1AJ7H

Immunoglobulin 48g7 germline fab antibody complexed with hapten 5-(para-nitrophenyl phosphonate)-pentanoic acid. affinity maturation of an esterolytic antibody
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
217
Chain Sequence
QVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCASYYGIYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN 48G7 FAB (LIGHT CHAIN)
publication title Structural insights into the evolution of an antibody combining site.
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1997-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1aj7H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1aj7H02
1JWUB 3IDMA 4XCNB 5ACMA 3QFDA 5I16B 5K59E 1A7QL 3V5KA 4YHNB 5EA0H 2YEZB 3DROA 1TTFA 1MFCH 4CMMA 1M7DB 4DVBA 2VZ3A 5K9KB 1C7SA 4X7TA 4LIQL 4PRIB 2Z91A 2FO1A 2A83A 3O41A 4RA3A 1R3JB 4PRDB 3BKJL 5F7EH 4MS8C 3IFPB 3L3JB 3VXOA 5ILTH 5DJYA 4NZJA 1SM3L 1KB9J 2A1WH 2X89D 5HHXL 4HWZA 1KIRA 2W92A 1G6VK 1MF2L 1VFOA 4U05A 3RDTD 4S0SD 2A77H 5I71B 4BFBD 1AKJD 4MWFA 3D39E 3CXDH 3I6GA 5FIEA 4GT7A 1EHNA 4R2GC 1IGML 5EBGA 3C09B 1M7XA 5F1SA 4XWOD 3WKML 1MIEL 4KDVA 1JMZA 3BVNA 1EGJA 4KRLB 4TOYH 4FXLA 1YMME 4OFKA 5L0QB 2X4TB 2NR6D 4JFXB 4Z0XA 4NN5B 4JN1L 1MVUA 4M6OL 1AQDA 4U7SA 5I2IB 2B4CH 3SDAA 1G1YA 4NYLA 2D0GA 1AC6A 2C3GA 3EGSB 3SDDD 2DKMA 4PLJD 3SKUD 4HJJH 1CF8H 4QHNB 4KZEL 3SPVB 3PNWA 3DJ9A 5EOCL 4TPRL 4PJFA 4KUCF 1CLYL 1XFPA 3RWFB 3N1QC 4NQXB 3F65A 3LCYA 3MLRH 4ODVH 3MCKA 1F3RB 4XMKL 3X3GH 5CJ5A 4OAWA 5ANMA 2G2RB 4H0GA 4G80A 1GZPA 1N26A 4LHQB 2QQLH 5DJ2A 1R3IH 5C0JB 3WN5C 4JREB 1CFTB 2PTVA 1CFVL 3ARDB 1KUMA 2P45B 1YECL 1J5OH 1CBVH 3MRQA 4NCC2 5DFTA 1S8DB 3QBTB 2VWEE 4YIQA 4WHCA 3L5WB 5IB2B 5HGAB 4Z95L 4FQXA 1PBYA 5CFHA 4OBRA 3QXAA 4G43B 3RUGA 3T3PE 2ESVE 1J88A 3VXTB 1ZS8B 1OCWL 4KY1H 3STLA 4QRRD 2NY2C 1JF1A 1XIWD 3QQNA 3NBNA 1B6UA 4HH9A 1N6UA 2XG4A 5JW5A 4I48A 1UA6H 3K2UH 4CL7A 3CZFB 4CN4A 3A6BL 5AZEL 4C56B 3BD5A 1GIGH 4LLDA 2XZCH 4K23H 4YO0B 5T1LD 1GGTA 2FZ3B 1TCMA 2Y36L 1JGVL 3KPRB 4Z77B 1Q9KB 3C6LD 2A9NL 1N5AB 3BOVA 3BHBB 4F7MB 4LCYB 3FT3A 5FO8B 4HIXL 4JGMA 1ACYL 3BGAA 1KPVB 3L5XH 2QTEA 2Z92B 2YPLB 4QHUB 1QBML 2ZG2A 5FYKL 4Q6IB 2ZSVA 4U1SA 4MA1B 2X4PB 4JJ5B 1WC7B 1MCOH 5AZ2H 1I85A 3U82B 5L2KE 4RIRB 3WJJA 5D71H 4JN2B 5KVEL 2P1YA 4IOIB 2G5RA 2WUBL 4LSUL 3KPPA 1QO3A 4F37F 5DMKB 2H6PB 5MENB 5TDNA 3IKCB 4OM0L 5FK9B 4U1HB 3O2DL 2WV3A 3KJ6L 3O9WC 5F7DA 1SEQH 5JW4M 2BY3A 3H42L 1UFUA 2PN5A 5B8CA 3ARFA 1R5VB 1VENA 5E2WH 3JV4A 4OFPA 4KK8D 4L4VE 2FECL 4MX7B 1CICC 3S5LB 2OR8A 1J12A 4MA7L 1IC7L 2C9AA 2H32H 1TJHL 3CVHB 1ZTXL 5DURD 3QG7L 2NXYC 4KC3B 5SX4H 4K7PL 5BO1L 2ZJSH 1YZZA 4R4FL 5E08L 1KENH 4PJXE 4WFGD 4M7ZC 4PJAB 3SDYH 3FO2B 3STZB 2M26A 1OSPL 4G8GE 5ESAB 1SJXA 5CEXA 3C9NB 1CR9H 5CBEB 2YHGA 1RZFL 4OQ1A 1ZOXA 3HC4L 2LABA 4XPFL 4N0FA 3N0PB 1YNKL 2ATPB 4D0BB 3TA3D 5JA9A 3OF6D 3H0TB 1LO0L 2BRQA 3MRBB 5MI0C 3OKNB 1KB5L 5CKAA 5GRVK 1GRWA 4ZFOL 1NGPH 2G9HB 4Y16B 2Q6WA 15C8H 1TVHB 3DOSA 1K3ZA 1OGAE 5JHDE 3C2SA 3VD7A 4QXUH 4KDWA 4OIAA 4D0CB 5HI5D 2EXWC 4UT6L 2GT9A 5I1KL 1HHHA 5CP3A 1N0XH 1RHFA 5GRUL 1KEGH 2YPKA 3RP1A 5TGBA 5E2UH 4WI2A 3FQXB 2Z35B 4LPXA 2HT3C 4P4KB 5BZDA 1OTTD 3HA0A 1LDPH 3BPCB 3DVGB 1D5XA 1RK1A 4J6RH 4JY5H 4UAOC 5JMOC 5KBNC 4RISH 4M7LL 1DBAH 3MREA 2Y7QB 5B3JF 2BHZA 3KYNA 2X89A 4HS8H 4KKCC 4I3SL 5F1IA 5K33A 3RDTA 1BF8A 1YY8A 1QSFB 3M1BA 1RIUH 3GSRA 1IGFL 4S2SB 5HXMA 4AZ8A 2GJ6D 4RWYL 4JO1H 1KJMA 2QADB 3BGFC 5E95B 1TPXB 1OAXL 3X3FH 4NNXA 5CMAB 4MNHA 3MRIB 4MNQE 5JORA 5IBTH 3S4SG 2IAMC 1MHEA 1OLLA 3K1DA 5GXBB 4NN5C 2CJUH 4JKLA 4L29A 2EDXA 4XPBH 1MAML 3ZDZF 1PYWB 2X44D 2WBJD 3HKFA 2HJLA 5DRNB 3T0BA 1T7VA 4KU1A 5LGJA 3K81A 4HDIA 1HDMA 2ZPKH 1XF2A 1ZT7B 3VGHA 3C60C 4S10A 1GL4B 2NNAA 4I5BA 4HULB 3TF7C 2VMFA 3PGDA 3Q1SH 1NDMA 2XXCB 4PREB 2UZXB 1AGEA 3D3VD 1U3YA 4KK6C 2Y5TA 3D39B 3PGCA 4JZNB 2AABH 3DV4A 2FSEB 3QIWB 3PV6B 1G7QB 5H8DA 5D8JH 5BXFA 1YMMB 2DS4A 4X9BA 1XZ0A 5E4EC 5H94A 1AQKL 2MPAL 4FFZL 3HE7B 1EO8L 4JFDE 1AGCA 4OIIH 3LQAC 3DGGB 4HZLB 4NQSA 1IQDB 5KVDL 3GBML 2ED9A 2CIKA 3TNMB 3MV01 1JGLL 3D18A 5EBLA 4MD4A 1FFOB 1JF5A 5HYJE 3QH3B 4JANB 2LFGA 4ORGA 4GAGL 4XTRC 4M8QA 4YDVA 2Q76A 2AXFB 4DCQA 1XIWA 3MOAH 4XP4H 1NMAL 3L3OB 3SE3A 4IHOA 4XVUC 1ZHBA 4KUZL 5FFLA 1LEGB 5JO5A 5ID0A 3OXSA 4WI8A 4NBZB 3FONB 1T7XA 1J86A 2ARJA 1S5IL 2FIKA 1CFQB 1VERA 2DKUA 1S7VA 5JHLH 3C6LA 1G9MC 1RQ5A 3FN9A 4RFNB 4X6FA 1AE6H 1VFMA 4HD9A 5BQ7B 3ULUE 2NXZB 3FMGL 1AXTH 5LAXB 4KAQL 4ZAKB 2YRLA 2CR6A 1NGQL 4EUPB 1TTUA 2V9QA 5I17B 3H9SE 1I9IL 1YEJH 2OL3H 2ESVB 1C8PA 2V2WA 5F89B 2I27N 4Y4HD 1QBBA 2XPGA 1BZ9A 3O3AB 3HHRB 2BVPA 3OJ2C 3O3BA 3S8WA 4KXZH 5DA4A 4BFIA 1HHIA 4IOFC 1A7PH 3MLXH 1CDIA 5GHWH 1RV6X 1WFOA 4D9RD 2FJGB 2XY2A 1J8HE 5C6WH 3L3DB 5FUCC 4PJBA 4K3HA 1FVDB 3RGVD 1MEXL 3TJHD 5D70H 1WGOA 3QSKB 5ICZB 5J57B 1IQWL 3TO4D 4ODUA 5E24E 3RVWD 4XVJH 3EAKA 2A6IB 3IDJA 3ROLA 4RRPA 1ADQA 3WLBB 4HG4K 3GSWB 3ULVH 3H9HB 3KPLB 5T1DL 3TWCL 2FBOJ 1Q72H 1UB6B 5D7SL 3CUPA 1UJ3A 3GI8H 5HYEA 1Q9OA 5D1ZC 1WBYB 2KQNA 4OGZA 4JRYD 4TUKL 5KTEL 2RR3A 4XAWH 3HR5B 5L2KB 