2DBJA

Solution structures of the fn3 domain of human proto-oncogene tyrosine-protein kinase mer precursor
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
124
structure length
124
Chain Sequence
GSSGSSGWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTRGGVGPFSDPVKIFIPAHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, signaling protein
molecule keywords Proto-oncogene tyrosine-protein kinase MER precursor
publication title Solution structures of the fn3 domain of human Proto-oncogene tyrosine-protein kinase MER precursor
rcsb
source organism Homo sapiens
total genus 10
structure length 124
sequence length 124
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2005-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dbjA01
2H3NB 3KPTA 2BCKA 3TWCL 5EORL 4OSUL 5DVLA 1MY7A 4ZSOE 3OPZH 3L3JA 4UUJB 3T0ED 1JP5A 4KVCL 1OD9A 1T20B 5D2LB 1KCSH 3F62A 3SE4A 4PLJD 1WVZA 4JJ5A 5KJRL 5D5MA 2P8LB 5INDA 3IU3A 3T0EE 5TH2B 1T66C 3N85H 2BRQA 3VXPA 2CKBB 1FO0H 4ZNEE 3VXTA 4PRPA 1DANT 4JM4H 4FQ1H 3K8MA 3ARBA 1M7IB 4H20H 1N59A 3PWUA 4NWTL 3D9AL 3S5LB 3VD7A 1ACZA 5GS0L 2CLVB 3MRLA 4KV5E 3L3HA 3QQ4A 3Q6GH 4OLUH 3GSUA 4LSVH 1AQDB 4K8RL 3Q48A 3EOTH 4LSUH 4P48A 5DMKB 3LDBC 4FMFA 4Z77B 1NGXB 4F58L 1KB9J 2DQGL 4RGNB 5FF6B 3TT1L 1D9KD 3O6FC 4U3HA 4LAJH 2YRZA 4MDJB 4TNWK 3BZ4B 1MQKL 1MH5A 3QUXD 4XPTL 5BQ7B 5JIHA 1FYTA 2PCPB 4ZUTA 1GGIH 1ZMYA 3E6FB 3LKNB 4NQVA 2AK4E 3QA3B 4URTB 4JKWA 4KJQC 4EI5B 3DURB 5GZOC 3GBNL 4NKIL 4POYA 4JFXB 3QB7C 4X9GA 2E7HA 3QJFB 3QDAA 3RGVB 1XCQB 3UPAA 1FFRA 2DS4A 4N9OB 1KCLA 1K6QH 5JW3L 3MJ9H 2FJGA 1OP5K 1N6QL 3E1F1 1PZUB 3QWRA 3G9VA 2V6HA 3EKCA 4FQ2H 4Z95H 3RZCA 4G6FB 4ERSH 5IB1A 3AXLA 2ITCB 4C58B 3HTLX 5I1HH 2P4AB 4OKVB 1JGVL 3OJVC 4H8WL 4YC2C 5L9DL 1P7KA 5E2TL 2EIBA 3BXNA 5E8NB 2Y36L 3ROOB 4L3CA 1MVUA 1F4WH 4NRXA 1OAZH 3NFNB 3LPWA 4TULH 5E94B 2OL3L 4AQOA 4G7YL 1HOCB 1CGSL 1A5FL 2JF1A 2DLEA 4TUOB 5FCUL 5C08D 4PJ8D 3Q1SL 3FO0L 2UVEA 4JFED 5MENB 1S7WA 2F8VA 5D1ZD 1NMCC 3DRTA 2GY7B 5C08E 3I02A 4JFEE 5GGTH 4XGZA 5DQDH 3NIDE 4LCIH 5I71C 1WK0A 2VLLA 4XHQA 1JGDA 3DXAA 4EDWL 1U95B 4PTUB 1N0XL 1HZHH 4Q2ZB 4PJEB 4QRRA 1CGXA 1B0WA 4IIQC 3SDAB 1YMHA 5C0BA 4UB0L 1I8MB 1H8OA 3SDXB 1CE1H 5IMOB 3PHOA 3HC4L 3ALWA 5IMKA 1K8IA 3RTQB 5D7KD 2Y7QA 4B0MM 2DQEL 4MD4A 3LEVL 4O5LH 5DJAA 1CF8H 2XWTB 1S7SA 1QTYT 2E8YA 3MRNB 4HT1H 3VRIB 4GRLA 5D7KE 5SWZA 4O2CA 1UM6L 4BSJA 4QRQB 4QGYA 15C8H 4L8DB 3BVNA 2QKIB 3GIVB 4XX1G 2DD8L 4F9LC 1ZSDB 1T03L 5IW6B 4GAYB 2VISA 1R3IH 5GS3A 4XPGH 3VFNB 4FQXA 4EBQL 3BP4B 3L3IA 4YEFA 1DN0B 3O0RL 1I9RL 3R06B 5DO2C 5D7JC 5D71L 5F9DC 4HQQH 4FNLH 2VR5A 4GW1A 1JPFB 4G7VH 1B88A 1RJCA 1IC1A 2FIRT 3GSXB 4FXGB 3PG2A 3QZWB 3O3EB 5LVEA 3DV6B 3TBYB 1H8SA 3HE6D 3QUMA 3MXVH 5EC1B 1GZQA 3SKOA 1WGOA 3ZYIA 5FGCB 4M1GL 4TNVK 5DRNB 4Y2DD 3LPGA 3TIDA 2QHRL 3C60C 1GAFL 3HI1B 5EN2A 1EO7A 4R3SA 1RZGA 2V2TA 2HJLB 1ZHLB 5SV3A 4QWWC 2DQFB 2MSPA 3VMPA 5FHBL 4XP6L 2YWYA 1JWSA 1LEKB 3B5HA 5CBEA 4PJCF 1FZMA 3C5SA 1IAII 1S9YB 4HWUA 4MCZB 5DJ2B 3EOYG 4PJ9C 4NJAL 3GO1H 2JB5L 5B4MD 5HGHB 4HWBA 3RU8H 1ZT4A 5IM7B 1TZHB 2EDNA 2PXYC 1S5HA 3QQNA 3CDFA 4HWEL 1CVSC 2PYEB 3IF1B 3Q3GA 5KS9F 1VCAA 4CU8A 2F19H 3RVWC 1J7VR 2MHAA 5C07B 4OZIF 1T04A 3Q5OA 4KPHL 4I1NB 4LASH 3W39A 5E2WL 1LE5A 3C08H 2EE2A 3TBSA 3BDYH 4WTWA 5L88L 4OF7A 4PJ7B 4L29B 5C0FB 4JO1H 1BQUA 3NFSH 3CLEH 2GEEA 4YUEL 1MHPL 2PKDA 2D7OA 3ZKSD 2DTMH 2VDNH 3QEGL 3C09C 2JJSC 4YK4B 4KUCF 4HMEA 2CPCA 1RMFL 2WIIB 3HE7C 4IRSA 4EUPG 1W0YT 3G6JE 3RDTC 1QLFB 3MBEB 5J11C 3D48R 4M8QA 4YFLF 4HPOL 1RUQL 5HYFA 4PR5A 1NMBH 4X7EC 4BZ1H 3TJEL 1RZ8B 4OQTA 2F54D 4FFVC 4PUBL 2FEDD 2HJKA 3OAYH 3DX8A 3MRMB 1MFDL 2Y4SA 1XGQB 3TFKD 2F54E 4XNQA 3E2HC 5BV7C 4P2OA 5F1NB 3FQNB 2H1PH 5F7LB 4P23D 1SJEB 3VFSA 2EEBA 4FN0A 5GZND 1QO3A 4L4TA 3TO2B 2VXVH 2XZQL 3P9WB 2IAMD 2KQNA 5DTFA 1Z3GL 4X6BA 1QBLL 4G8IB 2CRZA 1YNTA 5CMAA 3DSFH 3A6BH 3INUL 4QNPE 1U91B 4RA3A 4RRPA 2LQRA 4K94L 1FRGH 3BKCH 5CJOL 5DD6B 1DUYA 2PO6B 2HMID 2M2DA 2JKXA 3WXVL 4F9PA 3MLVH 1RSFA 2H9GB 1J1XH 1CBVL 3BMVA 4PJGA 3EFFA 1WIUA 3P77A 3D2UD 3C5ZB 2QJDA 3RX8A 3UJIL 4UOW0 2DQJL 5D96C 2HFFB 3EYSH 3HHRB 1FZOA 4H25B 3BRGC 3CSPA 3WLWD 4WV1B 5KVGH 2VABA 2KUTA 3CVHA 4LLYA 5I1IH 4DN3H 4KAQH 3BPCB 4QXTB 3LKOB 2HYMA 3LD8C 3V5KB 3U0TB 3NH7H 4U6YB 4JO2L 3QIBC 3H2WA 2CK2A 1LK3H 2ZKHH 5ANMA 4B50A 1DDHA 2BHZA 4X99B 5D93B 1I1CA 5IIEA 1HSBB 3GGWB 4N0CC 1ZLSH 4M5ZL 4NKMA 5D7IE 2B8OT 2NY1B 3G04A 4P46A 4B7LA 2B7DT 5CHNB 5T33H 3ULUL 4FQIL 2QHLA 2AJXL 4XP4H 2A6IB 2CIKA 3QH3B 2CIIB 3I50H 4MQ7A 1KTRL 5ECJE 2DI8A 4P2RA 1I3RA 4XI5D 5EG6C 3VFGH 3B5TA 1NFIB 1D6VH 4NN5B 3SO5A 3SN6N 1IC7H 1VKXB 4WO4D 4PJFF 2IQ9H 3LKQA 3U36B 3K4DA 3O4LA 3LN9A 1WCQA 1ZLVK 3HZMA 3TGXA 2E27L 2R4SL 2DMBA 3OHXA 4C83B 5I18H 4OGZA 1IQDB 1HXMA 4XNXL 1ZLWH 1QNZL 3QUZC 5EUKB 5JIKA 1UJ3A 1I85A 4GG6A 3SDCA 5D1QB 2FX8H 3SKNB 3ULUF 3JV6B 2C4FT 1L0QA 3TYGH 5KW9H 2OP4L 2W65B 5DSCA 3RWCB 2JIXB 1N5AB 5FO7B 1A2YA 5LBSL 4DW2H 2ZUQB 3VFMA 4KV5F 5ICXB 5H94A 3SOBL 5E9DB 1RD6A 1T5XA 4XCEB 3ZDZF 4DEPC 4G6JH 2KZ1B 2V9TA 1W2KT 4Z7VF 3MNWA 4XNZC 5ITBH 1OF2A 2A6JB 