3K74B

Disruption of protein dynamics by an allosteric effector antibody
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
QLQESGGGLVQPGGSLRLSCAASGFTFNNYWMYWVRRAPGKGLEWVSMINPGGIITKYAESVKGRFTISRDNAKNTLYLQMNSLTSEDTAVYYCAKDWATGLAKKGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Constraining enzyme conformational change by an antibody leads to hyperbolic inhibition.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
molecule keywords Dihydrofolate reductase
total genus 27
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k74B00
4DQOH 5DHVH 3RIFK 2V7HA 1CTNA 2CDGB 3BKCH 1UA6L 5F93C 3DROB 2F54E 1KJ3H 3DX6B 1QFHA 1U41A 1P4LB 1FE8H 2DM2A 2X9XA 1FFOA 2IPUG 3VGHA 2BZDA 4P2OB 2F8OA 1NAKH 3QUYC 1RUAL 1YA5A 3QFJE 2IBZX 1T7ZA 4P5MA 4V1DE 2NY0C 4NN6B 3L7FA 3MLUL 4AEFA 1NBVH 5FYJU 2D7NA 1MJJB 4P9HH 3R8QA 1AHWA 1DLHB 3KVQA 1R3IL 1GC1H 1XCTB 1MHHB 1NCUA 4P2RA 3UROR 2FHBA 4GBXD 3K3QA 4S11A 4S1SH 1XF3B 1W72A 5CUSL 1QLFA 2CLZB 3DGGA 4PJDE 4QHLB 5EIIB 3BZFA 2CRZA 4TNWK 4ZPTB 4ERSL 2NY4C 1GOGA 5ENWA 2ZCHH 3AY4C 4RX4A 4W6YB 4UQ3A 1JZ5A 1IBGL 3WE6A 3LN5A 2OXHA 5DUBB 2CIKA 2Z31D 4PJ5A 2NY4D 4JZNA 1I1RA 1TLKA 3QFDB 1G0DA 2NCMA 4WW2C 4YPJA 2BVEA 5FCSH 1CL7H 4YFLF 5C0RL 3ARPA 5D1QB 1NBVL 4AM0A 1XIWC 3SKJL 3C2AH 3ARGA 4OAWB 1NBZA 1CICA 3IFOA 1NCDH 5FV2A 4Z77A 4JFQA 1BMGA 2D7OA 1HXMB 2OX5A 1MFEL 4OLVL 1DN0A 4Y4FC 3Q6FA 3S5LA 1E6OH 3QIWC 4K3EH 1VPOL 1K8DB 3PWUA 3L5WB 5D2NE 4P46B 3C60D 5AEAA 5F89B 1Z9LA 3BH8B 1MNUL 4PBXA 3T1FB 5A40E 1I7ZB 3PF2A 1P4BH 3MV7E 4MAYC 1NBYB 2PNDA 2HG5A 3O81A 5I1JH 4X7TA 4XI5D 3GJEB 5LAXA 4F8TA 4KROD 3KNBA 1RPQA 4JFFA 4KY1H 5DQDL 1A0QL 3S37H 4JKLA 4LLUB 5D1ZC 3C6LD 1CL7I 1QVOB 3LQZB 4CU7A 5IB3A 4GG6A 4MD0B 5EU6B 1JVKA 2YSSB 1NCDL 2JELL 5BO1H 4ODWB 1WUNT 2PCPA 2D3VA 1IM9A 4LGPB 3VW3L 3OKNA 2H8PB 3KYNA 3IJSA 1W8NA 3PXJA 3ZL4H 2VLJB 1Y6NR 3IVKA 4ISVA 2IAMA 3O4LE 4XBGA 2VDPL 1EUUA 3PDDA 2VNCA 4DCQA 1S7XB 3DXAE 1X4ZA 3WEXB 2EH8L 1IQWL 5HHVH 1YZZA 3QXTA 3VA6A 2XOTA 5E9DA 1AFVL 1ZT1A 5ETUB 3OHXA 2VN7A 2CRYA 4TSBL 2WUBH 5C92A 2WINA 3M8OL 5C0CB 3ME0A 2Y7QA 3KR3H 3PWJA 2Q86A 4OZGB 4Z95L 1OGTA 3AY4A 2IALB 5C07B 1U3HD 3TC9A 4KJQC 3RUGE 3IXTB 5CD3A 4MQSB 4RFEB 2FYYB 3MV8E 1HSAB 4P49A 2FJHB 4JZOB 4E41E 2ZWLT 5F9JA 5CZXC 3SKMB 3O2DA 1BVZA 5IVZB 3UO1H 4YAQA 3LEVH 3GSUA 2FWOB 5EUOF 2B39A 3C60C 3L3HB 3ZZ1A 1CT8A 1LDPH 4WGVB 4IOIB 1BD2A 4EVNB 4XT1C 4A6YB 3HZMA 4X4ZA 4L3EA 2DLIA 1YEEH 4MLSA 4PUBH 4WHTB 2QJDA 4YIQB 4EN3C 3FL7A 1E4WL 4HK0B 1H3XA 3DX7A 1LK2A 3IAGC 3S37X 4ORZC 3LKNA 2NXZB 4JANB 1E6JH 4KTDH 1HHKB 4XP1L 5FYLH 5DLML 2CSPA 3CFJA 4Y5XC 3W0WB 4K7FA 4UV7H 1VEPA 3OX8A 3ECBA 4NQSA 1H9VA 3WS6A 4RCAA 3QZWB 4PJGB 2DM7A 5KVMC 1WCQA 3FCTA 1GPOL 2GY7B 2X42A 4ODTH 2DF3A 4PLJC 2IAMC 4LFHG 1J12A 3TNNB 3CSGA 4FQPA 4LCCC 4X7SL 1IFHH 4WJ5B 1G9MH 1A02N 1UENA 5D70H 4DN4H 4JVPA 3DVNB 4ZXBC 3O6FD 4JR9L 1X6LA 4N0UA 4BUGA 1YN6A 1AKJD 3BEWB 3L1OH 4Y5YB 1BD2D 4OLXH 3UZVB 1SEBB 3KPOB 2VLKA 3JBG7 4NQDE 4ZFZA 2D9CA 1TZHA 2YEZA 1A7QL 3TA3C 4R97B 4OQ1A 3D9AL 5HYSA 4OQTH 1PY4A 3MLVH 3V5DA 3PNWA 2HT3D 2X44D 4KK8C 1FSKB 2AJYH 4HMCA 5DSCB 3QPXH 1NGWA 3JTSA 2X10A 4GW1A 4YH6A 1KB5B 1MCQA 2VDNH 3VI3E 2I5YH 2IPTL 25C8H 1K6QH 3HRPA 3TNMA 3SE4A 4J3XA 5AYUL 4I0PC 4TUOA 3CU7A 3TESA 3WUWB 2FD6L 1U92B 2H3NB 4Y89A 1JZ8A 3QUXB 1U95B 3PABB 5DK2B 4FQIL 4WWKB 4X4XB 4LLWB 4OFIA 1ZA6A 1MJ8L 5JW4N 2HVJB 5EWIH 1EVTC 1KIQA 1WFUA 1S7RA 4FQQA 5AZEH 4QHKJ 1RIUH 5K9JH 2DWEA 1MEXH 3LEXA 4X8JA 3Q6GH 1Q8MA 2VL5A 3L7EA 3VWKB 5EH1A 3KPOA 1T0MA 3OKDA 5CEZL 1B0RA 3SN6N 4PJFF 3G5ZA 1IC4H 1FNLA 1BJMA 2IH1B 4L8DB 3CFCL 3N9GH 3RZCB 4JG0H 5I8CA 5I6XB 5FYLE 1QLEL 3HUJE 2YPLA 1JK8A 4DZBB 1LO0L 2PYFA 4X6DA 3VRIB 5I66A 2VDNL 1UH2A 1GZQA 1M6OB 1N5YL 3I02A 2BY0A 1Y0LA 1MF2L 1XZ0A 1IAOB 3FFCD 1YQ2A 3MRLA 1NGZA 1JHKL 3QIBC 3V4VH 1M6OA 2P5WE 3H42L 4LSSH 4WY7H 3PWVB 4JLRA 1UWXH 1LEGB 1RI8A 3L3OA 3BKYH 5EU7C 2VZSA 4IRJA 1QSFA 2JCCA 2NY6D 1MH5B 1MCOH 2XIDA 3B9DA 3RWHB 4AEIL 5ALBL 1NDMA 5C9JA 4U6VH 4PRBB 3QULA 3WLBA 4HWZB 3DSFL 3AC0A 4U6XA 2ADGA 3KXFD 2ED7A 5F7LB 1GYAA 4GRMA 1KIUA 5CP3H 5JOPE 1X5HA 3FZUD 4M5ZL 4Y88A 3C5ZB 3R0NA 5EZIL 5EO9B 1KGCD 3ZKMD 1MVUB 1UZ6E 4LCYB 3JV4B 5MP6L 1TPXC 1LP9E 2OJEA 5F8RC 2H26A 2JIXA 3MUHL 2NY6C 3BE1H 1G7IA 4G9DA 2ESVA 5DRZB 1VENA 3LKSB 3SE3A 2YA0A 1M7DB 3BKYL 5BJTA 1IGMH 4F9PA 4HJJH 5TJWK 5MEOA 1KELL 1K5NB 3G5YA 4NP4L 4UDUA 1CFQB 1KNOB 2EYSB 4NO0B 4F3FB 1DQML 1HH9A 4R7DA 5IW1B 1CXLA 1I8LC 1RK1B 4RMSA 3WFHB 1I1AC 5E9DB 4M5ZH 1AO7E 1KB9J 5FGCB 5HYQB 3BEWA 5C6TL 4PJGE 1S7XA 1VFAA 1OAKL 4JY5L 2ZCKH 3RL2B 4XAKE 3MJ7A 1B4JL 1H15A 3P30H 4RA3A 1MHCA 2HLAA 2QV2A 4ZPVA 4O2CB 5SWQA 1D5BB 1JGVL 2ICES 4NKMA 2YWZA 2EKSA 4AENA 5JHDB 5DJ8A 4F7TB 5JQ6H 5C0RH 4PBWD 5DMIH 5LG1A 1HINL 2C4XA 3M07A 3O6FB 1I1FA 4PJGA 5KVFH 3KNBB 5D7IA 3KLHC 4X7TB 3VFWA 2HG5B 1MFEH 4OLVH 5C07E 5C0AA 3VFGH 3VMNA 1WBYA 1OPGH 1C16A 4FTVB 4EI6B 2V2TA 4XI5C 3LN9A 1BGXL 4RMTA 5D72L 4OUUB 1TMCB 5F7DA 1S7RB 4FQQB 2VLRD 3HB3C 2CR3A 1A6WL 3CSYB 3PWLB 3RTQB 5GS0D 1NCCH 4NUJB 3VFPA 3GRWL 1HHGB 3A6CH 3U30B 1AC6A 1A3RH 2C3VB 4LCCA 2J8UA 4K94H 