1MFEL 4HKZB 4WO4B 4YUEH 3PWLB 1MCDA 4O02L 3OR6B 3QUXD 1IEBA 3GMQA 4KTDL 4B53A 4L3ED 1OM3L 3WIHH 3ZE2E 3LEXB 1MFBH 3MLWH 4P46D 4U4BA 4P49A 5AG8A 4PRAB 5DEFA 1FO0B 2NZ9C 3U36A 1QVOA 4E42B 1MCCA 1DFBL 4UIKL 2CSPA 4L4VB 5D9SA 4Y1AD 1X5GA 4UQ3B 2OJEA 3B9KC 4BQ9A 2P5ED 2XYCA 2OI9C 1F45A 3R06A 3NABH 4LSSH 1JNHA 3SKOB 1QBLL 5T1MB 4ZXBB 2X1PA 5CGYC 1QPXA 2R1YB 7FABL 5E5MA 4I2XE 4MA8H 4PJXB 1A7NH 2P8LB 3V6OA 2GSIB 1A6ZA 3S34L 5BS0D 4NZTH 4G8GB 5CKGA 4AM0B 5CZVH 5IR1A 2IMNA 2AK1L 2F8VA 2X09A 1AO7E 4JFOA 4GQ9L 4P4KC 4QXTB 4YE4L 5A2KH 1EJOL 3EJZD 4WFED 1BBDL 3ARBD 3P73A 5EN2B 3LKQB 2L4OA 2P24A 3BESR 4X7CC 5DHXB 5KN5B 1XCTB 2DWDA 2YR3A 3BJLA 3SEPA 4MD5B 4PFEA 3VFNA 5DRWB 3ABZA 5IP4A 3CSYB 3EYUL 1CDUA 3BMWA 2HT4D 1KLGA 1EVTC 5HBBA 4FXGB 4OZIE 1NKRA 1EUUA 2QLVB 1OGAB 4P2YA 1EXUA 3SE8H 1U3HB 3F12B 5JHDB 5IMKB 1F4WL 4DN4L 3UTTE 5B39B 2GJ6A 1ZA3A 1A6VL 4XAKD 5JIIA 4XX1G 4D0DA 1RUMH 4NO3A 2R9HC 2W0FA 3MOBH 5J12B 4UMGA 3LEVL 4I77H 4OD3H 3H3KA 4KJQC 1TXKA 2V5MA 1QA9A 2QL1A 3WFDL 3EOTL 1EAPB 4WEBH 4X5WB 4OCRL 5I1CL 1GH7A 3U9UA 1Z3GH 2WBJA 2R4SH 3L95A 1EFQA 1NUDA 1K4CA 4EN3C 2Q3ZA 1K5NA 3WIHA 5HHPB 1KLUA 1ZV5A 4RGND 2D03L 4PJ8A 3T2NH 5EULV 1D5IH 4POZC 3HUJE 3IXAA 4KK5D 3G08A 3QUML 1PQZB 4DQOL 4ZFFB 1DANU 3F6LA 1QP1A 1NAMB 2XRAL 3R0NA 1ITCA 5I1LB 4NKOA 1KTLA 2DM3A 1DR9A 1T2XA 2VXTH 2LV4A 1ZVSA 5DYOA 1BVKA 4XZUA 1W8OA 2B8OT 1X4XA 2OP4L 2DQGH 3W9EA 3QP3A 4MNQB 5A16A 1ZGLP 1FN4A 1DEEB 3ARED 5GS2D 2D9QB 4HFWB 4TNVF 4JB9H 4OGAD 5DFVC 4PB0L 4CW1B 4XBGA 2A6DB 5KG9A 1CE1H 1VKXA 3MACH 3IDGA 2GCYA 1ZLUK 4NBXB 4FQLL 2E7LA 1J1OL 5FHBL 5LQBH 1F6FB 1IC5H 3VD5A 3SBWC 2BVTA 4ZSOA 2ARWA 1BJ1H 5J06A 4JRXD 2ICES 1KN4H 1SY6H 1T04B 5T5FH 3MZTA 4S1SH 3CK0H 5GGSB 2AKRA 4N0UE 2EIZA 3BH9A 2NY6D 5T3ZD 1T2JA 1BWMA 2VXSH 4YK4C 1A47A 3ZE0E 5FKPA 4JFDB 2C26A 1QBMH 4P5TC 5D2NC 3HRZA 4BJLA 3BP5A 4IMLB 1RFDL 3NVQA 5EBMA 2NXZC 2XICA 5CJQL 4ZAKC 1JWSB 5HYJB 3VGBA 1M05B 3LPFA 4NHCL 2BNQE 4HLZH 1FNEB 5A3ID 4JFFD 1IAII 1CE6B 5EIQA 1P7QB 4KKBC 1UWGL 4L3AA 4OT1L 5EUOE 1KTDB 5GRJH 2VLKD 4X5XB 4A2LA 5C0IA 2GQHA 3A67H 1VHPA 5IJVA 1L9NA 5I1JL 4R6UA 3B2VH 5IT2L 3WO4C 3VWKB 5C2BL 3W11C 3QWOB 5F7LB 1I9RH 2DQIH 3TO4A 4BH7A 2VAAB 3DGCR 1A4JB 5TQ0H 5C7XH 3K74B 1CXHA 1T3FA 4KVCH 1NLBH 2CMRH 3GRWL 4LRIC 4M7KL 5TDPA 1X3DA 1MJ8H 2FBJL 3P11H 2Y1VA 3B5TA 4UB0L 1SMOA 3A6CH 3H9SB 1IGCL 3BWAA 4XBEL 5M94B 2ZOKA 3MZGB 4JO3H 3SCMB 4JRYA 2Q8BH 4KI5D 4NWTL 3QAZC 1CYGA 2QSTA 5C70A 3H9ZA 1OTUC 2YN3A 1RZFH 4WO4C 5IFJA 2BFVL 3MODL 3MV9D 5INDA 3QUXA 1WWCA 2B1AH 1F42A 4R96A 2NY4B 3LDBB 4L3EA 1J8HB 2JCCA 1SY6A 3FRUB 3TCXA 1LHZA 2E7MA 3MUGA 4HEPG 4OZGE 2MKWA 1MIMH 1ONQA 3WFCH 4GG6B 1LNUA 1TNNA 2XTJD 5LGHL 1NSNL 3GSNB 1VPOL 5GGTA 1F6AB 5ECJE 3SO5A 1A1OA 2CLVB 1R24B 5L9DH 3UBXI 5FUOL 5CEZL 1CG9B 5C9JA 1O0VA 4IRSC 1HHGB 3C5JB 1FG9C 4PS4H 1VDGA 1ZT1A 3VD3A 3MC0A 4RFEA 1JE6A 4NNYB 4G6JH 1OF2B 2AJ3B 2APVA 2GYSA 3MRDA 4FXKB 4I0PC 1JFQH 2VDOL 1TZHB 3U83A 5ADOL 3L7EB 3TVMA 4ELME 4KZDL 3T4YA 2HH0L 3IJYA 3RGHA 3ARBA 5IMLA 8FABB 2DLHA 2ZUXA 1FPTH 1T0NA 4DTGH 2IALA 4YFLI 1KXQE 2C4FT 2KQMA 1RZKH 3MRJA 2AI0L 2BHYA 4FRWA 2YBRA 2FR4A 4YX2L 4GLRI 2GW5A 4CNIB 3HNSH 2P8MA 4NBYB 4LCCC 4HV8B 1I1YB 2IADB 4ZQKA 4I2XB 3OXRA 1IARB 1P4IH 1X6NA 3KNBA 3QUZC 3WXWL 4WWKC 1W0VA 4ZO9A 1AO7B 2R4RH 4QXWA 3DBXB 1OWRM 4G3YH 2BSSA 5D7LD 2NY0B 5IK3B 5FM4A 5INCA 4MJID 1HIML 4RMSA 3WE6B 1C12A 3D0LB 4G9DA 2JB5H 1X6LA 5KSUB 4IIQB 2PYEA 2K9UA 3QZWG 5I18H 1MHPH 3FO1B 4OZIB 1KSRA 1UVQA 1W0YT 3IS1X 3DUSB 1FORH 5DMGD 4IEFB 1W0WA 3UTTB 3MRMA 4M00A 1CZ8L 5I8KH 4JO4H 1NCDL 3MLSL 3RKDD 4Y2OA 2X70A 4HMDA 2DL2A 4R3SB 3P2TA 3P3YA 3AREA 1FL6A 3MA9L 4JDTL 4YHOH 2Y6SD 3RNQA 4QKXB 2ADFH 5KAQG 3EIFA 1U0QA 4WU7A 4GS7C 3HUJB 2DIJA 2VZUA 1MHCA 4LVHB 3FFDB 2VKXA 3MBED 3L7FA 4KUZH 1JTTA 3L5IA 4F33A 1JUFB 4WTXA 4LOUD 1ZLUH 2RFXA 4GG6F 4JRXA 5K9OB 3AGVA 3FB7A 2HRPH 1CFNA 3VH8G 1E4XI 3QO0A 5IHBA 1I8LC 2EYTA 5FECB 1T2QH 3RQ3A 5IB1B 4Z8FL 3MR9A 3UYOD 1G1CA 1BLNA 5IB5A 3DVFA 5AYUL 1LK2B 2EE9A 3QJHB 3NCEB 2NMSA 3RTQB 1RZ8B 3ZKXB 2O26U 4P23B 5ISZD 5DZLA 4M1GH 3QIUA 4HXBH 4AEHH 2HFEA 2BK8A 2BXYA 4X4YA 3RWGB 5DMYA 1MFAH 5CIPA 4GXUM 3SKJH 2YA0A 1GZQA 3C2AL 2WW8A 1EMTH 3UPCA 3SDCB 5JOEA 4JFFA 5F3BB 3FOMA 4F2MA 4JQXC 4K94C 4A6YH 2VLKA 3ZO0A 4EKXA 5DJCA 1IBGH 1KCSH 3DX7B 3G6JE 4N0UB 5EIVA 4WRLA 5I73B 2D7NA 5AAMA 5CD3A 4KK9C 4OUUB 1SJEA 3O45A 3EO9H 4P99A 4P9HL 2EH7H 4QRPD 4GKNA 5CILL 4ZYKA 3QEGH 4GRWH 1Q0YL 3HMWL 4XHQA 2HVKA 1G7LA 1W72B 2IAND 3AXLA 5C08E 1D5BB 2JJSC 5KZCD 3ULUC 1FCGA 4X6BB 4LSDA 2XWTB 4MB4A 2YD1A 4K8RD 4MAYC 4JEGB 3MRLB 2B2XH 2BNQB 2Z93B 4R90L 3SCMC 5HHOE 2BY2A 3NTCL 5JUEH 1T6VN 4NO5B 4OZHA 4ZMAT 2PF6A 4XPTL 5EUOB 2PTTA 3BUYA 3KAAA 2PCPB 2WWMC 5GGRB 4DZBB 3MV9A 4XGZA 3OV6A 4J4PC 4XWGH 3BKCL 1JZ6A 1S7SA 4AT6A 4OF5A 4PB9L 2CIIA 4B7LA 1NGWB 4Z7VB 3V4VL 2QR0B 1D7FA 4U6VH 1EFXA 4IDJL 2V17H 4KV5F 3V8CA 3I2CL 4MMZC 4HS6B 2YSSA 1U8OB 3C6SA 3CLFH 5HDQH 4KRPB 3TZVB 4KWUA 1N4XL 5I1DB 4ONHB 3RA7L 1JGDA 5DJ6A 2A38A 2E8ZA 4XH2A 5DT1L 4FQHA 4U1MA 3HRPA 1N6QH 1AHWB 1LO2L 2OR7A 1C16B 1KCVL 1ZEAL 3GMLB 4YDLC 