1AJ7H

Immunoglobulin 48g7 germline fab antibody complexed with hapten 5-(para-nitrophenyl phosphonate)-pentanoic acid. affinity maturation of an esterolytic antibody
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
217
Chain Sequence
QVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCASYYGIYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN 48G7 FAB (LIGHT CHAIN)
publication title Structural insights into the evolution of an antibody combining site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 37
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1997-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1aj7H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1aj7H02
2HH0L 4RGND 3UYOD 2I25N 4G43B 5MI0B 4LASL 2R2EB 5LBSH 4F57L 3C60A 2A9NL 1T0PB 1WT5C 3TT1L 3RA7L 4LCCB 5GGVL 1WTLA 1KCUL 4H8WC 5IJKA 2Z91A 1AXTH 5IHZA 4KWUA 1QR1B 4LSPH 5LGKA 3U9UB 3MGTA 3NA9L 5F96H 1BQUA 5KN5B 1UCTA 2DMCA 5D7IB 5F1NA 1BQLL 3JXAA 1CU4L 3RIFK 4LU5L 4P9HL 1MJJB 4TUOB 2YD1A 3PGFL 3HMWH 4H25A 3C6LD 3DXAE 3GKWH 2HWZH 4K3JL 5CHNB 2GYSA 1RULL 5I8OH 3U1SH 1QPPA 2P5WD 3D39D 3OXSA 3CVHH 4WV1C 1D9KB 5EO1A 3LS5L 3SCMB 4J4PC 1NLDH 1U8OB 1A6WH 2WUCH 5ITBH 4O5LH 1CK0L 2DM2A 4ZXBD 4NKDA 4KJQC 4O02H 1CTOA 3O11A 3WUWB 3OX8B 4FQQB 4ODSL 5IB4A 4YBQC 3IJHB 5ALBH 1FVEA 5T1KD 2MHAA 2APWA 1HYRC 3M45A 1YJDH 5IBTH 1C16B 1XMWA 4QTHB 3EZ8A 3R1GH 4X98A 4NNYB 3DX7A 4MNQA 1WZ1L 4QRRE 3WDHA 5IOPA 5BV7C 2R2BA 3Q6GL 4R96B 2KQNA 5TDOB 1TPXC 4OZGB 5CP3A 2AJVL 1FNLA 3WO3B 1MELA 1KJVB 1GAFL 5JA9A 4WO4D 3WS3B 4WHTB 1AY1L 5EULV 3T0BA 4D9QE 2FX9L 2FATH 4RNRB 4HXBL 2G5RA 1RQ5A 4NKMA 5I1IH 4WDIB 4F58H 5BO1H 4EI5C 1BHGA 5I1GH 5GISL 3IF1A 4FXKA 1JNNL 3FFCE 2ED9A 3CVHB 3BD3A 1BFOA 2X4RB 4WI3A 3BI9X 3D18B 3QEUA 4YDLC 4APQC 5DJCB 5ENWB 1HYSD 3RU8L 3BZFB 1SVCP 4I2XE 3PL6B 4S1SH 1BF2A 2VISA 4X4XB 2QV2A 1IQWL 1A0QH 1DLHB 2FIKB 4M6NL 1ZVSB 5DJDB 1N5YH 1DCLA 1JZ2A 1L0QA 5LXGL 5J1AA 1OARH 3VD5A 4WCYL 5TQ2L 2B2XL 3D25A 1P53A 4HDIA 2YPKB 2YN5A 1IAOB 1QFWM 2Q8BL 3BPOB 3OF6D 4G6JH 1FBIL 5FUZH 3SJVD 3NCYP 5HBBA 4WHDA 3T0EE 4HWEL 4MS8D 5KSAD 4MA3A 4XVTL 3I3EA 1X4ZA 4C56A 3ELAT 3FQWA 3O2WL 4P0DA 1MCRA 3SDDB 5BVPL 2DIJA 3W11C 4XNUH 4EI6B 3DXAB 4XP1L 1BGXH 1RSFA 3DX9B 4JGUA 4G6KH 2PR4L 3GJFA 1YEEL 3K3QA 3MRLB 3QFJA 4OSUH 1MEXL 3QAZB 2DIBA 2O93L 3BSZH 1UJ3C 2DQGL 4HWBA 1XGYH 5MERB 5C2BH 5FEBA 5GRXG 5F7UA 3CK0H 3GSOB 4K55A 4R8WL 4ORGA 1JZ8A 2O61B 1LNUB 5K9KB 2RCSH 4RRPA 4U1JA 4KMQA 1UB6B 3RVTD 2YS4A 3BHBA 1AGDB 2ED8A 4LLAA 4M93B 1B0RB 1UH2A 3MXWL 4OQTA 5KAQG 2X4NB 2NY0D 4KMLB 5B39G 1Z9OA 2E8YA 4BFGA 1JZ3A 2ICEA 3U6RB 4QRRB 1BFTA 4KJPC 4M1GL 5E8OB 3VFWA 3TBVB 2IC2A 4E41D 3UPRA 1QQDB 4OI9A 5GS0L 1H3WM 1RZGB 4HKBA 1IC1A 1WFNA 3MFFB 1LK3H 2DF3A 3KJ6H 4M3JA 4PJDB 1DP0A 5FUCC 2A9ML 5DEGB 1WC7A 1I4FB 2EH8L 2ZZUT 3HNSH 4NQXB 3TVMA 2HKHL 5K9QI 2E7MA 1NCAH 3FFCB 4MAYA 4Q6IB 4UDUA 2ZCLL 5ILTL 3JV6B 1CGTA 1EGJH 4I2XB 2NY2C 4ERSH 4J6RL 1G7MB 4NQEE 5GSRA 4GW4B 3TN0D 1V7NL 5ESQA 2CIIB 2Y5EA 4PB9L 3RY6A 3OV6A 2AQ3A 2A1WH 2A74A 3LB6C 3WSQL 5HDQH 4I3GA 5BZDB 2HN7A 1J5OH 4BSJA 1MHEA 1GIGH 2O5YH 3MV8A 5DRXA 3C8KB 5TDNB 3LPGA 1YNKH 2X4PA 2YZ1A 2B4CH 1NCNA 3T0EB 5JO5B 4XCNA 5TQ0H 3Q2CA 5BXFB 1FNSL 3DTXA 4E9LA 1OLLA 3L5JA 2VERN 5HHQB 2PKDA 2W0PA 3MRIA 1OAXL 4KKBC 2P44B 1CFSA 2UY7A 1YECH 4L29B 5CWSA 1W72H 4NT6A 2L4OA 4P9MH 2Z93A 4PRHA 3L7EA 3EYFA 2D7TH 3E3QE 1ZOXA 4L4TE 1LMKA 3KPNB 4JGJA 1ONQA 1ZHBB 3FOLA 4JFZL 4OV5A 1P7QB 2BNQA 5DTFB 3ULSB 4PG2A 4U6YA 1BVKB 2F15A 5E8NB 4QXUL 2WNGA 5DJ0A 3VFVB 4RBPH 5F7DA 2ZP0T 1FL3A 3D2UB 3DBXB 3QXAB 4FOMA 4JY5H 1AQKL 3HNTL 4LFHD 2AXJA 3LZFH 1HSBA 3F8UB 3ULVD 1RVFL 5GRZA 1HOCB 3ES6A 4JFDE 4HBCL 4JPWL 3ZDZE 5FHAL 2E8ZA 1IM9A 2YPLA 3ZYJA 1A1MA 1LK2A 1U8JA 5ICXB 2WIIA 4JG1H 4JFHD 1N2RB 4Y4HA 4ZDHB 5C3TA 4ISVA 1MCWM 4RZCB 3V6FB 1X6LA 2WBWB 1I3RA 3VDBA 5A40E 2V6HA 4KJYA 5JQ6L 3KPPB 1JGUH 5JZ7D 4D94A 1LP9F 4JG0L 3G04B 3VRJB 1I8MA 4OZFG 4WW1A 1BBDL 5AAWA 2WLZA 2XICA 1JF6A 1ETZB 1W72B 1N0XL 4XXDA 3GIVA 3QUXA 2VDLH 3WBDA 4WFHE 1L6XA 1WFTA 3SE3A 1JYWA 1FNGB 1MFBL 2VXSH 5I76B 5L9DL 3IDYC 3P4NA 1WCBB 1E6OL 2Y5TA 5TE7H 3MX0A 1M05A 4NQEB 3TJHC 3HNVL 1HHKA 1UWGH 1D5ZA 1GPOH 2FHBA 1MAKA 4CVXA 4JFED 2G75A 3TIEB 3U36A 1CLOH 2C4FU 4QOKA 1DANT 5I1EL 3H9SE 4XVUC 2R29L 4HIJB 1S9VB 4KVCL 1QR4A 4KJWC 3ZMRA 1EMTL 3BWAB 1F58H 4ZSOE 2J3SA 1N8ZB 3TYFB 1MH5A 2H32B 3DMMC 2B1AH 2CLZB 3FB5B 3QIUA 4G8FA 5A1AA 2BSSB 1RZ7H 4KUZL 4R3SA 1IBGL 2YSSA 4UOJA 1YN7A 5ACLA 1ZWIB 1X6NA 5IQ7L 1QACA 4O2FA 5D72H 1NC2B 4Z0XB 4I4WA 2KZ1B 4UDTA 3GM8A 5FDYA 3U7AA 3B43A 3QUYA 3UTPE 1J05A 5C0NC 2QKIB 1A3RH 4NQVB 1G6RA 4L8BB 3ARWA 1XCQB 4JM4H 1JE6A 4WGWB 3QXDB 5DGRA 1TJIL 3PWVA 1TVDA 5DJ8B 5IMMA 5KANI 1IC7H 2D0GA 5IB3B 2FWOB 4F2MB 2BY0A 4JFDB 4MWFA 1OAKH 3S8WA 3V4PH 2NX5E 2G2RB 4HIHB 1C08A 4LLVA 2XWBB 4UV7L 3WIHH 4JFOB 2J6EA 1OTTD 4XP9H 4AL8H 4LPCA 3O6FC 2Z92A 4BH7B 1HH9A 1NC4A 4CRPA 3HUJA 3CPLA 5DVMA 2IAMA 3OKLA 4NO0A 1MCLA 1B4RA 4X6DE 4HUXA 1G7JA 4PJCB 4JFYA 4AEEA 5E2TH 5B39A 5DI8A 4PJFF 3EJYC 3MROB 5C0RH 2NW2B 5E70A 4ZFOA 3NIGE 4NBXB 3PQYD 