC 4NCDA 3P4MA 3VXQA 1FFPB 1EXUA 4OF6A 3T0VA 1OT2A 1P4BH 3BIAX 1NH6A 3H2WA 4XMKH 1QR1A 4PJ7F 4ZO9A 3U36A 1KFAH 3EOTL 3MYJB 4JFDB 1OP5K 4ACPA 4C58B 3BDYL 4JHAH 4IS6A 3Q5YA 5E6IC 5CGYC 5DWUH 4EUPB 3EUUA 3ARGD 3BGAA 3MA9H 4C57C 3BPLC 1WBXB 1DQDH 1FZMA 2AAVA 2PXYB 3DX7A 5ALCL 5IHLB 4HV8A 1OP9A 4O9HL 2VR4A 4MA3A 1EPFA 1INEH 3RDTD 3C5SB 4JVUA 3CFDA 2LU3A 4LF3A 4FTVD 1A6ZB 4GRMA 5JPNA 1UACL 4GAJH 4YDVB 1RUPH 4LVHC 3MV9A 3V5DA 4TUOA 4ELMA 2X4OB 2UZXB 4PJ9C 4NUJB 5FK9A 1D5MB 3PXHA 5ADPH 3LV3B 2RGSA 4GRLB 2B5IC 1KJMB 2XTJD 1QBLH 4OFKA 1Z6JT 4WW2B 1OSPH 3VXSA 3LEYL 3K2UL 1EUTA 2P8LB 5KVGH 5E7FA 1YJDC 3MRJB 2NY7H 1KYOJ 3CFCL 4L4TD 3TO4B 5KANG 1I1RA 4YEEA 3LEXB 2Y6SC 1ONQA 3NOIA 4XC3L 4XCEA 3QBTB 5FCUH 3V6BR 1WWBX 3VI4E 4RMTA 1J0IA 3W0WD 3OKDA 4JN1L 1KPRA 1M05A 5I15L 2ZUWA 5GRVK 5KSVB 2E8ZA 3WUWA 4WU5A 3F6IA 4JQIH 5ACZA 5E5RB 4NZRH 1R24A 5EA0H 4XP6L 4FXKB 1QG3A 4U49A 4CL7A 2VH5H 2EH7L 2AGJL 2F5BH 4WTZG 3ILQD 4DKFL 4MA8H 1WFOA 4N0UA 1OAYL 3G6DH 2V7HA 4Y5XA 3RA7L 5I1AB 3FQXA 3WFEL 2JKXA 4WEBH 3MBEC 3EDFA 4QHKJ 4XB7A 3QUMB 5SWQB 1AFVH 4LARH 1FZJB 4BQ6A 1QFUL 2APFA 3SE3A 5HYSA 4EEEA 4S2SB 5ETUB 1CR9H 4S1RH 3JWDL 1Q94A 2G5BA 1BQLL 1DBJH 4NN6C 1O0VA 2X09A 2B4CL 4N0YH 1RZGB 2CDEA 5DS8B 1HEZB 3OAYH 3TYGH 4BSVB 2YMXH 1U8KB 2QQQA 3QIWB 5ESVA 1ED3A 3HCVA 4Y4HA 3K4AA 1H3PL 5SWSB 1T03H 1G9MH 2VR5A 4G6AD 4KROB 3S98A 1JGLH 4DQOH 3CC5A 3MV7A 4LP4A 1OM3H 3D18A 3O2WH 4GXVH 4XXDA 1B88A 1MCQA 4WU7B 5E08H 5D2NA 5JMOC 1EO5A 5DJ6B 5E9DB 5AD0A 2F54B 3QNZA 3T2QA 5IB2A 3PJSB 3T0EC 3UTSA 1OB1B 4I3SH 5FM4A 2GITA 1K9TA 1NAMH 3D5OF 1OLLA 5DJCB 2DD8H 5JHDA 1MHHB 4ORZC 3GMLB 2QHRH 5INDA 1YPZE 3EZJB 4P5MA 5IP4A 3DXAA 1TLKA 3X3FL 2EIDA 2R1WA 1BP3B 2AJVL 4JKMA 3HNVL 3TJHC 5F9DC 2VKWA 2AKRA 5T3ZD 2XT1B 1QPXA 2FYYA 1JZ5A 1CFBA 3D87B 4XAWH 4DW2L 2PN5A 2OR9H 3D9AH 1ZHKA 4PBVC 3WDIA 2L7UA 5I9QB 1BJ1H 1HOCA 4HJGB 5MENA 2AJXL 3QCTL 4RIRA 4LLYB 4P2RA 5DA4A 4HFWB 1JWMB 5IFJB 4ODHL 5C3LD 3O41B 1BZ9B 1RZIB 4LLVA 4UU9B 4NKMA 5DEGA 3LQAC 1WCQA 2BOBB 2X1QA 5DMIH 4UTAL 5JNYA 3RVTD 1UJ3A 3A6BL 2X4RA 1CICA 5D1QA 5EORH 4PLKD 5D72L 2HFGH 4HLJA 2O5XL 5JIIA 3V95A 2NY5H 3P9LA 4XCYA 4RAUB 3LCYA 4OFPA 4UT7L 2ZUUA 4Y8DC 5TQ0L 1S78C 3MRDB 4Q0XL 5T5FH 1UWXH 4L1DA 2DM7A 3KS0H 5D7JC 1HHIA 1Q9WA 4OCMC 4P9HC 4U6TA 2C1OA 4BZYA 7CGTA 1M6OA 1G7MA 1TJIH 5KTEL 2ZJSL 4L3CB 5I8EB 2EEBA 3CUPB 3UZQA 1NBQA 5A1AA 3MJ9A 4IMKC 4I3RH 3TT3L 2A9NL 5INCB 2QBWA 4WUKL 3IETB 1BD2E 4ZOBA 1QYGH 4UOW0 1I8IB 3WHE1 5ANMB 1FCCA 2RQ8A 4LRIC 4ELKB 5AZ2L 3OX8B 1QSFA 3BMWA 3SE9H 3VDCA 5L0QC 1WGOA 4IRZH 2A6IB 1ULVA 1I1YA 2OCFD 4HD9A 1AHWB 5BVJA 4UV7L 4NN7B 2HFEA 4QHMB 4HXAH 5C07B 2UZIL 2Y5TA 3U7YL 2WINA 4OSUL 2XKUA 4ZXBB 1MH5A 1AXIB 4XBGB 4OCLC 2J12B 3F7YB 4Y4KA 1IGTB 4XVJH 1ZA6A 1M4KA 2YC1A 3QDMD 4GSDH 3UDWA 5D7LD 1PSKL 3HS0B 4JO2L 3ZHDA 4X8JB 3LDBB 1IJ9A 1CTNA 4I2XA 1R3JB 3V4VH 4LSSL 1U2HA 1XCTB 4LFHG 1YNLH 4PRNA 5HVHC 1T5XB 4NBZB 1CGUA 1HSAA 1JTOA 4NQXA 3SDYH 5E5MA 2W9DH 4QCIB 4X9GA 2YRPA 4CN4A 5IHBA 4D0BA 