1Y6MR 3L3GA 3GIVB 4O9HL 1URLA 5KJRH 3P30H 3RL2B 1CGTA 2OTWB 4A6YA 2ICEA 3UROR 2P7TB 4Y4KA 3RVXD 4Z7QF 4OZGB 4B7IA 1QRND 3BI9X 1U3ZA 5HPOA 5TQ2H 1JHLL 1S9YB 4TVPE 3H3PH 4C54A 2AEQL 2KZ1B 5SWSE 4FFWD 1R5IB 2BVYA 3EFFB 3GBNH 3T2OA 3QA3A 4YPGA 2BP3A 2C3VA 3HI1A 4PLOB 4NPYB 3QEUA 2OX5A 2C4XA 1EAJA 1ZANL 4WW2F 5D7IA 4RMVA 5EH1A 5IOPA 4GRLD 2J5LB 5I1CH 2FWOA 1A14L 1Q8MA 4L9LC 1H0DB 5E9DD 1B0RB 4BK5A 3C5SA 5GISL 4LLVB 4FZ8L 3ZKND 4M1DH 1KGCD 4K7FB 4Y5XC 4ELMB 3RX8A 3S9DB 3CVHL 5K9JH 4HC1H 3HZKB 5F9JB 4HQQL 1Y6KR 1JV5B 1JRHH 5D7LA 2ADJA 5JW4Q 1ZXQA 2F19L 2J4WL 3GB7B 2YZ8A 4HIJB 1BGXH 4NQDD 3BZFA 1F3JA 1DN0B 4MDJB 5I8OL 1G6RA 3VFGL 3O6FB 1JNLL 4PJFE 1RU9L 4MJ5B 4LBEB 5D2LF 3BP4B 5FKAB 1ERNA 2EDRA 5DMIL 3KPNB 3QO1A 4PP1C 3S35L 3MLVH 1SMAA 1IL1A 1YEIH 3T1FA 5IQ9B 1ZHLA 2IH1B 1LGVA 5SX4I 4ZUSA 3MNVB 1LWRA 2ARJQ 3DO3A 3UMTA 1NAKL 1XGUA 5FHBH 3U4BL 1DQTA 5DQ9A 1KF9B 2IBZY 1BAFH 2X1XR 4XXDA 4F37K 4IMKC 1F02I 3OKEB 5CHNB 1TNMA 1YQVL 4MQXD 5T3XD 5MEPA 1Y0LA 4K9EC 2W59A 5IGXL 1Y6NR 3MBEA 4HJ0C 5F1NB 2X4UA 1C1EL 4P3CL 3MCG1 3BRFA 5BJTA 4Z7VF 4M61A 2VH5L 4XNXH 1I8MB 4Z7WA 1MCPH 5F1OB 3WFEH 4M7JH 2CD0A 4PJ5A 2Y06H 3CNKA 2GAZA 3HCVB 1TQBB 4LU5H 4MSWB 3QDHA 1FRGL 5DVLA 1CXFA 3SGJA 3BW9B 3KXFD 4F58H 1IGYB 4L4TD 4MXWH 5ISZA 5LJYH 3EJYD 1AFVH 2OZ4A 2ZKHL 5BVJA 5IM7B 4U6YB 3QJFA 1FSKC 4X7SH 5D72H 5FOBB 2EXYC 1H8NA 4EI5C 4FQCH 1NEZB 1UYWL 2HJFA 1IM9A 4NWUL 1NFDA 3ZT5A 3IFOA 1N3NB 3RY5A 4FMFA 4KROD 1U95B 4J3UA 1JWMB 3SDCC 3U7YH 3OJMB 2NY5L 2PKDA 3IAQA 1JPST 3HB3C 3MGOB 1DDHA 1YMHA 4DWHA 5J89A 3CFCL 4UT7L 4P2OC 4WV1A 5CUSL 3KLHD 1K4DB 2ZOLB 4M7KH 1T83A 5ALCL 3V7AE 5I73C 3F5WA 1D5MB 4LLUA 3FT4A 1I8KB 5CEYA 4PPTA 3MA7B 4QRPA 1YJDC 3ZKMD 2ICWB 2VJXA 2IANA 3NCJH 4C59B 4I18A 4HMEA 3RX5A 3VXMD 2F9BT 1IE5A 1AXSB 2BC4A 1QSED 3U0TB 1WCBA 4YBLB 3BN9D 1UXSA 5ENWA 1NGZB 1XF5B 2OQJA 3C8KA 5CZXD 3IDYC 4APQC 1N2RA 3O4LD 3FO0H 1QLEL 3CX5J 4WFHE 1Q0XH 4BSWA 1RZIB 4ZTPL 1RHHA 1GAFH 3FOLA 2XQBL 3G6JB 4LKXA 3HZVB 4M43L 4IRZL 5IWLC 3VG0L 3LMJH 4X4ZA 3MCLL 1MQKL 4OQTL 3UZVB 3HE6D 3PIQA 1C08A 4YDKL 2CLRA 1VACA 1OAQH 4K7PX 2R2HA 2VN4A 1C5BL 3MO1B 2VLLB 2D7OA 1U8PA 1VFAA 5C08B 1KEML 3UBXB 1NFIA 1A6PA 1EV2E 1IKNA 3VWJB 5KVGH 5HJ3A 5C0FA 5FYJD 4JPKL 4XMLH 1CT8B 5CP7A 5HHOB 4NQTA 1OD9A 1ZLVK 2Q8AH 4UTBL 1AHWC 3BEVA 4JJHA 3E6FA 3VJ6A 3GGWA 3U0WH 5D1QB 4MJ6A 1QFWH 3IF1B 1X44A 3KPTA 4HX1A 5DSCB 1YPZA 5B4MD 1ZSDB 5F44A 1QRNA 1RZGA 3VMOA 3DIFA 4DGIH 2RHEA 4NHUB 2APFA 1NCAH 1T7YA 2CH8A 1QRKA 4JCMA 1I1FA 2CKBA 5F96L 4MDIB 5JZ7D 3N50A 4ZPVA 3V0WL 4FABH 1J18A 3VFSA 1CK0H 3ZDXE 5CJ8A 2ZCHH 3ELAT 3FQRB 4Y19D 2BMKA 1FLTX 3IDMB 4GRLA 3QFDB 3I9GL 3MLPA 2LTQB 5E9DA 2OM5A 2DD8L 1QG3A 1TCRB 2NY3B 2FCBA 3MSPA 1KBGH 2FJFA 3KPMA 1ZT4B 2BY1A 2GIYA 2Z91B 5KAQF 1PX4A 4W4OA 4YC2B 3CIQA 1HHJA 4YNYA 2VKWA 4NQDA 4G42A 5DJYB 3WHE0 4O2FB 5SWSB 3BP7B 2DQJL 5EC2A 2FD6L 1GGIL 4HWZB 4L8SA 3O6FC 3NFSL 2CDGA 3O6ML 3SKNA 3RPKA 3UTQA 2Z31C 1O7VA 1AI1H 4Y2DB 4EQ2A 3BVNB 3O4OB 2GSGA 2VDQL 1WF5A 5DJ8B 3B4NA 1Z2KA 4Z0XB 2R1XB 5I19H 1EHLH 2PR4L 5D96B 1GJIA 1AJ7H 4NN6C 1XGRB 4LSPH 1BVLB 4MVBC 4U6HA 4O4YL 3CVIL 3JUZA 3X11A 4BYHA 5JIKA 5I1HL 1DQDL 3PNWB 1RJLA 4P3DB 3TH2T 5I75B 2IH3A 3PXJA 3QR2A 4UILL 4PJFB 4XNZB 1UM4H 1JN6B 2F74A 4YFDB 4M5ZL 3GMPB 2WIMA 3QCTH 4LLAA 3T1WA 5DVOA 5I15L 2EDEA 2DM2A 3W2DH 3G6DH 3F7RA 1GZPB 2L7JA 3BPLB 2DMBA 4ZUTB 1J0ZA 3K1KC 5DJ2B 1S7RA 4JQIH 4OCYL 1OW0A 3U4AA 3I50L 3HC0A 4PGCA 5J11C 3KXFA 3KYKL 4Q0XH 1LEIA 5F7MC 4L4TA 3WDIA 3GHEH 3MRQB 3SY0A 3ZLQC 2DDQH 5IHZA 4YIQB 4QHMB 3FN0L 3MOQA 1TJGH 4PJDF 3T0EC 4LAJH 4FQXB 5JR1H 1CDBA 2ERJB 3QXAB 1N64L 3H7LA 5JNYA 1F11B 3ECBA 1GGUA 4FNLL 1NGYA 1MCKA 3V5DA 3HAEG 3STLB 2AV7A 32C2A 1QSVA 2AJVH 4KMTL 4HH9B 2F53D 4GQPH 3MLYL 3EKCA 4J3VA 3TPUA 5GGSY 3ZTNL 1QFHA 4RRPG 1LEKA 1B4JL 1O7SA 3WLWC 3WSQL 5HDBE 1OSZB 4PJBE 4PJCE 1MSPA 1NAML 4M62L 3EOAB 1S3KH 3QQ3A 3K8LA 2EDJA 4I9WD 3VI4E 3CXHJ 5EO9B 3LQAH 3VXMA 1TDQA 3FT3B 3D48R 5EWIH 3G5ZB 5H37G 3TJEH 1QSEA 3AS1A 1FLRL 1FGVL 4YBLC 4TUJB 5L2JB 3SN6N 2ZSVB 4MXQC 3WEXA 3RBSA 4WDIA 3LKNB 4GSDH 3P0VH 4V2BA 5BVPH 1NCNA 4J3OC 4QXGL 1MQ8A 1S7QB 3CFEA 4MXVE 4ZPTA 5BMFH 3KPPB 5TDNB 3FO9A 3J8F7 3HE6A 1QNZH 5AD0B 4HUXA 1DVFD 5HHQA 3C5ZB 5B8CB 3ARFB 4MLSA 4PV9A 3TNNA 3NH7L 4F3FB 3BO8A 2UVFA 1UQSA 2XZQL 3CU7A 4ONGH 4V2CB 5BRZE 5DVMA 2HA1A 1G9MH 1OOAA 3IJHB 3VGGA 4HCRA 3VWJC 4EVNB 1P7KA 3OKDA 4HMCA 2YD6A 3ARGD 3S88L 1FH5L 5E1HB 1WLHA 1FZKB 5JA8B 1MLBB 3SE4C 4QEGA 2V7HB 1K6QL 1OARL 1JHLH 3BDBA 2AJZB 2FATL 2K7PA 3DO7A 3TCLA 2NTFA 4TRPH 3I3EA 4M6ML 4LLWA 2NZIA 3VFVA 4FQJL 4WW1A 2FO4A 3DHMA 2RJMA 4M9PA 3AY4A 2ATKB 1U8QB 6CGTA 4NM4L 3DRTA 3AM8C 1J87A 1EHXA 2ZUQB 3U7AA 3K0WA 4RAVA 3VG9B 4E0RA 1RUQH 3IFLL 4HF5L 4U1GC 4HUUB 4S0TD 1A5FL 1T6WA 4WJ5A 3MRCA 1KCUH 1SEBA 2AW2A 4OZ4B 4TNVK 3NAAH 1FL3A 3ULVE 3Q0HA 3VXSD 1F58H 5I1EH 2AXGA 4Y19A 3ZYJA 4PR5B 4IJ3B 5GGQH 4KVNH 2I5YL 4CJ0A 4OTXH 4KTEL 2GJ6E 3CSBA 5B3NA 3KLSA 3S36H 5TE6H 1YN6B 1HHHB 3GJFK 4Y5VB 2LTQC 4JG0H 1JBJA 4QLRA 4L1DA 3JTSB 2UVEA 5GQBA 4FZEH 4DW2L 1K9TA 2YPKB 2H2SC 1FNSH 4F7EA 5ERWA 1NBVL 5BZDB 