4RGNC 3MRNB 2AEPL 2XZZA 4QRSA 4KY1H 2YUXA 4ODWB 4JY6B 3K8KA 4S1RH 2BY1A 4U1LB 3VWJC 3H9SB 4TNWK 1VENA 3SQBA 3VRIB 5DR5H 2VDKH 5I1HH 4DUVA 1AD0A 3FZUD 3OAUH 1ES0A 4OLYL 2CUIA 4OZ4A 3P3YA 3FONA 1ZVHA 2NXYB 4ZSOB 1O5DT 3LV3B 1DE4A 5DRWB 4AMKH 3OTTA 2DTMH 2FYYB 1NJ9B 3MLYH 1LEKB 1R3LB 3GSXA 4HPYL 5IB2B 1CT8B 1T2QH 3ARQA 1QSZA 3C6LC 1WBXA 3DVIA 2P8PB 1E4XL 2FR4A 3IU4H 1A2YB 3SO3C 4R0LB 1OM3H 5BQ7A 3MNVB 3HG1E 5E00B 3CLEL 4ZXBC 4OF5A 4FXGA 1Y0LA 1UB5A 3FHQA 1I7TB 1K3IA 3E8UH 1GC1H 1HQRB 3QDMD 5DEFA 1UKSA 4M1DL 3ZO0A 2NNAB 3X14B 1OB1B 4YXLH 3MJ9H 1UXWA 1GHFL 3T04D 2NX5B 3CU1A 2FJGB 2ADGA 2IADB 5C09D 5B4MD 3LSOB 3BRDA 1EXUB 1S9XB 4KI5E 1X4XA 1XCTA 1T1XA 2DWDA 4JPKL 4AZ8A 3ULUF 1ULVA 4BZ2H 4MCZA 5FYKE 5EOCH 2JJTA 2QEJA 4X6DB 1CDYA 3UXFA 2LE9A 3X3FL 2FJHA 3MLPA 1H3TA 3AM8A 2VOTA 3QIBA 4ZO6A 5F7LB 3TBSA 3CC5B 3KPSA 4PJAF 1RJLB 1RJYB 4LHUD 3UC0H 3WKML 2V7HB 5B8CA 2JTDA 4ZOAA 2QHRL 3S88L 4XCFH 4RIRA 1DQDH 3WFHB 3MNWA 5SWQB 5KSBF 2VL5B 3HFML 1CXKA 3LS4H 5I66A 5AD0A 3WFEL 1F4AA 4HMEA 3GSUA 5CUSH 1NEZG 2XTJC 3PWJA 4MVBD 4KK5D 4JQIH 4NGHH 4CDHA 1GOFA 1VACB 1AQDA 2AV7B 4GSDL 3SPVA 2Y07L 1OD7A 3GBNH 4FQCL 4N0FB 5FGBA 1LO5A 4OZFA 3QZWB 1CFVH 5D1QC 1MAML 4EOWL 1NGQH 2D2OA 2DQCL 4XP4L 5CJQH 4H20H 5I1DA 4WFGD 3OKEB 5T3ZE 4HUWA 4X9IA 5HI5C 1PGRB 2VDNL 4L8CB 5F9WC 4HF5L 2AJZB 5KSAC 5FYKH 1BX2B 4YIQB 4B50A 4D0BB 4J3TA 4FTVB 5IIEA 4AH2A 2HMID 1BF8A 2RFXB 1LO0H 3HC3L 5FKPA 2YXFA 3K0WA 3N9GL 5DFVD 5JNYB 3UJJH 3BE1H 3CH1B 2CIKA 4PUBH 3HG1B 3R0MA 3JTTA 4XWGH 1A3QA 3KNBA 1FGNH 1YEGH 4HXAL 3SDAA 4NWTL 3X3GL 5BVJA 3O9WD 3T0XA 3GSVB 3MRBA 5EUOE 2X1OA 1CVSC 1QSFD 1BVLB 3X11B 2VABA 3GIZL 4I0PB 3MOQA 4M7JL 3E1F1 5A2LH 1MF2H 4I18A 3NTCH 4N0RA 2NY0C 5T3ZH 3U4AA 3VFUB 5IB1A 4HEME 4HLZG 2R4RL 3LEXB 1B2WL 2VZ3A 2V2WA 1T66D 5F21B 1CD1A 4KKCD 1JHKH 1GGCH 2P5EE 1R3IH 3RWJB 1C5CL 3MOAL 4HWNA 5GRVL 4R4FH 3VXRA 1UC6A 2DKSA 2R8SH 4JR9L 1SEBA 4PJAA 1AE6L 3NFSL 1CZ8H 4JZOB 3GMNA 4D9LL 4M7ZB 4AEIL 2ICWA 5I74B 4E0RB 4LKCA 1F3JA 1FRGL 4Z7NE 1KG0B 2NW3A 3GFUA 2OR8A 3TN0C 2PYEA 3AY4A 5GIRB 4MD4B 2XN9D 3KPRD 3HE6D 2QADD 3FO9A 5C0AB 3VI3F 3SKOB 4OFYA 3D48R 2BVOB 4XAKD 5F8RC 1BAFL 3L3HB 1X5FA 1ACYL 1BFVH 4DEPB 4YBLC 5C70A 3BRGC 4Y2DD 5EO9B 1CGSH 5IWLC 4MJ5A 2WSKA 4L3CB 5K9JH 1PYWA 1NL0L 1FGVH 4HIXL 3W5NA 3EDKA 3G6DH 1ED3B 4PRIA 5SWZE 1KIQA 2GJ6A 3C5JA 4JM2D 4DOHE 4P3DA 1EO5A 4D8PB 5C8JA 3FRPG 4ZNEA 5MEOA 4KQ4H 5E94B 4K07A 5KW9H 3UTTD 1UZ8A 4Y5XA 1AKJA 1RUAH 1T04B 3MRMB 5E5MA 5EUOB 3BP7B 5ANME 4U1GC 3UTSE 3ZKXC 4JRXA 4K94L 5TE4L 3IKCA 1RK1A 4NRXA 2ADIB 3QWRD 2VLLA 4H0GA 5D96C 1OAZL 2ERJC 4YNYB 4G6FD 2DQFB 5DJ6B 3E6FB 2ZSWB 2F19L 2I5YL 2O5ZL 3GB7A 2FD6L 1N3NA 4ZUUB 5I2IA 2LU3A 3BW9B 2AXFA 1RAMA 3GEWB 3QULB 1A1NA 4F15B 1ZHKA 3BPNB 4U3XA 2P43B 4H8WH 5DMKA 5JXEC 5GGTL 4BH8B 4HULB 3WJLC 4HH9B 4QXGL 3MRFB 4ZUVA 5JZ7C 5MP6L 2WBJB 2QBWA 2VLME 3TV3H 2G5BB 2FECI 3I75B 3CFDB 5CZKA 5C08A 1NAML 1KCSH 4OT1H 1WAAE 4P2CG 3BXNB 3QNYA 3OXRB 4CNIA 1FZKA 1NBVH 3VW3H 1HH6B 1NGYA 1T03L 3KPQB 1KIRB 1VPOL 4K2UL 5F3HA 3CX5K 1S7XA 1SY6L 3HE7B 4P3CH 4U1KA 2F8XC 1TJGL 2VO5A 4NQDE 4HS3A 5HJ3B 3BPLC 5F9DC 4JO2L 1C7SA 1FORH 25C8L 3WS6A 1CF8H 3SGJC 1JN6B 2VDRL 3S5LB 3A6CH 3KYKL 5IW1A 3TNMB 2ZUWA 1MRDL 4Z78A 4OQ1A 4CN6A 4F37F 4HPOL 5KJRL 1NEZA 2DLHA 4CKVX 5BV7H 2FX8H 3KYNA 4DKEH 5E08L 3BKCH 4TUJB 4IJ3B 4MNQD 5SWZB 4GKNA 1DEEA 2R0WL 2P8LB 3VRLE 4KROD 4DOHB 2AQ2A 4AJ0A 4QWWC 1D5BA 3NABL 5GS0C 3GMLB 1U8NB 3TT3H 5DD3H 5FOBB 4LSTH 3NBNA 3AU1B 4M6OH 1AC0A 3SY0A 5ANMB 4N8VG 3SE9L 3UTSB 4W6WB 1DUZB 1OP5K 5E2UL 2VITA 2WWKO 2R1YA 4DWHA 1M71B 1S7UB 4OCYH 5CBEB 1Z5LB 4UINH 2C4FT 4NQUA 4LPXA 2IPUG 2F58H 2ZOKA 1OTTC 4J3SA 1SYSA 4QHMB 4B5EA 1H0DB 3PUCA 5JHLH 1A6TA 1PG7H 4AM0B 1B4JH 1OTUD 1QD0A 1H8SA 5C0BA 1KJ2B 4N0UA 3OKMB 4EDWL 5C1MB 2DQDH 4LSUH 5CAYB 3M8OH 1TPXB 5DQDH 1I8IA 3W39A 1MVUB 1I1AA 2EDKA 5I8EB 2J8OA 2MCG1 4MJ6A 3VXOA 1DQLL 2KDGA 4PGEB 1ZGLM 4C56D 3L5WB 1TQBC 1QFWH 5JW4Q 3CSPA 5FUCE 1XFPA 1H3GA 4N9GB 4NQDB 1VFAB 3BH8A 4EI5B 1H9VA 5HD8C 2MJWA 5CMAB 4WEUD 4MYWB 3QFJD 3ARRA 4J1UA 4XVJL 2EH7L 2Q1EA 4RA3A 5GRUL 4APQB 4YDLB 2YD9A 3FZUC 3SOBH 3I6LD 3MLTB 3T4AB 2LFGA 1Q9LB 1A9EA 3C09B 4YDIL 5LGJA 1HWHB 1N5AB 5DD1H 5BMFH 5E1AB 4HUKB 1FZOB 1XF5B 1AP2A 1GGIL 1Q72L 5GGQL 2LU7A 1KULA 3SDYL 2R69L 2ZG1A 4M1CD 3ZKNC 3VFGH 2HRLA 3QDGE 1GCFA 1DJSA 3NAAL 4JKWA 5E7FA 1Z6JT 2DYPA 4MNGE 4PV9B 2D4FA 3VJ6A 1NCCH 3T4YB 4ZPTB 4F9LA 3F5WA 2P7TA 4LCIH 1HILA 2WQRA 1UJ3B 2BERA 1MRCL 3TVMD 3JV5A 3UJTH 3L3OB 5EU3B 1HHJA 4MAYD 4YPGA 5SX4I 3WJJA 2AJYL 2OL3A 4FP8L 3UO1L 3E0GA 2I9TB 3FRPA 5CEZE 1LO4L 3T3ME 4KMTH 2EDRA 5B4MC 2YZ8A 4LGSB 3BO8A 4PJDF 4PRNB 1I9JL 5IFHH 4Z6AT 4UNVA 4JO4H 1ADQA 2JIXA 3QRGH 4LARH 5FA3B 1RZKL 2HLFC 3BQUC 4GRMA 4HHAA 4M5YH 3MYJA 3CFJB 4YFEA 2QSVA 1U8IB 1DFBH 2VXUH 4Y4FA 3MV8D 1WJ3A 2ENYA 3UJIL 3U0PA 3G6JE 4F7TA 1JGVL 4OCSL 2AK4A 1SJHA 3MUZ1 1N26A 4UNTA 4P4KA 3NZHH 1BREA 4DN3H 3BZDA 5E9DA 3SDCA 3T3PF 2ZJSH 3VGBA 4D9RE 2EE3A 5DC9B 2X4TA 2LVCA 3W9DA 2DQJL 2JJSC 5HHPB 4KK5C 1U8KB 4PRHD 3RI5F 4FQIL 3ZTNL 2AKRA 1E4KA 2J8UE 2XI9A 2XQBH 1RURL 4PGDB 5CEZH 4F3FB 