5HGHB 3GMOA 2EH7L 4U2ZA 3MJ9H 4EOWL 4X6BB 4U6HB 2WBJB 4F58L 3X3GL 2VJXA 4Z77B 2IQ9L 3BAEL 2MSPA 1KB5A 4GBXA 1LP9A 3QWRA 1ZE3C 1I1AB 3RVVD 1FO0A 3EOYG 3G6JA 3OQ3B 3V0WL 2B4CC 4R0LA 5FUCE 1KN4H 5EO0A 4HPYH 4WHYH 1HK6A 2VDOL 4C56E 4ZNEE 5C0EA 2ICCA 3C09B 4ZO7A 1IJ9A 4JY6A 1CLYH 3KPQB 4JFEE 5D2LA 2DIJA 4YHYC 2AXFA 4KI5C 5BV7C 2XN9B 4OLWL 4HEPG 2R39A 2AKRB 4DZ8B 3I6KA 1WIPA 1QSFE 4NFCA 4G42A 1U3HC 3MREB 4KDVA 3QXAB 2XQBH 2NR6C 5I9QB 1WC7A 4PJFB 3A6BH 3VXQA 1A3RL 3GSQB 5A2IH 2P47B 4KVNH 3CMOH 3G5XB 3CPLB 3VXQB 5L2KA 2NY2C 3IVKB 3HI1A 3GSVA 4Z7VE 2WUBL 1XGRB 4OLZH 1JGDB 3DHJA 3K4ZA 5E08H 1U91A 3LH2H 4M7JL 1OF2A 5GQBA 5KS9F 1UM4L 4FG6C 3KLHD 3QG6A 1T66D 4H25A 2DQJL 4X6DE 5KSAB 3RX7A 2X4PB 1BX2A 3HUJA 3Q0HA 3U0WH 3C8KA 4HH9A 3HFML 4EUPH 3HS0B 1BOGA 5ICZA 1YQVL 2ZUXA 4J3TA 3TVMD 3GNML 4RWYL 3IFNL 3H9HA 1PZ5B 1OWWA 1QBMH 2V7HB 5AAMA 3U6RA 3QWOA 5IQ9B 2PYEB 5F89A 1ZEAH 3DURA 4U7KA 3U4BH 4KVNL 2DLFL 4F37K 1ES0B 5EBWB 1F90H 3TYGH 1CDIA 4MA8H 3DUUB 3ZDXE 5FYLL 4M9OA 4GKNB 1SBSH 4GW5B 3QA3A 1KUMA 4WUUE 4LIQL 5BV7B 2NY0D 1IGYB 4YX2L 5I1IH 2YD1A 2PXYD 4PB9H 1PEZA 5FO9A 1FGVH 1ED3A 3K2MC 5FECB 3QIWD 3QEHA 4LDEB 4PG9B 2AV1A 4LGRB 3T65B 3CK0H 1U42A 2BSSB 3K74B 1IEBA 2P8LA 3TM6A 4F7TA 4ZFOA 2VLKE 3KG5A 4NQDA 2CXKA 5E8DL 1P9MC 5F3HA 4DN4L 4XBEH 1BVKA 3L6FA 3F7PC 1U8IB 2EDDA 3U7WL 2HLAB 3P9LB 1KXVC 4OZ4B 3S4SG 4KPHH 1CU4H 1DVFA 1WBXA 4OCSL 1BVKB 1A7QH 1MRDH 3L6FB 4LARL 5CFHA 1G6RL 4NN5B 1OW0A 2HAZA 1H0DB 4UNTA 2ARJQ 3ARBB 2EEAA 3GJFA 4XNXL 4QHKI 2Z93A 1OY3B 5H94A 2AXFB 5I1HL 4LLUA 5JIHA 2GT9A 4M43L 3L7FB 5DC4B 3QFJB 2HH0L 5DC0A 4HUVB 5F7WC 4HULB 3WFEL 4M5YH 4X8XA 3AAZA 5EC1A 4Y4FD 2A0LC 1MLBA 1RUQL 2P49B 4NYLB 2IMMA 4OZFG 3RKPA 2R0KL 2GITA 3U7WH 4PGJA 3BW9A 2WNGA 5IFHL 1MI5B 4FQLH 1Q1JH 1QUNA 1OP9A 3BSZL 3WO4B 2WWKO 5K9QG 2J8UB 1W72H 1UFUA 4ZAKC 1XGTA 4WO4A 4O58H 4LLQB 5CEZH 3RVWC 4OTXL 5T1LA 5E1HB 4OAWA 3TBVB 5ESQA 4E41A 4PRBA 3MCLL 4JKKA 3MV8A 4JFXA 4KKLC 1MH5A 2JCCB 2Q7YA 5CBEA 1XR8A 3LS5L 1IGFL 5C7XL 3V95A 1N5YH 3NCCB 3BVNA 4KZEH 5T3XL 1HXYA 1VADA 4JPIA 4PJ5B 4WRLA 1B0WA 2FECI 4NQCB 1M7IB 3MOBH 3AS2A 4Q6YA 3DRTB 1KCRH 4L8CB 15C8H 3EYSH 4HPOL 4LQFL 4M6AA 5JQHC 4ZO6A 3KPPB 4M1GH 4NQUA 2FJFA 3RKDD 4K3GA 1R5IB 4OFVA 3O4LA 4NC0B 3PQYE 1T21B 4WI3A 4WTWA 2X70A 4WW2F 3DSFH 3FQXA 4FFWC 5CLTA 3TCXA 2APXA 4WEMB 2RHEA 3O8XD 2D31B 2PYED 3KJ4B 2AJSH 5F9DC 3RVUC 2GKIA 1XFPA 1I85A 2VOTA 3VWKA 4BK4A 4XC1L 4S1RL 4GG6E 3RIFF 3KPMA 4F3FA 5T1MB 2DKMA 5CJQL 4JFFE 3WV0A 4WWKD 4LKCA 2GFBB 3ZTJH 5HHOB 5K9OB 2BNQE 1DBBL 3VXTB 3GBMH 4HIIA 3K80A 2HLFD 4P2OC 4XCEB 5DMKA 2W65A 1YNTA 1KB5H 4JAMB 4M6OL 3TA3D 3FQTA 4U49A 3PV6B 5E1AA 1G84A 1BQLL 3ZHLA 2FR4A 4IJ3C 1HEZA 3NGBB 4FQCH 3Q5OA 3S96B 1OP3K 4HAGA 5FUOH 4PJ8D 3V5KA 2G5RA 4DKFL 4WCYH 5F6HI 3E6HB 1DR9A 2CLVB 4L9LB 3FN0L 1ZWIA 5TF1H 4F8QA 2R2BA 2WBKA 4XMPL 4UQ2A 5FGRA 4TNVF 5ITBL 1NCBH 3RU8L 4S1RH 1OAKH 4I9WD 1NMCB 5JDSA 2FLRT 3TIEB 5HY9B 4U33A 2NY4B 3VRLE 1JPSL 2A6JB 1H5BC 4DTGL 1QFOA 5SWZE 1JGVH 3J8F7 4L1DA 1P1ZA 3G9VA 1SY6A 5HGGS 1U8NA 1EFXD 4R97C 5JIPA 4AENB 1G7PA 2EYRB 3BDXA 3B5HA 2CK2A 1GOFA 1NFIB 1A6TB 3HNVH 4H5SA 3VXPA 3L3DA 1MCKA 3NIDE 3CGTA 4NJ9H 4KMLB 1YMMB 2VERN 3GJFK 4Y5VA 4B5EA 2ADJA 4Y4HB 3EKCA 2FX8H 5TQ2L 1SQ2N 1ZLSH 4MA1B 4HG4K 4DKFH 1MCPL 2RCSL 5T3XE 5IJVA 2HKHL 4HUNB 4JO4H 4L4VB 1J05A 3D69A 4PGBB 1DQJB 4QO1A 1YY9C 4WHTA 2BNUA 1NL0L 2NY5C 4V1DA 2FX7L 3W0WE 3T09A 1HI6B 3HNTL 4DTGH 3MJ9L 1AQKL 3QFJA 3VG9B 4CU6A 2O5YH 4EVNA 3RGVB 5F7YC 2Q1EA 4DKEH 3WN5A 4MNHB 4UNUA 2AEIT 2E5EA 2APFA 4LNRA 1UB6B 2YR3A 2V5TA 4U6TA 1JGEB 4ZUUA 1MCCA 1CGXA 1DBJH 1MSPA 3W81A 4UTAL 4QHUB 3FO2A 2R4RL 1KN4L 2HFEB 4S1DD 3WFZA 5JW3H 3BEVA 5IMKA 4CJ1A 3FTGA 1MVUA 4KRLB 3BWUC 8CGTA 1FC1A 3ZDYE 3GIZH 3O6FC 4MJID 4I3SH 4JO4L 5C0JA 3ILQD 4NN6C 4NQDB 5AYQA 4BUHA 1QZ1A 3H3BC 3OAUH 3UCRA 3CNKA 5I1LA 5B8CA 2J2ZA 2BSSA 4N0YL 1LMKA 3CCHA 2R4SH 4JM4L 1PW3A 4PREB 2X4RB 1KEML 2QHRH 3PL6B 5DJDB 4NZUL 3B83A 1NGYA 2P46B 1YYML 4D9RE 4ISVB 4XBGB 3OKLB 1CE6A 3MLZH 2DLHA 3E3QE 2YPVL 4JQXC 3RGVD 1UM4H 4GW5A 6FABH 3V6FA 3DVFA 1KLGA 2Q8AH 3FB8A 4OKVB 3HZVA 5EUKB 4LPYA 5E94A 5IMMA 3V6OE 5CKGA 1GHFL 3Q1SL 4I2XB 4PJDB 3LKPA 5C09D 3RHWK 5IB3B 4CBPA 2A1WH 1M71A 4J7RA 4MXVF 3NN8B 5C0IA 2Y5TB 1KTLA 4LCWD 3HAEA 3QQ4B 3VXSD 5JPNA 1MCJA 3LS4L 2GYSA 4R4ND 1EERB 3CDGB 1NSNH 1UVQB 4GSDL 4LGSB 3P4NB 1A6UL 2DMKA 3JSSA 4XNMA 4M7KH 1OP5K 4YXLL 3QQ9D 1DEEB 2EICA 4N0YH 4HK0A 1INDL 1D9KA 4M7LT 3VXME 3T0ED 1RSFA 4XWOD 3GSNA 1ZA6B 4NZUH 1JHTB 4YC2B 5IESL 3L5WA 5FHBL 1UACH 3E8UH 5M7QA 3C08L 4KMTL 4K2UH 5TPWH 1CICC 1U92A 2H3NA 4BZ1H 3ULVD 1ORQA 1FYTB 2OQJB 4XC3H 1GVIA 2DBLL 4K3DL 5DR5L 3ZTNL 2R0WL 2HRLA 3M17B 3OWEA 4BSVB 5FYJL 1DBKH 5KTEL 4XMKH 2XTJC 3ARGB 5GRXG 1MPAH 4AEEA 3SDCD 2A1WL 4X83A 1NCTA 1HH6A 4L8BB 4MAUL 3RWJB 3OKMA 4HIXH 1ITBB 3MV7B 3S3PA 4XBEL 3EO1B 3LMJL 4OGYL 1U9KA 3BOVA 2R0LL 3MOAH 5HDQL 3FAWA 1YPZB 5EOCJ 1RZFH 3FT2A 4FZEL 3BPNC 3F7YB 2ADIA 1M71B 2H6PB 5ADPL 3CFBA 4KGJA 3GMMA 3BZFB 2A0LD 1OARH 4FA8A 4K8RD 4YXKH 3MRKB 4NIKB 2DL9A 2YXFA 5BRZA 3U79A 3ZTNH 2G5BB 1BIHA 3LB6C 1MI5D 3FB6B 