2FL5B 1DCLA 2EDLA 2RB8A 4XHJC 5FYLD 4OT1H 1CK0H 2PYFB 1FNEB 4NDMA 5HYJD 4QKXB 1YY8B 4JHBA 3ETBF 4HDIA 4NRYB 5MI0B 4YDKH 1MHHA 1I75A 2OZ4H 2YR3A 4OD2B 5FYLE 3HS0A 4ZUUB 3J7HA 1SYVA 2EKSB 4WHYH 3SGDI 1CFQA 5HYJE 4OFDA 5IBLD 3ABZA 5B38A 5K9QI 1GOHA 1X7QB 5I76B 2AABH 5BRZD 3JUZA 4RRPG 5E1AA 3CMOL 1Y0LA 5DUMH 5GQBA 2XPGB 3CFDB 2P43B 3QQ9D 3KYOB 3TVMC 5BRZE 1FVDB 5D4QA 4PJAF 4UT7L 3B5GA 4R26H 5E8DH 1I1AD 1R24A 3IGAA 4WY7L 1MCWW 3TA3C 4I2XA 2OR7A 4LLWB 1URLA 2BNQA 5EUOA 1TMCB 1GCFA 4L4VD 4PJ5B 1INEL 2R2CA 5FA4B 5FK9A 3WV0A 2HT4D 4X6CF 1LO3L 2DQUH 1Q1JL 5DQJA 3KPLA 4L4VE 1FORL 1K3IA 2W0FB 3VXSA 4QRSA 4DVRH 1H0DA 2VRAA 2QR0A 1DUZA 1IZJA 5JO5A 3HLAB 1X5LA 1NAMH 2DQHH 3HN3A 2COQA 5IVZA 5I1EH 1FH5H 4KHXH 5KSVA 4LSTL 4APQD 2CRYA 4Z7WE 3SDDD 2DDQH 1UM5H 5TE6H 4YWGL 1NFDA 3LDBB 1EXUA 4LCWD 1J1OL 1S9WB 4XNUL 1U0QA 3RNKA 1YQVH 1FBIL 1YPZB 1G7QA 1NGZB 4KXZI 3RWIA 3O6FB 4GJTB 3DX9A 5CILH 4XNYL 4ZOBA 2VKXA 3B4NA 3ES6B 5DGQA 4N0UE 1FJ1A 3UC0H 2CRMA 1B2WL 1S5IH 2WAHA 3CH1A 2F15A 5GRJH 5C0AB 2E6PA 5EORH 1A64A 4XPHL 5KVDL 2AEIT 4FQCL 2X89A 4EI6B 1U9KA 4KVCH 3TN0C 4LNVA 3R1GL 3H9HA 1Q9KB 1I9JH 3QDMD 5BVJA 1S7VA 4Q7DA 3JTSB 4R4NC 4U6HB 4HX1B 3GSNL 3OKDA 5KAQF 1D5XA 3N1MC 1U3HA 3QDME 4QHMB 3D9AH 3EOAB 5GRVK 3L6FB 4K8RH 5TE4L 3SY0B 3RIFF 2ID5A 3MFFB 3GKWH 2R0KH 3MRPA 4F58H 1OLZA 4PJHF 1C5BL 4G5ZH 2DQGH 3V7AE 2EIEA 3U4BL 5JOFB 4YC2B 2V5MA 3CUPA 3KHQA 3RIFK 5I66B 5EIIA 1HH9A 5IVNA 2Z9TA 4ONGL 4OI9A 1CG9B 4CRPA 4XPTH 5EU6A 4ELMA 4BA8A 1IT9L 4Z9KB 3I75B 2BK8A 4TPRL 4ZQKA 2Q3AA 3KXFA 1G7MA 3QPXH 4DUXA 2VLJD 3ZYZA 1NANI 2CO7B 3BQUA 4TRPL 3GBNH 4RMWA 1EV2E 2CLRA 3CXDL 5IEKB 1NMCB 2FGWL 4OLXL 2VLJE 1BQHA 4XCFH 5I71B 1CIUA 4DGYH 5E2UH 5JW3H 3O2VH 4IMLA 3PHQB 1N6QH 4KI5E 4DUWA 1MLCA 4IIQB 1LO2L 1FZKB 4PP1D 3L3GB 3P2TA 1BBDL 1MHEA 1JVKA 3PDGA 5HHXL 1CXHA 2C1OA 1HHGA 3PDOB 3G5VB 3QIUD 1AC6A 5LCVL 4PRDB 2J8UB 1NMAL 3GKZA 3KLAB 4NQEB 5HBBA 1JGVH 3IFOA 2W9DL 4I3RL 4H8WH 1WISA 5L9DH 2DM3A 2QQQA 5E99H 4WI2A 1MCJA 4ZUVB 3QFJB 3DYOA 1IQWH 2GK0A 3MOBH 5L2JB 3EYFA 4BSVA 1X5IA 3GMRB 1CGSH 5TDPA 2OXGA 4R0LB 5FCUH 2GTWA 2FX9L 3Q1SH 1KCKA 4KQ3L 3ZSSA 1LK2A 1H9VA 3KLHD 5A2FA 1E27A 2EYTA 5D7JB 4CNIA 2NR6C 1OW0A 4PP2A 3F12B 2WWMD 1UKQA 1INQB 1YEEH 2WP3O 3VXRD 2N4IA 5D6DA 3CDYA 1JWMB 4P2CG 3G6JF 5EU3B 2EDQA 4LQFL 5EZLB 4NQCD 4UBDC 3EYUL 3K8KA 4FTVB 5INCB 4MJ4A 2V2WA 4UINH 3VXRE 2BNRB 4HV8B 2JCCE 2V7HB 4NQCE 1PLGH 3MJ6A 1XIWC 4AIZA 3C60B 3IAGC 2W9EL 4JY6A 4MVBC 3HC4H 3NA9H 2ZCHL 1CDHA 3OKEB 5HXMA 3WJLA 4HLJA 4M6NH 1DBKH 2ADIA 2OZ4A 4J1UB 4K3JL 5FAAA 1DE4A 3B6SB 3U9UB 4JDZB 3O3AB 1U8OB 3CFJB 3IKCB 3O2DL 4OM0L 1A7RL 2HKHH 4WHCA 4OLWL 4PJ9B 4M6AA 2P5WD 5L2KA 1X4XA 2J6EA 2AGJL 4MNHA 5EZJA 2F58H 1T03H 4NHCL 3IS0X 1X5XA 2ZOKA 1N64H 3I9GL 3H7BB 5F9AC 3SE3A 2P5WE 5EOCL 2VQUA 4G3YL 2PXYB 12E8L 1KT2A 1BBJA 1VERA 4NO3A 3WL9A 4OZFA 5DJYB 1I9RH 2ZG3A 5D71H 3SDCC 3QIWD 3ZTNL 4J7RA 3ARQA 4P5MA 1DL7L 1R3LA 2AV7A 1O7SA 5F1KC 1QSFD 1IC4H 2P5EA 4C4KT 4M1GH 5KBNC 2NX5B 2UWEF 5K9KB 1GAFH 4UTAH 1QSFE 3ZDYF 3G5YB 5JPMB 3C09B 4PD4K 5FM5O 5AD0B 4OCYL 2C3VB 4CVXA 2WUCL 3RNQA 3HE7B 5EWIH 1BOGB 1U8IB 1Q9WA 3DI3B 3PNWB 3RDTB 4GAGL 5D1XA 2F53A 5J11B 3HR6A 2NLJB 4JPIA 3P73B 1NEZA 3X3FL 4NJAH 1CU4L 2R0ZL 3H9SA 4QHUB 3KYMB 1F2QA 1T1YB 2ZSVB 35C8L 2HFEA 3I3DA 3UJTL 1K9TA 2DLGA 1BQHG 1ZKAA 1KFAL 5FECA 4LSSH 4EKXA 4GW5A 2R2BA 4HF5H 2GHWB 1G7HA 4XWOC 5L8JB 2B2XL 1DQDL 3H0TB 1CFNB 3C9NB 3E2HB 3MRRB 4XH2B 5BV7B 1OGTA 2H6PB 1CTOA 4M1CC 3WHXA 4G8FA 4UOJA 3RGVD 1I1FB 4C59B 3MA9L 4N8VA 4DCQA 3CCHB 2OTWA 1QUNA 1MFNA 1MFEL 4UT6H 1KYOJ 1FCGA 3BUYB 1JZ6A 1OTSD 3L3JB 5EBMB 3T0BA 1SYSB 3EYVB 3UTTD 4IRJD 3QEGH 1HKLH 1YN7A 3RUGA 5L7XH 3UAJD 3MYJA 4LKCA 4MXVF 4X7SL 4R7DB 1MCHA 4BQ8A 1KNOA 3TO4C 3UTTE 3LAFA 4PRPB 5E4EC 3EZ8A 5HHOD 9CGTA 3DTXA 5EDXA 4JJHA 3HMWL 4Y4FC 5I30H 1RUQH 4I77H 4IDJH 5D96B 5HHOE 4D9LL 3T4YB 1NL0H 2WUBL 4NBZB 4I0PA 1T0MB 3TJEH 2NXZD 1YEKL 3STLA 4LHUB 1FVCB 3QAZC 3LD8B 4CU7A 3QIBB 3GBLA 5MEND 1H3XA 3GSOA 3U7YH 1UA6H 4ZXBC 5IV2A 1P7HL 4DZ8A 2XY1A 2BVOB 4TQEL 1QG3A 3G6DH 5MENE 3QISA 3D5OF 4HUWA 1YDPA 1JGLL 4PB9L 2GFBA 3CFCL 2EDTA 4C56B 4Y16D 1Q94A 4KK5D 4OZ4A 4PJIA 4HIEB 3UXFA 4QY8A 1IAOA 5DD3H 3IAQA 1EFQA 1E4KC 4K94H 4PLKC 1CLZL 1RK1B 1X4YA 2X1WL 5CP7B 3RTQD 2BSRB 2LU4A 4FFWD 4HIJB 1R5WA 5IG7B 3SDXE 5IFHL 1HH6A 3BRFA 1CBVH 5EO1B 1PEWA 5DEZA 1ETZA 5IESL 2FR4B 1V3LA 1YECH 3MRDB 4CN4A 3VFTB 4LAQL 5FUZH 1MI5E 4MLIA 3C87A 2UVFA 1G6RL 4RMSA 3RZCB 1J1PL 2X9YA 2UYLB 2AI0H 2R2EA 2PUQT 1UWGL 3HG1D 4P57A 4EQ3A 4OGAC 4QXUH 3SGJA 3QUZB 3P30L 3BW9A 2OL3A 3HG1E 3EUUA 4ORZC 1OPGH 2J8OA 1H3GA 2OJEA 4TUJA 1ZTXL 3PGDB 4OFKA 3X13B 1IGTA 4M5ZH 2JJVA 3BAEH 5T1KA 1IC5L 4EUPB 4U0RC 1HI6B 4V1DA 4XBGA 4NNXB 2FZ3A 1IM9B 3MV7B 3ULUH 1WITA 4GKSA 4GRWB 3M1BA 3BQUC 2YHGA 1D5BA 4CADB 3C6SB 2NTSP 1NEZG 3MSPA 4UILH 5EU4B 2NTFA 3NCJH 4QHLA 4HKJA 4DEPB 3QHTC 1I7UB 3OAUH 3V0VA 1S7QA 1JGDB 3V52H 5EC2A 5F7KC 4XVJL 3GB7A 4QRRB 4ZFFA 1BVLB 5C0BB 3V6OE 1ZEAH 3QCTL 3EAKA 4LPYA 4PIRF 4QRUB 1OT1A 3S35H 2AK1L 2BVTA 2YZ8A 4LNRB 3VG0L 4FZEL 3ET9F 3LVEA 1DQLH 4NNPL 2E27H 5DJAB 3WIIH 3VCLB 5H2BA 