5IW1B

Crystal structure of b4.2.3 t-cell receptor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
233
structure length
233
Chain Sequence
VTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSLGHTEVFFGKGTRLTVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYALSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An allosteric site in the T-cell receptor C beta domain plays a critical signalling role.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-CELL RECEPTOR ALPHA CHAIN
total genus 51
structure length 233
sequence length 233
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2016-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw1B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw1B02
3MGTA 1IC4H 3QWOB 3HZMA 4PREA 4JO1L 3JV4B 5I0DA 1FC2D 2PYEB 4BSWA 1EAJA 2A74B 4JY6B 2HH0L 1JGDB 2AJSH 1QSFE 3SGEH 1OOAA 4GRLA 1BBDH 3K2MC 4JFXA 4UTAL 1KFAH 4FRWA 3OJVC 5ETUA 1IAIH 1JHLH 3CLEL 4MSWA 1VGKB 2BNRE 2R39A 4QOKB 4YFEA 2VYRE 4Z7NE 1QBML 5TE6L 1RHHA 2FX8H 3ZE1E 1EERB 1I85A 4K8RL 3QI9B 5LWYL 1U8OB 1NFDB 3UTPE 4XP1L 1D7FA 2ZUQC 2CIIB 2OQJA 1MNUH 4JRYE 4O51A 2GJ6E 3BE1H 2W59A 2C9AA 1PG7H 1UH3A 3L5WB 2ERJB 1QG3A 3QG7H 1OAUL 5LJYH 3RVVC 2EYTB 1JWMA 1I8KA 3AS3A 1RJLB 3B9KD 5IJVA 3RZWA 3UTQA 3W2DL 3FO9A 1MWAB 4QY8A 1ZLVH 2VZ3A 1IGYA 2R4RH 4MDIB 3RDTD 2EYSB 1J7VR 3UP1A 4W6YB 5IKCB 3LQAC 2DJSA 2R1YB 3EDJA 3T4AA 4NYLB 1VACA 1KJ2H 4K23H 2HLAB 4GXVL 2A6DA 1JYWA 4XRCB 5E6IC 4WDIA 3BQUC 3LDBB 3TNMB 1E28A 1FDLH 3JWOH 4MGXA 5FM5M 1FVCB 5FYLD 3QEQD 4K71B 5C0ND 4Y1AB 3HAEH 3ILQD 1X4YA 2LV4A 1B88A 1FNEA 1ZT1A 1R5WB 5CFHA 4NZRL 5D1QA 2O5XL 4BH7A 3VCLB 4X7CC 3TJHC 3P0YL 2A6KA 1JV5B 2PTTA 3UMTA 3QRGL 1BQSA 2JJSA 4N8VB 5EU4A 3ZKMC 1D3CA 4KI5E 4LSRH 1HZHH 1UXWA 5HHNB 3OJ2C 4KZDL 2NX5A 4PGZA 1DQDL 4WTZG 2V6HA 5MI0B 4D0CA 3K4AA 5I30H 3CFCH 4L3ED 2OX5A 4MYWB 1V3KA 4URTB 4PLNC 3D9AL 2R2HB 3PL6A 5TJWK 2NTSP 4R8WH 2NX5B 2WANA 4H8WL 4PP1D 4MHHI 1RZFL 4P2OC 1BWWA 1I1YA 3NFNA 2VIRB 3FFDB 1L7TH 2VL4A 2Q86A 1WLHA 2NW2A 3ARYA 4CKVX 5C08E 1SEBB 4OJFL 3HZMB 4PREB 4JQVA 4LLDB 3BPLC 4PJEE 3KLHC 1DBMH 5SWSA 5K9OB 2Q87A 4DW2L 4YBLB 4YHKH 3F7QA 3WIIH 4UOW0 2RGSA 4Z5RB 5ANMB 5E2VL 2Q86B 4R7DB 3IDGA 5D5MA 1AQDB 1UB5B 5H94A 2Y36H 2VXSL 3D1MC 2QKIB 3OHXA 3TNNA 4UNTA 3GIVA 3K1DA 4XTRC 1RI8A 3HNTL 5JO5A 1I9IH 2COQA 2AI0H 3ROOA 3PP4H 2NY2B 4JPVL 4NKMA 4KJQC 2X1WL 3GJFH 3KR3H 4Y19D 5DMIL 2BNUA 4Y16D 2OP4L 2PXYC 4UINL 4YIQB 5C92A 2UZIH 1MUJB 3ARSA 3MBXH 4JFXB 2GEEA 4WWKC 3FL7A 1HH9A 1UZ8A 2GJZA 4PGBB 1KENL 3RIFF 5IVZA 5GIRB 2P8PA 2VXUH 4NQVB 3LS5H 3SDAA 4XP4L 3MLXH 4HK0B 4X6FA 4ORGB 5E94B 32C2B 3TF7C 1L6ZA 4YC2B 1XR8A 4MXWL 3ULUC 2Y25A 1ZHKA 1B90A 2XYCA 5I18H 2WWKT 3LOWA 4RMUA 3WHE1 4Y2DA 5ACZB 5D1XC 2VH5H 2EH7L 4XPAL 3EYOB 3CCHB 4JKKA 4N0RA 4PRBB 5TDPB 4CGTA 4HS6A 2O61A 3H7BB 4L8SA 2P5EB 3QUKA 4P3DA 4MNQE 1GAFH 2ARWA 4P23D 1RZ7L 4C83A 4ZQKA 1K8DB 1JGLH 4OLVL 2AJYL 2EKSB 4OB5L 1D6VL 3KPRE 2VISB 3IXAA 1K8IB 4U7MA 4HK0A 5T5FH 3QJHB 4J3UA 5F9DC 5GS0D 1R3KB 2B1HL 4WW2A 2CIKB 2ESVB 2P8LA 3KPMB 4NSKA 4UI2A 5DYOA 1CK0H 4PV8A 1FCGA 3A67H 3MOAH 3MR9B 5GHWH 3TBVB 2NXZB 1S7VB 2A1WH 1WUNT 1BIHA 2BOBB 3CK0H 1ZHNA 3AXLA 1R3JB 2A73B 1TJIL 2MTPA 4AH2A 1L7IL 2BDNL 1N6QH 4YNYA 4XWOD 5DGQA 5JXED 3PNWB 5BS0A 15C8L 3F6IA 1R3IH 3CAFA 1R3IL 5I8KH 2ADIB 2I07B 4M4PA 1HDMA 1E27A 3NCYS 4PB9H 3BKYH 3O8XB 3IFPA 1HQ4B 5E2WH 4PY8J 3ARGB 3FQUB 1A64A 2XTJE 4IRJD 1RZKL 2A1WL 3CFEA 3VFRB 2GCYA 3EO1B 