3G6JE 2WIIA 1IGCH 2GTZB 4D0CB 3WDHA 3NCMA 4YR6A 3MZTA 5TDOB 3OKOA 4P2YA 4WFED 3TVMD 4EDXA 2DQIH 4PD4J 3HB3D 4PJDE 4QLRA 5D2LA 1AR2A 5FUCE 3D25A 5F1SA 4JAMB 3QUYB 2IANE 3BWAB 4NNPH 5BMFL 2NXZC 2PW2A 4NKQB 3VXUD 1UM4H 5GS2H 5F8RC 1NANI 1Z5LB 3HNSH 3O6MH 2F8OA 4ZSOE 4D0DB 5GGRB 5FYKH 2QQNL 4ALAH 4A2MA 4JFZH 3AVEA 4F9PA 3ROLA 4LGRB 2XN9E 4G9DA 4JFFA 4OFVA 1VADA 4X5LA 5B3NA 3KPQB 1RU9L 1AO7A 4X0KB 1WWWX 4CMMA 2BRRL 1OTSC 3UTTA 4ZD3L 3MA7A 4XPHL 2W07A 4Z7UF 5DJXA 5H37H 3RVXC 4LSDA 3U9UB 3O6FB 1GZPB 3QUZD 4DZ8B 3IAQA 1UCBL 1FN4A 1ZHLB 4D94A 4MDJB 4LLWB 2HLAB 2MHAB 4QRSA 4EKXA 1RUMH 2X9XA 4HKZB 4MZ2A 2UVFA 1YEGL 5BOZG 4NC1E 3B3IA 3I3EA 2C1PA 4WNQA 3ULUL 3FAWA 1SY6H 2IAMA 1QKZH 4MAYD 2HH0L 1IBGL 3HE6D 1RZJL 1GGIH 4PTTA 5T3XL 4RBPH 2J4WH 1DE4B 1PJ9A 1ZSDA 1E27B 3SGDH 2QEJA 2YK1H 5MI0C 1RI8A 5SX4I 4X5WA 5C0EB 1E4XH 4UIMB 3OB0H 5GZNC 5CJBA 2Y06H 1GHFH 1MAML 4DCQB 4PJFB 3QJFB 3ZYZA 4DN3H 3MV01 3O9WD 4DUXA 1FL6B 5HYIA 2B1AL 1NCWH 3TPKA 1KJ2A 4H1LH 4RFNC 4LLQB 2ZPKL 1G6RA 5HHNA 4UAOC 2AERT 4I3GA 1QHOA 4F15B 3SDDC 3VFNB 1FVEA 3CK0L 3IB4A 3MXWL 4CUCA 2ZOLA 1B0RA 2NY6D 4LPYA 4OGYL 4D3CH 3OG4B 2VWEC 3CXHJ 3G04B 1IMHC 3H9SB 1IGJB 4IJ3B 1OAQL 4RGNE 4WV1C 1PYWA 3U6RB 4U7MA 1D6EB 4BFEA 3O8XD 1JUFB 5DD3L 1LILA 4WI7A 5FO7A 5C0BB 4OZIB 1PZ5A 5BRZE 4HWEH 2YSSA 4CDHA 3L95B 4R7NB 2FB4H 5GGUB 2UYLB 4OQTA 1T20A 1U8IB 4PB0L 3TN0A 4YHML 3D3VA 3GIZL 3WIHA 4JDZA 1L0XA 3H6JA 1H3GA 4QRUB 4LCCC 4OFYD 2HMID 3SDCA 5EO0B 3T0XA 4F8QA 1C12A 1IQDA 2BHYA 3TJEL 2DQGL 2KPNA 5E00B 1HHKA 1LO5A 1LEIB 1FNAA 2FIRT 2I27N 4N8PA 2UZYB 4X6CE 3EYFA 4ZMAT 4LKXA 3MLPA 4OZFA 2ITDA 3TT1H 2NCMA 3P73B 3ULUD 3NZHL 1A3LH 3UEZA 1KG0B 5HYJB 3VRLE 5DFTA 3BP6B 5F7DA 1AD0A 2FEDD 4JRYD 3O0RL 5T3XD 2PYED 3BFOA 1HKFA 4MLSA 5DHYB 5TH2B 4C56E 3GMRB 1J8HE 3LKOA 4ZTPL 4OCYL 2P44B 5DJYB 2VXSL 3HUJA 2DS4A 4MAUH 1E4WL 5IW3A 5I19L 4KC3B 5GGQL 3INUH 4AIZA 1T0NB 3WYRA 1HH6A 2CLRA 2AJYL 2XQYG 4ZUWA 1CF8H 4WFHD 3T09A 2RCSH 2WBJC 4JFHD 3RNKB 4BELD 2IPTH 2GIYA 2OTUA 3UJJL 2F5AH 1FGVH 5BXFB 3IF1A 4YK4B 5JW5B 5E99L 4S0SD 3VDAA 1YY8A 4MNGA 1FFOA 5JOFA 4KJWD 3BN9C 4K8RL 4DKAA 3P9WB 5L9DL 2ZUYA 2OXGA 5J1AA 2FX7L 2ORBL 4M61B 5D5MA 2FX8L 4EXPX 3ARUA 4O4YL 3TYFA 3EO9L 4UILL 1VGKA 4LSUL 2VDRL 4X4ZA 1GOHA 2IH1B 4KH2A 4QTIL 2VDPL 2X89A 3LH2L 4OM1L 3CMOH 4QYOB 1XIWD 5TE4L 3ULSB 2EDNA 4OGZA 4O2EA 1TPXB 4FQJH 1YUHB 2VZVA 5CBEA 2DQCH 4M6NL 1VFBA 4J4PC 3DGCR 4OGAC 3TWCL 3HR5B 2EDJA 3O3BB 5T1MA 3LY6A 4YZFF 3MRCA 4PLNC 3A6OA 2BSRA 3AY4A 3ESUF 5DT1L 3VXPB 4K9EC 5I71B 1NDMB 1T1WB 5GS0C 4PJFF 3RY5A 5HGAB 3H42L 2GJ6B 3SKJH 4NNXA 2W91A 2V5YA 5E6ZA 5H35B 1AIFA 2I07A 5DJZA 4W6YB 4KHXH 2J6EL 5HI5D 4DK3A 3NFSL 1CQKA 5TE7H 3SKNA 3MREA 3M8OL 4V2BA 3SDXB 3SGKA 4PJ8B 3RY6A 4X80L 1RK1B 3BKJH 1CGXA 4I0PD 3T1FB 2ERJC 4XVSL 3PHQB 1BQSA 5CSZB 5F9WC 4LPUA 2NY4C 1MQ8A 1AQKH 2NY2D 4UDTA 5D8JL 4XWGL 1BQHG 1S7VA 4MXVF 5JZ7D 5IM7B 4KPHH 4FQQA 1BWMA 1QRNA 2A74A 3UPAA 4TNWF 4OZHB 5DMGC 4NSKA 1CT8B 4M8QB 1F00I 4R7DA 2EC9U 3WD5L 1YC8A 