3K74B

Disruption of protein dynamics by an allosteric effector antibody
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
QLQESGGGLVQPGGSLRLSCAASGFTFNNYWMYWVRRAPGKGLEWVSMINPGGIITKYAESVKGRFTISRDNAKNTLYLQMNSLTSEDTAVYYCAKDWATGLAKKGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dihydrofolate reductase
publication title Constraining enzyme conformational change by an antibody leads to hyperbolic inhibition.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
total genus 27
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k74B00
5GRWA 4GAGH 1YEIH 3SDCA 1SYSB 4FG6D 3DGGB 2RFXB 4G9FB 4Y4KC 2VIRA 4UDTB 4HAFA 5EU6B 3FT3A 5IHZB 3B2VH 4GXUM 1TNMA 1RIVH 5E6YA 4LBEB 4Y4KA 4GAYB 1JF1B 5HHOA 1HSAA 5DD0L 2XKNB 3H9YA 1T1WB 4Z8FH 4D9QE 4KGJA 2ICES 5ICYA 3L3KA 2CGRL 5I1JH 5J7CC 3QWQB 4Y5XB 5F9AC 1NGXA 2ZJSL 3D9AH 3S34L 5JIHA 4LLWA 4K8RH 3MREB 4PGDA 4K3HA 4KMLB 3QUKB 2KL6A 2FH8A 3UTSE 3CD4A 4N8VB 1BLNA 2V7NB 1MUJB 1GIGL 1K3IA 2OM5A 1K8DB 1I1AB 2EEBA 2OL3H 1OW0C 1EUUA 1K6QL 4KU1A 4ZNEE 3ULSA 1Z5LA 5JXEC 2JB5H 4R4NC 4M7LH 3T8XB 4AT6B 5EOQL 1SJVA 1IEAB 1OW0A 2RQ8A 4OFVA 1CBVH 5GRZA 3QNYB 5SWSD 1N26A 3ZDXE 3BZFA 4XVUC 3KYMA 2OZ4H 3HC3L 3QXUA 2LU3A 5J12B 1FGVH 1XR9A 5E6IB 5JR1H 5IGXH 1LO2H 4S1DC 1NCDL 2EDRA 1WEJL 2GAZA 3RQ3A 4HBCL 5D5ME 2C3HA 1YDPB 1FJ1A 1WBXB 4XPGH 4PJEE 2P7TA 1U93A 3VXOA 1SQ2N 4NM8L 3T1FA 4XBEH 1MCKA 3LKRB 1TZGH 1QSVA 1FC1A 4HIJB 4GAGL 4KKLD 5HD8D 1TZHA 4MJIE 1H8OA 2DL2A 2YPLE 4E41E 4RQQA 1KXQE 5F7EH 3B2VL 1RIVL 2VDPL 4AIOA 1P7KA 3B9VA 3W9DA 2ADGA 5GZOD 5EIQA 4MX7A 1CFTA 2H6PB 3VJ6B 3BMVA 1J87A 3PQYA 3SDDC 1K85A 4Z8FL 4RFEA 3GJFK 1AXTH 1UQSA 5JW4Q 3W0WE 5I1JL 4RX4A 1BD2E 4OLWH 3CXDL 2GT9B 2HG5A 2XTJE 1FHGA 4H1LA 3D9AL 5D8JH 4K8RL 5BZWA 3GMNB 2YSSB 1FL5B 1F3RB 4EQ3A 1YNTA 2XNAA 2KPNA 5IT2L 3DX6A 3ARED 1K5NB 5K59F 2DBJA 4YXKH 1CS6A 2IPTL 4QRTB 1A6TA 3VMNA 4XX1E 1JTOA 4PV9B 1KJVA 4QXGH 4HZLA 4MHHG 1RI8A 1W0VA 3TZVB 4MQ7A 4GRWB 1UKTA 2A2QT 3IGAA 4MAYD 4NQUA 1E27B 5TE7H 2NW2A 1J0HA 3GGWB 3MV8E 4LVNB 4OZHF 4M7LL 1UB6A 2VKXA 5A16B 2GJ6B 5CKGA 1MFAL 2VDNH 2DM2A 3QPQC 1CLYL 2CO7B 2X4TA 2EKSB 3DUUA 1H15B 2G5RA 3E6HA 3EIFA 3G08A 2P8LB 3QNXB 5IKCB 3REWA 5ALCH 1D5XA 5C3LD 3D2UA 3FO9A 4RWYL 1FGVL 1TVDA 5T3ZE 2QQLH 5DJ8A 5JR1L 4KJYB 1I8MA 3QUZB 43CAA 1LO2L 3TN0D 2OJEB 4LLMB 3MO1B 2L0DA 5BS0D 3MRCA 5HGDA 5DRNA 1U58B 1R3HB 4XPGL 2BRRH 2R0KH 3CMGA 4GW4A 3OMZA 1G7PB 4Y2OA 3B8SA 2FGZA 1YMME 2CXKA 4O51B 4CW1B 4R0LA 2C1PB 3MMEB 4XBEL 3VFSA 1TZGL 4Z7VF 1QFWH 4CN6A 4X4XA 4AEFA 2BNRD 3GI8H 3GSXA 1KF9B 1M7XA 4PJAF 4TRPH 4PJAA 5GGSA 3NFPB 3U6RB 3ROOB 3IYLW 1S7VA 5T1LB 5F7EL 1DEEB 2EICA 3WHE0 2H45A 5HHPB 4J3OC 2JJTC 2FGWH 1TVHA 3GMQA 4PJ8C 3DV6B 2IF7A 4X6DF 4E9LA 3TF7C 1AXTL 2NY0C 4WV1B 3TC9A 1CFVH 5C0BA 3BZDA 4OLWL 2JJTA 3RI5K 1IC7H 3BP5B 4BSVA 5D8JL 3KPRB 3GMRA 1PX3A 5I74C 2ZOKA 3WBDA 5ESVA 1KGCD 3KPQB 4WIQA 3WFDH 3RNKB 3CFDA 3QEQA 4N0CD 2OQJB 5FGRA 3AGVA 3BIKA 4NYLB 1GGBL 1YEDA 5EIIB 3V5HA 4U1GC 1K2DA 1TXKA 1K4CA 2W9EL 5CZVH 1QR4A 3OKKA 5TE7L 1KLFA 3F7YA 3FFCA 1KPRB 3MV7D 4Q9QL 4IBLT 1JRHL 5CWSB 1MFCH 3D87B 3VGDA 3V6OC 5CJ5A 2VDNL 2F5BH 2F54B 2PTTB 4X7FC 1FVEB 4G7VH 2ADJB 2OI9B 2F53D 5B8CC 2QADD 1IGJB 1MCIA 5C0FA 3MRHA 1KPVA 1W2KT 3QG6B 2ZG2A 3X14A 4PB9H 4QOKD 2QQLL 4J1UA 1ROWA 4L9DA 5FM4A 5DFVD 1J86A 1TCMA 3N1FC 3LPGA 3TA3A 2G9HA 2DMKA 4Z76B 1D5BA 3TJHD 4GJTB 3STLB 1PVHA 2BRRL 1FN4A 5FYLH 3UYRH 1WC7B 4MJ2A 1JHTB 3RNQB 4HUWA 4PJIA 1MFDL 4P46D 4UNUA 4EIGB 5DLML 1QPXA 1BOYA 1H3VA 5EOTA 1QFWL 4NKMB 3GI8L 2Q6WB 5HPMB 1BZQK 4PTTA 3L3OB 1CD9B 5F96L 2QLVB 1MPAH 4LEXH 3L7FA 4FFVD 4NCC1 3EDJA 4TQEH 4NPYB 3IKCB 2X4PB 1FL6B 3TNMA 3LDBC 5DK0A 1OY3B 1N8ZA 1T3FA 5AUMB 5FK9B 1I1FB 3IFLL 5EU4B 2IALB 3QJFA 3FFDA 4GRLA 1CFVL 4GQPH 3SDCB 2EXYD 1Y0LA 4YHYC 3KNBA 1GZQA 3VFGH 2VIRB 3OKYA 4GRMA 5D7JD 4UNVA 3IFPA 3FT3B 4HZAA 2FL5A 1CD1A 2JCCA 1HQ4A 2WQ8A 2Y5TA 5F1SA 3MUJA 4Y4KB 3C2AH 5DZNA 5HHOB 1HSAB 3F7QA 3WFDL 3PIQA 3LPWA 4QF1A 2QJDA 4OI9A 3MV9E 5ICYB 5CZVL 5F6HI 3L3KB 5ACZA 3FHQA 4RA3A 3U1SL 5IHLB 1NGXB 4YPGA 3CZJA 4LLWB 1BBJA 4OZFA 2F5BL 4PGDB 4G7VL 4IMLA 4X5WA 1ZVHA 3SGEH 4ONOA 1N4XL 1BLNB 4HK3J 1F4XL 1WAAA 5IFAH 4F9PC 1HK6A 2AK4A 4L4TD 4U0RC 2ARJQ 3IETA 1OAXH 4PRDA 3VXNA 3ULSB 1YECH 3HRPA 1Z5LB 4FXLA 5DWUH 1OD9A 4FQ1H 4S11A 1Y6KR 1AHWC 2VZOA 4MZ2A 3L3DA 1ZLWK 5FYLL 3UYRL 3BYYA 1ZKAA 3F58L 4EN3C 3MQIA 3DIFA 1I9IH 3E0GA 5MI0B 1TZIA 2WWMC 4X7CC 2AEIT 3W5MA 3BN3B 3BZFB 4MQSB 4YDKH 1AHWA 2BK8A 3GM8A 4N9GA 3KYMB 4FQ2H 1NC4D 3OL2A 4XAWH 5IUSA 1XR9B 4EN3A 5T1MA 1YN6A 4P48A 1MJ8L 3WS6C 4F33A 1MPAL 4TQEL 2GAZB 4F57H 4EJ1C 2EDOA 1FJ1B 3MTRA 2PN5A 3SE9H 2YD5A 2P7TB 4KPHH 1U93B 3WS6A 3JV6A 2WANA 2R15A 3VXOB 5GXBB 2MQCA 3O3DA 1CICC 3T1FB 3S7GA 2ESVA 5LQBH 5CJXC 3TBWA 5JORA 5A3ID 2AEPL 2NZIA 3K2MC 1TZHB 3MBEA 3VFGL 3QAZC 4NC2B 4PJ7F 2VR4A 4RQQB 1QRNA 4QRQA 1MY7A 1P7KB 3W9DB 2ADGB 3MCLL 3PXHA 4MX7B 1CFTB 3WCYA 2PCPA 3GI9L 1EEYA 1CGTA 1EERB 3PQYB 3VXQA 1X44A 4RFEB 4XCYA 4ZFGH 2YA1A 1UQSB 4HUMB 1FPTH 2W91A 3PWPD 1KT2A 4HMDA 2HG5B 1T7WA 4OUUA 4IHOA 4CVUA 4H1LB 3SDYH 5BZWB 3V7AE 1YNTB 5JLZA 