3A67L 5E7BA 3SJVB 4R6UA 2YPLD 1U8HA 1P4LA 1NCUA 1DEEA 4P3CH 4PV8B 2B1HH 5TPWL 3T2NL 4GFTB 1FH5H 5D2LF 5KS9F 2ADGA 5F89A 1ZLVK 1AJ7H 1F02I 1EFQA 3DETD 4WTWA 4E41E 4FP8L 1WT5C 1QSEB 1WGOA 5TE4L 4L4VA 2Q7YB 3TBWA 4PRAB 5F7FA 4OF6A 5DJZB 5IHLB 3ULVC 5CZXD 4UMGA 4ZSOE 3PIQB 3DURA 1VESA 4Y1AD 3VXPB 5JPNA 3BZ4A 2WBJD 1DUZB 5CJQH 2RAMA 8CGTA 1OY3B 3QULB 5F44A 3B6SB 3KYNA 4I0PC 4WI9A 2GY7B 4XP4H 2XN9E 3KHQA 5LQBH 1H3PH 4GW1A 1N64L 3LS5L 3WCYA 3Q1SL 3RP1A 3WFCH 2D9CA 3SDAB 2VXUL 4X9FA 3LKOB 5GZOC 3UTSD 4IMKA 2ZJSH 4UV7L 5FAAA 5J0BA 4NT6A 5HHVL 4YX2L 3RWHB 4CL7A 4ZMAT 3T08A 4PGBA 2JELH 5T3XH 1AGCB 5HGAB 1UH4A 1UJ3A 1CDYA 2IMNA 5F7DB 1SMOA 4KI5C 5KG9A 2VQ1A 1T5WA 4PYGA 3SE4C 2D2OA 4LF3B 5C0AD 1NUNB 3LKRA 4RMWA 4OCWH 3PP4L 2D4DA 3MMEA 3IU3A 2QR0A 1ZGLA 4KDVA 4FTVA 1T89C 2MPAL 2G75A 4NQCD 2ZCKL 4X5LA 3U7WH 3MC0A 3NIDE 4F8TA 5ESQA 2VXSH 2ZSVA 1JNNH 5C0JB 3BP6B 2PO6B 1YQVL 4KHTH 1ZTXL 4NBYB 2BP3A 1F8TL 4M5YH 1EEYA 3OGCB 1KIPB 5FECA 4G80A 3VXQA 1C12A 4YR6A 5KVDL 3QPXH 4W4OA 4NKQB 1FFNA 1DR9A 1JTTA 1V5JA 5IG7B 3ULUD 1IM3B 1DBML 3MRNB 2OZ4H 3UTPD 4U49A 2ARJB 2BSSA 4L8DA 5D1XD 4G6JH 1A22B 3IETA 3V5DA 1OD7A 3MRRA 4BQ9A 3B8SA 4QHUB 1YQVH 5IUSA 2C4FT 1Z9MA 2J5LB 3DBXA 3GSNL 4FFZH 2MPAH 5EC1B 3OR6B 1IGTA 3G5VA 3IJHA 2ICWB 3V5HB 4LNRA 3QHFH 1AP2A 5DJ8A 5CEZE 3MLSL 3MO1A 5C0IB 1CICD 1D5ZB 2R2HA 5D6DA 3QDGD 2DICA 5F71A 3UROR 2DQIL 3I3EA 4PJEB 4ERSH 5JHDB 2J3SA 4OZHF 1DQDH 3N9GH 4KZDH 3NGBC 1T3FA 1YMMB 2JIXD 1PD6A 1CL7I 4LSRL 1NBZA 3LMJH 1MJUH 2HT4D 4NQCA 4LFHD 4ZS7H 4EN3D 1F4HA 1W72H 2P42B 3L5XH 1DTUA 5DFVC 1KNOA 4JANB 1OAKL 2H41A 1IEHA 4F9LC 4NZRH 2E27H 4L3EE 2JJSC 4JPKH 3WFCL 4OF8A 2X42A 4KKCD 5FA3A 5LQBL 5L8KB 2EO9A 4UNVA 1HHIB 3D25A 3RPKA 2X4OB 4LEXH 4LSTL 2P8MA 3WXVL 4PS4H 2R56H 5ITFA 4JFOB 4Z7VE 3N1GC 1Q9KA 3BVNB 5FYLE 1OT1A 5CHNA 1CDIA 4BFIB 3UTSA 1FYTD 1A3LH 1A9BB 2R29L 3GMRA 3I75B 5B3NA 1QBBA 1U58A 4HKJA 2R4RL 5J89A 3O4OB 2LU7A 1AIFB 1KJMB 3MJ8A 4U2YA 4OLXH 5SV3A 1ZGLM 1Q9LA 5EU3A 4PJEF 3EZJB 3ZKXC 1YEDA 1AC0A 4P5TB 2DM4A 4EI5C 3SCMD 2MFNA 5CJXC 4EXKA 2IPTL 4PYHA 1CFQB 4JLRB 1R3HA 3GSXB 4NO0B 3ZO0A 4C54A 1VDGA 1J10A 4HSQA 3VXRE 4Z6AT 4X5WB 2EDLA 4XP1H 3WUWA 4M02A 3IJSB 3UDWA 3BKML 3O3UN 1JN6A 1XR9A 4R9HA 2GTZB 4IRSC 1FZKB 3RQ3A 3D2UB 4HKXB 3RWGA 1MFBH 4HIHA 4L9LC 5TF1L 3BH8A 4NBXB 2VQ1B 3BPCB 2F5AH 1B6DA 3DVNB 3LKPB 3BPNC 1J8HD 3I6KA 1S78D 5I8KL 3WSQH 1IC5L 3CPLA 4X99B 4QOKA 1NGZA 3E3QE 4P2QD 4WW2F 3RWHA 3A0OA 5ID1A 3TC9A 4Y5YA 3OG6B 1FFPA 4GKZA 2HH0H 3VG0L 3QQNA 3ZTNL 3L6FB 1FL3A 1IC4L 4BA8A 4LQFL 4J7RA 4I9WE 5DMGD 5EU5A 3HRZB 3EZ8A 4XCCL 2QQKH 3QDJA 1HI6A 5LXGH 1GVIA 1D6VH 1F3JA 2QQNL 4OLVH 3RPIB 1KPUA 2BNRB 1WWBX 2W65B 1QFWH 3MROB 3MYJA 5HI3C 3RKPA 4K7FA 1JVKA 2E7BA 4NWTL 1ZHBA 1X5IA 5IFJA 4AMKH 1JPFA 5IGXH 3MRHA 1TIUA 1A47A 2HN7B 1YEFL 2EH7H 4XPAH 4FQJL 4D8PB 2FHFA 5EZOH 4EUPA 1T0NA 1WTLA 1FFPB 2I24N 5J11C 5EPMB 2D0GA 3SDYH 2DYPD 1E6JL 4RGND 4JFQB 3NCJL 1AXIB 3VFVA 4LLVA 3QB7C 3FTGA 3MFFB 4RCAA 4WV1B 4YZFE 1RUQL 4Z7UA 3V2AR 5BRZB 4WFGE 3WFDL 5GS1C 1BZ9A 1FO0L 4F7MA 1YYMH 5JW4R 3BDYH 4KK9C 4PJ8C 5AAMA 3ZKNC 3TLRA 3MRDB 4DN3H 3FT3A 4Y5YC 4H0IA 5GS0L 1EBAA 2YPVH 3TBYA 1UACH 2CKBL 2DL2A 2XZAH 3EOTH 3HFML 3GSUB 4WJ5B 1N5YH 4FZEH 2ICES 3VWKD 4ZUSA 4OKVB 4NRXA 5AG9A 4CN6A 2OP4H 5DVLA 1C16A 2F53B 3EO9H 3LZFL 3VH8B 4HV8A 4U1LA 1B0GB 1KIUA 3VDAA 5D2LB 2BSRA 3MZGB 2DJ4A 2WUCH 5D7IA 4HDIA 3U4EB 3HI1A 3EJYD 5CSZB 3KJ4B 1MCFA 4HKZB 4Z7OF 3C6LD 3S35X 1D9KC 1R3LB 5EBGA 