4N8VG 5FKPB 3IDYC 4J3VA 1BFTA 3PL6C 2PYED 2R9HC 4PJCA 3O41B 4NGHH 3X17A 4O2CB 4CGTA 4LCYB 3ILQC 1U8QB 2X4SA 3T0WA 3TT3H 1Z9OA 3AS2A 1RURL 3QNYA 2A83B 5J9PA 5E6IA 2GITB 2PYEE 4K9EL 1KJ2B 1RVFL 4K23L 5J13C 1JN6A 2EXYC 2X7LB 3TVMB 4U05A 5DUBB 2YPLD 1TJHL 1NBYA 3ZT6A 4FQXB 2XQYK 1KCRL 5HVWA 1R3JB 4UMGA 5J1AA 4GLRH 5C8JA 5DFVD 2YPLE 5I1LA 4BFBD 3QEQB 4F7TA 3TA3B 5AG9A 2ICCA 4NQUA 4BH8B 2Y5TB 4PJ7E 1ZGLB 2E9WA 4FFYH 1XGTB 1QBML 4NN6C 3QDHA 4GBXD 3FN9A 4PRHB 3VWJC 5E7FA 3MBED 5CWSA 1JUFB 3IRZA 4N5EC 2J88H 4L5FH 5DJDB 1F3DJ 4LDOB 5IK3A 3NAAL 3LQZB 4YDIH 1FL3A 5IJKA 4Z7UB 4XXCA 5FV2A 4XVSL 3GI8L 5IBUB 2AJSH 3GMLB 4ZAKD 2A9NL 1UH2A 1CT8A 1KLUA 5ISZD 3QQ3A 3F7VB 3MNVA 4WVRA 3UPRA 3OJMB 1VACB 1GHFH 2EDXA 2IQAB 3ZKND 5ISZE 1GJIA 2ZCLL 5ID0B 1T1XA 4XB8A 3FZUC 1ZT4B 3BEVB 1BD2B 3EYOA 4KI5F 4UT7H 1CL7H 3FT3B 3STZA 2DBJA 2MNUA 3CH8A 1B0RB 2R1XB 1IARB 1GSMA 3TN0B 4I3SH 1HK6A 4D0BA 3P11L 4D9RD 4L8SC 1Q72H 1LE5B 5DWUH 1K4DB 1MHCB 2GSGA 2VE6B 4WFED 3U79A 1F11B 1MF2L 2A1WL 3MZTA 1FORH 4P9ML 5HD8D 3DRQA 4D9RE 1FO0B 2EDWA 3HNTL 2YN5A 3CFEB 4WFEE 1AFVH 2ED8A 5JR1H 2ATPB 1KB9K 5I1CH 1IGFL 4HKBB 3T65B 3MACH 4LK4A 4LSTH 3S88H 4N68A 2WWKO 3AREC 3V4UL 3BP6A 3GJEA 1J1OH 3T2NL 3H6JA 4U1IA 4XNUH 4OLEA 2ZSWB 1WAAE 3KS0H 5GGRA 4J3UA 3O3BA 5C0EA 1TETL 3IDXL 3IDNA 4JCMA 4JEGB 2BVUA 1YN6A 4RBPH 4X6EA 1MAKA 3KPNA 2NY1D 4PGDB 3IXTA 4U1LA 4XPHH 5KVDH 4ZG1A 4KKLC 4FQCH 4LSRL 3VFSB 4HWZA 3DUUB 3H42L 3JWOL 5HHNB 2XACC 3L95B 1K2DB 3LS4L 1G7PA 3BE1H 3QI9A 2B4CL 1IGYA 2RIKA 2G60H 1OGAA 3PQYA 1E4XH 3RWDB 4G8EA 3WFHB 2APBA 4HUKB 3DUSA 1I1RA 4JFDB 3TJHD 4GUPB 4GRMA 1IAIM 5F3BB 4RNRA 2GJ6D 4L8CA 3M17A 4L3AA 5JXED 1U8MB 5HY9B 5T1MB 2VL5A 4K3GA 4J8RB 1RHHA 1OSPL 1QVOB 1WCBA 2GJ6E 3MR9A 4JRYD 2R1WB 4EN3D 1ZVHA 3OGOE 2HFGH 1X5YA 1NQBA 1GGBL 1BMGA 1YEFL 1AD0A 3FL7A 5EBLB 5D1QD 4JRYE 4OTXH 4GSDL 3IFLL 3GSWB 4X4XA 1JJUA 4XP1L 4QO1A 3VMOA 3OF6A 3BJLA 1BZ7A 4TPRH 2JIXD 5IEHA 4NM4H 1X44A 4HHAA 3KPPA 4JR9L 4TRPH 3CXDH 1BIHA 1KB5H 3SJVA 5C0IB 1B4JL 1ODAA 4Y19A 3LSOB 2AS5M 5ERWB 2BOBB 3OG6B 4J23A 5JW5B 1LO2H 2QADC 3MRCA 4NO0D 3OAZH 5LAXB 4LLQA 1JGEA 1XIWB 4G6AC 2HT2D 2H8PA 5HHXH 1K4CA 1A9EB 4Z7VA 2NW3A 1U8KB 4O58L 3S3SA 4GO6B 4U1JA 4J3WA 5JDSB 3L7FB 4PGBA 1QR4A 1U42A 4QT5B 4I3RH 3TH4T 2NXYC 1P84J 1BZ9A 1T1ZA 4L9DA 4UU9A 3BDXA 3EIFA 2I07A 4UTBL 3KNBB 4OV5B 2ENYA 1WC7B 4X4YA 2R15A 2J5LC 1J8HB 1I7ZB 3LQAL 1P4IH 4BH7A 4LLMB 1DZBA 3NN8A 1P9MA 5JLZA 1YMMA 1N4XH 3SCMA 1JPGA 3SDCB 4BQBA 4ZUSA 4GG6B 3MJ7B 3IETB 2XIDA 4HXAL 4M6MH 5ADOH 4X83A 2UUDH 1VGKA 5CJ8A 1NDMB 1WF5A 5D7LD 3R4DA 5EBWA 2J7LA 4KROD 4NQSA 3WD5H 5D7LE 1ES0A 2EH8L 4P3CL 4QYOB 1L0XA 4MD0B 2ESVA 1UCBH 2OSLA 4X6CA 3VDBA 4HEPG 5DFTA 1OF2B 1HQRA 1U93A 1HHKA 2MPAH 3GMPA 1SM3L 5F93C 5GGRY 5F1IA 2IAND 1IEHA 3O6FD 4P5TC 1U41A 2IANE 1YPZE 2NPLX 4KKAC 3BKYH 1N5YL 4XT1C 4WEMB 4WFGD 2FLRT 3SPVB 5C0AD 5F3HB 1IGML 2EDOA 1AR1C 4X7CC 4WFGE 1Y0LB 2B0SL 2AJYH 5C0AE 4WNQB 3RWJA 4Y8DC 5C86A 3HZKB 2D7TL 5E95B 3W11D 2DJ4A 1H15A 2VAAB 3FB5A 1FLRH 4MZ3A 4JRXE 5DEFB 3HC3L 4X6FB 2OM5A 3MLXL 2AV1B 2PW2B 3RIAF 5JIPA 4ODXA 4OFIA 5I1JH 3B9VA 1YYLH 4GAGH 2Y06L 5E4EB 1KN4H 1A6UL 3FB8B 3T4AB 3HKFA 2GAZA 2VXTL 1MCNA 3O81A 4Y4HC 2FATL 4U0QB 3QUYC 1Z9MA 2VXSH 4RGOH 2YBRB 4Y4FB 4S0SD 1P6AB 4XCNA 4Y5XA 1N8ZA 3ARDC 5TJWK 3W0WB 2BVQB 1F58H 3GJFH 2Q1EA 3L3DB 4H5SA 3QAZB 1G7LA 3RL2B 2X9XA 4F37F 4JAMA 1J0IA 1EAPB 3NIFF 3G9AB 3H9YA 2B1HL 1SY6L 5JNYB 1MRDL 3KPRA 5E8EA 4PGEA 4ZXBB 4JN2A 2Q76B 4P5KA 3UZQA 2V2XB 2QLVB 4HCRH 4HG4J 8FABA 4H0IA 3EW3B 3MA9H 5HGBB 1Z9LA 5AAWA 4S1QH 1YY9C 4BFIA 1O0VA 1U8HA 4LSDA 3D0LA 3HR5A 4F7PB 2IGFH 4OF0A 1LO4H 5CLTA 5AZ2L 3OB0K 3GSNA 3B9KA 1IEBB 1SJHA 2F5AL 2WBJC 5C6PB 3CK0L 1KBGH 1EHAA 2BHUA 4MX7A 4B53A 3QHFL 3GMMA 5B8CC 1T83C 3F7YB 4NQED 1XH3B 3B83A 4MWFB 1A6WL 1AO7D 3LIZL 2UZIL 3QEHB 1GIGH 2Z31D 2XRAL 3QO0B 2J8UE 4DVBB 4NQEE 2HWZL 1KPUB 4HMCA 4LP4A 2GUOA 3QFJD 4GG8B 4D9LH 4DGIH 3VA2C 2W60A 4O02L 5I19L 1X5HA 1TZGL 4IOFC 1AO7E 3NGBC 2GCYA 1UB5B 4R2GD 1FL5B 2A2QT 3QFJE 4JFOA 4OI7A 4JFPB 1EK3A 3U7WL 5IKCA 5D7JD 4NRZA 4HH9B 2HH0H 5GRUL 3DVNB 2IH3B 3D25A 3MUGA 4N90D 1QR1B 5E8OA 3VH8B 5HHPA 4XAKD 5EU6B 4FTVD 3DYMA 3HNVH 3CFCH 4U0RB 1KPRA 3FONB 4N90E 1D5MB 3SDYL 2HRLA 4BSWA 1IFHL 5I8KL 3BX7C 5GXBB 3BQUB 3C60D 5J1TC 2P8MA 3HI5H 2X70B 5F6IB 2VDOL 1N0LA 3BGAA 4MSWA 5HI4C 4K94C 1YQ2A 3LN4A 2XQBH 5BS0A 4PYHA 5MEQB 4JKKA 5IGXH 4WW1B 5KG9A 4FFZH 1G9NH 4LSQL 1J5OL 3RQ3A 3THML 5F7DA 3L7EB 2WSKA 3D69A 5I1DB 2DYPB 3QDJA 4RGMC 1LE9A 4K2UH 2X1PA 4HAGA 1A1NA 4PJ9D 1E6OL 1G6RH 4H26B 2E7BA 4O2EB 3O2WL 1X3DA 4P4KA 1C5DA 2D9QB 4FQHB 4WW2A 3LKSA 3G6AA 2ARJQ 2PXYD 1UADC 3IDYB 4I9WD 3VDAA 3PL6B 2YPVH 1KIQB 4J4PA 3O9WC 5IQ9A 1BP3B 4I48B 2BFVL 3WHE1 1ZTXH 1RIUL 5A16A 4YDLC 4LCCC 3C5JA 4W6XB 4BELD 1CS6A 4I9WE 1JNLH 4X7TA 5J13B 1IC5H 4GH7B 1J11A 3FQUA 3WS3B 3JV4A 4PLOB 5FO9A 1ED3B 5HDBF 5DGRA 5KVEL 5EO9B 2Z8RA 3IJSA 1NCAH 5KAQG 4JZNA 1FFNA 3T0EC 1EEZA 3EGSB 2NX5D 3RL1A 3K7UA 5T3XH 4PLJC 2OXHA 4RAVA 3JV0A 4DKEL 3BZEA 1YEGH 3DUHA 4JFFB 3UTOA 4NN6B 5JOPE 1UC6A 5K59F 1CDUA 3M8OL 2BDNH 3L5WA 4KDWA 3FQXB 3VE0B 