2XNAB 1F4WH 2AJVH 3DX6B 1JNHA 1A6TB 3N1MC 1KJVB 5HDLA 3CCHA 4HZLB 5IFAL 1NAKH 4HT1H 2GTZA 4M62H 4FQXC 3D25A 1W0VB 4ZO7A 4MQ7B 3IGAB 2BERA 1OAXL 5F7HA 4PPTA 5L6YH 1F58H 4MA7H 2NW2B 4UTAH 1YA5A 4OF7A 4HWUA 4FQ1L 5DWUL 1UB6B 3RGVA 4FQXA 1MCNA 4BSJA 5ADPL 5I1EL 3STBA 4WO4C 2X4TB 1I9IL 2HMIC 1QVOA 3DUUB 2ENSA 3E6HB 3G08B 4YDKL 5TDOA 4MB3A 3REWB 1D5XB 4DKEH 4JCMA 3D2UB 1IAII 4FQ2L 4JFZH 3FO9B 3HCVA 4WEBH 4XAWL 5DJ8B 4F15C 1I8MB 4HJ0C 3G9AB 4WO4A 2FATH 3PGFH 4KI1A 43CAB 3LN5A 1P5VA 4DUWA 3FRPG 1AGEA 4F57L 1QSED 1BEYH 5DSCA 5HSFA 4CMHC 3MRCB 3QEGL 5HGDB 4I18C 2Y1VA 3BO8A 5DRNB 3FT4A 4GW4B 3SE9L 4ZPVA 4BUHA 4KPHL 4OIIH 1F3DH 2F74A 4R0LB 3VFSB 4L8SC 2NXZB 3ZSTA 2YC1A 4I18A 4X4XB 1M1SA 3GSXB 4JZNA 5F7MC 5DDHA 4LQFH 4PJAB 5GGSB 5T3ZH 1S7VB 1YYMH 3BKJH 1CDJA 5C0GA 1NBVH 5GS2H 1JZ7A 3GMQB 1TVHB 4EKXA 4LF3A 2R56H 1OSPH 3OKNA 3NAAH 4ZFGL 1G1YA 4PP1C 3SE3C 5C0BB 3E2HC 4QGYA 4BSVB 4ZQKA 1VEOA 4DGVL 3GMRB 2F9BT 2HFGH 3SE3A 2ZOKB 2AJVL 2W0KA 5ESVB 1VDGA 2D0HA 4WHCA 3FMGH 2P5EE 3CFDB 4BH7A 3QEQB 3PV6A 1IAIM 5FUOL 3RIFF 5A40E 1NAKL 4HT1L 5I74B 3BIKB 1YEDB 4WWKD 4L4VD 3V5HB 1K2DB 1K4CB 4NRXA 1ND0A 3OKKB 3TT3L 3F7YB 3FFCB 5L6YL 1F58L 1PX4A 2Z8RA 4MA7L 3T0XA 2IMNA 1VPOH 1BWWA 4R4FH 3QHTC 4WU5A 1A1MA 4PJHA 2NY2D 2JE8A 3ZTJH 5C0FB 3MRHB 1KPVB 4QHKJ 4YBQC 5HI5D 1LHZA 3X14B 2XN9E 1I8KA 4JFZL 4WEBL 3V0AC 4LCIH 4OCSL 4J1UB 4Z77A 4Y4FC 3ARFD 3C6SA 3TA3B 1VSCA 2G9HB 1D5BB 1KC5H 1BEYL 2IPKA 2DQCH 2HTKC 2NZ9C 5E0QA 2ED7A 4I77H 1FN4B 3IT8D 4Y4FA 1FNSL 4OIIL 1OF2A 4HUWB 4PJIB 2JKXA 4GXVH 5EOTB 4KK5D 2Q7NA 4FQHA 3ZHDA 5DJAA 2VH5L 1XGYL 4PTTB 3DARA 4V2CB 4LQFL 5T3ZL 3UBXG 1YYML 1M7IA 3L7FB 3RAJH 3BUYA 3ZTNH 4G8EA 1NBVL 4HGKC 2HTLC 3T3ME 5HYSA 3TNMB 5DK0B 1N8ZB 1RULL 1T3FB 3QB7C 1I1RA 3QJFB 4FOMA 1LDPH 3OSKA 4ZYKA 1OSPL 4AH2A 4JB9H 3FOLA 3NAAL 4FTVE 3FFDB 2HRPL 4GRLB 3FO0L 1Q9KA 1XF1A 1Y0LB 4JZOA 3KNBB 1GZQB 3JUZA 5EZLA 4GRMB 5GJTH 5ECJE 2OBGA 3IFPB 5CJBA 4FQLH 1S78C 2FL5B 1CD1B 2JCCB 4Y7MA 1HQ4B 5IVXA 4CL7A 2Y5TB 4XP4H 3AS2A 1OAYH 4G6JH 5IVZA 4RGNE 3BH9A 4GW5A 3PIQB 3O6LH 4QF1B 3H9ZA 4YHLH 2E7BA 5D72H 2FO4A 4W4OC 2JELH 4S2SA 1NFDA 5ACZB 4KRLB 5ELIA 1QR1A 4OLZL 4OD2A 1HDMA 1OAZH 4YPGB 4R4FL 1BBJB 4OZFB 4JDTL 4IRJA 4MD0A 3O3UN 3KLDA 1NUGA 4W4OA 4LPCA 4IMLB 4U3HA 4X5WB 1UC6A 1CGSL 3QIBD 2J1KA 2PO6C 2VDQH 4LCIL 3VGAC 5FYKU 4YDVA 2X7LA 2AK4B 3QCUH 4XPAH 3IETB 4PRDB 3VXNB 1MCSA 3BH8A 3IKKA 1IBGL 2DQCL 4KTEH 3CH8A 2HLFC 3L3DB 4I77L 1N5AA 5EU7E 4JFDA 1YJDH 4LDOB 4PS4H 4JJ5A 2JLLA 3DIFB 4K7PX 1LQSR 1TZIB 1NCUA 4GXVL 5IBLD 1NMBH 3RL2A 4KRPB 1AHWB 2KDGA 4N9GB 4HHAA 4HV8A 4JPVH 3DOSA 3VDBA 1PZUB 4EN3B 4OF3A 3DROA 5C2UB 3JWOC 3CDCA 4OUOA 1YN6B 5T1MB 3ZYOA 1R5VA 4F33B 4NZUH 1KV3A 3PWJA 3RAJL 3ZTNL 3BE1L 4HIEA 1A64A 4K3JH 1OAQH 1EHXA 2KQNA 1WT5C 2DAVA 4ELMA 2AV7A 5I19H 5GS0C 3JV6B 1LDPL 4KTDH 5DQJA 4MQTB 4JB9L 2OMBA 3K3QA 3O3DB 2BSED 3SKOA 3OJMB 2ESVB 1LP9E 5JORB 3TBWB 1WT5A 4NNPH 2GW5A 1M7DA 3MBEB 2YHGA 3DX8A 5GJTL 2I9TA 3U46A 2XWTA 4WHDA 1KJ2A 4FQLL 1QRNB 4QRQB 1BBDH 4CADA 1I3UA 5EOCH 1YUHA 4LLDA 3QAZB 1OAYL 3BD4A 4PJ9C 2PCPB 4G6JL 1EEYB 1LD9A 5EUOA 3EDEA 3WO4C 5I1HH 3VRLE 1T83C 3O6LL 3BGFC 3VXQB 4YHLL 3UPAA 4XCYB 5D72L 5GHWH 2C5DC 4UB0H 1K9TA 2JELL 1KT2B 5J11C 3BT2H 5AAWA 1RHHA 1T0MA 2X1XR 4PJ9A 4OUUB 3QRFM 4IHOB 1OAZL 3V8CA 3S37H 2YD1A 5JLZB 4M7JH 1XH3A 2C3WA 3BN9D 1P53A 1CQYA 1JNHB 3SO3B 3QDAA 1CVSC 3CCHB 2GTZB 3D25B 4F7CA 4LSDA 3ZE2E 4P57A 4PJCF 1FFRA 4XCNA 3ISWA 1KB5H 3RGVB 2N1KA 4FQXB 4P0DA 3VFWA 3S6CA 4PS4L 4PJDA 3QZWG 2ICWA 4W68A 5D7LA 1QVOB 5LWYH 3UYPA 3C60D 1ADQA 5TDOB 3EZ8A 3S97C 2VLKA 3HCVB 3PGCA 4H5SA 2KZ1B 3VH8G 1CGUA 4K7PH 5IHBA 4WO4B 3LN5B 4NUGH 4NZUL 1MNUH 4AMKH 2J8HA 1AGEB 4P23C 4K3JL 4P9HC 3T3PF 1OAQL 5DSCB 4JPWH 2ITDA 1M71A 3BO8B 3R06A 3FT4B 4ZPVB 4ZS6C 4OM1H 4KTDL 3MROA 2F74B 1IQDA 4NQDE 3VD7A 3SE8H 2BSRA 2YC1B 4QHMA 2IBBA 4NNPL 4I18B 3DETC 3DMMD 2VWEE 4KK9C 4OKVA 4JZNB 4OZGF 3MX0A 5DDHB 1MCEA 3ZYIA 2MHAA 3FQWA 1JHKL 2M8XA 1QFUH 3WFZA 2FEDC 4XCEA 3WV0A 5C0GB 1BBDL 1J0KA 1PEZA 3HE6D 5TQ2L 3DYOA 2BVYA 3MJ8A 4YUEH 4C56E 5I1HL 1UGNA 2H8PA 3QRGH 4LF3B 2X4UA 4MNQD 5IBUG 1VFAA 3OKNB 4Y2DC 1T7YA 2EDBA 4N90D 5GHWL 2R39A 4UB0L 4KV5E 3FZUD 3BYTA 4P59L 4DOHE 3BT2L 4GO6B 1NC2D 4GAJL 5FA4A 4ZQKB 4Y2DA 5GSVA 2V7HA 3T0EC 4CJ1A 3S37L 5HYFA 1DANU 1FCCA 3EYUH 5MERA 4M7JL 3E2HB 3ZZ1A 5BS0E 4JDVA 3QI9D 1ED3A 5J3HD 3HPLA 3T4YA 5JOFA 3QO0A 2Z31D 3HMXL 4BH7B 5E08H 1WBYA 1IJ9A 3PV6B 3T0EA 4KKAD 4NRXB 1ND0B 5FO8A 3CFEA 5H8DA 4ESKA 1KB5L 2FHBA 5BRZD 2XA8H 4WU5B 1P7QD 1A1MB 5E1HB 1WK0A 4LCWE 4FRWA 3HAEG 5I6XB 4PJHB 5LWYL 3HLAA 5GRYA 4PG2C 5FF6A 1JUFA 3GHBH 1HHJA 1CDHA 1I8KB 4N5ED 4K7PL 4R2GB 4Z77B 5AG9A 5IMLA 4NUGL 1OGAE 1MNUL 2OJZH 3C6SB 1NEUA 2V5YA 2DI7A 4FQCH 1UXSA 1IAKA 2Q3ZA 1WIOA 2IPKB 4JPWL 1HN1A 3QCTH 3PDDA 4UV7H 4Y4FB 4Y1AD 4OM1L 1OF2B 3I6LD 5I8EA 1KGCE 1S8DA 1CDGA 3KHQA 3MGAA 2FCBA 2BNQD 1KEGH 4FQHB 5DJAB 4Z78A 2R2BA 4QYOA 4JE4B 1EO5A 3LB6D 3QUXD 1CGWA 3IAQA 1M7IB 5C08A 1QFUL 4TTDC 3BUYB 2APBA 4G8EB 2WBJA 3VI3F 5HYSB 3IDGA 2HJLA 1PDKA 5D2NC 3IDIA 1D5IL 1IT9H 2F53E 4RBPH 4ZYKB 3IDYC 4AH2B 