4N5EC 3WLBB 2BNQD 4NQCA 1N59B 3G6AA 2NY2B 1U3HC 4E42B 4XBGA 3OKOA 1MFCH 1Q9KB 4OUOA 5D8JH 1YEIL 3PWLB 2BNRE 5I73C 4YGVA 4PGCB 2DQIH 2NXZB 5BRZA 2CXKA 3L6FB 3JTSB 1IEHA 4GXVL 2IH3B 3BDBA 3CMOH 3WEXA 4UQ3A 5DFVC 4ZFGL 4MA8L 3QDGB 3U7WL 4DK6A 4HIEB 1JZ7A 1IM9D 2YPLD 4F33A 4GAGH 4XPTH 3CSYA 3FB6B 3SEPA 4Y4HD 4MNGB 4IDLA 3ILPB 3O3BB 3PHQA 2F5AL 4ZS6C 4N1EA 3O9WC 2AABH 5F9AC 5I1CH 4QO1A 3K4DA 1FFQA 4CVZB 4O51A 1I8LC 4JZNA 5C0CE 3QUXD 2DM3A 5L88L 3FCTB 3WKNA 4OLWH 3IDNA 1PQZB 5TJWK 4Z7UB 2J4WL 4YXHL 1S7WA 2WUBH 1EK3A 4HUUB 3EYVA 4KKCC 2VKXA 1LEGB 5HYQB 3FT4A 1S7RB 4WW2A 1HNGA 4N8VA 1Q0YH 1I9RL 4HIIB 4HJGB 1BQHG 1GSMA 2Q3AA 1CGXA 1KIPA 4KFZC 2Q87A 4HLJA 5JW4M 1PG7W 1J1OH 3UMTA 1CGVA 3G6JB 3MRJB 4GBXA 3FQTA 1IC4H 2HVKB 1E28A 3VGEA 5EBWB 3FQNA 5AG8A 4LAQH 3TBWB 4E5XB 3QIUD 5IK3A 4FFWD 3ZLQC 3U4EA 4RGOH 2FO4A 2J8UB 3HE6C 2QADC 1R3KB 3GSRB 3RL1B 5L8KB 5C9KA 4G7YL 3V5HA 3QUYD 4RGNE 4YGAB 5ACMA 5C7XL 1GH7A 5CEXB 2UWEA 4MD5B 2BNRB 4U3CA 4NSKB 1IGIH 2ADJA 4PS4H 4Y2DC 1CR9H 5I18H 2VIRB 2R4SL 3MRCA 4O4YH 1DUYA 2YC1B 3WD5H 4HG4J 2YD3A 2CKBA 4XRCB 2IALB 3UTZA 2DD8H 1XIWB 2W9DL 3HPLA 5IESL 4LDOB 3BH9A 5EIIB 3BZ4B 3ZZ1A 1NGXA 4JFPB 5FK9A 4JM2C 3W5MA 1YYLH 3TGXA 5JHDA 4YH6A 1CXEA 2NY6C 4PP1C 4M48L 1BBJB 2HJKA 3WMSA 1FL6B 1BOYA 1SEQL 3IFOB 1DDHB 1Y6KR 5C92A 1NC4D 1A5FH 5FDWA 1LE5A 4QYOA 3EFFB 2P5WE 2IAMD 3D39E 2ZOLA 4NO0D 5F89A 4KRNA 2BC4A 3DROB 4U05A 2PW1A 3ZDZF 4ZAKB 5ICZA 2WMPA 5JORA 3QG6A 5C0CB 4YHZL 2MQCA 2X4SA 2FDBP 1MLBB 5JMRA 5FF6A 2ADFH 4FZEH 1FFOA 1P4BL 1OSPL 5A43C 1ZS8A 1RD6A 2IBGA 2BVEA 3MUGA 4PJ7F 2GITB 1FCCA 2XPGA 3KS0H 3IU3B 1XF3B 3MODL 3ULUL 4PJCF 5CZVH 1OAYL 2AEWA 1R5VB 5H35A 3GMRA 1OHQA 4LRIC 2AK1L 4H1LG 4DAGL 3MFGB 1WQVT 3AC0A 3QA3A 3TBYB 2H3NB 2PO6A 1TCRA 1I7RB 1GGYA 3DVFA 3QNXB 2N4IA 2FEDC 3C5SA 1LDPH 3O6FB 3SGEH 4OGXH 4PBWD 4PP2A 4D0DA 1YNLL 4FG6D 4GH7B 2ZUXA 2BRRH 4OFKA 3G08B 1QO3A 4BUGA 3UTQA 5DQ9A 4OF6A 5LCVH 3NFPA 3MXVH 1UEYA 1X5KA 3EIFA 1K5NA 1VKXB 1DZBA 1EHXA 2IGFH 1RIHL 1TLKA 5EZJB 5DK3A 2ID5A 3MA7A 4F7CA 4TSAL 4RGNB 2J5LC 1X5HA 4KV5E 3KPMA 1PKQE 1MCQA 2XTJE 5EZOL 5L2KA 2KKQA 2YEZA 4K7PH 4HZLB 4UUJA 4HT1H 3HR5A 4LOUC 3BDYL 4HC1A 2APTA 4U6HB 3SJVE 3JWOC 1NANI 1IQDA 4AENB 1Z2KA 2VDPH 4WTXA 3DX6A 1YQ2A 4M8QB 5GZNC 5F7YC 4PJIF 5J13C 3C6LB 4XNYH 2OBGA 1XH3A 2P5WB 3D39B 2EDTA 5CSGA 4ONGL 1XF4B 5D6CA 4JO3L 5I30H 3Q6FB 4XVSH 3SO3B 3GI8L 3A0OA 4IM8A 3QIBD 2R2CA 5EG6C 2JELL 3KPSD 4U1HB 3LD8C 1RUQH 5CGMA 4ZXBB 1P5UA 5IF0A 5HY9B 4DCQB 1MCWW 2SEBB 5T1KB 2FHFA 1FAIL 4GW1B 2D4DA 2VDOH 4PJHE 4BELD 7FABH 5FO7A 3OPZL 3MREB 4H88H 1EHAA 3B3IA 1JK8A 1OAQL 5JPNA 5J9PA 1K4DA 1U6AH 3MCLL 2L7JA 3MUY1 3H3KA 1A6AB 5CLWA 3FQUA 4YX2H 1FFPA 1H8NA 3MA9L 2PYFA 1FNEA 1A6ZA 1MRFL 2GHWB 3HB3D 4Q9CA 4CADB 1A9BA 1G9NL 3F7VB 1U8PA 3Q3GB 3GMQA 1BQHA 4Z5RB 3OL2A 3FT2A 4G8EB 1W0VB 1UM6H 1Q9WA 1YMHA 5ID0A 1JNLL 4JLRA 4UOW0 4X0KA 3OSKA 5J6GB 1UJTA 1VGKB 1G7HB 3KG5A 1S7QA 4XC3L 4RX4A 5C07A 3LKNB 3VA6A 4JFQB 4X6BA 2F54A 1KCVL 1PKQB 4OGYH 3SDAD 4NOFA 1YZZA 4YFLI 3DGCR 3CXHJ 3I50L 5L0QB 1FLRH 2WQ8A 5JLZA 3JVGA 2D03H 1MAJA 3MPCA 5EPMA 3HI1B 4ACPA 4QCIB 4UTAH 3O6KL 2HH0H 5EC1B 3F65A 1VFUA 3SJVB 4M1CC 4LASH 5JW5B 1DQJA 5F9WB 4S0TD 4GS7C 5KSAB 1K4CB 1QBBA 2VL4A 1KNOA 5GGVH 4NHUA 4IOFD 4C4KT 3VFSA 3VXRD 4JRYA 3BKML 3QP3A 1KPRB 5IV2A 1BQLH 4HQQH 1CU4H 1F90L 3FN3A 3O6LL 1T21B 3PGFH 5JOPD 4GKSB 4K3JH 1RULH 4L8DB 3RKDC 3WIFB 4JCLA 3UYRL 3LS5H 1FIGL 1T83C 1QRND 5KS9F 3SGKA 1GZPA 4PJHB 1CK0H 2ARWA 2W65A 2VSCA 1NBZB 2NY0B 4ODSH 5IMOA 1AGCB 5F9JA 1F13A 4NWUL 4OFYD 1QFWI 4TVPL 3Q0HA 5TGBA 1A14L 3RJDA 4E41B 5DYOA 5HGDB 1HXMA 5DJYA 5GRVK 4JFHE 1X7QA 4RMWA 3W82A 4I5BB 5D6DC 5D2LE 1I3GH 3OZ9H 4HSQA 1PX4A 2X09A 3BPCB 4D0CB 2JJWA 5KG9A 3GDBA 4QRTB 2UYLA 3D69B 3VD3A 3Q6GH 1EBPA 1DBBL 3P9MB 3TIDB 3TNNA 4GMTL 3MLUL 3RVUD 4OGAC 3C9NA 4A6YB 4OLUL 1A47A 5DWUH 5AZEH 4H1LA 4PRID 3EYUH 4DZBA 2GJ6D 3OR7B 1JWSA 2Z8SA 3BUTA 3EOAB 3V9FA 1IEAB 1EEZA 1TTFA 3O3AB 1MJ8L 4MJ2A 3BJLA 3TN0B 1X9QA 1G7QB 1AKJD 1JNNH 1IGJB 4QRUA 3PP3K 4QF1B 4N8CH 4JRXD 1K85A 4L9LA 3VFTA 4DW2L 3BP4A 2QSQA 1JGEA 4FFVD 4NNPL 3ZKMD 4X7TB 3U9PL 1T0MA 3TEUA 4YBLB 2D0FA 2VZSA 5E03A 2AV1B 3LPWA 5DVNA 3TPUB 4WCYH 2B2XH 3FRUA 4Y4HC 3KPOA 2X42A 3VFMB 3L3DA 3P9WB 1OCWH 2XXCB 3OKNA 5FIEA 1C5DA 1OTSC 2A6IA 3F7YA 2P24A 5F7EH 4QTIH 3EOBB 1T2JA 2EDOA 3O2WH 4P59H 5BVPH 3O3UN 1MVFA 4MJIA 5C08D 2PXYA 3S37L 4LLDB 4JQVA 2PR4H 4LGPB 3OWEA 5KS9A 1X5GA 4U1GB 3ZKXB 1OQXA 2FRGP 1QLFA 3HMWL 5DHYB 1RZIB 3GKWL 2HWZL 3SGDH 3CDYA 4X99B 4NZTH 3U1SL 2Q3ZA 1JWMA 1TTGA 1J1XH 3W0WA 4FQ2L 3WL9B 5D96B 5JW4N 2ERJB 4JY4B 4M9PA 2XIDA 1NLDL 5T1MA 1V3MA 4NBYB 2WUCL 5ITBL 4O5LL 1YMME 2V17L 2H8PA 4O02L 3L3KA 3MXWH 1QLRB 5D2LB 4Z76A 1TZIB 4RWYL 1KXQE 4PJ9C 5ADPL 4NYLB 5LWYH 3OHXA 3SBWA 3QI9A 3SDXE 4M1GH 1OQOA 2BCKA 5IBTL 3UZQA 1A7PH 5C6TH 1NMCC 5E8EB 3V6ZB 2HG5A 5GS0H 1ITBB 3P11L 5CD5D 1VFBA 4Y7MA 5T1LB 4GUPB 3GSQB 2A9MH 5C0DA 4G9DA 2EH8H 4NP4L 3QUYC 2F5BH 2HKHH 1OP3H 5B38B 3QEQD 1JWUB 2Q7YB 2ARJA 2ZCLH 3BPLB 3QDJA 4XZUA 3DECA 4NZDA 4NO3A 3EO1B 1FQ9C 4PJGF 5I1IL 3MMEA 1ZHNA 4J6RH 1FVDA 