4F7TB 4MLSA 3OB0H 4HT1H 4LOUC 5EIVA 3VJ6B 3ME0A 5C8JA 1BZQK 5JDJA 1C08A 3EJZC 5DXWA 3ARRA 3WIIL 3REVA 4GMSH 4Z76B 3NPSB 4MD5B 1JGEB 3IDYB 5F3BB 3DGCR 1QP1A 2IAMD 1MCPL 2Z92A 5B8CB 1EBPA 4BKLA 4TN9A 5FGBA 4OUOA 4YAQB 4K94C 2OSLB 4LPVA 2OLDA 4S1SH 1FL6A 1PLGL 3S98A 1NMBL 3RTQA 1WK0A 4RNRA 2V5RA 5D6CB 1O5DT 4LCWE 3KLDA 1WICA 4TSAH 5I8OH 3BN9D 3HLAA 4FQ2H 1F4YL 2NY6C 1A8JH 2XICA 3WJJC 4H8WH 1FFOA 3V4UH 2RJMA 2BVOB 5GGRB 5FOBB 4HIJB 2F5BH 4N1HB 4G6FB 1EMTL 5IMLA 1D6EA 3L7FA 1E4XH 1S7SB 4PJXF 1ZSDB 5D6DC 4YWGL 5IVZB 4Q58C 1ZLUK 1RIHL 4PY7A 1GC1H 1MJ7L 4LARH 4L4TA 1HZHL 1F00I 4N0CC 4Y1AE 4JCLA 4Y5VB 1AQKH 5GS1A 4O2EA 2H9GA 1S7WA 3N1PC 3ES6A 3UPCA 3G04B 4H88L 1X5HA 4CAGA 4NJ9L 1IJ9A 2Z9TA 1NGXB 1FLRL 4NM8L 5T5NF 3HZYB 3O2DH 3QXAA 3MJGX 4WY7L 1CU4L 3B9VA 4Y4KC 4X5XB 5DJ8B 2C4FU 4L8BA 4HC1A 3UAJD 3MJ9A 4G80B 1FDLL 3JWOL 3ZL4H 1K9TA 3CMGA 5KVGL 4R7NA 4AEHL 4AIXA 4AYFA 1ES0B 1YY9C 3BP6A 4RGOL 4YHNA 3BZFA 4PY7B 4PUBL 1U8QB 4QOKE 2XRAL 4R7NB 4P4KD 4M7LT 4M48H 5F72S 1TZIB 4L8BB 1F3JB 5A2JH 1N3NA 3PABA 4WTXA 2MMXA 2YPLA 1WSST 2WSKA 1INEL 4U1LB 1OAUH 2Z0BA 1IBGH 1OAXH 5CZXC 4G8EB 3QXAB 5KSAA 5I1KH 3IDNB 2P48B 5ABDE 3H3PL 3DXAD 5EORL 3MV7A 1R5VB 4JRXD 1CD8A 1MNUL 5I8CB 1E4XI 3K80A 4OLEA 1KCVL 4UDTB 3BP4B 3BN3B 2B1AH 1JHKH 2NY0D 2OXGA 5GGTL 5JHLH 3KJ6H 2ERJC 1BIIA 4QHLA 2YEZB 3OXRA 3U46A 4U1MB 5TE6H 4OBRA 1KC5L 1SM3L 5L8JB 4R97B 1G6RA 2BK8A 1RAMA 3I6GA 4DKFH 4OCLC 3LHPH 2VSCA 3HB3D 4DZ8B 2ZUUA 2OXHA 2PR4H 3CVHL 3DWTA 4LCWB 3MRFB 3DRQA 2XTJB 3MV7B 4HKZA 1LO2L 4Z7VA 4O4YL 4ODXB 2Z4QB 1CFNA 5K9QI 2AJZB 2G5RA 3BDBA 4RBPH 2NY5H 3V6OE 5GRWA 5D2LA 3B6SA 3MA7B 1QYGL 6CGTA 4OM1H 3ZHLA 1Y18B 4CMHC 5DUPL 4QHKI 3LKSB 4AEIL 4HJ0D 1CI5A 3ORJA 5C0RL 1KJMA 1NDMA 1DLFL 4Y2DC 3QAZB 4Y89A 4IJ3C 3RNKB 3T0EC 4ESKA 3V9FA 2DQJH 4JHBA 4RFOL 2IMMA 3E2HB 1D5BA 4AM0B 4AIZB 1NCCH 4FN0A 4L4TB 4LDOB 1MWAA 4Q7DA 1NCNA 3IU4H 3AMLA 1IQWH 3PWUB 1X6LA 4ZYKB 1A4KA 2AJVL 2QR0B 3HNSH 4QNPE 1X5ZA 1I8KB 3QJFB 4WFFE 5JDSA 1QBLL 1G7PB 3TJEL 1P53A 4HIJA 5IB3A 1FLTX 2JJVA 2BVEA 1JE6A 3DHMA 3WL9A 2X1XR 4WCYL 2HWZL 2J8HA 5DJ0B 1TETL 4MS8D 4OLUL 5DURD 2BHZA 2APTA 5E5MA 1U41A 5K9KB 4KFZC 3FB8B 1CICB 4Q6IB 4KJPD 3VXUB 1DSFH 3HMWL 2ZG1A 5HI5D 2EC8A 1S7SA 4P23C 4M6AA 3B2VL 4KPHH 4N8PA 3IFNL 4YHLH 5CBEB 3L3DB 4L29B 1RMFH 1MHHB 1P4BL 3KLSA 3C5ZD 2VDLH 3JWOC 3RX7A 2E6QA 3W0WE 4HZAA 1K5NA 4G6KL 4NN7C 2EDNA 5TDPA 1I3RB 1KSRA 4ZNEA 3O4OC 1NLBH 5EPMA 5CIPH 5EOTA 4I3RL 4KVCH 5EU7C 5FM5O 1FYTE 5C6PB 2DD8L 1HYSC 3GK8H 3KPMA 2A9MH 4D9LL 5I71C 1K5NB 2FH8A 1GSMA 3CX2A 1E4WL 3HE6A 3W9EA 5JXEC 3REWB 4OZIA 4Q9RL 1K3ZA 4C56E 2N7BA 3ZYOA 1UKTA 4YR6B 4MAYC 4S1RH 1GGTA 5LBSH 4DN4H 3P4MA 4HIIA 4R96B 1EH9A 5IW6B 3WFEL 4ZFOA 3L95A 5FUOH 4JQIL 3SQOH 1U91A 5JIPA 1WTGT 2G2RB 3L1OH 4KTEL 3RWJB 4Y8DC 4GAJL 5JPMB 5H2BA 4JKPH 3IFLH 4OZHE 1V3LA 1QRKA 5EIIB 5H37G 4KRMB 3RWFB 4QRQA 5EN2A 5I1LA 1R0AL 4JY4B 2YD5A 2ZCHL 4Y5VC 1OP3K 4JR9L 7CGTA 2BXYA 3WIHL 1CTOA 2E8YA 4EI6B 1RUPL 1U8KB 4OKVA 1SBSL 3ROLA 3V4PH 3DIFB 4A6YL 1KJ3L 5FO9B 1QLFB 3B9KB 4H1LB 1A14H 4EJ1C 2XKSA 3D0VA 3QXVA 2DQUH 2D03H 1GZPB 4HIEB 3SDCB 4Z5RA 4YIQA 3OKKB 2A6IA 4HKBA 4JO2H 2R2BB 4MA1C 2P5WE 5K9OA 1BQUA 4IRJA 4YGAB 4PJAA 5DRXA 1CDUA 4H5SB 1T22B 3BD4A 3HKFA 4GG6A 3C2SA 4XNYH 1VPOH 1CFNB 1U8JA 2CDGA 2ORBL 4RAVA 4YDIL 3RZCC 4RDQG 3S8WA 4GMTH 4KGJA 3ZE1F 1Q8MA 4XNMA 4PJFA 4GRMA 2QADB 1DL7H 2EEAA 3G08B 3A6BL 3IDYC 4X99A 3X14A 3MROA 3F7YA 1JGUL 3WIHA 4DKAA 4PLOB 4C4KT 2QHRL 