1H3PL 3RUGF 2A2QT 4ZFGL 1T1XA 5FYKD 2Y23A 3ROOA 1D5XB 4XCFL 4IS6A 4OCSH 3RIAF 4DAGL 5J1SC 1YYLH 4G6MH 5C0BE 3MREB 3HZYA 1YY9D 2A6JB 2AXJA 4LVNC 2IQ9H 1R0AL 5F1IB 3RDTB 1CVRA 2HT2C 3ZL4L 3SO3B 2C1OA 4PJ9D 2HKFH 2H32B 1UZ8B 3GSNL 2AV1A 3OG4B 5E03A 1P4BL 5CD5D 1A0QH 1JGUL 5GS0C 4GKSA 3WHE1 1YUHA 4LEXH 4HKXB 1MHEB 3NN8A 1OWWA 5JW4N 4L29B 2YRZA 2E5EA 5D96C 3PL6D 3SDAC 4WTZA 2VLJD 4HDIB 2GJZA 1XF2B 2CXKA 3JVGA 2NNAB 3CCHA 4HUNB 4BUGA 4QTHA 4RFOL 3PGDB 5F97E 1ND0B 3GNMH 5DS8A 2F5AH 3OKLB 2W38A 1AGEB 4ZSOE 4G9FA 3BKYL 4G8FB 4NT6A 2A73B 1LILA 3DV4B 3TT3L 4LCUA 1U6AH 4PRNA 3BD4A 3GDBA 5F71A 5EU6D 1GOFA 2BCKA 2W0KA 4YXKH 5IBLD 1MFDH 1KC5H 1I1AB 4PTUA 1XR9B 3K7UA 4R4BA 4MLIA 1NPUA 5DUPH 1AGCB 2H45A 2B1HH 3O2WH 4NQSB 1YEFL 5H2BA 4X6DF 2CIKB 1G7HB 3T0AA 3HI5H 1IFHH 3DSNA 4MD4B 5DXWA 1R3HA 4G5ZH 1RPQA 2FGWH 5J6HA 4KKNA 4ORGB 2DQCH 4XT1C 4M8QB 3QPQC 4YDVB 1YYMH 4DCQB 3UJJH 3L5HA 4D8PA 2EDWA 1I7ZA 2R0KL 4TSBL 2ORBH 2R2CA 1C5DB 4IHOB 4P57A 1KIPA 1LQSR 4NQVA 3SGKC 5C0EA 2GTWB 5JO5B 3E8UL 3OXSB 1FNFA 4LHUD 3L1OL 2AK4A 2ARJB 4NKQB 4FTVE 3MJ9L 3O3DB 3IJSA 3CLEL 1MJUH 3V4PH 3C6LB 5IJKC 1MRDH 2ITDA 5KSAB 4XP5L 4LVEA 3UYRL 4M48H 5C09D 3KPOA 5D7JD 43CAA 2MKLC 4GMTL 3PWUA 5IG7B 3QXDA 1QLEH 1Y18B 3D2UD 2DQEH 4OIBA 2IQAB 1S78D 2V2WB 4D9LL 4JRYE 4RDQG 3ZSSA 3NIFE 1BZ9B 3K2MC 1INDH 2WWKT 1TVBA 1S5HA 1EZVY 3VFWA 1D6VL 4DN3H 2MCPH 1I85C 1HHIB 5IFHH 1BIIA 3WJJC 1RUAH 3LKRB 4XI5C 4YDIH 4HKBA 4FN0A 3MV8D 1JPGA 2JCCE 2OK0H 4PJBB 5IKCA 1DVFA 5EIIA 5I1GL 3DX9B 2AS5M 1UCBL 3HS0A 3N1MC 3VFUA 4HS3B 5B8CC 3SOBL 3ARFC 2VISA 3U9PL 3HLAA 1OB1B 3ROLB 1P6AB 3IDJB 4OM1H 4PGDA 5JQHC 3RI5K 1INEL 1YEGH 1EX0A 3CUPB 1KACB 1UJ3B 3R8QA 3K8MA 4LK4A 3WFBL 3BT2L 2DQUL 4M03A 1KXTB 1TFHA 3MLUL 1FE8H 3T8XA 1JGEA 5F88A 4KJPD 1WICA 2V5YA 1EDQA 1P7HL 5FB8A 1A9BA 1BFVH 3ET9F 1MY5A 3MBXH 4NCDA 4LQ1A 1RIHL 4XVSL 1CLCA 1MI5E 5GGRY 3E1F1 3OGCA 4Y4FC 2ZUSA 4XPHH 3GMQB 1NC2D 3HPLB 2L0DA 3NCBB 4RQQA 5GRZA 1JTPA 2CLZA 5CINL 4F8QA 1RVFL 3V0WH 4OCLC 3B3IA 2MMXA 5DEFB 2DI9A 5AWNH 3U36B 1QVOB 1JIBA 4HBQA 4OD1L 5BRZB 3NPZB 1PZUB 3MUHL 4WGWB 4OLYL 2EDHA 2DQHL 2CRIA 3DXAA 3BUTA 4QNPF 5I76A 3K3QA 1RURL 2IFFL 2APBA 4IJ3C 1LK3H 4TQEH 5I8EB 4NRYA 4HWUA 1HKLH 4NKIH 1K85A 1A6ZB 3FFCD 4MA3B 1X5LA 1MLCB 5C8JA 1T1ZB 1CD0A 1E6JH 3O3EB 3N9GH 3LOWA 4QOKD 4X0KB 1P2CA 3UO1H 3G9VA 2XA3A 4GMSL 3FQTB 4TVSa 3X14A 3OJDB 1XCQA 1UACH 3VFRA 3QHZH 3VXRE 3D0VA 3DURB 2DWDB 3G6AA 4JG1L 1ES0B 1LO3L 1V7ML 3CDFA 1FO0H 4RMQA 5CSZA 2PYEE 4Q97A 3GKWL 2HAZA 5JIHA 5FGBA 3VFMA 1KLGB 3BE1L 1V5JA 2WBWB 5D2NA 5KW9H 4OKDA 3TYFA 4PUBL 3RDTC 5JPMA 1XGYH 3O2DA 1EXUB 5TPWH 4Z76A 4JDZA 4PJ9A 2VDNH 5TFSH 2X4SA 2GJ6B 3I6KB 2JJVA 3QNZA 4D0DB 2W0FB 1F4YL 3QUKA 4XWOC 5HTSA 1FDLL 5HVHB 4OLUL 1T21A 5ITBH 4X9IA 2OSLA 4MZ2A 1ED3B 2NR6C 2EDNA 2JTDA 2X6MA 1S9KC 3QI9D 4PGEA 4IRJD 5FA4A 1B9ZA 2F8OA 4N90D 3U9UB 3PL6A 5DC0A 3L95B 3T4AA 3GMMA 1K5NB 4U3CA 3V2AR 1NLDH 4PJ8B 5DD1L 3SDDC 5C0BB 5I6XC 5CJXC 3V5HA 4PLJC 1CFSA 3DWTA 3IXAB 4QRQA 3OKKB 4NO0D 4UQ2A 4CAGA 1IT9L 2VDPL 5E6ZA 4U1IA 5IVZB 1I7TB 4RMTA 2A9MH 4NKOB 1DBKH 1AIFA 1KTLB 1ODAA 4PG9A 3B9EA 1E4WL 3LEYL 1N7ML 1ZVSB 1JPTL 5EU6A 5IVOA 4CN6A 1BVKB 4XZUB 5DQDL 5JDSA 4W81A 5T3ZE 1F8TL 2PETA 1U58B 1KJ3H 3W9EB 3VGAB 4LSQH 1JPSL 1KB5A 1PGRB 2EDBA 4ZFOA 1OGTA 1GYAA 1Z9OA 4FQIL 2EKSA 4JHAL 1N64H 4ODHL 1FBIL 3GJFA 2AJXH 2LE9A 3MJ8A 3I6LE 3DRQB 3OGOE 1NH6A 5MP6L 4KQ3H 1QACA 3DI3B 3DECA 3TC9A 4KPHL 5DVKA 5IBUB 2CGRL 1L0XA 2FB4L 3L5JA 4HH8A 2EH8H 1VB9A 4OLWH 2A74A 4ZSOB 2VN7A 3EFDH 2XZAL 1A6AA 1XIWC 3GSUA 1BM3L 3IXTB 4HGWB 3RZCD 3MGTA 1GVIA 2EYSA 1DQQB 1WISA 1NUFA 3BX7C 2R1WB 4AIZB 2HLFD 1U8HA 2NW3B 1QLFB 1ETZA 1RJZA 2DBLH 2DYPD 4YHLH 3HN3A 3GK8H 3HRZB 1F4AA 4I0PA 3R4DA 3TIEA 3C6LC 2XXMB 2HVJB 1LE5A 1CCZA 5FCUL 4J1UB 3DVNB 1WCQA 5C09A 4O2EB 5GRWA 5CCKL 4YXHH 2FEEL 3LH2L 3C08L 2APWA 5DC4B 1QFUH 2XIDA 5HVGB 4H0HB 4N8CL 1MRCL 2FHFA 4NGHL 1KPUA 4LPTA 5MHSE 1B2WL 2HWZL 5DRXB 3U46A 4HHAB 1Q94A 4GKZA 5GS1A 3BGMB 3TN0D 3JV6A 4WCYL 5C0IB 2WINA 5JQ6H 2HJKA 2JB6A 1OAYH 3MV8A 1IGTA 5C0AD 5J13B 2RAMA 5IJVB 4XVTL 5E8EA 3RBGA 5IVXA 2Y5EA 3ZDYF 4FTVB 5DZOA 4PGBA 3TO4B 3TFKD 5C0CE 4BH7B 4P9ML 3OKMB 4NZRL 2XTJE 4KTYA 2D9CA 5CBAA 3NACL 1T3FB 4RGMC 3QUZA 4KK8C 1OP3H 1T1YA 5KS9F 1UJ3C 3CFKB 5HYIA 1WFUA 2ZOKB 5EOQL 3RJDA 3X12B 2CK0H 3MMEA 4JRYB 2P44B 9CGTA 4I8DA 5C86A 4DUXA 5E0QA 4HWEL 1NCCL 4R0LC 3P9MB 4WWID 5I74B 5HGDA 1DN2A 4NKMA 4YHKH 1DL7L 4XP6L 3LQZA 5IFJB 5JW3L 3RFZC 2MCG1 2H9GA 5T33H 5IW6B 5ACZA 3QNYA 3BQUD 3QUXB 1NQBA 4K94H 3AS3A 4JM2B 3MRPA 4O5LH 3OMZA 2JCCB 3D25A 3MUGB 1CU4L 3T2PA 5BCAA 4DK3A 2I9TB 2KH2B 5LCVH 4P0DA 4YEEA 5C2UB 1I3GL 4JPVH 5FDYA 3TA3C 1A1OB 1KYOK 2BJML 2WQRA 4GRWE 3FT2A 3ULUH 3ILPA 2DLGA 3P40A 4OZFA 5GJSL 1ZT1B 4A2MA 1UH4A 1G7PB 3CFDB 2FNBA 3F58L 4OJFL 4UINH 5ESVB 3VE0B 3NFPB 5GGVH 4ETQA 3S4SA 5HI5C 5E6ID 3FB5B 5EFIA 4DKEL 3GSQA 1XH3A 2M1KA 3FFCA 3Q6GL 1ORSA 5K9QI 1MI5B 3V6OC 1MELA 1IGJA 4JFQA 3EYFB 1G9NL 4RAUA 3TVMB 1EK3A 3T4YB 2SEBA 1CGSL 1CLZH 3IJYB 4CVUA 2XA8H 1OTTC 1A3QA 5FHAL 4OCXH 4OGXH 1EEUA 2E27L 2VZTA 4YXLL 1QR4A 