2HN7B 1R5VA 5JOPE 4BKLA 4PJIF 1C1EL 3MBXL 4B41A 2R4RH 3MLZL 1ZT4A 1H9VA 4YBLB 2DQHL 3LN4A 4XNYL 2VJXA 4ZAKD 1FG2A 1IQWL 4U0QB 4XPFH 1GGUA 1KCSL 3ARBA 3TZVD 4F9LA 1YEFH 2P5EE 4N9GA 4OCXH 5C0CE 1BGXL 3T65B 4U0RC 4JG0L 1S9KC 5LKNA 2I25N 4PRAA 1M7IA 1DBMH 2OSLB 1YEHH 3OKNB 3ETBF 2PUQT 5FECB 3ARGA 1XGYH 3G5YA 4MSWA 4H25B 4GJTB 1WCBB 4P23B 1KLGA 2X2YA 3I6GA 1DL7L 4X6BB 5CWSB 1EV2E 1KIRB 4X4ME 2GY7B 4DVBB 1GGBL 2P5WD 4QNPE 5FDWB 1P4LB 4FTVA 3MMEB 3IDYB 15C8L 3WFHB 3X12A 4M02A 1DQLH 1RUQH 4YDJB 4Z0BL 4Z7WF 3GBNL 2BY2A 5F1NA 4U6VH 3U9PH 5IMKA 3EYUH 2KQMA 1P1ZA 4X6FB 3QXVA 3ARXA 3N1MC 5CP7A 4JE4B 5A43C 4NWTL 2MCG1 2NY0C 1A9EB 4FABL 4ZOAA 4L4TA 4WI2A 2LVCA 4AENB 3KVQA 4LVEA 1ITBB 1U8MA 1D9KC 2CKBB 4KQ3H 1I3GH 2YEZA 1AGCB 3W0WA 1U8HB 4MD0B 4PJHA 2XG5A 4P46D 4F7CB 2UV3A 3D0LA 1TZIA 1LP9E 3HLAA 4E41E 1ZANH 2PTTB 2O5ZH 1ZHNA 3RIAF 1SJXA 3JV6A 3T8XB 3GO1H 3QG6B 2J8OA 1I4FA 2NW3B 4PS4L 5JTWA 1BJMA 1F11B 4EI5C 1WFTA 1CWVA 2FLBT 5CINH 5C09D 3S88H 4NGHL 2XI9A 2BVOB 1CFSB 1SQ2N 3IFNL 1QSEB 3DWTA 1I3VA 2R1XB 1Z2KA 1KJVB 2EDEA 4TQEL 3MTRA 3KPOA 2F53D 3B83A 5CS7A 1H3TA 5TDNB 1UENA 1VGEL 2DLIA 4OKVA 3IXAB 2BY1A 4HEME 1QACA 2Q76A 3CDGB 3PQYE 1HHHB 1IEAA 3GHBL 5DEZA 3S37H 4TSCH 5CZKA 1OGAD 3L3JB 5F6IC 3Q6FA 2XY2A 1SJEA 4AEHH 1YY9D 3S5LA 1CDUA 2CMRL 1TCRB 3T2PA 2EYRA 5IQ7H 1FAIH 4R90H 1T83A 1EERB 2D7NA 3A6CH 5C9JA 5F7LB 4P0DA 3CXDH 4K23H 4KMLB 4NRXB 2VQTA 3BGFC 4HZLA 2DBLH 2CR3A 3BDXA 4DVRH 1LNUA 4K7PY 1YNTB 4QHNA 12E8H 4M9OA 2JJSA 2GKIA 1I1AB 5E7BA 2Z8SA 5B4MC 3NABH 1YECH 4NO2B 4HIIA 1QEWA 3EYSL 4LAQH 3I85A 1XF3B 1IKNA 5KSAC 4RFOL 1H8NA 3OB8A 2FGWL 1CIUA 1R3HB 4P2CG 4DAGH 4LHJB 4LVHB 3QDJE 3SJVD 5EUOE 1EMTL 4KK6D 3T04D 4PJ9B 3V0WL 3VD5A 4Z77A 5FUCC 4NUGL 2EE3A 2B5IB 5H37G 3WIFA 1Q1JL 2CQVA 5FUOH 2MJWA 4LHUG 3ZLQC 5FYKE 5I8KL 1QBMH 4RA0C 4G7YL 1F13A 1OSZA 5DD5L 1FNLA 4PV9A 1OP3H 2MNUA 4BK5A 3RTQC 5EO9B 1KLUB 1RQ5A 1FPTL 3QO0B 4PRPB 4GKZA 3EOBB 3PP4L 3HI6L 4Q9CA 3CLFH 4MZ3A 2GUOB 3BQUB 2CSPA 1F90H 3SGJA 1XF1A 4R97C 3VXMB 4NQSA 2WP3O 2ZOKA 3IKCB 1EFQA 3NCBB 1ERNA 1GZQB 4O58L 1MRDL 2X1WL 5IROA 3U7AA 3GZKA 4KUZH 2DWDB 5IR1A 5IT2L 3GBLA 3TO4D 4ZQKA 4Y19E 3I3BA 3TCXA 5J3HC 1PBYA 2GT9A 3MRNB 1K4CB 3QUXC 4FQXD 3AREC 1QD0A 1JGUH 1HQ4A 1PLGL 3L5IA 1ZLSH 3WLWD 5IOPB 4PJBB 2SEBB 1KSRA 1NFIA 3X17A 2ZSWB 5JLZB 3MJ9H 5FYJE 3NFNB 2ZP0T 3P0GB 3MBEB 1FL5B 3BZFB 4JZOA 3FZUD 3ZDYE 1QO3A 3RGVD 2DQTL 5A16B 5JDSB 4CJ1A 2XPGA 4XPTL 4P99A 4K94C 3QHFL 1P9MA 3RWGA 2ZCLH 1QOKA 2BJMH 3UAJD 1IEBA 4LSQL 3ZE0F 5GGTL 5KANI 4G8GB 4NKDB 2R2BB 4NN6B 5J0BA 4R3SA 4ZFZA 4FNLL 4WGWB 2FX9L 4WY7H 4H20L 3V0VB 3VXTB 4GKNA 5AAWA 4L4VB 4M03A 2LFGA 3STLB 2X5PA 3RVWC 1BMGA 2BVYA 2BDNL 3V6ZA 3ARZA 3M17B 1NEZA 2V5MA 3TO2B 2CLZB 1G7JB 3D85B 3T0EB 4XNQA 3KLDA 5A2IH 4MJIB 1EVUA 2DLTA 3HFML 3I6LD 3P0VH 3DV6A 5D7LA 3NCYP 4FOMA 4MNQD 1A6VL 2RIKA 3DVNB 3JV4A 1N59A 5D93B 1NLDH 3BH8A 5BS0D 4E0RB 5E9DD 2WAHA 2H45A 1BLNA 1I8MA 4Y2DD 5B38G 1LD9A 5DHXB 3T08A 1EHAA 3D2UD 2OX5A 2PCPB 3QFJB 3RWFA 