3K74B

Disruption of protein dynamics by an allosteric effector antibody
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
QLQESGGGLVQPGGSLRLSCAASGFTFNNYWMYWVRRAPGKGLEWVSMINPGGIITKYAESVKGRFTISRDNAKNTLYLQMNSLTSEDTAVYYCAKDWATGLAKKGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Dihydrofolate reductase
publication title Constraining enzyme conformational change by an antibody leads to hyperbolic inhibition.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 27
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k74B00
4MQ7B 5GZNC 4PRHB 1EBPA 1FLRH 3U7WL 3P73B 3S7GA 1I9EA 4M5YH 3DETD 3B5GA 4LFHD 5JW5B 1EH9A 2AV1B 1TTGA 1FIGL 4PJAE 3BH8B 1BQLL 2XWJA 3Q1SH 3H42L 5T3ZE 3IFPA 4OFYA 4JRYD 4U1NB 3QO0A 5D7JA 1A7BA 2NY6C 5DURD 1RUPH 1JZ2A 1G7LA 3WIFA 2YPLE 4XMPH 1KULA 4G8GA 4NRZA 3EHBD 2VDKL 4MNHB 1OW0C 1HHIB 5DFWH 3EYSH 4MNGE 5I1CH 1OAQL 2XRAH 2H3NA 4QRRB 2FLBT 2I60H 5K9QI 4TPRH 4NQVA 4F7EA 2AJYL 1XGRA 3TN0A 3MNZA 2X42A 4JFOA 5D2NB 4E41E 4DGVH 3KR3H 4I8DA 4N0UB 1AE6L 1HH9B 1RI8A 4JVWA 5KG9A 5EBMA 4ELKA 3V4UL 3B3IA 4UOW0 4KI1A 6FABL 5F1SA 3SE9L 3I50L 1KT2B 5GGQL 1F58L 5BW7C 3IKCA 4PPTA 4P57B 5DWUL 1Y6NR 3MV01 4NKMA 4BFEA 2J7LA 4DEPC 1G9EA 4Z7WE 1GVIA 4WJ5A 4UDTB 5TFSL 1MJ7H 25C8L 3C8DA 4PRID 4G9FB 4U7MA 3V5HB 4M43L 5IWLA 4CNIA 3VFRB 1QKZH 1NAML 5CGYC 4NO2A 2HT4D 4LVNC 2W9EL 4RGNE 2NXZC 2YOCA 2DD8H 2EDWA 3O4LE 2AEQL 5JXEC 2JCCF 4ERSL 2GJZA 5HXMA 4MHHG 4E42B 1YY9C 5FUCE 4PG9B 4JHWH 5C0NC 1F02I 5E2VH 3GBMH 4J3UA 1C5CL 4JFXB 5FUOL 1RULH 1X5XA 4HUWB 3IS0X 4XVUD 5E4EB 1M4KA 4NBXB 4X0KA 3CFIC 3IJSB 5D7JC 5E9DB 4MDIA 1YNTA 5D9SA 3MRJB 3RVUC 3RWCB 2DI8A 1U8LA 2VAAB 3JVGA 3CPLA 2E6QA 1KB5L 1RURL 4PP2A 2ILLA 1JZ6A 2BERA 2Y6SD 5GGSY 5C1MB 4QXGH 4NFBA 2HT3D 5J3HC 4XP1L 1DUZA 3O2DA 1YY8B 1X5AA 2YC1B 3P0GB 3OKYA 2FCBA 2EIDA 5IQ9B 3DXAE 5C09D 4NQCD 4P46A 2BHUA 4MWFB 4UIKL 4EIZC 3DIFA 3NZ8B 4Z8FL 1J87A 4NYLB 2HTLD 4ODVL 1DBKH 2X89D 4CJ1A 2Z91A 1A6AB 1G7IB 3REWB 4O4YL 3UO1H 5B3NA 4I1NB 2R9HD 3HRPA 5LGKA 4GMSL 1A64A 2CIIB 2HG5A 1I1AB 4L8SB 3PGDA 4YBLB 3HAEH 4LEXL 5E8PA 1E27B 2IPUG 2WIIA 3BIAX 2HJKA 3VRJB 3QIWD 4OF7A 3QNYB 2FH6A 4U1LA 1Q9KB 2HWZL 2WQ8A 4ZXBD 3SJVD 1INDL 2NW2B 4HWBH 3KYNA 3MCG1 4LLVB 5IWLC 3LN4B 3HC0A 1KELL 1AIFB 1XH3B 4EUPG 4EUPH 1ZOXA 3BN9C 4DJMA 4HDIA 1LK3H 1G7QB 2XV6B 1RUMH 1NUGA 5CFHA 4GAGH 1CR9L 4YX2L 5EU6D 4OIIL 1TQBB 1E4WH 2J8HA 2CRYA 2EH8L 1PG7H 3MRQA 2NTSP 1TTUA 3RUGA 3QUYA 3TBSA 3IDXL 5C7XL 5IHLB 1I1CA 4GS7C 3OAYH 5L8JB 3L3DA 3HI1A 5FF6B 5E0QA 4WHTA 4KMLB 4Y2DB 2R1WA 1WBXA 2WNGA 3SO3B 1BQHB 2EE6A 4FQJL 4HBCH 5D5ME 5IMKA 2AJXL 1IQWH 4QGTA 2J88L 3KLAB 5DVLA 3BN3B 3QQ3B 4LCCA 1VDGA 3PV7A 3THML 5EA0L 1GL4B 3JXAA 1S9KC 5DHVB 3O3EB 4Z7UE 2AEPH 1FH5L 4XRCA 3VXUD 2AK4D 1CDIA 4V2CB 4WWKD 2J8UA 4P46C 4W4OA 4FMFA 2R8SH 5FK9A 3R0NA 4WGWB 3QO1B 3MA7B 3W9DA 3IKKA 4XCEB 2Q3AA 4MZ3A 1MLBA 1MHHA 2CK0H 3HNSL 2Q76A 4TUOB 2A77L 4AJ0A 2XOTA 4WFFD 1KCRH 2PYED 2EE2A 3DX7B 1LVEA 5D7IA 1ZT4A 2D03H 1X5GA 4L3EB 2ICEB 1OAUH 1SM3H 3MGTB 3X11A 4ZNEE 2PTTB 3MGOA 1A6VL 2A74B 2EO9A 2X4PB 2R0WL 5E8EB 4F57H 1JK8B 4UOJA 3W9EB 2AJSH 1AKJD 2FIKA 1LP9E 2A6KA 1WAAF 3QIBD 4QOKE 1MLCB 4LLYB 1XIWD 2A73B 1KPVB 3VGEA 4JRYA 4I0PB 4RIRB 5HYQB 4FP8H 1GHFL 4G5ZL 3T65A 5IUSA 1GC1H 2CQVA 1XF1A 1I3RB 3GMNA 3OKMB 3EFFB 3BDYL 5BS0D 3BVNB 5IEKB 1RZFL 3IAPA 2X4SA 1YN6B 1JV5A 1TVHA 4JFDE 4K94L 1KGCD 4U0RB 5HGGS 1V7NH 5C0AD 3CUPB 2CR3A 3WFBL 1S3KL 2GUOB 3GMPB 1MH5B 3L3HA 3QEQB 2EYRB 1YNLL 1T20B 1IKFH 2BSSB 2HKHH 5C08B 4FG6C 4XI5D 4RISL 1U6AL 1MNUL 1IGCH 2BCKA 5T3XD 3QDME 1LK2B 1KLGA 2IAMD 4KMTL 1EXUA 1KTRL 3WUZA 3UBXA 1ZTXL 4P4KA 4H20L 1VACB 3F7PC 5FM5O 1DBBL 1HHJB 4EXKA 1JPTL 1FNSH 2CGRL 3JV0A 3G6AB 2ERJB 3TPUB 4QCIA 1GCFA 2DLGA 4NNPL 3IDGA 5SWZD 4NQSA 1CIDA 4W4OC 4DGIH 2BVQB 2RAMA 2VDOL 3AM8A 3VFMB 4JZJC 3QRFM 4FXLA 5DK0A 5EORH 4OZIE 4Y4FB 3AGVA 1KJ3L 5CJBA 3QXDB 5EH1A 2J5LB 2DQHL 4HEME 4OI8A 3WUWA 4WW2F 1LD9B 3QDJE 4PJ8B 5H37H 3SKMA 3VXTB 1CGVA 3QZWG 4IJ3C 3LKRA 1WTLA 3CZJA 4XVSL 1U8MB 4KUCD 4L8DB 2VLRD 4QHUB 2AK1H 1AD0B 3DETC 4HWZA 4Q9RH 2YZ8A 3B43A 1MCPH 3VA6A 4O51A 3M1BA 1Q9OA 1EGJL 4YUEL 4LGRB 2IMMA 3CMOL 3RI5F 2XWBB 5FKPB 1QNZH 3ULUD 3FT2A 1INEL 5T3ZL 5GS3A 5GJTH 5KAQF 1T4KA 3O45A 3G5XB 5CIPH 1R5IA 1KCSH 2H26B 2EXYD 2DF3A 3DI3B 3U36A 1XR8B 2BNRB 1CZ8L 1J1OH 4WUKL 1UCBH 4NC2B 4M8QA 4ORZC 4V1DB 5FOBB 1I7TA 5EO1B 1A3RL 4MCYB 5C09A 2HYMA 4NQCA 2JF1A 2DQFB 1NGZA 3S5LA 2B1HH 4JCLA 2YD5A 4LIQE 4UILH 4WI7A 4WFED 2ATKA 5JHLH 3MC0A 1NGXB 2P24B 2EDOA 3BOVA 2X89A 1M71A 4XH2A 5IMLA 3VMOA 1WWCA 4Z7QE 2OZ4A 4AQ1B 4LLAA 3TBTA 3N85L 1KIQA 5DA4A 4JPIB 5I19H 1NANI 2ADIB 3O41B 3CFKA 3WS6A 2B1AH 2FZ3B 3FT4B 1VKXB 3KYKH 1C5BL 4I18B 4KKNA 3QIWA 4UTAH 4MQSB 2A83B 4R9HA 4ZXBA 3SJVA 5K59F 1V7MH 4POUB 3CFEB 3HLAB 3VGFA 3S36X 1JN6B 5I71B 1IJ9A 3VE0B 2VTFA 1CI5A 1K6QH 2PO6B 2H32H 4Q97A 1A7NH 5HYJD 3K1DA 3BWAB 5D1XB 5B8CA 1UKSA 1HIMH 2CKBB 1IFHL 3H0TA 3PGCB 3QCVL 4TNWK 5EU6A 5EOTA 4ZNCD 4N0YH 1J86A 4H5SA 4OD3H 3VFVA 1RAMA 1UWGH 3C6SA 1I7ZA 1ZVSB 5E6ZA 3SQOH 1A0QH 2OBGA 1NUFA 1S9VA 5EIIA 1ORSA 3GMLB 5JNYB 5FO9B 