5FYJH 1DBKL 3MLWH 5TE4L 4M43H 2W07A 5C70A 1FYTA 4Z6AT 1QSED 1UKQA 1FC2D 4QWWD 1AP2A 1H8NA 2GIYA 3UTQA 3QXDA 1CDUA 4G8GB 4D3CL 2NPLX 1NMBH 3PWLA 3QDME 1NEZA 1RVFH 3QHZL 4JHAL 5CEZD 5HPOA 1K3IA 1RZFL 4FZEH 4NQED 5SX4I 3CZJA 2F5AL 2DQDH 3EZ8A 2A6KB 2I60L 4JEGB 1UWGL 3GSRA 1BIIA 1GL4B 5HHQA 1NPUA 3RDTC 1KGCE 3ZTJG 1ACYL 4PRNA 5DD5H 3RY6C 5DJXB 3UJTL 1B6DA 5DZOA 3DO7B 4PGZA 1IL1A 1X5KA 3LS5H 2ZUVA 4RGMC 3T04D 1G0XA 4JRXE 4ZPVB 3ZYOA 1S9WB 2X1XR 3UJJH 3TFKD 3TBWB 3HC4H 4OF5A 3REWB 3FOLA 2E3VA 1I75A 4JPVH 5GSRB 4H88H 5DUMH 4XMLH 5CJXA 4CMMA 5EN2A 4EI5A 5DA4A 4N1CA 5J9PB 2J8OA 1JL8A 2PW1B 1PG7X 4HJGA 3AS0A 1F58H 1NDGB 5EG6C 1MCLA 3REVA 2Z91A 1I4FA 2VXTH 4KJYA 1S9YA 1R3HA 1CFVH 2IEPA 1H3PL 4LSTL 4X98A 4AMKH 3L3DB 4LSPH 3HG1E 1XEDA 2AK4D 2LU4A 4X99A 4ZFFB 1V7NL 5C6PB 5KZCB 1RZ7H 1JNJA 3HC4L 2AQ2A 5CBAA 5I16A 1DLHA 3U1SH 1FL5B 2VZ3A 3R1GH 2HTKD 3AS3A 2ICEB 5DT1H 1T5WB 2AW2A 3VG0H 2N7BA 1LO5A 1DBAL 4TUKH 3MRIB 2VH5H 3VXOA 2OSLB 4G6JL 1ODAA 3PQYD 3HKFA 1IVLA 5ECJE 2W9DL 3DXAD 3C5JA 4IIQC 5CHNB 1DZBA 3SDDC 2UYLB 2GJZB 2YUZA 2VLRE 1FNFA 1AGCB 1AI1L 4KKAD 4AMKL 2ADJB 4Y4HA 3CFDB 2B0SH 4YDJB 3HPLA 3RX5A 1FDLH 3TV3L 1MCWW 5CS7A 3WIFA 2QADB 4H20L 3O6KL 3O0RH 5TF0A 5DMGD 2Z31B 3IFPA 2NZ9C 1OAUL 1OD7A 1UXSA 5CZVL 1P7QB 1S7WB 3A0OA 4J4PD 4TRPH 2H9GB 2P4AB 1CVSC 1S7QB 1U8KB 1KXQE 4OM1L 1S9KC 2GUOA 5IG7B 3GDBA 3TH4T 5IW3A 3QCVH 2DWEB 1JWMB 2X7LB 3EGSA 3RVWD 3SE4C 5ILTL 1S9VA 4FQ2H 3LEYH 2APBA 4MA3B 1AD0B 3RNKA 5KN5A 1YPZF 3ALXA 1ZVYA 4NWTH 4S0TD 1A7RL 4UIKL 4OBSA 4WV1B 1S9VB 4HDIB 5KSBB 1BM3L 1XCTA 2BMKA 2NZIA 1A7NH 5LXGH 4R4BB 5IEKA 2FECL 1ZTXH 2A6IA 4HMDA 3RVXC 4NKQB 3K8MA 1I7RA 3FFDA 4J6RL 3BVNB 1W0YT 3U9PL 3PGFL 2OXGA 3O4OC 5ESVA 1RZ8B 2BVQB 1DLFL 4J4PA 4KRPC 3X11A 1E27B 3SO3B 4P9HL 5CSZA 4OFKA 4Y19B 1T5XB 3CIQA 1EHXA 3SDXB 5JW3L 5ACZA 3CFEA 4FQ2L 1T2QL 5H2BA 4OFPA 4EIZC 1HCFX 3I6LE 1T21A 1J0ZA 3CLFH 5BVPL 3RVUD 2P42B 3QEQA 1DE4A 2GITB 2ID5A 4R26L 3T0EB 1QKZL 3DV4A 3CVHA 3IDYB 2X5PA 4TULH 3Q5TA 5EU4B 1A5FH 4JRXB 4KAQH 1AR1D 3SJVE 1W0VB 5E2VL 3DVIA 4NDMB 1KBGL 4G5ZH 1IT9H 4Z78B 2CK0H 2X89D 3D25A 5JOFB 3NFPB 1DLFH 1LP9F 4LLYA 3DMMB 2KQMA 3OJDA 3WLWD 1J88A 4KKAC 4UIMA 3RWGB 4ZTPH 4MDJB 2ZUWA 3TJHD 1UADC 4L4VD 4WNQA 3MGTB 3NABL 4QYOA 4V1DD 2Y1VA 4C4KT 4AL8L 3HZMB 5GHWL 2R29H 3WS6C 1PVHA 2OM5A 2R2CA 4X98B 1UM5L 1U8PA 4FN0A 4NRZB 4Y16B 4K9EH 1Q0YL 4ZXBB 4KK8D 3SBWC 3REVB 5E00A 3FQRA 4MXQC 1RZJC 3SKMA 1FE8L 2ESVD 5BOPA 1ZVSA 5C08D 3MLTB 1NAKL 4WUUD 5EU5A 5SWZA 3BYTA 3OL2A 1I8LA 4X5XB 2C3HA 1BEYL 3L3GB 3TZVD 3RI5F 4YR6B 2H41A 5L0QC 2F53A 2AGJH 4PJEF 2Z35B 3ETBF 4BZ1L 3FOLB 3ULSA 1KIPB 5HDOA 2DBLH 4K3DH 1JHLH 2ZOKA 3CUPA 5I73B 5DRXA 3WIHA 3EYVB 3B2VL 5LCVH 4PY7A 5CUSH 5T5FH 4XPHL 3DV6A 2H2PC 2VDPH 1JRHH 3MJGX 2DLEA 2COQA 4NO2B 2PYEA 1I8KB 2ZKHL 1WBZB 4ZXBD 2MMXA 5ALCL 5EBLB 5DJCA 3OKOB 3MGAA 2X4QB 4HXBH 2VO5A 3ULUC 4L4TD 1SJXA 5ADPH 4IMLA 3VI4F 3HMXH 1A22B 5TDOA 2HT2C 4MAYA 3SJVD 5B38B 3BQUD 3U36A 4IDJH 1MAKA 4C56B 1F4HA 4JKWA 5E4EB 1MFBL 1NGQL 5F9OL 1OAZH 4JO1H 4R96A 1H3VA 4LOUC 4HFWA 3BH8A 5D1XD 1S78C 1JWSA 5F7MC 1U3JA 4CADB 4FQ1H 3QIBB 4PV9A 1UYWH 3KDMB 3OMZA 4AQOA 1L7IH 1ZT4A 4XNMB 5GRVK 4DKDC 1MCBA 4JO2L 1QSVA 1AIFB 4G42B 2NYYC 2VZUA 1KACB 3OG4B 3FT2B 1S7VA 2QSCL 4PJCF 5D2LB 1DVFC 5KSBF 3KHQA 3EDFA 1MRCL 1IM9D 4KTDL 1WEJL 4KY1L 2DRUA 5DQDH 1FG2A 1GGBH 1CXIA 4IMKA 3KYMB 4U1JA 3SDCB 1RZKC 3OTTA 2JK5B 4RA0C 5D8JL 2X4PA 4HKZA 1EEYB 3U9UA 3MA7B 5J0BA 3HMXA 3NACH 1U91B 2JJVA 4LKXB 3U82B 3ZKND 2HVKA 1CQKA 5HYSG 3SDXF 4H88L 2DD8H 2XZQL 3HI1B 1I1AD 3VXNB 4WNQB 1EEZA 3QP3A 1BBDH 2VMFA 4JFOB 2BC4B 1WBZA 3L9RA 4WHYG 4N0FB 5E2WH 5GZND 5I74B 4U1SA 5INCB 5L7XL 4Z7WA 1PQZA 1W0VA 2BCKA 3P9MB 4FNLH 2I9LB 3KJ4C 3DUHA 4JVUA 2CXGA 3EFFB 2I5YL 3EOAB 1DBMH 1SYVB 1LP9B 3L95A 1EFXB 3MRHA 5JW5A 4LVHC 4AIZA 3QHTC 1C5DA 1CFTB 3NCFB 4JGMA 5D7JA 3QQ9C 2CKBA 3FB7B 3PGDA 2I07B 4NNYB 1VACA 3HZYB 5C0FA 4M1DH 4LAQH 3A6OA 1PY9A 8FABA 4XWOC 2J1KA 1GGIL 4TUKL 3CFEB 1RIUL 1QFPA 5HYQA 4RGNE 3CFIC 1IKFH 5E8PA 2OI9C 4LLVA 5E6ZA 3HZKA 3VE0A 5JNYA 3GBLA 1YEHH 4Q6IC 1YMMA 4J8RB 1IC4L 3L3KA 1CFNB 5ID0A 4O00A 3GMPB 1S8DB 4ODTL 1JZ2A 3FFCB 3AREB 2W1NA 4ZFOL 1CG9B 1BOYA 3BWAA 2ESVB 4EUPB 5EFIA 2CLRB 1NC4D 1MREL 2BMKB 2MJWA 5IVXB 3GSNL 2BNRE 3MA9H 1VDGA 5CGYC 3OKEB 4WV1A 3MLRH 4LNRB 3V4VL 4QRPE 5E99H 1ZT7B 4LCYA 3CAFA 1T03L 4LAQL 4MJ2A 4NDMA 5GGSB 4OLXL 3HE7D 2GY5A 4U1GC 3VGDA 3HI5H 4WW2A 4ZAKA 4HKXA 3D9AH 3F58H 3DWTA 3V7AG 5MEQA 4MNQD 1RMFL 4D0CA 1MIMH 2QKIB 4FQJH 2IPUK 4KHXL 3PV6A 5E1AB 2H32A 1TNMA 1WIOA 3L3OB 3ZKXB 1GGYA 4UIKH 4DOHE 4HH8A 1R5WA 1DQQB 1M7DA 3P11L 1EIBA 1FNEB 2VZTA 4OGZA 3GSNH 4XPTH 5D5MA 1QNZL 1TPXB 5I19H 4YFLI 2PTVA 4JDZA 5HHXL 2LQRA 5FIEA 3PQYB 4ESKA 5EU6E 4NUGL 3NFNA 2L0DA 4X6DF 1U8HA 4PV8B 2IH1A 3RZCA 3MNVA 1FZJB 2VLKD 2VR5A 4HT1L 5D2LE 4HXAH 4A2MA 2I26N 2FH8A 1MQKL 1JPST 2W0PA 4YHZL 1PX3A 3I6LD 3BESR 3QDJD 4Y4KA 3I2CH 2FZ3A 4NN5C 1HHHA 1JRHI 4PJHB 1FL5A 4KK9C 3DX9B 3TGXA 1K8IA 3FKUS 3AGVA 3RWEA 2LABA 4RFOH 2N4IA 4M8QB 3P11H 4EJ1C 4HIJA 2FX9L 3PWVA 4JLRB 4O5LH 2APTA 3LPGA 1RAMA 3D3VD 