3LS5H 3QHZL 1DLFH 3FOLB 4XWGH 2HLAA 1R3LA 1Q9KB 4GLRI 4JZOB 5D2NA 1X6LA 3OTTA 1WGOA 4QOKE 5EZLB 2ICWJ 1Q9LA 3O2DA 4PD4K 3EYUL 3L7EA 5IVXB 3LQMA 4YGVA 1JGDA 4XI5C 4S0TD 2CRIA 5JOPE 2QSQA 3KS0J 5IVZB 4GG6F 1WICA 2XI9A 3BH9B 4GW5B 5E08L 2I60L 1DUZA 3FRUA 1MWAA 3DO3A 2XG4A 2FO4B 3RTQD 1V5JA 5IIEA 3Q48A 4S2SB 3RZCD 1NFDB 4WGVB 3JV0A 5TDPA 5DRZA 1QR1B 1GHFH 3QIUC 4OD2B 1HDMB 4UT7L 4POYA 1JYVA 1NCTA 4P3CH 5JUEL 3TBYA 4IRJB 2XA8L 5DVNA 3LZFL 4MD0B 3CSYA 4NO2A 4XTRC 5EZOL 4M93C 5IB1A 1DN0A 1X6NA 3NOIA 2X1PA 3GHBL 4ZXBA 3C5ZC 4N1CA 2CR3A 1U8HA 2IPUG 4M02A 4YDVB 2X7LB 4G8GA 4Y19D 4L3AA 5LXGH 2OJZL 2A9MH 4IIQC 3BH8B 5B38G 3U7AA 3C5ZA 4WI3A 3QCTL 4XXDA 3VGAB 1N5AB 2E7LA 4UV7L 4JFDB 1IGCH 1AC0A 4JJ5B 3PWUA 5C0CA 1E28A 1BM3H 3RL2B 2O26U 1VERA 2P8MA 2X42A 4HHAB 4HV8B 4NBZB 3UAJD 3WL9A 3HE7C 5GPRA 3TH3T 1V3JA 3DROB 4GRWE 3BKYH 4LGSB 1R5VB 1HKFA 4NC0B 4R97B 3PWJB 3VA2C 1T66C 4BQ8A 1MCQA 3P30L 3RVXD 4HIEB 2QQKH 5FGCB 2AS5M 3AB0C 1X3DA 1WTGT 3HE7A 3ZDZF 2WQRA 4ELMB 1IGFH 2GITA 4Y16D 2AV7B 3CX2A 1IT9L 5DQJB 3CUPA 3LS5L 1MY5A 4JN1L 3SKOB 5SWZD 1LO4H 1RUKH 4NN5B 1M7DB 3R4DA 3DX8B 2I9TB 3U46B 4L4TE 2XWTB 1KJ2B 5JW4R 3V4UH 4EUPA 3MRDA 3WLWC 4CADB 5IW1A 4ZDHA 1YUHB 1MCRA 4LLDB 3TCXA 1YYLH 5EUOB 1AIFA 1LD9B 3WJJC 2AEWA 1WISA 1X5FA 3UTTA 4OI7A 2FIKA 2DTMH 2UY7A 5HHMD 1RHHB 1T0MB 4PJ9B 3RWDA 3WJJA 1GHFL 1QFPA 2A73A 3BGFB 4IJ3C 3RUGA 4P3CL 4G6KH 1LK3H 1XH3B 5IB5A 5J11B 1A7RH 2VJXA 5GS3A 4JO4H 5KZCB 2VLRD 3TFKC 3CFIC 3T0WA 4HK0A 1FNEA 5E95B 3ZKND 2EDHA 4F7CB 1OPGH 4RAHA 4P57B 5LXGL 3U9UA 3GSQA 4XCNB 5CGYD 4BZ2L 5DJ0A 1S7QA 4K8RC 3LN4A 4X98A 3VFWB 4IEFB 1IGCL 4PJDB 2YRZA 2ICWB 4R26H 3UJTH 5D7LB 4PJ5E 3IS1X 1UWEH 3T2PA 1BM3L 4N8VG 2NY1C 4L3EA 3WIIH 4KHTH 3K4DA 3WMSA 4Q6IC 2VLKB 2IBZY 2NYYD 3QWOA 1YPZF 3PGCB 4H5SB 5F7DA 4V1DA 4O00A 5JQHC 2QQKL 4OKDA 4PGZA 4Q6IA 2ITDB 1M71B 5GGUA 3R06B 3DXAD 1S7RA 2WK2A 5GGRY 2O5XL 4P2RE 1F13A 3NN8A 3MROB 1IQDB 2BSRB 3GZKA 4J3VA 4Z0BH 4QHMB 1LO4L 4XHJC 5HGGS 3VXME 1AGDA 1RUKL 4OKVB 1NUNB 1SJEA 1Y18A 4DW2H 2MHAB 3FQWB 1P6AB 1C7TA 3NIFF 1LO3H 2IANA 4EXPX 4XCEB 4JO2H 2E7CA 2NCMA 1ULVA 2W9DH 3D3VA 3MJ8B 1YYLL 1IM9A 1AO7E 2H8PB 5E8EA 2X4UB 1A1OA 1VFAB 1KJ3L 2H26A 3VMOA 2DTML 1IRAY 5E9DD 1YNLH 3PL6C 4YAQA 4LPYA 4JREC 3U9PH 5FA4B 3ILQC 4UIMA 4IRSD 3T2QA 4LAJH 4Y2DB 5GSVB 2V7HB 4G6KL 4U1JA 5JTWA 3LRHA 5MERB 3FB7A 4JDVB 3CVHH 4WCYH 3JTTA 1A7RL 1ED3B 3HPLB 3T4YB 4R8WH 1MRFH 5JOFB 4PGCA 3QO0B 1WBYB 3QH3A 4MA8H 1YEGL 3T0EB 2W38A 4M1GH 4C58B 2YD9A 4NO0A 3V0WL 1IAIL 1OPGL 4TSBH 5FO8B 3EJYD 3CFEB 3LSOA 5FYJD 1GRWA 3QYCA 4XBPA 4HW6A 5DQDH 3NPZB 5F1OB 4Z7WF 4Z7WA 3RWJA 3UJTL 1FIGH 2V5SA 4YBHA 3HLAB 2NXYD 3GEWB 5FF6B 4CU6A 1JUFB 3WIIL 1HHJB 4KHTL 4OGAC 4D0CA 3JWDH 2DM4A 4JRYD 5T5FH 1SM3L 3VXSA 1C5DA 4YE4H 4HGWA 4QXWA 4X7DC 5IMLB 2QQNH 5TJWK 3GDBA 5I8CA 3O0RH 1UXSB 1IAKB 2ZUSA 1EHAA 1OL0A 3O3AA 1WZ1H 2HWZH 4GS7C 4Q7DA 5JHDD 5TFSH 1FFNA 3M17A 1IGMH 5I8EB 1W0WA 3TESA 1Q72L 1S8DB 4YHZH 5D2LA 2H2SC 1NKRA 4Z78B 2R2BB 4QYOB 2QHRH 3VWJD 4G8FA 4DW2L 2K9UA 3ARDD 2PXYC 1G7IA 1KCVH 3W5NA 5C08B 1LO3L 2EDDA 4LARH 3V5DA 4JO2L 2E6JA 1V3MA 4YXLH 2WBJB 3MLRH 5J8OA 3RKDC 3IDGB 2HJLB 2W9DL 3NCCB 4PGJA 4WI8A 3IDIB 2PXYA 5D7KD 3MGTA 3K81A 5L88H 4LHQB 2HLAB 3EDKA 3BDXA 2AJ3A 2IBZX 1R3LB 2FD6H 3BZ4A 4GSDH 5D2NB 1YNLL 1W72L 4YR6A 3I75A 3U9PL 1Q9LB 1BGXL 2F58H 1XIWC 1A6VH 2FRGP 3DWTA 3IDYB 2LTQC 5DJXA 5BOZG 2NTFA 3L3GA 4HS8H 3L7EB 4OZIF 3GM0A 2B1AH 4WCYL 4ORGA 4YGVB 1JGDB 5C07D 3FHAA 4R8WL 1MRFL 2B1HH 1AE6H 2LABA 1XIWA 4MA8L 1DUZB 4HCRL 3FRUB 1MWAB 2WUBH 4MXWH 4XB7A 4M1GL 5IIEB 3OJ2C 4TSBL 5TDPB 2Y07L 3MLUH 5DRZB 4LRNH 1ZLUH 3ALPA 4BZ1L 5LG1A 2DJSA 5DQDL 3TBYB 2DMCA 3CSYB 4NO2B 2LU7A 1FIGL 4ZODA 4KK6D 5HI4C 5IB1B 1DN0B 4RGOL 4RDQG 5JA9A 1QSZA 4ZXBB 4D3CH 4A2LA 2VKWA 3MNZA 2DJ4A 3WXVH 3JWDL 1U8HB 5T5FL 3V9FA 3CVIH 1DQQA 4G8GB 4M93B 2QQNL 1WSST 2AJSH 3BPOB 1J8HE 3MRQA 3N85L 2BCKA 3C5ZB 1F4YH 1WZ1L 4XXDB 2HWZL 5DD1H 3U4BL 43C9A 3O8XC 3PWUB 5FYKD 2X4OA 1IGML 4FXGA 5C0CB 4W4NA 4YHZL 1E28B 5H37G 2XIDA 4EBQH 2P8MB 2QHRL 3AAZA 3WL9B 1P9MC 1MCHA 3O8XA 4QEGA 1P2CA 3JV5A 3ARXA 2FDBP 4QRRA 4PRIA 1KCVL 1JF5A 4OAWA 3O4LD 3B5TA 4LARL 4YXLL 2E9BA 3MLRL 5DD6A 2XY1A 3HE7B 5GZNC 1XGQA 1MCOH 5FCUH 2MKWA 4ZO9A 2GITB 1U3HC 3CUPB 4MCYA 5L88L 3EAKA 4J3UA 3ZDYF 4Y5VC 2FD6L 3H9SA 4GSDL 4MDJA 3A0OA 1OTUD 4WI9A 3WS3A 2F58L 4HBQA 1A6VL 1U3HA 2EECA 4EUPB 1J05A 4NRYA 3MRDB 3NIDE 4GRWH 4HS8L 4Y5VA 3TZVD 2B1AL 4ZDHB 5IW1B 3ESUF 4UOW0 1DJSA 3WHE1 3B43A 1AIFB 2B1HL 4JQXC 1AE6L 4BSWA 1KIUA 5F7UA 2QSTA 3TLRA 2J8UE 5FHAH 2WUBL 4IOSD 3UTTB 3LIZH 1VADA 2FIKB 2Z0BA 4AK1A 3O3BA 4KAQH 5K33A 4U1HA 1A9EA 1BFSA 2X4RA 3RWDB 2FYYA 2R29L 3MLUL 2A73B 4LRNL 4KY1H 4K9EL 3RUGB 5D1QD 1XGUA 1JIBA 3CGTA 4LSVH 4W70A 4KRNA 5IB5B 3RWEA 3NPSC 3QUZD 2HT2D 3EYVA 3B2UD 5SX5H 3I84A 4IJ3B 4D3CL 1S9XA 4HK0B 1FNEB 5HYJD 3DVIA 3CVIL 1BX2A 4U7SA 5C0RH 4X83A 5CLTA 1QNZH 3U9UB 3GSQB 4RSVA 2AXGA 5DJ0B 5EC1A 1S7QB 1RY7B 4P2OC 1F4YL 3LN4B 3DSNA 2CKNA 5DD1L 4X98B 5E2TH 3VXUE 3GHEH 5D1ZD 1SY6A 5A43C 4WI6A 2VNCA 4DJMA 4LOUD 4L3EB 2QSCH 5T1LD 3PUCA 4P2OA 