3T8XA 4WO4B 2UWEF 4PJGB 2DIAA 2DM4A 1G6RA 5C07B 5BRZB 3BZFA 4XVUC 1AHWA 4CVZB 1PYWB 2FX9H 2YUVA 2P5EA 1G7HB 4HV8A 4NQDD 2DQUH 4U1HB 4X98A 3ZSTA 1OTTD 1IEAB 4NC0B 5ILTL 4YGVB 4AIZB 1ZSDA 4OCSH 3QQ4A 3PJSB 1BWMA 3BE1L 1LEGA 4XPBH 4XPGL 4GXUM 2X2YA 1YEHL 1XF3A 2NXYD 2Y6SC 1KFAL 1RK1B 2G5BB 4NZRL 4PRHE 1A1NA 4YHZL 2MPAL 3ZTJH 2HT3C 3VXUA 2GSIB 1NC4D 2AK4A 4YXHH 1BIHA 2MOVA 1OAKL 4HD9A 1PQZB 2WBWB 3U7YL 5EOQL 2A0LD 5ICXA 1BJ8A 1EV2E 3ARQA 3OKDA 1A5FL 1FYTD 5DRNA 1YEJH 3SQBA 4PTTB 4P3CL 4HPOL 5EU7E 3V6BR 4M1DH 1UXWB 2HTLC 4R3SA 1ITCA 3DURA 3I85A 1P1ZA 3ARFB 2PYEA 1FCGA 2R9HC 4LVOB 4M03A 1G7MA 1DQQB 5IVXF 4M6AA 3V6ZB 3ZZ1A 4LARL 1N2RB 2CDFB 3IRPX 3UDWA 3I75A 4ZUSA 2DWEB 3T0EB 3U4EB 3WS6C 5HVHB 1BQUA 3KJ4C 3QIWC 3EO0B 4QRRE 4JQXA 3RL1A 5TDNA 4ELMF 1MAML 2ZSVB 2EDQA 3T2PA 5KZCB 3L6FA 3BSZH 4MX7A 1G7PA 4G80A 1XIWA 4NRYB 2ZUTA 3BP5A 3GJFB 4NRXB 3TPKA 1J0IA 3SKOB 5FCSH 5B8CC 2F58L 1B3JA 3CSBA 1TLKA 3CLEH 5GS2D 5C3TA 4XBPA 4D9RD 3MJ7A 4TVPE 2I24N 4MGXA 1YYMH 2XTJD 5BS0A 2W0KA 4H25A 1SEBA 4AZ8A 4KAQL 1Y18A 1KN4L 5I1JL 5EUKB 2AJUL 3LMJH 4G42B 1HHGB 4G9FE 3RY5A 1PSKL 5C0AA 4PJBA 1AHWC 3JTSA 5EPMA 3GKWH 1VFOA 4GAJL 5EDXA 1X5JA 1A6TA 1LO5A 1AGEB 2Q20A 4JB9L 3RWHB 1TJIH 3EYUH 4H0GA 2XN9A 3V5KA 2R15A 5HGAB 3N1QC 2VXQH 2IAMA 1W72H 2EICA 3MROB 2O93L 2RHEA 4LLDA 3D69B 3LQAL 35C8L 1HSAA 4GLRH 2QTEA 1K5NB 5DQ9A 5DJ0A 4WWKC 2E6PA 4RRPA 5BV7L 5SWZA 4HHAA 4KRMB 2I26N 3ROLA 4X7TA 3QPXH 3HNVL 2O5YH 3T4YA 5C2BL 4JQIL 3O4OB 5F7HA 1U8KA 2NY6B 1AJ7H 1S7UB 1F2XK 1EZVY 3G5VA 1D6VL 4DGYL 3KPNA 3NFSL 1R3IH 1VGEH 1KB9K 1RHFA 3IXTB 3UDWC 1FNGB 1BZ7B 1DE4B 2VQ1B 4WW1A 5GRVL 1HK6A 2VLRA 2BY2A 2YD4A 1GZQA 5MEPB 1SY6H 1T7VA 5JIIA 4JQXC 3Q48A 3PNWB 3SKJL 2EDRA 3K2UH 1J10A 1I8LC 4YPGA 3FZUD 4F9LA 5CD3B 3GUTB 4XXDB 1MCOH 4CU8A 3QIBC 3QUXD 4P2OD 1DLHA 4YFLF 1XIWC 4U1SA 3Q6GH 3TWCL 5IHBA 4ZS6C 2VDLL 5HYIA 1MFNA 4Q0XH 3LPFA 4HJJL 2Y07L 4QYOA 1I8IA 1BIIB 2Z92B 4OAWB 4MD4B 2UYLA 1NBQA 1ZHNA 3HG1A 5TQ2L 4YLQT 4DEPB 4NO0D 1H15A 3LVEA 2CDGA 3MRBA 4PGCA 4MJIE 2R2EB 4LCYA 4RA3A 1KNOB 2FWOA 3T2NL 5JA9A 5E99L 4DUVA 1BOYA 3IFLL 4NIKB 2MKWA 1CGSH 5F8RC 2XKNA 4BKLA 1YPZA 1VESA 3BJ91 4LVNB 1OSPH 3VXRB 5DRZB 4C59B 4H8WH 2MQ3A 2NXZB 4XI5C 3QUMB 3TT3L 3MNWB 3SGEH 1X6NA 4G6JL 1HH6B 4DTGL 1I9RH 3RAJH 4PD4J 3B8YA 1U92B 2X4OA 3ES6A 4NBZB 3UTSE 1IC5L 2Q8BL 3GZKA 4KUZL 2QQNH 1Q94A 3MRIA 4LPTA 4D2NA 4NCDA 1I85C 1HKLL 5DC9B 4PJXF 3PQYE 2IMNA 1FRGH 5D7JB 1F4XL 3E3QE 3QO0B 1EHNA 5AYQA 4OKDA 1HCVA 4PGEB 2P5WB 2EC8A 1G7LB 3WIFB 5F7FA 2BJML 5HYJA 4N68A 4G8GB 2O5XL 3EIFA 1S7TA 2BRQA 3F5WA 5HHNA 2VZOA 3HC4H 1AGFA 3BDXA 3U2SA 5B39A 4JJ5A 4W70A 1TCMA 1FE8L 4J23A 1HE7A 3GSNL 1DZBA 2H3NB 4NQVB 2VUOA 1L7TH 4FHBD 2KPNA 1XGRB 4PRDA 2QQKL 4JFOB 3HMXA 2JB5L 5F9WC 3AS0A 5KG9B 1C8PA 5EBMB 5HHQA 4PR5A 5AZEL 4F33A 4PUBL 3B3IB 4QHMB 3TESA 1IT9L 3WXVH 4ETYA 4QNPE 3ULUC 3ULSA 1FP5A 2OL3L 2HAZA 1FFPA 4K8RL 4WEBL 4Z5RA 4HKBA 2IPUK 4D9QE 4L3EE 4L8BA 5BJTA 3GHBL 2EXYC 1FN4A 4HWUA 2DTML 2VDML 1K3ZA 2BVEA 1CL7L 3D48R 1NC4A 4S1SL 2DLHA 4EDXA 3PG2A 1JZ3A 2CLVA 4WEMB 3LKOB 3B4NA 3C5ZD 1OP9A 4NO2B 1FYTA 1GJIA 3QUKA 5FHAH 4YE4H 1AR1D 1E4JA 1F42A 4A6YA 2SEBB 4CRPA 3HN3A 5LKNA 2EKJA 3MO1B 4UB0H 3OAYK 1B2WL 1NCAL 3MV9D 3ESUF 3ARRA 1D5ZA 2FBJL 3TEUA 3FN0H 1QG3A 3MACL 2VR4A 4GS7B 1EAPA 4C56A 1XZ0A 1OTSC 5DD6A 1MCDA 3G08A 1I9IL 1Z9LA 5LCVH 4ODTH 1EDQA 3T1WA 1E6JH 2ZPKH 4GKOA 3QEQE 2R29L 2HH0L 4MDIB 4HS6B 4K3EL 1YNTB 1UEMA 4GG8B 1KBGL 3FB6B 4OLWL 5D9SB 2H9GA 3L3KA 4WHDA 1JNJA 2ZCLH 4PJEA 1F6LL 3WFHA 5C08E 1U8LB 3CPLB 2NY7L 3PWJA 5EOCL 4RZCA 5C86A 5FIEA 4PP2B 3RTQD 1PY9A 4JO2L 1BM3H 4NCC2 3ZE0F 5C9KA 3S34L 4ONFL 3NVQA 1MCIA 5JPNA 2ZCHH 3OZ9L 1QYGH 4M3JA 4P46B 4NJ9L 3PUCA 5F93C 2NLJA 2YD8A 5T5NF 3O3DA 1ZKAA 3RWFA 3T2OA 4Z7NF 3HAEA 3VRLE 5J6GB 3E6HA 2VIRB 1HILA 2V2TA 2VXSL 2Z91B 5DUML 5AAWA 3KVQA 5CJ8A 2P48B 5DMIL 1OTTC 4HWBA 1RUQL 3JV6A 2KDGA 2HG5B 3WO3B 4QWWD 3PGDB 2BNQD 3D25A 4LBEA 5E8PB 2NXYC 1UA6H 2WIIB 1KPUA 2HJKB 1L9NA 2NY4D 3TA3A 3ZYJA 4U1LB 4C83A 4P5KA 4YHPA 4JAMA 3OJ2C 3HC0B 5DUPL 3K81A 4DN4L 2YWZA 2N1KA 4HUMB 2D0HA 3C5SA 5ICZB 3W11D 3BFOA 4FABH 4PG2C 4FRWA 3ZHLA 1YN7A 5E24E 4Z7OE 3EYVB 3K7UA 3ZT6A 4FFYL 4FQ2H 4OSUH 3RUGB 5DJXB 3TBSB 3WFCL 1FIEA 2BNRE 2C4FU 3CVHA 5EU3B 4PJIB 3HI1B 1TZGL 4V1DE 3U1SH 1B9ZA 4WHTB 4J1UA 2R1WB 2IAND 1XMWA 4K23H 4AEEA 3EFDL 3DRTB 5TE7H 2HJFA 5KAQG 1ADQL 3OKKA 5FYKH 5HI4D 3BISA 2ZUSA 5IMKB 4P2QA 4LSUH 3QUXA 4P2OA 4ZPVA 4Z18A 1FNLA 1LEKA 1A3LL 2EEAA 3MLYL 4JDZB 3WFDL 4MCZA 3MOBL 4MXVE 4PJHB 3QQ9D 2ICCA 2XZAL 3KNBA 1BEYL 4X6CF 3DARA 1OL0A 1C1EH 2YN3A 4UT9H 1U3HD 2DQGH 4HIHA 5HD8D 2XTJC 3KPLA 5FUZH 1CU4L 5DJDB 4XPTL 2J8UB 4TVPL 5FK9B 1CL7I 5HHVL 3W9DB 4JZJB 4YXLH 1MLBB 3RL2A 4R26H 1I3GL 1MHHB 2W38A 3QWRD 1EHXA 5KSBB 3I3BA 3WHXA 1P4BH 1QFUL 1GGCL 3MGAA 5D7IB 4L3AA 1SVZA 4AY0A 1F4YH 2D7TH 1U8QA 3MGOB 4C55A 4N8VB 5JUEL 3WD5L 2BC4A 3K0WA 2FIKB 4LSVL 4X7EC 1A22B 2DN7A 3BQUA 4X80H 5DUBB 5HYSG 4LF3A 4EIGB 2W9DH 4JRYB 5K9JL 5EIVA 1FFNB 5EO0B 3RKPA 2EC9T 5DVOA 2E27H 5ALBL 5DURB 5FGBC 5FYLE 5DRXA 1UWXH 5DDHA 5JR1H 3OB0H 2A6JA 