3VWJB 3RDTD 3BYYA 5D70L 1UXWA 2QTEA 2ITDB 4G8GB 3FFDA 1IILE 4MAUL 4D8PA 1RJZA 3BKML 4P2QB 4XPBL 4HK3N 3VG0H 3O2DA 1C16B 2HLAB 1AGFA 4NNPH 3IXAA 1OM3H 2ZJSL 1RJYA 4FFVD 3FHAA 3X3GH 4RAUA 4JE4B 2NZIA 1D5ZA 1D9KC 1DSFL 5DD0L 5DRXA 5EBGA 3RWHB 4G6ML 8CGTA 3ARWA 4RFOL 4X6DF 4IRZH 4K23H 2G2RB 2XN9B 3EO1A 4ZS7H 3PP4L 3MODL 5F9JB 2EIZB 3MRIA 5FO8A 2WLZA 5DJXA 3GI9L 2V5RA 5T3ZL 3DV4A 32C2A 2BX5A 3SQBA 2A74A 3DJ9A 4L8SB 1Z9SA 1T0NB 3QYCA 4XX1E 4XMKL 4PRPD 3LQMA 3WKML 2BSTB 3MV9B 4PRIB 4PRPE 1FV1B 3NAAH 4JRWA 5JMOC 1OP3K 1FFPB 3TNMA 4XVSH 2VDPL 3GI8H 3KWWB 2I26N 1AKJA 1NAMB 3W9DB 1F4YL 3AREB 2EZ0D 3VGDA 1H5BA 4N0FA 1YEIL 2ZCLH 4TSAH 1JGUH 4IS6B 1NBZA 1AGBA 5K9JL 1WUNT 2VLRA 4N0CD 1M6OB 2PNDA 5GGUA 4I4WA 1HDMB 1NSNH 1JV5B 3DGGB 1F2XK 1TCMA 2W0PA 5IMLA 4QF1B 4HKXA 5M95B 3S4SA 5D1ZC 3ARGA 5DT1H 5KVMC 2BRRL 4EJ1C 3G08A 1MEXL 3PABB 3LRGA 43CAB 5H35B 3RJQB 5IHUL 3MRHA 2JJWA 3UYRH 4Q6IC 2DLTA 5FA3B 4PJBA 5K9OA 1KF9B 3FB7B 3QWRD 5T5FL 3HNTH 2E7CA 1KPVA 3RZCD 2FJHB 3CZFB 5CIPH 4N8PA 1IGFH 4X80L 2DIJA 3IFPB 3I2CL 3CPLA 3L5HA 3QUZD 3KVQA 2X4PA 3T2NH 1A6ZA 5JXAH 3MRQB 5DJ8B 2R23B 2Q8AH 3SO3C 4P99A 4JZJC 4RMVA 5DJZB 4JZOA 4LLVA 1TTGA 3OWEA 2X4UA 4UT9H 5AYUH 3QBTB 2UY7A 4ODHH 1NPUA 1MWAA 3MV8B 4LGPB 4U1HA 1IM9D 1S7XB 3MV7D 3PGCA 1VGEL 4LSRH 2MKWA 2YOCA 1Y18B 2B5IC 4JPWH 3MV7E 4K7FB 1LP9F 1JF1A 3H42H 4R8WH 2PW1B 2A9MH 3ECBA 5EU7E 2FIKB 1JZ3A 1GGYA 3KJ4C 1R5IB 3LS4H 3DXAD 3EFDL 1QP1A 5ETUA 4ZTPH 4YEEA 1Q94B 4LDLB 4L9LC 4QRRD 2WV3A 2E6JA 5C0BD 4XHJD 1ZA6B 4MNQA 5E1HB 1QFUH 2QADB 1T1WB 2XV6B 3DXAE 5SWSA 3IU4H 4HJJL 5E08H 3UTSA 4N1CA 3VGGA 4QRRE 3N9GL 2X1QA 5C0BE 5TQ0H 4I3GA 5IHBA 1A0QH 2VDQH 3EJYD 1S9VA 4OCSH 4NPYA 3I3EA 4M7LH 1U8JB 3P9LA 3BOVA 1NC2B 5SWZD 5DRWA 2PN5A 4CMMB 2NXYB 1UM4L 5J7CC 4QRPA 3QO1B 3WHE0 1RUPH 4XTRD 4H0GA 1L7TL 1IAMA 4GSDH 3V8CA 1KCVL 5SWZE 5DMIH 5ABDE 4E5XA 3TVMD 3ARFA 2VDML 2DI9A 2VB5A 3OTTA 4RIRA 3U0PB 4YJZL 4FQXD 2J5LB 1JK8A 4OZHF 1B4RA 2PTUA 3WLBA 1A4JB 1REIA 2OJEB 2ZNWA 1FAIH 5KTEH 3QCVL 1IKNC 3TA3D 2FEEI 3ZDXF 4ZYKA 5DEGB 4GXVL 1NKRA 1V3JA 2KBGA 3RPIB 2Z93A 3S37L 4YXLL 3TZVA 3X12A 2EC9T 4JANA 1B4JH 2G75B 3CAFA 1PY4A 1EH9A 2EIDA 4PRHD 4U1SB 5MHSD 4PV8B 1N2RB 1HHHB 5IWLC 3TP4A 3D39A 3D85A 3MV01 3S34H 1XZ0B 5MHSE 3HFML 2EO1A 2NTFB 1LO5B 1AD9A 2ORBH 3V0VB 2ZUSA 2QSTA 1G7IA 4UIMB 2VZOA 5EC2B 5I1KH 4OB5L 2VAJA 3RWEA 3TH2T 5ICYA 1CR9H 2EECA 4YBLC 2KH2B 3V6ZA 4YR6B 2FO4A 4X98A 5CEZD 1KENH 3HPJB 3S4SG 2E9IA 4HUXA 4P5TB 2CXKA 1R3HB 4OIBA 3UTPE 5CEZE 3OJDA 1I8KA 1FG2A 3I85A 3HB3D 3QDGB 3TFKC 1OCWH 3NCFB 3D18B 5HDQH 5TDOA 4RSVA 3UBXB 3ZMRA 1JBJA 1LEGA 5GZNC 4ONFH 5L6YL 4GKNB 1A6AB 3GMOA 2IAMC 2HVJB 1H3TA 3HAEA 4RAHA 4ZNCD 2YUXA 5KS9B 1EMTH 1OAKL 1ZT1B 3ARSA 1B0GA 5ALBL 4OZIB 4XMLH 3T1WA 1P1ZB 3KPQB 1Z0NA 2A77H 4ODTL 3VXUA 1KCUH 4LEXL 5LWYL 2W92A 4I13B 1UACL 3UTQA 4OZGF 2AEPH 2HLFD 5LJYH 2P7TA 2G5BB 3PHSA 4CAGA 4OLYH 3CSGA 2XKNB 4Y4HB 4HK0A 3QUYB 5D7SL 1P4BH 5I8EA 4I18C 3WLWC 4BK4A 3D3VB 4XMPL 4HKZB 1IAKB 1JI2A 4KHTL 1KEGL 2D0FA 1BWWA 3ARDB 5F88B 5GS1C 5JQ6L 1NCDL 3HI6H 1BLNB 3P4OA 4HJ0D 5DJCA 4Z78B 4P2OD 3VXOA 1JMZA 2EDHA 4NFDA 5GRWA 3WFDL 2J4WL 3QFDA 3U2SA 5GGQH 1VB9A 4EDXA 5JW4M 4ODSL 3F58L 2VLKA 4NT6A 5HHQB 3ARUA 1DLHA 5BOZG 3OXRB 3LRHA 5JPNB 4L4TE 2DTSA 4OQ1A 1AGEB 3CU7A 1EEYA 3HC3H 4PJXF 4JFDD 1N26A 4XPAL 4PY7B 1NUNB 3OB0H 2IMMA 3MLXH 5FV1L 1A02N 4MA8L 4WUKH 2LV4A 2WBJB 3NFPB 5JHDA 3GNMH 5MEPB 2E7LC 4JFDE 5FKAB 2VDKH 4WCYL 4XI5C 4AIXA 3TV3L 5B8CB 3VJ6A 2Y06H 3WUWB 5D72L 3T0DA 1CFTB 2VXTH 2WWKT 2BMKB 5ALCH 3U6RA 1TENA 3BD3A 3BEWA 2X05A 2GW5A 4M93C 2VITA 1PSKL 5EO0B 1EHLL 5TQ2H 1T21A 5F1SA 3NGBB 3HNSH 4RFEA 1A6PA 3V6FA 4HGWB 2DF3A 3FQWA 3LN5A 3SBWC 5DS8B 1SY6H 1MRDH 1P7QA 2EH7L 2YK1H 3HCVA 3BMWA 1VADA 1QLEH 2NR6D 4KRNA 1F8TH 5ANME 4Q58C 3KPNB 1T2QL 2C9AA 5HPOA 4P46D 5GPRA 4WUUA 3HMXH 1BOYA 4WEBL 3GSQB 5EU5B 3IT8D 1WEJL 3MLZL 1WFUA 1XIWD 2I27N 1DP0A 1OTUC 5JOEA 1SQ2N 4EVNA 4MVBD 3BIBX 4KZDH 1TNNA 3BGMB 4U49A 3OXSB 2AW2A 4CVUA 4Y1AA 1V7NH 2H41A 5F70A 4LGRB 1DQTA 1WFTA 4X5XB 4BFGA 2NNAB 1A6WH 1I9IL 3ARYA 4W4OC 2D0HA 4RGMB 4H0HB 3OKNA 2NY7L 4LMQE 5IR1A 3ZL4H 4U6VL 1S7RA 5D6CB 1BVKB 1F00I 4R96A 5DK2A 5DZLA 4MJIB 1CDYA 1TVBB 2X4OB 5BW7C 1WCBB 1IGIL 2BSSA 4YBQC 3O4LE 1J8HD 3TYFB 1PZ5A 3HAEG 4QOKB 3BO8B 3U7WH 3O9WB 3BDBA 1F4AA 4PJFB 3SDCD 1J8HE 3BZFA 4LCCB 1V7ML 4YDLB 1UFUA 2AJ3A 3B3IA 1UVQA 5D5MF 4MA3B 2V17L 4ZSOB 5IB3A 4GG6E 5DYOA 4ZUWB 1I1AC 3HRZA 4POUB 2FYYA 3VFWA 4V2CB 5I8KH 4U1KB 3QXAA 1MCOH 2JE8A 5HYIA 3T0EB 1A1OA 4WWKA 2H26A 1RUAL 1PGRB 5GRXG 2HT4C 4NKDB 4CL7A 4KDTA 2ZG1A 4LSQH 4PTTA 4MJ5A 3V0WH 2QQLH 1G9NC 5DJ6A 3VWKA 2Q7YA 4JFZH 2F8XC 1G9ML 4TTGA 4DTGL 3KYNA 1KG0B 4P59H 4WHTA 2NW3B 3K1DA 3KHOA 4ZOAA 1YUHA 2W0LA 3HPLA 1CWVA 5FGSA 1BM3H 1GPOL 3LMJL 1Z5LB 4E0RB 1D9KB 1RIUH 1MJUL 2DLFH 3AS1A 2AK4B 1U2CA 2C7UA 2O5ZL 3MRJB 3UBXI 4NC2B 3MA7B 2OJZL 1HHIA 4JG1H 2FHFA 3C8HA 2Y1VA 4LCUB 1KJVA 1JNHA 1S7UB 1QLRB 5HVFB 1UWEL 4R9HA 2IADB 1ADQL 3BSZH 1C08A 1GZPB 3VRLE 2EICA 4I2XE 4WI7A 2OTPA 2GI7A 4PJAB 3QRGH 4UDTA 5EUOE 1J10A 1KULA 5J89A 3VXSD 5ID1A 4AEIL 3GK8H 3NTCL 1KTLB 