4E42A 2Y6SC 4X80L 4EBQL 3QWOB 5F7DB 4XB8A 3GBNL 1AGFA 4V1DB 4EXKA 1J9CT 3E3QE 4MA3A 3GO1H 3UTPD 2NY1B 1MREL 2A6JA 4Q6IB 3PWNA 1QPPA 5GGUB 4PRHE 3G6JE 1MCOL 2AP2A 5FCUL 3WIHH 1S7RB 2X40A 1A5FL 4S1RH 3MRLA 3NN8B 3LS4H 1UFUA 4OT1H 3S9DB 3LKOA 4G42A 5DO2D 2VSDA 1AGDB 2B20A 4FP8H 2X05A 1SJEB 1Y18B 2W0PA 4WEMB 5B39A 4OCXH 1R0AH 3UTSA 5E1AA 2IANB 2P5WE 2FBOJ 3D3VB 4AY0A 2GCYA 2ZUWA 1IM9B 1WFNA 2DQJH 3M07A 4FQJH 5E8EB 3T08A 4J3SA 1A1OB 3LIZL 1CK0L 5DFTA 4ZNEA 2DKUA 4NO3A 4KAQL 2H26B 3OKLA 4QNPE 5D1XC 5CEZD 5DGQA 4CBPA 1H3GA 4YAQB 1AR1D 1YEEL 1EAPA 5GGSY 1YNKH 4UIMB 4KY1L 4U1JB 2BDNH 2MTPA 5CFHA 4G80A 3FB7B 5DRXA 5D1XA 2HFFA 3JTTB 3VD3A 4JREB 1UG9A 3ARBC 3NZ8A 4PGCB 3VGBA 1KFAH 2E7MA 4NO0B 5AYUH 4QTHA 5C0RL 1QNZL 5D5MF 1VFOA 5D5MA 5HPOA 3LSOB 3ARBA 4J23A 3NFNA 1UM5H 2VL4A 4H1LG 4PJEA 1T22A 4XBPB 5E2TL 4Z7WB 3CDGA 2A6IA 3GHEL 3RWJB 5CP3H 1JL8A 1T21A 5EO9A 3EJZC 2W1NA 5EFIA 4RBPK 4WHYH 1FZKA 3V0VA 2QSCL 4MJIA 3KLHD 1S9VA 4WY7H 4D0CB 4NC1E 4E41A 4X6CE 4N90E 3VXSB 1C5DB 4HGWB 5I8CB 4O02H 5KAQG 1AQDA 2N7AA 4GBXC 3O3AB 4ERSH 3ARRA 3R8BB 3EGSA 1FFNB 4QHLA 3M17B 4S1RL 4YHMH 3FQXA 1W0WB 3KG5A 3LS4L 3W0WA 1BD2A 2BY3A 5D2LB 4GBXA 5FB8A 4OT1L 2AXFA 2Z35A 4GS7B 1HILA 4NQVA 4G8FB 2C9AA 4Y4KD 1LE9A 1UCTA 3IDUA 4GLRH 1OWWA 1G7IB 2BSTA 4OCXL 3ARVA 1R0AL 5I8KL 3V5DB 3NA9H 5GGVY 3PDOA 5BRZE 3VGEA 4CGTA 2XZQH 1FDLH 3EKCA 3NFSH 4FFZH 3KLAA 4FQJL 1DBKH 2PXYB 3MGTB 1ZA6A 3FO2A 4PRPA 5E99L 4LLQA 2AJ3B 1S7WA 1KB9J 2AJXL 2DI8A 3BZ4B 3MV8A 3O9WC 4OCYL 2BXYA 4YR6B 3SJVE 3I75B 1YNKL 3NABL 2EXWC 5DJXB 2NTFB 3L3GB 2BDNL 2LU4A 4HJJH 5ESQA 3RY6C 4ORGB 1RQ5A 3O9WA 5CCKH 3BQUC 3U48A 1XIWB 2H32A 3LRSA 1KFAL 1JZ2A 5C8JA 2BNQE 3RY6A 2V5MA 5JPNA 3BQUA 1WZKA 3MUGA 1UM5L 1KEMH 5JXED 4R4ND 1DBMH 2BMKA 1YMMA 1QHPA 2IAMA 3RIAK 5C1MB 3X13A 4U05A 4NQCA 5CS7A 2LAAA 3KPMA 4OCWH 4WY7L 3MNZB 1MCPH 3P11L 4XVUD 3EUUA 5J1SC 3BP7A 1A3RH 2YXMA 4JFED 3PG2A 3CDYA 1DQQB 1RZ8A 1BREA 4O02L 1QD0A 4H0IA 5C7XH 3MRQB 4S1DD 4OCRH 1FYHB 4NKIH 1MCFA 2BCKB 4ERSL 2AAVA 5IM7A 1EUTA 4NNYA 4YFDB 43C9B 1I8LC 2X4OB 4HPOH 5FEBA 4YHML 4FXGB 3NACH 1MSPA 4W6WB 1AD0A 1FNFA 3NBNA 1SVCP 2ZCKH 1ORSA 3AAZB 3A6CH 1V7NH 3WNMA 3O8XB 1I8LA 5EB9A 1P2CB 4NP4H 4O2FA 3RU8H 5GRJL 4QRRB 2E8ZA 4PRIB 3IDJA 3WKNA 3PQYD 3OG6B 4OAWB 3RGHA 5IQ7L 3NA9L 4M61A 4UT6H 2XV6B 1T89C 5DD6B 4JVWA 3SQOH 2XZQL 4RX4D 1XGQB 4H1LH 3K0WA 4FFZL 1DBKL 5E2UL 3SDDD 4MCYB 4YZFF 1CI5A 3ULUE 5DF0A 3H9SB 1P6FA 4WHTA 3EYSL 1EO8H 3PP4H 4MDJB 1PY4A 1F2QA 1CR9L 3WS3B 1U3HB 1N6QH 1J05B 3HKFA 4CAGA 4NRYB 3UXFA 4Y5VB 5CCKL 4ORZC 3WNOA 5EN2A 5IJVA 1FZJA 2VQTA 4BSWB 3GIVA 1QO3A 1VADB 3DBXA 3O3BB 1IZKA 2DQIH 1PD6A 2H2PC 4U1HB 1A9EB 2X4RB 2FYYB 2AGJH 1KEML 1AI1H 2IQ9H 1DBML 5B3NA 1UH3A 1XGUB 1XF3A 1TITA 2YD7A 3QIWA 4OFPA 4LCCC 3QISA 5I15H 3RWEB 3QPQD 3EYVB 3VFTA 1AJ7H 4OCWL 1S9XB 1PG7W 1Z9MA 5SWZE 1BX2B 3P4OA 3ZT7A 4JO1H 3UX9B 5C7XL 2IPUK 4F80A 2AXGB 4NJAH 5EC1B 2XWBA 4OCRL 1DBAH 3X11A 4OZFG 4IRZH 1MEXL 2BY0A 3KAAA 3I50H 4HPOL 1DUYA 3NACL 3VFPA 1ZE3C 3LQAH 1HWHB 4P2OB 3S36X 4E42B 3MFFA 3A6CL 1IL1A 1V7NL 1UADC 4NP4L 4LRIC 4CNIA 5CLWA 1AGFB 5C6PB 4J6RH 1ZWIA 4MA3B 3CLEH 5HHME 1FZMA 1CE1H 2J8OA 4UT6L 2A6JB 2ZUYA 3SQOL 3U7WH 3V6FA 3PWNB 5C0BD 3TT1H 5D9SA 4LRIA 4PJ8D 1Q8MA 3MRLB 1UACL 4PJHE 4RGMC 3FAXA 5C0IA 1SYVA 1U8JA 4NNXA 2NY0D 3VFMA 3LKOB 4G42B 3I9GH 2IFGA 5HDBE 3DVGA 1JZ5A 1DSFL 5IOPA 1EO8L 5HYIA 1HH6A 2IJ0C 1N6QL 4I3SH 5B39B 4I3RH 3UTSB 5E1AB 4G6AC 5MEND 1MIML 1T2QH 4ONFH 4UOJA 2WMPA 3CU1A 2GCYB 3AM8C 3FFCD 5ISZE 2MCG1 2CDEA 4KMQA 1V3LA 5ID0A 1ETZA 4NO3B 5K9QG 3OKLB 2DQIL 3FB8A 2AGJL 1EAPB 1RV6X 3KPNA 2H1PH 2R69H 2K7QA 1AI1L 2IQ9L 4YHOL 4G80B 4OLUH 4EDXB 5I15L 5DRXB 5D1XB 2HFFB 1MIEL 2W0FA 3DXAE 5A2JH 2IWGA 1AJ7L 3NZ8B 3QUYA 2EKJA 5GGVH 3VRIA 2R1XA 4U6VH 2XZAH 2R0ZH 3QG7L 1G1CA 2XYCA 4QTHB 3KXFE 4JO1L 4PJXF 3KPTA 4HPYH 5D5MB 2E9JA 3ARBB 3C9NB 1JTPA 1DBAL 3NFNB 3SDAC 4PJEB 1T22B 3IU4H 4IRZL 3CDGB 2A6IB 1JP5A 2J12B 1T21B 5EO9B 1H3XA 5EFIB 4FFWD 1FZOA 3LQAL 1FZKB 1ZV5A 3V0VB 3SDAA 4MJIB 1S9VB 4P5TC 4E41B 3MXWH 4J6RL 4W81A 5E9DE 3CLEL 5HYQA 1AQDB 3HMXA 3HG1E 1CE1L 4OCNC 4P5TA 4JY5H 3U7WL 3O6FC 3TT1L 3PDGA 3EGSB 4QHLB 4U1IA 1J1OH 4JDZA 3DO7A 1QYGH 3FQXB 3F6LA 3W0WB 4I4WA 1BD2B 1QBMH 4YQXH 4AENA 4GBXB 5FB8B 2XTJB 2AXFB 4C54A 2Z35B 3O6FA 4HEPG 1BIHA 5KTEH 4Z7OF 1HILB 4NQVB 5F72S 3RPKA 2CDFA 1LE9B 4I3SL 1QFHA 2BSTB 4I3RL 1ZLUK 1CL7I 1CIUA 2VR5A 1X5IA 4KI5C 4KROC 5FYJE 2ERJC 1DQJA 3PDOB 1T2QL 4ONFL 4PYHA 2OP4H 4TULL 3KLAB 3F7PC 4OZFH 4NSKA 1ZANH 2YWZA 5GGQL 1ZA6B 4PJGF 3FO2B 4KI5F 4PRPB 2A1WH 3UO1H 4LLQB 5IBTL 1S7WB 2YRLA 3MV8B 2AV1A 2ZUUA 4JRYE 2N7BA 3U2SA 2R69L 1UKSA 2VLJD 2YUZA 3QR2A 5ESQB 1T03L 3GBMH 3TYGH 2XKSA 1II4E 3O9WB 5JHDE 4X6BA 5FV1L 4YDIH 2H32B 1YY9C 3B8YA 3INUH 3LRSB 4U6VL 4HFWA 5C8JB 4UIKH 5JPNB 3JXAA 5CJOH 2R0WH 1UEYA 3MUGB 2VN4A 4CVZA 3IU4L 1WITA 2BMKB 4Q97A 1YMMB 2GY5A 2IAMB 3NIGE 4TUKL 1CVRA 1HYSC 3X13B 4C83A 2WWMD 4NQCB 3KPMB 2DM3A 4LHJB 3S88H 2DTSA 4RMVA 3BP7B 3MXWL 3NA4A 1RZ8B 1A7QL 4HIXH 1A6AA 3VDCA 4JY5L 2ESVD 3FL7A 5IM7B 4NNYB 1OAKH 2WP3O 3VXTA 1EXUA 1J1OL 4IOIA 