1MHEA 5CEZD 1DQMH 3MNZA 3BP4B 4NQDB 3RAJH 3UYRL 5CZVH 4MQSB 5CJOH 3TVMA 1S7UB 4FFZL 1CDGA 3GMMB 1DVFB 2FATL 3GI9L 1EJ6A 2GTWA 3U0TA 3EJZD 2E8YA 3VH8B 3TPUB 1T7WA 4U1GC 3WV0A 1LE9A 1WEJH 3KPMA 3OZ9H 3VXUA 2V5SA 2C3VB 5ACMA 1T22B 4S11A 4M5YH 3O3AA 4JR9H 4P5TD 4R0LB 3CH1B 5BZWA 4U1JA 4ODVH 3B43A 4YHNB 1MI5D 2VXUH 1DDHB 3B9VA 3SKOA 4ZOEA 2QJDA 2HVKB 5DJ8B 5KAQG 4JDVA 1OW0A 4H8WC 2V2XA 1K8IB 2DTSA 4OM0L 3MCG1 4XI5C 1NMBH 5HDBF 1NQBA 2XOTA 3MYZA 3DLQR 3KPSB 4FFYH 2JJUA 4PB9H 3MLVL 2UWEE 3NMEA 3QUZA 4G9FB 2R4SL 4HUVB 5F9JA 2CDFA 3PV7A 3NN8A 4X7TB 1SVCP 4LPWA 3DUUA 1Y0LB 4X6DF 3H0TB 5T1LB 2G9HB 3ARVA 2YA0A 4PJCF 3TV3L 1QPPA 1JYNA 2G60H 4KK9C 1T1ZB 3K8LA 4RAHA 1LK3L 4PJEF 4MAYA 2VAAB 1KF9B 1TZHB 4HEPG 2VB5A 2VNCA 4FQLH 3HE6A 3T4YB 2BOCA 1L9MA 1KOAA 4HUNB 3ZT7A 5D1XC 3MFFA 1U8QA 4HZAA 1OAUH 3HZYB 3JTSB 3FCTB 2FBOJ 3KYOA 4G8IB 2VLKD 4PJBF 5K9QG 1JZ4A 2PO6C 3MRPA 1G6RH 3NVQA 5H2BB 1OT1A 2OL3L 4ZUVB 3C60B 3O9WA 3QEUA 4I9WD 4JFOA 1J0YA 3GSWA 1P7KA 4ZO8A 5JMRA 1EAPA 4NO5A 2D03H 2JCCA 2DMBA 1X3DA 4HUMB 5BV7L 4NZUL 4JRWA 4N8CH 1DFBL 1A4KB 4IIQB 3WEXB 4OAWB 4ENEC 4UTBH 1AE6H 4OLYL 3VFOB 4GRWH 5CD3B 4OLVL 3UPRA 3WHXB 1S8DB 2FBJL 3WIHH 4PYHA 1IAKA 3Q3GB 4CADA 3V6FB 1RZ8B 5HVHB 2Y23A 4NBXB 5ITBH 1T66D 3ZKQD 3S35L 1TXKA 3LMJH 4EDWL 3WLBA 1DUYA 4PGEA 3EIFA 2O5YH 3ARFC 1B0WA 1U36A 3LN5B 2X4UB 4LASH 2EDTA 5C0AD 4OFYA 4OZFH 2ESVE 4V1DB 3C6LD 3EO0B 1H15B 1J0ZA 4JN2B 4DFHA 1TJGH 3MLXL 2MCPL 4A6YB 3MACL 5JA8B 3BEVA 5I1LA 4HS8L 1RUAH 4XBEL 4U31A 3ZDXE 1FJ1A 5F1IB 2NXZB 1A7BA 2Y72A 3CVIH 4LHQB 3QPXH 4M62H 1W0VA 2GCYB 4AYFA 2JF1A 3LSOA 2XA3A 5J11C 2D9CA 3ZKMC 2ED7A 1B0GA 4E42B 4JRYA 4Z7NE 3WUZA 1A4JB 5D70L 5DJ2A 4YHLL 2PYEA 1F02I 3ILPB 3ULVL 4YXHL 3NPSC 2R0ZH 5E94A 1MVUB 2R0LL 4RX4D 2E9WA 3CSGA 4OCWH 5IBLD 5I1IL 3R06A 1CFQA 2YUWA 4L4JA 4ELME 5CSGA 4E5XB 3IDIA 4HUWA 5FF6B 1A6AB 4LCWB 4PJXA 1IAMA 2ID5A 5IVNA 5GJSH 3ZKSD 4XAKE 1JRHL 2VZOA 3V5KA 4QRRD 3VXSE 1EHNA 4LQFH 1MHCA 1CD1A 5IF0A 1BEYL 1PQZA 5L6YH 4FQCL 3GMNA 4Z95L 5IVOA 4YHYC 3MROA 2R29L 3U0WL 2VXQH 3EJYC 1J87A 1MCDA 2NYYC 3RVVD 3SE8H 1EH9A 3MOQA 3DRQB 4OCRH 3B8SA 2EDOA 3OKLA 5MI0B 2K7QA 5ESQA 2FD6H 4AM0B 4XHJD 2H1PH 1BHGA 3BN3B 3UBXA 3E6HA 1HE7A 1WBZB 4I13B 1ACYL 4M6ML 1MJJB 1TNMA 1CE1H 4GQ9L 2BNUB 2BVUA 5KOVC 2FHCA 1RJZA 2HT4D 5C0FA 4PRIB 1JPGB 1FFNA 1XIWA 5D9SB 2XZQH 1PAMA 4R2GD 3SDDB 3W81A 1JZ6A 1J05B 3PABB 1FL3A 4KK5D 4N0UE 1RJYA 3VXOA 5CJXA 2FH8A 1U3HC 1RIVH 2EDWA 4U1KB 2ICEB 2ZNXA 3QA3B 4GLRI 3IDMB 3RPKA 2VLJE 4NZTL 3GUTA 2NR6C 3KXFE 3S7GA 1KPUB 5E8DL 1EBPA 4UT6H 5I6XB 2G75A 4MB4A 1BOGA 1T5WA 4NQCB 1PKQB 1K4DA 3T3ME 5AAMA 3NCEB 4U4BA 4IOIB 4LCCB 3QIUB 3ZMRA 5I74C 2D0GA 4UQ3A 3WNNA 4QTHA 4MXQD 3ZKNC 3JBG7 4Z78B 4HKJB 4I0PA 2CDGB 3W39A 5D7IB 1YZZA 2VDLL 1CFTB 4CVZB 3ISWA 1G7IA 2A73B 1I8KA 2Z9TA 3IU4L 5EPMA 1RZKC 3WFDL 2AV7A 3BJ91 3UYPA 3MV7E 3S3JA 5MEPB 1T2XA 5I8CA 1M7DA 4OZGA 4RFEB 5D2NE 1BBJB 4XNMA 5A2KH 3JVGC 5IMLB 1BZ7B 1A5FL 2XQBH 4HKBA 4QXGH 2C3GA 4YNYB 4CN1A 2L4OA 3UTSE 