2QQLH 4HMCA 1AXTL 1FFOB 3SE8L 3CC5A 1A4KB 4BQ8A 3LKQA 1MJ8L 5FDWB 2FBJL 4PJ8A 4HWBL 3MRRB 3RI5F 4JDZA 2X4PB 2KDGA 4OIAA 1FORL 4R2GC 1NMAL 5EULV 3SE8H 4UOW1 3UC0L 1KXVC 2VAAB 3ARFC 4NKIL 2XQBL 4KZEL 1KTKE 4ZFOL 1A3QA 3PXJA 1MAML 3QQ9C 4XI5C 4XAKD 5B4MC 2PF6A 1YNLH 4NC0B 4FQ1L 3P9MA 4MB3A 4G8GA 1B6UA 1A1MB 2DYPB 1EEYB 3VXSA 5ADOH 5IEKB 3IDIA 4EIGB 1JGVL 1FJ1A 4MDIA 1D5IH 5GPRA 1KELH 5EA0L 2Z31A 3V5DB 1Q72L 3QJHA 4HCRL 3VMOA 1EO7A 4J6RL 3E3QC 4F58H 3ZE2E 5C0AE 3JBG7 1ONQB 2ARJA 3R0MA 3PWLB 4WWKD 3CSPA 2JB5H 4G9DB 1OQXA 1CWVA 4TTDC 5IOPA 4HFUL 1U8MA 3I6LE 4U6HA 1FJ1B 1EEZA 1HCFX 2ADGB 2JK5A 4HWEL 4L4VD 4GW4B 3MXWH 5J8OA 4KMQA 4ZUUB 1J12A 5JW3L 5GRZA 5CGYD 4L3AA 3OKLB 4TULH 2YPKB 4MAUH 1CXHA 1NLDL 4B5EA 3VW3L 3T0AA 4JFOA 1KCRH 2MCG1 4RMRA 1N26A 1SBSH 1P4IL 3WDHA 1RUPH 5F88B 1S5HA 2AV7A 3D25B 1HDMB 4MQXD 3C2AH 4HUWA 5FA3B 3ZDXE 1KIQB 2IG2H 5ENWB 4Z7UB 1NBYB 4I1NB 2D0FA 2ZWLT 4DKDC 3QDJD 2KKQA 3NCEB 3O4LD 4DZBA 1S5IH 5HI4C 5I16A 2V2XA 2CSPA 1WZMA 3H9YA 3KXFB 4DK6A 1LE5B 4U1IB 4BSWB 3IFLL 4JKPL 5TDOA 5EBMA 3LKOA 4PRHE 2IPUG 1T7YA 1LHZA 5FUOL 3HZKB 4JFFA 2OSLA 1AXSB 2NTFB 2HLFD 4FFVC 5LBSL 4DN4L 4EDXB 5FGCE 3EBAA 5DA0B 4MNQD 1CDJA 1HYRC 4W70A 2CUHA 4XNMB 5I8EB 3BAEL 4U1KA 3F5WB 1BFVH 5ICXA 43CAA 1FGVL 3QO0B 3V0VA 2IAND 3RWEB 3SDDC 1IAMA 1VCAA 5C0JA 1FG9C 4WI4A 1RZIA 5F1KC 1NLBL 3DXAE 1R24B 3ZHKA 3HE6D 5EUKA 5KVFH 4KK6D 4AJ0A 5DJ2B 5D7LB 4LSVH 4GXUN 5F8RC 3CXDL 4RGMC 4DFHA 3VFNA 4IBLT 5GGSA 4H26A 4Z9KB 3U9PL 2WWMD 5B8CC 4DUXA 3T0EB 1NSNL 2Z93A 2CKNA 5IV2A 4NQEE 4ZTOL 4XNUH 3QISA 5I1DA 3HMWH 4OCNC 3AXLB 1INDL 5D1ZA 4CADA 4L3EB 4H1LG 1S9VA 2I26N 4P9HC 4WWKB 1DJSA 2UUDK 5IM7B 2F8XC 4WCYH 3GSOA 3IFPB 4IMLA 5I73B 3V7MA 1IQDB 5GGVY 5DEZA 1GOHA 4QXGL 4Z7WE 5F1IA 3SDCC 1BQLH 4IIQA 4LSUH 1PX4A 4FQHB 1KB9J 3GMNA 2FBOJ 5D7KE 4HAFA 5IWLA 2FEDC 2OR8A 2DLHA 2PN5A 2V5TA 1XGTB 2GK2A 1X5XA 4QF1A 3MV8A 4PTUA 4E41D 4ONOA 2O26U 2DQJL 1ZLSL 3RVXD 3WS6C 4JPIA 5D1XB 3PP3H 4HZLA 4ODTL 2B4CL 4NQED 1I7UA 1QHPA 4OLYL 2P8MB 5IFHH 2YBRB 3DX9A 3U0WH 3OAZH 4L1DA 1XAUA 3NCBB 3UYPA 1MWAH 2PTUA 3EDFA 2HVKA 3OPZL 1MQKH 3A6OA 3CVHH 5EUOB 1A7OL 2HKFH 1PY9A 1FIEA 4GBXD 1XF2B 4JM4L 1FZJA 3T0DA 2N7AA 1BZ9B 1PW3A 1MFEH 2W1NA 4G8IB 4DKFL 2DWEB 4FFYL 1C1EL 1LQSR 1DZBA 5DVMA 4XX1G 2VZVA 3QNYA 4ZG1A 3S3PA 4NKMB 2AAVA 1SJEA 1OF2A 4LLMB 5JHLL 1MCOL 4HBCL 5ICYA 5DC0A 2VLRD 3QDGA 3WS3B 1OSZB 5DEGB 1URLA 4U1SB 4N1EA 5IJKA 1IAII 5E7FA 1KLGA 1NGQL 1HKFA 4RDQF 3AREC 4M8QA 3RAJH 5LAXA 1WCQA 5F7EH 1CE1H 1WCBA 1H15B 3EOYG 4DGYL 3X13B 1IFHL 3UZEA 4AG4H 5IBLD 5KZCB 1ADQH 2ADJA 4NJAH 4JJ5A 4HLZG 3QZWA 3MFGB 4XXDA 1RJZB 5IBUG 2XRAH 4YXLH 1PSKH 3ESUF 4JY6A 3HUJB 3TA3B 5BQ7A 3V4VH 1KCSH 1DBKH 1N0XL 4KY1L 3V0VB 5F96H 1NDMB 2EYSA 4D9QE 4FFWD 4RAUB 2Y6SD 1T6VN 4QY8B 5KVGH 3UXFA 1B2WL 5EO1A 3VFGL 4LHUG 4Q9BA 1I1AC 2X4QB 1H3GA 2Y5TB 1MHEB 4KKLC 4JZOB 5TFSH 3QR2A 1I3UA 3E2HC 5DEFB 1CLOL 2K3TA 3EYUL 1FVDB 4Y2DB 5ACZA 5EU4B 1RZ8A 4U6VH 2YOCA 4WI7A 5C6TH 1MJ7H 4LARL 2DYPA 2YA2A 3T0EE 2IGFH 1T3FB 1YMMA 4EXPX 4N0YH 1N6UA 4GG6E 2M26A 5CJ5A 2AEQH 2DM7A 2BHUA 4YO0A 4ZUVA 2EDQA 4KQ4L 2Z8SA 4FQ2L 3WYRA 4JFPB 4HWZB 5D7JA 5BV7L 5IT2L 4ZUUA 3W82A 2GK0B 4RIRB 1KGCE 4GS7B 4ODSL 1P7QB 2BC4A 1XF5B 1EFXA 1S7RB 4NQUA 3ZHDA 4JZJC 1N3NB 2AQ2A 3OZ9H 5J7CC 3MRLB 4FNLH 4P2RA 4P23B 4JKLA 3D3VB 2ZKHL 4YGVB 1IM9A 5E9DA 1KB5H 1W0YT 3D2UD 1K4CA 1MFCH 5T3ZE 2VDPL 4JRYB 1GGBL 3IXTB 1S78C 4K07A 5TF0A 3VI3E 2WW8A 2HMIC 2GCYB 3ZYZA 5CCKL 4APQD 