1QYGL 2DIJA 1VA9A 1CLZH 1AD0B 5JDJA 4XVJH 5F7LB 4ZMAT 15C8H 1CICD 4RZCA 4I48A 3H3PH 5KANI 1ORSB 1ZVYA 1G0DA 3G04A 3I3DA 3BMWA 3DECA 4O2FB 3RVUC 1ZS8A 2CK0H 3IDJB 4DZ8A 4JFYA 3DSFH 5LJYH 1HIMH 5I0ZA 2DDQH 4M61B 1DQMH 5I75B 2P5EA 1XAUA 3SOBH 3G5YA 3RWCA 3SBWC 2OP4L 2ADFH 5SX5K 2ZZUT 3MRIA 1KXVC 5C0AE 1R3JA 3UO1L 4LKCA 3TVMC 4WHTB 3SBWA 3VXRD 5JMRA 1NFIA 1G9EA 3C8HA 1O0VA 4PRNA 4EI6A 4GAFB 4M1CC 3KYNA 3MR9A 3ZKQD 3TVMA 3GBML 3TYGL 1CCZA 5HYSG 5J1AA 4AEHH 4HF5H 3HNSL 5EN2B 5IJVB 1FZJB 1BAFL 5FYKE 4JVUA 5IMOA 3GIVB 1QO3B 4CRPA 3DBXB 4FQXD 1KJMA 1EPFA 4PTUA 3TIEA 4UIKL 5CJOL 2R0WL 3ULUH 1FVDA 1TTGA 1J0YA 2VAJA 4ODXA 2YR3A 3O4LE 1XF3B 2DM7A 3QIWB 4ONGL 3O3EA 4LSQH 2DL9A 4OSUL 2HMID 2YEZA 3VFTB 4YEFA 1I4FA 1EVTC 1KN4H 3S88L 1T5WA 3P4OB 4HJ0D 1RIUH 2OCFD 4LP4A 3QQNA 3QWRA 2XWBB 3X11B 2FB4L 5F7FA 1B6DA 1OAKL 4FTVA 1RZIA 1DUYB 3M8OH 3BP6A 3VFPB 3X3FH 1X9QA 5DA4A 4XVJL 4WW1A 4P5MA 1JI1A 2DKMA 5DYOA 4RGNC 3MFFB 1FQ9C 5C71A 1IL1B 4CNIB 1U8QA 1ZWIB 3FAWA 1FZMB 1DTUA 1Q0XH 2DDQL 1DQML 4Y89A 3V6FB 5E2JA 3SOBL 4YEEA 5D9SB 3O41A 4HEME 2ADFL 3EOTH 1DDHA 1V05A 3DI3B 2W9LA 5C0IB 1SYVB 4PP1D 1U8JB 4NNXB 3VFMB 1NCAL 5HYJE 3DVGB 5IOPB 3ZMRA 1HH6B 1BHGA 4NJ9H 3UTOA 5I76A 5IMMA 4AEHL 4HF5L 2G60H 4XNYH 2D7PA 2YKLH 5EU7C 2CDEB 2IFFH 2FX7L 5ID0B 1S7XA 5F8RC 1ETZB 2MQ3A 3ULUL 3FB8B 1CU4H 3RIAF 4YHKL 3KPNB 2MCPH 2XQBH 2VXTH 4L29A 5C08E 3D69A 4LSQL 1DBBH 3MLPA 2W0FB 3SDXF 3QUYB 1EGJA 4H26A 4YBQD 3VRIB 2R1XB 5DVKA 1KUMA 2E9WA 4XZUA 5BVJA 4OIBA 3ECBA 2HTKD 2NZ9D 4L5FL 4G3YH 4NZTL 3RVTC 1EVUA 2O5YH 4M7ZC 1A3LL 1LP9A 3M8OL 1FZOB 3X3FL 3QDGD 5LKNA 4N0YH 3LPFA 2BVUA 4QXUH 3SDAB 4OZ4A 1OLLA 3QFJE 5FIEA 4RIRA 4X5LA 5E8OA 2YMXH 4KQ3L 5CEZE 4JGUA 4Y8AA 5HYQB 4P5TB 3VRLF 2HTLD 4JR9H 1YEKH 4U1IB 4JDZB 3DO7B 3EOTL 1MHPH 4I4WB 2E27H 2NY7H 4AENB 1MHHA 4TN9A 3O6FB 1TJIH 2Q8AH 1UJ3C 2VRAA 2CDFB 1A6WH 1RVFL 4MJ4A 4G8GE 2C4FU 4Z7UE 5F6HJ 1ZHBA 5DK2A 1DQJB 4M9OA 2V5RA 1G0YR 1CYGA 2G60L 1F90H 4XNYL 3L95A 4NSKB 2YKLL 5D96C 3NCJH 4XPHH 1QTYT 2IFFL 4KZDH 4KROB 3TV3H 1VGKA 3ZE2F 2ERJB 3T09A 3RPIA 5E5MA 5IMKA 1CU4L 2AV1B 2BVQA 1BP3B 2VZ3A 4N8CH 3U2SB 1JBJA 2MJWA 2XQBL 2VXTL 5E7FA 1S7UA 2EIEA 2D7QA 1MI5E 1DBBL 3I6GA 1TQBC 5LVEA 4X6BB 4KKBC 2R2HA 4DKFL 3MRBA 1KOAA 2PO6D 4OFKA 4D0DA 4PLJC 4LGPB 1MAMH 3OZ9L 2AW2A 4HFWB 4OJFH 4LGRB 4JFDD 5JDSA 3VW3L 3ZYZA 2VWEC 4CVZB 3GSOA 1FFPA 5JNYA 3AREA 1R5IA 2HLFD 4G3YL 4OCMC 2O5YL 4X99A 1W72A 4C83B 2X5PA 4UAOC 3C09C 3TM6A 2DQUL 5GRVL 1OTSC 2ZNXA 1GGIH 4MAYA 5F9OH 1TVBA 3EO1A 4WTZA 2EH7H 2YMXL 3TH2T 1E6OH 1GPOH 1A6AB 4RCAA 3BZEA 2PR4H 3C8DA 4UBDC 4C56A 4HCRA 4DN3H 1YEKL 4LHUD 3VXTB 1EXUB 3H7LA 1YN7A 4IOIB 4KV5F 3HZYA 3TN0C 5GS0D 1P1ZA 2NY7L 4M1DL 4I2XA 4RZCB 2G5BA 4I48B 1TJIL 3R1GH 2Q8AL 3JWDC 3G04B 3MJ9H 1FO0L 1IGIH 1A6WL 1L7IH 3TN0A 4NHCL 1ZS8B 3BISA 1UM6H 4DZ8B 5BS0A 1B88A 5BV7L 2P42B 4JFYB 4Q9RH 2P5EB 3QQ9D 3G5YB 3RWCB 1F90L 1L7TH 4PJ9D 2WIMA 3IVKA 4XPHL 4WWID 2UWEE 4P4RA 1A0QH 3MRIB 3TV3L 1R3JB 4ODVL 5LCVH 4QWWC 1P4LA 4M03A 1NFIB 4JFEE 4N8CL 4Q2ZA 2ORBH 4PRNB 3QDJD 4EI6B 3MODH 4LCWA 4K2UH 3MRNA 3L5WA 3KYNB 3MR9B 3TVMB 2CXGA 1QFOA 4I0CC 2EYSA 5FYJL 5J1AB 1F3JA 4Y5XC 4OB5H 1KNOA 5CJQH 4X6EA 4G6FB 1OCWH 3W39A 3FN0L 4WVRA 5IMOB 4XHQA 1MAML 1ZEAL 1HNFA 3L1OH 4OJFL 1KJMB 1OGAA 5IG7A 4PTUB 3HFMH 3TIEB 3K8LA 1JNNL 4OIAA 5FOBA 3QDMD 5D7LD 3OR6A 1FVDB 3W11C 1WJ3A 5IQ9A 1AXIB 4ODXB 4CDGC 1I1AC 2VLKD 3I02A 3O3EB 4KJWC 3D39D 3H9HA 3H42H 3MOAH 3H8NA 2YEZB 2AQ3A 1I4FB 2VZVA 5HGBA 3MYZA 1Z0NA 5DD3H 1T5WB 3AXLA 5F9OL 2EH7L 3MV7A 1ACZA 1E6OL 3U4EA 5KBNC 2A0LC 2NW3A 5K59E 2PR4L 4P23D 5CP7A 5E6IC 4GUPA 2F53A 4IMKC 4JY6A 4D2NA 4FTVB 1RZIB 5F7WC 4ZS6D 3BP6B 3HI1A 2YA0A 3EDDA 2ZG1A 5EDXA 1JFQL 4WW1B 4OD1H 5DJYA 1UWGH 4QOKA 4P5MB 3WJLC 4QT5A 2NY4D 5DYOB 4OZHE 1EFXD 2DRUA 3R1GL 3NGBB 4IMKA 5MEPA 3MJ9L 1IGIL 4KK9D 1U8QB 4P46C 4WFGE 1UM6L 2VERN 1CTOA 3ARZA 4Q9RL 3WJLA 4RGNB 1KTRL 2ICCA 1TJGH 3IFOA 3P2TA 1KPUA 3O41B 4OLEA 1L7TL 1MFBH 4P46A 4GT7A 4RFOL 2CMRH 5E03A 1IGYA 1KN2H 1DDHB 4Y2DD 5FO7A 5LCVL 1RK1A 3OF6A 3LQZA 3MLYH 4NO5A 2MOVA 2C3VA 5F88A 4P2QE 3L5XH 3FQUA 4K2UL 2X89D 2LFGA 5SWQA 5I76B 5TGBA 5IMMB 3MRFA 3OKEA 2FZ3A 4Z7VE 4OB5L 4KJQC 5CJQL 2YUWA 1OCWL 1SJXA 3L1OL 1S7XB 5T5NG 2L4OA 5HGHB 3HFML 5D7JA 5EULV 5FO9A 1KTLA 4FXKA 4LCYA 3LN9A 3VDAA 1E4XI 4ZFZA 4EUPG 2RCSH 3HZVA 1MJUL 4L29B 4UZGA 4X6DE 3HTLX 5HTSA 3D69B 1YEJH 4U2YA 1B0WA 3H42L 2YN5A 1B0GA 3MOAL 3CZFA 1OTTC 4H26B 1BIIA 3ARWA 5DD3L 1TNNA 2Q76A 4GRWF 5FYKL 3W9EA 5KOVC 3WYRA 1JN6A 4XZUB 2DOCA 3RL1A 5BVJB 5IHUH 1AP2A 3AS1A 2ZSWA 1OT2A 7FABH 3ECBB 5TDNA 2EDEA 5I1AA 2YPVL 3WD5H 4JJHA 4NWUH 5MENE 4TVPH 1LP9B 5ILTL 4NN6C 4OD1L 4XNZB 4OZ4B 3UPCA 3HI6H 5HJ3A 4L4TA 4LP5A 3V4VH 4RIRB 2JJWA 1M6OA 5E8OB 3BX7C 4DFHA 3FQTA 1X4XA 3RBGA 2A77H 3W82A 1OT1A 3NTCL 4TTDD 2ZKHH 4N68A 1CL7H 3V6OE 1MFBL 3O81A 2NX5E 1K4DA 2WBWB 3O2DH 5EIVA 2CMRL 1KN2L 4H88H 4HMEA 1U8IA 4D9RD 1HOCA 3OKOA 1NC4A 4JPIA 1MHHB 1TPXB 3MLYL 4MD4A 4MGXA 3L5XL 1I1YA 1JGUH 2Y36H 3HNVH 1MWAH 5DJ2A 1ZHBB 1FIEA 2GKIA 4WV1C 5DK2B 1NLDL 4XP6H 3MXVL 4LSSH 1BZ9A 4WW2C 4XI5D 1L0XA 3L95B 