5CZKA 4U6YA 3X17A 4PR5B 3TH2T 4OGAC 3BIKA 3T3PE 4PJAE 5D5MB 2XKNA 5BVJB 4UUJB 2Y36L 2VXUH 5CBEB 1ZGLM 1MQ8A 1KPRA 1R5WB 5FUZL 3HZKB 5DSCA 3ARXA 2ICWI 2VWEE 1W2KT 4RIRA 4O9HH 3O3BA 4JFPB 5JHLH 4P2QE 4CVXA 3M1BB 4HWUA 4LVOB 3QUKA 4P59L 1OPGL 3QUZB 3LPWA 4WFEE 4YHZH 4HUMB 1VACB 2VL5B 5F6IB 2MKLC 1XF5A 4JREC 4K9EL 4N0UB 5DO2C 4I77H 4GQ9H 3O9WD 5F1NB 1TJHH 1KIQB 1MFCL 3TBWA 3KPSB 4L8CA 2OL3H 3IU3A 1BZ7A 3O3EB 5EULV 1IL1B 3WFBL 4MA1C 4IRSA 2NW2A 3GIVA 1T89C 2E9BA 1B9ZA 5GIRA 3BZEA 3IETA 4NQCD 5FUZH 5D7LD 5IFAH 1FLTX 3BWAB 2WV3A 4E5XB 3UDWC 4HJJL 3TLRA 3HMWL 4XPAL 1D6EB 1ERNA 3G5VA 3DI2B 4BYHA 2XQYG 2IBZY 1AO7A 3QDGA 3O45A 1DSFL 5AUMB 2JB5L 1BJ8A 1T22B 4L4VE 1CIUA 4LHUA 1T0PB 3MLXH 3SCMB 3VXNA 2MHAA 4L5FL 4L4TA 4W4NA 3WIHL 4Z8FH 4KK9D 4Z7UB 1NEZB 5DHVB 3VCLB 1NAMA 3MACH 1MAML 2H2SD 4GQ9L 5IW6B 5KG9A 2ZNWA 4A6YA 1MFCH 3WFDL 3GSOB 5C0FB 4OF3A 1LNUB 3RVXD 4KKBC 1QG3A 4HXBL 1N7ML 1AR1C 4Z0BL 3UBXA 5FKAA 4OZIB 5D1XC 4HWBA 3MRKA 1HQ4B 1PBYA 4OF6A 3SGJC 4N9GA 4J1UB 4QRPB 2CD0A 2NX5A 5DMIL 1T7XA 2AJXL 5KVFL 1IGYA 5DEZA 4X9HA 2F53D 1DSFH 2EYTB 1KJ2L 1BQHA 4QRRE 4X7CC 3ZYJA 4CVWA 4WI2A 5C0BB 3BPCA 2J6EA 1INEL 4L5FH 3MNZA 3CFJB 3QI9B 3MUY1 4E41D 3F6IA 1VFMA 3MACL 3FMGL 1B4RA 2ATPB 2YN3A 4AIXA 2FO4A 4L8BA 3X3FH 4YHNA 12E8H 2DLFH 4LCIH 2OZ4A 3FRPA 1NMCC 3TPUA 1CGUA 3IJSB 1GGTA 5GSVA 1A1OB 4EN3D 5KW9H 4RNRB 1F3RB 1CYGA 1MRCH 2X1OA 3DETC 4ELKA 4L4JA 1F4AA 1SEQL 3EOTH 2ICWB 5IF0A 3MMEA 4JFZH 4ZS6C 4B7LA 3SGEH 1SYSA 5IF0B 2X1PA 5JA9A 2VDOH 4PLOB 5F9WB 1UM6L 4NNPL 2I27N 1V7MH 4QNPE 4PJAA 2KL6A 3V5HA 3NACL 4WI8A 5DWUH 4YC2C 1OP3H 3LHPL 2BHZA 4NQTA 3CVHH 4OCWH 1LDPL 2DD8L 1MRFL 2XZQH 3NN8A 3EHBD 2IANA 5HD8D 5JORB 3MREA 1KENH 4P46A 3GSXB 2CR6A 3CMOL 4X7DC 2ADIB 2H6PA 4LCIL 2BHYA 4PUBL 3L5JA 4Q9QH 4K3JL 4KC3B 2XTJB 1CS6A 2XN9A 1E4WH 3VFNB 3RGHA 4N68A 1UCTA 3K4AA 1OTTD 3MNZB 3E3QC 4W70A 5EUKA 1MRDL 1YY8A 3LH2L 3V6BR 3VD7A 3I3EA 7FABL 4P5TB 4NN7B 3G04A 4NQDD 3FO1B 4K8RH 3TZVA 3QI9C 2DQUL 1FIGL 5L7XH 5GRJL 4CVZA 2O93L 5EBMA 4G80B 4H8WC 5EU6A 1UM6H 2IFGA 3X12A 3GJFH 2A77L 3FQRB 2BERA 4HK3N 4U6HA 5KSAA 1LILA 4IMLB 4NFBA 3H3KA 1U8PB 5JZ7C 2A6DA 1L4IA 4WW1A 2VDLL 2X4SA 4N0UE 2XRAL 1A9EA 1KENL 4YGVA 1QBLL 3O6LH 4I4WB 4UB0L 2EDRA 1CGTA 4Q2ZA 4RAHA 3IDIB 3PIQB 4K3JH 2ATPA 2J8HA 1WZKA 3B2UC 5JZ7D 3DX8A 4WHCA 4Y1AD 4LEOB 3UPCA 4PJBE 5J3HD 4RRPA 2XACC 4GKOA 5FDYA 4QT5B 3EYOA 4M3JA 2DQUH 5B22A 2V5YA 3O11B 2VLMD 4NRXB 4MNHA 1J0IA 2ZOKB 3CUPB 4V2BA 4Y2OA 2PETA 3EO9H 4LCWB 3MRNB 2WMPA 5J12B 4KK5C 4D9RD 5SV3A 3BT2H 4G7VL 2W0FA 4QRPA 5IP4A 2A2QT 1J86A 4G7YL 1OGAA 4N1HB 3FB8B 1T66C 4PGCB 4MHHI 2UWEF 1DUYA 4P23A 4LPVA 4JE4B 1U3YA 5K9JL 5KG9B 1T6VN 1S9XA 4OCSH 1NAMB 1KCVH 3BP4A 5EIIA 3U7YL 4BQ6A 3I3BA 4LARH 4MVBD 1F2XK 3MRBA 5I6XC 1NLDL 2EYRA 3ARGD 2MTPA 5CJ8A 3L3IA 4PJGF 4QTHB 5EUOA 3KPLA 3VXRA 3LVEA 3Q2CA 1C16B 4ZOCA 1AHWB 1WFOA 4ETYA 3S5LG 5DRZA 2YUXA 3DTXA 3RUGA 4X5WA 3WKNA 4QRRB 4R4BA 5GRYA 5GIRB 4FHBD 3W11C 4Z78A 2DIAA 3P9WB 1X5LA 2H26B 4TVPH 4UQ2B 4QRPD 1RUQH 3QQ3A 4OQTA 5DJ8B 2V9RA 3RWEB 5F7KC 2B2XH 4WY7L 3KPSA 1AD0A 1FQ9C 1TZGL 2UVEA 3PDGA 5E9DE 3RNKB 1FLRH 5KN5B 4XCFL 4QEGA 4X4YB 3DXAA 5HVGB 2E7LC 5T1KB 4Z7WE 3U7YH 5ALBH 4X4MA 2VUYA 4OCXH 3TBSA 4ZOAA 2E7HA 1PLGH 1FZOB 4OGAD 2P24A 3EFDH 2R2HB 1U8HB 4PV8A 3I2CL 2WIIA 4HWBL 3H9SA 3QBTB 4HLJA 4UINH 5I0ZA 3LRHA 2IFFL 4KZEL 4NKIL 3MRLB 4LHQB 1CQYA 5DRNB 1U6AH 1NLBH 1RULL 1U3HA 4F57L 4F7PA 5BS0B 2VAAA 4BZ2L 2JE8A 5CD5C 1PYWA 3SQOL 1WZ1H 4KJWD 1FLRL 2VWEC 3HNVL 2JIXB 1IGML 3PGCB 3DJ9A 3QO0B 4WIQA 4WVRA 2Q76A 1A7PH 1WCBA 2N56A 3ARUA 1WAAF 1MWAL 4M6ML 3MRRB 1BVLA 5L6YH 4UTBH 3ARGC 1ZLSL 5CEXA 1PLGL 1SBBA 1TETH 4EDXB 1HSBA 4YHYB 2RFXB 3X13A 4NQEA 1D6VL 4R3SA 5D1XA 1TZIA 3AS1A 4JVWA 1XF1A 4QCIB 3FQNA 1JF5A 4HUXA 5IG7A 1R0AL 4Q0XL 2OL3L 4QRSB 2NY2B 4YK4C 3WFBH 3WJLC 5I76B 4RGMB 2GK0A 4JFFD 2H45A 2XY1A 4P5TD 5E70A 3WUZA 4RMQA 5IB1A 4Z5RA 5T1LB 1WGOA 1JNHA 3RDTD 3TO4C 3HPJA 1F4WL 1XGYL 3V9FA 3HNSL 3CDCA 5HHOA 1A1NA 5K9OA 4XPAH 2AXGA 5HPMA 4UTAH 1AD9A 1DP0A 4ZUWA 5DUPH 1RU9L 3V0AC 3CX5K 2Y6SD 5FEBA 3VE0B 3FB5A 1PDKA 4NZJA 3BPLC 3LKQB 1JK8B 1D5ZB 3CFKB 5MEQB 4Z7QE 1UKTA 3S3JA 4L9LC 4XPFL 3TIDA 1A6WH 1FZOA 4BELD 3VXOB 5SWSE 5FYKL 3FQXB 3B9EA 1KT2A 1NBQA 3MRIA 1C5BH 3NCJL 4W4OA 1AY1H 2OR8A 4QXUL 3RJDA 4PRPE 3GKWL 2NTSP 4QY8A 5LVEA 2VQUA 5T33L 4X8JB 4XTRC 5JLZB 4AIZB 1PKQE 1IAMA 4JM4H 1OQOA 5EC2B 1J1OH 3JWDC 4XPGL 3BUTA 3B9KC 4F58H 4CN1A 1XF4A 2BOCA 3V79C 4HS6B 1J5OL 1FHGA 3WSQH 4Q97A 3HC0A 2VR4A 4P2CG 35C8H 3O9WA 3JWNC 4YZFF 4N90D 5C0CE 1DQTA 4MQXC 1KPVB 3BO8B 4ZS7L 4HPYL 1C08B 1LDSA 3B43A 5C8JA 3U4AA 3H7BA 1L6XA 1INEH 5T1DH 1EAJA 2W9LA 2AK1L 5TE6L 4ZOBA 5FO8B 2QSVA 3SDDA 5A43C 1TVHB 3LKRA 1I1CA 4J23A 2OR9H 4KRMB 1VEMA 4WUUB 3GO1H 2XKSA 2JJWA 3X3FL 1BFSA 1CR9L 4F7CB 2YMXL 5DJAA 4ZAKD 3BXNA 2O5YL 4AT6B 1PEWA 3MV9D 4XVSL 2A83A 3GM0A 1S5HA 1GZPA 1I3GH 1MIEL 5A3ID 4LHUD 3QDMD 5GS0H 2I25N 2B8OT 5E8EA 5F96H 4IS6A 4TSCH 5IM7B 3H7LA 4ZS7H 3F7YA 3QB7C 4LMQI 3ULVC 4K7PY 1IEAB 1BQSA 1T2XA 2EDYA 3D85A 2JB6B 5GGUA 4HUVA 5L88H 3QEQD 3DYOA 2B4CH 1FBIH 1MELA 1UZ8B 