1FSKC 2VSCA 3GMNB 4X4XA 5CCKH 2VLJA 5TPWH 1J0KA 2QSVA 3SCMD 4TRPL 2X4SB 1JV5B 5A43C 1TVHB 3SDYH 2ARJB 3GSUA 1MREH 1W8NA 2ZUWA 5HTSA 4UI2A 1CBVL 3L3HB 3RWIA 3PGFH 3NABL 3FZUC 5CZVH 1UXSA 4HJ0D 1A7QL 3WXWL 1NFDF 3LV3A 3QUXC 3I6GA 3P2TA 4CN4A 3MRPA 4AG4L 3GI8L 1N64L 4CN1A 4HXAH 4OZGA 5ESQA 5C3LD 3P4NA 3H3PL 1KLGB 4MD5B 1EXUB 3MQIA 3UBXB 1S9YA 2ICWJ 1LDPH 5ERWA 1IGML 4TULL 4BZ2H 4QCIB 3T0EE 2QSCL 3KYOA 3IDGB 4UTBH 1EEYA 4NQSB 3CLFH 4ZO7A 4X9FA 4PYGA 3QWOA 3QIUD 1YEGL 4PRIB 4BSVB 3JV5A 1IEBA 1OGAD 2Z31D 2C3VB 3C5ZA 4M7KL 5KOMC 3WUWB 2PYFA 2G9HB 2P8LA 4PD4K 3SKMB 3TCXA 4HQQH 1N7MH 2I25N 3LKRB 3V7AG 5A2IH 3QHFL 1X4YA 4KRLB 4YHKH 5IG7A 3HI5H 3E2HC 4HC1H 1GGBL 2JIXD 3F58L 4XZUA 4ODWA 4HWZB 4GSDL 1YQ2A 2Q6WA 4MXQD 1HI6A 1GC1C 1Q9OB 5FHBH 1TETL 4XCFH 4DAGH 4MA8L 3O9WD 4M5ZL 2FO4A 4GXUN 3PWUA 3HR6A 1XCQB 3CSYA 3RWGA 4POZD 3NAAL 1NLDH 3P0YL 3QYCA 3FT2B 3QEGH 1NCNA 4G3YH 3CCHA 4LL9A 3MJ9H 4LP4A 4OFPA 3U9PL 1T4KB 3O45B 4IOSD 2XIDA 1TJGL 4G9DA 3VMPA 3RTQA 3U36B 3FTGA 3IJYB 4OLVH 3DV6A 4OD1L 1RD6A 4J3WA 2FJFA 5SV4A 2EEBA 3C08H 4M8QB 1G9NL 2FB4L 1I7TB 4Y1AD 3GMQB 3HNTH 3DRQA 4HKXA 3ZDXF 5C09B 4NQCB 1RY7B 3UTQB 5AD0B 1NGZB 3S5LB 4L9LA 2ATKB 5DT1L 1FNAA 5GS0D 2O61A 5IMLB 4XC3L 3MCKA 4HXBH 4X9BA 3TBTB 3M07A 4KH2A 4WHYH 5A2KH 1KIQB 1M05A 4Z7VE 1F13A 3NCJH 2BNQA 3SE8L 3UX9B 1IGYA 1FO0B 3KJ4B 3QIWB 2BRRH 1TTFA 1RFDH 4ZXBB 3SJVB 4B7IA 5F9OH 3RIAK 2D7PA 1FHGA 5AZ2H 1DCLA 1P6FA 5I1IL 3STLA 3C5ZC 1G9MH 4CAGA 2X41A 2Y72A 3P9WB 2X4RA 1TDQA 5ALCH 3S36L 4JPVH 3HPLA 5B8CB 4X6DA 4F7CA 5GGSB 2OYPA 5LGJB 3DHMA 5JW4M 2FATH 3H0TB 3WNOA 1MHPH 3TYGH 3MLVL 4BFIB 4P2RE 4H5SB 5LGHL 1DEEA 1ZA6A 3C6SB 2YXMA 1I7ZB 4BSJA 1S9VB 5EIIB 1ORSB 5LWYL 5FO8A 1OAYH 1ZLUH 3CFJA 1L6ZA 3T8XB 5F88A 5FGSA 2B39A 4KI5F 1WEJL 1G6RB 3STZB 3BZFB 4MSWA 4XNYH 1AHWB 2NY5L 3MUGA 3U0WL 5GGUA 4OT1L 2XQBL 2FO1A 2F5BL 4HV8B 4OLYL 4JG0H 1MCBA 3QFDA 3VXRE 4OUOA 2X5PA 3QHTC 4X98B 3H8NA 1A7PH 1NCWL 4GT7A 2MWCA 1ZSDB 3QQ4B 1QFWL 2E7MA 2EYSA 1SYSA 5BOPA 4HH9A 4ODUA 3RTQC 5B38G 5KN5A 2YPKA 2NY1D 4D8PA 1U3HA 4O2EA 3VXUB 2AK4B 2A9MH 4HKJA 4I9WE 5ICXB 4WWKB 1MCKA 3TV3H 5DRNB 1J5OH 3LKSA 1CF8L 1RVFH 1YEEL 2KUTA 4H26A 4HFUH 5LQBH 4L9LC 3RVWD 3WIHA 4R3SB 4MB3A 4U1MA 2VWEE 4KJPD 3DURB 3QWRA 2DQDL 4K55A 1W0WA 3RWJA 4ZTPL 3RQ3A 5EN2A 2EDDA 4G8GE 3P0VH 1G7MB 1MJJB 4YEEA 3LEYH 4QWWC 5E8NB 3I75B 3ZT7A 3FAWA 1PW3A 3ARGD 4PS4H 1Q72L 3LZFH 4PLKC 4BSWA 2NY4C 4UINH 5TDNB 1AKJB 4R97C 5IR1A 4XCYA 1NUDA 3L6FB 4NNXA 3QIBB 4MX7B 1G7PB 1QBLL 4G80B 1XIWB 3BP5B 3W11C 1JNNH 3TT1H 2E9BA 1RJZA 1BD2D 3IDUA 5CKAA 3TO4D 3QWQB 5DJAB 4XBPB 5KOVC 5C0RL 3V4PH 3O3BB 3MJ7B 15C8L 5IV2A 3L7EB 1XR9A 1JFQL 2AQ1A 2XY1A 5BS0B 4H25B 1SEBB 3SCMA 4YHIB 1Y18B 5DS8B 5HJ3A 4DUWA 5DK3A 5C0AB 4K9EH 5I8KL 3SGKA 4YDKH 1Y6KR 3VWKC 4CKVX 4OCYL 4HFWA 5K9QG 4PJAF 5HI4C 12E8H 3CC5A 1A6TB 1LO5B 3DV4B 1RZGA 2QSQA 5EC1A 3N1PC 2Y36L 3TYFA 4LAJH 3L7FA 1MEXL 3V5KB 3QQ9C 1CLCA 4JFHE 2JCCA 3K3QA 1MVFA 3CMGA 4PLOB 2MCPL 4RGOH 3IYLW 1U3HC 1G84A 4RMQA 4LLDB 5HD8C 4OM1H 4OCXH 4MXWL 4RSVA 5DJ2A 5DQ9B 5DJ0B 5DD1L 2IFGA 1WFNA 5SWZB 4KC3B 3ROLB 4X7TB 3DGGA 3QIUA 3QT2A 3T4YB 2OI9C 1U8KB 1OGAA 1JTPA 3D0LA 2Z31A 3LHPH 2C4XA 1AC6A 4AEHL 4R4BA 3IDJB 3KPNB 3T2QA 3JSSA 3V7MA 5JIKA 1VB9A 1A6WL 3WN5C 5FYKD 1ZWIA 2C26A 1WZ1H 2ENYA 1A8JH 1AQKL 1J05A 3BUYA 2WBKA 4U1IA 2VLRB 3UJJL 1CD1A 2CKBL 1GZQB 5IT2L 2JIXA 3FB7A 3TJEL 2XFXA 4YPGB 1WISA 3B5TA 3O6LH 5F9WB 1FFOA 5AEAA 1UH4A 1SBSH 3R1GL 1YMMA 2O5ZH 3W2DL 1DLHB 1MRFL 3G6DL 4NWUL 4QO1A 4U1SB 3BGAA 2CO6B 4XTRD 4NJAH 4R2GD 4X4MA 3ILQD 3W82A 5MEOA 4O58H 5EZJA 3NCYS 4HIXH 4QYOB 1I8IB 1N6UA 4LASH 5FB8A 1FL5B 5DO2D 2UYLB 3MOQA 3NMEA 3B9EA 3GGWA 1ZHNB 4P9HH 1S7QA 5FYLL 1QFWI 2J1KA 5T5NG 2W0PA 1JRHI 5F3HA 1KACB 4JFQB 3SCMC 5IGXH 4PGCB 5KW9L 1IGIH 1N0XL 2FWOB 2UVFA 1MWAA 1F3JA 2VL4A 4OFIA 4Y1AA 2CJUL 4YZFE 5ITFB 5FCUL 3SGKC 3TO2A 2XKNB 4HJ0C 4BKLB 1YPZB 4N5UA 1XGPA 2V5YA 1HEZA 4MJ6A 5IJVA 4XPHH 3HI6H 5KVGL 2M26A 3FL7A 1OD7A 5F7UA 4LKCA 2V5TA 3UAJD 4NM8L 3V79C 2GI7A 3ZHKA 3RUGE 1K9TA 2PETA 2X4OB 1IL1A 3ES6B 1JHKH 4LEOB 2YSSA 1RIUH 3MRIB 4YHLL 5E6ID 4U1KA 4G7YH 1S7SB 3FFCD 3LS5L 1CFQA 4L4TA 1P84J 3QIUC 1Z3GL 1O7VA 2NMSA 1RK0A 4DZBA 2Z31C 1QFWM 2X9YA 3GM0A 4KROD 2BVTA 3SN6N 2B8OT 1ED3A 1R3KA 5DQDL 3VFUA 4PTUA 3K74B 4F58L 3AAZB 2WW8A 1CS6A 4CVUA 3FB5A 1IRAY 5CHNB 1S7TB 5HHNB 2COQA 5B39B 4JJ5B 1J11A 1H5BC 3MFGB 4ZOBA 4YHML 4GAYA 2J8UE 4PRDB 2ADFL 4NKOA 2R4RH 1DQMH 4GW5A 4S1RH 1A14H 5ANMA 3O9WC 4PR5B 1OAQH 4IMKA 2BVOA 1QO3A 4POZC 2AW2A 1PLGH 5CILL 4JKMA 4NQDB 1HZHL 4C57C 2AJYH 1QSZA 1U95A 5F96L 1FFPB 3D85D 1R3LB 1K4DA 4HKBB 3HE7D 4NNYA 5D7IE 1KUMA 5C70A 1AE6H 5MEND 3FN9A 2M8XA 3GNMH 4HKZA 3DX6A 5T1MA 1FN4B 3V4UH 2NXYB 3R8BB 4IMLB 3I50H 4LNVA 3VD5A 1NC4B 5GGQH 5BO1L 4YDIH 4EDXB 1F58H 1J8KA 5DWUH 1FPTL 1I8MB 1PJ9A 4QXWA 1FYTB 3QUKB 1WAAA 1ZVHA 1JPST 4JRYE 1G1YA 1Z9MA 4A6YB 5TFSH 5D5MF 4G6KL 25C8H 3C2SA 5GS0C 2D7QA 4M43H 1X5ZA 4JR9L 5C8JA 3BMVA 3NIDE 3RI5K 2OR7A 3WHE1 4RFNC 4C54A 5JW3H 1PVHA 4TNVF 1D5ZB 3ARGA 2V2XB 2AEQH 2V7HA 1UB5B 4Z7UF 4ERSH 1XZ0B 4FQPA 3G08B 5CUSL 2C3HA 