3HUJE 1C16A 1RJCA 5DMKA 2FJFA 1BJ8A 1VGKB 1WF5A 3P40A 5C3TA 2Y4SA 3RPIB 4WW2F 4WW2A 3JWNC 1R3IH 1CFNA 5E5MB 5IMKB 1CGVA 2BVQB 3Q5YA 1AXSA 4HWBA 4QRSA 5D96B 5F9DC 2ZNWA 2AI0H 2R8SH 3QIUD 4QRRE 2RCSL 4PJ5A 4QRPD 4F2MA 1S7UB 2DYPA 3I6GB 4RDQF 4XTRD 3C87A 5DD0H 3RNKA 1HQRA 1CTNA 2R2HB 3U0PA 2BZDA 3MRBB 5D7SH 1BF2A 4D0DB 3C5ZD 4UOW1 1DE4A 1X5XA 2CGRH 5E56A 3ZHKA 3FO1A 5JDSB 2K7PA 4CN1A 3BRDA 2UV3A 5IHUL 3JVGC 2ATKA 3GSOB 7FABL 1FFPB 5JNYB 4ZD3H 4P2RA 3AREB 1R5IB 3WD5L 4NWUL 4RISH 5GRUH 4X99B 2QL1A 5A2LH 1W72B 3VXMA 3JVGA 3UC0H 4M3JA 3V4VL 4MAYB 1H0DA 1TVBB 3EO1B 3HE7D 2YK1H 1S7TA 2A77L 1PZ5A 3C09B 4HG4K 3BZEB 2ZKHL 4C56B 1T66D 4P4KC 1PAMA 5EOQH 1AO7A 1CL7L 3RDTC 4TNWK 1PW3A 1B6UA 1DBJH 1JYWA 1YN7B 3O2DL 3HZYB 4H88L 1IVLA 1P1ZB 3QUMH 4DFIA 4TUOA 4I2XB 4P4KA 3UZEA 2G5BB 3RDTA 1CXIA 2B5IC 5CP3A 5I0DA 1B2WH 1J12A 5D93B 2Y36L 5C6TH 3TN0B 5L0QC 5AZ2H 5BS0B 4HBCH 3UTTD 5CEZL 3WLWD 4XP6L 2APXA 2C7UA 1FNHA 4KUCD 1NMCC 1F02I 4NFDA 4ZTOL 3IVKB 4OBSA 4G8IA 4P4RB 1URLA 5BQ7A 1P4LB 3BRGC 4NKOA 1R3IL 4X0KA 2R8SL 4Q2ZB 4XC1L 2AI0L 5CUSH 4MAUL 3LOWA 1INEH 2VDPH 3HZMA 1E4WH 4LCWB 4APQD 1NCBH 3FQNA 3L5WB 3MRNB 4M7LT 5L8JB 1T20A 2AJUL 3UDWA 2EYSB 1F3JB 3CFKA 2PUQT 1KNOB 5D7SL 2J5LC 4X6EB 3TFKD 3W39B 1AKJD 4XP9H 1GCFA 3LY6A 5BXFA 4PJ7E 4ODTL 5HHXH 1OGAB 5IG7B 3CXDH 5FOBB 1UYWL 3OR6B 3VFOA 2VXVH 5IQ9B 4XPTH 4ZD3L 4K8RD 2IC2A 3VU2A 5IT2H 1CG9A 3BVNA 3I02B 1Z9SA 4RISL 5GRUL 2W92A 4JFFE 1NMAH 2IPTH 3H9HB 4V1DD 1CDIA 1OAUL 1S5HA 3BJ91 3AUVA 1EO7A 2NY1D 1NBQA 5HGBB 3UC0L 4NM4H 4E0RA 3ROLA 4U33A 2EO1A 3AXLB 2O61A 2YK1L 3MV7B 3TYFA 4XWOC 5MI0C 3U4EB 3VXRE 1D3CA 2NW3B 3HMWH 1X5HA 4M6AA 1MFAH 5CP7B 2ZG3A 1U3JA 4GUPB 2F53B 1DBJL 2QADB 3CLFH 1CLYH 4JY6B 3FQRA 5C0JA 3HI1B 3QUML 5ETUA 5DJYB 4OF8A 2PYEE 4QOKB 5D6CA 4QT5B 4RWYH 4XHJD 5MEPB 3ARFA 3GSNH 3QQ4A 3D3VD 1B2WL 1JPTH 5SX4I 5C6TL 2J88H 5AZ2L 3K4AA 4DKAA 1A47A 5DD5H 3U30C 3IFOB 3GSUA 2AJYH 5JW4M 1KPUB 2YD3A 3SKMA 4P46B 1IGYB 2BOCA 3WFCL 5FO7B 1RK1B 2CPCA 3LQZB 4Q6YA 4NO5B 2C3VB 2DLTA 5F88B 2CUIA 3PL6D 5T1KA 5CUSL 3HZKA 2JTDA 1INEL 3FQUB 3ILQD 1E4WL 1NCBL 2GJZA 5SWQB 3S35L 5TGBB 3MRFB 3OKEB 1EX0A 2FZ3B 4NO0D 2HJKB 4DVBA 2ED9A 5ANME 4XP9L 5GRVK 3K8MA 5KN5A 3DURA 1FP5A 1KCRH 5HHXL 3RZWA 1J8HA 5D7JB 5FO9B 1X7QA 4IDLA 1KTLB 4FXKB 4LCYB 2VXVL 5DHVA 4XPTL 3RA7H 1MJJA 4ZFZB 4U6YA 3HZVB 3B4NA 1ZXQA 3QT2A 2XXCB 2X9WA 1NMAL 3VXSD 1B0GB 1PJ9A 3CZFB 4X7SH 1VEMA 1BIIB 1GGBH 2YUXA 4NM4L 2Q76B 2W9EH 3W9EB 5CZKA 4PRBA 4PRPE 3K4ZA 1Y6NR 5KAQF 1JN6B 3CC5A 4Q9QH 4LLVA 3RL1B 3S5LA 2V9RA 1JRHH 1FYTE 3HMWL 1PYWA 1AP2B 4U6XA 2ZSWB 2VE6A 2PKDA 5TDNB 3SHSA 5I1AB 3CLFL 1DVFD 5KS9E 4Y0GA 2FIRT 3S3SA 5HDOA 4XPBH 2D4DA 4NFBA 5HJ3B 1U91A 4L4TB 1J5OH 4P2YA 2ZPKH 3GSNL 1M6OB 1NLBH 1JPTL 3FQTB 1A1NA 2J88L 4R0LC 2PXYD 4NN6B 1WFTA 2NXZC 5ITBH 5DD5L 3NCMA 2AJYL 2WWKT 3RKDD 4MYWB 2J8UA 4FN0A 1K4DB 1MFDH 5DLMH 1HXMA 1T4KA 1U8IB 3LQAC 5INDA 1HOCB 3OKOB 1NC4B 4JPIB 2NLJA 4MD4B 4NQCE 4UU9A 5F96H 1I1YB 3BD5A 5DJ2B 2OMNA 1XIWD 1A7BA 2FH6A 4S10A 1A6UL 2B4CH 1BZ9B 3IFLH 3HN3A 3BDYH 1A7PH 1C16B 5DMKB 1G7QA 2FJFB 2ZWLT 3QDGE 1KCRL 1LILA 1DP0A 1VKXA 2GTWA 4U1SA 4XCCH 5LBSH 5EBGA 1GL4B 4WW2B 1ZT7A 3BHBA 1CFNB 1AXSB 4QRSB 3VXUA 3RA7L 3LMJL 5B39G 3P9WB 4PJ5B 3QXTA 2RB8A 4LSTH 3E3QC 5F1IA 1QSFE 2DYPB 4F2MB 3WHXA 5CZXC 3BGMA 1HQRB 4X7SL 5HI4D 3U0PB 1QBLH 1N6VA 1DE4B 5BZDA 4N8PA 4I9WD 3FO1B 3U1SH 4Q74A 4Y8DC 4WUKL 2IBGA 4L1HA 3BPCA 1DZBA 1X5YA 1TENA 3U7YH 4PRHA 3G6JA 5ITFA 1CDBA 2ATKB 1X5KA 3ARPA 4JO3H 4P2RB 5I71C 1CXKA 1WLHA 2YD2A 3TBTA 2ENYA 3O8XD 5CSGA 1N4XH 3D48R 3NH7H 1SEQH 3TA3C 4XMLL 1AC6A 3VXMB 3CMOH 4PRID 4XPBL 3P0GB 4YK4C 3VA6A 2A74A 5CGMA 1F4XH 1J5OL 2XWJA 5J0BA 1H0DB 2ZPKL 4OGZA 1NLBL 1ONQA 1LEGA 4HIHA 1I8IA 1S7TB 4MNGE 3C60C 2WV3A 1PZ5B 2P5WA 5ITBL 1Z0MA 3OBAA 1WZMA 3ZLQC 1AO7B 4WJ5A 5ESAA 1D6EA 2AVGA 3F58H 5GS1C 5B22A 5GZND 3H9SD 1PG7L 3BEWA 5FYLD 4ZOCA 3C60A 4PJIF 3TNNA 1N6UA 1U3HD 3LEVH 4NQED 4QNPF 4TUOB 1S9KC 4P4KB 3L5JA 3RDTB 4RA0C 1DQDH 5GS1A 2B7DT 2FHFA 2RAMA 1IMHC 1MJ8H 4QTIH 2YD6A 3MOQA 1QSEB 1ACYH 4GRLC 2B4CL 2B5IB 2C7UB 2QSVA 5E7BA 3BDYL 1A7PL 5ACLA 1YY8A 5L0QB 2YZ8A 4G8IB 2XZZA 3DMMA 2AEPH 5BQ7B 5LBSL 1N0XL 4XCCL 2DKSA 2OXGA 5HHNA 2N4IA 4NKOB 2DQHH 3LEYH 1NMCB 4JFHD 4X0KB 2JCCF 3HZMB 4EDWL 3FQNB 1KACB 3MCLH 4LSTL 3QPXL 2JB6A 1T20B 4X4ZA 2UZYB 3GI9H 1OVZA 3CFKB 4XX1G 2HT4C 5TH2A 4X6CA 5L2KE 1QBLL 3V2AR 5BXFB 1SY6H 3O2WH 5FAAA 1NC2A 3QI9C 1QLFA 2IH1A 5I1IH 3P4LA 4QHUA 3UJJH 1J0ZA 5ICXA 3TH4T 3VFOB 3U7YL 1XZ0A 2J5LB 1XMWA 1UZ6F 5JHLH 4JO3L 2GHWB 1OGTA 1CG9B 3BVNB 3QI9A 5C09E 3VD5A 1ZK9A 4EOWH 3OGCA 3NH7L 1SEQL 1T80A 4JKMA 3CMOL 1S5HB 1WAAF 1X4ZA 4ZFFA 4E0RB 2P48B 2D0GA 3ROLB 4WUUD 1VENA 5F1KC 2O61B 1FORH 3TYFB 4TSAH 4D9QD 4HWZB 3F65A 5KW9H 5BRZA 2EDWA 4KRPC 1P7QA 1S9WA 4N5EC 5EO1A 3QDJE 5ADPH 5I1EH 3Q5OA 1HHGA 3FQRB 3LV3A 5C0JB 2A38A 3LEVL 2PTVA 5ETUB 5I73B 4PJCE 1BMGA 3SJVA 5D6CB 1OARH 3R0MA 1DQDL 3ARFB 3WFBH 4JKKA 1GGUA 3QQ4B 4QTIL 1B4JH 3QDME 4HC1H 1ACYL 3QEGH 3MBEC 1JYXA 3GSUB 3U0WH 5D6DC 3SKMB 2HJFA 4V2BA 5I30L 3D39E 2R9HC 2BNQA 2BOCB 2D03L 3U30B 