4FQXC 4RWYH 3QWOB 5IQ9A 4HGKC 1DUZA 1L0QA 1H0DA 5HBBA 1ZS8B 2GCYA 1AE6L 1ZT1B 1RIHL 1MRFH 1IE5A 1C5CH 1QEWA 4PYHA 4Q9RH 1ZT4B 3WEXA 2R56H 3ZYZA 5IQ7H 4P46D 4G6KL 5CZXD 2QQLH 5C8JB 2MOVA 4XVSH 3TYGL 3M17A 4BSVA 4UT9H 5DVKA 5BS0E 1U8LA 1A9EB 4QOKD 3CSBA 3N06B 4KKNA 1NGXB 4Y19D 3TCLB 2A6DB 4HLZH 1EEYA 1TITA 4KK6D 3U9UB 3CDFA 1INQA 1A14L 4HFUH 4JHBA 3QIUD 1T7YA 4PJIB 4QRUA 4P3CL 1YEFL 4OFYD 1A6VL 1RZGA 1B88A 3D2UD 4TQEL 3MLWL 5EC2A 5TE4H 3V6OC 2NR6D 5L88L 3UTPD 5TFSH 4NWUL 2DLTA 3SGDI 1WC7B 5LGHH 2IGFH 1MCSA 4QOKE 3CDGA 5E03A 1VGEL 1FSKC 4PLKD 4JHAH 5I9QC 3D85B 3VFNA 4M61A 5ACLA 1XR9A 5C09B 2GJ6A 4ZO9A 1EO5A 1PG7L 5J11B 2BJMH 1JWSB 5JORA 1I1AA 3MRCA 3U0TA 2DQHH 3QUML 4K2UL 5IGXL 1Q0XH 2V9QA 1CICB 4Y2DD 4C58B 5DD5L 1X3DA 2FH6A 3RUGF 1YEFH 4TN9A 3UTSE 2MQ3A 4NZTH 3VMPA 2WBJA 4O2EB 1YMMD 4I2XE 2JKXA 3BDYL 2AS5M 4HH9B 2Q6WB 1ZOXA 2J4WH 1KCUL 3BYYA 4G7YH 4K71C 4JJHA 2EDNA 3JV5A 5DJ6B 3RTQA 5EU3A 2DQFB 3P0YH 4N8VA 4WUKL 3MBED 4IHOA 2DN7A 3FQWB 3GBNL 1UCBH 3MCKA 4L8SC 5FUCC 4OGYH 4NM8H 4L3AA 1HSBB 4ENEC 3MODH 4NOBA 4ZPTA 5IFHH 4P4RA 2JJSA 2EIBA 1UVQA 3NTCH 4QHLA 4NCC2 5IFJA 4KTEH 1F58L 3QQ4A 5JPNB 1EHLH 2HRPL 5D6CA 1JTTA 2VLRA 2PKDA 2XZCL 3VRLF 2KUTA 3DV6B 4ZSOA 4ENED 4GH7B 2VXTL 3RTQC 1CD9B 4OIAA 1I85C 1WTLA 5GS3A 3HLAB 5HJ3A 3WNLA 1MCEA 3D6GA 3SDXE 4N5UA 4KI1A 4QRTB 4R2GC 1IGTA 5DVMA 3SE8H 3VFMB 2OTUA 3GK8H 3VWJA 4Y2DA 2E6QA 1IGFH 5C7XH 2WBJC 1P2CA 32C2B 5TE7H 1C1EH 3VFUB 3MLSH 1T2JA 5GRVL 2VB5A 3B8SA 1DQJA 3ILPA 4LEXH 1CE1L 5I1KL 1J05B 3P0YL 2B5IB 3C6LA 4TVPL 2HWZH 5DT1L 4B41A 4S1QL 4N9GB 3GBNH 1UCBL 1KCRL 4IIQB 4TVPE 3CJJA 4XP4L 4FMKA 3JWOC 3B9KB 1J1XH 4RMVA 1FAIH 3FB5B 4PJ7F 3HG1A 5HVHC 4ZUWB 1NQBA 1ONQA 3VJ6A 5DJ0A 3MXWL 4YDLC 4JFHE 3UP1A 1AXSA 3NZ8B 1EJOH 4RGOH 3HPJB 4HS8L 3O9WC 3EJZC 1NMAH 1ZHLA 3TPKA 3NZHH 1ACYH 4Z5RB 2FCBA 4NOFA 5E8EB 2HFEA 5EOQH 5ACMA 1E27A 1Q9LB 4HWBH 2X4OA 3B9AA 2YOCA 3DMMA 3GK8L 3MOQA 4XC1H 5J56B 2ADFH 2RJMA 1UGNA 3BD5A 3FHQA 4LSQL 1AR2A 2NTFA 1BBJB 2GSGB 5CAYB 1OAUH 4LPTA 1CE1H 2Z9TA 5DUML 1TZIB 5HI3D 4GW4A 4NT6B 1JWUB 1PKQB 4KKLD 3GIVB 3KPRB 4P2OA 2X05A 5CCKL 4Q74A 3V6ZB 3NFSH 1P4IL 3BP4B 2CUMA 1S7TB 2CDEA 3DROA 3SKOB 2J8UF 3IF1B 4OD2B 1R3LB 4JFYB 5DC9B 5C0ND 5I17B 1BQLH 2EDKA 2IQAB 1H15B 2OP4L 4MVBC 4ZSOE 1LEGA 1GAFH 5FGBC 1VFAB 1XF5B 1TETL 3ISWA 3FFCE 5FUOL 1WV7T 4XCYA 4O02H 1ROWA 1DUYB 3VD5A 2GUOB 2Z4QA 1N6UA 2ITCA 2CIIA 4Z76B 1DQDL 1QD0A 1QA9B 2JCCF 5F6IC 5C08B 1K2DA 4HZLA 3I02B 4LLDB 1IAIL 2YC1B 3B6SB 3U1SL 1PSKL 1JPSH 2EXWC 4HMEA 1OGAD 4HKBB 2AABL 3QRGL 3R1GL 5I8EA 4RDQF 5DJYA 1N59A 3G9AB 2YPLB 3L5IA 5CGYD 2YA2A 1JF6A 4QXGL 3PGFH 1H3WM 1T04B 3SPVA 4A2LA 1WTGT 3EYOB 4WO4D 2ERJB 2I24N 1I8IA 4M93B 1YEIH 5JIKA 4HBCL 3GKZA 3PWPD 5BRZE 3BIBX 1FN4A 4LEOA 4MSWB 4WWKC 4XAWL 2UYLA 1R5IA 4WTZA 5GGRY 2CLVA 4L9LA 4NGHH 1G7QB 3DX9A 5IWLC 1OW0C 4R8WH 5J3HC 1HHHB 1AGFA 4M62H 2GJ6E 4YBQC 1RHHB 3QQ3B 1U95A 2BY3A 3PABA 3AM8A 2UZYB 1PZUB 5E2UL 5ELIA 4HWZA 1TNNA 3DETD 4G9FB 1A5FL 2R69L 3IRZA 3RUGB 2MPAL 3EOBB 1UWEH 2OJZL 1KCKA 4E41B 2UUDH 1KBGH 3MUGB 1JF1A 5FHAH 1BPVA 5HGDA 4OM1H 4WWID 2XYCA 32C2A 1P2CB 2R8SH 1QA9A 4OF0A 3UYOD 1NH6A 4DJMA 3QCVL 4HKJB 5DEFA 3A67L 3G6AB 1OB1A 1OLZA 5F8QC 5T1DL 1S7SA 4B7IA 2OK0H 4IJ3B 2CRIA 4FXGA 5I17A 5JPMA 4KVCL 3ET9F 3VXMA 3HCVA 1MLBB 3N1MC 2ZCLH 4LRIC 2CO7B 4ERSH 3V6ZA 3RVVC 2OR9L 3UTPE 1J0YA 3RDTA 2ZCHL 4OD1L 1N64L 5EA0H 1MLCA 4HKXB 5CEYB 4NT6A 3LN4B 3MV01 4KROB 1Z3GL 3ZDXF 5KVEH 2CUIA 4MJ5A 3STLA 5ESAA 1OHQA 2OJZH 4LVOC 43C9B 4LPXA 5DD1L 5H8DA 2RAMA 2Z93B 5IEHB 4FQXD 3DMMD 4HJ0C 3P4OA 1CL7L 4XZUB 2NY7L 1FRGL 3AXLA 3K0WA 5CSGA 4KV5F 5L8KB 4YXHH 4MNGB 3SKJH 3SO3C 3F7QA 3FT4A 2NZ9D 5GSVB 2UY7A 1OM3H 4KV5E 5ESQB 3TPUB 3T0XA 1J8HA 3CZFA 5BRZD 1OLLA 2DBJA 1URLA 2DM3A 2H1PL 4PJ7B 2B4CL 4XPHH 1MWAB 3CLFL 4WW1B 4XNYH 5BVPH 2F54B 3T8XA 4N5EC 5E4IA 2NW3B 2AJZA 5JMRA 5HHME 4R26H 1N8ZA 5E8OB 3ARDA 2FHFA 1Z0NA 2O5ZH 3JUZA 4YHPB 2VLKB 2QQLL 2DJSA 4JRYD 4FFZL 3SCMC 4UT9L 5FO9B 3QUXC 3TVMC 3OXRB 1FVDB 5IVNA 4ETQB 2NY7H 1FRGH 2HJFB 1FVEB 5FB8B 1LE9A 5T3ZH 1FNSL 5C0CA 3H9SD 5HHMD 5ANMB 1EFXA 5DR5H 4Z7UE 4OFYA 3RJQB 2C4FU 2L7JA 1EZVX 1C12B 4HV8B 3Q3GB 3H9YA 1Q94B 1CDBA 1FGNL 1NAMH 4RQQB 4ZSOB 1CVRA 5LGHL 4YWGH 3ZL4L 1IZJA 3ECBB 2BVOB 4NQSB 3QAZC 3W0WA 1PZ5A 1UQSB 2BXZA 4R9HA 3T1WA 1L7IL 3K46A 4PRPA 3N85H 3LMJH 3TA3B 2H2SC 1JI2A 4YO0A 5SWSA 1U0QA 2YRPA 4FQXB 3VFTA 1VKXA 1T22A 2BFVL 4LHUB 4N0CD 2Z0BA 4TSBH 5MEPB 2HTKC 1J11A 3BD3A 3M8OH 1I1YA 2UWEA 4LSRL 3MMEB 5CEZE 3QWRD 2P8LB 3HE7A 4QGTA 5L0QB 1W0WB 3QFJD 1CLOH 2C1OB 4ORGB 3TYFB 2ZOLA 1ED3B 2XKUA 3GSUB 3T4AA 2G5BA 4YAQB 2Z92A 2NW2B 1LEKB 2P7TB 3F5WB 5FA3A 3CPLA 4PJCA 3O3EA 1AGEA 4JGJA 4W6WB 3GSQA 1ZKAA 3LEVL 3GUTB 1C7SA 4XX1E 4PY8I 1GZPB 1JRHL 2OMBA 2GJ6B 1ZA3B 5IHUH 3UPAA 4ZQKB 4FRWA 1YEEL 1P4BL 4MX7B 1S7VB 4C83B 4P23D 1KCSH 3CD4A 2OR7A 4KTEL 4JHZA 1BREA 1FZMB 4JRYE 1A0QH 3VGAB 1JE6A 7CGTA 5K59F 4WI6A 4KQ4L 2LAAA 2XKNB 5BVJA 2YK1L 1KPVA 5E56A 2NY0B 3SE8L 2DWDB 1OAZL 5F6HJ 2IH3B 1CDGA 1RUKH 2YD7A 4XRCB 3TN0C 3MQIA 2BNQA 2F15A 1G9ML 4XBPA 4TNWF 4PGDB 1D9KB 3FO0L 4GRWH 