1V7NH 5I1GL 4PB9H 5JR1L 3QJFB 4ODHL 2J88L 4QY8A 4WI2A 1JPGA 5LJYH 2X4UB 4K7PY 3VFPB 4OAWB 1L4IA 3AB0B 5DF0A 1N5YL 4WUKL 5IW6A 3D5OF 3NN8A 3RWDB 5C0BD 4OZIA 3PJSB 2NYYD 3U82B 1L9MA 4Y8AA 3OR6A 4ELMB 5FUZL 4L3EE 4P5TA 1I1AD 2E7HA 2XQYG 2AGJL 3ZE1F 3O0RH 3GHEH 4YHOL 4XNUL 3QDME 1VEOA 2RB8A 2MFNA 2P42B 1ND0B 4MNHA 4LEOB 4TQEH 1F2XK 4YFLF 5TF1H 3RUGF 2I07B 4FN0A 4XMPH 3MRKB 3C5ZA 1AQKH 2H1PL 5DDHB 1DVFC 3B83A 1YMMB 4UI2A 5C09E 1KB5B 1P6AB 2JK5A 1XGUB 5FGSA 5C2BL 1RVFH 4X9HA 3CK0L 2EXYC 1M1SA 1U91B 2VQUA 4JDZB 4Z8FH 5JQHC 4FG6C 2N1KA 2RCSL 3DVNA 2DLFH 4OFPA 1YC7A 1EEQA 4Z7WE 2ITDA 4RFEA 3TBTA 3MRQA 2KBGA 3QHZL 3D9AH 3E6HB 4YHPA 2PW2A 4HMCA 4JG0H 4MDIB 1TQBB 1HHGA 3VCLB 2DYPD 2Z9TA 3B6SA 1U42A 2QTEA 1N0XH 4NUJA 3GRWL 4P46A 5GPRA 2ZG2A 5C0IB 3AGVA 1S7VA 4FRWA 3KJ6L 4PJGA 4FXLA 5F7KC 1Y6NR 1MFBH 1CDGA 5L9DH 4MHHG 4EZMA 4BYHA 3V0WH 3HNSL 4LLMB 1NCAL 1ZGLB 2DLEA 4WFGE 4AEFA 3E2HC 1MI5A 2V5TA 3OMZA 3WHE1 2RHEA 1V3JA 2EIZA 1T1YB 2V2XB 3BP6B 4X4ME 4ONHA 4EJ1C 3ROLA 5IB5A 1G84A 1T5XB 3LKSA 5I1EH 2R29H 3VG9B 2IBZY 3MUHL 4Y89A 4ERSL 3FO0H 2FECL 4PD4K 5GZOD 2ZKHH 2JIXD 5IKCB 4KVCH 1UXSA 1EMTH 4R7NA 2FJFB 1BP3B 2A1WL 1WZMA 2DLGA 3CZJA 1U41A 4OF8A 1KENL 1XF2B 1LHZA 2JJTC 4Y4FD 1EDQA 2O5YL 2WAHA 3AM8C 3QIBC 5SX5K 1M7IB 4L3EB 4KUZH 4M02A 5GGVY 3PWUB 4NQSA 5CGYC 1WIUA 1IBGH 2AK4D 2W38A 3MV01 4QHLB 5TQ0L 4P4KD 3ME0A 1R3JA 5E9DD 5FA4B 1AR2A 3H42H 3S7GA 3SDCD 1J0KA 2FX7L 3PABA 4BFIB 3BYTA 3QDMB 1QSFE 4LRNL 2GSGB 5F7HA 5LAXB 4MQTB 1RZ8A 1W72L 2VLJA 4GRLC 4LKXB 2N7AA 3RUGA 2MPAH 2VLRE 3SGEI 5FYJL 1KFAH 2LQRA 2D7TL 5EOCJ 1U3ZA 3REWA 4ENED 3LKQB 2IFFL 4NQCD 2DJ4A 5C09B 1TCMA 2Q6WA 4HUVA 5FYJU 2FHCA 2FL5A 1M6OA 4Z7VE 1P1ZA 5MEPB 2A6JA 1T1ZA 3P4OA 4M61A 2BVQA 3HB3C 4JY5L 1CLZL 3QUMA 3VXNA 4QHNA 5BRZD 2DJSA 4Z7WB 2Y1VA 5DHVH 3LOWA 3MV7A 3OJDB 1MREL 4LHUB 2JB6B 4HKZA 3GMMA 1P4LB 3WE6B 4ZO7A 4RISL 5C0FA 1T1WB 3G9AB 3DIFA 3QWOA 3TH4T 1NCDL 4JANB 1WICA 5HYSG 2APXA 2I9LB 3DWTA 1JGUL 2XN9E 3KPRE 4XC1L 1YEKL 1ZT7B 4I18C 2Z4QB 1U3HB 3IDJA 3P9LB 2X05A 4JGMA 2BSRB 2VXSL 3GGWB 4RFNC 5I73B 4ZD3L 5ICYA 2A38A 4Y5VB 4IOFC 1MUJA 3MRRA 1H15A 3PV7A 4JREC 4FQPA 4JAMA 2OXHA 2AXGB 2GUOA 3M17A 3TLRA 3DV4B 4HPYH 4PG9A 1CE6A 2AJSL 4GBXD 4Z7UF 4OCLC 2CO7B 5DSCA 1OD9A 3VD7A 3ARBC 2VR4A 3CJJA 5TF0A 3ZKQD 3UTTE 5HHXH 3O9WB 2X10A 4K7FB 2P49B 4YAQB 4HV8A 2B1AL 3RZWA 1QSFB 1RZ7L 2EDWA 1RIVL 2FGWL 4WJ5A 3BEVA 4PLOB 4YFDB 3UBXI 3CLEH 2VE6A 1QSEE 1WBYA 3QIWA 4HMDA 1QNZL 4R4BB 4CU7A 4OCWL 1S9YA 4O2CB 3MR9A 5DUPH 4NFCA 5D72L 4PGBA 5CGTA 1TVHB 2AJ3B 4Z77B 1S5HB 1HCVA 4Z7VB 2F8VA 4M1DH 5ELIA 1QP1A 4GG8A 5J1SC 3HI6H 5DD6A 1HHIA 1NH6A 4NZRL 4XCYB 1FO0B 3EHBC 4YR6B 2DKUA 3EOTL 1NGWB 2H26A 1N0LA 1Z3GL 5DQJB 3RVUC 4QNPE 4OUUB 5EU6A 5I17A 1G7PB 2ZCKL 4JPKH 5FUOH 3S9DB 1G0YR 1HI6B 4M62H 5JHDD 2NTFA 1TNMA 3WIHL 5JPMA 5DJAA 1L7TH 3X3FH 1WF5A 4XP9L 4JZJA 4U3HA 5INDB 4AL8L 2BNUB 4TN9A 1BIIB 4AY0A 3WKMH 3MGOB 3WXWH 2QHRH 1BJ1H 2XN9B 3HE6B 3KPRB 2QADB 4TVSa 3HFMH 5IVZA 4ODUB 3HC0B 2GFBB 5ETUA 5E2TL 3ZKMC 5CEYB 4NKOA 5CSZB 5F88A 4XXCA 5C0RL 4ZQKA 4FQCH 3RY4A 4OBSA 3KAAA 4Y2DB 3VFNA 3VWKA 1YPZE 4GAYA 1MAMH 3L7FA 1MJUL 2DQCH 3LDBC 4XP4H 3S3JA 4KY1L 5HGBA 5ESVB 4PY8I 4X8JB 5J6HB 2BP3A 2C3VB 2Y7QB 3TO2A 4MDJA 3HRZB 3CCHA 2AS5M 1ZA6B 3EO0A 3G5YA 3RGVA 1UKQA 4JM2B 5DR5L 3C8DA 5MEQA 1CG9A 2VDKL 4LHJB 5I1HL 2PO6D 3OAUL 2X70B 3LIZH 5A3ID 5J4MA 1OLZA 2GTWA 3UTTB 3QO1A 2Y23A 4AMKL 2B0SH 3BIKA 3N9GH 1OT1A 3MLYL 1G9NC 4PREA 2CDEA 1T2QL 3QB7C 4RA0C 3O2DA 3MNZB 2GY7B 1QSEB 3S37X 2BMKB 5EU4B 1TJHL 3VMNA 5EO0A 2X6MA 4HXAH 4NWTH 3X3GH 2VQ1B 2D7MA 3IU4L 3S4SG 5D7SH 5EIVA 3DUUB 4IBLT 2UY6A 2ILLA 4G6MH 4XI5D 4WEBH 1OM3L 4PRDB 3LKPB 3T08A 3GIZH 4M7JH 3AREA 4O9HL 1F4HA 4NRZA 4Q6YA 4P99A 3GNML 5L2KD 3E8UL 3JWOH 2R4RH 1JPFB 3IFNL 4WIQA 4I77L 3UAJC 2V2TA 4OCXH 1UVQA 3ZT5A 4QEGA 3NACH 2Z91B 2R2EA 5IHZB 4YXLL 1C5CH 3MGTB 5CD5C 4U1MA 3BP5A 5JIHA 1OOAA 5F1NB 1G7LA 5TPWH 2NTSP 1AE6H 4R2GD 1QR1A 3NFSH 4H25B 4Z7QF 4H0IA 1I85C 2EXWD 5KN5A 2Z8RA 4G8IB 5D7IA 1LE9A 4D9LH 3OXSB 1U58A 5EO1B 4TYUA 4KRLB 3K74B 2HKFH 1FRGH 3VXMA 1QFUH 3V7AG 3G5VB 4W4OA 3B9KA 3ESUF 1IKNC 2J5LB 4NKDB 2YUVA 3S3SA 5HDBE 5IB4B 4XCFL 3SCMA 2EDQA 1YPZB 4HCRA 2MHAB 2YHGA 4N90D 4NC1C 3STZA 1D5IH 1N6VA 2DL9A 3GBLA 2ATPA 3DHMA 1ZMYA 3WUWA 1FYHB 4FQQA 4JQIL 3IJHA 4X98B 3GBNL 5E2WL 3DX7B 1ACYH 2VZVA 2W0FA 1CFVL 3H6JA 4HUNB 4KROB 5IOPB 2R2BB 2XV6B 2RAMA 2Y06L 4LLUA 4HIXH 4S1QH 3SGDI 4LVOC 5J13B 4NNYA 3ISWA 5DURD 5FYKL 4XP6H 4R96A 4G9FA 5TDOA 4KQ3H 4OZGA 1AXIB 4L4JA 1KJVA 4NKMB 4NCC2 1YQVL 3IF1B 1ZLWH 4DFIA 2D31B 2P8MA 1BFOB 3UJJL 2HTLD 3BE1L 2NZIA 4HKXA 4PUBL 4RX4D 5TE4H 5C07D 2DBLL 3PXHA 5F93C 2F54D 1FGNL 1YEGL 2CGRL 1PFCA 3CVHA 2HVJA 3VI4F 3LRSA 1OAZH 4LL9A 5DJCA 5ENWA 2DKMA 5JOEA 4AT6A 4C83A 3D25B 4HDIB 2VDQL 2BHUA 3MV8E 1MF2L 3TWCL 2VUYA 1YEDA 5T3ZL 4HKJA 4KV5F 2YD4A 5MP6H 5IFAL 2MNUA 2GIYA 4MA3B 4C56B 4M03A 2ZUUA 3H9HA 5ADOL 1JHKL 2C3HA 4XBPA 4WRLA 4JRYD 3GJFB 4PRHE 4NNXB 2ED7A 4XCEA 1B6UA 2G9HA 3SDDA 3PDOA 4UT6L 1FFNA 1VPOH 4EI6A 1OVZA 3DXAA 1TTUA 2R0LL 3H2WA 3WHXB 1ZXQA 2K3TA 1TJGH 3WJJC 