3B2VL 2DM7A 1GRWA 5C6TH 1QA9A 5IVZA 4NN5C 1C5CH 2H9GB 3L3KB 1J1XL 4XVTH 4PJEB 3TBWA 1EERB 3WFHB 2VLMD 1OAZL 5I1KH 4TSAL 1LO3L 5FUOH 3PWJB 1OT1A 1BD2A 5I76B 4R6UA 5SX5H 3LY6A 3OB8A 3TO4A 4MYWB 4R90L 2XTJB 3LCYA 4KHTH 2YMXH 1VGKA 5JPNB 3ZE2F 3CGTA 1CLOL 4WI9A 4R7DA 4PP1C 4RFEA 4WFGD 4NCC1 2NLJB 5ETUA 5A16A 1LP9F 3O3DB 3BI9X 4POYA 3G5ZA 3HAEB 4IMKC 3E6HB 4XP1H 4UUJA 1HILB 5I1AA 3B9AA 1CGTA 1PG7W 3E0GA 5BZDA 1SEQH 4PRPD 2V2TB 3ALWA 1YEDA 3CIQA 2P8PA 3JV6B 3PL6C 4UIKH 3KDMA 2IQAA 3D25B 1YQVL 4LBEB 4ODVH 4B41A 5LVEA 3QUML 1KPUB 1X3DA 1XGYL 1XF4A 4KK6D 1DEDA 4O4YH 4P5KB 4XPAH 4GMSH 5ADPL 3R8QA 2R1YA 1DQTA 1T0MA 1X4ZA 2A2QT 2OP4H 3LQZA 4LEXH 4L8CA 1UWXK 5H2BB 1SMOA 2YEZA 3C5SB 2NX5D 4JCMA 3OB0K 2R2BA 3UXFA 3RVVD 1G0YR 3RVWC 1INDH 1YN7B 2ZG3A 3EYOB 2DYPD 3SDAC 4KJPC 3ZTNL 2BOCA 4KQ3H 2QJDA 1NFIB 1FSKB 2UV3A 2AQ2A 4FQIL 4I3SH 4XNUL 3ARGC 3E6FA 3VXNA 4OF0A 1QBMH 4WTZG 1CR9H 2E8ZA 2JJSA 1R3HB 4YX2H 2B5IB 1VHPA 4OIIH 3BRDA 4JKPH 4CW1B 1V5JA 3CDGA 4NPYB 2EH8H 2C1OA 1OM3L 2HJFB 5C09E 4NQCE 4PY7A 3RY6A 1AGBB 5C7XH 3QUXB 3MRHB 1LEKB 2XZQL 1JJUA 3S88L 5E8DH 3GMOA 4MCZB 1WBYB 4CGTA 3KNBB 3PHSA 3QB7C 4FQJH 1RJYA 3EBAA 3TO4C 3TZVC 4HZAA 2AJXH 3D6GA 4HIHB 3FRPG 4PV9A 2DWDB 5E5RB 3KPLB 3VFOA 4KJYA 1X44A 4NO0B 3MRCB 4L4VD 4FXGB 5C0FA 4U1JB 3SJVE 5TF1L 2CRIA 5EA0H 4MAYD 3RL2B 4PFEA 1FH5H 1Q9LB 4LLWA 3GRWL 4OUUA 1X7QA 4Y4KD 4MQTB 4XMKL 2HN7B 3WHXB 1J1PL 5GRJL 4WW2C 2M2DA 1CE1L 1CN4A 2PW1A 2R4SH 3VGGA 5EU6E 5EZIL 1AXSA 3HNSH 4IEFB 1U8QB 3D1MC 3ZSSA 3VFNA 3E2HB 4AMKL 1YJDH 1ZMYA 3E8UL 2R1XA 4KKBD 2BC4B 5I75C 4P23D 1NANH 4LLQA 4LMQE 5J9PB 4KTEL 4XP5L 5E6IA 2X6MA 2UWEA 2P5EE 4LF3B 5HYEA 1ZLVH 4HGWB 1A6VH 5DGRA 2R0WH 1JPFB 2I07A 4NKIL 1QEWA 4JREC 1PZUB 4A2LA 1MFAL 2W92A 4Z7QF 2MFNA 5TDOA 1JNHB 4HIEA 1TCRA 1IAIL 1ACYL 2JJSC 3GSUB 1H3UA 3VXUE 1U8IA 2AK4E 2NPLX 4WRLA 4UNVA 5J1AB 3RWIB 1WFUA 1WFTA 1UXSB 4D3CH 1RZFH 3DYPA 3HA0A 1IM9D 5HI3D 3O2DL 3I6GB 1WT5A 3MRPB 1T7WA 4P3DB 3AU1B 2YUZA 5LJYH 3WNKA 4XTRC 4H0HB 4ZQKA 4R2GC 3X3GL 3ILQC 3P4NB 1A7OL 4WFFE 3VH8G 1LE5A 2PYEE 5IK3A 1JGUL 3D85A 3VGAB 2BZDA 1PDKA 3ALPA 3HE7A 3OQ3B 2HP4A 5DO2C 4JN1L 5CJ5A 5ERWB 5MENA 2GJJA 5FYJL 3T0WA 5IVXA 3MLTA 1U6AH 4ZOEA 5FA3A 2HMID 1MNUH 3LS4L 3KYOB 1NC2D 3MREA 2IPTL 3RU8L 3RWEA 5BMFL 1ZTXH 1UM6L 3QWOB 4R4ND 1FFQA 1R0AL 1ZXQA 1IEBB 3A6BL 1DBBH 1G0DA 3QZWB 5JW4N 2CGRH 5CJOL 3C5ZB 4KJQD 1PD6A 4M1CD 1PG7X 1CDYA 4NNPH 3X3FL 3VXPB 2P8LB 5HPMA 3VFWA 3BKYL 1IQDA 4LU5L 2YA2A 3ARDD 3UAJC 1R24A 4RFOH 3I2CL 1ZLUK 4KVNL 3T77A 4KGJA 3MV9B 5BS0E 1P84K 4LSQH 3ULVD 4XZUB 2X1XR 3JWNC 1JWUA 3MJ9A 1KGCE 2G5RA 1DUYA 1HI6B 5E6IC 1BX2A 5C0AE 4PJBE 4XVSH 3RIFF 1A6ZA 1FGVL 3K4DA 2FR4A 3PWUB 3RWGB 3CSYB 2X44D 2NW3B 1H3PL 4HLJA 1U93A 3WL9A 2HLAA 4KROC 3VXMD 3GSWA 4X83A 3DUSA 3R06B 2XN9E 1QSED 4ZUUB 3JZ7A 3BXNA 2DICA 4YUEH 5T3XE 4G9DB 3RTQB 2IADA 3O6MH 2WV3A 3DV6B 4S0SD 4KXZH 4Q74A 3G6JA 4Q7DA 1Z9OA 4Z0XB 1T0NA 3MV8D 3DRQB 5SWZE 2Z93A 1N4XH 5IBTL 1FBIL 2D9QB 1DBJL 1N5AA 4L9LB 2X7LB 4O9HH 4PJDF 4WU7B 1WT5C 3T1FA 2GEEA 1A1MB 3U4BH 3FRUA 5AG8A 4PRPA 1BJMA 3MLSL 5L8LB 4WI5A 1UVQB 3T3PE 4KDWA 4PJ7B 1IEHA 2Q7YB 1BVLA 1YMHB 3HE7C 1M05B 5TE6H 2RCSH 3V0WH 2BNQB 1T3FA 1KEGL 5DJZB 1IGYB 2VLRE 2H32B 2NY4B 4PB0H 3D2UD 3GO1H 4OZFG 1OAXH 5D1QD 2A9NL 5E70A 3N85H 4R97B 1TPXC 3FHAA 2XY2A 3STLB 5T1LD 4IDJL 3FAXA 4PRAA 2NX5A 1C5BH 1UYWL 3QG7L 4JG1L 1AO7D 3FMGL 3DROA 2GK2A 3H9SD 3NCBB 5I18H 2OTWA 4X6DB 3ULUE 3KLHC 4F7CB 2DYPA 1XFPA 1FVEA 5EBWA 5F6HI 2AABL 5SV3A 3HG1E 4OTXH 1ZA6B 4ZTOH 2D0GA 1WWBX 2DQIL 1UWEL 4FQHA 1Z2KA 1IAII 4HIJA 1QR4A 1IFHH 3CFJB 3QDGD 4GG6A 5F88B 2GT9A 2IANB 3L5JA 4HUKB 1ES0B 5KS9F 3MUGB 5A2JH 3L3OA 5GGUB 1KN2H 5IIEA 1YPZE 1ZV5A 4IOIA 5F89B 3QFDB 5HDBE 4M7LH 3LIZH 1KCUL 4WFEE 4KMQA 5LAXA 3X14A 5C0EB 3GJEA 4UAOC 1SYSB 4HH9B 4ODUB 1E4KA 5BCAA 5JXAL 5L0QC 4DVRL 3HZVA 1V05A 5KN5B 2JK5B 3QCUL 4X8JB 4CMMB 3OWEA 4D8PB 1U3HB 1I4FB 1AXTH 3MPCA 1CWVA 5DVNA 5ILTH 4ORGA 4HKJB 3BE1H 2EO1A 2XKUA 1ORQB 4L4VA 4BZ1H 3LKSB 1KFAH 4H26B 4MAYA 2OI9B 4PJXA 1CTOA 3H2WA 1AP2A 4Y4KA 3HPJB 1OAKH 3U7YH 5EOQH 1W0WB 4KVCH 3RWJB 2DJ4A 2L7JA 1U91A 1IAIM 2F54D 5EN2B 3IETA 2BSED 4APQD 5HYJE 4P3CH 4HPOH 3WN5B 1BVZA 3QXUA 4OGYH 1G9MC 1MJUL 5HHOD 5KSUA 4LHUG 1N5YH 4MQ7A 4BSWB 2OJZH 4KK6C 3P73A 3CFCL 4QRSA 5B21A 3QHZH 4XCYB 4LSSL 3CDYA 1L0XA 1TNMA 4LARH 4NZTL 4OCWH 3VDCA 3BH8A 1FYHB 1S9WA 1WUNT 4G8EB 5GRUL 4ZO8A 3SOBL 2YD2A 1JF1B 3U30C 3RVVC 1DANT 3CD4A 4JHBA 1C5DA 1IGFH 3FCTA 3S35X 5IMMA 4ISVA 2YD3A 5IV2B 1LO2L 1XR9B 3PDOA 5L7XL 1FV1B 4MNHA 1HHIA 3SCMB 2F58H 3EYQD 5C0IB 3SKUD 4X5XA 1IBGH 2QQLL 3BIKA 3IGAA 2FBOJ 1FYTE 2X9XA 5D2NA 3ZKND 4N0UA 4DK3A 3MLZL 1IM9A 1RZGB 1HH9A 4KAQH 5E56A 4TNWF 4JQVC 1T7XA 1KN4H 3HB3C 3WFEH 3LD8C 5HHPB 3L7FB 3KPRD 1NCBH 1E4KC 2JCCB 3SBWC 4GAJH 5KBNC 1H8NA 1T03L 3TC9A 4NC1C 4AEFA 5C0BD 1F6AB 5DJ2B 3ARVA 4WNQA 4C56E 2ORBH 1NC2A 4JHAL 5CKGA 2WSKA 3QIUB 1UJTA 4MAYC 1FO0L 1OGAB 2Z31B 3LQAH 4PREB 1T1WA 4S11A 2VISB 4O2FA 4Y4KC 4PJEE 3RA7L 2B20A 2D7OA 5C6PB 4OQ1A 2DQJH 4R4BB 1ZVYA 1A4KA 2EDEA 4MAUL 2ITDA 5BV7H 1AI1L 2D4FA 1F6FB 3EOTH 