3WO4C 5DQ9A 3ILPA 3VGAC 1D3CA 4PJDF 2FHCA 1ES0B 1QFWL 3AUVA 3AU1A 1UCTA 3VXSE 3H3PL 3OX8A 2YD8A 4YHPB 1C8PA 4X6CB 3W0WD 5TDNB 3TNNA 5DLML 2NYYD 2H45A 1RY7B 3VFOB 3B2VH 5F1IB 1DSFH 5DD0H 4U4BA 4YFLI 4JLRB 1A7QH 1JYVA 3RA7L 4QXGL 3MLRL 2A73A 3BP5A 3V6BR 3P9MA 4X9HA 2RCSH 3MBXH 5T1LA 3PP4H 3MODH 5MERB 4YHZL 4A6YL 5C08B 4JFEB 1MFAL 2NY3D 4NO5B 3LS5L 5D1ZB 3PWJA 1C12B 4PLKD 3T77A 4P2YA 2ATKB 3GI9H 5LQBH 3X14A 3CX2A 1A3LL 4KI5C 5ICZA 1ZWIB 3L5IA 3MYZA 3PUCA 3BPLC 1T2JA 3KPOB 1R0AH 4Q6IB 1QBAA 4ZPVB 5IW3A 4AQ1B 7FABH 1V05A 1MY5A 4CN6A 5GGSA 4OCWL 3DBXA 3G5ZA 1VFBA 3GMQA 3QIUC 4R7NB 5F7NC 4YPGB 2YD3A 1QEWA 4OGAD 4OCXH 1I7TB 1HCFX 4HS6A 4NZDA 2NY4D 3GHEL 3WIHA 3V5DA 4HWBL 2OMNA 3LHPH 4YIQA 3SO3B 3K0WA 4JO4H 4JZJB 1FGNL 2EXWC 4HS8L 1IAIL 5EU6D 1KV3A 1ONQB 4EIGB 3WFBL 4YX2L 4YZFF 3SGKA 3RY6A 4PJHB 1ZGLM 3QG6B 5DDHA 5DI8B 5HHMB 5FYJD 5C9JB 5CCKL 3KXFD 4M48L 4JFYA 5EU6E 4PGZA 4ELME 5HPMA 4Y4KA 3BQUD 1FHGA 3ARPA 5CLWA 1S9XA 2B5IB 2WWMC 5T1DL 5FYJE 4PG2C 3KXFE 2Q20A 5C0CA 5IHUH 1Q9LB 4O9HH 1MLBB 4NKOB 3KJ4B 3N1QC 3QNXB 1EX0A 2ED7A 3L3OB 2XY2A 3WNKA 1MJ8L 4W4NA 4Q9QL 3E0GA 2CRIA 4JGJA 5GS2H 4L9LB 2FO1A 1M71A 4WI6A 2DYPD 5T5NG 1MCDA 4ZFZB 4K3EH 1WICA 2CKBL 4YHNA 4TVPL 3UROR 1UB6B 1JHLL 3KPSA 3SE9L 2XNAA 2YZ1A 3WSQH 3DO7B 2P24B 5F89B 3CFKB 3QG7H 3V4VL 5J0BA 1UKSA 4PBVC 5DA4A 3HUJF 1F02I 1OB1B 3ILQD 1E28B 2PTTA 3NZ8A 1OAYL 4DQOH 3VXMB 2GCYB 2RAMA 2EXYD 4P9HH 2JK5A 3O4OC 3PXHA 1TFHA 4JFOB 3F5WB 4O2FA 4WJ5B 3V4PH 4XBPA 2Q3ZA 1INDL 3QIWC 4JKLA 3VXNB 2A6DB 4N8CL 3GM0A 2Z8SA 4YDJA 4NQDA 1LDSA 5KSUA 2C3WA 5JUEL 1SBSH 1DEEA 1KB5B 3EFDH 2FSEA 3FOLA 3VWJD 4D0CB 3PIQA 1EAJA 2KKQA 5BO1H 1CLOL 1J12A 4G8GD 4N5ED 5HYSA 2DMKA 4KMQA 1CZ8H 4WI9A 4JQIL 4P2QD 4LKXB 3OR7A 3G6JB 5BVPH 1P84K 2M8XA 4G8GE 4AMKH 4YAQA 5ITFB 5FHAL 1MJ7H 3GHBL 4U1MA 1NGPL 4JY4B 1YYMH 2XI9A 1MCPL 2JB6B 4YBLB 1UZ8A 1T3FB 4JY5L 3U9PH 1UM4H 3PWVB 1L7TH 2ICWB 4ELKA 1E4WL 3FZUD 4XRCA 3TF7C 3RWFA 3KS0J 2F54B 1VHPA 1JPSL 2XN9D 1JCKA 3VFUA 3IJHB 5L2KE 5F7YC 3RHWK 1HNGA 2BC4A 2BY3A 4Z0XB 4MAYA 2DWEB 5FFLA 3MGTA 3PWPA 4XBEL 6FABL 5SX5K 3A6CL 5IFAL 2R29H 4AEHH 3EDJA 1BREA 3D0VA 4HFWA 4L8BB 1EHXA 1UH3A 1A22B 2I5YH 4YXLH 1NC4A 4PB0H 3S37H 2IALB 1SEBB 4GLRI 1JZ8A 2IAMB 2Z35A 2I9TA 2P5ED 3UTZB 4M7ZC 5IB2A 4PJGF 3IJSB 4JZNB 1OTSC 2FWOB 2X4QB 4NKQB 5GJTL 5FOBB 1M7DB 4PRID 5BZWB 4DK3A 2DWDA 4IRJC 2P5EE 2VJXA 3BWAA 3BZEB 3UAJC 2NMSA 1FDLL 4HIIB 3P0GB 1ZXQA 1EERB 3MXWH 2IFFL 1GRWA 3O6MH 1OD7A 3QWOA 3D2UB 2F53D 3P4NB 3FOMA 2UWEB 3IFNH 4HC1L 2R1YA 3GRWL 5CBAB 1RFDL 2WINB 3KYKH 2EE3A 3H9SD 1ZVSA 2F53E 5GIRA 3V5HA 4I18B 4QEGA 2NXZC 3IXAB 4LU5L 1Q9OA 1WBZB 3H9SE 5GS1B 4NQTA 4QLRA 4JFHD 4MNGA 1UG9A 4KKLD 5D7IB 4IMKC 3DPBA 1CL7I 4M4PA 3G5XA 1ORSB 4JFHE 4Z7QE 1KLGA 1RK0A 5F97E 1UQSB 2CDFB 4FMKA 1W72H 4OGYL 1G0YR 5HJ3A 4Y16C 1AHWA 5FM4A 1XF4B 4KK5C 4PJ8A 5F7EH 2QQNL 1MRFL 4F7CB 5F7FA 4WTZA 5A40E 4NZRL 2OCFD 1QPXA 3DVGA 4ODTH 3ULVL 4JB9H 1CGTA 4JKPL 4LEXH 4P3DB 5CD3A 4I5BA 5GS0D 4NUJB 4L4JA 1UACH 2Y07L 1T89C 4K8RD 3QULA 5ACZB 1UH4A 1XF3A 4K7PH 1J0HA 3RVVD 5B39G 3QRFM 4NYLB 1S7TA 5EOTB 3T3MF 4M93B 1XF2B 3FCTB 1TVHB 2ICWJ 3FT4B 4OCRL 3MV8D 3CMGA 3S9DB 1XR8B 1TIUA 4N0FB 2B1AL 2EDJA 2IH1B 3GJFB 5EPMA 4X0KB 2OK0L 3KG5A 5HYSG 3S37X 3RZWA 1BQLL 3FO9B 3IDJB 3WN5C 4NSKB 2YD7A 3SGEH 4MDIA 3GMNA 5E2JA 2XKUA 5J6HA 3WXWL 2NY5C 1K8DA 1A14H 2D7PA 3OGCB 4YXKH 4MXWH 1N6VA 4ESKA 3WE6B 1DQQB 1KIRB 4HUUA 3AY4A 5D9SB 4OLVH 4MA8H 5KSAA 5TPWH 4PJIE 2YEZB 1E4XI 4ZD3H 4QGTA 2VQ1B 3IDUA 4D2NA 4WCYH 4PS4L 3HE6A 3U4AA 5K9OB 5CZVL 1NC2D 5D72H 1LEIB 4Y2DA 1EA9C 4M7KH 2X4NA 5HYJB 3QEUA 4HPYL 4D0DB 3BD5A 2FB4L 4ISVB 5ESAB 1EHLH 4PRBA 1ZHBB 1SMOA 1WTLA 3WIFB 3REWA 5I17B 4M5YL 3TBTB 4YHKL 2BZDA 3RVXC 3T8XB 2Q8BL 3FB6A 5BRZB 1KIPB 3NACL 3EDFA 3NCEB 4OGXL 4WU5B 3LV3B 1MJJB 1WWBX 2LAAA 1F3JB 5T1KD 2W59A 2R0LH 1OARH 4KU1A 4OZHA 1I1AB 3RPKA 1PG7L 5B3JF 2QSVA 3MLZH 4NZUL 4FXLA 5J8OA 3MRKA 3MREA 1JZ5A 4L4VB 4GBXC 4NC1E 2L7UA 5E2VH 3TCLA 1WBXA 2A0LD 2MFNA 4QTIL 4U1NB 5GRYA 4TSBL 1NFDF 4JG0L 4M4RA 1DFBL 4JFQB 4HJGA 1RZJL 2IPKA 4TOYL 3RAJH 5I1AA 1W0VA 4M43L 3I6GB 5FEBA 5C2BH 4U6VH 4MB3A 2YC1B 1YC7A 3K2UL 4HXBL 4ZAKC 2ICWI 1G6RB 2RJMA 3OAYK 4KKAD 2GSIA 4DZBA 2ZPKH 3OSKA 5DRZB 3TBVA 5CEXA 1QSEB 4KJWC 1YEHL 1NGYA 3QDGD 1BWMA 3DIFB 5I8CB 1Z6JT 1M05A 4IHOB 3ZKNC 43C9B 4GMTL 2VLMD 1AR1D 3GSRB 4ZPTA 5E6ID 4WTZG 1MUJA 3QDGE 4PJCE 4YQXL 4LPWA 1CYGA 3K81A 3FTGB 1K3ZA 2VLME 2R4RL 3LKPA 4XP5L 3O8XA 2AJZA 3MUHL 4P23A 4KY1L 4XAWH 5DJ0B 4NHUB 4PV9A 2LU7A 3I6KB 1JHTA 4GXUN 1ZANL 1AXTH 1NCCL 5LGJA 3MUY1 3QDMB 1FIGH 1OY3B 5IT2H 4S2SB 5CUSH 3MV11 2WLYA 4S10A 4LEOA 1BFVL 2YKLL 4UDUB 4BKLB 2A38A 4PY8J 3TC9A 1A6VL 3O3DA 5C6TL 4JN1H 3WO4B 1I8LA 4Y4HD 5EZOH 3VGAB 3QUYD 2I60H 3IB4A 1RZFL 5D2NC 1ZS8B 3MO1B 5IJVA 5IFJA 1G7IB 2F74B 2NZ9D 4RMUA 5LGHL 3X11B 1GPOH 4JDTH 3LMJH 2BHYA 3DMMC 1MJUH 1MCEA 1XGYL 2HN7B 3VRJA 4GW4B 1WTGT 4YHLH 3MLSL 3AAZA 2OJZH 4ONHA 3ZKXC 3JTTB 4Y5VA 4HUVB 4PG9A 4BQ9A 3VI3E 2IF7A 1HXYB 4ZO8A 1X5ZA 4G9FB 4LFHG 5IHZB 3WKNA 1QQDA 3P4LA 2VLJB 3P4MB 4XPFL 1UWEH 3UEZA 4Q97A 1FC1A 1ZT7B 1PQZA 1YJDL 2E5EA 