2BX5A 1ZLUH 4P3WA 4N5EC 1FYTE 1V8HA 5JHDE 2ZKHH 3Q1SL 2HJLB 4JG1H 4JANA 1EFXB 4KDTA 3AXLA 3GBML 5HSFA 2ARWA 3VD3A 3CSYB 1AY1L 4XRCA 3MSPA 1YC7A 5H94A 4PJ7A 4ZAKA 2QKIB 1TTUA 3WFBL 2WBJB 3DXAE 4MJ6B 1YEJH 4XHQA 3TZVA 1RK0A 4OIBA 2VZUA 5DJ0A 3VA2C 2NXYD 5C7XL 4GOSA 4UMGA 1S7SA 4FZEL 4NRYA 5TFSH 4Z8FH 1QNZH 4LSPH 3QULA 3BIKA 3CVHL 4HFUL 1CVRA 5BQ7A 5MENE 3KJ6L 4PJAF 5IUSA 4H5SA 2EYSA 4RZCA 3CIQA 3KJ4B 3R1GL 5HHPB 3OR7B 2P5WA 3SPVA 4IRSC 2MQCA 1JNNL 2HT3C 2O26U 2Z93B 2ICCA 3H3PL 1J9CT 2J6EA 3QEQD 5IJVA 3OKMA 3QXAB 1D7FA 4Y89A 5HHQA 1IC7H 1EEZA 5GJTL 4OLUH 4ODSL 4XGZA 2A38A 1XR8B 3W2DH 5FAAA 1MJUH 4HWZB 5C0NC 5IMOB 3B9AA 4IRJD 4C54A 3NH7L 2VL5A 3WNOA 5HI3C 2X4PB 2MTPA 3QNXB 4RA3A 1ZT1B 3U4EB 4HPOL 3OJDA 2XXCB 4HGWB 4JB9H 1AKJB 4WDIA 5I16A 2W0PA 4JY5H 1JNJA 2C26A 3HA0A 4GKSA 1KN2L 2Z35A 3H7LA 4Y5VB 1MEXH 2A6JA 4HWNA 1IM3B 4P46A 4QHUB 3DETD 4NKIH 1N4XH 4UINH 4BUGA 2H32B 1CDYA 8FABB 2MOVA 5DHVH 1GGYA 5DJDA 3FL7A 1R3LA 1P4BL 3IJYB 5FDYA 4XMKL 4KAQH 1DBKH 3RJQB 1QVOB 2CUMA 1KACB 1KFAL 5F9WB 2NY4B 5IFHH 4NC0B 1UCTA 5C09A 1XF4A 5DWUL 4UDUA 1TVBB 3MA9L 3EYVB 5DQ9A 1DQDL 1G7LA 2CH8A 4JHWH 2DM4A 4GXUN 5FKAB 4RMSA 2F53A 1INEL 1EX0A 5BVPH 1IGYA 1Y6KR 1ORQA 4WI3A 4BFBD 2HLFD 4GAJL 4P4KD 2R15A 3S8WA 3SBWA 1RUPL 1NJ9B 1YEDB 3W9EA 4X99A 2ICWJ 3L3HB 4W70A 5ADPL 4WO4B 1GJIA 3F5WB 1NGWB 1XGPA 1OGAA 1QBLL 2ZG3A 4JFXB 3VCLA 1OSPL 5IVXA 1ZKAA 2H9GA 3NPZB 5EIIB 5KVGL 1X4ZA 2OL3B 5GGVY 4KZEH 2NY7L 4OQ1A 4U0RB 1WFUA 4XC3H 2X41A 2BVQA 5J06A 4LLUB 1J10A 5C08D 2NY1C 2HKHH 5FCUL 5D2LE 3C8KA 2Q8AH 4GH7B 4M6AA 5ICXB 3TP4A 4DFIA 1HSBA 1HXYB 4QRQA 1AGEB 3H3KA 3B9KD 3V4PH 1KXTB 1TTFA 4JQIL 3BSZH 1CTOA 4KRLB 3L9RA 4NZRL 5EA0L 5CBAA 1Q9KB 3SJVA 5T3ZH 3LRSB 4JFFE 2OJEB 2OMBA 3HZVA 3LPGA 3NIDF 1HDMB 2VH5L 5FYLD 4CMHC 1AO7E 2HFFA 1S3KL 4MA8L 3FB6A 5EU6E 2Q7YB 2P8PB 2Y5EA 3VXRE 1W2KT 3G6DL 1GCFA 1A6ZA 3LPWA 1G7HA 5CUSH 3HZMB 5KJRL 2NY0B 3IFLH 3MR9A 4WEBL 1DUZB 1A21A 3IS0X 5DD6B 4CVXA 5TPWL 4GMTL 3L7EA 4JFDE 1AFVL 4LARL 3BPOC 3MUZ1 2EZ0D 2IG2L 3V52H 5HHOB 4FQIH 2DQFB 1H3VA 3BUYB 5C0GB 1CR9L 3VRJA 4S1RL 2EXWC 2GY5A 4NQED 4PY7B 3PWLB 1S7TA 1U3YA 4U7KA 5DFVD 2GEEA 4HIEA 4N0FB 4N0YL 3QXWA 3TO4A 2MKWA 4NZDA 1VFOA 2LE9A 5ID1A 3VI4F 3TYGL 4P4RB 2YMXL 1K5NA 5BW7C 1D5XA 2WIMA 4XPAH 4D9RD 1T03L 1G9ML 4FQXA 1JGLL 4HSQA 4DQOL 4EI5B 5IBUB 1OM3L 2R39A 3O2WL 2FLRT 4GXVL 2YZ1A 4LNVA 4B7IA 1N3NB 3UTZA 5J6GA 3QJHB 4MMZC 5E08L 1BD2B 1MUJB 1BAFH 3QUKA 4BFIB 3LRHA 3GSXB 4LCYB 5HGHA 3VGFA 4I3SL 1T21B 1S7QB 1I1CA 4XCNA 1NAML 4QWWD 5FCSH 2DD8L 3RGVA 3V4UH 1LEKB 2QHRL 1FG9C 5I75C 4P2QE 1MCWM 5GRZA 1U0QA 5DR5H 4EVNB 1I7UB 1MCOH 5F6IB 1VCAA 4QRPD 2EDDA 2H26A 2VITB 2JIXD 3N1PC 4LCUA 2A6KA 4PGBA 4F2MB 2XQYK 4CVUA 3VGEA 4CU6A 3TA3D 5I1HH 4RAVB 1BVLB 4XAWL 5E8EB 3ARDD 3BGFB 4L8SC 1X7QB 2OR9L 1FLRH 2XFXA 3D9AL 4NDMA 2ENYA 3GSRA 3QCTH 4MNHB 1WFNA 5ESAA 4KKBD 5GSRB 4G80B 5C3TA 4JJ5A 1FZKA 1SYSB 3OV6A 5HY9A 3HAEB 3HMXL 4HXBH 1E28A 5DMIL 5AWNH 4MNQA 4B7LA 5E6ID 5CGYD 5BS0A 3D69B 1ZWIB 