4LKCB

An antibody against the c-terminal domain of pcsk9 lowers ldl cholesterol levels in vivo
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
229
structure length
229
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSAIGTAGDTYYPDSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCVREGTYYHDSGSDNYYSYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of PCSK9 antibody
publication title An Antibody against the C-Terminal Domain of PCSK9 Lowers LDL Cholesterol Levels In Vivo.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2013-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lkcB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lkcB01
1KCUH 3SKNB 4KAQL 3RGVD 1UCBL 5DUBB 2PUQT 1FVCB 5E9DB 4KMQA 3IDJA 1A3LL 1MH5B 4PGEB 4YFLF 1X5IA 3TZVC 4QRSA 2FWOB 3O3EB 1RJZA 3MACH 4KK6D 1HILA 5T3ZE 5I1DA 4YZFE 3TM6A 4LQFH 4G6ML 3QDME 1UC6A 4G7VH 4MWFB 5IJVA 3NIGF 2BRQA 2WNGA 1U8HB 2EO9A 3D85A 3EO0A 4XNZC 3TJHD 5I16B 2CK2A 4DUVA 2VXQL 5KVDL 4RGMB 2VO5A 4ZFZA 5E0QA 1FC2D 5DO2C 5C07B 4ZD3H 2HFEB 4JO2H 1MF2L 4GUPA 3V6OA 2AK4D 2AKRA 4OSUL 3VDAA 2YD9A 1P7QA 4F2MB 2NY2D 1LDSA 5ALCH 4TVPE 1K4DA 5C70A 2NY3D 3MODL 5GS2D 5DUPH 1TTUA 3MLXH 4FQCH 3FO2A 1NBVL 4HH9A 5CCKH 12E8H 1JK8B 1MJUH 1XR8A 5J8OA 1QR1B 1DLFH 3L5XL 4KWUA 5E8PB 1BLNA 4LSPH 4M02A 1BHGA 4UOW1 4QNPF 4DAGL 2GKIA 3MRNA 5GGVY 2CKNA 2X10A 3BGMA 2APXA 4OZFG 1DANU 5IHLB 3STLA 3MLZH 2DDQL 2QTEA 2EIZA 4K7PX 4KZDL 1RZKL 3ZDZE 4NQDB 3QH3A 5DZNA 5DWUL 1NAML 3RNQA 1WBZB 2B1HH 3TA3D 4MJIB 1TZIA 3UJJL 2XZCH 3S4SA 3TESA 1WCBB 5BRZE 1CQYA 5C6TL 4OKDA 4OZIE 3TYGL 5CZVL 2DM2A 2O5XH 1A4JA 5SWZA 1IGIL 2W0KA 3PGCB 5T1KA 4NQSA 4W68A 4YDKH 1CD1B 2VISA 3TVMC 2NXYB 3EOYG 1NAMA 3BPNC 3RWDB 4Z7UB 4WI7A 4X0KB 4WEUD 4WUUE 1D5ZB 5HHOA 5D1QA 3LV3A 4BQ9A 2W92A 1I1RA 3AS0A 2D7QA 1OW0A 5JMRA 2WQ8A 3RPIA 1MCPL 1MHCB 3N9GH 4UQ3A 2OR7A 4HHAB 5DDHA 4BZ1H 4KPHH 5JA9A 3MR9B 2GFBB 2H2SC 4NUJB 5IF0B 1AHWA 2MNUA 4I0PA 1CN4A 4JY6B 1LP9E 4J8RB 4R7DB 4F15B 4J6RH 4N8CL 1ED3B 4JPKH 3RZCC 3WUWA 1WISA 3LHPH 3EJYD 2HVKB 4TN9A 5IQ7H 1N5YH 5C3TA 3OSKA 1MHHB 4JANB 5E4IA 1AH1A 4FQ2H 4JPWL 2KPNA 3CX5K 3ZKXB 1QQDB 5I1HH 2C1OB 3HNVH 5ITFA 1NFDE 4XPTH 4NN6C 1H9VA 5HDQH 3MCKA 1TVHA 1A9BB 2ERJB 1PG7X 2YPLA 3IDGB 3G6AA 2VITA 3X13B 2X9XA 2DTMH 1K8DA 5C0CE 1D5IL 1DBML 4X6DF 1DFBL 4CW1B 5CP7B 1KTDA 2G5BB 3BX7C 3WIFB 3F12A 3P77B 4RRPA 4LLYA 4R26L 5EFIA 2Z4QA 1XGYH 1QSFD 4LL9A 5GRJH 3W2DH 4GW4A 3FONA 4X6DB 4WEMB 1S5HA 4YUEL 1J18A 2LVEA 35C8H 3F7RA 3VFRA 1BM3H 4Q9RH 1RV6X 2VKXA 3NIDF 3O9WC 4DN3H 2BDNL 3GB7A 4KY1H 2AXFB 1IC5H 3L5HA 2HTKC 3X3GH 5K33A 3DMMD 3DURA 5BVPH 1B4RA 3GI8H 1CK0H 1ZHBA 4UAOC 5IMLB 5F7WC 1UWGH 3MA9H 4A2LA 2NXZD 2WW8A 1JGLL 4EXKA 3G5YA 2HAZA 3KPPB 3L3KA 1V3MA 3O8XD 2JF1A 3EYFB 3U6RA 3D39B 4GKOA 3IU4H 3FB7A 4LHUG 3KR3L 3LH2H 1AGDA 3Q0HA 4KKAD 5JLZA 4X80H 3E8UH 1A1MA 1IE5A 5IMMB 4G42A 1PAMA 5I19H 4MVBD 3W5NA 3L3JA 3MCLL 4IOSD 1FYTD 2BY2A 3IDMB 2FB4H 4QTIH 1S9XA 2F58H 2BERA 3C09B 4LSVH 4PGCA 1JPST 2VL4A 1MJJA 5J6GA 1F4WL 2R0LL 4K2UL 4RGOL 4Z7QE 4EEEA 1A0QH 2JJWA 4YJZL 1W72B 4TNVK 3TBYB 3TP4A 3QDMA 5EBWA 4O9HH 2DBLL 1MI5D 4XC1H 5DMKB 4FXGB 1CDUA 4M8QA 4R0LA 3SDCA 3BXNB 4OFYA 2I9TA 3FT3A 4JGUA 2RFXB 2AGJL 2FIRT 4XWGL 3VGGA 3GSVB 5TFSH 5FFLA 1FBIL 3QJFB 5CLTA 3I84A 1OAQH 2H32A 5IIEB 3HMWH 1W0WA 4YIQA 1S78C 4HMCA 1SBSL 5C0ND 2DQTL 3ULVE 2A2QT 3VFTB 4GG8A 2EDHA 4X9FA 1JV5A 3CXDL 5C09E 4POYA 4AL8L 4RAUA 3O3BB 1QSVA 4JHWH 4I77L 4F7TA 4UT6L 3MRLA 3VXRB 3ZL4L 1QFWI 4PGDA 5E2JA 1KTLA 2R1WA 1AXSB 5D7JD 3VA2C 2Y06H 2ITCA 2KDGA 3MV8B 4NP4L 4ZSOB 4I18B 2R9HD 3HMXA 4HWZA 4LLQB 2NY6B 4N9GA 2PW2A 5K9KB 2E3VA 3I2CL 3FZUD 1UZ6F 3BSZH 2V17H 2Y1VA 3HE7B 4P46B 3NPSB 4Z7OE 5EULV 2FLBT 4GFTB 2DM4A 1S9WB 4JG1L 4UB0H 1UXSB 4H0IA 3EOTL 2EKSB 1T21B 4XB7A 2XG5A 4YHZH 4ZPTA 5HYSA 1R5VA 3T09A 4P2RE 3MRKB 3PWVB 5CILL 3FO0H 4MD4A 2AJYL 1DP0A 4L8CB 2PF6A 2VAAA 1SVCP 1RUMH 3OPZH 5BRZA 5C0AD 1BX2A 5LCVL 1GGCL 1ZT4B 4D9QD 5C0GB 4OZIA 1RK1B 2P48B 4KVCL 3KPLB 1I4FB 4IRZH 2NW3A 4NO5B 1HHKA 3MGOA 3G6JF 3P9LA 2CDFB 2Y9RT 3UZVB 1A4KB 5EBGA 4G8FB 5D8JH 4ZUSA 4KKLD 5JOFA 1YYMH 5JR1L 1EEUA 1ZT1B 5IB3A 3TWCL 1C7TA 4NO2A 1OSZA 1M7DB 3INUL 4P5MA 3S3PA 2NY1C 3SJVB 1T3FB 1VFAA 4ZOEA 3QUZD 1IAIH 1T66D 2QSQA 4LVOC 5F89B 4NWTH 3W0WD 4PRHD 4WI8A 3EDEA 3O6FA 5EU3A 3JWNC 4KKCC 3GMRB 2VYRE 2F9BT 2AEQL 2DAVA 3VRIB 1LP9A 3TO4D 4EDXB 2CUIA 1UQSB 4OLZH 3HE6B 1YEKH 5SX4H 5CSBA 5FDYA 5F9JB 3ZTNL 3MRIB 1JPFB 3IDUA 5FYLE 4XHJD 1RVFH 4E41B 5C0RH 5DT1L 3L5WB 1G1YA 5DJ8B 5LXGH 1DVFA 3U9UA 3AMLA 3EYVA 1GL4B 4MGXA 5F93C 4Y19D 3IAQA 1TZHA 1NFDA 2F5AH 2ADIA 1KB9K 3CSYA 2R1YA 1JGDB 2BY1A 1KXTB 2AW2A 3M8OH 4L4TB 5BO1H 2Y5TB 5C0CA 1FE8H 3TN0C 3ARGC 1JTTA 3VXSA 1QPXA 3UC0H 3ULUD 4NJ9L 2AV7B 2K7PA 2VDPH 3UTOA 3NCFB 3STZA 2AQ3A 2DF3A 2R4RH 4ODTH 4OZGF 4BQBA 5IOPB 3DYMA 1J1PL 4PJFF 4PB9L 3CZJA 3P0VL 3BZ4A 4KJQC 3L6FA 1MFBH 1MIMH 5I2IB 3EYOA 3HAEB 1G9ML 5GRUL 3MV7D 1EXUB 2O61A 4MD5B 4XXCC 4N0FA 1QNZH 2R29H 4L5FH 1DQTA 4JQVC 4G3YL 4PJFB 8FABB 1CE1H 2QEJA 3F62A 3FQNA 2DQCH 1FFOB 3RTQD 3DJ9A 5K59F 1A64A 2PYFA 5ID1A 