3JWDL 3TPUB 5DHXB 2HRPL 3BPLB 3PWLB 2C4XA 5J6GA 3DX6A 1EFXA 2I25N 2HKFH 1SEQH 3TJHC 1QFWH 2D31B 5TF1L 3AFLA 4YO0A 5JXEC 3QIUB 1DR9A 4MCYA 5DLMH 2RFXB 1E4JA 3LKRA 4F8QA 4X4MA 1A6TA 3BIAX 4WI4A 4EN3C 1GC1L 5DR5L 1J86A 3GIZL 3EO0B 2PR4L 3FT2A 4KRPD 1JRHH 5IOPA 4WO4A 2AXGB 3MLRH 4J6RH 1DBBL 4M61B 4A6YH 4NUGH 2OTUB 1MFAH 3OKOA 4JPKH 3UDWA 1CFSA 2JJTC 3DSNA 1MNUL 4KRMB 4X8JA 4Q9RH 5GGVL 3QUMH 3UJJH 3VXRB 3MLUL 2F5BL 4ZS6C 2JCCB 3FO1A 2GIYA 4AM0A 4NQCB 3LRSB 3AS3A 1DLHB 1VFAA 1OAXL 4LBEA 1A7OL 1FNGB 2Z8VC 5DD1H 1OGAD 3PQYD 1XGRB 2A6KB 4LARL 4JDVB 3FO2B 5KSBA 5LGKA 2VXQL 2V5TA 1YNKL 4PREA 1FVEB 4OCWH 2HT2C 3O11B 5BOPA 1OGAE 3PQYE 3FFCA 2NW2A 3VW3H 2FX7H 4YE4L 5CIPB 5CEZH 1I9EA 1XMWA 1TCRA 1IRAY 4HWBH 4QOKD 5DVKA 1L9NA 3U1SH 4YXHH 4GQ9L 1ZA3A 5MEOA 4LF3B 4HZLB 1AIFA 5JORA 3LZFL 2P5WB 4QOKE 1KJMB 4HS8H 3RWGB 3BT2L 1U8NB 3KR3H 1FPTH 2ERJC 4WI5A 2ZG2A 4ZTOL 4PJFE 3WFBH 5DHYA 3O4OB 3DHJA 1AJ7H 4M62L 1BEYH 1P4LA 3FQWB 3VGFA 4H1LH 5AEAA 2ILLA 4FZ8L 3DROB 3CLFL 1KELH 3HZVA 3FN0H 4WFHD 3H8NA 3QIWB 3REVB 3U7AA 3ULUD 2JELL 3MLTB 1JWUA 3MGOB 4N0YH 3A67H 3SJVD 3SQOL 5HYEA 4Y19D 4WFHE 1FNSL 3ULUE 2Y23A 1QSFB 1A7NL 3SJVE 4ZDHB 2BVPA 4WU7B 4KROC 4Y19E 5MP6L 1BF2A 3GFUA 3PWNB 2YD1A 4ZOEA 5B22A 1BFOA 4HIHB 2CKBH 3JVGC 1XF1A 1ND0A 4TVPH 4LLDB 5F9OL 1XR9A 3F65A 4OIIH 2QL1A 4OV6F 3QJHA 3ZDZE 6CGTA 4Z7VE 5C0DA 1L7IL 3P0YH 5KANG 1MAML 4Z7QF 4X8XA 4OQTH 4Z7WA 2AK4D 4LRIA 2QSQA 1JNNH 1CGVA 1CICC 2I9LB 3CVIL 2APFA 3JZ7A 3MRBB 4APQA 3SDDA 2IG2L 1F6AB 1IEAA 2ICEA 4LCWA 4P9HC 3AC0A 1G7JA 4UIKH 1T22B 1ZHKA 4QTHA 3STBA 1YMMD 2P8PB 2DL9A 3SCMD 5SX5H 4KH2A 4AENA 4YGVA 3CC5A 3W11C 3RUGF 1MRCL 2C3HA 1YMME 4ODWA 4G43B 2MKLC 3NABL 3OZ9H 4M7ZB 1X5GA 4PJAE 2HG5B 2AJVH 4FABL 4DKFL 3UTTB 2XZAL 3QCUL 4IRJB 4K7PY 1G0DA 2ESVD 4Z5RB 3BN3B 5KVFH 4XVUC 5FHAH 3GHBH 3W5NA 1GOFA 2ESVE 5HHOB 4X6CE 5DZNA 4UOW1 4PJDA 3CVHH 3BISA 3DWTA 1KXTB 4PGCB 1FL6A 4OM1H 1E4WH 4AT6B 1I1YB 2NXZB 1QFOA 4LRNH 5ILTL 1RZKH 2H32A 3E6HB 3FQTB 1R3KB 1IL1A 1A1MB 4XBEH 4PJIF 1WJ3A 4GAFB 3A6CH 4YNYA 1OAQH 5IFAH 1DVFC 4E41A 3HZYA 4YDVA 5FGBA 2LABA 1U92A 5DD5L 1KTDA 3L5JA 4LVHC 1ADQA 1LNUA 5IROC 4FQQA 2YD6A 4Y16B 4M6OL 3OKKB 2R56L 4MA7L 3T2OA 3UMTA 5I2IA 1Y6NR 2QQKL 3Q6FA 4X5WA 1BX2B 5IB4A 4POZD 4UQ2B 2CGRH 4Y5YC 2OQJB 4K07A 2DQCL 2J12B 4ODUB 3BD4A 1HILB 2ARJB 3WFEL 1MI5B 4YHIB 3O3UN 1WBYA 2G9HB 4NBYB 1J18A 1PW3A 1CTNA 2X44D 2Z31C 1X5JA 1D6EA 3EJJX 1NLDL 4F2MA 1RFDH 3DX7B 5JIIA 4Q0XH 3JXAA 1T5WB 4MHHI 3QUKB 3W9EB 2X4TA 2XG5A 3HG1B 4LU5H 2Z92B 4R2GC 4R0LC 3U46A 3UO1L 5HHMD 4ORGA 5LG1A 1F4XL 1NDGB 3LH2L 3C8KA 3MLYL 2YN3A 3KPRD 5IF0B 2HP4A 5BMFH 4A6YA 1ACYH 3CSYB 4PJHE 5TFSH 5HHME 5CJBA 3QXDA 2GTZB 1JTPA 4LVNC 2FNBA 2Z4QA 1OSZB 3KPRE 5CJXC 5CEYA 3ULSA 1UT9A 2DQTH 3WN5B 4FXKB 4OGYH 5LKNA 2V7NA 5ESQB 4HMDA 4NZTL 3P0VL 1CD9B 5SWQB 2QQNH 1W0WB 4NIKB 2IPTH 3SEPA 4AH2A 5EH1A 3MRFB 2ADFL 1SBBA 2CLZB 2IBGA 1OT2A 4NZRH 5ESVA 5C0GA 1PYWA 4ODVH 3PGFL 4JKPH 3MOAL 3UYPA 2YMXL 4W68A 4XCCH 4R90H 2LVCA 3DETD 4OD3H 4MD5A 4NJ9L 4JHWH 1CD1A 5CSZB 5ENWA 1J9CT 1S8DA 4LOUD 1MIEH 1MCWM 2EYSB 2XFXB 3VXMD 4OCRH 3BKJH 4G80B 3DVIA 1TXKA 1RZIB 3VXME 1XGPB 2VWEE 3HUJA 4HWNA 5D8JH 3MNZA 4O4YL 4AJ0A 4FQJH 1NGWA 5CJQH 4UV7H 4H1LA 4I8DA 1I3GH 1HHJA 4WGVB 4E42B 2YPLB 3HC0B 3WXWH 3L3KB 1OQOA 1J05B 2H3NA 3GZKA 3O45A 5BV7L 1T4KB 5DDHB 2MCG1 3SKJH 5HPMB 5CINL 4OAWB 3V0AC 1T20A 5D2LA 3BHBB 5IBTH 1OAUH 2VKWA 2P8LA 2UY6A 2XYCA 4TSCL 1UXSB 4DJMA 4GBXB 3W82A 2FD6H 5TH2A 4GQPH 2CKBA 3C6LC 2IBZX 5BS0E 1T7YA 1A7PH 4S1DC 5IW1B 3FQRB 1AP2B 4EXPX 4HPYH 3T0XA 4EQ2A 3CDGB 2CLVA 2WANA 3EO9L 3QDJE 2R8SH 5CKAA 1JF6A 1A8JH 1AQDA 4N9GB 4ZAKB 3VI3F 2VR9A 5ISZB 5DMKA 4K55A 4M5YH 4Z77A 5GSRB 1NGXA 1ZLUH 2ZCKH 1YNLH 4J4PD 4S1RL 2R69L 5FF6A 4WGWB 2PTVA 3WJJC 4OGXH 5FXCH 4MDJA 3BZ4A 5FDWB 2DN7A 5BQ7A 5GJSH 2PCPA 3RFZC 4MXQC 3E6FA 3LKNA 4XC3L 1AGCB 1F90H 1KC5L 3NIGE 3QA3A 2DKUA 3OR6B 4TUKH 2CDGB 5DMYA 1Q8MA 1U8LB 3DURA 4NZUH 4EI5A 5B39B 5EZIH 4B7IA 3SE4C 4JFXA 1RULL 4KVNH 2R2HB 3QJFA 4CN1A 4NWUL 5DUPH 1XCQA 4RZCB 3L9RB 5BZDB 3T3PF 4UQ3B 3ARBC 4JG0H 2VDRL 4LHQB 1JHKH 4ETQB 4EXKA 5HDLA 2O5YH 5HYQB 2M26A 3PV6B 3L5XH 3PP3K 4NM8H 4P0DA 4HXBH 5D2NB 2UWEE 4Z8FL 3ZDYE 2ITCA 2VMFA 1EGJL 2DKMA 3SE8L 1IBGL 4OKVA 2EZ0C 3N1PC 2AJUH 5BXFB 3ROOA 3DMMB 1S78C 3NFNA 3MRGB 3EBAA 4QCIA 2EDEA 5L8KB 1A4KB 2SEBB 5E94A 2XWBB 4R4FH 1AQKL 2XZCL 5FYJH 3LEYL 3VFUB 4OFPA 1D5IH 4CDGC 1HOCA 5IQ7L 5F1OB 3ZKXB 4TUOA 4XP5H 2VXUL 4BZYA 5ADPH 4XC1L 4XNMB 4J3XA 1LO0L 1FZJB 4HFWB 4X6DB 3R8BB 1CXIA 2W38A 1I7RB 3W5MA 2WQRA 1RJLB 1KACB 4RA0C 1XGUB 1U95A 4PTUA 4Q2ZA 5JDJA 1H3PH 1V3MA 4PJEA 4KZEL 2ADJA 3SDAA 1I8MA 3IDMB 4RDQG 1K5NA 5TGBB 5C6TH 1UKTA 3SDXA 3ROLB 5IMOA 4JO3H 3RZCC 4H1LG 4F7EB 2GJ6B 4HC1A 3RTQA 3GRWA 5LGHH 1NAKL 4S1SH 4MXVE 3MRNA 3FOMB 4JRYB 3VRIA 3OKMA 1DQJB 4EN3B 4QRQA 5C2UB 1HEZB 1EPFA 4RMRA 4L8DA 5GSVB 2QKIA 3GIVA 1E6JL 4M7JL 3IJYB 3W2DL 4AL8H 1ZSDA 1NCTA 3MLSH 5IW6A 4GAYA 1WWCA 2VH5L 1GGCL 1PG7X 1TJIL 1YC8A 5F7UA 1LDPL 3VFNA 2VLRE 3BP4A 2FJFB 1DN0A 5EU7C 2YPKB 3R06A 5AUMB 1KJ2L 4GRWF 1EHNA 3ARGD 2DBLL 1JPFA 2AXFB 5FGBC 1OTUD 