5F9WC 3MRQA 4EKXA 2AEIT 2R69L 2X4RA 4UB0H 2WBJA 5EU7E 3FAXA 3QEGH 1X7QA 3RBGA 1M7XA 1P6FA 2CGRL 2PYEE 5EU6D 1UZ6F 2R1WB 5I15L 2R2BA 4MSWB 2A0LC 3H9HB 3JWDC 3JTTA 4Y4FA 5JA8B 1WCBB 2Y7QA 2EIZA 1IEBA 1N5YL 3MLZL 3EOTL 3HFMH 2QSCL 4MMZC 3NVQA 3ARXA 5CILL 3X17A 1GGCH 3L5IA 5KBNC 4HFWB 3N85H 5T5NG 3IAQA 1VKXB 1FO0H 3C9NA 5K9JH 4N5EC 4UQ3B 1YNKH 3OXSA 1BAFH 3SCMC 1ND0A 3DMMB 1SY6L 1NFIA 1KV3A 4P2RD 4IRZL 4XRCA 1KPVA 1QEWA 1OL0A 3SPVB 5AWNL 3ZT7A 3RGHA 1YEFH 2UZYB 3MLPA 2YK1L 3P4NB 4JZOA 3O45B 4XC1H 5C0NC 1NMCC 3WLWD 2CXGA 1CGXA 1JHTB 1TCRB 1FRGH 3G6DH 2EO1A 2B2XL 3NZHH 1YMHA 4XCYA 2NY2C 5EO1B 5KG9B 1IQDA 1OTUD 5GRUH 3FT2A 3SDDD 3G6JE 5I74C 5GS2D 1FPTH 3RY6A 5ISZE 2BFVL 4NM4H 3ZTNH 2R8SH 3Q6FB 3MV8B 5C08B 2AGJL 1M7DA 1IGYB 4MJ6A 4YHYC 3MLUH 3C60D 3QDJE 4BQ6A 1OM3H 4YO0B 4ZUVB 3N06B 2NX5D 4TUJB 4TSCL 3SOBH 4J2XA 4R3SB 4G9FB 5MEPB 1BF8A 1EHLL 4OLZL 4P46B 1G9MC 1G7HB 2LAAA 1LMKA 3AREB 1T7XA 5DRZB 4YHPA 3FMGL 1T1YA 3LEXB 1N7ML 2X4PA 4GSDL 4R2GB 4GAFB 2YPKA 4C55A 3NTCH 1NFDF 2HTKC 3SGDH 4QYOB 4MA3A 1VERA 1T0PB 3IXTA 4UV4H 4L4VB 1EV2E 1EZVX 5DJ6A 4R96A 4X0KB 2ZOKB 1BVKB 2YBRA 4PPTA 1U8MB 1QFPA 2XWJA 5E00B 4FXLA 3O8XC 3QDMB 4HUXA 3TCXA 3REWA 5DFTA 4PGDA 1ZANH 1QFOA 2FJHA 4NZTH 5HYQA 4LSQL 5D7IF 3BISA 1DEEB 4M1GH 3F12B 3HE7C 1Q1JL 1I9RL 2OL3H 3ZDYE 2PYEA 3KYAA 4X6CF 1B0WA 3VFSB 1HXYB 2F19L 2LTQB 2NXZC 3RU8H 5FV1L 4WV1C 1WISA 4NQSB 1KIQA 1P69B 3PWNA 3HA0A 1N6VA 2I07A 3KPNB 5CGMA 3GKWH 1T66C 1U3YA 4GAYA 1CXEA 2PCPA 4K8RC 3C5ZA 5E8NA 4DGIL 5C0EA 1FFQA 3VXMB 5FEBA 1GIGL 4X4ME 4NZUH 4LDLB 5EBMB 3UBXB 3K7UA 2AS5M 4MCYB 4YEEA 2FNBA 4N90D 4FA8A 3MCG1 4ONHB 2GJZB 1SJEB 3HI6L 5DUBA 2AJUH 4ZXBB 3QI9D 4JDVA 3ULVL 3E8UL 4HPYL 2GSIB 1A6TB 4P49A 3QJFA 1S5HB 4X4YB 2GTZA 3BW9B 4BQCA 4YHOL 1P1ZA 5EBWA 3TYGH 1H5BB 3GHBH 1LDPH 1BLNA 3T09A 4WWKA 3SO5A 1D9KB 2G60H 5FKAB 2M8XA 3PHOB 3TPKA 1MF2H 4WI8A 4XC3L 3SPVA 1AQDA 5H94B 3OQ3B 5CJBA 4LP5A 5MHSE 3ARGD 4OCXL 2M1KA 4H1LH 1U3ZA 1F97A 4OI9A 4Z7WF 5C2BH 4NQTA 2QSTA 3EIFA 3T0EA 2P47B 3PDOB 5IB4B 4JHWL 2OZ4L 1CBVL 2NTFA 4EDXA 3VU2A 3CVHB 4ODBD 3K2UH 4U3XA 3K4ZA 4JGMA 2VABA 1NAMA 1C8PA 1WBZA 1UWEH 2G5BB 4I0PB 2WQRA 3TT3H 4POZD 2V2TB 1OB1A 4QGYA 4X6DB 3MGAA 4UDUB 5K9QG 3FRPG 4MA7H 2AXJA 3U7WL 1JPST 5I19L 3PWVA 3P9MB 3G9AB 2XY1A 3KNBA 2DQHH 4OCWL 1TVBB 1WIPA 2AVGA 4RZCA 1KOAA 3P77A 2WM0A 4HMEA 4NNYB 1EUTA 3ARPA 3GMMA 3L3GA 1IT9H 1S7XA 3D87B 2P4AB 4HWNA 3LN5B 5E5MB 1M6OA 4K3JL 3EOBA 4JRYA 4XMKL 4N9OB 2ZJSL 4NNXB 5I73C 4XVUC 2A74A 4NRYB 3LPWA 2PO6C 2XFXA 3L95B 1DFBH 4PRIA 1N64H 1OCWL 3ARZA 4U0RC 4IHOA 4LSDA 5JW5A 1XGQA 3CDGA 4HS8L 4CDGC 1AGBB 3HE6B 3Q3GA 5DHVA 5L0QB 4KKBC 5DMGC 2A77H 1LK2B 1LEGB 5DSCA 3LIZH 2BOCB 4LOUD 1GGIL 4PJHA 2WP3O 3S88H 2ZG2A 5HI3D 4F3FA 5L2KA 4ZAKA 3VE0B 1D5MA 5FYKH 2D7OA 1L0XA 3PL6B 1ULVA 2R0LL 3F62A 4FZ8L 5JLZA 2Z8VC 3HMXH 5IQ9B 2KZWA 5DJDA 5DK2A 2BERA 4FQCH 1C08B 4M93C 5C0GB 1RK0B 3RX8A 2MOVA 1RFDH 4XMKH 1FH5L 2XN9A 4G8GD 4KQ3L 4PGEB 1SYVB 5TPWH 4UT6L 5E4EC 4NFBA 3BKJH 3DV6B 5D8JH 5GISL 4PG9A 5DD6A 5DURB 3O4LB 4LFHG 3EAKA 4MD0B 5F3HA 4MCYA 1BFOA 1GL4B 4ODVL 1EO8H 3QFJE 3ARFB 4PJ7B 4EI5B 5EOCJ 3W9DB 1TZGL 4XP9L 5BOZG 5F97E 2A0LD 4YDJB 4M4RA 2Q8BL 2X4TB 3NCMA 5HJ3B 2BDNH 5EUKB 4MA7L 1TJIH 4FTVD 2R2CA 3C8DA 2OM5A 3FONB 3LH2L 5GRVL 1IVLA 3T0XA 3MOAL 4KGLA 3CC5B 1IAKA 1JNJA 3NCFB 3FHAA 1JRHI 1J1PH 1RJZA 4ZODA 2Y07L 3CFDA 4WGWB 5D2NC 1W0WA 4I13B 3EJYC 3P9LB 2MKLC 1RZGA 2X4NA 1UB6B 1T2XA 3G9VA 4KKNA 3T8XA 4RGNE 