1H8NA 4CMMA 2E9BA 4W81A 2A6KA 2X4PA 1JN6B 1FZKB 3OKOB 5GGVL 5IBUG 4FMKA 5TGBA 5ACMA 2UZIL 2VXSH 1C5DB 4BFBD 3MYJA 5IB5B 1TJGH 1H5BB 5JZ7D 3U46A 3V0WH 4UDTB 2LTQB 4H26A 3CFCL 4LK4A 3FQXA 4OF6A 3S3JA 1X44A 3VA6A 4KTYA 5I1EH 5KZCD 3HRZB 4XNMA 1N0XH 3BKML 5SWSD 3S4SG 1F6AA 2QHRL 3SCMA 2NY5C 2F53B 2DI8A 1A6ZB 4HC1L 1IGYB 4U1SB 5HDBF 1F11B 1MFNA 1Q9KB 3BPCB 4HMEA 4XCNA 5HY9B 3RGHA 4QRQA 3BDYL 2F74B 3QCTH 3MFFB 3LKQA 4DZBA 1OP3H 3I6LD 2YR3A 4HZAA 3FOLB 3VXOA 1NC4A 3H42H 3OQ3B 4NQEE 5DHVA 5F3HB 3LEXA 5KSUA 5BV7B 1NDMA 4LPUA 5DRZB 2Y6SC 3L3GA 3P9MA 4MS8C 1CFNA 1SJHB 5C09A 5FV1L 5DURD 3DV4B 4HAGA 4UNTA 5F7EL 5GGTA 4O4YL 3DROA 3QUMA 2OSLB 5GJSH 4KTEL 3WUWG 1T4KB 1S8DA 1QVOB 2CKBH 3MOBH 1RURH 2ESVE 5TQ2L 5AAMA 1KELL 1C8PA 4FXKA 4MA8L 1UCTA 3BQUA 2W38A 1UB5B 1ZHNA 4HUWB 2X41A 3DUUB 3DVGB 2AEWA 4O5LH 1KOAA 4R97B 2NY0B 1A7NH 2DMKA 1JYXA 5FDWA 1IC7H 3GBML 1NCBH 4HK0A 1HCVA 4BK4A 5D7LE 3VD5A 3PDDA 3ARBB 4BSWB 2VUYA 1ADQL 5IBTH 3ZKMD 2XYCA 3KXFD 5HYEA 3ARZA 1U6AH 4P2RA 4R90L 4NQCD 2W0FB 3DBXB 2P1YA 4RRPG 1QSEE 4U6TA 4EN3B 1MHPH 3WLWC 3PV6A 5T1LD 1IZJA 1TITA 2VR4A 2BVOB 4IEFB 1IEBA 1PFCA 3SE4C 4LP4A 1KPRA 4D0CB 1JZ4A 1G7JB 1LK2A 4X4ZA 1XF2A 1A3QA 1NGZA 3L1OL 1J0HA 4R4NC 3DRQB 4ELME 4GRWE 3PWLA 5EU6B 4H20L 3IB4A 4LEXL 1L4IA 1MWAB 1WIUA 4BFIA 4WI5A 1IGTA 1X5FA 5DVNA 4PJ5E 2KUTA 1NMCC 3QI9D 3GJEB 2K1MA 3QIWB 1ZS8A 3LKOA 2IF7A 4GRLD 1QLFA 2B5IB 2OQJB 5IGXH 4UQ2A 4NN5B 3QO1A 5CJXC 2Z31D 1YEHH 4NRZB 5HVWA 1RI8A 4X5XB 3H6JA 4JM4L 1YNTA 1A02N 4XHQA 3R06B 1B3JA 2P24B 4D9LH 5I73C 4HXBH 5HHMD 3BP4A 1RJLA 2DS4A 1CCZA 3LOWA 2CO6B 4HKXB 3B3IA 4U1NB 1UT9A 3QO0A 3RIAF 4TOYH 4NJAH 3MQIA 3QEQD 4J7RA 2AJZB 2EXYD 1NMBL 2DQEH 5E2WH 2VXVL 2XZQH 3PGFH 5EOQL 5L7XH 1EX0A 1XT5A 4P2OB 1SY6L 5DS8A 1CLOL 3SQBA 5H2BB 2FR4B 3VD9A 2DN7A 3MUGB 4Y2OA 1P6FA 4OBRA 3EYQD 5CD5D 3LRHA 4GOSA 4WI6A 1XR9B 4DUWA 5HPOA 4JVWA 3FTGB 1ZGLM 3T0ED 3UTZA 3GSNL 1BECA 1P84J 1RK0B 2DLFH 3D2UB 4HULB 1AKJA 3KYOA 4PJHE 2B4CH 3NCEB 4YE4H 2A83B 4LRIC 1NC2A 3E6HA 4PLNC 5L0QC 1Q9LA 2D9QB 5I8EA 3AREB 2EE9A 5F96H 3HI1A 4HFUH 5E9DE 5CBAA 3U9PH 3X3FH 4KRPC 3C5ZB 4YHMH 1SYSA 2A1WL 2XFXA 2HT3D 1GHFH 4RNRA 3L3IB 4X7EC 4Y4FC 5CBEB 3HUJB 1T20A 2WUCH 3GJFH 4WO4D 3BZEB 1EK3A 2ID5A 5HGGS 2A9MH 4WUKL 4PB0L 1U3YA 1J1OH 4HUVA 3LS5L 3K4ZA 4HWEL 5D7IB 4AH2B 4ZDHA 1KT2B 5C07E 1DQLH 4Y4HB 3NIGE 4MAYB 5EZIH 3OJMB 4G9FD 4U7KA 4HQQH 3GKWH 4NKOA 3QCUH 3QJHA 4HD9A 3MRJA 1CDCA 4QHKJ 2Z35B 5HYSG 4CKVX 1OHQA 2HA1A 5I1CH 2SEBA 5AUMA 2HN7A 5B38B 3PGDA 3UMTA 1NDGB 5EUOB 5ALBL 3GM0A 5IM7A 3CCHB 3UDWA 3NA9L 3DYOA 3C6LD 1H3UA 4XBPB 1U8IA 4XTRD 5B39A 2VLJD 4MHHG 2D03L 1J87A 4HCRA 4M7LH 3GSOA 1CT8A 3OV6A 4XPBL 5E2UL 1X5GA 4MYWB 3STBA 1TCRB 4QY8A 1T7XA 4WHTB 4QRPD 2I24N 4PR5B 1T2JA 1ZA3B 4Z95H 1HSAA 3T2PA 1INDH 3UTSE 4OCLC 2GK0B 1Y0LB 5B21A 2QL1A 4B5EA 3F7YA 4NFDA 1XIWA 4NQDE 4J1UB 1YN6A 4QNPE 4DGYL 1KUMA 4Y5YC 1S7UA 3DHMA 4P4KD 5J13B 3RGVB 3WFEH 1VSCA 2E6JA 1FNSL 3QHZL 5ISZD 3SE3C 3T0WA 3PABB 2GCYB 4MJIE 1NJ9A 1A1OA 3MLRH 5KN5A 3LN4B 3SKUD 4NHCH 3CZFB 4PRAB 3OAUH 2ESVA 3FMGL 1RAMA 3PNWA 3P0GB 1T2QL 1QUNA 2W65B 1CQKA 1ES0B 2VDQL 5LWYL 2BCKB 2G9HB 1S7WA 5IB4A 3QNXA 4JN1L 3O9WA 1IEAA 5H37H 1CE6A 2C4FT 2GYSA 2E7LC 3U36A 5DI8A 5IW1B 4XBGA 5FF6A 5C9JB 5D7LA 5HGDB 1EEZA 4F57L 1CBVL 1N5AA 5TDOB 2Q86B 2PO6C 1OF2A 2AK4B 1RZ8A 3I6KA 1DQML 3UJIH 1GVIA 3KS0J 1F4YH 1KIRB 4CADA 3HC0A 3G04A 2Y72A 2NY2B 1BJMA 4DKFL 2VZVA 5D70H 4KDVA 2NY3B 4IHOA 4CMHB 1KC5H 1ZKAA 1QSEA 4L29A 1LO2H 1D3CA 3ILPA 3PJSA 4OLUH 2G60H 3V52H 5HVFB 2A77H 4EI6B 3EZ8A 1ZANH 2RHEA 1T7ZA 2V5TA 4OZHF 4KHTL 4X98B 2DJUA 3NCYP 5HDOA 3UJTL 2UWEB 3GI9L 3SKMB 1K6QL 4X5WB 1BIIB 2ZSVB 4ELMA 1U8OB 3GMQA 3KS0H 1DDHB 4LCCC 4PJ5A 4P99A 4P3DB 3BDBA 3C08H 4I4WA 3BH8A 3CXHJ 3TIDA 4GKSA 5EBMA 3QFJD 2GUOB 4PJ8C 4N0UB 1CR9H 3QIBB 4ZXBD 1FGVH 2X4QA 4M3JA 3TA3B 1NGPL 3QDGD 1U42A 2ATPB 1C08B 1RU9L 1EV2E 4X6DE 3TNMA 4LSRH 3BZDA 3I6GA 5E6ID 4F80A 3MROA 4NQXA 3SDAD 3VFMB 3RHWK 5HGAB 4NZUL 5IG7B 3OKNA 1ZGLP 1DJSA 2DQFA 3JV5A 3O6ML 4G9DA 4DVBA 1KCRL 3W9DA 2GY7B 4N0YH 1MUJB 4OT1H 3U7WL 1CZ8H 4YDJB 3BPLC 3I9GH 2LQRA 1NMAL 2IAND 5HPMA 4X83A 1FFNA 1NLDH 1T1XB 4K94L 4G43B 1F58L 4GS7C 3NIDE 1H0DB 2R0KL 3M45A 5GZOC 4FFWC 1F4XH 2EXWC 4YHNB 4X4XB 3LAFA 1LO3H 3NABH 4ERSL 4XNQA 4F33A 1BQSA 4UBDD 3SDDC 3D39E 5DVMA 1VGKB 1XGTA 3EGSA 2NQCA 3O45B 4PJHA 3VXMD 1N0LA 4U1GB 5EH1A 3GNML 3SKNA 1G9NH 4KHXL 1J88A 4OKVB 1FVCA 5E9DA 1BAFH 1JHTB 4UINL 4PGEA 4LARL 4OGAD 3TIEB 4OI8A 2EECA 3CAFA 2FWOA 3GGWB 3TH3T 4EOWL 3O3EA 5FO9B 3O2DH 4S1RH 4U0RB 3WUZA 2YS4A 5E94B 3DRTB 4JG0L 4AEIH 5MP6H 1G7MB 3PQYD 2ED7A 5MERB 1U8HA 5KS9B 3U1SH 5JORB 4DQOL 3CVHA 1ETZB 2WAHA 1SQ2N 3ELAT 4NN7C 5ADPH 1MY5A 3K1KC 1TJHH 2YZ1A 2ADFL 1A7BA 4YLQT 4HX1B 5C07A 2PYEB 4APQD 1NAKH 3RAJH 3MJ8B 2ZCHH 1ZHKA 1QSFB 4A6YL 1QFWH 4DKEL 5DD1L 1VB9A 1O7SA 1BQLL 1I9JH 5MEND 5LBSL 4O58H 2ADGB 1N7MH 5GGQL 3IGAA 1I7TB 1Z5LA 3QZWB 4U7MA 5IR1B 3DMMB 2FBJH 3VXRE 3FQTA 4TPRL 4DVRL 2W60B 2W9LA 3PHSA 1QR1A 1FH5L 3OR6B 3LB6D 2UVFA 5E8PA 4J3SA 1GIGH 3WD5L 2YSSA 1I3GH 3GIZL 1KLUB 1FO0L 1RIVL 1CXLA 2NXZB 