1BIIB 4FXGA 1YJDH 2VIRB 3GSXA 4WENB 3QZWA 4HS3B 3O3EA 3DV6A 5E5MB 3TBYA 1VA9A 1RIVL 3O6KH 1RIHL 5EC1A 2EYRB 3WS6A 3BWUC 1BGXL 3EHBD 3Q0HA 5DRNA 4RQQA 4NO0B 1UEYA 5F96H 2DJSA 3HI1A 5FYKL 4PJBE 4GKZB 4AYFA 2VC2H 1N3NB 1YEJH 4UV4L 1R6VA 1ZHLA 2HJLA 4WRLA 3EJYC 2DQFA 3V6OA 3EYQC 1BAFL 3T0VA 1C1EL 1LEKA 4GRLC 4YBQD 4HUMB 1WV7T 3GIZH 3AM8A 5HGDB 4ENED 2J6EH 2PR4H 1S9YA 5DJ2A 3M45A 3OJ2C 4XTRC 5HGHA 4OUUA 4K71C 1AXSB 5IM7A 1TZHA 2ERJB 4OZFH 1CI5A 1LD9B 2ADGB 5JHLL 1IM3B 4FQXC 4OUOA 1HCVA 2PYEA 3IF1A 3H7LA 4HLZH 4OD1L 3BP7A 5C07A 1RZ7H 5GGVH 4KMTL 1B9ZA 1FGVH 3MLUH 4M3JA 4DAGL 1F45A 3VFRB 2X4RB 3ALXA 2Q6WB 1AGDB 1IGJB 1U8PB 5FYJU 4KK9D 5D7LB 2ZUYA 4PJ7A 4L29A 1CGYA 5BJTB 5C0FA 2CXGA 4NFBA 1T7WA 5GHWH 5SWSD 4JHZA 4KROB 5E0QA 5C3LD 3UTSD 1CDBA 3T1FB 3EOBB 1HE7A 1KCSL 1LP9B 4D3CH 4HIXH 4JREC 1TQBC 4MNQE 3WEXB 2WIIA 5SWSE 3OBAA 3WNOA 3UTSE 4AG4H 1FO0L 3MPCA 1CDGA 1QLFA 1QSED 3MBEA 4JM4L 4FQ1L 4PRNA 4H20L 1QYGL 5FCSH 2IANB 4QRPD 2KL6A 1MFBH 1QSEE 4Q74A 3LCYA 3TBWB 4LSVL 25C8H 1FN4B 1CICB 1HNFA 3EOTL 4LSUL 3R0NA 4QRPE 3TPKA 3ARFD 1Q38A 3HB3C 3NZHH 3KGRA 3MRMA 4J3SA 3TWCH 1XGQA 4OSUH 3BIKB 5F1NA 3WNLA 3FQNA 1SJEA 4WDIB 1ZOXA 5EFIB 5KJRH 3HRPA 3TZVD 4MB5A 3SQOH 3RY4A 3TO2A 5F7MC 5T3XD 1PX3A 1UZ6E 4JRXB 3VXQB 1GGIL 4WEUD 4G8IA 2FCBA 3EZJB 2ZOLB 3CZJA 1Q0XL 2BOCB 4C57C 1U91A 4XXDB 5T3XE 1EVUA 5MP6H 3GSVB 3D39D 3D85D 4NWTH 1YEDB 5GS0H 5DD6A 1P2CB 2PO6A 4IRSC 3D39E 1VFUA 2H9GA 1DBJL 1K6QL 4AEFA 2GJZB 3MJ9L 2HLFC 4JQXA 4IOIB 3C5ZA 4D9QD 4CW1B 4KKCD 3TT1H 4G42B 1OL0A 1VFOA 2HFFA 4JQVA 4Z95L 1QFPA 2IEPA 4H25A 2VN7A 4WV1A 1MQKH 4D9QE 4ERSL 3CVIH 1WAAA 3RKDC 4RBPK 4S11A 5I1HL 3BPCA 4QXTA 2IG2H 3LKOA 4HJ0C 3V5KA 3U0TA 5E8PB 4U6YA 3VDCA 3BH9B 2E7MA 2VUYA 4G9FD 4P2OC 1M05B 1QA9B 5EIQA 1SJVA 2YA0A 3QNZB 4NKIH 1OAZL 4X99A 4TULL 1W8NA 1XFPA 3EDDA 1DVFB 1HSBA 3GGWA 4G9FE 1CXFA 1KLFA 4KI5D 4LVHB 3SKMB 3W81A 1CVRA 2XWJB 5B38G 5CHNA 3T08A 1WT5A 2YUZA 4DKFH 4KI1A 2A6IA 3QH3A 2CIIA 4LDEB 1FFOB 3MCKB 4Y5YB 2VDLL 5C92A 4F9PC 3B43A 5K9QG 3CFBB 4MJ6B 1HQ4B 4RWYL 1NFIA 1CE6B 2AERT 1QACA 1AO7B 2ICES 2CR6A 5E2TH 3RBSA 2Y36H 5HI3D 2Z31B 1VKXA 2BXYA 2ZUTA 1HWHB 3U36A 2EXWD 4IOSD 4O51B 2OL3H 4OZGB 4C83A 4O5LL 4R2GB 4ETYA 1CF8L 1IQDA 4G7YH 2XOTA 5ILTH 5EUKA 1A5FH 4HT1L 3FO0H 4F33B 1RZKC 2Z91B 3VFVB 1MCQA 3NPSC 3OKLB 1HSAB 4X4ZA 4NQXB 5D1QA 3SKNA 1BJ1H 3TIEB 4LVNB 1AE6L 2W65A 4P46C 4XPGL 3RWCA 2MWCA 4EDWH 3ESUF 4LLAA 1N0XH 3H3KA 4LPUA 2JIXA 4MA7H 1N5AA 5FO7A 1W72B 2VLKE 3OAZK 4UB0H 1S3KL 1N6UA 5ICXA 4HQQL 4NP4L 5E9DA 4G7VL 1EBPA 1H3UA 4U6XB 4YHML 5JHDD 5HGAB 2BJML 4G9DB 2DQEH 4W6WB 3LEVH 4WW2F 4KJYB 1QKZL 2A6JA 2FL5A 5JHDE 1EFXB 1TZIB 2Z8WC 4PJXB 3FKUS 1UM6H 2Y6SD 3KDMB 3ALPA 2PYFA 1FNEA 5B3NA 1YY8A 2C1PB 3WDHA 5IVXF 5CP3A 2DD8H 4OD2A 3NIGF 4ZUUA 2EKSA 3VFPB 2KPNA 5JQHC 1OLLA 1UJ3C 1I85C 4EBQH 1X7QA 1TJGL 3LH2H 3O0RH 5I76A 1P7QD 3LPFA 3QPQC 2WW8A 3GO1L 3KPMB 1T7VA 3RU8L 3LY6A 2XPGA 3CFDA 2UUDK 3KYOA 1PKQA 2EDRA 2X09A 5DC4B 1FVDA 4WUUD 2CQVA 3FRUB 2VZUA 5J4MA 2F19L 4YGAB 2QHRH 5DK0B 4LLUB 4BYHA 4ZFGL 1DTUA 4WUUE 1KUMA 2ADFH 4RX4A 4X8JB 5SX4H 4PJ5A 4LASL 5FA4A 3PGFH 3MOAH 4Y1AD 5E00B 3C08L 1UENA 2YMXH 1VFAB 5FHBH 4XP6H 3MJ8A 3C6LB 1EEUA 2W0FA 3RRQA 4Y8AA 1MIML 3CLEL 4Y1AE 4CJ1A 1Q0YL 3SHSA 2JB5H 3A0OA 4HH8A 3HLAA 2CJUL 1MREL 4GS7C 2CDEA 3K4ZA 4OI8A 1G9EA 3QT2A 4HWEH 5IMMB 1S9WA 1I8IB 4P49A 1NGZA 1L6ZA 3O6FA 3PJSB 1AI1L 4XWGL 3FN3A 4KPHH 3ES6A 4BZ1L 4CDHA 1BPVA 5E2WH 5C70A 1ORQB 5L88H 1F4HA 2BCKB 5C0AA 2CMRL 4WTXA 2JLLA 4YUEH 1MHPH 2H1PL 4WWKD 1VDGA 3S96A 4JJ5B 5D5MB 4YHYC 4TSCH 1FNFA 5INDB 1Q9KA 3IU3B 5DK3A 2VXVL 1RMFH 2VZSA 3VXPB 3VXTB 4U6HA 3JTSA 4HX1A 3DSFL 1KTKE 3A6BL 1VEMA 3ARBB 1N59B 3PWUB 4HPOH 2KDGA 2N1KA 3EOAA 1FRGL 5J57B 3L6FA 4M03A 3MRLB 3L3HB 3EO9H 3QQ4B 3WUZA 3PP3H 3GSUB 2AQ3A 5A2IH 3MLVL 1OWRM 4PUBH 1J1XL 3SY0A 5HI5D 2MJWA 3GJFK 3D87B 2NYYC 3MFFA 1MFDH 4UAOC 5JOFA 5H8DA 4KTDL 5I66A 1MWAL 1MH5B 5E70A 4DN3L 4MMZC 1FYTB 2XZQH 4KGLA 4ZUTB 1Z3GH 1KEML 4NQVB 1QBLH 3I75A 1KC5H 3NH7L 3ESVF 3INUH 4PJBF 3ZTJG 1LK3L 2ZKHL 2NY3C 4Z18A 3ZE1E 5CJOH 1OOAA 1RULH 5IEKA 3CXHK 1ZLSL 2IFGA 2RQ8A 4HSQA 3WXVH 4YFEA 1MI5D 1FP5A 2FJGB 3AVEA 3PHQA 1U3HC 2VDRH 4IIQA 1FZKA 4OZFG 4PBXA 3UJIH 3FAWA 2DQJH 3L3GA 3I50L 4HLZG 3PDOA 3G5VA 5IB1B 3AXLB 2CUHA 4PRDA 3VFGL 1IJ9A 3N06B 2J8UA 3KLAA 4NQEA 2NY4C 3DECA 4JO2H 1P7KB 3BXNB 4L3CB 1MVUB 4NRXB 4ZUVA 1IC7L 1DQML 4QHKJ 2IQ9L 5L2JA 3QXTA 5HVGB 5GGVY 1EVTC 4F9LA 5I18L 3LEYH 3GMRA 2ZUXA 4J3TA 1SVCP 1JIBA 4FQIH 2AJXH 3T04D 1X6LA 1S7WB 1ZVYA 4TYUA 5D7JA 1G1YA 5F6IC 1RQ5A 5ELIA 3DRTB 3F12A 1INQA 3I02B 3NIFE 1JWMA 2UZYB 1OWWA 4XGZB 5EU3A 4X5LA 3TYGL 5KW9L 5EZLA 2VLLB 4FQQB 3ARTA 4FTVA 3DXAB 2D0GA 2BNRA 4HV8A 4KZEH 2HFTA 1YMHB 2V7HA 4DW2L 3C60A 1A7BA 3PHOB 1GGUA 5IMKB 1K8IB 1UYWL 3OKEA 3DO3A 2Q7NA 5DURD 2Y7QB 1L6XA 2R4SH 4MD4B 4WFFD 4XNXH 4J1UA 1QNZH 5ITBL 3IVKA 1S7SB 4H88L 3NMEA 5F44A 2OI9C 1NCBL 3B6SA 4FG6D 4GRLB 3RVXD 5SWZB 3U9UA 1CDCA 4JDZA 1CK0L 3NVQA 1U8OA 3O3AA 3CFJA 3QP3A 4WFFE 1D6EB 1MCKA 3BVNB 4PJ9A 1UZ6F 4YDKL 5DHVH 1XEDA 2FECI 2X4TB 4GOSA 4K71B 1FC2D 3W2DH 2OP4H 2VISB 