1T0PB 3WHXA 2AEPH 4WFFD 1MCLA 3UTZA 1NBYA 4MAUH 1BZ7A 2EIEA 4HIIA 1JGUH 4ELKA 2YBRB 2FR4B 3I02A 1KLFA 3OKYA 3RNKB 1S7TA 1N5YL 2P8MB 3DUUB 4ZQKB 1S9WA 2W65A 3D69B 1MPAL 1WAAE 3NIDE 1Q9WA 4MCZB 2K3TA 2ZZUT 3S37H 3RWCB 1FAKT 4X6CA 3AU1A 1CLOL 3QI9A 3REVB 4IRJA 4JQXA 3T0DA 4L8DB 1BEYL 1TLKA 5GZND 3WNOA 4CVZA 2WBJC 3S35X 4LP4A 4LSTH 3VXRB 4RGNB 4LGRB 3QIBD 4CVWA 3LKOA 3NPSB 2PYEB 2HFFA 5IB4A 2UWEA 4U6XB 4QY8B 4Y0GA 1AGBA 1UVQB 1G84A 1W0WB 3MRMB 3P4NA 3UC0H 4LSRH 2I60H 3OX8A 4PJ5E 4HPOH 1JHKL 2X70B 4UUJB 3P9LB 4QWWD 1C5CL 5E7BA 3LV3A 5E8NA 1FZMA 2B0SH 5CEZD 3TO2B 2DQDH 3EBAA 1FYHB 1QFWI 1UENA 4N68A 2X4NA 3MRGB 3RNQB 4DEPC 1NJ9B 2CKNA 2DWEA 4WU7B 1QKZH 2FX8L 4K3GA 2HN7B 1RZJC 3ZE1E 1X5KA 3WUZA 4RDQF 1MHCB 2E7LC 1EEZB 3O2VL 4F15B 3GBLA 3L7FB 5FA3A 1HILB 4QYOB 4F33B 2YKLL 5EZOL 4LQFH 1IZJA 1X9QA 1FAIH 1GC1L 4L5FH 3QDJD 3RZCA 5TDOB 4Z0BH 2EYTB 3NCCB 3WXVL 1JL8A 5IB5B 4X9GA 2QSCH 3D85D 4PTTB 35C8H 4OGYL 2IBZX 2D31A 4JY4B 3L6FA 1DLFH 1PG7L 4XNYH 3LS4L 4FG6D 3PWVA 5MEOA 2GUOA 1BQSA 3U7WH 3QNXA 1B3JA 5DGQA 3QIUB 2HFEB 1EGJL 1MCHA 1JYNA 1WFTA 1FNAA 1YQ2A 4UV7H 3LQMA 2F54E 4K9EH 4OFYD 4Y4HC 3BIAX 3FOMB 2JK5A 2J8UF 4ERSL 1DQLH 3TN0A 5EORH 4NNPH 1JF6A 1LO4H 1KCLA 4AEEA 1T7WA 1CD8A 4X4MA 3VXPA 3O45B 4JHWH 5L6YH 3RGVC 3TJHC 5DC9B 3QUMA 4KJYA 2A6KB 4MJ4A 2WWKO 3T77B 1BPVA 3INUL 1M71A 3CXHK 3TO4C 3BT2H 4KDTA 4GKNB 4YZFE 3RVWC 1E4XL 3VI3F 1G7LB 1HXYA 4Y5XA 4ONFL 1XR8B 4P59L 4HFUH 3HI6H 3V0VA 5EA0L 5FF6A 1MFCL 1WBXB 4PJIA 4F57H 4HXAH 2O61A 5FM5M 1FC1A 4W6WB 3BUYB 2VLRA 4XGZB 1F90L 3BQUA 5FYJU 3OBAA 1U8IB 3GI9H 5F7EL 3QUXC 1S7SB 4AT6B 4M93B 5F7UA 2CIIB 5ILTL 4S1QH 2E3VA 4XCEB 3ZHKA 1VGKB 4P46C 2A1WL 1EFXB 5C0CB 2XTJB 4PRBA 5FYLH 1P84K 3IS0X 2A77L 2YSSB 4PRID 5ICYB 3CXDL 1YJDH 2WQ8A 1W72H 5IF0A 4XH2B 4PD4J 4IMKA 4TOYL 4FQHB 4U1MB 2R2BB 2VQ1A 1RULH 2NW2B 1FIEA 5E6IA 5HYSB 1RUKH 3L3GB 1PX3A 1BQHB 5HYFA 4X6EA 3DETD 1A9EB 2B4CL 2Y25A 3FAWA 1J0IA 3BRGC 4A6YB 4Y4KB 4HJJL 4YGVA 2BOBB 1CF8L 1BFOA 2OS7A 3EJZC 3QXUA 3RL1B 3ARBC 3IRZA 2R8SH 3QQ4A 1ZHKB 5E8PA 1FC2D 3IAPA 3HMXH 3MLRL 1CWVA 4HWBH 4P2RE 4ODVL 4GRWB 4GXUN 3X3GL 3QA3B 2HT4C 1F4YH 4WHYH 4WW2A 3JZ7A 3HI1B 5SWZD 3E6HB 3QEUB 1V8HA 2QQLL 1R3IL 2R0ZH 3L3HA 1Q1JH 5IOPB 5A40E 1J0JA 3U30B 4H26A 1J11A 1QFOA 1J5OL 5C0GA 3WIIH 3GRWA 1CBVL 4RX4D 2Z4QA 1P53A 4N8VB 5DJZA 4PP2A 4CKVX 4XPAH 3WIFA 1G0DA 4M5YH 4GBXB 5I1AA 2ADJB 2C3XA 1IM3A 3ARDD 1UCTA 3QIBA 4KY1L 4RGNC 5T3XE 3MNZA 2HLAA 3BZFB 4XNUH 1F3JB 1NBZA 3NPSC 5D2LA 1G6RB 5I9QB 4KK5C 2MFNA 3PXHA 4D9QD 1UA6L 3K2UL 5F6HJ 4N1CA 2QHRH 3LHPL 5F7YC 3QWRD 3QO1B 1HH6A 3EYVA 4Z78B 4HG4J 1GIGL 4N1EA 2XZCL 3DV6A 4K23L 3T1FB 1ZHLB 2H8PA 2DBJA 1L6ZA 1GHFH 2X4RB 2EIDA 3FTGA 3L5XL 3AREC 4KI5F 1XGUB 5E2VH 3BKMH 5DQ9B 4OGAC 4XXDB 2QQKH 5JOPD 5IWLA 4OZHF 3KPRD 4WHTB 4JR9H 1MCOL 5AZ2L 3LIZH 3HC3H 1Y0LB 1E4KA 1JPFA 5DHYB 4X8XA 5D71L 2PXYB 1YEEH 1FGNH 3P9WB 5FUZH 1BBJB 4N9GA 3FHAA 12E8H 4GXVH 1LE9B 1SEQL 1CQKA 2CRMA 2DB8A 4CDHA 4PJ5B 2R39A 3N1FC 4JDVB 5E2WL 4HGKC 2NY6C 1T0MB 1CD1A 1GPOH 2ZSWA 3QEHB 1FYTE 3D85A 2OTUA 4LARH 5MEND 1EUTA 3QQ9D 5TF1H 1VEOA 1H9VA 2J6EH 5D93C 2M8XA 1KPRA 1A4KA 1IGIH 2ZJSL 2KPNA 1KENL 1IM9B 4OFYA 1A2YB 3KLAA 3LVEA 3SDYL 1E28A 4WUKH 3HNTH 3QUYB 5A3IC 3KHOA 3QRFM 3MROB 4ZOCA 3TBVA 3LRHA 3MJ6A 4FQ2H 4WUUD 5E8OA 3CH1A 2YZ1A 2V7NB 1DDHB 2Q20A 1LD9B 1I9JH 3EZ8A 5DDHB 5IROA 2F5BH 3EUUA 4PYGA 2GEEA 3ALWA 4HSQA 3F5WB 4LLUB 4NRXB 5C0DA 4KMLB 4Q6YA 3U0PA 2FHBA 1NGPL 5T5NG 15C8L 1ZA6A 5DJ0A 2VR9A 2VLME 5D7IF 4I18B 4MD0A 5ALBH 4QXUL 4R26H 2B5IB 2ENYA 2BC4B 4O00A 4TUOA 1WCBB 2X1WL 3FN3A 1SJVA 5JW3H 4GW1A 2F54B 4NP4L 1N0XL 1Q9LB 1UXSB 2DLEA 1XF1A 4KI5C 3TYGH 1FFNB 4YFLF 2OQJB 1JZ4A 4CBPA 3IB4A 1KEGL 4Y16D 1N2RB 1ZAGA 5E2UL 5IMMB 2AEWA 3GSXA 3MNWA 1XF4A 1LDPL 3SGEI 1ZLWK 1RHHB 3FOLB 2EDKA 4J6RL 4JY5L 4MNGA 4HJGA 5I16A 2J2ZA 2P5WE 4RISL 1DBAL 3S3PA 2LVEA 3NCFB 3PIQB 1C08B 2Z31A 4R2GB 2ED8A 5E56A 4HS8L 5K9KA 4F80A 2CLRB 3MFFB 2R2HB 5J6GB 2XTJC 5GJSH 1RIUL 4JFHE 1U8PB 1H3TA 1VFAB 2DM7A 4OJFH 4PRDA 1M4KA 2YMXH 3IFPA 4V1DA 1T5XA 5HJ3B 2UZIH 4JO1L 3LPWA 3V6FB 1IC4H 2DIBA 2DI8A 1K8DB 5CP7B 3X3FL 4F7PA 1U8LA 3BEVB 1QSFD 4U7KA 5IBTL 3UJTH 4PLKD 3WDHA 4EZMA 5IQ7H 1IEHA 3E6FB 2CJUL 4XPBL 4H88H 3GGWB 3B83A 4LASH 3EO0B 4AK1A 3D1MC 2QADD 2ZPKL 4YXLH 4KJQD 2E6PA 1UG9A 3NOIA 2VXQH 1F13A 5F9OH 3DIFB 4JFXA 5JPNB 5B3JE 3Q1SL 4ZD3H 2CDEA 4L8CB 5I2IA 5ADPH 4Z7WF 4PV8A 4ZPVB 3RWDA 1L6XA 2DJUA 3EGSA 2AABL 3IGAA 3GHBH 4C56E 4POZD 3ZHDA 4QHNA 5SWZA 5FYKU 5D8JL 4NQEE 2EC9T 3BJ91 1DBJH 1UEMA 1X5YA 3RWFA 4GRLB 2NY7H 2WZPD 4XCYB 4OIIL 5E9DB 2EDQA 5EU4B 4RX4A 4J3WA 3CDGA 1KIQB 2G2RA 4WTZG 3ZDZE 3QIWD 1LDSA 2NY2B 1YMMD 2PW2A 1NFDF 5C0JA 1PAMA 4XP1H 1CFTA 3RX7A 3HE7D 3MLZH 4R4ND 5FUCE 3UAJD 1S8DA 4P2RB 3MOAL 4XP4L 1XEDA 1YEHH 3VH8A 5HGAA 1M1SA 4L8SB 5CJOH 4G9FE 5DMGC 3VXTA 2IGFH 2L7UA 1ZS8A 1WIUA 3UTQB 4Q9RH 1MWAH 1SBSH 4G8IA 5IFAH 3RKDC 3DX8A 1MCWW 2GSGB 4GOSA 5JHLL 1T20A 3QDGE 5GPRA 1AE6L 1MY7A 2FX8H 1AXTL 3L9RB 3JWDC 4WENB 5EU7C 3GMOA 1KJ2H 4UZGA 5HD8D 1YEJL 1RD6A 1NANH 1KG0B 1RK0A 1DTUA 2Y6SC 4ODXB 4TNWF 4YO0A 