4F58L 1NH6A 1AO7D 3MV8E 4ZSOE 2YD5A 4TSCH 4Q9QH 1KCKA 2LAGB 3ARFD 4IJ3B 3EFFB 2BRRL 5MHSE 1KF9B 1H8OA 1HN1A 3UTSA 4WIQA 4L9LB 4U6VL 1QZ1A 1G9EA 5FA4B 3QUYC 4NQDA 3GSXB 1OGTA 5LGHL 1UZ6E 1PLGH 3MRFB 2XWJB 4U7SA 1WBZA 1SM3H 4S2SB 3BKCH 2H2PC 3LMJL 1KJ3H 5CP3H 5TE4L 1FYTB 2QADB 3TN0A 3ARGA 3GKZA 3NN8B 1WCBA 4NNPL 2VR9A 3D0VA 1RMFH 1IJ9A 2D0GA 3T0XA 3JTTB 4X9HA 3HZYB 5DD0H 4HEME 5FYJE 2J6EL 1MI5B 4M6AA 4M5YH 4KTDL 1D7FA 1HHGA 1J05B 1D5ZA 4ZUTB 5EOTA 3G6JE 2B8OT 4LLMB 4F7MA 2J8UF 1K2DA 5DJDB 1MHCA 4PV9B 4XVJL 4I9WD 4JQVA 3I02B 1HYSC 5EORH 4HHAA 5HHPB 3VGAB 5E99H 4BELD 3MR9A 2IQ9L 5IF0A 5CJ8A 3BIKB 3DVIA 5D5MF 2C3GA 4J8RA 4R7DA 2DOCA 1AR1D 2LU7A 4XCFL 2JB6B 2J8UB 1ED3A 4XI5D 2D7NA 1S7RB 6CGTA 4FFZH 2R1XB 3WLBB 1R5WB 1CXFA 1S3KH 4NBZB 4XH2B 4JANA 1EHLH 4Z76B 5JW4R 5IVZB 1CD0A 1YEGH 5JUEL 3ARTA 1JFQL 5D7JB 4M5ZH 4NQVB 1NUDA 1FDLL 4AENB 4PP1C 1QQDA 2C1OA 3DARA 1EHAA 3WFBH 5GS0L 1NGXA 2COQA 3FQRB 2OJZH 1CXKA 1MAMH 4OCRH 5L2KE 1ZLUK 1B0RB 3FQWA 3WFCL 5IB1B 3QWRD 4ALAL 3X13A 1HQRB 4ZS7H 4WW2F 1GCFA 1JNLL 1M71B 1A5FL 1ACYH 4CW1A 1FL6B 4D8PB 1NSNH 2FGWL 4U3HA 3WIFA 4ZAKD 5T1KD 5IHZA 3U2SB 3E6FA 3P77A 4PY8J 3WEXB 2HT4D 2IPUG 1I1YB 2VERN 4WW2B 3GSQB 2FL5A 5C0AB 2HFGL 4HMDA 4X6DA 2QKIA 1N6VA 5HHOD 2X5PA 3DWTA 2ZZUT 1UCBH 5A2KH 3RWFA 4M1DL 4ESKA 3OXRB 5TE7L 4JHAL 4UT7L 3FOMA 2EIEA 5FGRA 1T7YA 4OZGE 3WJJC 1P2CB 5EZJA 2NY7H 4PJFE 5E5MB 5IMLA 4OF7A 4OIIH 1K9TA 5B39G 4TSBL 4G6MH 3DX6B 4TTDC 3QUZB 1EZVX 5J1AB 3KPPA 3W0WB 4PRHB 5F7MC 1ONQB 4PJBF 5T3XH 3EYFA 3D39A 1JCKA 2VXQH 1MCEA 3PWUB 3TNNB 2H6PB 4EVNA 1A47A 4LU5H 4Y1AE 3TO4B 5K59E 3MNZB 1ZVSB 1G7LA 1U92B 2DQJL 5E95B 5DZOA 5IMMA 4U1IB 5GRVK 4PJBB 1G7HB 3X14B 1CF8L 1A9EA 5E2VL 3BN9D 3UEZA 4QCIA 4UTAL 2DWDB 5EC2B 3MODH 3ROLA 3V6BR 3UAJC 2BSTA 2DLHA 5IT2L 1X5YA 4Y19B 1W72A 2AJXL 5J0BA 4HEPG 5DLML 3L5XH 2B1AH 4AIOA 2L4OA 5DMKA 2EEAA 2VDOL 3PDOB 4FXGA 2UYLA 2WK2A 3BXNA 3UP1A 4DAGH 2RFXA 4MA3B 4WDIA 3CFEB 1DL7L 5I76B 4JB9L 5HDBE 25C8H 4L3AA 3C8KB 3PIQB 2YXMA 1I7ZB 1S7SB 2FJGA 2ZG1A 4MLSA 2DDQH 4G7YL 2MCG1 1RZKH 2ZPKL 1DBAH 3VFTA 5DWUH 3U30B 1E4JA 2EE2A 4GT7A 3P4MA 3T1FB 1N8ZA 1OP5H 4XC3H 3S37H 1AY1L 3O3BA 4YFEA 3MUZ1 3MV7B 5C6TH 3MGTB 4YDVA 2V5RA 3VXRA 4YHYC 1FP5A 1NLBH 3IJYA 4K8RH 3TYGH 4EI5C 5CJXA 1IGIH 1AXSA 2GJ6E 3T1WA 1CU4L 2UZYB 3K2UL 2HRLA 1J7VR 2WBJC 2XY2A 3RTQB 1JGVH 3MV8A 1QRKA 3CDGA 3RVTD 1M05B 5ACZA 5IEHB 4ZSOA 5SX5H 1PZ5A 3BP5B 4Y4KC 3FRUB 4LLQA 4V2CB 4FQHA 3VFWA 5K9KA 5KG9B 4P46A 4ZQKB 5LAXB 5JXEA 4M7KH 1ZMYA 2IH1A 1S9WA 1UXSA 4KDTC 1DN2A 3FHQA 2EKSA 1T21A 5T3ZD 3WV0A 5D96B 2V5SA 3MRKA 3QDMD 1DN0B 3PWVA 1X5HA 3QEGL 3HTLX 4JY5H 3QQ3B 4AZ8A 1KJ2A 4P23B 4L8CA 1CGSH 1Q1JL 2HLAA 1E27B 5KZCB 3V5KB 1ZT4A 3QA3A 5C0GA 1FIGL 4M8VA 5SWSB 4P57A 1RK1A 3AS1A 3MOAL 1I4FA 4QYOB 1JPTH 2D3VA 3BPOB 1P5UA 3K8KA 5I15L 4LRIA 4AG4L 3PE9A 4IRSC 3RVWC 4H1LB 4M61B 5EUKA 1UH4A 5TPWH 4FA8A 4HS3B 3KDMB 1M7DA 4K55A 2WWMD 2X4TB 5EU6E 5L8KB 3G6JA 2CRZA 2IPTL 1UH3A 2EYRB 1WWAX 5F89A 4PJXF 4PJCB 5I6XC 3BH9A 4ODVH 1CLCA 5IK3B 1D5IH 1DBMH 4RWHA 1DFBH 2AVGA 1KIQB 3ZMRA 1B6UA 3VRIA 4R96A 3MV9D 1GSMA 2ZUQB 5HI4C 3SQOL 4M6NH 1UQSA 2H1PL 4R26H 3MX0A 4PJXB 5F9JA 3QIUC 1JPFA 3DHJA 5ADOL 3GMNB 4DWHA 4YUEH 2VDNL 3VG0L 4S1SL 3L5WA 4WHYH 3O8XC 3S36L 2BDNH 3L3DB 5IUSA 1OAKL 2IJ0C 5KSAD 5L2KA 1XFPA 2QLVB 1CIUA 3IDYC 3KHQA 5ICXB 1L0QA 3BD3A 1F02I 4ZPVB 4MVBC 1JGLH 3V7AE 2FX9L 3ARVA 3LKSB 3LRSB 3KXFB 3CMOL 1QFPA 3RU8H 3FB6B 3KLDA 1DBBL 4NQCB 3F7QA 4FABL 3KR3H 3CIQA 1RHHB 4WU7B 1V3KA 15C8L 3RVUC 3KVQA 2YD3A 5IOPA 2AJVL 4FQ1H 1DBJL 1BBJA 2K3TA 3MUJA 1AQKH 3GHEL 3LZFL 5T1LB 4RZCB 5CJQH 1BIHA 5I2IA 2RGSA 4GG6F 4TNWK 3O6FD 1JTOA 1EXUA 3DNKA 4HIIB 4MD5A 4Y5YA 1G7PB 1A6WL 1F4WH 4K2UH 4OZGA 3I75A 4RGOH 4PJFA 3WXWL 1ZA6B 4DN4L 8FABA 3SE3A 5ESQB 1IT9L 4HUXB 1JTPA 1JF5A 4WHDA 1H3PL 1I1AC 4GG6B 5JNYB 5E00A 3QI9B 5E8EB 3W39B 4QLRA 5AG9A 2P44B 1F3DH 3OKOA 1JN6A 1FZKA 1N4XH 3U4BH 2AGJH 4GRLB 4XWGH 1DVFD 1HKLL 5D2NC 4Y1AA 3SDYL 2QQKH 4J3OC 2Z31B 1AI1L 1H5BA 1S7XA 4YPJA 4UDTA 3QEUB 5BMFL 1RJYB 2OTUA 1SBSH 4GW1B 3WN5C 2R9HC 3RDTC 3B9KD 1NGYA 1IQWL 3FFDA 2ZWLT 1YMHA 1R3LA 2DWEA 4HKJA 5HHMB 1ZVYA 3SBWA 5C0CD 1TZGH 4HDIB 5DJZB 3R8QA 1QD0A 3V4VL 1MCWM 4I77H 4UT6H 3VXSD 3MRRA 3QEQB 1V7MH 1A6ZA 1BEYL 1IGYA 4U1SA 1F11A 2ZNXA 3LQAC 3L3HA 2VQ1B 5HY9A 2XQYG 5HD8C 1X5JA 2WUBL 3RUGF 4CVXB 2YKLH 5A16A 2YZ8A 1OLLA 2VUOA 4MXVF 3S35H 3BRDA 4OLWH 3FOLA 4WI4A 1T83C 4TQEL 1BBDL 4JG1H 1P1ZB 3T0EB 4PY7B 3RUGB 2J5LC 1FG9C 1R6VA 2H9GA 4NM4L 3ZYJA 1U0QA 2VIRB 4LCCA 2X9WA 4OZFB 2YA2A 4NHUB 5HYJD 5FGSA 3DV4A 1EJOH 5GGUB 2AJYH 3TH2T 1E6JL 3MBED 4ODHH 4KK9D 1UWEL 4OCYL 5LCVH 2CSPA 1T4KA 4MCYB 4PJ8A 3DSFL 2XKNB 1L9NA 1NEUA 4LHQB 2GJ6A 4KVCH 1EA9C 4L8SC 4ORGB 3WKMH 1AGFA 1G1CA 3QG7L 1X7QA 1FAIL 5DVKA 3DUUA 1OCWL 3RWEA 4WO4B 4HGKC 3H2WA 1IEHA 3SE9H 1T1YB 1VACA 3RVVD 4JVUA 1HDMA 5HDLA 1ZOXA 4CU7A 3INUH 3T04D 4TRPL 1H3VA 1A6AA 4LPYA 4BSWA 3S8WA 4O2EB 1P53A 1HNGA 4G9FB 3RA7L 3SCMD 3G5VA 2JK5B 1EBAA 4Q6YA 3IXTB 4K3DH 5EC1A 5AAWA 2AEQH 4LDLB 4JFYB 4U6YB 3KNBB 2W0FA 4MQXC 2XI9A 2GQHA 5GRVL 1BQUA 2DBJA 4CVZA 