3QFJD 4QNPF 3ARPA 4RMUA 3HFMH 3ARBD 5IESH 1J05B 1CTNA 2VMFA 4D9RE 2NY3D 3ARDA 3BUYB 1XF5B 4U1IB 1KTLB 1H5BB 2XTJE 1CD1B 2PUQT 4PG9A 1WIOA 1Q38A 2JIXB 1I7UA 1Z5LA 2XFXB 2HRPH 3D9AL 4P23C 4RGMC 3VW3L 4JFXA 4DFHA 1F3DH 3Q5OA 3MBXH 3O9WB 2PF6A 5E9DA 2CMRH 4K3JL 1G6RL 5INCA 5MEOB 5EZJB 4YHNA 3MRJA 3A67L 4Z78A 1KYOK 5FB8B 1QSEA 1NCDL 3GGWB 1S7QB 2VQUA 3S8WA 3TWCH 2V5RA 1MCEA 1MCJA 2APBA 2VDLH 3D3VB 5F3HB 2GTZB 3WKML 5GZOD 2Y07H 1KJ2A 1P7QD 3F8UB 1RJLA 4V2BA 2VNCA 1PZ5A 3PDGA 1MWAB 1F3JB 3TO2B 1UENA 4Y1AB 3UBXI 2APVA 3WBDA 3IVKB 1E6OH 5TQ2H 3MV8A 2VR9A 1OD9A 3IS1X 3DGCR 1OQXA 4XPFL 1QHOA 4WUUD 5HI3C 4MJ6B 1S9XB 1KLFA 5IJVB 5JHDD 1OF2A 1ZEAL 3EOBA 1CGWA 4MZ2A 4LKCB 3IFLH 1G7IA 5DD5L 3REWA 4DKFH 4HUVA 1YUHB 2J8OA 1B90A 2B4CC 1IL1B 3BD5A 1EBAA 1C08A 4DQOH 4XWOD 2JB6B 1E27A 2VDPH 3RNKA 2HMIC 4G6JH 3D2UA 1CDCA 4Z0BL 1CFQB 4KI5D 5D1QA 4R4NC 3NACL 1RK0B 4DZBB 1AIFA 1XH3A 4P2QE 4KJQC 4KUZH 4NN5B 2OSLB 3RDTD 5SX5K 1R3KB 4M1CC 3VFUB 5ADOH 3DVFA 4LKXA 1Z0NA 1AO7A 1GGTA 3H9SA 4XNQA 3N1MC 1IC7L 4YK4C 3J7HA 1T0PB 1BFVL 3MCLL 1ZLSL 3ARDC 3C8KA 4NZJA 4NOBA 4GXVL 3V5DA 1I1YB 2BJMH 3GK8H 1R6VA 5GS1A 3OKLB 2ZJSH 5J6HB 1CD9B 3BKML 2BNUB 4NKOB 5ECJE 3QDGA 4GW5B 1KSRA 2GSGA 5FF6A 1FAIH 5I1GL 4P9HC 5ANMB 1FE8H 5TE4L 2H6PA 3GSNH 1BQHA 3PHQA 2BVOB 1QO3B 4AEIH 2DS4A 3SKNA 3OAZH 1U95B 2BHYA 2QQKH 2FECL 3QI9D 4O02L 4CJ0A 1K4DB 3PL6B 1BFOA 4NNYB 3WIIL 1U9KA 2VC2L 3KLAA 4BK4A 1F97A 2L4OA 1NAKL 4Z7OF 1K8IB 4HKZB 4Q6IC 4XCNA 2W60A 3DX6B 3QQ3A 1IT9H 1MOEA 4BQCA 2OL3H 5T3XL 1CGYA 1M7IA 1RUAL 3O3EA 1D9KD 4NQUA 3ZDYE 1T83A 1SJEA 1ZHBA 1H8SA 4KDTA 5C6WH 4RBPK 4P5TC 2VDMH 4LDLB 2APTA 2N56A 1HXMB 1CL7H 1FGNL 3O81A 3UMTA 3SDAB 4GUPB 4S1SH 2R23A 1VADB 4LAQL 4K2UL 1AD9B 3ARFD 3WLBA 5C8JB 5CINH 4APQA 2F54A 2VLJE 2ZOLA 4MXVF 4QRUA 2Q1EA 3DX7A 4PY8J 4S1DD 1WZKA 1J18A 2ICEA 1JGDA 3ARGB 5HHOA 2V7HB 1QRNB 2DMKA 3MGTA 5HHXL 4GQPH 3PHOA 4LIQH 2AEIT 2X4PA 2F19H 5D1QC 4OIAA 1NCAH 1NJ9A 3QA3A 3UTTD 5KZCD 3V52L 2PW2A 4JEGB 2X4QA 3M8OL 4LLYA 3TBWB 1NFDA 2FYYB 1KPVA 4OZGE 5JDJA 2X70A 3CH1A 1I9IH 2DIJA 1PX4A 4LMQI 3JV4B 1BD2B 2YR3A 2X10A 2R29H 2HH0H 3TO4B 2YPLD 1KBGH 4LRNH 4HF5H 1I3RA 4OLWH 1DR9A 3ULUL 3OKMA 4M6ML 2OTPA 3RPIB 1EIBA 1Q0XL 3BVNA 4OJFH 5GS1C 5IEKA 4NP4H 1KIPA 4R7DB 5SWQA 5I0ZA 5D72L 4G6AD 4RFEB 2H41A 1YDPA 5A16B 4JO2H 3IU4L 3CUPA 4IM8A 2GUOA 3BP7A 3S34H 3G5ZB 1MCWM 5DLML 4YPJA 4OCRH 3QUZC 4ONFH 5BZDB 3RZWA 1YEDB 3AUVA 2VDQL 5IBUG 3N9GL 1QPXA 4NJ9H 4WW2B 4OCNC 1A6UL 4JZNB 1FLRL 1R3JA 3KDMB 3KPRA 3OKNA 5TQ0H 5D1ZD 2OR9H 2VXSH 3FB8A 1VACA 1WFOA 5FV1L 5I16A 2NY2C 5DJ8A 1BQSA 5FM4A 2OMNA 3H9YA 1Q8MA 3G6AA 3TPUA 5ACLA 5C0BA 3Q1SL 5I75B 2R1YB 4D0BA 1T0MB 1T83C 2P44B 4TUJA 3LQZB 4L8CB 4JHZA 5SX4I 1RUPL 2YEZB 2W0FB 1XT5A 3NOIA 2R2BB 4JFED 1CXKA 3TM6A 2IQ9L 1J12A 2MHAA 4LCUA 2BOCB 4LDEB 1PFCA 1JYNA 4JREB 3QFJA 3EYSL 1GGIH 3NBNA 3LAFA 3VXTA 4TOYH 3WLWC 1RZ7H 2I60L 3ARBA 3E6FB 4R7NA 4TPRL 5F7WC 2KZWA 5CJXA 2FLRT 3NCCB 4FXKB 4DGVL 3WDJA 1HWGB 2EC9U 4M02A 5C9JA 2VLKD 4FFYH 2C1OB 1AD0A 1LWRA 5DYOB 4OF6A 4PY7B 4XNMA 4J8RA 1H9VA 3GMOB 5K9OB 3HMXL 1TZGH 4GW4A 4R2GB 5FKPA 3EFDH 3GIZH 1RJYB 1ADQH 2FECI 4YHYC 3G5XA 1JZ8A 3MNVB 3MRNA 4PV9B 2BNQE 2IGFL 3VFOB 3P30H 4KJYB 3WFDH 2Y9RT 5FGRA 5FDYA 1GXEA 4Y5YA 3EYQC 1P7QA 2DMBA 2XZAH 1BEYH 5FOBA 3RZCD 5EO1A 2DD8L 1X7QB 4WGVB 3X13B 3ZKNC 4QRPD 4YC2C 2DQFA 4XPTH 4YH6A 3OSKA 4TVPH 2YRLA 4X6DE 5JHDA 3MRGB 4BM7A 3KPMA 3V6OC 5HHVH 1NBYA 2P24A 3VXQA 1LEIA 1I3GH 1S5HA 1ZK9A 4A6YL 1MCLA 1CG9A 3TH4T 1I1RA 2D2OA 1JWSA 4EN3D 1P69B 2HFEA 3VFNB 1HCFX 4KPHH 2H8PA 1CDHA 4JPIA 3VFTB 3WDIA 5EUOA 1RULL 1VFMA 2VE6A 1GGCH 1Q0YH 5JZ7D 4FFVD 2P45B 4I18A 5E6IB 2A83A 3FFCB 2UWEB 2GAZA 5JUEH 3BDBA 2E9IA 2VH5L 5A1AA 4KROB 4HCRH 4IIQA 2BX5A 2P5WD 4RX4D 3FQUA 1QEWB 2OXGA 5D1XA 2H1PL 4QXGL 1RJCA 2CKBA 4ZG1A 4H0IA 1RSFA 3ARBC 1L9MA 1OT2A 4Z7VF 2AJ3A 4KDVA 5J3HD 4DZ8A 4C4KO 5CP3H 1S5IH 3ZE1E 5FO9A 4DOHE 1DBKL 3PWVB 3N50A 4PJGA 4TRPH 3VDBA 5BRZA 2DMCA 5C07A 4ZFZA 1PYWA 2PR4H 3UO1L 3DHJA 4ZQKB 2C1PA 5DJYA 2H2SD 1CBVH 3GSQA 1N6VA 3X17A 3NABH 1LE5B 5IK3B 3QI9A 3D85B 3WXWH 1EX0A 5DMJB 4YGVA 3HE7B 1WBZB 3AS1A 4KRPC 5MENB 4ZFOA 5IVXB 3MLTB 3RKDD 1N64H 3BEVA 3MV7D 3UZEA 4HWBL 5GZOC 4Y5YC 3OGCA 3H3PH 3MREB 3BMWA 3RWEB 4G7VL 5I1EL 1NBZA 4F37F 1D9KA 2GSIA 1MF2H 1TPXB 1IGMH 3WJJA 3AC0A 1RUML 1S7XB 2VKWA 3V6FA 1UKTA 3BN9D 4UT6L 4PTTA 2PTUA 1AGCA 1LDSA 1YJDC 2PCPA 4UIMB 5HPMB 3SGDI 4G8IA 1DVFD 2GJ6D 1NCTA 3VFWB 4I3GA 2GHWB 3ZDZE 1IQDB 3ARFA 4JO4L 4ZS7L 1R24B 3D18B 1U8PB 3T77B 1JGVH 3MUY1 4XWOC 2DWEA 5TDPA 3BPOB 3U4EA 1JWUB 3K1KC 3R0MA 1BX2B 2CK2A 4I77H 3F62A 3QHFH 1B4RA 4KI5C 1A6ZB 3VFSB 1FAKT 4XCCH 2JJTA 1IQWL 3ZYZA 3UTTA 4OB5L 3F58H 1U93B 3BP6A 1H8OA 2VYRE 4IIQC 3RDTC 3GSWB 3DUSB 2ZCKL 5IF0A 3SKOA 2OX5A 1TETH 3BXNB 4LHJB 3VJ6B 4UAOB 2JCCE 1F11A 5L0QB 2AEPL 4JLRA 2IADB 1G7JA 3NAAH 4FFWD 3P0YH 4HT1L 5FV2A 1I1FA 1BQHG 2AI0H 4DKDC 3U9PH 3IDMA 2BSTA 2Z93B 1TJGH 4JFDD 2KZ1B 1HHGA 1YC8A 2CK0L 1N5AB 4OD1H 2VLLA 1OGAE 3DNKA 3T1FB 3CXHJ 4W81A 3FRUB 2FB4H 2DQTL 4PRPB 4ZFGL 2D03L 5ICYB 3DX9B 5DHVH 2YPVL 3QI9C 1BVLB 