5E9DA 5EORL 3OF6D 3RL2B 1HHGA 4LEOA 3PNWA 2HFGL 4Y2DA 2NY5L 2IANB 1A1NA 3D2UA 2X4TA 4WHYH 1MLCB 1YPZF 5DJCA 5T5FL 1NGXA 4ZSOB 4HJJH 5DURB 1EIBA 1NSNH 3L5HA 4K71C 1K8DA 5C86A 5DGRA 4OCSH 1OAXL 2W0KA 2XN9B 1TJIL 3P4OB 1G7PA 43CAB 4I3RL 4ZPVB 5TJWK 3OXSB 3FQUA 1QYGL 2A6DA 1OOAA 1T0MA 4EN3B 4JGMA 4MNGE 4Y88A 4P5TA 1HXMB 4FZ8H 3LS5H 4Z7UA 5IHUH 3BO8B 3SE9L 4BUHA 3L5WB 4JQVA 4KJQC 3QUXB 4IRZL 4PY8I 3MNVA 4LLYA 3OAYK 1H5BC 1HK6A 4JPIB 1GOFA 4MMXC 1KLFA 3MRGA 4HXAL 1F4XL 4UU9A 3JTTB 4GAYB 5HXMA 4XVJL 2GSGA 2YZ8A 5AUMA 4GSDL 4YBQC 3MLYH 4HBQA 3V4VL 5CIPB 1ETZB 3BZ4A 4JPVH 2KZ1B 4NOFA 5F7HA 1YNLL 4Y2OA 2XTLA 5D96C 3MBED 3SDYL 1F58H 3OKEA 1Y6NR 2W9DL 4ZFOL 1WC7B 3CVHB 5DQJB 5FHBH 4HH9B 3QXDB 4H88H 1NCNA 1HQRB 1IGCL 5JQ6H 2VLKA 2DQIL 1S9XB 4P57B 1TQCB 3CNKA 4WWKB 3LD8C 4X98A 3ZT5A 4RGNB 1SJHB 1H8SA 4NNPL 1JWSA 4Z7VF 5BRZB 2I24N 5LQBH 1UM4L 3VFVA 1WISA 3HZKB 3HNSL 3O6ML 4MDIA 4KVNH 5HJ3B 4H0HB 1FNGA 2J1KA 5FYKL 2H8PA 4ALAL 1F6AA 4JFZL 3MUGA 1TENA 1QRNE 4YIQB 3RZCC 4I0KA 5FA3A 4J3TA 5I1DA 3EKCA 2EECA 4H0GA 3WJLC 5D1ZC 3AS3A 3VWKC 4X6CB 3X3GH 4Y4HC 3L7FB 4QHLB 5C0DB 3WL9A 2X4QA 3KPPB 3QEHA 4D9LH 4Q6IA 3QDGB 5DRNB 1XGRA 2DJSA 3P30H 4JCLA 5C0AA 2X44D 2UUDH 1QFHA 1BQUA 2FO4B 1RUML 3C6LA 3CLEH 1NBZA 5CFHA 1UWXK 1C7TA 1FVCA 3GSOB 5C07E 3G6JF 5ITFA 2DM3A 3F7VB 2YPLD 1IBGH 1SY6L 3TJHD 1J8HB 3P2TA 4JZNA 1QKZL 1AQDB 2B1HH 1F2XK 4U1GB 4PJDF 1GGIL 4HUUB 2JB6B 2Z91B 4E9LA 2XIDA 2NMSA 3VG9C 4ISVB 4MWFA 4UNVA 2J4WL 3RUGF 1VESA 1E4XL 2WUBH 3DRTB 3DYMA 2Y06L 5I0DA 3ZE2E 1GHFL 2YD9A 4GBXB 4C4KO 2BMKA 4YWGH 4DN3L 3PGCB 4HULB 2VQUA 3QB7C 4HW6A 1NCWL 1NUDA 1S7WB 1A0QL 2ZPKH 4I18A 4RX4A 1I85A 1KB5B 4FTVE 1U9KA 3F62A 4EI6B 1O7VA 2N7BA 2X05A 5HGGS 3NCJH 1KC5H 2XTJE 4POUB 3PL6B 4D3CL 1PW3A 4QRRA 4RNRB 2Q86B 1XCQB 1S78D 1V7MH 1DLFH 4L4TE 1A1OA 1OTUC 4HWEL 1HILB 5D7JD 4MDJA 1CICC 4ZFFA 3QYCA 2FB4L 2VISA 2PETA 3G5VB 1SMOA 3O3EB 4GG8A 4LMQE 5ENWA 2PO6B 5DRZA 4PJHE 1VERA 3L3OA 3HMWH 1F45A 1EEYB 4FQ2H 5EO1B 3TIDB 3IDNA 5KG9A 2CR6A 4MD4B 3FHAA 3N50A 2DAVA 1AR1C 2E7LA 2EXYC 1YEEH 3AC0A 5EIQA 1JYXA 3TT1L 3PIQB 4PTUB 2YR3A 3NIGE 9CGTA 1A3LL 3UZEA 4L8DB 2KKQA 3BP7B 3EDKA 3X14A 4APQD 1CGSH 2RR3A 2VZTA 3V9FA 1IT9H 3R0NA 1IC1A 3GSQA 1MELA 3DIFB 4MAUL 3S5LG 4PGZA 5E03A 3INUL 4WTWA 3IKKA 3IT8D 1JPTH 2V2WB 1CF8L 3G04A 1NAKH 1IGJA 2RCSL 3DMMD 5DK2A 1EO7A 2BY0A 3RWEB 3OWEA 2FGZA 2IPTL 5EZJA 4ZUTA 4Y4KC 3PF2A 4TUJA 1FGVL 3VFMB 5K9QI 5LVEA 3MV8D 3UDWC 2VRAA 3KWWB 1NBYB 3BHBB 1RMFH 3MGTB 2VDOH 2J5LC 3PV6A 2ORBH 3MJ7B 4PJIA 3QFDA 5J11B 4X83A 1NAMB 3H9SE 3LQMA 4H26B 3Q5TA 1W72A 2VABB 2EKSB 2P5EB 3HC0B 4RBPK 3TFKC 4OJFH 5C0CB 2AJUH 5C0BE 3NPSB 3VRLF 1LWRA 3AAZA 4JDTH 1UB6B 3OB0K 5E8NB 1KCLA 3UMTA 1BVKA 1XGUA 5HPMA 4ZUUB 4OD2B 4FQJL 4WJ5B 3ZT6A 2DQCL 4BH8A 4X4YB 1KCVH 4PY8J 1BFOA 5DHYA 4ZO7A 3F12A 4PP2B 5FO9B 4MQXC 1RURH 1MLBB 3S96B 1IRAY 3RVXD 2EDLA 3NFPB 2HKFH 5HGBB 4F9PC 1T1XA 3KNBA 3MLUH 5CMAA 5KN5B 4RRPG 3E6FB 4DUVA 4ZODA 3HNTH 3BW9B 3RRQA 2XKNB 3SKJL 5A2LH 