2K9UA 1PY9A 4FTVD 5GSRB 3V2AR 4N9OB 4XVSL 1XGUB 3D1MC 3C9NB 4RQQB 3SDDA 3C6LB 3GSWA 4LVNC 3QDJD 7FABL 4FXLA 1NC4D 2BVOA 2VLJB 5DT1H 1CDJA 5IV2A 3UX9B 5GSVB 2XQBL 4CGTA 1CDYA 1G7JA 1JWSB 1LMKA 5ID0B 3DRQA 4QRPB 5C09D 2GITB 5C0IB 3R1GL 5EU6A 4DTGL 2AV1B 1MWAA 2A74B 5EZLA 4OZHE 1MAKA 4U33A 5DMIH 4JEGB 3GJEA 2Y07L 2H26B 4JRXD 5JPNA 2D9CA 2OQJA 1P4IL 2YUVA 4P4KB 3QPQC 2XY1A 2PXYC 3WMSA 1MFDH 4NJ9H 2ATKB 4NRZA 2ZOKB 4UTBL 5ISZB 1W0VB 4XMLL 3L5IA 3SKJL 4JAMB 2NW2A 3R06A 4KDWA 6FABL 4LSUL 4GBXD 2EH7L 4OM0L 3LS4H 3KPSE 2VKWA 2P5WD 1J1PH 3CH1A 1OT1A 5I75B 4JZOA 1RZJH 4Z0XA 4KRNA 5MEPB 4U1NA 5KTEL 5IROC 1KCUL 1KENH 3RZWA 5GQBA 1HINL 1E6OL 3MSPA 4R2GC 1QKZL 2DKMA 4G3YH 1HZHL 4HAFA 2CPCA 4N0CC 5ESVA 4P2OA 2HTLC 4UV4L 1KB5A 5C0DB 5H2BA 2F5BL 2FR4A 3MUGA 5ILTL 1OD7A 2DJSA 5J11B 1B0WA 5GGVH 1I9IH 4G7VL 1J1XH 4PRDA 3GK8H 3QISA 1RK0A 4CVWA 1P7KB 4HLZG 3TZVD 3DYPA 2HKHH 4XAKD 1IAKB 4ZD3L 5AEAA 3VFOB 1A8JH 2V7HA 5KW9L 3UTTB 3CC5B 3AROA 5HGHB 4P59H 2G75A 2CDEB 5ALCL 4ZNEE 2VQTA 1WZMA 1AP2B 5DUPL 4ONFL 4HC1H 4RIRA 3SE8H 1UEYA 12E8L 4PBVC 5CBEA 4XAWL 2VAJA 5FYLD 3BZEA 3BDYH 5DO2D 1DLFL 1U95B 4LVEA 3U48A 3QFJB 1TVBB 3VDCA 4LSPL 4ZXBB 4NC1C 3QT2A 2WLZA 3QDGB 1QSFE 5I30H 5CEZH 1UM4H 4HJ0C 3DI3B 1OAXL 3IAPA 2Z35A 5E6IB 1NGWB 4WFGD 2VDLL 4R3SA 3SDAB 5B38A 1BQHA 3MLZL 5DA0B 1NDGA 2W0PA 4S1QH 1FCGA 1IARB 5F7EH 1CICC 1FZOB 3CCHA 2C1PB 3VFPB 1ULVA 3V5HB 4KTEH 4X4ME 4EZMA 2IANB 5TQ2H 2B1HL 3KJ6H 3PP3K 1FCCA 4MA8H 4AM0B 5BJTA 3L9RA 4FQLH 4PREB 4OUUB 2DIJA 1R0AH 2DB8A 5JA8B 4WVRA 1MCCA 3REWA 4JRWA 4JHBA 1KPVB 5I9QC 1ZA3A 2J2ZA 2M1KA 1TDQA 1DZBA 3QDAA 1Q94A 3HB3C 2F8XC 3TH4T 2GK0A 1Y0LA 2CIIB 1R3HB 1ITCA 1ADQH 3K81A 5DQJA 3MBXH 3VXMB 3TT3H 1DQQB 4P49A 4QOKD 1U8KB 3VMPA 3CDFA 4FMFA 5DFVC 2EC9U 3N9GL 1FYTE 2PTTB 4BZ1L 4KPHL 1H3GA 5DEFB 2XZZA 3CZFA 4ZODA 4OLYH 2NNAB 2L7UA 5LGKA 3TVMD 2EDJA 4DK6A 1YC7A 3P9WB 1XMWA 2W65A 4PRBB 1ES0A 3PQYB 1MI5E 3LHPL 2BCKA 1OWWA 4WJ5B 4YBLC 3SDXF 3RWGB 1FN4A 3L1OH 3DX7B 2XQYK 4H20H 2LFGA 4FQ2L 4KJYB 5C9JA 5DHYB 4MXQC 4ZNCD 2H2SD 4APQB 5I1HL 1NBYB 3HNVL 3WS6C 4Z77A 5TDOA 4YH6A 3SDXB 4JO4H 4XPTL 5MI0B 1GOGA 3KJ4B 4GAYB 1KIRA 3RZCD 4ZFFB 2X4NB 2I60L 5FA3B 2LV4A 5MENB 2DTML 1L6ZA 4IDLA 4OFDA 5D7SL 2J8UE 5EA0H 2HWZL 3NCMA 3WKNA 4EI6A 1MFEH 3MFGB 4YHIB 5JIHA 2X70B 4OLEA 1WWBX 1T0NB 5D5ME 5EU7C 3SY0B 1SBBA 3WS3B 1JIBA 5IWLA 3VFUB 1PVHA 4AJ0A 1UWXK 5DD3L 1AO7B 1U3JA 2YPVL 2ICWB 35C8L 4X5WA 1BIIA 3ARFB 1GOHA 1BM3L 2EDFA 2ZSVA 1U8OA 1WBYB 3PV7A 4YEFA 1NMBH 1DDHA 4OZHA 2VXVH 4C4KT 3IDJB 5EOQH 1IC5L 4P3DA 3VG9B 4ENEC 5BVPL 1UXWA 1EGJL 3GI8L 1HILB 3ZE0F 2GTZA 2Y4SA 5I1DB 1IGFH 1UWGL 2GUOA 2OBGA 4WEBH 2BNQE 3ARYA 2E9IA 1R5IB 5IJVB 3IETB 4XZUA 2OXGA 3AAZB 3TA3A 1INEL 3GSNH 5A43C 4KJWC 3SKOB 1C08A 4PUBL 2DLEA 3KPSA 3O9WD 5C0AE 2LE9A 4D9QE 1Z9OA 4PPTA 1YQ2A 4ZFZB 2HTKD 5I8OL 5D7LD 5HGAA 4JVPA 5IG7A 4N5EC 5L8LB 2FH6A 3KPOA 4O51A 2A38A 1JNHB 1MCNA 1T1XA 4QTIL 2FB4L 1H0DA 4X6EB 1T5XA 4LSVL 4NWUL 1CGWA 3FO2B 4HH9B 1OTTC 3UROR 3H3KA 3W0WE 4PRHE 3W9EB 4HWBL 2JTDA 4X4XA 5FAAA 1MCBA 4RCAA 4PB0H 3QCVL 4Q58C 4O9HL 3TBWA 1TVDA 3LS5H 4XC1L 4HWEH 4Y4KA 3SN6N 2X05A 2YA1A 3NAAL 3MRCB 5IJKC 5E1AA 5T5NF 3T4YB 2A73B 5ETUB 5IBUB 1B88A 4PJBE 4U1LB 1DLHA 3BGMB 1JHTA 5IHBA 3STLB 3TIEA 2WIMA 5ALBH 4HUUA 5K9JL 4QWWC 3NA9H 1V8HA 1LDPL 3K4AA 4Y19E 4ZNEA 2JELL 1H15A 5E94A 4U2YA 1OPGL 4XMKL 2Z8RA 1FZJB 1UVQA 3GIVA 4JHWL 3S4SB 5JORA 1TQBB 5F1KC 4ZFGL 4KVNL 1ETZA 5E2UH 3QXVA 1A4JB 3MREA 4BH7B 1S78D 4ZAKB 5T1KB 4HX1A 2V2WB 3MJ8A 3B9EA 4FQQA 2VXUL 1QSFA 3BSZL 2V17L 1NAMB 3HC3L 1QPPA 1TPXB 4YXLL 5HHOB 2EC8A 3LV3B 1HXYB 2O26U 2CUMA 3ILQC 3QHZH 3BI9X 3BO8A 5I1KH 5KOVC 4YHZL 5AD0B 5IR1A 4L3CB 4X4MA 5DDHB 1U3HC 3DMMA 3BP6B 5K93A 2FNBA 2W60A 4O02H 5FGBC 5F9OL 3FO0L 3OR6A 1JZ6A 9CGTA 1DBKL 1UM5H 1D5MB 3MJ9H 2ZUWA 1CIDA 3OPZL 3L7EA 3U83A 2VDQH 5LWYH 4NZDA 3EFFA 1G9NC 4QHUB 3NCJL 4IRZL 3O8XA 3LDBB 1FRGL 3AM8A 5T5FH 1IGMH 4UV7L 3MLWL 4Y89A 4ZO6A 5D8JL 2I25N 5T1MA 4L9LA 5EZOL 1FORL 1YYML 2YD2A 43CAB 5FA4A 3BEVB 4F57H 3S3SA 4WV1C 3SGDH 3GM8A 4YC2B 1CBVH 3RWCA 1JF1A 4LPWA 3MCKB 3N1PC 1RZGA 3G6AB 1IAIL 3PL6C 4NWTL 1FYTA 1K8DB 3NN8A 3BP7B 3VFVB 5ESAA 4ODUA 1S9YA 3CSGA 4XNYL 3JTTA 1QEWA 5KVMC 3HZYA 4LLYB 4LCYB 1JWUB 4OLZL 1YEKL 2JJVA 1MI5A 5F7KC 5IEKA 2NY1D 3TT1H 2A6DA 3FONB 3UJTH 1TNMA 2Q8AH 4KK8C 1S5HB 5C0RL 5CGMA 1RULH 1K6QH 1A6PA 4KI1A 3G9VA 5LXGL 1F6FB 3GB7B 1I8IB 3I6LE 4K9EH 4KKCD 5DJDA 2A0LC 5CINL 3O81A 4PV9A 3V7AG 2F5AL 3I02A 5HHPA 2EYTB 2IMMA 3HI6L 4F7PA 1I1AA 4UU9A 2JB6A 2J8UA 5BO1L 1NGPH 3G5YB 2R1XA 3SHSA 4PJXE 1FE8L 3WLBA 2D4FA 3QEHA 1RU9H 1K8IB 4Z7NF 2FECL 3S34L 2DLGA 3UC0L 2J8OA 4PRID 5CWSB 5DHXB 5IVZA 3LQAL 5D5MA 3CU1A 3UTSD 3FB7B 4NQVA 3KYAA 4NZUH 4GXVH 2R4RL 2VQUA 3O6MH 4ODTL 4AENA 3WN5A 1A1MB 3OKLA 3RDTA 3SGKA 4JKMA 4Z18A 1ZEAH 2FBOJ 1MFBL 4C4KO 3L3JB 3JUZA 5IB1A 1MIML 3RRQA 4K94H 1F58H 4HXAL 1S9XB 3F5WA 3TN0D 3ARGD 1KACB 4OFVA 1QNZL 4L5FL 4OGAC 1FL6A 4D8PA 2BNQA 3U2SA 4ERSH 3QDMB 3VW3H 3WEXA 3NPZB 1I1YA 4UUJA 4NQCE 4WW2A 3TV3L 3GSQA 4KJQD 1MCQA 4M8QB 1QBBA 5C0AA 3SDCB 3FT3B 3GNMH 4HJJH 2VXSL 