1OAUL 1SM3L 3BHBB 3MBEC 2EIZA 1UACH 4NHCH 5GRYA 1FZOB 1T3FB 5T5FL 4F57L 5KVMC 3MROA 1TIUA 2AJSL 4XC3H 1T1XA 1TJHL 3D69A 1D9KC 5CSBA 1OARL 1NUNB 1K5NA 3WJJC 1YMME 4FP8L 4HGMA 3U9UB 4F2MA 4ZODA 2VJXA 4PRAB 1WTGT 2NX5B 3QEUB 4WY7H 4JFEA 3U30B 4X4ME 2OTWB 1CGUA 5DVMA 5E94A 2DYPB 1VEOA 2OJEA 4ZUVB 4YBQC 1FVEB 1GH7A 2GY7B 5EBWB 4NDMB 4S0TD 5I1HL 4S1DC 3S36H 1V7NL 1FNGA 3KXFD 2VQTA 2IPKB 1BZ7A 4FQHB 4HIJB 2VQ1A 3GBNH 4GG6B 1DLFH 5MEPA 4Y1AE 2GT9B 2VLKA 3PNWA 5F6IB 2XQYG 5IIEB 4LOUD 1IKFL 1QQDA 3BPNC 4IOIB 4OLEA 3OJMB 4XXDA 1IGCL 5LWYH 1NCUA 1Y0LA 5ENWB 4M4PA 4KY1H 5LAXB 1WEJH 3X14B 1YA5A 3GJEB 4I3RH 4NFCA 1FNSL 4PBWD 3U0WH 4OT1H 3LDBC 2XQBH 4OD2B 2F5BH 4OLYH 3HZVB 4P5MB 1FCCA 4I2XB 5D70L 1NCWH 4HULB 1RU9H 4ORGB 4DGIL 1RV6X 4PJFA 4LK4A 1QFWH 4QRQA 2I9LA 4L4VB 2AV7B 5EORL 3WNLA 1JRHH 1OWRM 3NN8B 2R2EA 4G6AC 4L4TE 3MYJB 4MAYB 4KV5E 4PJXB 3RZCA 1AP2B 4Y4KB 4QRPA 3ESVF 2FH8A 3HUJA 3MA9H 5DRZA 3RJDA 3IETB 3P3YA 1F5WA 5E95B 3MLUL 1ND0B 2FGZA 5I0DA 4IRZL 5D1ZC 2AK1L 3JBG7 5B3JF 2DQDH 2VITA 1U92A 4ZTPH 4Z76A 4QRSB 4U6VH 4P23B 4RGMB 3JTTA 4L3CB 2J4WH 4UT7L 5ANME 3G04A 1QNZL 1S9WB 4PLNC 4TSBL 1GOHA 3D0VA 2E9WA 1KCSL 1C5DB 2BK8A 3ZKSD 4J3XA 4AQOA 2P5WA 4RX4A 4PGEA 3BRFA 3FCTB 2CD0A 5IMMB 4P59H 4ISVB 1J1OL 1F8TH 3PDOB 4LSTL 3VFPB 2EKSA 1NMCB 3S35L 4IBLT 3RIAF 1A6PA 2YD9A 5FUCC 1BZ9A 4X5XB 4OKVA 5C0RH 3VU2A 2VXTH 4UQ3A 3BIKB 3IGAB 2B1HL 3L1OH 4UILL 1JFQH 4M9OA 1OOAA 2GCYA 1WAAE 1YEKL 1IM9B 4KZDH 1SJHA 5ID1A 3HRZB 2XT1B 4QHMA 1DDHB 1FG2B 4MJ5A 3W5NA 4OCYH 1MFBL 2AXHA 4UTAL 2Y36H 4HUUA 2W07A 1V7ML 3MV7A 1JZ7A 1KTKE 4WNQB 1NC2B 4U3XA 2X4TA 3GRWA 4QXUH 2CUMA 4J7RA 1K6QL 3STBA 4FQ1H 1A7NL 3LKOA 3UTPD 3RZCC 2J2ZA 1T1WB 4O2FB 3HMWH 5MERA 4XMLL 4ONOA 5DD1H 3SDXF 1A4KB 4YDVB 2ITDB 4Y7MA 4N0YL 1BD2E 5HDOA 1DVFA 2GJ6A 2SEBA 4OD3L 3RVXD 2HKFL 4YK4B 2PXYD 5L2JA 5D7IF 3ARDB 1A0QL 4EN3C 3MO1A 2OTUA 2MQ0A 5HDQH 1I7UB 1T5WB 1Z5LB 4JO3H 5IFHL 4FFVC 5JZ7C 5E1HB 2FX9L 3FO2A 2AS5M 3BH9A 4ZUWB 4DUXA 4EJ1C 1AQKH 1U41A 4K7PH 3OAZK 2DQUL 5GGTA 5IW6B 1HKFA 2XXCB 5IT2H 1PAMA 4HS6A 4OCSL 2DKSA 4ZOAA 3KPPA 2E6JA 5INCB 4GG8A 3TJEH 3FB6A 4YHNB 3VXMB 1OCWH 4XPBL 4Z78B 4Q9CA 1QSEB 3R1GH 3W2DH 4NWUH 4Q6IB 3TFKD 2Y06L 1JCKA 1KJ2B 2VXVL 1RJLB 4PJCF 3BESR 1PZ5B 2KKQA 4LQFL 3IDNB 3T3MF 3MV8B 5DFTA 4ZFFB 3C8HA 2W65B 4P5TB 5KW9H 1NFKA 5C71A 1OF2B 5J6GA 2ZNWA 4H1LA 2VIRA 3EOBB 1CDGA 2H2SC 3L5HA 2CJUH 3CAFA 2ID5A 3KHQA 3NFNB 4HUVB 3WIHL 5I1LB 5CZKA 3S37X 5F7EH 1C08B 5DD3L 4U2YA 3RKDC 5DGQA 5KVGH 2YKLL 4BQ6A 2G60H 4WFHE 3RNKB 5JO5A 5FECA 3D2UB 4UV7L 2G75A 5D1QB 5AAMA 1WLHA 3S4SA 2F53D 5HVFB 3A6CL 1DQLL 5T1LB 2BVYA 5ICZA 4OQTH 4LKXB 3ZL4H 3WSQH 1AO7B 3H9SB 4XNQB 3LS5H 2B2XH 4YWGH 1DVFC 1YYML 1MHCA 4ZMAT 1EJOH 4EXPX 3V0AC 4LRIA 3EYVA 3C8KB 4X9GA 3ZKMD 3OKEA 1B6DA 3H7BA 5DJXA 3V5DB 5EFIA 4F58H 5GS1B 4M62L 3KXFA 3MUJA 2XNAA 3CFDB 5EU3A 4PJIA 3D5OF 2LU3A 3QDGB 3GKWL 4HLZG 4LGPB 3GJFH 4HLZH 1BLNA 2GSGB 1CFBA 5K59E 2H6PB 1ETZA 3DRTA 3H7LA 3PHQB 4N90E 3Q2CA 5BVJA 2GK0A 3SKNB 1U42A 2BFVL 2VXQL 2ADFH 4DN3H 3NTCL 1BFOB 4JDZA 2W91A 2BY0A 4PJHA 2UY7A 1WCBA 4XCNB 2W60B 4D9LH 1ACZA 1QP1A 4FFWC 4OLZH 1HZHH 2NY2B 4UNTA 2WLZA 5F96H 1M7IB 1FORL 3BD4A 3CXHK 2O5YL 1YEIL 5DJDA 3DPBA 4HMEA 1SJEB 1ZHBB 3GM8A 3AB0C 2FEEL 4MJID 5IFAH 1AJ7L 3OR7B 1G6VK 2UWEE 4JZJA 1MQKH 5BO1H 1VGEL 2R23B 4R4FH 2J3SA 3RIFK 5KSBA 5CWSA 3WLBB 1FPTH 4APQB 2F54B 2ZOLB 4QRUB 1OGTB 2FGWL 4WI4A 2FEDD 5J0BA 2WANA 1OQOA 2EDLA 4KK8D 1JGDB 4G6KH 43C9A 5HHOB 1CT8A 4MA1C 3V95A 4K71B 3PHOB 4JR9H 4JGJA 1KB9J 4N8VA 3UTSD 3S96B 2W9LA 2H45A 2F8XC 3QA3B 1NJ9B 4EQ2A 4GKNB 2PW2B 3IDIB 2X4QB 3QG6A 4Q0XL 3V0VB 5GJSH 3PQYD 5DUBA 1NFDB 2X70B 3CH1B 4ZS6D 4YHOH 3U79A 5CUSH 1FFNA 5EO0A 1T04A 4ZD3H 4CDHA 3P9MA 5AYUL 3LH2L 4LRIC 5MENE 3HKFA 4M48L 1ZLWH 1J1XH 4EVNA 5IVXE 1OAZH 4TSAH 1C12B 1IGJB 3LEVL 3OX8B 2Q3ZA 1KIPB 5SWQB 3UPRA 1CGSL 2ARJA 1OSZA 1YDPB 3MRDA 5ELIA 3VG0H 1OSPL 4R90H 3BP7B 4LCIH 3ABZA 4LOUC 2D3VA 3MFFB 3MLRL 3MOAL 1BWWA 4YC2B 4YXKH 5E03A 1MWAL 1NEZA 2A6DB 1I9RL 2IFFL 5I9QC 1R3JB 2APFA 3LN5A 3KPRB 3OKNB 4FOMA 5BXFA 5EU4A 4MD5A 2QLVB 3BPCB 4EEEA 2H2PD 3FB8B 1JMZA 5GS0L 5I16B 5DJ8B 2UY6A 1UC6A 4KKAC 4PB9H 5C0BB 4D0BB 1F00I 5F1IA 4TUJB 5DHYA 5ESAB 3GMMB 3QUMH 4PRIA 4BSVA 4HBQA 4RCAA 1XGYH 3FO9B 1WICA 2DI9A 1RZJH 4RMVA 2C3VA 1LGVA 2BMKB 2MHAB 4LCUB 2VLME 5F71A 1ZANL 2G9HA 3HC4L 3QFJB 3INUH 3B9KC 2LU4A 2VZ1A 3MTRA 1FC1A 2PXYA 5CLTA 3ARBB 4R7NB 4J12A 3GEWB 3ISWA 1L7TL 3G6JE 2NY3B 2DIBA 1J0ZA 3ZTNH 4RNRA 1NCCL 5I8CA 5C9JB 1EA9C 2R2CA 3IFNH 4XNXL 1X5HA 5MEQA 1ZGLA 4WFGE 4JN2B 5F1KC 4XNMB 4GRWF 4J8RB 5DC4B 2DQCL 2YK1H 4U3HA 5J11C 4GFTB 3T08A 4QLRA 1XCQA 3RX8A 4Q9QL 4GW4B 4PRPE 1OM3H 5CJQL 1I75A 3TVMC 4NN6C 3FOMA 3MRNB 3FO1B 1DFBL 3S88H 4D0DA 1R5WA 4Y5YB 3IJYA 1P7QB 3B8SA 5IMOA 3UTZA 5LBSL 1L6XA 1V3LA 1EVUA 3GMQA 4L4JA 2F8OA 2JJUA 4XC1H 4PJBF 2RR3A 2FEEI 3KPOA 4WUUB 2NX5E 4Y8DC 1L0QA 3UTQA 5AD0A 3PIQA 4X9HA 5JHDB 1CFSB 2AXFB 3KPMB 5E5UB 5DA0B 4J4PD 4JZOA 1NBYB 1BBJA 3VXQB 3ALXA 1QRKA 4ZAKD 1LEIB 4OLUH 1S5HB 1CG9B 1QSFD 2FSEA 2VUYA 2X09A 1JWSB 4M7JH 3DYOA 2V9RA 2OMBA 3FN0L 