2IPTH 25C8H 4ORGB 2XNAA 4U1JB 3KHOA 1BZ7A 2W60A 3BHBB 4FQ1H 3LEVL 1ITCA 5IT2H 1MRDH 3GSOA 3SKJL 3S36H 3QCTL 4WWID 2O61A 1LNUA 2ICEB 2QQQA 5I8CA 1UB6A 5FHBH 4Y4FC 4KHXH 3FT3A 1E6JL 3VFWB 3PL6C 2F53A 1MCSA 3UPRB 2EKSB 2Q8AH 4LPVA 3PIQA 3K1DA 4WVRA 5E08H 1BFVL 4PJHF 3U6RA 4P4KC 5GJTL 3AS0A 2R0KH 3TBVA 1JV5A 3H8NA 1FGVL 1WC7B 3BPOC 3NABH 1DQQB 5DJZA 3TVMB 1MY7A 2I60L 1E4KC 4UDUB 2H6PB 2VNCA 4J3VA 4ENEC 3QHFL 4HZAA 1O0VA 1ZEAL 5IHLB 4HAFA 3NFNB 3T09A 5GSRB 3CAFA 5KW9L 5ESQB 4HGMA 1RUAL 3JV6A 2E9WA 3RAJH 2HN7B 1MHEB 3MV8B 3EKCA 4GW4A 5DRXB 1IEBA 2CMRL 2FLBT 3S4SA 4XCNB 4M7LL 5BZDA 3QXVA 1BVZA 2HT3D 3DTXB 3Q5OA 3MRIB 5C0GA 1CFSB 2E5EA 1Q1JL 3LKOA 5FM8A 3T0EA 5CWSB 5JO5A 3FFDA 2Z93B 4PRHB 5BXFA 3L7EB 3EYFB 1DQLH 2MKLC 3H9ZA 3FOLB 3NZ8B 4OV5B 4OLXH 4W6YB 4U6YB 2R1WB 4OTXH 4U49A 2GK0A 2PXYD 4OT1L 3T2NH 2CXGA 3T2OA 5ITFA 4KKNA 5DJ0B 2A0LD 3VW3L 1QRKA 4UU9A 3KPNA 1FL3B 5DD0H 4FQXA 5DTFA 3VH8G 5HI4D 5I71C 5GRUH 4J3WA 5E8NA 1D3CA 1HSBB 2C26A 1MSPA 2GEEA 2GSIB 4Y5YA 3ES6B 4M5ZH 1HXYA 3W0WD 1L7IH 1OAUH 3D2UA 3RWGA 1FORL 1GOGA 3QXAA 2VDML 3UX9B 4NJ9L 4R7DB 1EGJA 2QQNH 4YDIH 1IM9B 2YPLB 5IM7B 1A1MB 1LK2B 1U8JB 4GBXC 2WIIB 4DTGH 4Y4HB 2X4OA 3T0VA 1II4E 1I7ZA 2VXVL 3SDYH 1FYTD 2R69H 3WLWD 1C1EH 3ULVF 1LP9E 4KJYB 5ICXA 1KJ2L 3NAAH 3QI9D 1I8MB 4WW1B 4ZDHA 4CJ0A 1C8PA 5SX5H 4XXDB 2E3VA 3GIVB 3QUXB 4XNZB 1PEWA 3VRJA 2M8XA 3P4NB 4WFED 4I9WD 2Y5TB 1UWXK 3TT3L 5DD3L 1MRCH 4LSTL 4F9PA 1D5ZB 4M6OL 4CVXB 1KLUB 3QDJD 2AJYH 2G75B 3U36B 5HYJA 1LO4H 2R39A 1QSVA 2YBRB 4NQEA 1AJ7L 4BQ6A 2APVA 3QEHA 1A1OB 1Z9LA 3H0TA 3BWUC 3K46A 1CFTB 4XX1E 1F4YL 2JF1A 4LSQH 1MH5B 4G8FB 1KOAA 1S9VA 3TZVC 2CDFA 5JHLL 3BWAA 4R3SB 2BOBA 3WYRA 2YSSB 4PY7A 4Y0GA 1B4JL 3TYFA 4GT7A 1JTPA 3MUJA 2DQDL 4LSUL 4EUPH 1H5BA 4I4WB 4UDTB 2YRZA 5EDXA 3ORJA 5A2KH 4RAVA 4P57A 3QUYB 4L4TA 3ZTNH 4FQIH 1RI8A 1G6RB 3DETC 3CZFA 3SKMA 1QFWL 1VGEL 4KGLA 5GGUA 5IMMB 5HHME 1QHOA 1T7ZA 1HKLL 2PCPA 4MWFB 4NQVA 5DZNA 4ELMF 1AHWC 3LAFA 4OD2A 4BZ1L 4PGJA 4Q9BA 2CRIA 2VZOA 1C08B 4LLVB 3VFRA 5T1DL 1KBGL 1WZLA 3QJHA 1IGYB 5A3IC 2I27N 2F74A 2HT4D 5F72S 3IGAA 5FECA 2Z92B 2FB4H 1HH9B 1LP9B 4NN7C 1SMAA 4NOBA 4ZFGH 3U7WH 2G2RA 3OKLB 5DD1L 5BMFL 4NO0B 1UH4A 4JFOA 1JP5A 4HUXB 1G7JB 4OF0A 1PZUB 1FCGA 4PJFE 1AR1D 1G0XA 5B39B 4CVWA 5DI8B 2VZTA 4KKAD 5BOPA 1VFOA 3V52L 1WUNT 3R06A 2E6JA 5LGHL 4RCAA 1WVZA 4NJAL 3MBXH 3DGGA 4ZFOB 4C57C 4P46D 1D6EB 3B9VA 3K2UH 4OCRL 5L88H 1NCCL 1FE8L 1IGTB 3A6BL 3IFLH 2J4WH 2XA3A 2YPVL 1AD0B 1A21A 1DVFB 3GSNL 2D9CA 3UJTL 1EHNA 4YDJB 4OZ4B 1EJ6A 3FONB 4XB8A 1DE4B 3BKYL 1J10A 2VSDA 5I19L 3GSXB 3B8YA 1GGTA 5IFHL 2XZQH 4S10A 1WBXB 3QRGL 4OFVA 5DRWA 3TPKA 4L8SA 1QVOA 2FYYA 35C8L 4M5YL 1MIEH 2FR4B 1UKTA 1CT8A 2VXUL 4TULL 5BQ7B 1KJ3H 1WEJL 4PGZA 1AIFA 3V6OC 2GTZA 2P8PA 5IP4A 4FXGB 1Y0LB 1UB5B 1FSKC 3NZHL 1A2YA 4DN3L 3RNKA 4OZFH 1YUHB 4JKMA 3L5XL 4XH2A 1KN2H 4G7YH 1JMZA 2VLJD 4YHIA 4J7RA 5C7XH 2FZ3A 1K8IA 1UXWB 4EKXA 1MLCA 4LCUB 2K1MA 5CEZL 2ADGB 2CPCA 3ZTJG 3RTQA 3DYOA 3X14A 1XCTB 3UCRA 1MFCL 3GKZA 5IESH 1E4WH 3J7HA 2NX5A 1HHHA 2DWDB 5DGQA 1R5IA 3VXRE 1W0WA 2OI9C 4OLEA 1JTOA 4MCZB 1KPUA 5FCSH 1S9XA 5AUMB 2FJHB 3FHAA 2FEEI 4JPIA 4PJAE 2EE2A 3QIBB 3TBSB 1DSFH 1SEQH 2NXYC 3KPSB 4Y19E 3MV7D 2CLRA 4FMKA 3CMOL 5B8CB 5KSBE 3N1QC 3M1BB 4RIRB 1OWRM 2HTLC 2DI7A 4X6DA 4XPTL 2C3WA 1JHTA 1CDBA 1MWAA 1QFHA 3TO4A 5I66B 2ARJQ 3CC5A 5AD0B 2QQKH 1QRNE 3GSUB 2B1HH 5F8QC 3PWJB 3CIQA 4GRLB 1AQDB 3SPVB 2ZCHL 5SWQA 4OZFB 1P4BH 1F00I 3FTGB 1FH5H 5I1DB 5KVFL 3MODH 4S2SB 4TTDD 3ULUH 1U8HA 4OLWL 1OAYH 2XWTA 2WUBL 3MZTA 4KK8C 3MJ9A 3CX5J 1BLNB 1ZE3C 4K23H 4DKFL 4L8CA 4OGZA 5FKPB 1U92B 2AJZA 4PRIE 4JVWA 1YNLH 2IFGA 5DVKA 1J1OL 4HK0A 1B9ZA 4D0BA 2OZ4A 1LGVA 3BN3B 4U7MA 2YD7A 2RFXA 3G9VA 3KNBB 2EE6A 3SDAB 5BVJB 4OIIL 1X4YA 5JNYA 3MRBB 3QG7H 3U79A 1RIHH 3OB8A 5J1TC 3H9YA 4JRXE 3SGKC 5DK0A 1Y18A 3PP4L 5EZIL 2AJUH 4I18B 3QIWD 3EYOA 4RGOL 3QPQC 3GSVA 1Q0XL 5IB1B 5CS7A 3LRHA 5EZOH 1KEMH 3X11A 3N06B 4BSWA 3FAWA 1CD1B 1OGTA 3NCBB 3SO5A 1ZT4A 3BDYH 3X12A 1AI1L 2Z8VC 2A73A 2B8OT 1IAIM 4ZTPL 5GS2D 3VXRB 2HJFB 3LEXA 5I18L 4JREB 3OG6B 2DL2A 4O4YL 2CLVA 3WD5L 1SEBB 4PJAB 5HDLA 2V7NA 4Y19B 1L9NA 4OZHF 5C08E 5EU6D 5KSBB 4IRSC 3T1FA 3RDTA 3FQRA 4LKCB 4O58L 1F3JB 4RMSA 3GI8H 1KUMA 4JZOA 1QRNB 2NW3B 5I6XC 3VI3E 1NUDA 1A5FL 5EIQA 1NQBA 3R8QA 4E0RA 3O41A 5LG1A 3REVA 5A16A 3GM0A 1KG0A 4UIMA 4N0CD 4MD4A 1CLCA 4BSVB 3OPZH 4N68A 1VB9A 2GJJA 4FZEL 2NY3D 2VH5H 3MZGB 3SKOA 2HT3C 5I16A 1OAQH 1ZLUK 3VWKD 4MJ5B 4QRPE 1IE5A 4K3EL 1XGQB 3MCLH 5JW3H 1A7RL 2CKNA 3H7BA 3QQ9D 3LQZA 4PRIB 2VWEE 1KIQB 3IDGA 4AK1A 4L3CA 3C08H 5EUKB 3RGVD 1U93B 1CE1L 5C8JB 1G9NH 1V5JA 3JV4B 2FSEA 1VHPA 4LSDA 2HP4A 2PXYC 3QXWA 1A6UH 2Y36L 4KRPD 3HMXL 2A0LC 1UZ8B 4JQVC 4J23A 4Y5XB 1AKJB 3QEQE 2EDHA 4OGXL 5E5MB 1CWVA 4D8PA 4JRXB 2BRRL 5HI4C 4KZDL 1VEPA 4XC3H 1G7IA 2DMBA 3PGCA 4YC2C 5E94A 1FZMA 3BOVA 1KCVH 1RK1B 1T04A 2MTPA 4NRXB 5EUOA 2VLLB 3I50H 3QBTB 3S97C 5AAMA 4BM7A 5I74C 2XT1B 4YQXL 2AP2A 1F4XL 1N3NB 3WDJA 4G3YH 1A1NB 4NC1E 5HHOA 3ARED 3LDBB 2BHYA 1AGBB 3WLWC 1G9EA 2DQFA 1S7TA 2DI8A 3IETB 4ZUVB 1J9CT 