1ACYL 1MLCB 1RZ7H 4WTZA 1E4KA 1W72B 1F58L 2QBWA 1K6QL 1HHHA 1ES0A 1AO7B 3VFOA 1X44A 4G8GB 3GRWH 3LN4A 3TYGL 3PL6C 4IEFB 2YC1B 4YHOH 3G6JA 1XGRA 1NCDH 5TQ2L 2XI9A 1MLCA 3TESA 4F7EB 5D93C 2BNQB 2FIKA 3O0RL 5DHYB 5KSAD 1QLEH 1RZJH 1SEQL 4ZSOA 5J6GA 4X6DE 3HI6H 4Y5VA 4FFVD 1FO0B 1A1OB 2J5LC 1T0MB 2MCPH 1SJVA 4K7PX 1QPPA 3CFEB 4PRHB 3GHEL 2C3VA 1M7DB 4MJ6B 2FD6L 1OHQA 1MCIA 4LRNL 1PY4A 4NO3B 1R5VA 4CU8A 1LO5B 3TN0C 1MREH 4XNXH 1U8KA 4KJQD 1JYNA 3LSOA 4WW2C 3KR3L 1MIEL 3Q6GL 1J11A 4JPWH 2JF1A 4BM7A 3VMNA 2ARJQ 4XPTL 4Y19E 3RU8L 1ROWA 1H5BC 4BZ1H 1ETZB 1EX0A 1I9IL 2GJ6B 3DLQR 1OT2A 4D8PA 1I9RH 1BFSA 4LL9A 2FCBA 3NA9H 3QFDB 4KDTC 1EVUA 1NAML 5IHUL 2YMXH 4LSQH 4P57B 2XWTB 5CKGA 5H37H 4NZTL 3PV7A 3HCVA 1T22A 2VZTA 3VGFA 1ZANL 4F7PA 4RMVA 1QSZA 4LIQL 2X40A 2YD6A 4EOWH 5I71B 1GHFL 1IAIM 1HSAA 2WV3A 3T3PF 4HKBB 1KEGL 3MA7A 3C9NB 4HIEA 3PGFL 3HZKA 1R3LA 3L5JA 4JFFB 3DUUB 4M7JL 2B5IC 3BP4A 3E6HB 1EGJH 3FCTB 3D0LA 1JPSL 3ZE0E 4IRSD 3CVIH 4LAQH 1H3WM 1OAZL 5F70A 3TIDB 5MENB 2V9QA 4R8WL 3FQWA 3TT1H 1ZA6A 4OAWB 2FLBT 5KS9E 4X6BB 2RCSL 3WLBB 2EIEA 5JDSB 1SJXA 4K3DL 4MQSB 1X7QB 5JA9A 3RWIA 4U1NA 4ELKA 5DD6B 2AGJH 3OKEA 3RL2B 4NKDA 4D0BB 4JY5L 5ADPH 2AQ1A 4AIZA 3HB3C 3TCLA 1X5AA 1QACA 2F15A 3QXUA 5HBBA 4KKLD 3ZE0F 5GRUL 5DVOA 2W0FB 5J13C 4JFDA 4WW1A 4U0RB 3RIAK 3UEZA 2Q8AH 1LO4H 3QIBC 4WEBH 3W11D 4HS3B 4YUEH 2DQGH 2VLRB 2D7TH 4YHMH 1JJUA 1GPOH 4BUHA 4IRJB 4B0MM 5TQ0H 3HS0A 1CG9B 1MFNA 3QQ3B 4JGJA 4YK4B 5CGTA 4ISVB 1D5XA 4K23L 4CN1A 4Y16A 3BZFB 3UZQA 5GJTL 3DYOA 4NKDB 1QSVA 4XCEA 2QSQA 1VA9A 4RQQA 3PGCB 3UBXG 5I1EL 2F53E 5JQHC 3HE7D 2XKNA 4V1DA 5GSVB 2ATKB 1AY1H 4L8CB 1UC6A 4LIQE 1XGPB 2I60H 2NW2B 1S7QA 5DWUH 2NXYB 4Q2ZA 3FFDA 3TP4A 3BE1L 4M7ZB 4XGZB 5DK0A 3IRZA 5D4QA 4HXBH 1T04A 4Y5YB 1J8HA 1LP9A 2BRRH 4PJ8B 4GW4A 3L3GB 1XF3A 5H2BB 5BRZE 3P2TA 1UQSA 5C07D 1HNGA 4I4WA 1U91B 4QRSB 1IEAB 5T3XE 1JZ2A 5EZJB 2FX8L 4OQ1A 1EIBA 3MV9D 3IVKA 2V7NA 3OXRB 4TOYH 1GZQA 2VDKH 2DQEL 2R1XB 2XZZA 2B8OT 3MLWH 5CCKH 5L2JA 1IAIL 4F2MB 4FOMA 2E8ZA 3RGVB 4JRWA 4QXTA 4CNIA 4M1CC 2VDPH 2QHLA 4YFLF 2HTLC 3QCTH 4XAWL 3BKCH 5ILTH 2HN7A 4NN7B 4C59B 2JCCE 3SKOB 1E6OH 4JO1H 5E8NB 5I1JH 6FABH 3PV6B 3GGWA 4OCYH 5IQ9A 1XF4A 3IDMA 1T7ZA 4XHJD 2EECA 2NLJA 3I2CH 1AH1A 4ONGL 3BZEA 1Q9LB 5DRXB 1IGMH 2UYLA 3S35H 2J2ZA 3NCYP 3SKOA 4PTTB 5HY9B 4KKBD 5F1SA 3WE6A 4J12A 1H15A 3S5LG 3WDIA 4DCQB 1FQ9C 3MOQA 5IKCA 3BN9C 3QFDA 4D0BA 1TQBB 2FR4B 4N0FB 1H5BA 3VWKA 4FTVB 1YMME 5I1HL 1KJVA 5FO8B 1G7LB 3RGVD 2J12B 5EWIH 3BW9A 2LU4A 4NCC2 5CSZA 2ZP0T 2PXYB 4KUZH 3MLRH 3S36L 4Z77A 3NN8A 4AEFA 2IPUK 4XMLL 3SE3A 1C16B 2F53A 4YDKL 4DJMA 1T03L 5FKPB 3ECBB 1BOGB 2W0FA 2GI7A 1DE4A 5C07B 5FB8B 3EDKA 3OR7A 2VDNH 1AO7A 4JRXE 1AO7E 2NY5C 2PXYD 3O3AB 5FCUL 4P59L 5TFSL 3P0GB 4Y4HA 4AENB 1NL0H 3DX6A 1CLZL 1CFQA 4JLRA 1F42A 3WLBA 5GSVA 2VL5A 4LU5H 3OR6A 3QDGE 1A6AB 4APQC 4RQQB 1U8QA 4AH2B 3UJIH 4X6DA 4OQTH 2WUBH 5K93A 3MV11 1SYSB 3P40A 4U31A 3L3IB 1RUML 4MCZB 1AC6A 2A6JA 2DN7A 4UBDD 1A6ZA 2APFA 3RZCD 1ZE3C 3NABL 2DBLL 5IMOB 1ZEAL 4OIIL 3SJVE 1KPUB 2BNRA 2YSSA 4X80L 4JEGB 1A6WL 4GO6B 4JY4A 3ES6B 1CE1L 4E5XA 2ATPB 3QZWG 1MJJB 2DQDL 1G9ML 2ZSVB 1YN7B 1T1ZA 1FCCA 4X7EC 5FYJH 3GBMH 3EYFB 3QT2A 5K59E 2G2RA 3TPUB 3H6JA 4LLYB 3HTLX 2CK0L 4ZFOB 3OKDB 3MRBA 1ZLUH 1AFVH 4OCMC 2AXGB 3M8OL 4TNVK 4KMTH 4HWUA 5C0GA 3S34H 1TDQA 4FFYH 4BFBD 4QCIB 1JZ3A 1BX2B 3MACL 1U8IA 3GNMH 4OCRL 3WXWL 1QRND 4MAYA 5CJOL 2ZUXA 5I1GL 4ZUSB 4ZAKB 4CW1B 3P4LA 