3KPRA 4Z77A 3IAGC 3SQOH 3FZUD 2P43B 1ZLSH 3VU2A 3O9WB 3CDCA 5DHVH 4TVPH 2KKQA 3T0WA 4AENA 1RJLB 4YDJB 1A7PL 3MLXL 2IH3B 3SE9L 1G7JB 1HNGA 3MBEC 5GHWL 2KZWA 3OHXB 1I8IB 1U91B 3T04D 5D6CB 2ESVD 3G9AB 4LOUC 4Q6IA 3TIDB 1FZJB 1CICB 1VGEH 4JJ5A 1QTYT 5D70L 4FQQA 1WC7A 1FFRA 4RIRA 4AH2A 1DEDA 4DUVA 3L3KB 4LCWE 4XVJL 5GJTH 2NXYB 4UIMA 1UM5H 5DMJB 4H20H 5HPMA 1D3CA 4WEUD 5GS0H 3ULVL 2AK4E 1Q72L 3IKCA 3KXFB 1HNFA 3KYOA 3GI8L 1LEIB 4PJDA 3SE4A 1DP0A 3SY0B 4K3DH 2OJZH 1IEAB 1R3KB 1BFTA 5IHZB 1L9MA 1R5VA 2W9DH 4XAWL 2VSCA 1ORQB 2PO6D 3GIZH 4YUEL 3VW3H 1VA9A 2E9IA 2UY6A 3S5LA 1YPZF 1NGYB 4KROB 3V5DB 3MRNA 1E0OB 3CVHA 2APXA 4WUUA 3WIHL 4JY6B 1FNLA 1MFBL 1RI8A 3MLWL 3ISWA 1CTNA 3UZQA 1X7QA 5L2KD 1HZHH 4WV1C 3TPUB 3PDGA 1CI5A 4HKJB 1T83C 1FYTB 3KHQA 2VZVA 2LU7A 3STZA 4AIOA 2FIRT 5ESAA 25C8H 3C9NA 2AJUH 4JKPH 3SDXF 1J7VR 3QQ3B 2ITCB 5DF0A 3NABL 1OT1A 1KJ2A 4LSSL 2MHAA 4I18C 4D0BA 5GRVL 3MRFB 2B5IC 2J8HA 3H0TA 4L4VD 4X4XB 1A6TA 1OAKH 3MRBA 4MA8L 1A7NL 1HN1A 4K8RC 3WD5L 4UAOB 1F90H 1X5AA 2CO7B 3JTTB 4NZTL 4Z7UA 5DHVA 2G9HA 5CZVL 1TVHA 3WEXB 4ZOAA 4LFHD 2QQQA 1KFAH 4KHXH 4DUWA 1QSZA 1OQXA 2HYMA 4D0CA 4ZXBD 4ZPTB 3CU1A 4HPYH 1Z0MA 4HUXB 4G8GD 4HBCH 5HHQB 1GOHA 3M8OH 2DMKA 2VR4A 3TNNB 3BGFB 1MCFA 3BO8B 1CXIA 5CLWA 4DZ8B 3SE8L 1UQSB 3O6KH 1TJIH 2IAMB 4HGMA 2PW1A 3QCVH 3DXAE 4YHZH 1RUML 1IKNC 2XFXA 5KVFH 3MOBL 4NN7B 3CFJB 4I77L 3GJEA 4OD3L 5T1KB 1HOCA 4XRCA 1EZVX 1J9CT 4N0YH 3WDJA 2VQUA 1DZBA 3C60B 1OGAD 4WEBL 1U3HD 4S2SA 5JHDD 3GSVA 1Z3GL 1H5BC 2R4SL 5JLZA 4LP5A 2P5WB 1CQYA 2NTFB 1YEKH 4LLWB 3T2NL 3VFVB 1P69B 4WW1B 3RVXC 3AS0A 4MQTB 1D5IL 1IMHC 4AJ0A 3BN3B 2WIIA 3R1GH 3DRTB 2P46B 1WFNA 5E4EB 4G6KH 1BX2B 1JYVA 1K8IB 4E0RB 3ALXA 4FFWC 3D87B 4WJ5B 2VXTL 1FVCB 3MRCB 3N85H 1SEBB 4TN9A 1ZT7A 5D2NE 1FL3B 1GGCH 3B6SA 3RWIB 3JV5A 3BDYH 3QISA 2AXGB 4Y19B 3LN5B 5EC1A 2DQGL 2ID5A 4JFZH 4UBDD 4PREA 3QDME 4GRLC 4JZNA 4JB9L 5TE7H 3UTSA 3BMVA 2FSEA 3ZKNC 2MWCA 3QIWA 1CE1L 1G7QA 1HINH 1IAOB 1SQ2N 3MACL 1YMMA 2EO1A 4F7CB 1T1XB 4YR6B 5FM8A 3ROOB 5LQBL 1TQCC 1IC5L 3AB0C 3HE7A 4OB5H 3SGKA 4W4OC 5JTWA 4OLZH 3W9DB 5I0DA 3DGGA 4HZLA 3LHPH 2FX9H 3HZYB 1V3KA 1IQDA 3Q48A 4JVWA 2VUYA 4ZFZA 3TNMA 4MCYA 1KN4L 4NFBA 1SY6L 5T5FL 4E9LA 4S1SL 3CK0L 4L8SC 5IJKA 4NQEB 2MSPA 4OQTA 2Z0BA 1J1XH 2VXSL 1U2HA 3FB6B 2H3NB 2BRRH 4GKSB 3L3OA 3ZYOA 3LRSB 2Y9RT 5JMRA 5CP3H 1YUHB 1N0LA 2HG5B 3NN8B 4K2UH 1JZ2A 1F4XH 3SJVE 3FONA 2RB8A 4QCIB 3BYYA 3TV3H 4JFDD 1IAMA 5JOFA 4MQXC 1JI1A 3MUY1 43C9B 4QTHB 4DVRH 1KOAA 5LAXA 3REWB 4BZ2H 5DS8B 5GRJL 2CXGA 5DUMH 2OTPA 2EEBA 3A67L 4FFYH 5HYJD 2ESVA 4G9FB 4LHUG 3B2VL 2RQ8A 1PY4A 5C6PB 1I9RL 5D1ZB 3H7BA 2DQIL 3IU3B 4PRNB 2BCKB 4M3KB 4QHLA 1P7QD 5TQ0L 3QDGB 5C7XL 2Z8SA 4KVCL 2J88H 4I1NB 1NLBL 2CMRL 2V2TB 4PTUB 1RY7B 3WL9B 1P4LA 1MJ8L 3B43A 5T5NF 2EKJA 1OW0C 3P11L 4AMKH 4FFVD 4X6DA 1LMKA 4S1RH 3A6CL 4PGZA 4QF1B 3VWKD 4JO3L 4Y4FA 3PHQB 5CSBA 5ICZA 2Q8BL 3EJYC 4AG4H 5B21A 3KPSA 1BMGA 2A6IA 3CD4A 4YWGH 4WY7H 3WLBA 3BAEH 3GSWA 2PO6A 3PDDA 3H9HA 1R3HB 3KPLA 4ENED 4QRSB 1UB6A 3CX2A 1DBBH 4NZUH 4LCIH 1T03H 5J6HB 4YQXH 3RWEA 1WTGT 1WZ1H 2B1AL 3H9SD 4KROC 5JW4R 1A7OH 1WBYA 4D8PB 4TTDD 4AL8H 5DJXA 1I7ZB 2P47B 1WWAX 3B9KB 1MIML 1JCKA 3BZEB 3WFCL 4HIHB 4P57B 1KIPB 5L2KA 4HKZA 2OI9B 5C0EB 3RVUC 4LCWB 4MZ3A 3MV8E 3KLHC 1BD2D 5IW3A 2AK4B 5L9DL 2YXMA 2NY4D 3IJSB 1J8HD 4JZJC 4EI6A 3H6JA 2ITDB 2JJTA 3F7PC 4NP4H 4PS4L 3ZKMC 4KMQA 1NMBH 1L4IA 4AIXA 43CAB 4E42A 4L4VA 4XP9H 2IPKA 4G6JL 2IG2H 1A21A 4FQ1H 3VA6A 3BN9C 1JFQL 3OPZH 1TVBB 3N06B 5CZXC 3VFWB 4U3HA 3SKOA 5BW7A 2X1OA 3VXNA 2R1YA 4HT1H 1FPTL 2P8LA 3RY6A 5IEKB 2GSIA 4DTGL 1JPGB 4ZDHA 1AKJA 1VADB 2ZCKH 4QHKJ 3HE6C 5IKCB 5EIIB 5CAYB 3HS0B 4M8VA 4NUJA 3BZ4B 3VFUB 1RZKL 3VRIA 2VISB 5L88H 5DGRA 4QXTA 1M6OB 4OZFG 1UEYA 1PG7W 4KH2A 2IMMA 3HNSL 3TH4T 4Q9QH 3LKQA 2GJJA 1DSFH 5L8LB 1XCTA 4N0CD 3F62A 5F9AC 3LKPB 4MD5A 5DRWA 4EN3B 4NN7C 1WEJH 2VDRH 3T8XB 1P4IL 1H8SA 2QHLA 1JGEB 4HIEA 5F6IC 5F88B 3RRQA 4FXGA 1CDYA 3SDDA 3IDIB 3P0YH 5CJXA 1EH9A 1A9BB 5FB8B 1X5XA 1JZ8A 1U3HA 2PUQT 3KYAA 2R4RL 3T3MF 5B39A 3JWOC 2YD9A 4G3YL 5LWYH 4G7YH 1U8NA 4K55A 2CLZB 4XMPH 4Z5RA 4YJZL 2JB5L 5B4MC 2MTPA 2VDMH 2E6QA 2NY1D 3HAEH 5KSBF 3AY4C 3B3IB 1EAPA 1MHPL 4ETYA 5I18L 3KGRA 1AO7D 5F9WC 3HPJB 2XN9E 4LGPB 4KFZC 1FORL 2NY0D 3ZYIA 5JZ7C 5HHPA 5I8KL 5FO7A 3DXAB 4JO4L 4PD4K 1ADQH 4ODSH 5I76B 3MJGX 5HHME 1MJ7H 1UZ6F 2W9EH 1PQZA 1CDJA 4NRYB 2WSKA 5E94B 5EPMB 3D9AH 4YHOL 3UTTD 5H37H 1PLGH 3ARSA 1EEYB 4BA8A 2ADFL 3WBDA 4BSJA 5SWQB 4QRRA 5EOTA 2FX7H 1RJCA 2CRZA 3CPLB 3X14B 1XCQB 4HFWA 3D0VB 4L3CB 3G6AB 5F7KC 4YK4B 1SJHA 2A6DA 4C4KT 4MHHI 5CSZB 2HRPL 4HUVA 5T1LA 4P5TB 5D2NB 5FCSH 5JPMB 5F3HA 1T2QL 4F8TA 2X4OB 4Z76B 2O5ZH 2DTMH 5F7NC 1QOKA 3OB8A 3QDMB 1HXMA 1E27A 3PHSA 5BV7C 1QQDB 3V9FA 2FYYB 3VFTB 1OP5K 3IFNH 1T04A 3WS3A 1T21B 1GCFA 5GGSA 4KQ4H 4HXBL 4M1GL 4AEHL 2GY7B 3AC0A 2YK1H 5DWUH 5FA4B 1MFAL 3SKJL 1MAJA 3PL6B 3T4AB 3FJTA 3GMMB 3SE9H 2CRYA 4UV4H 1EMTL 2K1MA 3IDXH 3HAEA 3RTQD 3W0WE 4YHIA 5AG9A 4TTGA 3NCYS 3WO4B 4P23D 3JVGC 5IMOA 4QRQB 4UQ2B 4QRTA 4A6YL 2Q86B 4GG6E 4PJ7F 1RZ7H 