3STZA 4EKXA 2VLRB 4L3CB 3SQBA 1LD9B 1J1XL 1FYHB 3BRDA 1GGIH 5CP3A 3ARSA 1ZLVK 1FV1B 3VFWB 1GXEA 3KGRA 5TQ0L 4FFYL 2VABA 4G6FD 3B8YA 3DRQA 1WEJH 3CC5A 4DGYL 4X4ME 5IHZA 4QF1A 5I1AB 3PQYA 3BP6A 5FCUH 1NANH 4M1CC 4P9HC 5SWQB 3BRGC 4E9LA 2ADFL 5TH2B 2NY6B 1A4JB 5D7LE 4QHMA 1HYRC 2EDQA 3HI6L 1DQQA 3QPQC 5F9AC 4PIRF 3MA9L 43CAB 3WDIA 1XAUA 5F7HA 4PREA 2YKLL 2GK0B 1BFVL 1EO8L 2FEDC 4TTGA 4AG4H 1QR1A 4U1NB 3WFHA 4HG4J 2DYPA 4NBZB 3QJFB 4FQHB 5EUOE 4FFYH 4P46C 5KSBE 1MAJA 3R0MA 4OUUA 1SJVA 2EDBA 4OBRA 4NQEB 4R3SB 3B5GA 2XZAL 5BJTB 4EI6A 5I71C 3WMSA 3DHMA 3VXSB 5C0CD 2C1PB 2Y07H 1SJHB 4R6UA 5CEXB 5FCUL 4FNLL 1FDLL 3TV3H 2NLJA 2Q76B 1PX4A 3UPRA 2DS4A 1MHHA 3G08B 3T77A 2VC2H 5IVXA 1U8NB 2IBGA 3HI6H 3PV7A 5HHNA 5JOEA 4HS6A 3FAXA 3OSKA 1F11B 1OGAE 1G9EA 1EO8H 2FZ3B 1JHKH 4EEEA 5I19L 5J11C 5T1KD 1HWGB 1CGWA 4QXGH 1WWCA 5DRNA 1QHOA 5CKAA 2B1AL 5JNYB 5DHVA 5FAAA 1YEIL 3QULB 1S78D 5E8PB 4Y5XB 3RL2A 3Q5YA 1J8HD 4FZ8L 1FL6B 4OQTL 5IJVB 1OQXA 1IGJA 4YUEH 5TDNA 1FPTH 3LKQA 5I75C 5HDBE 4I9WE 4NRYA 2DYPB 1YEDA 4PJBA 3UC0H 4M62L 1QR1B 1Q9OA 4E5XA 3V7MA 5EZIH 1X4XA 4PJEE 4PRIE 4JN2B 3MV9B 1SYVA 2YA1A 3MRHB 5IM7A 5BW7C 1ZVHA 1JIBA 1G7IB 3CX2A 3SDAD 1JZ4A 2MPAH 2V2XA 1GGUA 2BCKB 4FQIH 5L2JA 1JPFA 3BPOB 2AEWA 1AGBA 2H32B 1FYTD 3O3AA 1L9MA 4ELMB 4NZRL 4TOYL 2V17L 1T0MB 3OKDB 3TIEA 1L9NA 2VISA 3KLSA 3NBNA 3HI5L 1ITCA 1HHIB 1KELH 4MS8D 4XVJH 4NSKA 1TJIH 1UB5B 3AU1A 3SGDH 4FZ8H 4WW2B 4NHCL 5DYOB 4WI4A 1GGCL 5EPMB 1VFBB 1N3NA 1QQDB 1NJ9B 1TVHA 3EYQC 4HWNA 2Q3AA 3SDDB 4N8VG 3TVMA 4G6AD 2ILLA 4KVCH 1NDMB 5C9JB 4P2YA 3ROLB 2ZCLL 3RRQA 4RISL 4UUJA 1L7TH 2VLLB 2W65B 2FEEL 5I18L 1TJHL 2IANE 2HP4A 2PXYA 2VLJE 4R4NC 4OJFL 2IH3A 4IRSC 4CGTA 3AREA 4EDWL 1Z3GH 3BJ91 4LBEA 1G7LA 1FIEA 4HKZB 2BNRB 1U8KA 1RJLB 4HW6A 5DHYB 4NZDA 2V2WB 2XTJE 4NUGH 1YY9D 5KS9A 3KYAA 5IR1B 3RWFB 4GG6F 1VGKA 4QXTA 3MR9A 1F8TH 3FRUA 4TPRL 4DZBA 4P4KC 4IOFD 2X4NB 1XGQA 1GC1L 5JR1L 1SEBA 1OM3L 5E5MB 2JB5H 1OD9A 3BIAX 5IVOA 4GRWF 4L3ED 4YDJA 3ULUE 4AL8H 3DGCR 4Z7VA 2VISB 2X1QA 4BFIA 5L2KE 3I6GA 3IGAB 5F1SA 4ODUB 4G3YH 5D1ZA 3T08A 1LK3H 4MB3A 3INUL 2HYMA 3I3DA 3WFDH 4F2MA 1AGEB 2EH7H 3SGKC 1BF8A 3BE1L 2EECA 2MKWA 1DANT 3FCTB 3GHBL 3QXVA 1A2YA 3QWQB 4TUOB 4JFEA 1G9MC 3IJHB 1VADB 4JPIB 2XTLA 1D7FA 2HN7A 4C56A 1NKRA 2GT9B 4QRRA 4JZJC 4EXKA 1RJCA 1FNSH 5CJ5A 2FIRT 2D7TH 2A9MH 4NRYB 2BC4A 3G6JE 5JHLL 3GI9H 1X5FA 5MEPA 2NX5E 5LGKA 1YJDL 3NH7H 1KJ2B 1E6OL 4KQ3H 1HHJA 3B2VH 3MXVL 2AXHA 5LCVL 5SWSB 1TQBB 4RAVB 4YWGL 1KYOK 2XG4A 5GS1A 1JPTH 5I0DA 3FZUC 5I74C 4N0RA 4W4OC 2VQ1A 4ZYKB 4NKOA 4W6XB 2J8UE 3INUH 3WL9B 2ICWJ 2XQBL 1TCRB 4JM2B 2CH8A 1BVLB 4RGNB 4ACPA 1Q94A 3GSXA 1SY6H 1XIWB 4NYLA 5HHNB 3AM8C 3T77B 2EDXA 5EFIB 2E7LA 1OGAB 1QP1A 3HMXL 4FMFA 3WYRA 2HMIC 5C0AE 2W0FB 3C5ZD 4G8FB 4PJAB 1HINH 3C9NA 2PR4H 2GHWB 1QACA 4Z7OE 2DQJH 4JFZL 5D7IE 2P45B 4YR6A 1QFWM 4ONHB 4OZHA 5K9QI 1PJ9A 1Z0MA 2D7TL 4MNQE 1J18A 4J2XA 1U93A 3CXDH 1P53A 2VTFA 1BECA 1YJDH 3NH7L 3KLAA 1RURH 1V7ML 4GXUN 2BSTB 5J8OA 4FQHA 5E00B 4PRAB 1JPTL 2XQYK 2FHCA 1D5IL 3DX8B 4EI5D 2IAMB 5DS8B 4YIQA 5AG9A 3EJYC 3GRWH 1AXIB 2H32H 2WQRA 4DGIH 2E6JA 3VI3F 3RWIA 4XNZB 4O51A 3B3IB 2HT4C 1KCSL 1F90L 3L95B 5D7KE 3WS3B 4XCNB 3B2UD 1HIMH 1RZJL 1NCWL 2P5ED 3K2UL 2YPKB 3ARTA 4PRDA 4U1MA 2R1WB 3NFPA 4KRPB 4WU5B 1PQZB 3P77B 5B38A 2XXCB 1N6QL 5I1IL 3BP6B 2CMRL 4PJDF 4U1SB 5E95B 3RIAF 2X09A 5LAXB 2O5XL 1UT9A 3UTTD 3VXUB 5DGRA 3DRQB 5IHBA 4XX1G 4OB5L 4P5TA 2EDJA 4G8FA 4NPYB 5HYIA 1AGDB 4JM2D 4JB9L 1D5IH 1UJ3C 3ALPA 3G5XA 3U30C 5E2TH 4DAGH 1O7VA 2LU3A 3T0VA 3STZB 3A6BL 3MROA 12E8L 4FABL 3V52H 4GBXC 4NO3A 2A38A 1TTUA 1CXKA 3O2WH 4JFQB 3QXUA 1NCWH 3K2UH 2GTZB 4YBQD 5KVGL 4QHNB 3QPQD 1QPXA 4P23B 4PJIE 4CUCA 4OCYL 5AZ2H 2X4TB 3EOTL 4UV7L 4YDVA 3HS0A 5DHYA 4GAJH 3RWJA 2KPNA 3C60B 5SWZD 4PS4H 5FM4A 3IXAB 3QDGB 3PJSB 1FZMA 5J6HA 1A7OH 5CSBA 2C7UA 1C7TA 2PXYB 4Y8DC 2HN7B 5B4MD 1U8MA 5F44A 3GJEA 5F21B 4Y16A 4OCWL 3GMOB 3DIFB 5D5ME 4APQD 4CW1A 4DAGL 2YKLH 3NCBB 1NBYA 3QNZA 4ZQKA 3RIAK 1ZEAL 3RWCA 1X5IA 1I7ZA 3U4BL 3GRWA 4M1DL 2E9IA 1UG9A 1S7UB 2KH2B 1H3GA 5DA0B 3L1OL 1EMTH 4FQLL 3O8XA 1KLUA 1U3ZA 4MSWA 4PJCB 3N1QC 1JPGB 2NY3B 5D2LF 4Z18A 2Z92B 5AZ2L 4Y16C 5J1SC 3S5LB 2KZWA 5CINH 3BGFB 1FIGH 3O4LD 1KTLB 2WWMD 3M1BA 2J5LC 2BVTA 3L5HA 3IFOB 3X12B 4NBXB 1UXSB 4HKBA 1QFWH 3EZJB 3WO4C 1PFCA 2EKSB 3MRFB 4RMUA 4U31A 1D9KD 4KDTC 4GBXB 25C8L 1EX0A 1KG0A 5FKAB 3RWIB 2X4TA 2CIIB 2G9HA 2BNRA 1IEHA 3C09C 4X6BA 1YMHA 3DLQR 3C87A 5FXCH 4WFFD 5FM8A 3U48A 3ZE1E 3QJHB 5MENE 2B2XL 3W2DL 5EZJA 2EC8A 3MYZA 5D4QA 4K94C 1HDMB 1G9NC 4EQ3A 3PL6C 5IW1A 3MO1B 2ZUSA 4YUEL 3QDGD 1NJ9A 1M4KA 3MNWA 4I0PB 5AUMA 3S88L 4NCDA 1OWRM 4Y2DC 5D7SH 3EYFB 4R90L 2A6IB 1QFWL 2HJLB 4D9LH 4X5XA 4PJAF 4G7VH 1JV5B 4I18B 2R1YA 4ELMA 2XWBA 2FEDD 5DO2D 4HEME 5F97E 2R1WA 4N1EA 4ZFGH 2PTUA 1N8ZB 5E8OA 4ELKB 1P4LA 3DX6A 5D1ZD 3ZO0A 4KK6C 4ZXBA 3W2DH 1X5AA 3O3DA 4MA3A 4X6EB 3TO2A 3T8XB 5D6DC 2AEPL 1F42A 4UT7H 1HI6A 3RFZC 4OLUH 3AUVA 4O58L 4GMTH 3RKDC 5FO7A 1YEDB 4PJBB 1BQUA 4X9BA 1EBAA 3SDYH 3QCTH 4FFVC 2L4OA 4XMPH 2DAVA 1O7SA 4R90H 1D9KC 