4URTB 2QJDA 3OXRA 5B38G 1TJGL 1W0WB 3V0WL 4EOWH 1P2CA 2DJ4A 2UZXB 5C2BL 4FQIH 4LLVB 3RI5F 4Q0XH 5ANMB 4RAUB 5F7NC 3QUZA 2KZWA 4GG6E 2FSEA 3W0WA 4F7TB 4PRHA 3MRLB 4L8SA 1KTLB 3JVGC 4XB8A 3PXJA 2CLVB 2H6PA 4WFFD 2ADFH 3MV9B 1BJ1J 5C92A 3MNZA 1H3XA 1U92A 4HWZB 4N9GB 4A6YH 1YMMD 1IRAY 5FB8A 4PJBA 3WNLA 4QHMA 4RAHA 3WDHA 2DWDA 2Y25A 5EC2A 5HHME 4AYFA 3BJLA 5GGQH 3OKKA 4QXWA 1MRCH 1MLCB 3U7AA 1XGPA 4W4OA 3RJQB 4OM1L 4Y19A 4NZTH 4ZPTB 1R5VB 5KSAB 5C0EB 1D9KC 3E2HB 3QEQE 1MQ8A 1HHHA 4TPRH 1NQBA 5DYOB 2VAAB 3WD5H 2QQLH 4U3XA 3GIZH 1MHEA 5GJSL 1FO0H 1RIVH 1BX2B 4F58H 2MPAL 2GK2A 3MOBL 1FGNL 2CKBL 5J3HC 3V4UH 4OLXL 2BRRH 5EU7E 5DQ9B 5I76A 2ICWJ 2NW3B 2EDNA 3C8KA 2Y6SD 4O2CB 4ZUSB 1HEZB 1S7SA 3T0EE 4MS8D 4KUCF 5TF0A 3RUGE 2JJTC 3GMOA 5IB3B 5LGHH 4P5MB 1IC7L 2FGZA 4MXVE 1VFAB 3T1FA 4U4BA 3LMJH 2OL3H 4NUGH 3O6FB 5EU3B 1NFIB 2APVA 1WZKA 2PXYA 4Y16C 2OMBA 2PNDA 4FFVC 3I3DA 3RKDC 5E8OA 1R24B 3RTQA 5IEHA 2J6EH 1M05A 3BP5A 1F42A 1MHPL 4EKXA 5KSBF 1YEJL 3PHQB 2AQ1A 4JFPA 3FCTA 1DVFB 2ZNWA 5IROA 1UENA 4DUXA 4MXWH 3EYVB 1YYLL 4XVJH 2OP4L 5I74B 4PJEF 4G9FE 1QFHA 1DN0A 3HZVB 4O2FA 3QQ3A 3VWJC 3B9KB 1FLRL 3VXTB 3WLWD 1FFPA 3BZFB 4XCFH 5C0CB 1P69B 5IGXL 3PHOA 3VXSB 4QYOA 1YEHL 4YDIH 5J12C 5JUEH 3STZB 1JFQH 1JHKL 4R4ND 4LAQH 1FDLH 3S7GA 4D9LL 4M61A 4K71B 5GS0H 5JW4N 1IC1A 4HXBL 4QRPE 4ODSL 1F6LL 1GZPA 3O3DA 5JW4M 3LKPB 4TOYL 4NJAL 4P5TC 2O61B 3GFUA 4N0FB 1A5FH 3B9DA 4KMLB 4KQ4H 5IK3A 2PETA 2DQEL 4K3EH 4K8RC 5E2WL 2XZQL 1K5NB 1BOGA 1KIQA 3ALPA 3PGFL 1MCSA 4DEPC 3FQNB 4MJ6B 1JUFA 5GGRA 5C6WH 5ISZE 4PJXA 4WCYL 2XTJC 3MBEB 5ID1B 2Q76B 3DX9A 3CDYA 2HFGH 2A6KB 5CGYC 4UZGA 1GRWA 5TGBB 3KLHC 1PG7H 3RY4A 4F9LA 5IQ9B 2M2DA 3MYJB 3L3DA 2FRGP 4JHAH 4UT7H 3O4OB 5F9AC 4H26B 4YC2C 5F96L 1F3JB 2NZ9C 3KWWA 4W70A 1AQDB 4AIXA 1E28A 5ICXA 1F00I 3U9PL 2YPKB 3X3FL 4ZPVA 4X9IA 1CGYA 4XNMB 2VWEE 1GPOH 4YHML 3LRSA 1F6AB 1V5JA 4G8EA 3SCMB 5FYJD 2OTWB 1FHGA 3UYRL 4XCNB 3RIAK 2IEPA 1RHHA 4QRQB 5FM4A 4PBXA 2A9ML 4FTVB 4OCWH 1VPOH 1J1OL 3LKQB 4DZBB 4KRPD 4QRUA 3QDJB 5T1LA 1VDGA 2MWCA 4RZCA 3VXOB 2XKUA 1NC4B 3DOSA 1IM9A 1C1EH 3H9SE 5EZIL 5KSUB 3LEXB 4HIIA 4HQQL 1NDMB 4ONHA 3O6KL 2XV6B 3L3GB 1U93A 1BWWA 2E7BA 2YD7A 5I1CL 4Y4FD 4E5XA 2AJXH 5ESQA 4GAFB 5C09B 3SOBL 4HUXA 2GI7A 4RWYH 3GJFA 4GG6A 2ARJQ 3DROB 1JE6A 3QB7C 3SO5A 3W39A 4JRXB 1DL7H 4W6XB 1YQVH 1I85C 4FXKB 3HA0A 4JB9H 1KN2L 5CKGA 3A67H 4G6FD 3EAKA 1ZHNB 5HVGB 3FFCD 3R0MA 3QEUA 3QDGE 1RJYA 5L2KD 4GBXB 3UZQA 4TVSa 2ZPKH 3EJJX 1QLEH 3ARDC 1W8NA 2P5WB 3S98A 1INDL 4HK0B 1AY1H 4C83A 1J8HA 5BW7A 3QEQA 3WFEL 2VQ1A 1CU4H 2AXGB 3UYOD 2C3XA 4NHCL 5C7XH 4OGYH 4G6JH 4M7LT 4RMTA 3HHRB 1CL7L 3VJ6B 2WV3A 1EO8H 1RZFH 1U36A 2CO7B 2V9TA 1ZT7A 2MFNA 5E70A 1KPRB 3T0EA 5DK0A 4PY7A 5IB2B 3RUGA 3UPRB 4J3UA 5ELIA 5D1XC 5IW6A 3CNKA 1XF2B 5CIPB 3VXME 4XVTH 1PQZB 3CGTA 1AC0A 3PWLB 3ISWA 1TXKA 3QEGH 3TZVB 4BFIB 2IBGA 1ZLSL 4RBPK 3WNPA 3UJIL 2V5MA 1FIGH 4MCYA 1F4YL 5FYKU 3LKOB 3EBAA 5CEXA 1MELA 4ORGA 5D70L 3QO1B 4Y1AD 2BVQA 1IAII 4XNZB 3PQYE 2G60L 3TPUA 1ZANL 5DMJB 4TUOB 4J23A 4WO4A 5K9QG 3D25A 1T1YA 3BT2H 1RJLB 1QRND 2PO6D 5C0BD 1GJIA 3B3IB 2IPTH 4LFHD 3MRDB 3FAXA 5IVNA 3QO0B 3F8UB 5SX4I 2H41A 4O2EA 2AXJA 3SDXE 4G9FA 2HMIC 3QHTC 3IXTA 2ZUYA 1OARL 4WI2A 3KNBA 2BFVH 5MENE 3PWPE 1J0KA 5DRNB 3C08L 1P5VA 1K4CA 5GSRA 3TF7C 2J3SA 2H32H 3C6LA 5ADOH 2DD8L 1JZ8A 2VDNH 4N1CA 3VG0H 4LCIL 4S1SH 4RMQA 2CQVA 1WAAF 3UTZB 3S36H 3KYOB 4LSRL 2BVUA 3EUUA 3E6HB 5C08E 5ID0A 1Q9LB 4QRPA 4PIRF 4RISH 4WI9A 5I8EB 2FECI 4QHNA 1TNNA 1ZTXH 2AV1A 2A74A 4PJ7F 3QQ4B 4CDGC 1CD9B 3Q6FB 2X44D 4JKPH 2EYSB 1CZ8L 4PJ8D 2FX9H 3ZKNC 1SYSB 3LPGA 2GJ6D 1NLDL 3CMOH 3HMXH 4P4KA 4QOKB 1OAYH 5CJOH 4RNRB 1F4XL 2ZOKA 5ISZA 1XGRA 1LE5B 1DBBH 1W0VA 4D9RE 4JAMA 1T20B 2R69H 3NABL 3KYKL 3WIHH 3ZE0E 1Z9MA 4C57C 4HUVB 5BOZG 3GHEH 3DO7B 3TVMB 4J3XA 2GJZA 2VABB 4HFWB 5MEPA 4FQXC 3BPNB 3CFBB 43C9A 4NKOB 4ZTPH 3BJ91 3QJHB 1ND0B 3ORJA 1A6WH 5GZOD 4FFWD 1BAFL 3TBVA 2SEBB 4HIHA 4MCZA 4MA7L 5DR5H 5AUMB 3IJSB 3ULSB 5C0DA 3BWAB 4N8PA 1U3HA 1QA9A 3O2DL 5JPMA 1E0OB 5EU4B 3SDDD 1MCIA 5FGBA 4I9WE 3S5LA 3D0LB 1U8IB 3V6ZA 5B39B 5F88B 3T2NL 2RCSL 5AZEL 3RZCB 4MA1C 5I71C 1SJXA 3GSOB 1BD2D 1AI1H 1P7KA 4F8QA 4QY8B 3J7HA 3JUYA 5ADPL 2V2TB 4YHPA 2BOBB 1F97A 3EFDL 5GISL 4BSVA 1NAKL 3RAJL 2X4OA 1HSAB 1LO5B 3H9SA 3O2DA 4WV1A 3VFOA 2ZCHL 3IXAB 1T1WB 1UADC 4EUPB 3U82B 4ETQB 4NN6B 4AEHH 1J0JA 4BUGA 1YN6B 2FX8H 1S7UB 5HGHA 3DPBA 2CDEA 4CNIB 4O58L 1BEYH 1AP2A 1N7ML 3MA7B 1G6RL 4F7EB 4NNYA 1A1OB 1N59A 3F6IA 2IGFH 1ZLUH 2WUBH 1B90A 1NCWL 4QXGH 1U95A 3BD5A 3PNWB 1GIGL 3PXHA 1TVBA 1I3GL 4GO6B 1PEWA 1RZJC 4QXUH 3IFPA 1Q9WA 4TQEH 3VD7A 4ZXBA 4TSCL 4Q9QL 5IB4B 5EPMA 4WGVB 2ZUVA 3O9WB 1NGWA 4MX7B 4XBGB 3PWNA 5D7LB 1IFHH 2ORBH 1KNOB 1EO7A 1FZOA 2C1PA 2HG5A 3VFPA 1N5AB 1OF2B 2AK1L 4UAOB 5DJ2A 3V5HA 1RZ8B 1PLGL 3SO3C 4HF5H 4HJGA 3DSFH 5J06A 4CADB 1IKNA 3HC0B 1SM3L 1EHXA 3BKCL 5EO1B 2J12B 4JO1L 4IHOB 1FZMB 3L95A 4TUKL 1FAIH 3HR6A 4L29B 2HFFA 1FYHB 4OCSL 1RMFL 3GRWA 5ICZB 4H1LG 2ZJSL 1F45A 1OCWH 4OI9A 1OT2A 3QUYD 3S9DB 1A7OL 4WFED 1ZV5A 1I75A 4TRPH 4M5YL 1FVEA 2CIIA 