4K7PL 3SBWC 3QI9C 1F4WL 3BW9A 5C0BE 4OZHA 4Y4KA 2P5EA 4M7LT 2RBLA 4RFOL 5C08B 5F1KC 3QNYB 4HH9A 2VDPL 2CK2A 3BKMH 5DFWH 4MLIA 1CDCA 4TSCL 4H0HB 3AMLA 1AC6A 1ZGLP 5F3HB 3BXNA 3O6LH 3OXRA 5D7JA 1S7XB 4U1KB 1XR9A 4HS3B 1HH6A 1MCBA 5KSUA 2XWJB 3SN6N 3VMPA 3KPQA 1HEZA 2D3VA 4NFBA 1FIGH 3VXMD 1KTDA 2A83A 2DDQH 3HE7A 5IW1B 4RRPG 4KC3B 4PJBF 3B9KD 3DVGA 5DD5H 5HJ3A 4ODBD 4Z78B 4OCMC 1DN2A 2JJUA 3SCMD 2EDFA 4LSVL 1K9TA 4QRPB 2OSLB 5F3BA 4Q0XL 1TENA 1NEZB 1BD2A 2FIRT 4NCC1 5GJSH 5I1JL 1A14H 7FABL 1FPTH 5I9QC 5IBLC 1P7KA 4Q74A 4H88L 5GGSY 3EO9H 3HI5H 2I26N 3DYMA 5CCKH 4X7FC 3RVWC 3FB7A 2VRAA 5IEKB 1D5BB 4RMTA 1DBBH 3P73B 2WIMA 4X8XA 1PG7X 4GMTH 3MLUH 1DQTA 1E4JA 1F02I 3QEQB 2P8LA 2AAVA 4XTRD 3HLAA 3SY0B 4XHQA 2WBJC 2R56H 4G9FD 4HWZA 3U0TA 1DQMH 5FOBA 2VITB 1MJ8H 4YE4H 3WFCH 3UTSA 2YR3A 4WV1A 4JO1L 1RHHB 3PWNA 2M2DA 4YHML 4DW2H 2ZOKB 1SYSB 1F11A 4NNPH 3CDFA 2D7OA 4PRPA 4OGYL 1A6TB 2GAZB 1IC5H 1FLRL 4TUKL 3PGDA 5C0BB 4L1DA 2X9WA 5JA8B 1MCEA 1HDMA 1A4JA 4V2CB 1I8IB 4NQTA 3W39B 4LVOB 2JB5L 1J0IA 5JW4R 4KKAC 4B0MM 2AK4E 1OF2A 3VXOB 1Q94B 1ZHLB 1MIML 3I6GA 3BEWA 1WAAA 5E2VH 4P46C 4A6YL 3HA0A 3BH8B 1P84K 2UV3A 4IJ3C 3S37H 4PGEA 2E6PA 4K3GA 1DBAH 3B9AA 3AS2A 1V8HA 4QT5A 4HQQL 3SDDD 4J1UB 4PJBA 2XYCA 3DXAD 3V4VL 4GRWF 4NQCE 2OK0L 1M4KA 1VFAA 4KKLD 1BZ9A 1UWXH 1ADQH 5DO2D 5CFHA 8FABA 4FQ2H 1A9EB 4EQ3A 2EYRB 5LGJB 4KZEH 3LY6A 1B90A 3D0VB 3JUZA 4I48B 1AP2B 3BN9D 1YDPA 4X7DC 4LLYB 2V17H 1QEWA 1OSZA 1U0QA 4RWYH 4WY7H 1N5AA 3QWQB 5ADPH 5HDBF 4CBPA 4P23C 1FZOA 1LQSR 2YD8A 2F53D 4M8VA 2DYPB 3ZHKA 1W0YT 4P5KB 3SKNA 2OQJA 1OGAA 1I3GL 3OZ9L 4OF7A 3VJ6B 3P11H 4ZO9A 3F5WB 1HILB 2IAND 1UYWL 4NP4H 5DWUL 4FZ8L 5AZEL 1HHJB 1L0XA 3EYUL 4YPGB 3BVNB 1VSCA 2OL3B 4PJDE 4ORZC 4JJHA 3BO8B 3FQXA 3U48A 4UT7H 5L2JB 1EO7A 3NCCB 3ULVL 2JIXB 3W9EA 4QXWA 4GRMB 4HHAB 5JR1H 3MYJB 4U0QB 2XY2A 4N8CL 4ODHH 2ZUTA 1F2QA 2J88H 1QA9B 4Y4FB 3O3DA 4MXWL 1ZSDB 3RVVD 1AGFB 1OY3B 1ZK9A 2C3XA 1NFIB 2AK4B 1IL1B 3T3PE 3C09C 4WUKH 4P4KB 2Z31A 3IS0X 3SDCB 1U8IA 3C2SA 3HZVA 5F6HI 2APFA 1MPAH 4TNWF 4DFHA 2X4TB 3JWDL 3W9DB 3WIIH 1OCWL 5JXAH 4HS8H 5HPOA 2AKRB 5SWSA 3CFKB 4HS6B 5F7EL 4QTIL 5E6ZA 1AO7A 2AGJH 4W4NA 4EXPX 3UP1A 4P59L 4NQCB 4YHOH 3G6AB 4MXQD 4N8PA 4D2NA 5HHPA 4TTDC 4K8RD 3D87B 4XBGB 3OKOB 1IFHH 1NFDA 1MCKA 2FH6A 3T1WA 4FQXD 4YGVB 3W81A 1WK0A 2HTKC 2H1PH 3MRPB 3BD5A 4E42A 4WWKA 3GUTA 2Z8WC 4NZTL 1J1XL 3D2UD 3EFDH 3WEXB 4UQ3B 3WXVL 4F33B 2KPNA 2OJZL 4QXTA 3CSYB 3FOMA 1MCNA 5JHDE 4W70A 3JTSA 1G1YA 1X5AA 3PHQB 5DLML 1P4IL 3CH8A 3DYPA 4UILL 2P1YA 3D3VA 3I84A 3QHZH 3FB6A 3B8SA 5LWYL 4O51B 4MXVE 5L6YH 1A7PL 5C6TL 4JZNB 1EUTA 4M6MH 4JHBA 2A6KA 3GRWH 3K81A 3QRFM 4J2XA 5ESAA 4LAJH 2X9YA 3IDNB 1MCIA 4KXZH 3EYVB 5I71B 2IQ9L 4BQ8A 5IMLA 5C0EA 2F5BL 1GYAA 4WW2B 5HVGB 4N8VB 4KTDL 1RZFH 5ISZA 5FYJE 2CUMA 2GCYA 5HYJD 1KIPB 3RWIB 4HUUA 2JCCF 4NQED 4BUHA 1YEFL 2OTUA 32C2B 1KB5L 4GBXB 3LN5B 3RHWK 1INEH 5F44A 1E28B 4HJGA 4XB7A 5C9JA 3ZSSA 3FQNB 3LKRA 2NXZC 1KENH 3V2AR 3MYZA 1CL7H 3G6JA 3Q1SL 5IK3B 4YPJA 5T5NG 4EIGB 2AQ1A 5IJVB 5CJOL 5EBWA 3U4EB 5J57B 2FO4B 3TBWA 2FX7H 1HNFA 4LRNH 4N0CC 2H2PD 3V5HB 2BFVH 2J8UA 4L4TD 1NCUA 3F6IA 3TA3A 3EGSB 2NY3C 2ADJB 2OR9H 5FYJH 3O0RL 3GHEL 3VWKC 3MRCB 2IFFH 2IWGA 1DUYB 1Z0NA 4NPYB 5TDPB 1S9WA 2YD5A 2CKBB 3UTZB 2BSED 5CEXA 3OJMB 3UBXG 5DZOA 3HPLB 3MJ7B 4MA7L 1IAKA 4TQEL 1HN1A 1NGXB 5TF1L 3BIAX 5FK9B 4XMPL 1CLZH 5FB8B 5JHDB 4XRCA 5CKGA 3P30H 2Q20A 2HJKB 1CFNA 3TZVB 5FDWB 1MREH 4Z8FL 1LE5B 5HSFA 4QYOB 3T65A 2AI0H 3S35H 5F89B 2IH1A 2BC4B 3DMMA 2WWKT 2DLFL 2H32H 4RISH 3WN5A 5AZ2L 5ICZB 5JORB 2P45B 5ID1A 3ARVA 2LU4A 1CQYA 1NCDH 3TYGH 3BT2L 3DV6A 3RVXD 1S8DB 3V6OE 4YHYC 5EU7C 4PJ7E 1FFOB 3D9AL 1ZS8B 4ALAL 4XC1H 3HUJF 1MFAL 1FLTX 1YEKH 4L1HA 4N90E 4D3CH 1CFQA 2XPGB 4PJCE 5DMJB 4KTEH 4WFHD 4XBEH 3QQ3A 2JCCA 2Q76A 5KAQF 5CJ8A 1AHWB 1IGMH 2XZCH 2GITA 4ZD3H 3V0WL 5J3HD 4LHQB 1R6VA 3F7RA 2DI9A 1TCRB 2PO6B 3WV0A 3C5SB 1I1FA 4AEHL 4BJLA 4D0DB 4K7PX 4NN7B 4PP2B 4N1CA 3I9GL 3RWEB 3TBYA 3IKKA 1G6VK 3O45B 4FABL 4UBDD 3FO0L 2AJSH 1XIWC 3OKDA 4PLKD 2EIBA 1QO3B 3K4ZA 2ZKHL 1WWBX 3AAZA 5DQ9B 1FHGA 5JIIA 1C12A 1IZKA 3NFPB 2D0HA 3EAKA 4I0CC 1K5NB 1JF5A 4DUXA 3U46A 4TSBL 3LEYL 5IQ9A 3B4NA 4EN3D 3QEGH 3B9KC 2FGWH 1RIVH 3IT8D 3MLZH 5IG7B 3KPMB 4TRPH 1QNZH 3U4BL 4OCWH 5L2KB 1JNJA 3H42L 4ZAKC 2YEZB 3C8HA 4UUJB 3L3IA 3LN4A 1HSAA 5FGRA 3MRDB 3L3JA 3G5ZA 3HR5B 5T5NF 3UTPD 1KJMA 1Z0MA 1VADA 1VA9A 4CW1A 2MPAL 4BKLA 1KFAL 1IQDB 3VWJA 4NZRH 1R3HA 2BJML 3EOTH 4PJIE 3RTQD 1ZLUH 4GOSA 2DRUA 4UQ2A 2BY2A 1R24A 1RZJL 1Z3GH 4LPUA 1CN4A 1BOGA 4R2GB 2OMBA 4WTZG 3VGHA 2NX5D 3CFIC 4WGVB 2ZUQB 1XH3B 4WUUA 1D5XA 2ZCKH 1FN4B 5D6CB 1HZHL 4IOIA 3FAXA 5CLTA 3RX7A 4I1NB 5SX4H 1FSKB 2H9GA 4PJ7B 3R8BB 3Q6FA 3WNKA 1PLGH 4Q9RL 2YN3A 2V9RA 4Y2OA 2OTWB 5JOFA 3TO4D 2PTTA 3AXLA 4QHKI 3IXAB 2WK2A 3HHRB 4NM8L 3B3IB 1JK8B 5T1KA 5JPNB 43C9B 5J9PB 1K4DB 5DA4A 2IPKA 4IMLB 1H3PL 3CUPA 4NO5A 1XR8A 1MJUH 4U6VL 4QGTA 5F6IC 1FFPB 2XZAL 4KTYA 5DURB 5EC2A 1FNEB 2IBZX 1A6ZB 1FO0L 2OI9B 3HS0A 3IDIB 1F3DJ 5BJTA 4Y1AD 4PJEF 1CDIA 1U8PB 4MQXD 2EDYA 3K80A 1BQHB 3KHQA 