1MQKL 4NT6B 4R90H 4GG6F 1JPTH 3TPUA 2VDQL 3PP3K 1UG9A 2GTWB 3UBXA 4FTVE 1MPAH 1OGAD 3NZ8B 5E8EB 5HDBF 3L3KA 2Q7NA 4LASH 5EBLA 1TQBC 3ZLQC 1Q9KB 3BVNA 4FQPA 4OZGA 5HGDA 2BY1A 1Z9OA 4ODWA 4Z7QF 4IRJC 1AHWA 2R1WA 4H25B 3ZE2F 3VFWB 5I9QB 2X4OA 1YEDB 3N1MC 1PZUB 1NKOA 2BSTB 3TVMD 4EIZC 3RUGE 3HCVB 3QIBA 4LEOA 4FG6D 2FX7H 4PRAA 1XGUB 3EFDL 2JCCB 2Z4QA 1Z3GL 1A6UL 3UJTL 4JB9H 1MAKA 3K8KA 4PJBB 4U1IA 5FUZL 4C58B 1LK2A 5IVXF 1N8ZA 3OB0K 4DZ8A 1BOGA 4TTGA 3TBTA 3OXSB 3MRJA 4I77H 4U05A 4FABL 1I3GL 4NPYB 2VL5B 1N5AA 1YN6A 4APQA 3LEYH 5TE7H 1S9KC 5EU5B 1MCRA 4HUKB 4NQVA 2I5YL 4HKXA 5CIPA 2Y06H 4F80A 3PHQB 2P8PB 5E4EB 4U0QB 4ZYKA 4P2QA 5F9AC 3ZKSD 3QCVL 4L4VE 1VFBA 1DBAL 1INDH 3MRKB 4PJGB 2V2TA 2OK0H 5IFAH 1MHCB 3O3DA 3DGGB 1CQYA 3HC3H 3CU1A 5DGRA 3H9SA 3SEPA 5F6IB 3D39A 3GRWA 2X05A 5HPOA 2EZ0D 3DO7A 4HEME 4B53A 3L3OB 4EI5A 4LLVB 2DKSA 4ELME 4W6XB 5C7XL 4QRTB 5DJXB 1RHFA 1Y6MR 5DD5L 2P1YA 4YDLC 1VENA 1RUAH 4XCEB 2E7LC 1J0KA 4YHIB 2B4CC 1OB1B 1HHGA 4X6CA 2X41A 4Z0XA 2ILLA 3VWKC 2O93L 1BFVL 3X12B 5BO1L 3S4SB 3SGEI 5D1QB 3D3VA 5HPMB 3SKUD 5CEYA 3QQ3A 1A1MA 2J7LA 2W65A 4V2CB 4C83B 1Z0NA 4KVNH 1L9MA 3RKDC 2CUIA 2V7NB 4Y4HC 1G84A 1IEAA 2VR5A 2VQTA 4BYHA 4JDTH 1XF5A 2YRPA 3BGAA 2Y72A 2CPCA 2M2DA 2OJEB 4LKXB 3WO3B 1S7WB 4EDWL 3DI3B 3EJJX 3KPPA 1LO5A 1YEHL 1MCWW 5C9JB 3IFOB 2UWEF 3CLFL 2ADFL 3MRIA 3RNQB 1AGBA 4QHNA 3ARGA 3H9SD 4KHXH 1A9EB 4Z7QE 3C2AL 2VZOA 4F7MB 3FO2A 1ZS8B 1FZOA 4MHHG 3VI4F 4D3CL 5DDHB 3MO1B 5A16A 2D9QB 2BNQA 3CFJA 3O6FD 2FEEI 3ARFD 2DQFA 4WEUD 3FFCB 4EQ2A 4TULL 4MJ5B 5SWSE 1YEHH 3BP7A 1G7IB 2HA1A 5J13B 2YUXA 1NEZG 3C09B 2DTMH 4GKOA 3FCTA 4Z18A 1SVZA 3ZZ1A 4ELMA 2HRPL 5A3ID 5KSBE 3VGEA 3VXRB 4G8FB 2A83A 4CVXB 3QDMA 4HUXB 4YQXH 5GRJL 1JZ8A 2HT2C 1H9VA 4DEPB 2AV1B 5EZLA 1XCQA 2W9LA 3X3GL 5HXMA 4XMPH 3BMVA 3VFWA 3LQMA 1CFVL 1JYXA 5IW3A 5BO1H 5FV2A 5EA0H 1NAKL 4GRLB 3MUZ1 1WWAX 1Y6NR 1AR2A 5LGKA 3MGOB 4Z78A 2YD4A 5E8EA 4BFIA 5J12B 4MB4A 1RULH 3LS4H 1HINH 4QTHA 4Y16C 2BY0A 4AZ8A 3QWOA 5C7XH 1CGSH 1YNLL 3TM6A 1UENA 5KVEL 1ED3A 4GT7A 2YPLE 2A9NH 1NGZB 5B38B 2XQBH 4L4TD 4KZEH 5IG7A 3RY5A 2JKXA 1SY6A 5E1AB 1OWRM 1U95A 3VXOA 9CGTA 4JFDB 2IADA 1AKJA 1ZVYA 3QCVH 2FBJH 1N0LA 5HVWA 4OTXL 1A3RH 1UKQA 2PUQT 3RGVC 2G75B 1KYOJ 5C86A 2XXCB 4DKEL 2P8LB 2Y06L 3RFZC 5CEXA 4IS6B 3VRLE 5DS8A 1YMMD 2JIXB 4B41A 3SGKA 3X11A 1I3GH 1D5ZA 4JN2A 5MI0C 1G7JA 4RWHA 3VXRD 4I5BA 3G5ZA 4YBQC 1P9MA 3U2SB 3O45A 2EYRA 3QFJA 3B5HA 1N2RB 1FVDA 1A6UH 3TO4A 4O5LH 4ORZC 4KRLB 5IMMA 1WFTA 2ZUWA 1CE6A 2J6EH 4CJ0A 5KSAC 1ZT1B 2J88H 4IDJL 4N9GA 1KCLA 3B4NA 4MD4A 5HVHB 3KDMA 2P43B 2VISA 3IXAB 3VXTA 1VEMA 4P2QE 1XIWD 3MUY1 3T1FA 1A6AA 1VSCA 1JHTA 1TCRA 1ZA3A 3UTTA 5E9DD 4XPFL 4X0KA 1HXYA 4PRIB 2X5PA 2DQUL 1B4JH 1MPAL 1I1FA 2APXA 5DMYA 1CL7H 1A14L 1QLRA 3QFJB 2DI8A 5FM4A 4YK4C 3MRDA 1KJ3H 1I1YB 3NFNB 3ZTJH 5I1GH 3WXWH 3CFKB 1ETZA 2J4WL 3RVWC 1WWWX 3EDDA 1TPXB 1KB5A 4EBQL 4MXQC 3P77B 2ZCHH 3U36A 3JWDL 5GGUB 1U3HA 4LBEB 3VFVB 1AE6H 4MQXC 2H6PB 1CDCA 3LKNA 4JHAH 2I25N 5FO8A 1A3RL 4NHUA 3LRHA 1T83C 3L1OL 5FGBC 4N90E 1U9KA 1IKFL 3IDGB 1A1NA 4NDMB 5JMRA 2X1PA 4DCQA 3V7AG 3RTQC 2NY3D 2MQ0A 1A6WH 2VJXA 3WE6B 1YEJH 2YKLH 2Q76A 4OZFB 3QA3A 2IQAB 2XZCH 4S11A 1Z5LB 4LVEA 2C3WA 4D9LH 3T2OA 3IDUA 1I1AA 5HHOB 2NY3B 3IDMB 2YUZA 4I2XB 4M3JA 1RQ5A 4M3KB 4KVCL 4PJHB 4QRPD 3CJJA 3QO0A 4JG0H 3TH4T 3MOBH 1HQRA 3UJIL 4DVRH 1UKSA 5T33H 2VDLL 1J5OL 4P5KB 4WHYH 3PWPB 1P4BH 4H0GA 2AV1A 3FO9B 1JMXA 1WBYA 4J3WA 5GZOD 