5CSZB 1R3HA 2H2PD 4ELMB 5DC4B 5FEBA 3GMMB 2FHCA 2ADJA 2PCPB 4RFNC 5EORL 1AGBA 2CIKB 4XVSH 5DEFA 3TIDB 4GKSB 4JKKA 5EBMB 4XNXL 2NNAA 3RL2B 3A6CH 5GGSY 4LOUC 3OB0K 7FABH 2APBA 2Q7YA 3PQYA 4FFZL 4WJ5A 2XQBH 1S3KL 3RWGA 3AXLB 1EDQA 1EHLL 3I6GB 3MROB 1NCCH 1YEGL 3DX7A 2K7QA 4M5ZL 2I07B 4DTGH 5SV4A 1HYSD 4DVBB 4OQTH 4IMKC 1QG3A 2CMRH 3WFBL 3SDXA 1Q8MA 3Q3GA 2OJZL 5ECJE 4OGXH 4OCRL 2Y07H 5DFWH 1FFNB 4ZFFA 2EDBA 1P4IH 1QO3B 5MENA 3PWPA 3HZKB 3N1FC 5L9DL 2D31A 1PD6A 4MQTB 1SMAA 2OM5A 2X1OA 5INCA 4XMLH 3DTXA 3SKJH 3JVGA 6FABH 4YHIA 3MJ6A 4LSUH 4OM0H 2EH7H 5DHVH 2X70A 1NEZB 4F33B 2R2CA 4PP1D 1H3TA 1T0NA 1SVZA 3SY0A 3ZHDA 4ZOCA 3TBTB 3EGSB 4YWGL 1CG9B 3VFUA 4BKLB 5KTEH 2BNRD 2IPKB 5C08A 3ARFA 2VLRD 1HINH 1E6OH 4BZ2H 4Z7NE 1QKZH 1WBYA 3WJLC 5E56A 1HZHH 1MREL 2NCMA 2F15A 2HLFC 4UV4H 2F5BH 2ZKHH 4JKLA 1D9KA 5CEYB 2XWTB 3B4NA 2NY7L 5ILTH 5D6CA 4OIIL 4QRRA 4YK4C 2EDOA 5FYKL 1R5IA 3IETA 3WNKA 3AAZA 2V9QA 3CVHB 3SKOA 4JHZA 1KN4H 5T3XL 5F1SA 3OKMA 2Z93B 4KMTH 2VTFA 3JV6A 4LU5L 2HRPL 2NX5E 4NYLB 2OR8A 4OJFL 4I1NB 2AI0L 5KW9H 1ZHKB 1A6UH 5D72H 1JNHA 1NCAL 2NY1B 4TTDD 4PRPD 3B9VA 4LVOB 5ANME 4HUKB 4ONFH 4X6EA 3CJJA 3F65A 2Q87A 5KVEH 1I1CA 3IGAB 1ERNA 3BMVA 1Z5LB 4Y16A 4XAWH 3DXAD 5FK9A 4FNLH 3W9EA 4YNYB 3FQTB 4LQ1A 3T8XB 3TC9A 1YJDH 2B1AL 3PDGA 1Y18A 2YSSB 3TCXA 1C16A 3MV9E 5E6ZA 3MRCA 5ERWA 3QRFM 3T4YA 2A73A 1LD9A 5ETUA 1OAXH 3GBNH 4U1LA 25C8L 4PRIB 3UAJD 2VZSA 2AERT 3QUXC 2G5RA 2VDLH 3UTSB 3WIIL 2DL9A 1HHJA 2B0SH 3QXAB 4HH8A 1FPTH 4OLVH 3KHOA 3ARXA 4JFOB 5JOPD 1DBAL 1OGTB 4J4PC 1YY8B 3VWJA 3EZJB 4OF3A 2BHYA 3DUHA 4QHKI 3F7VA 4UNVA 1NL0L 1YY9C 5FOBA 4XC3L 5JDSA 3S37L 3QWRA 3ESUF 1FZJA 3TN0B 4M43H 3ARGB 4Y2DC 5HI5C 3KPSD 5EIQA 3G08B 1NLBL 2HYMA 4K8RL 3D0VB 2YK1H 3UBXI 4ELKA 4BH7A 4ZAKA 1JGVL 2V2WA 4OI7A 4CU6A 4ZFOL 3LN9A 3AVEA 1QFUL 1OSPL 3B43A 2X9YA 3BAEL 1HHGB 5MEQA 4M7KL 1HXYA 5HI3C 5EOTB 4P5TA 3R8BB 4F7MB 2IQAB 2WMPA 1K2DB 1QTYT 4EI5D 4OQ1A 4QT5A 5AD0A 4L3CA 5D93C 3BP6A 4JM2F 1LEGA 2WBJD 4JY5L 2OZ4L 1HWGB 4Y4KD 3BD4A 1D5MA 1CGSL 4BH8A 4OF5A 3MRGB 4JJ5B 3DGGB 3TPKA 4OCMC 2OJEA 4QHUA 2YWYA 3UTPD 1JPTL 5BCAA 1HH9A 4FFYL 2CRIA 2CR6A 4Z6AT 5BQ7A 3NZHL 1VEMA 43CAA 4GQ9H 3BEVA 4IIQC 3LN5A 4JREC 5TPWL 1NGXB 1NBZB 2FHFA 2XRAH 4YDLC 1YMMB 4KQ3H 5KSBE 1J10A 4PG2C 4MSWA 3MNWB 3IAGC 3FQWB 1X5AA 4RMUA 2I60H 5D2LF 3NACL 5D7SH 3BP7A 2HWZH 4ODVL 4P2CG 3VFVA 4PJEE 5AG8A 5IHZB 1DUYA 4IRSD 3VXSE 3E6FB 4M6NL 4LCYA 3RVWD 1A1NB 1JWUA 4UIKH 1RIHH 2FL5B 3WNOA 3AMKA 5KJRH 2QKIB 5DD3H 2YPVH 2IAMC 2WP3T 3ZYIA 3RNKB 3RWFB 2VLKD 1I8IA 2DKSA 1HNFA 3OF6A 3FOMB 4MNGB 5DGRA 1EGJH 1Z2KA 2EYTA 5HI4D 3MRBB 5EZJB 1S9VA 3U4AA 5B8CC 4JCLA 2OCFD 3QIUD 3MC0A 5HYJE 1INEH 1SJVA 5FUCC 2VJXA 3CK0H 1K8IA 4PG9B 2ILLA 1JRHH 4PUBH 5CWSA 2WZPD 3VD4A 1RSFA 3RU8L 1MJ8H 2XNAB 5I8OH 4EVNB 1ZVHA 1MLBB 2JIXA 1G7LB 3LEYL 5M94B 4FQ1L 1EMTL 2PTUA 1AQKL 1A9EB 4H25A 3KPTA 5CJQL 5GRWA 3ARUA 4QCIB 2B2XH 4X6FB 4EBQH 3ROLB 5JDJA 1TFHA 4NWUH 2D7MA 2OK0H 3IKCA 1MPAH 2BSTB 1ACZA 3KPRE 4JFED 2EZ0C 1YEEH 3ARWA 2JJSA 3D5OF 4N1EA 4HWBH 3VGBA 5FKAA 4PJ9C 3P4OA 3QCVH 4JZNA 3RVUD 2CLRB 5IBLC 4HIJB 3EJZC 5E4EC 2UYLB 3NAAH 1DR9A 4WI3A 4ZO9A 3H9HB 4YXHH 3HKFA 4FTVE 3OKEB 1N4XL 3U4BL 4WDIB 2UUDK 2DQDL 4LCWD 3OKYA 2R56L 2NX5A 3QDJE 4HPYH 2QQKL 4I5BA 2QSCH 1U8JB 4K9EC 3HR5A 2AABL 2FJGB 4BQ8A 2E8YA 2P8LA 5CKAA 1ORQA 1AE6L 1ITBB 5K9JH 1I1AD 1LDPH 1AGEB 3OX8A 4JDTH 4CJ1A 2JELH 4LLVA 1XF5A 3Q48A 4KU1A 1NMCB 3P4MB 3IT8D 3OAZK 1TZGL 5ANMA 1N8ZB 1OPGH 4XMKH 4GAJH 1HH6A 2CK0H 4ZFGH 4KVNH 4YDVB 5TE6L 1V7ML 3IJYB 2MKLC 4JRXE 4X6BB 2CLVA 4ZYKB 4PGJA 3MV9A 4GRWH 5ACZB 3CDGB 4KFZC 3ZHKA 2YKLL 1PZ5B 3RDTD 3WO3B 2VXUH 4FQHB 3VFWB 5I73B 2VSDA 4NO0A 5I1GH 3HC3H 2NR6C 3S35L 4OLWL 2P5WE 4YXLH 3BGFC 3HCVA 2IH1B 4K94C 4F7CA 3PF2A 2ICES 3BE1H 2ICEA 2N1KA 1MLCA 5F7UA 1YECL 2BNQD 3A0OA 2NY4C 5KSAA 5C0EA 4PJDF 5HD8D 1EJOL 1T03L 5F9OH 3WSQL 1KJ2B 3KYMA 5DYOA 1DBKH 4R8WH 2W9DL 5KAQF 3ARSA 4ODHL 5HHVL 4LLAA 2HLAB 1A2YA 4JGJA 2XXCB 3QA3B 4P2YA 2FZ3B 1E4WL 2E27H 4P57B 3CFKA 5GIRA 4ISVB 3WKML 4PJDB 3NCJH 4MDJA 5DQ9A 1PGRB 1FRGH 1YNLH 1OB1A 4DKAA 4O2CA 4UV7H 3MLWH 3QWQB 1HEZA 2E7MA 4U6HB 5EZOH 1FORH 5L0QB 3G5XA 5EUKB 3T4AA 3SE9L 1I3UA 3RY6C 2D0FA 3G6JB 4KRPB 4FP8H 2X09A 2L0DA 2EH8L 4XAKE 1VEOA 4XWOC 3VXPA 2MKWA 2FHBA 3BH9B 1LGVA 1NFIA 2JB5H 4N0RA 4K3DL 5I1LA 4XNYH 4R96B 4Y4FB 4CU8A 3IFLL 1QYGL 3L5JA 1R24A 5HXMA 2V6HA 1UG9A 2UY7A 1MCOH 3LCYA 4LLUB 3PHQA 4KXZI 1WLHA 1L7IL 2LU3A 4GKZA 4L8DA 4YHLH 2R2HB 1GGUA 4HIEB 1XF4B 4G6FB 5CINH 5CAYB 4J12A 1S7VA 1L0YA 4MQXD 3C2SA 3ZE2F 5KSBA 5L2KB 3HZVA 3VCLB 3HI6H 4PV8B 4KK5C 1QLRB 5DMIL 3B9KA 1MIEH 4WFGE 3VXTA 2HJLB 1FV1A 3BZFA 3K0WA 5F7YC 3AS2A 3HG1E 4PJEA 3S34H 2VL5A 5GHWL 4QEGA 5IESH 5D9SB 1MFDL 3VI3F 3LQAH 3QFDA 1V7NH 1YDPB 3LS4L 3WDIA 4L8BB 2WP3O 4NQTA 1BBJB 3PP3H 3QYCA 1DANT 3VMOA 2P7TB 3DVNB 5IFAL 1RZJL 4LKCA 3LKPA 4LSTL 4ZTOH 4HXAH 1KENL 4Y5YB 3VXNB 3QPQD 2FJFA 2PXYD 3I75B 4OZGB 1EEQA 1JPGB 1K5NA 4JQXC 1FL3B 2GIYA 4QOKE 4MJ6A 5FECB 5HYJA 4PJ7E 3S96A 3B2UC 3BUYA 3FHAA 1AXIB 5E00B 3M1BB 3ULUL 1KIPB 4YBQC 3TV3H 3MBEA 2Q76A 1Z6JT 4P0DA 