4ONOA 2UZYB 1YMHB 5ID0B 1CIDA 4YWGH 4CADA 4JLRB 4X0KB 4J8RA 1G9ML 1DTUA 1V7MH 3Q3GA 1S7QB 1T80A 4IHOA 5C07B 4Z5RA 5TH2A 4KKLC 3V79C 4XPFL 2FCBA 4FTVE 3BGMA 1ZAGA 2PTUA 5C0JA 1TJHH 5DO2C 5HHXL 1GL4B 4AIZB 2E9JA 1VGKA 5D1XA 5JLZB 5EPMB 5E4EC 1KB9K 5CJBA 3MLWL 2NR6D 1UGNA 3BN9C 1EAPA 1ZLSL 1PKQA 3MO1A 4O9HH 5EBMA 4KK9D 3MV11 1DQJB 3GNMH 5DUPL 5I1AB 15C8L 4QCIA 3WO4B 3IFNH 4PJIB 3VXUA 5D1QA 4I77H 4FQHB 1KNOB 3A67L 4X6CF 4NHUB 5H2BA 1FG2A 1W8OA 1EO8L 5JW5A 4LIQE 1BFSA 3VFSB 1CGUA 3HI6L 1DR9A 4JRYB 2PETA 2WWMD 2PN5A 1RU9H 1K4CA 5IV2B 1UACH 1MQKL 4KI5D 4LPWA 3OGCA 3MSPA 1FDLH 3LMJL 3UBXA 4DVBA 4Y88A 1WZKA 4WO4C 3WNLA 1ZKAA 2MSPA 3LVEA 4YDKL 5FUOL 4POZD 3QNZA 3VGAB 3RDTD 3HCVA 1FNFA 4M62L 5KS9E 1IKFH 1HKFA 1L7TL 1FG9C 1GZPB 4GKSA 1A3LL 2W65B 1K6QH 3ARFA 3WXWL 3KLAA 5IMOB 1DLFH 4RMRA 1F6FB 3W0WE 5F9JB 3ARGA 3O2VL 1HYSC 5GS3A 5TGBB 4PTTA 3OJ2C 1RHFA 5DYOB 3ESVF 3TCLA 1HXMB 5DJYB 1X7QB 4LIQH 5L0QC 3CFEA 1FYTE 5E2WH 4PJEA 1X5IA 3B2VH 5C0AE 4DQOL 5KG9B 2UYLB 1WTGT 1NGZA 2Y06H 2EC9U 2CSPA 3TNNB 2P4AB 2NZ9D 1A7QL 5KOVC 1WV7T 4H1LB 1JZ4A 4DZBB 4QRTA 1JWSB 4MS8C 4IRSB 4U6XA 5T3XD 3IYLW 4P2RE 3GMPA 4WFEE 4HH8A 5BS0A 3LIZL 4I9WE 5F1IA 4C59B 4K8RC 4ZODA 1JUFA 5I6XB 1YQVH 5IUSA 4UB0L 1U9KA 2B0SL 4QRUB 4A2MA 3QDJE 1IEAA 3O3AA 3VFTB 2DBLH 3BP4B 1JGEB 5MENE 3ZHDA 1KYOK 4X4YB 2ENSA 2NY7H 1IGJA 2CGRH 3IDXL 4R4ND 1NBQA 4P49A 4QF1A 2W1NA 4MB5A 2EEBA 3STBA 5D7SL 4X6CA 4G6ML 4NN6C 4WEBL 1A8JH 2DWEA 3L1OH 3PV6A 3RVTC 2EDJA 3CD4A 4F7EA 5E24E 3FRUB 2FEEL 4S11A 4WFFD 5HHOD 2VDQH 3KPOB 3L3DB 4O2EA 4X7TA 1XT5A 1YY9D 3TWCH 3ARPA 1RUKL 2EO9A 3OKNB 1QYGL 1C5DB 2A6IB 3JWOL 3F7YB 4OLVH 4PJ8A 2AV1A 1JGLH 1YEHH 2P24B 3EDJA 3QPXH 5IFAH 4OZIE 4Y4KD 2P5ED 4OCXL 1X44A 1MFDL 1K2DA 5ADOH 2CRMA 3NACL 2PXYB 3KLHD 1YY8A 1W8NA 5KS9B 4LDLB 5TPWL 1BM3H 4UT6H 3BUYB 4WTZA 3IAPA 2AEQH 5BCAA 4PD4J 2R0LH 5D7JD 2RQ8A 2DQHL 3OQ3B 4YC2B 4ELKA 5CBAB 1JWMB 4Z9KB 5GHWH 5AEAA 3W0WB 2VLKE 3FB8A 3ZDYE 3MJGX 5LKNA 2GK2A 4MQ7B 1TMCB 2HKFL 5T1MB 5BZWA 1QFUL 3HE7D 3FKUS 1JF1A 4Z95H 4HX1B 3LEVH 3CGTA 2H8PB 1EIBA 3IDUA 3L3KB 3SKJH 3PF2A 1D6VH 3D0LB 4Z76B 3QCTH 1FYTB 2Y4SA 3ROOB 4JY4A 1GOHA 1CIUA 1EVTC 2VQTA 2BRQA 1P2CB 3QI9B 1BD2D 1D5IL 3LQMA 2BCKB 3VU2A 1E6JH 1QLRA 5D2LA 2FBJH 2HG5B 5JXEA 2HLAB 3WJLA 4YUEL 1VFBB 3OAYK 5GJTH 4P2RB 5C0DB 4G9DB 4JFXA 4YDVB 2H2PC 3O6MH 4S1QL 1R5WA 2X2YA 4U1NA 4G7VL 2Z35A 2ARJB 3U2SA 1IGCL 2I60H 5T1LA 4ZUTB 4PLNC 3QDJB 4PJGE 4XZUB 1KPVB 4XP6L 4GUPA 3GSQA 3QHFH 4KQ3L 3GK8H 3P0VH 5MENB 2X4QA 1ZEAH 3MMEB 2X89A 4HWBL 2Q7YA 4N0YL 3UTSD 1NANH 4JQXC 4F7MA 3EO1A 1G1CA 4QY8B 1JPGB 3QO0A 2YD2A 1E27A 4KI1A 2IQAB 3ULVC 3RBGA 4PRPD 2CMRH 1PKOA 4OQTL 2BZDA 3QJFA 5I9QB 4ZUSA 3OAZK 1KTLA 4M7LH 3THMH 1CGWA 3NN8B 1F5WA 1SJXA 4Z18A 4OZIB 3QQ4A 4KXZI 5FGCE 3VFPA 4UAOC 4L5FH 5K93A 1Q1JH 1UEMA 2VMFA 3RVXC 3C60D 3INUH 3ZE1E 3WNOA 4PJ5A 3PJSA 2C3GA 2VLMD 2GJZB 3RZCA 2DQEH 1Y6MR 3JWDC 4POUB 3BAEL 1JNHA 2B20A 1J8KA 5HVFB 3MJ6A 4OIBA 2VLKB 3RUGE 5T33H 4FS0A 2CR6A 3VFOB 1CL7I 5J3HC 1BQSA 4PJXF 1BWMA 2JK5B 5DMIL 1HK6A 4R26L 1KACB 5DT1L 2IPTL 3UPAA 2HFEB 2OYPA 4EVNA 1ORQA 4KAQL 2VDMH 3MRKA 1B0WA 4NJ9H 4HAGA 3DVNB 2DICA 1YMMA 4IMKA 5D7LA 2P46B 4UBDC 1XGUA 4FQ1L 4JVUA 4PLKC 2YMXL 1S9KC 4AIXA 4DZ8B 2ITDB 5E8DH 3O81A 4RFEB 5IT2L 2XTLA 4L8SC 3S36L 2VXVH 3MRQB 1U95A 3SDXA 1P7HL 5FHBL 4KHXL 1KJ2H 2PW2B 4P3WA 1HHGB 4EN3C 2Q8AL 3AB0C 3RWCA 2VC2H 5FYLD 3LH2H 4NUJB 2BHZA 4P46B 1OGAD 4PJGB 2R0KL 3HPJA 1V3LA 2BDNH 2OP4L 3W11D 2HJLA 4B7LA 5C0IA 4GG6F 12E8L 5EOTA 1M7DA 5I15L 4HFUH 3D85A 2EIZB 3U0WL 4ONHB 3ROLB 5IB5B 3RTQC 2X44D 2DAVA 4XPAH 3KDMA 1AJ7H 3BGAA 1UXSB 2YXMA 2V2XA 2MWCA 5ERWB 3RAJL 1EZVY 1RUPL 1F4YH 3DRQA 5FGCB 2QSCH 4P23B 1LWRA 1QTYT 43CAA 4OD3H 4NQSB 1UM4L 4JJ5A 3PWPE 2Z31D 5H94B 1R3JB 4FFYH 3PABB 3RPIB 4OFDA 2HFFA 4L3EA 2NLJA 4NN5C 1F97A 1FL5A 2HFTA 3RUGB 5SWSD 5FA4A 3REWB 2HRPH 1AO7D 4PJXA 1A6PA 2UZIH 3S96A 1VGEH 4OLXL 5D71H 5DRNA 2Q6WB 4HUVB 4LKXA 4OTXL 3T2NL 1M6OB 1LD9A 3JZ7A 1HKLH 2A6JB 4Z7OF 1ZT1A 4M61B 5DD0L 2BVQB 3LKQA 2HFGH 4BZ1H 3VXNB 3K1KC 4LNRA 4MQXC 5T1DH 2J12B 1KBGH 4WWKD 1GGBH 5IR1A 4M5ZL 3ZE2F 3BQUA 1L7IL 1OAUL 3RWFA 1IT9L 5EU6E 3LB6D 1H3UA 2QQNL 4HKZB 4YLQT 5JTWA 1KCKA 3VG9C 1T5WA 5C0FB 3NMEA 1HINL 4DTGL 3V5DA 5K59F 3GI9L 2HAZA 1C1EL 4OBRA 1IM3A 3U7YL 3V52H 3GMOA 3D3VD 4OLZH 5GGRB 4FQLL 5LGHH 4GG6A 4NJAH 2NR6C 1XGRB 4KKBD 4KH2A 5HGHB 4JANA 4YO0A 3UEZA 3OG4B 4KK9C 1CVRA 2I9LA 4OCRH 1QBLH 5GS2H 1G6RL 1FE8H 4JHZA 3BZEA 3A6BH 1T4KB 1ZT7A 5ICYB 3QCUL 3IJYA 4UV4L 2YPVH 1U3HA 3GSNH 4LCYA 1MUJB 1Q9OA 2BSRA 2B39A 3NVQA 3LQAL 1H15B 1I3UA 2C7UA 2WWMC 3GGWA 5ISZD 3PHOA 4JAMB 4XAWL 2EYTA 4LBEA 3BKYH 3M17B 3KR3H 5I19H 4Z7UE 4PG9B 1S5IH 9CGTA 2J6EL 1D5MA 3KXFE 5DSCB 5IBUG 2M1KA 3P77A 4NO2A 5D2NC 3PWPB 35C8H 3RDTC 4WW2F 4LSQL 4HGWB 1SMOA 4HV8B 2DQTL 4PTUB 4Y16A 4JFFA 4WU5A 4TULH 4DGIL 1SM3H 5DHVA 1WEJH 3CFCH 4PRBA 3CLFL 3UZEA 2BK8A 4WJ5B 3BEVB 5D9SA 2VE6B 3UDWC 1WBYB 3QIWB 5EA0H 1QKZH 1S9YB 3MR9B 1SQ2N 5EU7E 4PGBB 5K33A 4ZFOL 2UUDK 1I8LA 3RX8A 1JJUA 4WNQA 1GZQA 4DKDC 3L5XH 1OP3K 2ORBH 2VLRA 2C9AA 4MVBC 4R4BA 4IRZL 