5FFLA 5EWIL 1YMHA 3QUXA 3T3PE 4R7DA 2DQHL 5D1XD 3LEYL 5D6DA 5CD3A 1EJ6A 1FRGH 3MZGB 5T1KB 1X5ZA 3HZKB 3MLSL 2FX8L 2PTUA 4NZJA 3ZTJG 2GJZB 1JNJA 2VUOA 1E4XH 4PY8I 5ICZA 1NCWL 2XICA 3EFDL 4DVBB 2WUCH 3ARBD 2MNUA 5JXAH 4OZGE 5KN5B 5IJKA 3BKCH 3DURB 1SY6L 3O2WL 1J8HB 3SCMC 5I1IL 4FABH 1X7QB 3SO3C 3UJJL 4DGVH 4PGEA 1K3ZA 4O58H 5HI3C 5DHVB 4N0RA 3T0VA 5JHLL 1JWSA 1ZHNA 3S4SA 1MJJB 4U6YB 2YPLD 4E41D 3SCMA 4N0UA 4EOWL 3EJZD 3GBLA 5FUOH 2LE9A 3RGVC 3OV6A 3RTQA 2AEQH 2XQYK 1V3KA 2VUYA 4PRBB 3TT3H 1FORL 4TSAL 3CC5B 3QJHA 1P4BH 4LLVB 3S5LB 3PHOA 5KW9L 3ULUC 2SEBA 1PYWB 3W0WD 4HK3N 1BD2D 3SGDI 5I1CH 4U6XB 3DNKA 3S98A 2VE6B 5C2BH 1LO0H 5L8LB 2VR9A 2MSPA 1PLGH 4QXTA 2X1OA 2VO5A 5KSUA 3BPNC 2CUMA 4ZNCD 4NHUA 1OARL 4OCSH 1U91B 3WFBL 3AFLA 3ULVE 3HC0A 1B4JL 2VLLA 1A1NB 4HC1L 3G5XB 3T2NH 5HHVH 4K71B 3DUSA 3VGGA 3EHBC 1FNSH 3MV8D 3U0WL 2J8UB 2D7NA 4L9LC 1BWMA 1HXMB 3K2UL 1T4KB 3V95A 5INDB 1Z3GL 2NLJB 4UU9B 4JAMA 4JRXD 2VH5H 1XGYH 3O9WD 2WP3T 1FRGL 2H32H 4L9LA 2EXWD 5T3ZD 2XT1B 3U4AA 1KCSH 2VABA 1E4XL 2YUVA 3U36A 1JGLH 5GS2D 1RULH 3MGOA 3ZT6A 2O93L 3BQUD 2WUCL 4UTBH 1G9NH 1F97A 3GSVA 1G7QB 5SWZA 3A6BH 5JXAL 2IGFH 2HRPH 3BKCL 3FO0H 1VKXB 2EO9A 2GTWB 4M00A 4U1SB 4ZOAA 1YMMD 5FCSH 1ZT7B 4WI4A 4FABL 4BA8A 3BHBB 3VI3E 2QEJA 4O58L 4WI2A 3VXUB 2JIXD 5TPWH 4TVSa 5DFWH 1BJ1J 5F1IB 5FKAA 3SPVA 3WHXB 4KKCC 4Y5YC 4UQ3A 2P43B 3ESVF 4K7PY 3BGMB 3O6KL 2X4QA 5FUZH 1TETH 4ELKA 4XMKH 2AEQL 5BZDB 4D9RE 1BQSA 5E94A 5I6XC 4JPKH 3QHFH 4Y5YA 2CIKA 1P4BL 4R3SA 4OLZH 3BPCB 3MRJA 4PRHB 2AK1H 3G6JB 4JDTH 3QEHA 5ITFB 1GXEA 1XFPA 2P1YA 5I1CL 3MNVA 4GG6E 5C2BL 4HX1A 4R2GC 1LO0L 3TBTB 1INDH 4PJHF 4ZO8A 1LK2A 5T3XE 5F7NC 1CGSH 1PLGL 5AYQA 5HDBF 2A74B 4F7PB 4S0SD 4DZBA 5I71B 2XWJB 4X9GA 4P2CG 1ONQB 1LEGB 4HIHB 1I8IB 4MVBC 1NUFA 1W8NA 2OTWA 2BVOA 2NY6C 2P5WB 4YK4B 1IBGH 3T2NL 4LPWA 5HHVL 5ISZA 4WJ5B 5ESAB 1D6EB 1N7MH 4QRPE 5F21B 3BEWB 2UY6A 3C60B 5F6IC 3TNNB 3WNNA 3QULA 4EEEA 5GS1B 4X4ME 4OFIA 5GGTL 1RURH 5GRXG 5DXWA 4GG8A 3X3GL 5IVOA 2PW1A 3BE1H 4CVXA 2BC4A 1KCSL 3DXAA 1JGLL 4HG4J 3F62A 1AR2A 1IILE 1YY8B 4UTBL 1G9NL 3A6BL 2IGFL 3KXFA 3DMMB 1IAOA 4EVNA 5HHNB 1RUAH 4XP1L 2H2PD 3ZDZE 4HMCA 4O5LH 3V7AG 5TPWL 5FV2A 4NOBA 5IVXF 1BVKA 3CIQA 2JB6B 3FB5A 5F7YC 4JLRA 1FO0A 1HXYA 5TH2B 1NEZA 5EBLA 4X6CB 4HUVA 5FUZL 1TETL 2GJJA 4XMKL 4IRJC 5DC0A 3S37X 3FB6A 1NFDF 5E9DA 1CXFA 1NC2B 1QLFB 2X10A 2IH1B 4JPKL 1S9YA 3QHFL 3HG1A 4M6ML 1YQ2A 4QHUB 1ZHLA 5ICXB 1XZ0B 4RMRA 2AK1L 3SQBA 4PJBE 1RZ7H 3CJJA 4MZ3A 5DC9B 1EH9A 5KVDH 1OGTB 3QI9B 1INDL 4ENEC 1A4JA 4POZC 1G84A 3OGCB 4YDLB 1UM4H 1PY9A 5M95B 1QKZH 2JJUA 5BOPA 4ZFFB 1BQHA 1QQDA 1IKNA 2D7TH 3ZE1F 4KRMB 2UZXB 4TNVK 2AJZA 1T7XA 2NXYC 3BIAX 3IB4A 3MV9D 1BVZA 2EDXA 5FM5O 5BRZB 1JTTA 5SX4H 4EI5C 4PB0H 1P7QB 1S9WB 4N1EA 4FS0A 5EO1B 1BF8A 1XCQA 1N7ML 2BHUA 2VISA 1A8JH 2G75A 1HHGB 3I2CH 3LV3B 4MJ5A 4R97C 2LV4A 4EI5A 2C4XA 4NZDA 4JRYA 3SJVB 3NCFB 3WFHA 5DVMA 4OFYD 1RURL 3VGHA 1UXWA 3WKML 3IJHA 4YJZL 5JHDA 4MHHI 1XGPA 3RVVC 4G6AD 3VWJC 5F89A 4NN5C 3TPUA 4ELMF 1FGNL 1WTLA 3RI5F 2HJFB 4C4KO 4DGIH 1YPZE 3ZHLA 1U41A 2BNQB 4GFTB 3VWJA 3BD3A 4OM0L 1YMHB 3QUXB 1RUAL 4F7EA 3ARDA 2FSEA 4R7DB 5CD3B 4GOSA 2Y06L 1JHKH 4BQBA 1NGQH 5KJRL 4O5LL 5DS8A 2E8YA 4NT6A 1NPUA 3PP3H 2R4SH 5F93C 4X9FA 5TQ2H 1AY1H 2UZIH 5ICZB 5EUOF 3MUHL 4FFYL 1G0XA 3MJ9A 4XNQA 1J8KA 5SWSE 1P4IH 3NIFE 3ARTA 4P59H 4GAJH 3KWWA 5ALBL 3EYQC 4PGEB 1RZ7L 1JWSB 3SDAD 1ZHNB 3S4SB 5KVDL 3E8UH 3JWOL 5C07A 4GMSH 3SCMB 3PWLA 4N0UB 1Q9OA 5KVFH 3MJ7A 1UM4L 3HMXH 1QKZL 4XNMA 3RTQB 3MCG1 2D7TL 4AG4L 2K1MA 5GS0L 5K9OA 3QJHB 3PHOB 2SEBB 4PB0L 2WBKA 2VDOH 5L7XL 4PJDF 4LPTA 3O6FD 5I8OL 1QOKA 1XF5A 5C0AA 4XVSL 3I2CL 4QXTB 4RAUA 5DGRA 2BRQA 3GIZH 5KSUB 2CSPA 4Z7QE 4NHUB 2ADIA 1PKQE 3BRFA 4DQOH 4NWTH 2G2RA 3HC0B 2ITCA 1HZHH 2VLLB 1T1ZA 4LSRH 2GIYA 3BPNB 1EV2E 3EYOA 3CU7A 4KI5D 2YN3A 4HFUL 3DUSB 2DF3A 1PKOA 4ETQA 4DGIL 4YBLB 4DWHA 3G6DL 4M6OL 1ZGLM 3ZKSD 2OLDA 1SBSH 5E24E 1QUNA 4JAMB 4Z7NF 5C0NC 5MEQA 1O5DT 4L9LB 1NGQL 1WIUA 3O4LA 3QNZA 2QV2A 3RWIA 3ULVH 5F3HA 2R4SL 1J88A 2D7OA 4TOYH 4JVPA 3HPJA 1AY1L 2UZIL 2VABB 3DV4A 4J4PC 3U36B 3WDHA 1Q38A 4UV4H 3MGOB 1D5IH 1UA6H 1I9EA 3GSVB 3QHZH 1P4IL 5SWZB 2VDKL 1CGXA 4JKLA 5HDQH 3HC4H 3UPRA 4J4PA 4BKLA 4I2XE 2HH0H 1MVUA 5MEOA 1RZFL 3E8UL 3MA9H 5C0EA 1KCLA 4GKOA 3OB0H 4GMSL 2H3NA 5FKAB 4TUJA 3SPVB 5KVFL 3IRPX 4UQ3B 2P49B 1HYSD 3GNMH 3MACH 5KSVA 2I60H 2X4QB 1EJOH 1Q0YL 5D1QC 3GSRA 4ELKB 5T33H 4C57C 1MLBA 5HHMB 4K3EH 3RY4A 5E94B 5GGRA 2BNRE 4Y5YB 5E2WL 2CIKB 4R3SB 4OZIE 4UT7H 3EYFA 3MRJB 1A4KA 1TIUA 5D1QA 5E4EC 3VD9A 3QEHB 5JUEH 4NBXB 2VDOL 3LZFH 2NY5H 4NGHH 3MNVB 4PGBA 1REIA 4HX1B 1HHIA 3KPSD 5EZOH 1LK2B 3GIZL 2YOCA 5DR5L 3U83A 5HYJA 3BAEH 2YPKA 5T1DH 5D1ZC 4DZBB 5IB4A 3N1GC 4LAQH 4DQOL 4NWTL 4L8CA 4JQVC 1HZHL 1LVEA 2JJSA 3FKUS 3RVUD 4LSRL 1NAMH 2BVOB 2OTWB 5DMGC 4M5ZH 4L1DA 4HUXA 5D1ZA 5ISZB 1JV5A 4B41A 2WZPD 4JQVA 4BELD 4YFLF 1KB9K 2NY6B 5T3XH 4YIQA 3QULB 2VMFA 2WBJC 1SBSL 3CFJA 3TVMD 1ITBB 4DTGL 3QO1A 4Y88A 2XN9D 3P9LA 4GG8B 3MV7E 5F6IB 4G6FD 4M1CD 4C55A 2PW1B 3P30H 4CVXB 1U8KA 3ULVL 2BC4B 4TOYL 