3H7BA 4MZ2A 3FRPA 1LDPH 3L3IB 5DJYA 5LBSH 2AABL 2BXZA 3PXJA 3SGEI 1OW0C 4A6YB 5J06A 4GW1B 3SOBH 5D6DC 3S36X 1T6WA 5EOQL 3QXDB 1NBQA 2Z4QB 5C0CD 5CEYB 1TNMA 1YJDC 3QUMB 1ERNA 1GZQB 5E8DL 3SKOB 1BGXH 5C0CE 5IP4A 1J8KA 3U82B 4DFHA 3TIDB 2NX5A 1H3VA 5K9KA 2C3XA 5AZEL 5EN2B 5FYKH 3GEWB 3K8LA 4R3SB 3G5YA 4UV4H 1RZGB 5JPMA 2V2TB 2QBWA 5AD0A 2JJSA 4JREB 2C3VA 3WJLC 2YS4A 4UNVA 1TQBB 5FM5M 1I3UA 3KPSD 3HE7A 2DQUL 1BOGA 1U8IA 1JWSB 1FNLA 1C1EH 4OJFL 3PNWA 3RDTA 5CBEB 4KJWD 2NLJA 1FZMB 3C5SB 2N7BA 3KPSE 4DVRL 3P73A 3CMOH 3JV5A 4QHKI 4FA8A 2DQHL 1NAML 4QHUA 3KYMA 1T1YA 2ZSVA 4M1DL 1FH5L 4KHXL 3SE3C 4J3OC 1IE5A 2O26U 1AC0A 1UM5L 1S5HB 2DDQL 2WNGA 4UZGA 5TE6L 2FGZA 2X1XR 3Q3GB 5SV4A 3HUJB 3H0TA 1YQVL 4WY7H 1CFNA 4OD1H 2MHAB 3MRRA 4XH2A 5F72S 2H6PA 1T04B 5CILL 4NQDD 3KLSA 1INEH 1CD8A 4DAGH 3W39B 1I1FA 2BVEA 1E0OB 4KRLB 3UC0L 1LO3H 1S5IL 3TBSB 3CCHA 1Q1JH 5GRJL 3O45B 4NQDE 2D03L 5E6YA 3BUYA 4XVTL 2W91A 2NQCA 1HYSD 5HDBE 5EBMA 1SYSA 3EYVA 1ZAGA 4R7DA 4IRSB 1I9JL 4Y89A 2XTLA 4YWGH 5D1XC 5D2NE 4M8QB 1QYGH 4CJ0A 5K59E 2APTA 1FBIH 3DMMD 3T4YA 4PR5B 4XNYH 4M02A 1T0MA 1BFSA 1B2WH 2HJKB 4LHUA 1FVCA 3GKWL 3DX8B 2R0KL 4TNWF 4MAYD 4G5ZL 3QIBA 3PWPD 4XNQB 4P2OB 1KN2L 2WM0A 4JCLA 2O93L 5I9QC 5CZXC 2BVOA 3R1GH 1NC4D 5E56A 3PWPE 1QO3B 4L4TB 4QXWA 5I74C 5DTFB 4X6BB 4X6DE 4C56A 1YNTB 4JVWA 5CMAB 1Q0XH 3GSNH 4HIEA 3QPXL 3ARZA 4HZAA 1RK1A 1DUYB 5CP7A 4KK6D 2BSRA 4XCFL 5GS0C 4HIJA 4WI8A 5TE4H 5IG7A 4DGYL 1DBJH 4Y88A 5EO1A 5E2UL 3O2VL 1EJOL 4PJGB 4K8RC 3EFFB 5A2JH 3FRPG 3P77B 3CDCA 2FR4A 1C5BH 1EGJA 3JBG7 3MRDA 3U4BH 3VFTA 3RVVC 1FZOB 4I0PC 5FYKU 5FB8A 2VABB 3B9EA 4ONGH 2UYLA 3CVHB 4LLYB 1LQSR 5EULV 3CGTA 1IT9H 3QUZA 2VO5A 5ANMB 5E99L 3I6LD 1DDHB 3NPSB 4KFZC 4HUNB 3PGDA 4QCIB 1JZ4A 1IQWL 2VNCA 2FGWH 3MOBL 3X13A 4MNGE 4OLXH 5IIEB 2J2ZA 4NKMB 3I6LE 4ZS6D 4EUPA 5T3ZD 1HI6A 3G04B 2K7PA 4P46B 2HAZA 4NNXA 1IM9A 1DANU 3MV7A 3Q5YA 2RHEA 4CUCA 5T3ZE 4CADA 3C6SA 2CIKB 1TTFA 2VL4A 2FH8A 1BBDH 4MQ7B 1YEEL 2R39A 2VDLH 2X6MA 5EU4A 4P2RB 1I7UA 1I3RB 5LCVH 1Y6MR 2AP2A 4UINL 1NMAH 1QFWI 3E8UL 4RWYH 4LIQL 3TM6A 1BVLA 2W9DH 2ADJB 1PLGL 1K5NB 1QRNA 4QRUA 1J0JA 1BHGA 3UP1A 4H8WC 3IDGA 3NA9L 4LNRA 1F97A 3LKQB 3O4LB 1TITA 3QXVA 3WNMA 3HZMB 4O00A 4M6NL 3OHXB 4W81A 3SGJC 5DHVA 1DBKL 1HXMB 3VCLA 5FKPA 1JRHI 1UJ3B 2FX9H 2J1KA 4KQ3H 5J3HD 3OKMB 1CIDA 3O41A 2MCPL 4LCYA 1U8QA 5H37H 2HKHL 4M9PA 3JWNC 5AAMA 2A83A 4N5UA 2GITA 1KJ2A 4YLQT 2F58L 2X7LA 4LQFH 2FDBP 1AE6H 3TVMA 3EYUH 4WWID 5DUBA 1N64L 4ZFOL 5DSCB 4ZO7A 2YA2A 4NC1C 4OFYD 1A2YB 1R3JA 1S3KH 3VFMB 3VMNA 3QEQA 5H94B 3TA3A 5GS2D 4NP4H 4BH8A 4X7DC 2W9EH 2Y5TA 5KSAD 1ZGLA 1W8OA 4YHMH 2ZCHH 1T5XB 1XGTA 5F7WC 4TNVF 1QBBA 3CX5K 2BJMH 3MNWB 5F8QC 2VUOA 2A0LC 4PRHA 1LP9E 4K3JH 1QKZH 4LHUG 1IC4L 2KQMA 1JUFA 4LFHD 5EIVA 5T5NF 4RISL 4RQQB 3O2DH 4NDMB 1A7RH 4OM0H 5DJDA 4UTAL 4OLWH 4HDIB 3LQZA 1MHHB 3DNKA 4Z7UA 2AGJH 2DQIL 4GS7B 3HS0B 3GMLA 1SYVB 1CICD 4NHCH 1CFQB 5EWIL 2HVKA 3I9GH 5B38B 3F7VA 5EOCH 3ZE1F 4G3YH 12E8H 1VACA 1TJGH 1I4FA 1RI8A 2IQAA 5E6IC 5E1AB 2NY0D 5ID0A 3ZTNH 4Z7NF 2WK2A 4OUUB 1DL7H 5IHLB 2R0WL 3BEVA 1BD2A 4JRXD 4LSSL 3FT3A 4HF5L 3VGEA 1PDKA 1N7ML 3TEUA 1R24B 3IGAB 4ZFGH 3BP7B 4I2XB 3DI2B 1B0RA 4WIQA 2R1XA 4OF3A 2BNQB 4OZHE 5EUOB 3TN0A 1PEZA 4OCYH 4XZUA 4YHYB 2WUCH 5FK9B 5CFHA 3ZDXE 4XVUD 2YSSA 1K4DA 1MHCA 5DQJB 2VE6A 3KPLB 4XB7A 1F11A 1NBVL 4UT6L 3RIAK 5FOJA 3VXSB 4QRSB 1MIMH 1FO0A 1H0DB 1Q0YH 3X3FH 2QR0B 1DUZB 4TTDC 1CU4H 5IJKC 3CFEA 5F71A 2R0ZH 5JO5B 1HKLL 2LU3A 4XXCC 5IUSA 4YPJA 2ATPA 2DQDL 2CJUH 1MREH 5IVZB 5L7XL 4KKBD 4HKBA 3T65A 35C8H 3UJTH 2NZ9C 5KSVB 3WIHL 3FAXA 1KFAH 1NFDB 1MCRA 1EXUB 4PRNB 3ARRA 2B2XH 1DQDH 2ZSWA 3RNKB 4UAOB 1EJ6A 1G7QB 3RWIB 4XWGH 1AI1H 5I30L 4IDJL 4I77L 1YZZA 3DX9B 1NL0L 1JZ7A 3L1OL 1DVFD 2DJUA 3J8F7 4F37K 1FJ1B 3CH1B 4PGDA 1MFEH 5CAYB 2CMRH 3O8XD 5JMRA 3U7YL 2YD9A 1UA6L 2NY3B 2X5PA 5E5RB 4N0RA 3DUUA 3H9HB 3G6DL 2P47B 4X7SH 5HHNA 3L95A 2W0KA 1K2DA 5BVJB 1S7VB 1OVZA 4JM2F 3OKDB 3RWDA 1D5XB 1U3HB 5DD3L 3WFHA 3MJ9A 4JFDA 3HMWH 2XICA 4GUPA 2WZPD 4KTEL 1JL8A 2WUBH 5F3BA 1KGCD 1U8MA 3QSKB 5HY9A 5T1MA 3S7GA 3NA4A 1YEKH 5E5UB 4J8RA 1QVOA 2NY4B 3MRPB 3WBDA 2R1WA 4DOHE 1KGCE 1YECL 4OZGE 4KTDH 3CUPB 5FUZL 4KRPC 2LTQC 5EIIB 1HH9B 2AKRA 5EBLA 5C9KA 1MWAH 1JFQL 4TQEH 2AI0L 3GSWA 2LFGA 3LEXA 4ELMB 1JGLH 4QXUL 2P1YA 5I1GL 4PB9H 1KEMH 1UWXK 4ZQKB 4U2YA 3KXFB 1G7MB 1OPGL 2HT3C 2CLRB 1CLZH 3KJ6L 5L0QC 3M07A 1BQHB 5IBUG 3BAEL 5C0IA 5IFHH 3QI9C 5GGTA 2H2PD 3LSOA 4J12A 5ERWA 2BOBA 4IMLB 3OV6A 5IESH 1EFXD 3ZHLA 5JW5A 4KJPD 1MLCB 4LMQI 5LAXA 4LAQH 1XIWA 1PX4A 1MHEB 1A9EA 1J1PH 5C6WH 4UILL 2C1OB 1HHGB 4PJXE 3NCJL 1U8KA 1UWGH 5FM8A 3OAUL 4U7KA 3V52L 5JDSA 3L7FA 2P45B 3P30H 4ZO9A 3IFOB 4QT5A 3QXUA 2OI9B 1GXEA 1ZEAL 3S35L 3CNKA 3K2MC 4F3FA 2APXA 3JUYA 4X4ME 1DQMH 5IVXA 1DBAL 3VG9C 2O61A 2GK0B 2VZ1A 3EYFB 3TCXA 1DQLL 3KNBA 4BSVB 4OV5A 3F6LA 3WIIL 2WP3T 2ZP0T 1GYAA 1WC7A 5TDPB 1J8HA 2GTWB 1I7ZA 1LK2B 4NGHL 4LLMA 3K4AA 1BF8A 3TT3L 1E27B 5JOPD 2EYTB 4CNIB 3ULUC 4GT7A 4PP2B 2AAVA 4CBPA 3MJ7A 3IETA 2X2YA 2QV2A 4AEEA 1H8NA 1NDMA 2V2WB 3C6LD 1BJMA 2IPUG 3F6IA 4IBLT 4XVJH