4MA7H 3S3SA 5JOEA 4DFIA 2HFEB 5JW4R 2ESVD 2H8PB 1WZMA 5IROC 5EUOB 1J1PH 5LCVL 1KC5H 2VE6B 1QTYT 1E6JL 2ZPKL 3RFZC 5EBLA 4GG6E 1FO0A 4XP9L 3PF2A 1FDLH 5EZIH 1OTSD 4L5FH 2GAZB 2ZCLL 4LSPH 4AMKH 2F53A 1EK3A 1UM4H 4W6YB 5KS9A 2R56L 3E8UH 5J12B 3U0PB 3D87B 4IIQB 3RDTB 3S6CA 3FQUB 5C0CB 4KTEH 4XP5H 1AY1L 2MTPA 5GGSA 3RVXC 5LGJA 3T3PF 3VXSD 1AFVH 5KVDH 4M1GL 2PXYC 4BFIA 2VABA 4Y4HD 4XXCA 2AJ3B 4NC1E 4F15C 2W59A 1QYGL 4K7PY 1X5YA 5T33H 4DZ8B 4KUCF 4OIBA 2WBJC 4L4VE 1MFAH 3VH8B 4KQ4H 4JM4H 4FZ8H 3DUHA 4PJXE 3STZA 1IAIH 5GXBB 4ZFZB 2NTFA 1AQDA 1DBML 1ONQA 4S10A 4DVBA 2DRUA 5JORA 5CEXA 3FQXA 4RWYL 2C1PB 4NGHH 5DJYB 5J57B 3GSQB 1UJ3C 2QHRH 3QULA 3SGEI 3QI9B 3U4AA 5I30H 3O2DH 1UA6L 5I8EB 1NL0L 3HE6D 4ZFOB 3TFKC 1X5LA 3BEVB 1O7SA 3MXWH 3OGCB 3X3GH 4Z95H 1A7OH 3RRQA 3JWOC 2DLIA 1JGUH 1NBZB 1D9KB 4JN1H 4FABL 4WWKA 5GSVA 3V6FB 1BVKA 1AGCB 3LS4H 1ERNA 2PCPB 1YPZF 2IPTH 3RU8H 5I6XC 3OV6A 4NFDA 4G8IB 3KPSD 4TSCL 2FD6H 5HDBF 4ODHH 4FQ2L 3P11L 3MXVL 4HSQA 4OSUL 4OZHF 1IILE 5CD5C 3O11B 1MJJA 1PY4A 2ZP0T 4ZDHA 1KIUA 5E8NA 4X7DC 3U1SL 5IB3A 5TDPB 2WZPD 4K23L 2XQYK 5IVNA 1WCQA 3BKYH 2NY0D 3Q3GB 5FYKL 2F15A 4LU5H 2R0LL 3CDFA 1I8LA 1AKJA 5D2NE 3UTTB 1QLRB 3BPNB 4N0UE 2DDQL 3BP6B 2X05A 3QIBA 3U46B 3SDDC 4XP6L 3ROOA 2QHLA 5IF0B 1CXLA 4XWGH 1UB6A 2KBGA 4UT9L 1F11B 2DQGL 3B83A 3LDBB 4JLRB 1G7JB 1H3PH 2YPLB 5DJAA 4ONGL 5FUZL 4XXCC 3O3BA 1MRDL 1I1FB 3ZKMC 3L7EA 3BP4B 4M7ZC 4YDJB 1LHZA 3IDMB 2BSTB 3NIFE 4YHIA 4R26L 5DS8A 1MIMH 1H3TA 2BVUA 1BBDL 2VLLB 4U6TA 3VRIA 1I3VA 1P4BL 2O26U 5IJKC 4KU1A 3DV4A 1A7RL 4PJ5D 1DBJH 2UVEA 1WIUA 4B53A 2EIZB 1F4YL 2N7BA 1P9MA 4KJWD 5EU5A 5D1ZB 3MLSH 1T1XB 3ZE0E 3ULVE 4X80L 1JUFA 1J8HD 3PWPD 3HC3L 3GSXB 2W9DL 4N0FA 4F2MB 1I85A 2VXUH 4QRTA 1KCVL 5M94B 2WUCL 4JFEB 5E9DE 5JR1L 2DBLL 4FQXC 4H88H 1GPOL 5E94B 2A9NH 5CCKL 3EO9L 5TPWL 4WHCA 2OJEB 1FFRA 1QSEE 3IDJA 4N8VG 1EHLL 2FJHA 3N06B 4LFHG 4IOFD 5FA4A 4MJ2A 3SDYL 4DCQA 2FEDC 4HS8L 2ITCA 2XG4A 4KK8C 1B6UA 2VAJA 5LXGL 1GAFH 1BJ1H 3H9HB 2AXJA 2VLKB 2AABH 3MV8E 1QQDB 3MODH 4QTIL 4HXAL 1EMTH 1UWEH 1Y0LB 1MAJA 3P4LA 2CSPA 1LDPL 3FFDB 2FX7L 3NFPA 1NBVL 1J88A 1FL5A 3MLXL 3L5XH 4PGDA 1C7SA 5D6DC 2QBWA 3CLFL 1CK0L 1EUTA 2BXYA 1CFNA 2AJVH 5F3BA 4PJFB 4QRQB 4MVBD 5E7FA 4JFQA 2I9LB 1J0HA 4UQ2A 3PDDA 4DVRH 5ITFA 3RZCB 3QDAA 3UBXG 2Y5EA 4EOWL 4N8CL 4OM0H 4JY6B 4QRPB 4HIIA 4HQQL 1AO7E 3HUJB 3H9SE 4J4PA 1V3KA 4XBEL 4MS8D 1DBAL 4YHKL 1NMAL 1P9MC 4P0DA 4ZAKA 3HI5L 5EWIH 2E9JA 3T0AA 1QSFA 2FDBP 1TZIB 4EN3B 2H2PC 2LFGA 5DXWA 4I48B 2ESVA 2VITB 4Y0GA 4U6XB 5HGHA 2CIKA 4LEOA 1AGDB 4Z76B 2Y4SA 2ED9A 4DAGL 1KLUA 3WUWG 3QDGE 3JTTB 3UPCA 3G04B 1NLDL 5I8OH 1S7SA 3QEGL 3IU3A 4G3YL 3MJ9L 1E28B 1A47A 3CFCH 5E1AA 2GW5A 3D0VB 2DJUA 3ARED 4X99B 4LSSH 1F4WH 2E7LA 3AAZA 5AUMA 4M6OL 4OLVL 5GRUH 2EKSB 3SOBH 4TQEH 3C08L 3VXSA 3PP3H 5CHNA 5DQJA 4P2RD 4Y4HA 3BGMB 3HNTL 2VZ3A 1BZ9B 4Y88A 4OKVB 1S7WA 4JFYA 2A1WH 4UQ3B 3OAUL 4GRLD 5HY9A 4KKCC 1QLFA 1FZMB 2GCYB 32C2A 1SJHB 3ZYIA 5ID1B 3UJTL 1WQVT 5CGTA 4HXBL 5D5MB 4NQDA 43CAA 4EI5D 4MJ5B 2F54E 5ACMA 1R3LA 3MLZH 4P2CG 3C9NA 4UDUA 2GYSA 3HE6A 2BRRL 4HUUB 5HHOE 2E7BA 5F9OL 3MV7B 5AZ2L 3S5LG 1RIHH 5DK2A 1RMFL 2X4TB 5I1DA 4I5BA 4Z7UB 1G9ML 1CGXA 4U3CA 4IMLA 3RNQA 2IBBA 4HX1A 5ALCL 4Z6AT 4JPVL 1I8MA 2OZ4H 3RBSA 3BYYA 5MERB 1NFDE 1TMCB 3BWUC 2DAVA 1MHPL 4PG2A 2VZTA 2BDNL 3TYGL 4JHAH 3KPSA 1L4IA 1DVFB 2GJ6B 4J4PC 4U05A 3GBLA 1ZE3C 1EO5A 4ZAKC 5L2JB 4NO5B 2V6HA 3V4VH 1LNUB 2OTUB 3RA7H 2WINB 3GJFK 2HRLA 4MAUH 1U58A 1IE5A 4OZ4A 2AVGA 4XNYL 2V2XA 4N9GB 4EDWH 1UB5A 3FO2B 3DECA 4OV5B 3BH9B 2WWKO 4GQ9L 4QKXB 4JG0L 4R96A 4O5LH 3TN0D 1A7PL 4RAHA 5KTEL 1NGWA 4KK5C 2CO7B 3VXOA 3BT2H 3KPPB 5M7QA 3MRFA 7FABL 4RWHA 4IS6A 4NZUL 4F7PB 2W1NA 2E7LC 3KPRE 4HWNA 5I76A 2P7TB 4D0CA 4YEFA 2A9ML 4K3JH 4JANB 4Y4HC 1G6RH 3SGJA 2CLZA 3NGBC 2CRMA 1J5OL 3BD3A 3FT3B 5C0BE 5EG6C 1QOKA 4K3HA 2RFXB 4KRNA 3AB0B 4JFDB 4JDTH 3ARSA 5DRWA 1T89A 4BA8A 5EIQA 1VPOH 4H1LB 1OB1A 3P0VL 3ZLQC 1UH3A 3LEYL 1HSBA 3VFGH 4G6MH 4OZGF 4JKWA 4PJ5A 3QFJE 1NMBL 4XPFH 4PS4L 3WV0A 2E8YA 3LZFL 4XAKD 5AWNL 3L95A 3BZEB 1CCZA 3HE6C 3QDMB 4UINL 4EUPA 1A4JB 4YNYA 5JO5B 3ARUA 4MA1B 3S37L 4PLKD 5FECB 1EJ6A 1WITA 4JRXD 2G75B 2WIMA 3S4SB 1J8HA 3PWPA 1BJ1J 1K4CA 1ULVA 5EZOH 4JFFD 1EFXD 1I3UA 1JNNL 3ZDXE 3TT1L 4L1HA 3I9GL 4QF1B 4BH7A 4LPXA 5H2BA 5SX4H 3HZYA 4Z0BH 5MP6L 1ZLWK 1YNKH 3EYOA 5FGBA 1MHCB 5ABDE 3ARYA 1NFIA 4YQXH 4ZUTA 3OKEB 2XG5A 3H7BB 4GRWH 5EFIB 3BW9A 2EIEA 4O2CA 4FZEH 3KXFB 2XNAB 3SO5A 5JTWA 3OPZL 1YECL 1BLNB 1R3HA 2F8VA 2NY0C 12E8L 4FQCL 1ZLSH 5D7LD 4CW1A 5ACZA 3BYTA 4NPYA 1GOFA 5FAAA 1ETZB 3VWKD 1AGBA 1YYLL 5BVJB 2GK0B 3L3GB 4F37K 3MRHA 2OL3B 5JHDE 5I1GH 1WBYA 3BPLC 4RGOL 3T0BA 1IVLA 1WCBB 5TE4H 2NQCA 2GY5A 4OM1L 4OCXL 2AEWA 2IBZY 3L5WA 3SGJC 4AH2B 5EUOE 1HDMB 2DWDA 2PNDA 4NO0A 3BAEL 2JJVA 2B4CL 3MRCA 1X9QA 4FXGA 4U1JA 3LHPL 4WIQA 5FGCB 1FLTX 3GI9H 1T89C 5T3XH 1Q9LA 1CD8A 2WP3O 5CWSB 1LO4H 2HN7A 5L2KD 3B9KB 3NH7L 2Z8SA 4KJWC 4WVRA 4IJ3B 4RRPG 43C9B 3KS0H 4MQXD 2LQRA 1IM3A 4LVOC 1CT8B 3LN9A 4K2UH 3O6LL 3U83A 1TZHA 1EVTC 1SBSL 2O5ZL 1NGQH 2Y23A 1KIRA 