2VLLB 4J3VA 3QI9C 4KHXL 4Z7WA 3RHWK 4WI4A 3M8OH 1TCMA 3LRGA 1I9IH 1HKLH 5TE7L 1CFVL 1QFWI 2W0FB 5JIKA 2K3TA 3MNWB 4HDIA 3KDMA 4XVSH 2VLMD 3R4DA 3PDDA 3BKJL 2MFNA 3QWOB 3VGHA 3LEVH 4XVUC 3CFEB 3QEQA 1AQKL 3VFTB 4PGDA 5A3IC 5GS1B 3O4OB 1UWEH 2PXYC 5IB4B 2GFBB 3LQZA 2IAMC 4KPHL 4NO3A 4PRHD 2QQKH 4UT9H 1U3HB 3MRMB 4IRJA 4OIAA 5GQBA 2BHZA 3IJSB 2CUIA 2DQHH 3QHZH 3WO4B 4X4XB 2R4RL 3O3BA 1KEGH 1DTUA 3OKKB 4WW2C 5FHAL 2D4FA 1U8OB 3OJVC 1KCSH 1AI1H 4QOKD 4U6YA 5FKPB 4L3ED 1NCAH 3HI5H 3VFWB 4XPFL 1JCKA 2IBZX 2DICA 5DUMH 4D2NA 1NEZG 1YEFL 3O6KH 5GHWH 2EEDA 1UB5B 2LU7A 4U1NB 4WFGD 1E4KA 1DBML 3OHXA 1YEHL 3PQYB 5JXEC 4Y16B 2DYPD 2VQ1B 2Z92A 3IJHB 2AK4B 2DTMH 2GK0B 1XGYL 2YUZA 3RWCB 5BJTB 4GW1B 3QDME 5L8JB 4LLDB 5GSVB 1JGEB 1JHTA 4I4WB 4P4KA 1DQLL 1RUQL 3SDCC 5IFAH 3AUVA 3D39D 4F37K 5KBNC 4ZFOB 4U6VL 3U9PL 3EYUL 4C59B 4FP8H 1YMHA 3VD7A 4WW1B 2BC4B 2I9LB 3SDXE 4K7FA 2IQ9H 4NM4H 3CPLB 3PWUB 5IVZA 4TSAH 3WKMH 3RWJA 2C3XA 1QFWM 43C9B 3VW3H 5C08A 3QDJB 1KB9J 4LU5H 4J6RH 3SKMB 3ZE1E 2R56H 4KQ3L 1I3GL 2Q1EA 2LABA 3MQIA 4EUPH 1YDPB 2MWCA 3DGGB 5IV2B 3B9KA 4OZHE 1NGQH 4HAFA 1KGCD 2CK2A 4Z6AT 1WVZA 4JKLA 3ZZ1A 3QIWC 3K3QA 4UUJB 4PS4H 1ZANL 2O5ZL 1P84K 3BN9D 1TVDA 2XKSA 1I3RA 1OPGH 3C5JB 5CINL 1CLCA 3S88L 3RU8H 4QNPF 4ODXB 3QCUH 5ILTH 4ZFGH 5J9PA 4C83A 5F3BB 1MVFA 2QQLL 2DWEB 5J7CC 2AQ3A 3M1BB 4Y19B 3TBSA 4YDJA 1QSZA 1CL7H 1FFRA 5IW6B 5EZLA 5EC2A 1CDJA 3QWQB 2AK1H 4J4PD 3I84A 3L3GA 4OGAD 2CIIB 5JORB 3JUYA 4L9LA 3S37L 5E70A 5C0IB 4TSCL 4JFPA 3EGSB 5L2JB 4NQEA 2F74B 3CZJA 3FOLA 4LPVA 4O51B 5GIRB 3CFJA 1XGQB 4AEHL 5GS0D 4MD5B 4KY1H 4Y1AD 5EBWA 1F42A 5IQ7L 1FAIL 2CKBA 4R90L 5HYQB 4XZUB 3A6CL 3QZWA 3CXDL 4K23L 4H1LB 5FO8B 3CAFA 2DBLL 1LP9F 4DVRL 2J3SA 12E8L 4RQQB 1KIUA 1YMMD 3NABL 1Z3GH 1YECL 4JZJA 1MWAA 3RNQA 4GUPA 3BP5A 2PTTA 2BCKA 4NRZB 4NKOA 4LAQL 3T8XA 4G6KH 2RFXA 2NW3A 1NL0H 5EBMB 1F4YH 3GEWB 5DSCA 2HJFB 1XH3B 3QO1A 2DLEA 4XP5H 5HGDB 2Y7QB 1P4IH 2AEQH 3H7BA 3V0WH 4DAGL 2BSSB 3G6AB 1ZTXH 1Z9LA 3FO2B 2BNQD 5C92A 4R26H 2R1XA 3A67H 4OF8A 4J1UB 5E8PB 5DDHB 3RBSA 4YFLI 5FUOL 1SBBA 3KYMB 3EYOA 2DB8A 4QRPA 2WUCH 1QBML 2JIXA 4HWUA 5LCVH 1G9NH 3DX6B 3GKWL 3TA3A 4IHOB 3Q5OA 3TCLA 2GJJA 3QNYB 3ARDA 4NYLB 4P3DB 3L3JA 3CLFL 1F90L 5ICZB 3GRWH 3WN5A 2W59A 4KUZL 4KKAD 2W0LA 5BZDA 1MJ8H 1RHHB 3LKPB 4X6EB 3RVUD 3ULUE 3CCHB 4KJPD 2VERN 3QQ3B 5E6IA 2VKXA 5CEZH 4U6HA 3UTOA 2DDQH 3OF6A 5B38B 1JGUL 5T3XE 2PYEE 4CMHB 1ZLSL 2Z4QA 4B0MM 2ZUXA 3PG2A 4PBWD 3F8UB 4NPYB 5EUOF 3T2NH 1JHLH 3GSVB 5JA9A 3MJ9L 3KLAA 3CGTA 4XPGH 4ZDHA 4KKNA 3H9ZA 4TTDD 3MRKA 4WFHE 3RWDA 2W60B 3QHFH 2YRZA 4AT6A 4G7VH 3BPOB 3S36H 5JO5A 3RPIA 2ZCLL 5MEQB 4PRBB 2BJML 3RDTC 5GGSY 5EOCJ 2J8UA 4M7ZC 4Z5RA 3GSNA 2X1OA 1T3FA 1FC2D 2HG5A 1HYSC 3UBXG 1JZ2A 3RBGA 2UWEB 4WY7L 1UXWA 3EFDH 5DTFA 1D9KD 2NTFA 5KVEH 1V7NH 4GAFB 1A1MB 2M26A 4X6DA 3PWJA 3QUYC 1AGDB 5D6CA 2UVEA 2X4SB 5F7WC 4PJCA 4R96B 3HKFA 5EOTB 3JV5A 3VXNB 4PJ5B 2HVJB 6CGTA 1V5JA 2AJZB 4PJEA 1N8ZA 1J18A 1A6PA 3P0VL 3BXNA 1KBGH 2FECI 