1UB5A 1IBGL 1KCSL 4LPUA 5HYJA 3BIBX 5DJDB 1M05A 2VL4A 2HMID 4PG9B 2DL9A 4LL9A 4RWHA 5J3HD 4HUWA 3EO9L 4G6AC 2BX5A 4KHTL 1CE6A 1PEWA 1IVLA 1P7QA 1OTSD 2EH7L 2W91A 1KTDA 3QEGL 4X5XA 3QAZB 3UJIH 4R0LA 2R23A 2EKSB 2QJDA 3SJVB 3VWKA 4GAJH 4E41E 2B2XL 3QRGH 4H8WC 3GJFB 1QUNA 2VAAA 4WNQB 1A4JA 2UY7A 3MJ8B 5JUEL 3RWJB 1MCEA 4XWGL 3TA3A 2R69H 4R8WH 3OF6A 2C3WA 1PG7X 3BWUC 2XWBB 1A6AB 2BNQD 4OLVH 3GSUB 5D7KE 1SYSB 3MGTB 4MB5A 4U6VL 1FHGA 2EYSB 4IRSB 2V17L 4PG2C 1T22B 1DCLA 4WGVB 1G6RL 1BD2A 3ARXA 3CLFL 5HDQL 4M6NH 2BNUB 1S9XA 1J8HA 4JM4H 1R3LB 3FRUA 3FQWB 4FQPA 4P5MA 3WD5H 4I0PB 2EDYA 1LE5B 4I4WA 2D7MA 1DE4B 5I30H 1N6QL 3GSNA 1F6AA 1IC1A 4U1NB 1KJVB 4KRPD 3IKKA 2CLVA 1R24A 1RZJH 3PWPE 1RMFH 2VXUH 3TZVD 5HY9B 5KJRL 3P30L 5F8RC 3F6IA 1AP2B 2YOCA 4PJEF 1KPUB 2G60H 4JGJA 1FG2A 2VLRE 5F9DC 5TQ2L 1OF2A 2GITA 2HJKB 3MV8B 5TE4H 3RWHB 1FNGB 3H3PL 2VE6B 1S9VA 4KV5E 4P5KA 1I7UA 1OD7A 4LCCB 1TZHA 4PJHF 1DVFC 3L7EA 1RIVH 3GBNL 4PGBB 4XHJD 1INQA 5LBSH 4EEEA 5KS9A 1MCWM 4NSKB 3ZT7A 3QUZB 4WWKB 8FABA 4Q2ZA 2JLLA 4S1DD 5HHNB 1T1YB 5EBWA 2RGSA 4XX1E 4ZUWA 1I4FB 1RAMA 4R97C 1B4RA 3ARGC 4M1DL 1KCRH 5IHUH 4OCWH 4LDEB 5B38A 4CNIA 5K9JL 4HC1L 2VL5B 1D5ZB 3MJ7B 3KYMB 1SHMA 4Z7QE 1JRHL 3MQIA 3OQ3B 2H9GB 5DI8B 5DUBB 2IADA 3QNYB 3O8XD 4I2XA 1A6UH 3WNPA 3MRPB 3D3VA 3D25B 3JWNC 1BGXL 3UPRA 2EYRA 4Z7NF 5EOCJ 2VITA 3VFOB 1AO7A 1XGQB 3DBXA 5K9QG 2O5YH 4QRUB 2G5BA 3IDUA 2FEEI 4KKLD 5ETUB 2BY0A 4TULH 1PKQA 3MLVL 4U1LA 3ILPB 1DBMH 1YEIL 5KSUA 4IIQA 3V52H 3UDWA 2ZWLT 4JRWA 2IJ0C 3HG1E 3FO1A 4ETQB 4OZIA 4GS7B 2H2PD 3S4SB 2VO5A 3DUSA 5SV3A 3GSQB 3DTXA 2AJYH 3UTTA 1ORSB 3EZJB 5ID1B 4DGYH 1NCWH 1BAFL 1PSKH 2I9LA 1UWEH 3MUJA 2XACC 2BDNH 2SEBB 1OAZH 3PHOA 2K7QA 2UYLB 1YDPA 1JK8A 5IESH 4ZOEA 2XN9B 4LLMA 1NFKA 3G04B 3WHXB 2W07A 3UTZB 4NFCA 1YY9C 4H1LG 4XNXL 1CXKA 5D2LE 5FYLE 1BZ7B 2HKHL 1MCPL 4HIIB 5GGTH 3B9DA 4M7JL 3WFEL 3LD8C 5FGBC 2Y06L 5HHMB 3HUJA 4ELKB 3I02B 1NDGB 5F7HA 1J1PH 4LU5L 1XGTA 5ITFA 4PJ9C 4D3CL 1JUFA 2W65B 5CD5C 4F58L 3QEQD 5K9OA 4DGVH 1UM6H 4Y89A 4EOWH 1PKOA 1Z9LA 2VABA 4MXWL 4Y4HA 2IF7A 5HGBB 1AFVL 2GFBB 1OLZA 2BVOB 3GMRB 3QI9B 4X7SL 5ESQA 3PQYE 5F93C 5D72L 3V8OA 5IEHA 3PWJB 3QB7C 4FQCL 3CGTA 3PL6C 1LK2A 3QJHA 3EYSH 3RTQA 1RZ8A 3U7YL 2WP3O 4P23A 1DLHB 4OD2A 3RGVA 4Z7VE 2HFFB 5IB4B 3BRDA 5AUMB 4ALAH 1AGBB 1TZIA 1ZHNB 4BZYA 3U48A 3GM0A 4OFIA 5IVXF 1AGFB 1NC4B 2AGJH 2ICWI 5E4IA 5F3BA 2FH8A 1KT2A 3OX8B 4EQ3A 4LRNH 1A7BA 3O6LH 4MAYB 1UT9A 3U1SH 2JELH 5IBLC 3LV3B 2Y07H 5EO1B 3NCJL 5E8NB 4ODTL 1J0KA 3DX7A 1FZMB 4N0UA 1HQ4A 4UDUB 4UNUA 1JI2A 1EO5A 3GZKA 3W0WB 3VRLF 3FO0L 4LLQB 2E9BA 1U2CA 4P46A 3PJSA 1K2DB 1Q0XL 3I85A 2BNRE 1GAFL 4X6BA 2DJSA 5FA3B 2HFGH 1CIUA 2XWTA 4KGLA 1PZ5A 1F00I 4C55A 3LMJL 4Y1AA 2BNQA 5E00B 4U2ZA 1B0WA 4NQCE 2P5EA 1OAQL 2YWYA 2C3HA 3EJJX 2PCPA 5GGRA 4DZBA 4LMQE 5GRXG 4LNRA 4ZS7H 5DQJA 4YDLB 5D6DA 2G75B 5KVGL 1NGWA 1FJ1B 1LP9F 4E41B 2QR0A 5BS0A 3PWVB 4XMLL 2J7LA 5MERB 4AEIH 2WANA 5GS2H 5MEOB 3QNXB 1ULVA 2W0PA 1FNHA 2Q8AL 5D7JC 1U8OA 5C08D 5I1DA 2ADGB 2ILLA 1S78C 4ONHA 2J8UA 1IAIM 3U0WL 1CL7H 1QFWL 1IKFH 2JK5B 3EOYG 3IETA 4XC3H 3GFUA 5HHOD 4BH8A 4DGIL 3IYLW 5GS1C 1NCBH 1GSMA 4RBPK 4MNGE 1NCAL 3GIVA 2DI7A 5HI4D 1XT5A 2Q7YA 4YHYB 5D1QD 2X9WA 4QGTA 5GIRB 2P7TA 5T3ZH 4FABL 1CK0L 3PABB 5F7FA 4L9LB 2IEPA 1T66D 3I75B 3K4ZA 1ITBB 2ZCHL 1HXYB 4S11A 4Y5XB 4LAQH 3RI5F 1BREA 4LPCA 4V1DE 4P2QE 5FV1L 4ZS6D 2R29H 3PWPB 4Q9CA 5EZLA 1R5IA 3EFFA 1YEDA 3V0VB 4X6CF 3VRJA 5CIPH 3H8NA 4JHZA 5FF6B 1AR1D 1OY3B 4KJPC 1KBGL 2O61B 3RPIB 2H41A 2WUCH 2VLRB 5D5MF 2VDLH 3O8XA 3QXTA 1B0RA 1CDHA 5L7XH 2UWEF 2NY3D 4TSAH 4ELMA 4PY7A 1YN7B 4PRBB 3GMNA 5F9JA 1KTRL 1H15A 5C3TA 1JV5A 1MVFA 4PRPE 3NFNB 3UTOA 2EEDA 2Q7NA 1AI1L 1CS6A 4OF8A 1IAIH 3KR3H 2NX5E 4TNWK 5SWSD 5SWZE 3IU4H 1ZWIB 4CGTA 4AY0A 4MJ5A 3VFPA 5E6IB 3MFGB 3WUWA 5I19L 4RZCB 4JO2H 4NIKB 3T0EE 1EHLL 1AJ7L 4X6EB 3KPNA 4LSPL 3WFHA 4DFHA 4Z7OF 4OUOA 3QHFH 1Z5LA 3LRGA 4J3XA 4X80H 3TT1H 4Y2DD 1YA5A 5FGCE 2YD3A 3HFMH 4YBQD 2EDTA 1BFOB 3MNVA 1W8NA 3QQ4B 2M2DA 1UM4L 3QCTL 1NGXB 1JVKA 5CHNA 1MCIA 2GHWB 4NC0B 3W2DL 4WW2B 3G6DL 4N0RA 4JZOB 1JHTA 1WIOA 3I84A 4J23A 3RHWF 3HG1B 5F1NA 3L3HB 2IWGA 3GSOA 5JXED 2YD5A 1FSKB 4JQIL 6FABH 2DAVA 2B39A 3OZ9H 4H26B 4EI5B 3QEQA 1I1RA 4Q0XL 3BIKA 3KS0J 1ZVHA 1I8MA 5GZOD 4C4KO 3GHEL 3F7YA 4JAMB 2Z4QB 2DDQL 3HCVA 3GUTB 5DTFA 1TJGL 3ZTJG 1WQVT 4PP2B 2UUDK 3X13B 1QLRB 2XV6B 3QI9C 5JR1L 4IRJC 5I1AB 3P4MB 4P2OB 1IM3B 2AQ2A 3BW9A 5JOPE 5C3LD 5TH2A 3JWOL 4N5ED 4OF0A 5I66A 3MNZB 2HLAB 3F7VB 3EDJA 5C07E 2AJVL 5D2LB 5E99H 4M1CD 5E6YA 4KHTH 4E5XA 5FOBA 2YPVH 4FQXD 1A22B 2CPCA 1N3NA 2I07B 5DD3H 3EYVB 1U95A 2P4AB 4ZUVB 1JWMA 3WMSA 3ARTA 3DV6B 2OXGA 3OKOB 1S3KL 2H8PB 1G0YR 3MGOA 5BZWA 5MEQA 3VA2C 3IDYB 3LQAL 4APQB 5EWIL 1K4DA 3PQYB 2ZOLA 3TJEL 3W5MA 3T08A 1A6WH 1D5MA 4PJDE 3QULB 1OPGH 2HTKD 1I8KA 4PJIF 3S5LG 2DOCA 4OCMC 4PY8I 1A3LH 2F8XC 3O11A 3NIGF 5ICXA 1AD9B 3LKSA 4GSDL 5F1KC 4GLRH 3P0VL 2LU4A 4JPIB 5BVPL 3OSKA 5J9PB 4DK6A 3U0TA 4PLNC 1T5WB 5DLMH 5BMFL 1G6RH 4H0IA 4JFEE 3VXUE 4I0CC 4WUUE 1QNZL 1GXEA 2XWJA 1NGZA 1XF5A 3RZCC 