3MMEA 4ODSH 4KK9C 5J9PA 4PJGE 3QG6B 5C07E 5BRZE 3ULVL 5J11B 5HHXH 3CVIH 4HGWA 1T04B 4P9HL 3AREA 3P9MB 4X6DF 1JPFA 3V52H 1KCLA 4LPYA 4ZSOA 5EO9A 4NN6B 4YGAB 5IGXL 3REVA 4EVNB 1LILA 3GB7A 2R69H 4IOFC 3UCRA 1U3JA 2GKIA 1IGIL 3TBVB 3QCTH 1GIGL 1JNHA 5GGVH 1QBBA 2ICES 3UPRB 3K8KA 1A02N 1OSZB 2JELH 3MRDB 4NT6B 1KJ2L 4JE4B 3QNXA 4GRLA 5J1AA 4BH8B 1CICD 5CBEA 1Q0XH 1CDJA 5KVEH 5LG1A 1NEZB 3K4ZA 5IHUL 1V3MA 5F44A 2EH7L 4NZDA 4YIQB 4P3DA 3DSNA 3AU1A 1ZT7A 1U8HA 1UZ8B 3IU4H 3LN5B 4OBRA 4B5EA 5BXFB 4EI5A 5EU4B 3P4OA 4XP4H 2UZYB 4NQXA 5HHMD 1RIUL 2EDYA 3QJHB 1KJVA 1HINL 4G7YL 4JPWL 3LKQA 1A6UH 4MVBC 4AYFA 3C2AL 1UZ6E 1P53A 5F1IB 2Z4QA 5DHYB 2XWTA 4NWTH 2DKUA 3ZE1F 2P1YA 3UTTE 3M45A 4QHNA 3QZWA 1JIBA 4OF5A 1Y6MR 3M17A 3JUYA 5JQ6H 2E3VA 4NKDB 2MSPA 3O4OC 3RVTD 3VXPA 1CDUA 3BKCL 2EDXA 4TUKH 4MS8C 3SGDH 5L9DH 1N3NA 1DN0B 1H3GA 2GIYA 2PXYB 2IQ9H 3TH3T 5MI0C 1NGPH 2B7DT 3HHRB 4RNRB 4F15B 5I8CB 3MV9A 2R4RL 1DQML 1GGUA 4S1RL 1A14L 2WBJB 5MEQB 1CFVH 1ZGLB 4HEPG 1Q1JH 1PLGL 5CIPA 4PJDB 1D5XA 2J12B 2NW3A 4JPKH 5B39G 4F8QA 3U0TA 1UJ3B 3GNML 3AREC 4IRSD 3BJLA 2VO5A 4JFZH 3R06A 4J3SA 4ZUUA 3ET9F 2EEDA 3FOMB 3KAAA 4D0DB 5D96C 1R5WB 3ZDZF 3HMXH 4P4KD 3D3VD 1XGUB 2V17H 1VFBA 3JWDL 4YDIL 2HTKD 4OLXL 4PGZA 5IMOB 3PP4L 4Z0XA 3MX0A 3UTZB 2X4NA 5D7SL 2CDEA 4GRLC 1JZ4A 1CVRA 1FZJB 3CXDH 3E1F1 2IGFH 3QISA 3KPOB 1QLEH 3EW3B 1BFTA 3PIQB 4JFEE 3QXAA 2YXFA 2X7LA 5I6XB 4WU7A 4R8WL 1A1MA 4JZOB 1BBJB 1M6OB 4K07A 2C3WA 4EI5C 5JW3L 1UVQA 2F5AH 2FSEB 4PJ7A 3HCVA 2Q7YA 1YMHA 2R2HA 5J1TC 1RZJC 4AT6B 3WCYA 5DJZA 5D7KD 4F80A 2ZKHH 2B0SH 5EBLB 4LSRH 3UEZA 3QJFB 1NGYA 2H32A 5I15L 4A6YH 1N59A 4KTDH 2VLKE 4I13B 4JRXA 4PLJD 4PV8A 5C6TL 4OF8A 5D71L 4XVTL 3S98A 1P2CA 2F53B 2YZ1A 4JFFA 1EFXA 3T0VA 5I1KL 5KS9B 2C7UB 1MIEL 3P9LB 3SDDB 4I4WB 3CZFB 1ZHLA 2OLDA 4CU7A 2HJLA 3Q6FB 4P9MH 2VWEC 4BQBA 3NZHL 4KHTL 2YMXL 1SJVA 2VABB 2VH5H 3PWNA 2BVPB 3EDKA 5E2UH 4M7ZB 2I5YL 5JA8B 4PJFE 2BP3A 1D5BA 1EO8L 2H1PH 1J9CT 3PV6A 4DK6A 4X5LA 4PP1D 2XKSA 1LO0L 5IFAL 2HFTA 5E2WL 1SEQL 5D7LA 1HYRC 4RAVB 2DM3A 2IANA 1OP3K 3TN0C 2NTFB 3VWKA 1ES0A 1AQDB 1MY7A 1ONQB 4M3KB 4DVBB 5GS2H 5JORB 5CEXB 1MJ8H 3FQXB 5F89A 4QRPE 5DEFB 3T09A 3WO4C 3HUJE 3QULB 1IC4L 1SQ2N 2AJZA 1PKQA 3PL6D 5SWSD 4Q9BA 2X1WL 5F97E 3I6LD 5C0EA 1F4HA 4XPAL 2ZWLT 3KS0J 1NLBH 2JK5A 4X8JA 1ZHKB 4CMMA 5E2JA 3VWJD 4QY8B 2ZUQC 4DW2L 1I4FA 3HAEG 2OP4L 3O2WL 2Y1VA 2NZIA 2YRZA 1FVDB 3UJIL 5GSVB 3QXWA 1ORQA 1BVKB 4F3FB 4MJIB 2VDNL 3QBTB 4KQ3L 4U7KA 4FQXB 1DL7H 4G7VH 3RWDA 3RX7A 5I1EH 3W0WD 3SY0A 5KJRL 4I3SL 3SDAD 2P5WE 3HPJA 4EI6A 5DFVD 1JNLH 1N6QL 4WTWA 1I8KA 3H3BC 4UT6H 5L2KA 1JYVA 1QBML 3WN5A 4X6EB 1JTOA 4ZDHB 3O3UN 2R0KL 1BOGA 5IB3B 4JKPL 5J4MA 5IFJA 1QRND 4UOW1 5IBLD 4HUXB 3OL2A 5D2LF 4JO4H 1S7VB 4ZS7H 3UTSB 1A2YA 3K46A 2DQEH 5IEHB 5E8DL 2UUDH 1DSFL 2BSRB 4QHLA 4RA0C 2D9CA 3QXTA 3NIGE 4YR6A 4KV5F 3PQYB 4G8EA 2P5ED 5CEZH 3ROOB 1JF1A 1UB6B 2D7MA 3CVHH 4HWEH 1CLZH 4XBGB 4XX1E 3JVGC 4OB5H 1CFTA 3TZVD 5BVPL 1MI5D 3EZ8A 3RGVD 1T2JA 2J6EH 2PKDA 4AENA 2ZCKH 1FV1A 3MV7E 1MFEH 3NCMA 2XA8H 3B6SA 4K7FB 3RHWF 2CUHA 2EDBA 3DLQR 4OCLC 4XVJH 5C0IA 1KXVC 1RUKH 4HT1H 1WJ3A 1HOCA 4PRBA 3S3PA 3VRIB 4NM4L 4ALAH 1W72A 1CICA 2WUBL 4FQLL 5FKAB 3PXHA 4MB5A 2R4SL 1U8OB 4K3DH 1KENH 3MRKA 3SDXA 5HHPA 2GJ6E 2LU7A 1IGTA 5EU5B 4QGYA 1YJDL 5FO7B 1ODAA 4JVPA 1HHHA 4EZMA 4LHQB 2DQTH 4ZFGH 2QV2A 2FX8H 3EOYG 2VR5A 2YPVH 3VGBA 1JUFB 3FONA 3ZE2E 1F6AA 4N0FB 4BUGA 5L88L 1U36A 2R0ZL 4NQED 1JP5A 4QRTB 5T5FH 5DJ6A 3HS0A 3MZTA 2V9TA 1TJHH 3OF6D 1A9BA 4PREA 1OARH 2VISA 2EDHA 3QPQD 3PP3K 1SY6A 3BUTA 3EO1A 2ZUXA 2FJHB 2WLYA 4YO0A 5FA4B 1K8DB 4DCQB 3LRHA 2ITCB 2KQNA 3G5YB 4MQXC 4OCMC 4WCYH 5JW4Q 1XF5A 1KTLA 1H5BA 3QUYC 4D3CL 4Z7WF 1EFQA 4E5XB 4PJCA 4LNRA 5IOPA 1L7IH 8FABA 1S8DA 5I1HH 4XAWL 2YA1A 3TNNA 3O9WA 3O8XD 4WI8A 3PWLB 1EUUA 1HQ4A 3WHE0 2AGJH 5FYJE 3NCEB 4IRSA 3NFPB 5GGVY 1K85A 2XN9D 4PGDB 5B4MD 4LCCC 2ADGA 4QXTA 1FL3A 5IKCA 1CFNB 1NEUA 5F3BB 3D3VA 2GTZA 3FO0L 4GRMA 1TENA 3B5HA 4UQ2B 1QVOA 4ZFOL 5JLZA 3IVKA 5D70H 1KG0A 2YUXA 1CICC 1WZLA 4HIIB 1MY5A 1S9XA 5F1OB 5KVFH 1BAFL 4MMXC 1OVZA 3EGSB 4RFOL 1Z6JT 4ZAKB 1U8NA 4LSQL 1QSFB 5H37G 4LLUB 1YUHA 5E5MA 2OCFD 2ESVB 2P47B 1V3JA 1RZKH 3BRGC 5HGHB 2CIKB 3KXFE 2HT2D 4PJIE 1KLUB 3MLUH 2JB6A 1CXFA 4JFPB 4IRZH 2Q7NA 5CLWA 1JPSH 4J2XA 3IU3B 3KPTA 4KZEL 2P43B 3U7WH 5BQ7A 1U3YA 5E1AB 2OSLA 3T04D 3EJJX 5HDLA 3RVTC 1FIGH 4UT7H 2YBRA 3O6ML 5AUMB 1NDGA 4PJHE 1BQLH 3BEWA 3H42H 5TJWK 3VXSB 4TSBH 5DQJB 1FNHA 4Y4HB 4W4NA 3HG1D 1D5MA 3NGBB 3EHBC 1N4XL 1S7WB 1M7DA 3P77B 4JFYB 1I1YA 2E5EA 3FQWB 2IH1B 3OKLA 5HY9B 4O9HL 1QLFB 1S7RA 4LSTH 7CGTA 5J6HA 2VDKH 2BNUA 3S35H 5FGCE 3U4BL 32C2B 3HZKA 5JPMA 2C3GA 2EE9A 3DSFL 4JM2F 4FMKA 2WWMD 5JDSA 43CAB 5KSBE 2EDNA 1P7HL 4IRSC 5TE6L 2RCSL 3V0WL 1YEKH 3PL6A 5SWSA 4QHKI 3C9NB 4UDUB 4PB0L 3HE6B 1K8IA 3GO1L 1OAXL 4IHOB 4P4KC 5DK2B 1GSMA 2HTKC 6FABH 4FNLL 5I1DB 4H8WC 4I5BB 3VWJA 2OQJB 2DKMA 1RIVL 1MFBH 3SE9H 3WMSA 3RNQB 3QDHA 1DQDL 2OK0L 4HX1B 3MUZ1 4FFZL 5DVKA 5I18L 2ICWA 2VB5A 1X6LA 5HVGB 3AM8C 4YDLC 3DVIA 3KLHD 1HXMA 3W0WA 3KPSB 3SDAA 4OTXL