4LVEA 3DXAB 6FABL 5H94A 4UV4L 4TSCL 3KVQA 1E4JA 1KCUH 3O2VL 1D9KC 3RWHA 1UA6L 3WDJA 4JN1H 5HDQL 3HC4L 3KXFB 1LDSA 1QLEH 1IAOB 3LHPH 4EVNB 5JW3L 1HWGB 5FUCC 2OK0H 2HH0L 4IOFC 1D9KA 4Q58C 5INCA 5JA8B 3BW9A 1IC5H 3ZT5A 3MA9L 1BVKB 5IB2A 3FB5B 3MRPA 3DLQR 4MA1B 4JLRB 3QFJA 3ZDYE 1RFDH 3GNML 3MACL 3QP3A 1FO0B 1HXYB 1EJOL 1NEZB 3KYOA 5EBLB 4HUVB 4OCLC 5E8DH 4FQQA 3BWUC 4XC3H 5T33L 2EE6A 2APFA 4HUKB 5BV7B 4NQEE 3FB6B 2CKBL 5EG6C 5E9DB 4K3EL 1JVKA 1S9YB 3HG1B 1DL7L 4FTVD 1ZHLB 3BOVA 3PNWA 4ZXBC 5DQ9A 4NGHL 2NY5L 4P3DB 4PUBL 4ZAKC 4JQIL 1A4JB 1HH9A 4X7TA 3BPOC 5FGBC 3BAEL 5E8PA 1BQHB 5T1DL 1QQDB 2I07A 2E7LC 1JWUA 4RGND 4LAQL 4Z7UA 4ZAKA 2AJZB 3NZHH 1F6AA 1NDMA 4U6HA 4BZ2H 5FGBA 1NAML 4JFHE 4M5ZL 5KVGL 5EBMA 1SEBA 4WGWB 1XCQB 4G7YL 3PHSA 2VISB 4M7KH 4RAVA 1OLZA 2G75B 1JCKA 2NXYB 4MJ5B 5T3XL 4KQ4H 2XY2A 5ENWA 4EI5B 3U0TA 4JRYB 2MMXA 1I9JH 3WFHB 1V7MH 2X09A 3EJJX 4WTZG 1UXWB 1MI5A 2DQTL 3ZO0A 1NGWA 2AERT 3AMLA 3IJHB 5JHDB 4K3DH 1XGPB 4ZOEA 5F89B 2VXUL 3TPUB 4I0PC 1KCUL 2O5XH 3ZE0F 5KSBE 2CJUL 5T5NF 5HVGB 5EZIH 3JSSA 5DT1H 1QLEL 3VWJB 3LHPL 3RJDA 4I0PA 2OK0L 3T0DA 1S3KL 4F7EB 3ARDB 2FSEB 4WUUE 1EGJH 1DN2A 3RHWK 2WINA 5DS8B 1IC5L 3QUMA 4HKBA 4NT6B 4L8DA 2XKUA 4OQTH 2YRPA 4M43H 2L7UA 1RFDL 1CLCA 4XNQB 1A9BA 5FGSA 3F8UB 2VDMH 1U8LA 5E8DL 3Q3GA 4XC3L 1KJ3H 1D5ZA 5IROC 3RRQA 1CGYA 4KUCF 5JZ7D 1G9ML 3KWWB 5DUPL 1T0PB 3BDBA 3RUGF 4KK8D 5IROA 3T0BA 5C07B 3PWLB 3RVTD 3SGDH 1Q9OB 3SY0A 3MJ7B 3RIFK 5F70A 5FM8A 4NIKB 1N2RA 1YEGH 1OM3L 2EDQA 3B3IA 4XNMB 3B9KC 3MV11 5IVNA 5DUML 4QCIA 3V0WH 1IAIH 3NZHL 5K9OB 3UJIH 5JXEA 3E6FA 4H20H 5ABDE 3B9KA 2UWEF 4M7KL 2UWEA 4OQ1A 1MCJA 1EIBA 1XF5B 5C0AB 4RAUB 4KQ4L 4JFEA 2ADIB 1VESA 4EIZC 1I9JL 1SM3H 3U82B 4D9LH 1GAFH 1MQ8A 1V7ML 3PWPE 2G2RB 2ITCB 2V2XA 1T1ZB 4ODUA 2IMMA 2V2WA 2MPAH 3EYOB 1YEIL 4K3DL 5HBBA 1IEHA 4ETQB 1RJZA 1Q72H 2NY3C 1OP5H 5EZIL 3LD8B 4WTXA 5DT1L 4WI5A 2I27N 2HT3C 4LFHG 1I85C 1JPGA 4LEOA 4LLAA 5MEQB 4L8BA 1EGJL 1ZHKA 3O4LB 3QNZB 3QXDA 1RMFH 4LASH 3RWIB 5F3HB 4U4BA 3HB3C 4OQTL 4OGXH 4P3WA 5FDWA 4Z95H 3HPJB 3DV4B 3LRGA 1I85A 4M43L 2P24A 3GSNA 3C6LD 3SDDA 2OTUA 4KKBD 2VDML 4FQIH 1JPST 4PLJD 3L3JA 3UPRB 3ES6A 2DS4A 1U8OA 5TQ0H 4BKLB 3DPBA 1W72H 4WTWA 1HHHA 4NQDD 1WIPA 1BGXH 1MVUB 5MEOB 2DMBA 5A2IH 1A6PA 5C0EB 1QSEE 3MCKA 3Q5TA 4N5UA 2OL3L 2H3NB 2CLRA 4TUJB 2H9GA 4TNVF 2HFTA 2BY1A 4D8PA 3UBXI 2JB5L 4OZHA 4DUVA 5KSVB 4HCRH 3GSRB 4R96A 1EEZA 4C56D 2CD0A 1OTSD 1MLBB 1VB9A 3UZQA 3CFCH 5GGRB 4PBWD 1CBVL 2Y07H 3UJIL 2FLBT 4JRXE 3K80A 2FX9H 2DB8A 3EYFB 3V52H 4H20L 1A4KB 3SKUD 5D1QB 3GRWA 4BZ1H 2EIDA 2OZ4L 4NRZA 4UBDD 1P7HL 1Q94A 4PGBB 1JWMA 5CD5C 3KJ4C 4ACPA 1A2YA 1HHIB 3D0LA 5IGXL 5TE6H 3UROR 4RGOH 5E4EB 5HYJB 1TDQA 4P2QA 2YPKB 1L0YA 1GC1H 4D9LL 1GAFL 5IB4B 2HN7A 4L8CB 1JZ6A 5DJZA 4U2ZA 1C1EH 3N85H 2MPAL 4Z7VA 3TO2A 1CFSA 4HUXB 5D1ZB 3ELAT 3U4BH 3MV01 1JV5B 4G9FD 4CN4A 5MP6H 1D5MA 3J7HA 5EU6D 5D2LF 5DEFA 4FA8A 1OP9A 5DZLA 4YIQB 4LCWD 4CVWA 3CFJB 3AC0A 4QWWD 4L4VE 5BMFH 2YD4A 1H3PH 1BQUA 3QO1B 4X6DA 1U42A 3P9LB 2A83A 4LASL 1RMFL 4FZEH 1U8KB 4NQXA 4OGXL 4Z95L 4RMUA 5H94B 3MRKA 1OGAD 1W0YT 4PJ8A 4XXCC 1FVCA 2HAZA 3RWHB 3PHQA 4FQIL 4U1KA 3FOMA 3BI9X 1ZLSH 3D1MC 5TQ0L 2J4WH 4YXKL 4XXCA 1U3YA 1D9KB 2X70A 3M1BA 4QXGL 3W11D 5A1AA 5INCB 3BW9B 2OS7A 3Q0HA 5MENA 2B4CC 4YZFE 5IB2B 3GMPA 1I1AD 3MRPB 4J12A 4KJWD 3QFJB 2P47B 4B5EA 2VC2H 1VEPA 2WLYA 3KYOB 4FQQB 2EC9U 1UEMA 4MNHA 1MFNA 2X2YA 1TFHA 3CFCL 2R29H 2FX9L 3V52L 3PNWB 1F4AA 4K9EH 5ALCL 2A0LD 1GH7A 1QBBA 5DQ9B 3V6OA 3VRJA 4HKJA 2NX5A 3C2SA 4LFHD 2D3VA 3UYOD 5E6ID 5B8CA 5TE6L 1ZLVK 1HH9B 4X7TB 1MH5A 3FONA 4GKZA 1I7TA 4EZMA 3CFBA 1EBAA 5E8PB 4ODWA 1GC1L 2B2XH 5JOPD 2R0KL 2I07B 3AMKA 1JWUB 1DFBH 3ZL4H 4Z7UB 3OWEA 4ZAKB 4FFWC 4I3GA 1F6AB 1NDMB 4U6HB 4M3KB 1IQWH 1C1EL 3PP3K 3KPOA 5DEZA 4XGZA 5EBMB 1SEBB 3HUJF 3OF6D 3HUJA 5MP6L 4TRPL 3EO9H 4RAVB 5CGTA 5CBAA 1T1XA 5ENWB 1JI2A 4X80H 3U0TB 3STZA 2WAHA 1L9MA 4P5KA 2FGWL 4BH8A 5BMFL 4YHPA 3SGJC 3GBNH 1H3PL 4UDUA 3RVWC 4F8QA 4RFNC 1L6ZA 4JFOA 3OKDA 1MI5B 1MREH 2CIIA 4FZEL 3UTQA 4BK4A 1NGWB 2P8PA 4H8WH 1IC7L 3SGJA 1A5FH 4K3GA 3V79C 4KJQD 3K1KC 4BFEA 1ZLSL 4MS8D 2J4WL 1DEDA 4M8QA 5DI8A 4I0PB 1NBYA 1VFUA 2HA1A 4XP5H 1J1PH 2WIIA 2WINB 3QUMB 4HKBB 4WHYG 4L8DB 1R3KA 3DJ9A 4PLKD 5CJ8A 2X6MA 2IADA 2B0SH 1A9BB 2VC2L 5C86A 1MFCL 4JRWA 1U8LB 4CDHA 3Q3GB 2XG5A 1CK0H 1D5ZB 1OTTD 2GJ6D 1C8PA 1JK8A 1P5UA 3V5KA 1YEEH 2VLJA 2B8OT 4LVOC 3ILPA 4TPRH 4PB9L 2LAGB 3TJEH 1ODAA 4LQ1A 5JQ6H 3SY0B 1OSZA 5DURB 2MWCA 3BEVA 1N2RB 1WV7T 5IB3A 3N1QC 2K3TA 3B3IB 4F9PA 3L6FA 2B2XL 2J6EH 2V5TA 1DFBL 3ZL4L 4QCIB 3O45A 4KKNA 2XACC 1IQWL 3KPLA 3E6FB 4PBXA 1DQTA 4RMQA 3KLSA 3B9KB 4LCUA 1J10A 2UWEB 1CQKA 3EO9L 5GIRA 4LEXL 3ETBF 4PJXE 4JFEB 2EDLA 4A2MA 3WSQH 2V2XB 4ODUB 1BECA 1WQVT 2V2WB 4ZSOE 1IC1A 3OB0K 4H8WL 4UUJA 3CXHJ 4HWBH 4PJ7A 1RJZB 3KPRD 1CICA 5CJXA 1DANT 1F42A 3N50A 3OB8A 4PJ5D 3PXJA 3C2AL 2DYPD 1JPGB 3KPPA 4LEOB 4XP5L 1S5IH 4L8BB 5L2JA 1ZHKB 1J1PL 2NY3B 5I8KH 3QXDB 4JFFA 5KVEH 4DN4H 5FDWB 2P24B 3GSNB 2B0SL 1JMZA 3SDDB 2OTUB 4Z7OE 3WDIA 4HC1A 5E99H 1TTFA 1KTDA 3L3JB 1KYOJ