3RZWA 3UTZA 1FFPB 5I18H 1H5BA 4Q0XH 2VXVL 1H3UA 5T3XH 1BD2E 4XB7A 4O5LL 4OJFH 2Y25A 5IVXF 1NC2D 4J12A 4DGVL 5FGSA 1NFIA 3OKEA 3QHFL 4HGWB 3HLAA 5HJ3B 3N1GC 2GJZA 3WNOA 4XCFH 5A3IC 3C5SA 3MZGB 3RAJL 3UXFA 2HJLA 3PL6D 1KXTB 4OI9A 4URTB 4GXVH 3E6FB 2VABB 4O9HL 2D0GA 2F8VA 1KTDA 2WQ8A 2RGSA 5I8OL 1F3DJ 1LO5B 4I18C 3EFDL 3SDYL 5IR1A 3MO1A 2HKHH 3WHXA 1ZMYA 4OZIE 2ICEA 3RWHA 4PGDA 4GJTB 2QQKL 3S96A 4I77L 1RJLA 2OZ4H 2EIDA 4X4XA 2WBWB 3D87B 1A9BA 2Q6WA 1RUPL 5IJKC 5IOPA 3WFCH 4O2EA 3QZWG 3NA4A 4DGVH 1CDCA 3D48R 3MGOB 5C0BE 1T1XA 2VLLA 1J0JA 4JFDE 4HDIA 1A2YB 1R3HB 1WZ1L 3SQOH 4KK5D 4IRSB 3LAFA 2C5DC 5CIPB 4X6DB 2PYFB 2BP3A 5C0DA 3PNWB 5EPMA 4OIBA 3DI3B 5J89A 4LVHB 4YPGA 2PW1A 4Z7WB 4WENB 1J1PH 2A9NL 4QF1B 4XNUH 1K4DA 2QKIA 3KJ6H 5JOPD 5C0GA 2AK1H 5TF1L 4Y4HD 4LHUG 3RU8H 2BVPA 2NNAA 5E6IB 1OSZB 4ZAKB 4JKMA 4JFOA 4PJHF 5E5MA 3T4YA 3LV3A 1R0AH 1OTUD 4HBQA 1WWAX 2PYEE 2E27L 4H8WL 1QFUH 3O3BB 3BMWA 4LLWA 1IM3A 3LRSA 2PUQT 4POZD 4OV6F 4QRUB 2HVKB 2DI9A 3BAEH 1O0VA 1R24A 1F4YH 4XRCA 5GGVH 4PP1D 4LLMB 3TJHC 1T80A 1KIRB 3PHSA 5BZDA 2C7UB 2DQCL 4U1GB 5IOPB 4HF5L 1ZK9A 1TDQA 1S8DA 1GHFH 3Q1SH 5I1DB 2B1HL 1IGJB 3QI9D 1EHAA 3C60A 4PP1C 5DRWA 5DVNA 2A9NH 1CLYL 4YDVB 1RURL 1G7HA 1DN2A 2OSLA 3DX7B 1GC1C 5FA4B 4XWGH 5E5RB 1MCRA 3ABZA 1ZLWK 1TZHB 2YEZB 4EQ2A 2YD6A 1CFSB 2BVOA 3FMGH 1DL7H 4D2NA 1RIHH 5I1GL 4QXUH 3UTQB 1QFUL 1YN6B 4HZAA 3HNTH 4G6KH 4XPGH 3FB6A 1YN7A 5HYFA 3G08A 2XNAA 1HIML 2YD5A 1AGBB 3ULUF 1EUTA 1EGJL 1EXUB 1R3JA 1LEIA 1F4YL 1TVBA 4PPTA 3GGWA 1MFDH 3AMKA 4P2RE 3UEZA 4BQ8A 3EW3B 3OR7A 1S9YB 3ROOB 3EYQD 4DKAA 4GUPB 2C1OA 4ORGA 5C3TA 3TYFA 3VJ6B 4OLYL 4MB4A 5MHSE 3WNPA 4MHHG 5DWUL 1QRNE 4JB9H 3SJVA 3CVHL 5ETUA 1VEOA 1RJYA 5FF6A 4P2RD 2F54A 4P2OD 4R7NA 4U2YA 5C2BL 4NHUB 1CR9H 4WDIA 3MJ6A 5KJRL 2JJTA 1G6RB 4GLRH 4NQCE 3QEQE 4Q9QL 3GEWB 1CBVL 2NY1D 1NUGA 4L29A 4MMZC 4QHUA 5MENB 1YYMH 4FTVD 4H1LH 1EGJH 3L3HA 4MA7L 4D8PA 2X9WA 3VWJB 3KAAA 4APQB 2YPVH 5F3HB 4OCYH 5K33A 4PY7B 4F80A 1Q0XL 2AJUL 3EYVA 5F96L 3U83A 3QDHA 1RZIA 6CGTA 2VZOA 1JV5A 1QVOA 2R1YB 5F1IA 2D4FA 2VKXA 4U1JB 2VDKL 5FECA 3CK0L 3LN4A 4F15C 2F53B 1MVFA 4WEBL 1FBIL 2FL5B 3P4NA 3MNWB 3V4PL 2G60L 3IDMB 4FTVE 3T0BA 4KI5D 5JDJA 1IQDB 5GPRA 3MV8D 4LLVB 2P1YA 2UVFA 1A6UH 1D5ZA 3WXWL 5D1QC 1RHFA 4UB0H 1U8OA 1KV3A 3MBEB 3LKPB 3WL9A 4GAYB 1CBVH 1I9EA 2XPGA 3W0WD 5E94B 2DQDL 1FNAA 5FHBH 3DURB 3ZT7A 1YMHB 4GT7A 1KLGB 5D7JC 5ID1A 4GOSA 2LVEA 4Z7NE 2AJUH 1IGIH 3VA2C 2ZSVA 5GJSH 4CN6A 1CDJA 4HFUL 3DUSB 3HUJF 2A73A 4XP6L 5T3XD 5D1QA 4IRSD 4TUJB 1AC0A 3VGBA 5KTEH 1KTKE 4MD0A 5HI5D 1MJUH 2CKBL 4LASL 5LBSH 4XZUA 4MXWL 4IDLA 4C55A 3QXWA 5SWSD 4JPVL 2ED9A 2WWMC 2OBGA 4Z7WF 1OF2B 1VGEH 3UDWA 4FXKB 5I30L 1OVZA 4FP8H 1G7MA 4E42B 1MHEB 3FTGB 1KC5L 3WDJA 3GSVB 1G7QA 3CVIL 4BM7A 2IG2L 1XT5A 5B3JF 3DGGB 4AEHH 1DFBH 2VITA 1CGVA 3KPSD 3UMTA 5D96C 2PW2B 5JW4Q 3IDJB 2W91A 4PJ8A 3MRGA 1A1MB 2DQHL 3QUMH 5IGXH 1IRAY 3T0EE 4HS8H 1FO0L 4GS7B 5GJSL 4OTXH 2AKRA 4L1HA 1PYWB 3HB3D 4EIGB 3V7AE 2ORBH 3ZT6A 1TQCC 4KJPD 3RY5A 5J6HB 1NGXA 2FATL 1WK0A 5C0EB 4D9LL 5KS9B 1V7NH 2BY1A 1KCUH 5L2KD 5C08A 1R5VA 3LD8C 2F5BL 5ISZA 4FQXA 1VKXB 2VXSL 4LSUL 4WUKH 3MOBL 3DYMA 4Z9KB 1QEWB 3UX9B 1F6FB 5GISH 3VG0L 4KI5E 4OD3L 3D5OF 1S3KL 4DWHA 1CXFA 4UMGA 4LVEA 4ONFL 3VWKD 4LVNC 3ORJA 3PHQB 3FRPG 1SJEA 2D7PA 1EHLL 3O4LB 2UY6A 4OCXL 1OAXL 5KSUB 4OZFA 1ZA3A 2BNRD 4QYOB 5DMYA 1FO0H 1T3FA 2WAHA 3O41B 4K3HA 2D03L 4R4FH 2YUWA 2UZIH 4MDJA 1AGDA 3BQUB 5EIQA 5KOVC 2R1XB 4HC1L 3GSWB 3N1FC 1FN4B 5DI8B 1HHIA 3VXUA 4H20H 1WFTA 1NGYB 3PL6A 5TE7L 4JY4A 4OZGE 2F5BH 4P5MB 4JY4B 1JYVA 4EN3B 3PDOA 1S7QA 5I1KH 2CRMA 4F57H 4PLNC 4XMLL 4S1QH 1FFOB 2UWEB 2ZUQC 5FYLD 4JRXA 1HQRA 3H8NA 3TT3L 2YC1A 2BRRH 4HZLB 3H3PH 4NKMB 3B3IA 4P48A 4PJ7A 3MC0A 3TA3A 2GSIB 5IMOA 1LHZA 4HX1B 4LPCA 5DEGA 4RFNB 2P43B 3D39A 4OF8A 1P7KA 4MJ4A 5ILTH 4Y16D 4NN7C 5ANME 5JTWA 4MYWB 2MCG1 1D6VH 1CXHA 3H0TB 4JFHD 1N2RA 3OR6A 5L9DL 5ITBH 3KLAB 2AQ3A 3CXHJ 3TBTB 4Y7MA 3IDNB 2OZ4L 2RQ8A 5IV2B 3QDMA 2BX5A 1JWUA 4LVNB 1V3MA 3OV6A 3WFCL 1QSEB 3MBXH 5FB8A 1LE9B 4XH2B 2BSRA 5CIPH 4NJAL 4J6RH 2BOBB 4XB8A 1YEJL 1KT2B 2NY3C 5B4MC 1F11A 1HYSD 4YDKL 3SO5A 4LPUA 5FHAL 4PGBA 2R2EA 5GGQL 3MLTA 3QNXB 1R3KA 3QO1B 3UPRB 5JPMB 5LWYL 1CTOA 3RNQA 1I7UA 3LB6D 5D6CB 1B2WH 4KRNA 4XVTH 4PRHB 5HYJB 5D2NC 3MFFA 4CRPA 4OZ4A 3NIFF 5I1CL 2F9BT 4TSAH 2AXGB 5C6WH 2XG5A 4U0RB 3AVEA 1EGJA 5L9DH 5DTFB 1ZLWH 2AI0L 1DQDH 5E0QA 4PD4K 3O6KH 3O0RL 4M8VA 1ACZA 1HXYB 1C5BL 3NCJH 1MFAH 3OJDB 1QRNB 5F71A 1I3UA 5DD3H 4EI5B 1P84J 1YC8A 2A6JA 2ZSWB 5C0AD 4YHKL 4YQXL 3BHBB 4MD4B 1YEJH 4QLRA 1YDPB 1WZLA 4G5ZL 5JDSB 2I9TA 3C8HA 3VH8A 3BN9C 2J12B 1JMZA 5JXEA 3KYOB 4I5BA 2FDBP 1KYOJ 4MJ5B 4KFZC 1DBJL 2ERJC 1AGFB 1XZ0B 4HF5H 2OTUB 4M02A 2WW8A 4PGEA 3KPRE 4QRTA 3VFMA 4NQVB 1Y0LB 4BQ9A 2FR4B 5DJXA 4ZS6D 3RA7L 4B0MM 4NGHL 3SKNB 5F7EL 5EBWA 3MRRA 1RQ5A 4TSAL 4BFIB 3L5XL 1RK0B 4IRJD 3LCYA 1MCFA 5HHQB 5CLWA 1VHPA 3LDBB 3UJIH 3NCYP 4XWGL 4POYA 5EZLA 4BK5A 2Z8WC 1A7RH 3ES6B 2AI0H 1BJ1J 2R2EB 3S7GA 4XGZB 4LRNH 3WCYA 5E2UH 1DL7L 4NNXA 4PG2A 3QISA 3U7AA 3AFLA 2XV6B 1A7NL 