2DMCA 1KCSL 1I9IL 1J1XL 1K3IA 4JM2C 4NC2B 5IQ9A 3PWJA 1CD8A 3VXUD 3GK8L 4Y1AB 4PY8I 4R2GD 4F9PC 5KSVB 1LK3H 1S7XB 1F90L 5TJWK 4N0CD 5T5NG 2OTUB 2HTLD 1WEJH 4JO3H 2HKHL 1F3JA 1GZQA 1AQDA 4PS4H 4HKJB 1NGYB 3H3BC 2XPGA 3FFDB 1R3LB 1YMHB 2DWEB 4LLDA 2P49B 5SWQA 5C2BH 5I1IL 2YPKA 4X6CF 1QRNB 2PO6B 5C0BB 4AIZA 2YEZB 1L7TH 3KPRA 3V6OC 4P59L 3ME0A 3MRRB 1Q9OA 1MEXH 1MNUH 2OTWA 4PBWD 3FN3A 3L3HB 4IRJC 4KRMB 1T04B 3SE8L 4X6CB 4LPTA 5JQHC 5DVLA 3MZGB 1U3ZA 1UB6B 1RUAL 4PJGF 2BSSB 4FTVA 2DLIA 5A16B 2CXGA 3GSRB 5GS0C 2ZCKH 3QDJA 5JQ6L 1Z9LA 4Z5RA 3P4NB 5I30L 5CEZL 4PJGB 1UM4L 1IZKA 2H9GB 4JPIB 4OM1H 4HC1A 4LCCB 1BOYA 3G9AB 2A9NH 3TGXA 4S1QL 2BVPB 3B83A 5JHLL 5DTFB 3NCCB 3U0PA 3BKJL 2MPAH 1BFOA 4LEOB 4PJ8B 4AT6B 1EVUA 1FGNH 4OLXH 1U8MB 4JRXA 1AGCA 2GJ6B 3KJ6L 4N8VB 4HUMB 1AGFB 2IC2A 1X7QB 4ZUVA 4FQLL 4HJ0D 2CJUL 2P5EE 4RMWA 1QOKA 1R0AL 1YUHA 3REVA 4XP4L 3RWEB 4GBXA 2XACC 1VACB 2P5WA 1CICD 1HDMB 1IGJA 2Q3AA 5I1AB 4XRCB 4NT6A 1FQ9C 2E6PA 5EU5B 1A6AB 3BPLB 5E2TH 3NFPB 2R4SH 3MBXL 4ETYA 3TT3L 3G5VB 4NPYB 4GS7B 5EC1B 3TBSA 1CDIA 1Z0MA 2AQ2A 2AXGA 5D1QC 4CVZB 1T89A 1AR2A 1SYVA 4OLYL 3SDDB 3GSWB 1JGEB 3HB3D 3VJ6A 1IM9D 1YEJH 4NFBA 5IV2B 1ADQA 1AHWC 2VH5L 4PTUB 3ARPA 5IB2A 5LKNA 4I0PC 1BD2B 1A21A 2VLLA 3UPRA 1YYLH 3D18A 4W4NA 3WJLA 2OP4H 5DJCB 5CIPA 5DFVD 1PQZA 3K8LA 5F21B 3TZVA 5EZLB 3K46A 4ZOBA 5JIIA 1FLRH 1IVLA 4JO4L 4OF0A 5JPNB 5EA0L 3OGOE 4Q6IC 3MPCA 2OR9H 4MNQD 1KJVB 3L7FA 4ODXA 1JHKH 2NW2B 4NN7B 1MFEL 4TUOA 1E4XL 4IMLA 5AWNL 1WWCA 4MXQD 3H8NA 1PSKH 3CH1B 3O3AB 2X1XR 4ODSH 5FCUH 4JZOB 4Z0XB 1J8HD 4RGNC 3MRDA 4K7PY 2DM7A 4QXTB 5DXWA 3U0WL 4LAJH 4Y5XC 5ESVB 1J5OH 1VENA 2BSRA 1KB5B 3L3OB 5DRNA 5H94B 5HHXL 4HWNA 1DEEA 3HG1A 4YPGA 4WCYH 3RWJA 1IGFL 4WEBL 4M3KB 3QG6A 2R2BA 4LIQL 1VFMA 3CPLB 1FIEA 4PRDB 4MB3A 1MRDH 5C0JA 2AAVA 4LDEB 2XN9D 3OAYK 5J1SC 3UYPA 1UFUA 3U4EA 3QUXA 4ENED 3O2VH 1SY6A 4DOHB 3QQ4A 2GAZA 2V7HB 3Q6FA 1WAAA 3QUYB 4JRYD 4J4PA 2EYSA 4IS6A 4R4BB 2H8PA 2G75B 3N85H 4QOKA 4JDVA 4KJWD 4PFEA 3GSNA 4PJ7A 3BKYH 4RIRB 2D4DA 3PUCA 4KRLB 3MCG1 3UYRH 1LE5A 4XGZA 5LQBL 1V3JA 1CGTA 1XZ0A 5I0DA 3JTSA 4N5ED 2OMNA 4BJLA 2FYYB 3DO7A 3TVMA 4JFZH 2VABA 4P9HL 4C56E 4U1JA 1OTSC 4ZMAT 4HFWA 4DGIL 3CFBA 1FFRA 1OL0A 1ND0A 1DE4A 2DICA 4E42B 3O6KH 3RIFK 1G7IB 4R0LC 2MJWA 1OTTD 4R3SB 1BQHB 3SOBH 3IJSA 3ULSA 5J56B 1HXMB 3BWAA 4GW5B 5EU4A 4NRXA 4PP2A 5EWIH 3D0LA 2ZOLB 3ECBA 5F88A 1RIUH 1U8NB 3B6SA 3QXDB 3RZCA 4XPGH 5BJTB 3L9RB 1KN2H 1IBGH 2EDQA 4MB4A 1NCTA 2BC4B 3VRJA 2V2TA 4FS0A 4QGTA 1OY3B 3REWB 2BOBA 1JL8A 1QSZA 4PRIE 1NCUA 4QWWD 1LO5A 1MFAL 1Q94B 3IXAA 2HT2C 1T1WA 4EUPA 4ETQA 1LNUB 1BWMA 5T1DH 2QQNL 5KANI 5DQJB 2UV3A 2BNRB 2EE3A 4PLJC 3AFLA 2VLRB 4CNIA 3MLTB 3MA7A 5I1KL 1RFDL 3CDCA 4F7EA 3MLVH 2JCCF 3D9AH 5DMGC 3B8SA 4O02L 5EN2A 5CZKA 3KLSA 1UM5L 2VXTH 3MJ9L 1CL7H 3GSUB 1TLKA 1JNJA 2P5EA 5LVEA 2ITDB 4O00A 4TNWF 4NFCA 1WV7T 1QACA 3ILQD 1IAOB 5F9WC 1FN4B 2QBWA 5LJYH 2AJUL 4MX7A 5T5FL 1IGML 4XVUC 3UTQB 3VGDA 1U3HD 1JWMB 1KNOA 1PKQA 4U0QB 1N6UA 3MV11 4Z77B 1ZLSH 4RX4D 4Y88A 5B8CA 5EO1A 3HZMB 4PRPB 1FG2B 4AQ1B 1KULA 2VSCA 1FZMA 3C5SA 4XCEB 3SGEI 1J11A 5DMYA 3HAEH 5ICZA 5SV3A 3DXAB 2EEDA 2IWGA 3H9SD 5T33L 1F3RB 1OM3H 3ZKQD 4F37F 4HBCH 4OF8A 4FQJL 4WFFE 3MZTA 5CD3B 4MAUH 1UJ3C 3SPVA 3TT1L 1OTUC 3ZSSA 5CSZA 5C3LD 2Q8AL 1RULL 3PL6D 3EO1B 4E0RB 3F6LA 1YMME 2J4WL 1OARH 4OZHB 4K9EL 4LSSH 4LSQH 3GMMA 5M7QA 1VGEH 2UVEA 1FSKC 2PCPA 2EE6A 3FB5B 3MO1A 1UXWB 2WWKT 2CIKA 3ZYZA 2GTZB 1HOCA 3RL2A 2DD8H 2VDKH 5FUOL 2VN7A 4LCIH 4KK8D 4XZUB 4JN2B 2W07A 2C4XA 2BMKB 1DSFH 3T65A 4G8GE 3AXLA 3KPSB 2O93L 1U8QB 2VDRL 1PG7W 2A0LD 2F54A 3WO4C 3G5ZA 1UEMA 3VD3A 2I07A 3OZ9L 4GXVL 1EUTA 2WM0A 3HNTH 2FD6L 4B50A 5CZXC 3Q5TA 3KPOB 3FQUA 4O51B 3KAAA 1PY4A 4MNGE 4YQXH 1ZEAL 2X1QA 2Y7QA 5D6DC 1QO3A 3HC4H 4LHUA 3HZKA 5GS1C 4LVHC 4F3FB 1T5XB 1LO4L 3AB0C 4YHYB 4EI5B 3QIWD 3NFSL 3KYKH 3MLPA 1NEZA 3TBWB 2WBJB 3PP4H 3KPQB 3VW3L 3VU2A 1Z0NA 4Y4KB 3TBTA 4LF3B 1VHPA 2WINB 1CG9A 4BKLA 5E1AB 2IPKA 5BS0D 4HJJL 1SMOA 4M03A 1DLHB 5BXFA 1EFXA 1WC7B 2IG2L 5FO7B 1FLTX 4MA7H 4K3JL 1XGQB 5DJYA 4HUUB 5CEYA 4CVUA 2XWTA 3MUY1 4MZ2A 1GGIL 1Q72L 4FQIL 1H15B 5BOPA 4Q0XL 2RCSH 5AZEH 3T2NH 2KZ1B 1PBYA 3BHBB 4IBLT 4Q2ZB 4HW6A 4DCQB 3GIVB 1UVQB 4Q7DA 1J9CT 1TMCB 4TUJA 2X7LB 5D1ZC 2J8HA 4X8XA 4OTXL 3K4DA 4UT9L 3FN0L 3MREB 2Z93A 2DQUH 2RBLA 4IOFC 1S7TB 3EFDH 4IRSB 4NYLA 4WRLA 5GISH 4BQ6A 4C56A 4FQQB 1W2KT 2ZG2A 3A6BL 1KSRA 2V2XB 4WGWB 2AJ3A 2YMXH 3PWPD 2VLKB 5I6XB 2BVYA 3ET9F 3K3QA 1JJUA 1MRCL 3CFDA 3TLRA 1G6RH 3BO8B 3V0AC 1X5LA 1PYWA 4FZEH 4NZTL 1IL1B 4YNYA 3JV4A 1NCWH 4QTHA 3T8XA 1F2XK 4CRPA 3ULVC 1INQB 2QQLL 3QIUB 4A6YA 3L7EB 2ED8A 1W8OA 1MWAH 2R2EB 5C08D 3V4UL 3CLEL 4S10A 1D5XB 4M4RA 3IJHA 4XBEH 3O8XB 4H0HB 5TDPA 3JSSA 4PRIA 4KROC 4RGNE 5IVXF 5T1MB 1X4YA 1HWHB 2Q8BH 3QXAA 1D9KD 1EFQA 3QWOA 2AS5M 1MVUA 1RUKL 4TSAL 4JFOA 3BQUC 3BVNB 2Q6WB 3RWCB 3IDYB 2AK1H 4QRRD 4ZOAA 5DQDL 1YY8A 1JF1B 3WFDH 1U58B 1RZGB 1GAFH 4D9RD 1FO0A 2QR0B 5IVXB 5TH2B 5J3HD 4JO1H 2OL3L 4NUGL 4WWKC 4TUKH 1MVFA 2I27N 4CL7A 2X4UB 3G08A 3LD8C 1WZLA 3HI5L 4OCSH 5ESAB 3TJEL 