1UQSA 2ZCKH 3THMH 1S9WB 4QF1B 2FWOA 3WJJC 1MIML 1NLDL 3K80A 4XCFH 5I75B 1UXSA 4ODBD 1JHKH 2BXYA 1T7YA 3HMXA 1KTLB 3ZDYF 3TH3T 2P46B 3MBEA 1MAKA 3I6KA 1CFNA 1EBAA 4LKCA 2AI0H 5LGJA 3CZFB 1DQML 2XWTA 3RAJL 2NTSP 3ILQC 5CJOL 5CZVL 4U1IB 4PLJC 1DBBH 3BMVA 5IQ9A 3O6LH 2V7NA 4O02H 4AIOA 1FP5A 4CKVX 1YN7A 1OP3K 5K33A 1RJCA 3FQWA 4BQCA 2KQNA 3L3DB 3TH4T 1WEJL 3OZ9L 3O2DH 4M5YL 1WAAE 4JR9L 4OD1H 1JF1B 5IEKB 4N90D 4BFGA 4NO0B 4ODVL 4PREB 2DLFH 1OCWH 2VXUL 1ND0A 3HI1B 5B4MD 4ONFH 1E6OH 3LKQB 3P4MB 3VXQB 1ZOXA 1WF5A 1EXUB 1EHXA 4L8BA 5KSAD 1M71A 1NMBL 1J11A 2OQJA 4AL8L 2IBBA 2ATPA 4FFYL 1QR1B 1WWAX 4E0RA 4LFHD 4IS6B 2YD5A 1NDGA 5B8CA 5C0JA 5ADOH 1FQ9C 1FZMB 3DX7B 4IJ3C 4XWOC 4Y5YA 3L1OL 4HV8B 4OLXH 4F58H 2G60L 4MA3B 2YPLA 1FRGH 3CFDB 2QR0A 4LF3B 5JPNB 4FQLL 4GRMB 4HLZH 3DTXA 3VFSA 3RTQD 3V5DB 4TUOB 4ELMB 1RD6A 5FK9B 1OAUL 4YC2C 1G6RL 4LQ1A 3VH8A 4XH2A 1A3RH 3VXSB 3TPUA 5L2KD 5F3HA 1KIPA 3T0AA 1SJVA 2Y1VA 3OL2A 2FJHA 4OGXH 3I50H 1SYVA 2P5WE 2AW2A 4NC2B 3MO1A 2C4FT 3PUCA 4UBDC 4N8CL 4KXZH 1KENH 1ONQB 4XCEB 1OWRM 5IMMA 4ODTH 3ARED 3SGJC 4UTBL 5DJ8A 3ZTJH 5F7KC 1AE6L 3FOMA 1JPST 1U93A 1VACA 5C6WH 3OKDB 1KPRB 1KIQA 5IROC 1M05B 1LMKA 1JGDA 2UWEF 3HG1D 3C6SA 4WU5B 5ACZB 3WIHL 3ARPA 3JWDC 5SWZD 1ZGLM 1R24B 3RVTC 2DJUA 2Z31D 5D7JA 5ITBL 2B4CC 4FG6C 3LMJL 4GG6A 1WIOA 5B3JE 2O5YL 2RB8A 4LASL 1OGTA 2VLRD 5MHSE 4IMKA 3REWA 4N0UB 5JW4M 4YAQB 3BGMA 2NNAA 4BH7A 4I0CC 2VAAA 5ID0A 1A2YA 1JK8A 1TJGL 2V7HB 3LD8B 4Y5XB 4YK4C 3FQXB 32C2A 4OFDA 1RUAL 4YHZH 2VLJB 4MQ7A 5IIEA 4KKCC 3KXFB 4W6XB 3CVIL 1A02N 2BVPB 3QPXL 4M62L 2LTQC 2PYFA 4AY0A 4XNZC 2GQHA 1PX4A 2B39A 1SY6A 5HYSB 4Y4FD 1JMZA 5IB5A 3U30B 5JW3H 3RVWD 1AH1A 3MRLA 1Q94B 2G5BB 4M1GH 5D70H 3S9DB 5I73B 4APQA 1T1YA 2EKJA 2CDEB 2F53E 1GPOH 2R0ZL 5TGBA 4LRNH 3ZO0A 4OCWL 5ESVB 4QEGA 4OAWA 1ED3B 3HCVB 4Y4HB 1V3KA 2DLHA 1B4JH 3MV7B 3D18B 1AP2A 4XXDB 3DMMA 5GJSL 4YHOH 1YN6A 5D2NB 4HG4J 3S4SA 4Z7QE 5AD0B 3EDDA 1KPVB 2DOCA 2ICES 5IVXE 2E6QA 5CHNA 2DQJH 4LQFL 3QNZB 5IB2B 1ZA3B 3T77A 3VD4A 3UTSB 3TNMA 5I71C 5L6YL 2GITB 3MV8A 5HD8C 1G1YA 1FYTB 5I1JH 1OY3B 5JHDB 3VFRA 3LN5A 2VXQL 1W72H 2UY6A 3SE8L 4G6FD 5INDB 5LAXB 3VG9B 3SEPA 4P5MB 3EO0A 1T2QH 1H15A 4MCZA 4OCRL 3WFCH 5AEAA 3ZDXF 4GMSH 3DBXB 3DXAB 1EHLH 4C56D 2FD6L 5IWLC 2R1WB 5F1IA 1JNHB 2AKRB 4XNXH 1Y6MR 1A7OL 2HJKA 3MGOB 1CE1L 2RAMA 3K0WA 3Q6GH 4Z7NF 2FYYB 4UB0H 4WHCA 3V5HA 3HB3C 3SJVE 2E6JA 4CAGA 1ZHKB 2NX5D 3QR2A 4X7DC 5DF0A 3WXVH 2CO6B 1MFCH 2FCBA 4MS8C 4HT1H 1HOCB 4N8VA 5EU5B 5MENB 1I9JH 4JFQA 4RIRB 4P2RB 4AMKH 5IJKA 1RIVL 5HHXH 4XI5D 4PJAA 2P47B 1Q9LA 4LLVB 4NKMB 5DEGB 1A6AA 2E7BA 3HE7D 1S7XB 5JNYB 1UJ3B 2VZSA 2X4RB 1CICB 1YYLH 5D1QB 4UT6L 3UYOD 3QQ9D 1RUKH 1GVIA 4GW5A 3PWNA 2P1YA 3H8NA 1OW0C 3P9LB 5FEBA 4XCYB 5CLTA 1GAFH 2XZCH 4L9DA 4HK3J 1WV7T 3KYKH 3ARSA 1MNUH 4JQXC 5D1XD 4DKDC 1HHIB 1Q9WB 3L3KB 3NIFE 2C1OB 3U48A 1M6OB 1P5VA 4LCWE 1G7MB 1I1FA 2WMPA 5KVDH 1EJOH 4PFEA 4ONOA 1NGYA 3UCRA 4Q9QH 1FAKT 1WBZA 4PRHA 3ARRA 3FFCD 4MAYC 3PDGA 4P23C