3K8LA 3FRUB 3UTTB 4RBPK 5J13B 2XA3A 1CLZL 4S2SA 2R69H 2Y6SC 3VH8G 1WVZA 1QTYT 1NGPL 2BVQA 1GRWA 1R5VB 4MDIA 2Z8RA 3QDMB 2VSDA 5DJZA 3U9PH 4KXZI 1I3GL 2GAZB 4U1HB 1NFKA 5AWNH 2WIIB 5IMLA 2R8SL 6FABL 2RR3A 1FP5A 3V6OA 4C4KO 4L8SB 4YEFA 3BZ4B 1CXEA 4IRZH 1EBPA 3TBSB 5L2KB 4CJ0A 4D0DB 3T2NL 3RY6A 3WBDA 4P9ML 4LSVH 1GOHA 2PO6A 1ZANH 1FVCA 1G1CA 3V5DB 3SGEI 1V3JA 1J0KA 4FXKA 4G6MH 4ZFOB 4YFDB 3HR5B 5C2BH 1QSZA 3QG7H 2R56L 4F9LC 3TT1H 5ALCH 1WSST 2JB6A 2FSEA 5GGUB 5JIIA 4QXWA 3DSNA 3G6JF 1L6ZA 3O4OB 4I8DA 5C07D 2QADC 3ARDC 4RZCA 2DQEL 1FO0B 4KMTH 4IDJL 2FIKB 3JV0A 4OM0L 4WJ5A 1A14H 3P73A 1ZGLP 3BH9B 1ZHLB 5D1QD 4WU7A 5H37H 4ONGL 4IRJC 4BJLA 3K4DA 3PG2A 2W9EH 4S1SL 3NABH 2H1PH 5TFSL 5GHWH 2R29L 2P8MA 1OL0A 1UM5H 3P3YA 5F7NC 1CFSA 4PD4J 3GSNB 2YRZA 1AQDB 3NAAH 3ZKXC 2PO6C 4JKPL 4LF3B 5E4EC 3QG7L 2MHAB 5GZNC 1I7TB 5LQBH 4C56D 4OZIF 4UV4H 1BEYH 4G8GA 1PG7H 5IHLB 2IPKA 4LCWA 4EXPX 1A6ZA 1DCLA 4HHAA 3F8UB 4GKZB 4QTIL 3ARED 3ARYA 5GGSY 3HE6D 1R24B 4FXLA 4OIIH 5CJXC 3RP1A 1NKOA 5ANMA 3BUYA 4MQ7B 5D8JH 4IS6B 2J5LB 3SY0A 3WNMA 2W9EL 5DHXB 5JLZA 1BZ7B 1JCKA 3D39E 1DVFB 1FGNH 1NAML 1WBXB 2HJFA 2J4WL 4JPWL 2N1KA 5LBSL 1MHCB 2Y5EA 4RFEA 1SJHA 5FM5M 2YD4A 4G43B 3SE9H 5IB4B 4M7LH 1OSZA 1MY5A 5DJDA 1NMBL 3NAAL 3W39B 3DBXA 3S9DB 4IHOB 3SDCC 3OPZH 5EOTA 3BGAA 5HHMB 2BFVH 1UH3A 3CVIH 2CDFB 1BBDL 5I1JL 2NW3A 2F5AH 5LGJB 4JO3L 4G6AC 2I60H 3LIZH 5BCAA 5F88A 1JN6A 1J7VR 4NM4L 1XF2A 4MJIA 3I9GL 3VXUE 5EORH 2G2RB 1KJMA 3ALWA 5IMKB 1T1XB 3RBSA 2J6EL 4MMXC 4UOW0 3BO8A 4W81A 2CJUL 3FO2B 2C3XA 5I76A 1IGTB 4DFIA 3VW3H 4JFDB 4JO1L 4PP2A 2PCPB 1YUHA 3W9EA 2JJTC 2GAZA 4NUJA 4U1HA 3VFPB 4LQ1A 4HSQA 1JHTA 2VDMH 3SE9L 4HUWB 4LEXL 5IHZB 2VXSH 1UH4A 3O2VH 4BH8B 1XF4B 2WP3O 2O61B 3CC5B 3PP4L 3THML 5CWSA 1DEEA 3EHBC 3ULVE 5HVHB 4X6FA 2WANA 4UI2A 1IAII 3BFOA 5ICZB 2NY1C 2WUCL 5MI0C 1IKFL 1VA9A 4JHWH 3LZFL 3MXWH 5EU3B 1U8QB 2D03H 2R15A 2P8MB 1NC4A 3KS0J 1T7VA 1AD9B 2W38A 1U8LB 4PTUB 1CK0H 3VFOB 1RZ7L 1EDQA 3TWCL 1K4CA 4ZUVB 2G2RA 3HN3A 4MJIB 3ZKMC 3IJYB 4MD4A 1NCAH 4WDIB 2Q3ZA 4R7NB 4Y0GA 2ZSWA 4X0KB 1G6VK 2X2YA 4W68A 4I1NB 1BJ1H 1PGRB 5INDA 1A7BA 1HH9B 4R7DB 1X5GA 4S0SD 5CCKH 3ZKNC 5KVDL 3QEGH 2WZPD 2XI9A 1P4IH 1K4DB 1E6JL 3JWOH 2W9DH 5T1KA 2APVA 3LSOB 5D1XB 4YPGB 4YK4B 3W39A 4DGYH 4FQJL 4Y5YC 2UZXB 3T3ME 1AI1H 3G6JB 3WXVH 1EAPA 4O02L 2MCPL 3UTOA 1Y18A 3OKKB 3IDUA 3F5WA 5FA3B 5C9KA 5HHOD 3QNYA 2XWBB 3TEUA 3MTRA 1KN2L 4N8CL 4DW2H 3MGOA 1IAIH 1UKSA 4XPTL 5HVWA 4EUPA 4MZ2A 1ORQB 5SX4H 4GKZA 3OJMB 2VAAB 5D70L 2FLBT 2OYPA 4XH2A 3C5ZA 2PTTA 4NJAH 4JR9H 2UUDK 3UTTE 3RX8A 4AG4L 4I0PA 4WFHE 3CH1B 4M93C 4FOMA 1N0LA 5IT2L 4LK4A 3W5NA 3MRBB 5GGQH 3VCLA 3TJEL 4WI9A 5FK9A 1IKNA 3FO9B 5LWYH 5HYSB 4S2SB 1YEKH 3JWOL 3BD4A 4ODSH 2J3SA 3BP7A 4M3KB 5A2LH 4XXDA 1F3JB 1ZS8A 2GCYB 1GGCH 4HXAL 1YEHL 4ALAH 1MQKH 3CDYA 4NWTL 1R6VA 1FL3A 3O9WB 4K23H 4LNVA 3DVNA 4P23C 1NGZB 2GJJA 2GSIA 3T2PA 1VFOA 1HNFA 4ZDHA 4X4YA 3ZE0F 1EEQA 1A6TA 4U0QB 2FX9H 1E4XI 1IM3B 1UJTA 4EDWH 4L9DA 3P0VH 2FNBA 2BY2A 3MJ7B 5KAQF 3O11A 3QSKB 4PTTB 1T20A 1YYLL 5C3LD 1Q38A 2AK4B 4YHPA 1YEKL 3L7EB 4JANA 3QUKB 3LEXB 1TQCB 2R1XA 3A67H 1UJ3A 4WUUA 1Q9KA 5BV7L 5FK9B 5JR1H 1MIML 2EYSA 4MZ3A 3VI4E 3IDIA 3PIQA 3UC0L 4P4KD 1A1NB 5FO8A 1VSCA 1HKLL 1KPRB 5M94B 4DQOL 3NPSB 1QR4A 5EBGA 3B9VA 1UA6H 4PY8J 1DEDA 3O2DL 4KH2A 4OD1H 3PXHA 4X80H 1QNZH 4KAQL 4QRSA 3NIGE 1E4XH 1M7XA 2ARJB 1NFDA 3C6LB 5E2VH 4GKSA 5DQJB 1JNNL 3ZDZE 3S35H 2NY5L 3SDCA 3JV4A 2AXJA 3VD4A 3ILPB 3ESUF 3IS1X 3EYFA 2OL3A 4CAGA 3HMWH 1Z5LA 4YHIA 2Y7QB 3PWJB 3FOMB 1F3DH 1TJIL 3RDTB 4BFGA 1LVEA 2ADGB 1OAYL 4M6NH 4AH2A 5IV2A 4U6XB 4ZTPL 3UTSD 5J1AB 5DJ2B 5EZOH 4FG6D 3E6FA 5I1EH 3T2NH 1RUMH 4KQ3L 4X9IA 3MZTA 1CWVA 1WJ3A 3ARDD 1LE5B 1ZHNB 1HCVA 1HKLH 3IDJA 4PJ8B 4DN3L 4DCQB 3AB0B 5IFJB 3MJ8A 5MP6H 3VFSA 4QWWC 4GMSH 3VFOA 5HPMB 4BA8A 4X80L 3U0PA 2Z8VC 5I75B 3LQAL 3OGOE 1FNEA 3KYKL 1EV2E 3MRFA 3RHWF 2NY5H 5HGDB 3D3VA 3RPIB 3V4UL 1I9IL 4CNIB 4ZNEA 2XA8L 5HYEA 1XH3A 2PR4L 1II4E 3C8DA 5GS2H 1B0RB 1OAYH 1JHLL 3BISA 4M6NL 4UDTA 3GI8H 1KJ2H 3CXDL 1DQMH 2QLVB 4GRLA 4X6FB 1JPGA 3EDKA 1T1WA 1JGLH 4ONOA 5GGSA 3SCMD 4Y8AA 5KSUA 1F5WA 3MFFB 2V9TA 4GAFB 2ZKHH 4JFDA 2HKFH 3MUJA 2NY3D 3QO1A 4Y4FA 5C0BA 5DMKB 1ZV5A 1E4KA 4HIEA 3KYKH 4F37F 2KZ1B 2V6HA 3V4UH 3IDMA 5CD3B 3VXSE 3IKCA 2K1MA 3WDHA 3AAZB 2IALA 5C07A 5FYJE 2XA8H 3VXRB 3MLUH 1JN6B 4S10A 1CLOL 4MD5B 1X5JA 4PJXE 3L3KB 2GFBA 4OZIA 1R3IH 2DQIH 5EU5B 5F1IB 3GJFB 1OOAA 2ZJSH 2CIKB 4QHNA 2ITCB 4J3OC 5L8LB 5ABDE 1S9XB 1BZ9A 5E7FA 1K85A 2X40A 1F6AB 3DPBA 5D6DA 3T0WA 5BZWA 1XGRA 3WD5H 3MRPA 2XWTB 1UYWL 3ARWA 5FYJD 3TN0D 3PGDB 2I07A 2CKBB 2XN9D 1RFDH 3FB7A 1A4KB 2YD3A 4JO2H 1FJ1A 1HHJB 1G9NL 1A8JH 4YHNB 3DXAB 2FO4B 4ODHH 3PWNB 2Q7NA 1MHEA 2EC9U 3RWGA 4XP5H 5IWLA 2DYPD 5KVGH 4KJQD 3KR3L 1KSRA 4HHAB 3LQMA 1J10A 4LLAA 3WJJC 4KU1A 3QT2A 4P3DB 1A3LL 3I50L 1BQHB 4PRIB 1YEGL 2WP3T 3WNNA 2CJUH 2MQCA 4BH7A 2XFXB 5C0NC 1A7OL 3MV8B 4JFXB 2ESVE 2B20A 3GSWA 4Y5VC 1VPOH 2NX5B 9CGTA 2M26A 1LEIB 3DUUA 4I4WA 5D1ZB 3K81A 3O2VL 3QEQB 5H35B 5DJ0B 3ZDYF 1MI5E 4IOIA 5DS8A 2C26A 3PWPA 1QBLH