4ODUB 1S9YB 4JFEB 5FM8A 2ZJSH 4PJDE 3C60C 3NCYS 1QEWB 4Z8FH 2YOCA 2MQ0A 2ICCA 1A7OH 4K7PL 5IEKB 2A6DB 4JCMA 1T0PB 4R9HA 3KPNB 3NGBC 2VDML 2XWBB 3C5JA 5H8DA 3U79A 4LCWB 2OL3A 1WK0A 5L88L 2IQAA 4XXCA 4MXWL 5T3XD 4Y16D 4FFVD 3T2OA 3I3BA 2VB5A 1ORSB 3P73B 3RKDD 4UIMB 4XNXH 4F7PB 4KXZH 1YJDC 4YAQB 5DK3A 1I1AB 1YC8A 2J6EA 4UU9B 3UCRA 3P3YA 5A1AA 3MRGA 4JJ5A 1CFTB 3DGGA 4G8IA 3QEHB 2N4IA 2NLJB 4JM2A 5EBLA 2IBZX 4P4RB 5D2NB 2GY5A 4YDIL 5D5MB 1ZGLA 4F9PA 2XA8H 4OD1L 4LAQL 3VXQB 3VWKC 4OGZA 3TFKC 3VWJD 3WN5B 3RDTB 1NBZA 3OKLB 3FFCE 4M93C 3OJDB 4MJ2A 3DV6A 1YMMA 1E4XI 1K3ZA 2DQIH 1VERA 3T0AA 1H8SA 3MNWA 3RL1A 1ROWA 1WIOA 4JLRA 4JZJC 3THMH 3CLFH 3F5WB 2WWKO 5L9DH 1CGUA 4KQ4L 3EW3B 1BF8A 4K3EL 2IALB 4IRJA 3ZE2E 2BNQB 4TULL 4X99A 5JXAH 1A1NA 5D2LA 3QAZC 3C8DA 4UUJB 1CTOA 4POZC 4YWGH 4G8GA 4EDWL 4WW1A 5CLWA 3MLYH 4LPCA 2W1NA 3RNKA 1PG7L 2ZUUA 4P5TD 3VDBA 3VI3E 1MREH 3LQMA 4OCXH 2J5LB 5CUSL 4K8RD 2DIBA 1DQDH 3TCLB 4MNGA 3H9ZA 5ABDE 4I48A 3MRBA 4RAVB 5CSGA 2P46B 4MQ7A 3QDHA 1Q38A 4ORZC 4GH7B 3GZKA 3OGCB 5FYKH 3RP1A 2XTJD 1RUQL 5CGYD 1UACL 1GPOL 2H3NB 2FSEB 5F6IC 3KLHD 4L8SB 4PG9A 1AD9B 3KYNA 1EPFA 2VZOA 2X1PA 3QIBD 4RBPH 2XNAA 4U2ZA 1D5BB 2HRPH 2HVJA 4OJFH 1MLBA 5F8QC 2AI0H 2NZ9D 4OCWL 1VPOL 5HHNB 4EUPG 4OAWB 2Z8WC 1NCAH 5FB8B 4Z7UF 1V05A 4QHMB 4BSJA 2EDXA 4Z78B 4H0GA 3VFGH 1C1EL 3T77B 2P43B 4X6FA 4LNVA 1QRNE 5C0BE 1SEQL 3OKKB 1P9MC 3CUPA 1XGPB 2X42A 3JWOL 1LO0H 1HHHB 5C0FA 4JDZB 2F8VA 4RWYL 1VKXB 2F19H 2CLRA 3LSOA 4HIJA 4X6CE 1MHEB 3IFNH 3ZDYF 4IDJL 4LVNB 4OB5L 3H9HA 1YN7B 3DIFA 3OKEA 3NH7L 3MRQA 3UDWC 3SE4A 1YQVL 1Y6NR 5B4MC 3OF6D 2YD6A 3A67L 1U8JA 1A7PH 3WIIH 3OXSA 5HVHC 1A6TB 4PJGE 3GMOB 1CXHA 5GS2H 1QLEL 1AGEA 3MJGX 4GMTH 4XXDA 4RSVA 1NL0H 3DI2B 1JI2A 3ZE1F 1GH7A 2CKBB 3HLAB 5F1NB 4HKZA 4Q97A 2PXYB 1JZ7A 1VFOA 5A40E 1XIWC 4M7ZC 4Q6IA 4X6BA 1CGVA 4ZYKA 3OR7B 2JIXD 5E8OB 2X6MA 5C7XL 3G6DH 4OGYL 5H35A 3ARDD 4G6JL 4YFDB 4D94A 1QFUH 1OSPH 1EO8L 1RZFL 3BAEH 1LEIB 3OKDB 4JFPB 1DEDA 2PYED 3FCTB 3WHE0 5J4MA 2OI9C 3VXUB 4R2GB 5LGJB 3DETC 4XVTL 3V4PH 2JLLA 4Y5XA 4O2FB 2OZ4H 1T22A 2YRZA 1CFQB 5GZNC 1FFPB 4OD3L 1ZK9A 1WTGT 3QHFH 3SGDI 2FZ3A 2G2RA 1UZ8B 5FCSH 4ISVA 4PJDA 4XCCH 3PHOB 2NX5D 1JPSL 2YRPA 4FFYH 5D1XD 5D71L 4Y5VC 1REIA 3T2QA 3M17A 1BPVA 3NZHH 2FEDC 4U6HA 1KIUA 1BD2E 1T1ZB 2HKFL 4ZG1A 3GHBH 3ES6A 3BOVA 4M1GL 3KPMB 2CH8A 3BT2L 2WBWB 4JGMA 5T3ZL 1GZPB 3O3DB 2DYPA 2Z0BA 1N64L 3ZDXF 3NACH 2DIAA 3FJTA 3IU3A 2XOTA 1ZAGA 1BOGB 2BFVL 5IHUH 1GC1H 4Y4FA 4BYHA 1NEZG 5K9OA 4HV8A 5DURB 1JUFB 2QADD 2X4SB 3ZTJH 5GGRB 4X9GA 2R0WL 1BGXL 4GLRH 1WCQA 4NO0D 4NSKB 3DX9B 1RZIB 1T7WA 3B2VL 4AMKL 4IOIA 3JXAA 1WF5A 4LLUA 3BYYA 4OIAA 4TVPL 2R2HA 2HMID 2RR3A 3UXFA 4HIEA 1XF4A 4XPAH 5KBNC 3FFCA 4RISL 3EDFA 1ZTXL 3VCLA 3KWWB 1IGCH 3E0GA 4PV8A 1E28B 4NCDA 1QLRA 1CICB 1BZ9A 4V1DE 4JKPL 2HJLA 1FNEA 4LMQI 1GXEA 5FO8B 1DQJA 5EB9A 4ODBD 5DF0A 5EO0B 4G8EB 3HMXL 1LEKB 1OAYL 5CJOL 2E9JA 5D9SA 3C87A 1G7QA 2PN5A 3MGAA 1YDPA 2R69L 2OTPA 3WIHL 3RWIB 4L8BA 3LEYH 5I9QB 1EMTH 1B6DA 4QRUB 2P7TA 3DVNA 4K7FA 2DQGL 1OOAA 4DOHE 3U7YL 3ZKND 1IM9B 4KUCD 4M6OL 3WE6A 4ZTPL 3RJDA 1U2HA 3AS3A 2QHLA 4WFEE 3VXNA 5DD5H 3D3VD 4ONHB 2P45B 1U93B 3V6FB 1JPGA 4AY0A 4E5XB 5DR5L 1IC4L 4I2XB 1FL3A 2YD1A 4GSDL 1EUUA 1N2RA 5FECA 3GJFB 3OMZA 2C7UB 2CLZB 2I5YL 3WIHA 3M1BA 1KIPA 2QQQA 1MCJA 4PD4J 5JW3H 5GRZA 5F1IA 2YUZA 4FQXD 2MOVA 1CVSC 4B7LA 2I9LB 3C8HA 4Z9KB 2DQDH 2R56H 4YBLB 1Z3GH 2XZAL 4M48L 5ICYA 2IFGA 5KSVA 2AABH 5HHQA 5EIIA 4MNQB 3OB0H 4KH2A 1AE6H 2E7LA 4G5ZH 2YUXA 2IPUK 1RUPL 4KJPC 1IM3B 4RGMC 1QRNA 2PO6A 3IRZA 5C0BA 2YEZA 4AEHL 1AD0B 3A6OA 4C83B 1J8HB 4KKBC 2FX8L 3X17A 3QBTB 4WUUA 5TE6H 3IVKA 5JIPA 1T04A 4X6CA 3S36X 2W9EL 2H45A 2IGFL 3MJ7B 1UB6A 1YEDA 1MFCH 2BSSA 4QXGL 4OUOA 4RDQF 1R3JA 3GSRA 4DFHA 5F7LB 4JR9L 4QXUL 1UJ3A 3EDDA 1ZT7B 2MQ3A 4NO3A 3UBXB 3P4NA 5DK0B 3KG5A 2FATH 2XN9B 4PJGA 4JPIA 2NTFB 4X7DC 5IW6B 2BNRE 1YECH 4QHLA 5KVFL 1FNFA 2VLRE 1T03H 3WSQH 1IFHL 2ORBL 2BVPA 1HHIA 2W9DH 5DTFA 4JRYB 5HHVH 4XX1E 5HJ3B 2Q7NA 2BOCB 3CFIC 4HF5L 4LEOA 4AT6A 1A7QL 5E08L 1E4WH 1U8MA 5CEXB 2HJFB 1B0GA 4N8VA 4M1CC 4C59B 5F1OB 2BVQB 1WBXB 3NTCH 4WNQA 3IDXL 3LKRA 5M95B 1N6QH 2JCCE 4XP1L 3TPUB 1FNGB 1EH9A 1WITA 3LVEA 3D25B 1D6VH 2LABA 1QBAA 5I1AA 4XRCA 3ZKSD 1ZXQA 3CFJA 2ICWI 2FH8A 5EU5A 1WFOA 3SGEH 2EH8H 4YHKL 3KPRD 3NFPA 5D6DA 4BM7A 3RVXC 4LCUB 4NPYA 1EEYA 1BVLA 4P3WA 5GS1A 3FO9B 3MNVB 4G80A 2NXYC 4JFFD 3IF1B 4PRPE 3SGJC 1TENA 5I66A 3CSBA 2C4FU 3IFLH 1QYGH 1K4CB 5GS3A 4XP5L 3LPWA 2YC1A 1ZWIB 1WIPA 3A6CL 1JGEA 4JFDE 3DXAE 3TO2B 4LRNL 5F9DC 1L7IH 2N56A 3MOQA 1J8KA 4PTUA 1BD2A 4M7JH 3QXUA 4F15C 1CLZL 1C12B 5DJCA 1NCCL 4QHNB 3WL9B 2DLTA 5L8JB 4OQTL 4B53A 2CMRL 2KQMA 4LOUD 3CX2A 1KYOK 5DRWB 4MDIB 4OGXL 1ZHLA 1I9RH 3ZKXC 5JOPE 1S5IH 4P23D 5GHWH 1BZ7A 1KG0B 4DGVL 5CEZD 4PJAF 5D1ZA 1YEIL 1XGRB 2ERJC 1KJVA 1MCWW 1W0YT 4GRMB 4J2XA 2OS7A 3ULVL 3O3AA 4OQTA 1BFVL 4GXUN 2MHAA 1J0IA 2GJZB 4Y7MA 4PJAB 2ZSWB 4P3CH 5IFAH 4LSTH 5J7CC 4GXUM 5GGTL 1HE7A 43C9B 3C2AL 4QXTA 4NKMB 3QUML 4BZ2L 2VC2H 4EJ1C 3TBVB 4CN1A 4HIHB 4MCZB 3H7LA 2X1WL 4V1DA 1IQDB