4GG8B 3TA3D 5DD6B 1HHIB 2DQUL 2FGZA 1TVHA 3JBG7 1GJIA 2H26B 2BVPA 3GSNB 2W92A 2BX5A 5EU6B 1NGWA 1N7ML 2UWEF 2XKNA 2NTFB 2R15A 5JPMB 1RZJC 2J8HA 2DBJA 5DJAB 4Y5VC 4I0KA 3ZSTA 2HMIC 3L95B 3O2DH 4MAUL 4M00A 4U2YA 1UQSA 4F8TA 2FB4L 1HI6A 1DN0A 2BSTA 2VB5A 3DMMD 3B5GA 3S6CA 1ZA3A 2BNUA 3VXME 1BIIA 5GSVA 3IFPA 4R4NC 4UIKH 4HW6A 2CRZA 4ZQKB 2ZCHH 2NY3B 2AXHA 3MBXL 3VWKB 4GAYB 4NRYB 5CSZA 4YHLL 5HGBB 4MXVF 3TP4A 5KVFH 2NCMA 5C0ND 3K2UL 3ECBA 3TO2B 1FC2D 1X5ZA 5B3NA 3CCHB 4JE4B 2HA1A 3IFLL 3T2QA 1T66C 3EO0B 1TZGH 3G5YB 2EC9T 5MEQB 1CG9B 3KXFB 3WFBL 2Y7QA 2GTWB 4DKFH 5DUBA 3N1GC 3QO1B 1R0AL 3BIKB 3RWHA 4QOKD 1JZ6A 4NZUH 2X70A 4G9FE 2CDEB 2I24N 1A22B 4G5ZL 4O00A 2XZQL 5D7JC 4GXUN 3BDXA 4HWUA 3ZT6A 3Q48A 4OIIH 2WP3O 4M3KB 1MIEL 5CINH 3PDGA 1G9MC 4YHYB 1I8KA 3LHPL 4B41A 4HCRH 1KJ3L 4QHKJ 3LRGA 4MMXC 1QSEA 2QSTA 3PP4H 5EZIH 2BMKA 5EU4A 3RL2A 1AFVH 5F7WC 1MHPH 4NRZB 2HT2D 1A4KA 1K8DA 1Q0XH 3CDGA 3DUUA 1X5YA 3MOBH 4PRDA 4MB3A 3VGDA 2JKXA 2YRPA 2W0KA 3QFDB 5D7KD 2V2TB 1UVQB 3MRHA 1KN2L 1AI1H 5KOMC 1XF1A 4KDWA 4ZTPH 3EUUA 4U1MB 1JPFA 3VWJD 4LRIA 4N9OB 4S1DD 3BP5B 2X5PA 1G7LB 1BIHA 1NUGA 4Z7QE 1PW3A 1INQA 3IJSA 2EE9A 1WFUA 1E4WL 3VXSA 4WUUD 4ESKA 1LE9B 5GS1C 1NLBH 4GW5A 5KVEL 1U58B 1B88A 3V5KA 5TFSL 3WNMA 2VAJA 4O58H 4CJ1A 2EZ0D 5FXCH 3VXMB 4WHYH 3U30B 3NIFE 1DSFL 1P6FA 3KYOB 3B9KB 4XPHL 4X5WB 5GQBA 4G8IA 4BQCA 1C7TA 4MLSA 1S3KH 4KDTC 1JRHH 4EEEA 4HFWA 1U8LA 5E99L 1CFBA 4MD0B 3G5VA 1KT2A 3STZB 1OW0A 2QQKL 2ATPB 2B1HL 3Q5TA 5EH1A 5HYSB 1LO3H 1KCRL 4ONFH 2E9BA 1JGDA 5AG9A 1TZHB 1YPZA 2W0FB 4R9HA 1T20B 3DUSA 5B21A 4K3EH 4OKVB 1FH5L 2BOCA 4LLUB 2F53E 5E7BA 5HPMB 2Y6SD 1T7YA 4DVRL 1A7RH 3C60C 4CL7A 1CDUA 2OJEA 4TNVK 4G9FB 3CDCA 1CE1H 5IJKC 4PR5A 2IANE 2Y36H 4K23L 4HK3J 3HMXH 4F7PA 2ZUYA 1FJ1A 5EOQL 2P8MB 2R1XA 3DLQR 4NM4L 3S34H 1QUNA 3J8F7 4DK3A 4HKXB 1BECA 5GGRY 4KZDH 1B0GA 1QOKA 3AFLA 2WZPD 5D70L 1JYXA 3VI4E 3RNQA 3EDFA 5BW7A 2FNBA 2D31A 2HVJB 1JHLH 5D1XD 3LRSB 4JPVL 3QG7L 2APBA 4YQXH 4AT6B 1F4XH 4C83B 1EVUA 4NKIH 3WCYA 4Q9QH 4TOYL 2AJUL 2XTJD 4MA1C 5F6IB 1YEDB 4HKJB 1KEML 1BPVA 1NUNB 3VXUD 1J88A 3A6OA 5D1QD 1F4WH 2QR0A 3L9RA 4WU7A 3H9HB 4CMMA 4XBPB 3S36X 2IEPA 2VJXA 3QUZA 4RFOH 5HI5D 1J12A 4LDEB 4KROC 4XCEB 4TSCH 5HYFA 5I0DA 1QZ1A 2G9HB 3OAYH 4YZFF 3PDOB 5FO8A 1FFNB 3ARUA 5DEZA 1NMAH 2ATKA 3PNWA 4TPRH 1I7UA 1YN6A 5EN2A 5KVGH 4NNXA 2C1PB 1MFEH 5FO9A 4URTB 2XNAB 5E4EB 4ZOCA 1BZ7B 2W60B 3WHXA 3STLA 5K9OA 3ARFD 4ZUWA 5EFIA 1MNUL 3ARGD 3NA4A 4LSVH 5I8CB 3FT3B 4Q0XH 3V7AE 3H3PH 2F53B 4XWOD 1FZJA 5I1JH 1SYVA 4RAUB 3PIQB 4XNXH 4JDTH 2VN4A 1OTUC 2VH5L 2Z31C 3IVKA 4XP5L 2IG2L 5CD3B 3OAZH 4P2YA 2RIKA 5DJXA 1JV5B 4EUPG 4WI8A 3X13A 2EKSA 5DK2A 3I02B 5DJZB 3FMGH 1LVEA 5JW3L 5A2IH 3OKKB 2IANB 5GGTA 4LQ1A 4ZFZA 4E41E 4RDQG 5F7NC 4DGVL 6CGTA 3JWNC 4WO4B 4K8RH 3BRFA 3C08L 2D9QB 4X9GA 3HR6A 1DQQA 1EEUA 5BS0D 4FQJL 1NAMA 1A6UL 4XNMA 2H6PA 3D1MC 1EJOL 4XX1G 3C6SA 4Q58C 4JHWL 2R23A 4JO1H 3IXTB 1QFOA 5HYJE 3UTOA 1T83A 5HXMA 2QL1A 3NFNA 4YHMH 1SY6A 3FO1A 1IGFL 4WWKC 1IEBB 3HAEG 3S4SB 3L3GA 4TUKH 4MQSB 4U33A 4MX7B 3ZE0F 5GRJH 4G3YL 1CLYH 1OL0A 1PX3A 5C0GB 3P0YL 3LKOB 2JB5H 5D6DA 4Q2ZA 2CO6B 3FFDB 4PJ8D 4LNVA 1URLA 4ODXA 1MIMH 4PRAA 3NOIA 2GK0B 4A6YH 4GMSL 5ITFB 1O7SA 1OT2A 3BX7C 5DMYA 2WINB 1MY5A 4UU9B 3NZ8A 4FQXB 4JB9L 1INDH 3V4VH 2R1WA 3TVMC 4H5SA 2OK0H 3HZMA 4MAYC 2J7LA 4Y5YB 3F58L 1OPGL 1HXYB 3KPLA 3PDDA 2F8OA 3RWGB 4NN6B 5KZCD 1HQ4A 1A6VL 2DDQL 3O4LA 4BA8A 2GSIA 1A7OH 2PYED 3IRPX 5DD5L 2X4OB 4PB0L 5D1ZA 3O4OC 3ULVE 1I7ZB 2R2HA 3RY6C 4QRQA 4R7DA 4P2OA 1BJMA 4ETQA 4IRJA 5IM7A 1U3YA 1FV1A 2C1OB 5GJSL 4OI8A 2VN7A 2VXTH 3NIDF 1UZ6F 4MSWA 1FPTL 5JXED 4P5MB 3EO9L 3HI5L 3K4AA 3RX5A 3NGBB 5CCKL 2YK1H 3NPSB 1EH9A 1YA5A 4LSRL 3QUKA 1UYWH 4X4ZA 3TA3C 4FZ8H 3DOSA 1OP9A 4ZFFB 5T1LD 3MCKB 2R56L 5HYJB 2QLVB 1NPUA 3MLVH 1DQML 4PG2C 3DX8B 3I3DA 3VXTB 2WM0A 2X89D 4DGYH 3QEHB 1RIUH 3H0TB 2N7BA 4YE4L 3ULVH 1KLUA 1AD9A 1ORSB 4FFZH 4RDQF 3SE8L 3WFCL 3VGGA 1KGCD 4GO6B 4JFEE 3DURA 2KZWA 2YBRA 2G60H 4QHUA 4NFDA 3DJ9A 1A1OA 2CDGA 5AWNL 4MXWH 2CDFB 1MHCA 4UOW1 5F7MC 2BOBB 1IC5L 5K9QG 1CFTA 4PY7B 1YNTA 4KDVA 3AS3A 1RMFL 4PJ9A 3T8XA 3WN5C 1PZ5A 4BZYA 1H5BB 4IIQA 1MJ7L 2IJ0C 2IBBA 4RAVB 3JWDH 4P57B 2DLIA 1NEUA 3GJFK 4L4TB 4PJ5D 4DJMA 3CZFB 4QWWD 3SKMB 3RZCD 1XZ0A 5GGUB 1JPST 3IRZA 5GS0D 3FO2A 5F1OB 2BVTA 4OZIF 5E2VL 1DBKH 4ELME 1ZLWK 3GJEA 4LEXL 3QUXC 5EU5B 4XNZC 3CFBA 2PCPB 1DBAL 3SE3C 2OL3L 4OD2B 3ARDA 1KN4H 1MHHA 4XNQA 5E6IA 3VFRB 5JDSA 3UROR 4K3HA 2WV3A 3QJHB 1LEIA 2F74B 1KELL 1ADQL 1T22A 3IGAB 5D5MF 5FECB 2FH8A 1JYNA 3WXVH 5DC0A 4KZEL 5D7LD 1YMMD 2VXQH 4M9OA 2OJZH 5IROA 4ODVH 3ZDYF 1IGYA 2V5MA 5C3LD 5JMOC 4FHBD 4UAOB 2YKLH 4PLJD 1LP9A 4NUGL 1NCTA 1N6QH 2FBOJ 5DLMH 1P4IH 4JHAH 1U8QA 4WY7L 2EDDA 3R06B 4UILH 4MHHI 3NCJL 4XMKH 3QIUC 3T77A 3MLSH 3DGGB 3PG2A 5HVHB 4FFWC 2CJUL 3IB4A 1WWCA 2HT2C 5HTSA 3KVQA 2WBKA 1AXSB 2PTVA 4EUPA 2W9EH 2QQLH 2IQ9H 3NCYS 2EO1A 2UUDH 3PQYE 1N6UA 1D6EA 1NBYA 3DO7A 5HD8D 1IGTA 3D85D 4KTDH 4JFEB 4S1DC 2MCPL 1XGTA 5IGXH 1TVBA 4GJTB 1DVFA 3RIAF 5DXWA 4K9EC 1KLGB 2DIAA 1YEFH 4KVNH 4YDJA 4UT7