5E2TH 4NUGH 1YC7A 1WV7T 1TETH 1RZIA 1KN2H 2ZSWB 4ONGL 2HLFC 3G6JA 4R7NB 3VGFA 3HZVA 2OTUB 4B5EA 3WNKA 1G9ML 3TBSB 3CJJA 3NZ8B 2ZP0T 3JWDH 3CC5A 3C5ZD 3UTPE 2W60A 5E1AB 1F4HA 1KPRB 3MO1A 2FLRT 2VLLA 3UBXA 2BNRB 3KLAB 4KJWD 1E28B 4TRPL 4RGOH 1CT8A 5DRZB 5HHOA 5E8OB 1JZ7A 3CH1B 1FV1A 1F5WA 1X5FA 4NQCB 5FAAA 3C8HA 3QFJD 3TN0C 4WFHD 4JPWH 3E2HC 2JIXB 3EYOB 1L7TH 4CVXB 1BZQK 3QPXH 5D1QA 1B90A 4YHYC 1RUQL 2F58H 2RCSH 5L8KB 1EEQA 1EO7A 3TFKC 4RBPH 1KCUL 4RCAA 1ZSDA 3NAAL 5J8OA 5DJ0B 4KDTC 2ZG1A 4L9DA 1F58L 5I1EL 5GGQL 4KVNL 2D7QA 4OTXL 3VGDA 3L3IB 4MDIA 3S36L 4TUOB 1MCBA 5TE6L 3B9AA 2OZ4H 1B0GA 4ISVB 3QCUH 4JG0L 4ZTOH 3S3SA 2LAAA 4MJIA 4U0RC 4FZEL 1FNSL 4WU5B 4BZ1H 1BHGA 3VXQA 3HZMA 4MNGB 3BQUC 4HJGB 1AR2A 4JKKA 4OCSL 3THMH 3PDOA 1YYLL 4G6ML 1TCRA 2XKNB 4Q9BA 3MYJB 4XC1H 2Z31B 3CSGA 2IQ9L 3K4DA 1ZT4A 5ANME 4LLYB 4BSVA 2CDFB 3ZKSD 1HHKA 3W39B 2HKFL 2IPTH 3MYZA 2R0WH 4V1DB 1T5XB 4P2QB 1KXVC 4NM8H 1NEUA 3BDXA 4NN6B 1A0QL 4O2FA 3HR6A 5SWSA 3BEWB 3BP7A 1B88A 5C0RH 3MRKB 1I1CA 4K8RH 4F7PB 1U8LB 4LEXL 1U3JA 3G5XA 5E6IC 2X05A 1V7NL 3UTSE 3RUGE 5HHVH 4Y2DA 4F7TB 5DD6B 1U42A 5DJ8A 1EPFA 4X7EC 2HKHH 4EDWH 3QZWB 2R1XA 3GNML 2EZ0D 2CDEB 2LQRA 2F5AL 1XGRA 1BVLA 1U8MA 4PRPB 4PV8B 2V2XA 4N8PA 3RWDB 4GG8A 5J11B 1MCRA 1QD0A 4UU9A 4D3CH 3IGAB 3QXWA 1A3RH 1U6AL 2NX5B 4WW2C 5SWZB 4YXKL 1VFBB 4P3DA 2GTZA 1MFDL 1VEMA 4JFPA 4EDXA 1KC5L 1JN6A 5JXEA 3GMPA 3T0EB 3KDMA 4G8EA 3PWNB 5DUPL 3ME0A 1E4JA 2B1HL 3O2WL 3CDGB 1KULA 5JXAH 1R5WB 3EHBD 5FGCB 3LB6D 1BQLH 2BOCA 1HCFX 3HI5L 3TPKA 1IFHL 2PW2B 4ZUTA 4X8JB 2OR9H 1I1AD 5GZNC 1KELH 4G5ZL 2FGWL 1L7IH 3FCTB 4EUPG 2DQCL 2XY1A 1YYML 3QIBC 2UUDH 3UJJL 4MQ7A 2DRUA 4QHMA 4CU6A 2ORBL 4EIGB 3VH8B 2CKBH 1MH5A 4OF3A 1IAKA 4NDMA 4FMKA 1F11A 3WO3B 3OR7B 4ODTH 5HSFA 4LVOC 1FQ9C 5DR5H 2C4FU 4G8IB 5J1TC 3OL2A 3DX8B 4W6YB 1MJUL 3V4PL 1T20B 1MRDL 3DARA 4QWWC 4G7VH 3CAFA 1MREH 4K3EH 4XNQA 5FO9B 1AY1H 4M48L 1E6OH 4PJGF 3GMOB 4X6DE 2DQEL 1OSZA 2QKIA 1DUZB 1RK0B 5EU5A 5CWSA 3MPCA 1UH2A 3EOAA 4O51A 5HYQB 1INDL 3KPSE 1UH3A 1TZGH 4K7PY 1OT2A 4DN3L 1A02N 5C07B 2MCPL 5EO9A 3M17B 5KSAD 1E4KC 4AENB 1A7RH 5IFHL 4G6FB 3V0AC 3G5ZA 1RUAL 4D2NA 2FJHB 4YDIL 1R6VA 3OJVC 4TUJA 5L2JA 5HGGS 4NOFA 2OK0L 4L8BA 1DANT 2OCFD 4X9HA 4C83B 4FQQB 4ZOBA 3UXFA 3LKNA 5GGUB 1KYOJ 4AH2B 2D7TH 4UIMB 3V4UL 1S7QA 5HPMB 4OM1L 3E3QC 1AGDA 2I25N 3ILQC 1YEGL 3KYOB 4YHPA 2EICA 4PJDB 1FL5B 5AD0A 1H5BA 3QDAA 3C5ZA 4FG6C 3RU8H 2X7LA 1FE8L 5DD5H 4YPJA 4LFHG 3BH8A 4F3FA 1SBBA 1BFVL 2R56H 3MBXL 5T3XH 1JZ5A 3IJHA 2BVQA 4EVNA 4UTAH 4XPHL 3MRNB 1D6EA 4JFEB 5HVWA 3VXUB 1OHQA 4WUUB 4U1GB 3JSSA 1FZOB 2I26N 4ZUUB 4X98A 3HNVH 4CU8A 4EBQH 3QFJA 3FQUA 1FZKA 1T89A 1X7QB 3BPOC 5AWNL 1MLBA 3NZHH 5IROC 2V7HA 3SDXA 1MWAB 1G7IB 4NO2B 2AJZA 4OLXH 2J12B 4OKVA 3ULSA 3V5KB 2ATKA 1KJ2B 4DFIA 2DQTH 3DROB 2MHAB 4CMMB 1U8QA 4DVBB 4KXZI 1LK3L 4TQEL 2GY5A 2EEAA 4NJ9H 2DN7A 1A6TB 1HKLL 3BSZL 4X7TB 5BRZD 4NKIL 4HUUA 5B39G 2A83B 3O41B 4J8RA 4OZ4A 4Z7UB 5DHVB 1E6JL 3CMOH 3N9GL 4QO1A 3VXOB 2A0LD 4PR5A 3OWEA 4LVNB 3UO1L 2AQ1A 1KIRB 1QR1A 1UACL 1YN6A 2LVCA 2C1PA 3QHZL 3PUCA 4Y5VA 2AERT 4K3JH 2ZCLH 4XPGH 4MWFB 3JTSA 3I6GB 1QEWA 1FO0L 3O0RH 4NJAH 4FOMA 5FDWA 5J4MA 2BSTA 1WZMA 4LHJB 3PP4H 5KW9L 3DSFH 4QNPE 4QT5A 1S7XA 1XGYL 5TPWL 4XNMA 5C6TH 2VDNL 5TFSL 2PW1B 3PGFH 4LKCA 1MVUB 1OVZA 1A1NA 1FIGH 1AQDB 2JKXA 2XFXB 5DK0A 5FGSA 2A6JA 3SDAB 3GJEB 1HOCB 4NYLB 4XRCB 1EHAA 5ITBL 4NZDA 2OBGA 3ULVD 4HUMB 4I3RH 5I71C 1A8JH 5DK2A 3GSVB 2H32A 5LXGH 3DETC 1UZ8A 5JLZB 3G5VA 5I1IH 3C09C 4UT9H 3T09A 1NLDL 4P48A 4QRRE 3MCKB 3OAUH 5L0QC 4HKXA 4OAWB 5ANMB 4G80B 3NCMA 2WIIB 2X1QA 5D1XD 1EBAA 1JNNH 5C71A 3A6OA 2A9ML 1DBKL 4PJ8D 1XF3A 5C0BD 4DKFH 2IPUK 3B6SB 1CGVA 1T4KA 4I3GA 1HEZA 2PYFA 3U2SA 1ND0A 4HCRH 5EC1B 5FYJH 1KJ3L 2CUHA 3OKLA 2QBWA 1G0XA 4LSQL 3TBWA 1BOGA 4P9HC 1DQMH 1H3UA 4OV5A 4G8FA 5A2IH 3CSPA 2A73A 3UTSB 4WTWA 3RUGB 3JWOH 2AJXL 1JF1B 4KQ3L 1I1AA 1XR9A 5JW5B 4JREC 1N8ZA 4I48B 5EZIH 3ARDC 2EH8L 4OLWL 1I7RA 1GGBH 3EFDL 4ZFZB 1G7HA 4LLDB 4MCYB 4JZJA 3MV7D 2R2EA 2R0LH 2FGZA 2NYYD 4PJAF 1MNUH 2DLTA 2R15A 2DBLL 1S7UA 4YHLL 3GK8L 1C5DA 4U1SB 2VZSA 4GRMA 2AXHA 3G5YA 2GTWA 3O4LA 3B2UD 4YXHL 4WFGE 3PP3K 4Z7UF 3RAJH 4DKAA 3O3DA 1F2XK 1QFUL 1QO3B 5JOFB 4YAQA 3EYQD 5F7DB 5KSAA 4J12A 4FP8H 3MXVH 3P4LA 5IG7A 1Y18A 5JQ6L 1OAYL 3JV4B 4IBLT 2IQAA 4QTIH 4Q6IC 1P84J 2YC1A 4TSCH 4MA1C 1WBZA 1NL0H 3GO1H 3H7BB 4P4RA 4LF3A 5JIPA 2V5RA 4QHLB 2HTLD 5BV7H 5H35A 5GGVY 2AAVA 1BD2E 3HTLX 3LKRA 5EU3A 4F9PC 3DNKA 1KCKA 1P4LB 5HI3D 4U33A 4X6DB 3LZFH 3QQ9C 4PJCA 3JUYA 4GW4A 3V6OE 3DX9A 2CK0L 4FTVD 4RAHA 4Y4FB 4HS3A 3JXAA 1ZLVH 1YNLH 1AH1A 3KPSB 5E70A 5CEXB 1OB1A 4O58H 4YHKL 2PO6B 3ESUF 4BQCA 5K59F 3DMMD 3BZDA 3RWEB 5T33L 4K94L 1W2KT 4N0FB 4XCCH 3NA9H 4O5LL 1EIBA 3V6ZA 5DJXB 5GS3A 2DTSA 4HUKB 1KTKE 5LCVL 3ZDYE 2Q6WB 4JPVL 4OSUL 1QYGH 3HPLA 3GKZA 4JM2D 3ULUL 2GT9B 4EI6B 4NC1E 5KS9E 4YHMH 5EDXA 2QQNH 4UINL 5GGVL 5TGBB 2JE8A 4H8WH 5B38G 2IPKB 5BRZA 5IB3A 1UXWA 1OAUH 4ZNEA 1RK1B 5GSRA 3Q5OA 1A7QH 1P9MA 4Y16C 3SGDH 4EJ1C 4F9LC 3KYNB 1CLZL 2XA8L 2OL3A 5I8EA 4OCXL 3VXNB 3NMEA