5D2NA 3IU3B 4QWWD 1MCKA 5I1AA 4PJFE 5KVMC 3WN5C 2QSVA 3LRSB 5INDA 1AXSA 3GO1L 1BBJA 1VKXA 2B5IB 1JTPA 4XPGL 5I2IA 3P4NA 5FCUH 3PGDB 1XIWC 2DQTL 4OCSL 5A2FA 3NOIA 5CJ8A 1MEXH 1MY7A 1JN6B 1XR9B 2DTML 4FXKB 1N2RA 3CZFB 3O9WC 3VXSB 5E2TL 2YS4A 4C56D 3TV3H 5CD5C 1JTOA 1S3KH 4XMLH 2NPLX 1A2YA 2XNAB 1G7HA 2PW1B 3GSOB 3HN3A 4QT5B 4KUZL 4K9EH 4JM2C 1FVCA 3DUHA 3DYPA 3KNBB 3C8HA 2AJVH 4HG4K 2A73A 1RV6X 3SDCD 3CFBB 1C7TA 2VXTL 1S9VB 2NW3B 4OD1H 1JK8B 2J6EA 3QUZC 3CLFH 2FEDD 3KPPB 5CINH 4NYLA 3BQUB 4O58L 3I84A 4Y19A 1DQLH 1KTLB 1OAYL 1WBXA 1D5XB 3KPOA 4QHMA 4ZAKD 5EU6E 4M43H 4S1DC 3O11B 1S7TA 5E8OA 1YA5A 4W81A 5JXEA 1OP3H 1FAIH 5DJ2A 1V7ML 2VN4A 1IC1A 1T5XA 4IOIB 2X4RB 6FABL 3QUKB 1WITA 3S4SA 1NMCB 1EFXB 1S7RA 4Z7UE 1BVKA 5F89B 5D1ZD 1TMCB 2BC4B 1Y0LB 1KNOB 3PXHA 2CLZA 5JR1L 1UB5A 5DD3H 1HILB 3HAEG 3ARBB 3IRPX 4Y4KD 2DQCL 1K4CB 3PHSA 3MLWL 2WWKO 4RISL 1IM9B 1W2KT 4X4ZA 2EDTA 4LPUA 4JFDD 1MLBB 2IH3A 3DX8A 4Q6IC 1X5JA 3O6MH 4P23A 4P2RB 3SGKC 3AS1A 3LEXA 4BK4A 3KGRA 3ULVE 3PQYB 4I8DA 3TWCH 4XAKE 5B39G 1VHPA 3C5JA 5HHOE 4G8IA 5HDOA 3RZCB 3O2WH 3BUTA 4L5FL 4OGYL 3HI5L 4N1CA 3BEVB 3KPRB 4LCYA 2VNCA 5I16B 3MLVH 2PYFA 3GIZH 4ZD3H 1LP9F 2NY4D 1EGJA 3WS3A 1G0XA 4Y4FB 1T2JA 4WWID 1MI5E 3KPRD 3LPGA 3M45A 3U1SH 1OAXL 2I5YH 4OZGE 5GSRA 2X2YA 1INEH 5JUEL 2FL5A 4XXCA 3OJDB 2UV3A 1EEQA 2FRGP 3STLB 2I9LA 3PWNB 3FN0H 3IB4A 4I77L 1IKNC 5JO5B 3WN5B 1XF2A 3DURB 2XZQH 1NC4A 3TBSB 2NZ9D 5I76B 5M95B 1NFKA 3SN6N 5GJTH 4KUCF 3WNLA 4N8VG 3VFSA 2FGZA 1U8JB 1F6LL 2QL1A 2NY1B 3IDJA 3U7YL 1AD9A 3NAAL 3MV9B 5EOQL 1QVOB 2IC2A 2FGWL 4M1DL 1LP9E 1ZGLB 3IAPA 4D9RE 3P11L 1LO3L 2ADJB 4K2UH 5JTWA 5SWQB 4WEBL 4XWOC 3ELAT 3FZUC 2IH1A 1WZKA 3O2DL 5IVNA 1AHWB 3VI3F 4W4NA 4KK8D 4NJ9H 1F4XH 1WBYB 4Z7WB 1YY8B 4U2ZA 3JTSA 1FSKC 5HGAA 3CH1A 2E9WA 5ITBH 2BVUA 1HEZB 3TO4C 4ONHA 5A43C 3ZKND 3IS0X 4WUUE 3MRPB 2CIIA 2J8UA 1GC1L 3PHOA 3BO8A 2DIAA 2YRLA 4WUKL 1UM5H 1IL1B 1BHGA 1KPRB 3MPCA 1JPTL 3UTQB 1HH6B 3RVUC 4MNHA 2YZ8A 4PJ9B 3GNML 3MACH 4OCRH 3QIWD 3VFUB 4ZSOB 5GGTA 3INUH 3TT1L 2FDBP 4J3TA 4ODHL 3E1F1 5DJAB 1OTSC 1WZ1H 4YXHL 4F7EA 2GQHA 3MFFA 1OAZH 5IM7A 4TSAL 5I8OL 4TUJA 1UJ3C 2J8UF 3FB8A 4Q6IA 4MQTB 4V1DD 1NMBH 1T1ZB 5DJYA 5D2NE 5KTEL 1WEJH 4PR5B 4S1SL 4DGVH 3D85A 3PGFH 3P4MB 4TUOA 5AG8A 5C0DA 4GW5B 1X5GA 4HGKC 4GMSL 4Y4KB 3MUGB 5E2UH 5L6YL 4HD9A 2F9BT 3MYJB 3W9EB 1HCVA 4OZIB 4WVRA 5GZNC 2F74B 2WNGA 5C0DB 1QNZL 1KTDA 2C7UA 5IESL 4LCUA 2X70A 3AC0A 2IBZY 1SEBA 1CGVA 1K2DB 4FXGA 4S1DD 2NZIA 3GSQB 1I3RA 1RJYA 2P44B 4G6AD 3HZVA 4FQQB 5L2KD 2WUBL 2WUCL 1RURH 1BGXH 3GI8L 4JPWL 3K8LA 4U33A 4WU5B 1EJ6A 5EZLB 1CZ8H 3BQUD 5MEND 1XCTB 5F93C 1KEML 4Z7UF 4LU5L 5J1TC 1Y18A 4Q9CA 2UWEE 4G8FA 3HHRB 1CLZH 2DM3A 3WIFA 1IC7L 2E7HA 1F3RB 2Y9RT 2E9IA 1EVTC 2L4OA 4Y5XA 4P4RA 4P59H 3GHEH 2BY3A 2Y4SA 5DEGA 1ZHLB 2V2WB 3O2VL 2PYFB 1BJ8A 1FV1B 4K3EH 4LBEA 1HH9B 4JFEE 2OZ4A 4G5ZH 2H2SC 3WFDH 5ENWA 2C5DC 3EGSA 3JTTB 1KB5B 2VB5A 4PP2B 3LQAL 3U46B 3B43A 5C1MB 5DJDB 1P5VA 4WU5A 5DK2B 4M62L 2Y5TA 4QRQB 1F5WA 4MA1B 2OJZH 3KLAA 2FO4A 4N5ED 4N0FA 3KWWB 1FP5A 3MV8E 2PETA 4GJTB 1T6WA 2X7LB 5GQBA 2ZSWA 3RNKA 3W0WA 3TA3C 1U6AL 3HAEB 4PTTA 5KJRH 4CMHB 3FQTA 1ACYH 1FAKT 2D7PA 3HR6A 5FM8A 3C08L 1X5LA 4YE4L 1Q9OB 5MERA 2A83B 4PJCE 5FHAL 2Y07H 3UCRA 2XTLA 2C1PA 5KSVB 3P73A 1ITBB 4LQFH 4OM0L 4OCYL 3N0PB 1MCNA 1E6OL 4LLWB 5IMMB 1RZIB 1QVOA 5BMFH 5BS0D 3VG0H 2ICCA 5IK3B 3C60C 1T66D 4X6DF 2GK0A 4RIRA 3LKQB 3VD3A 5I66B 2C3HA 5SWZE 3U2SA 4OT1H 1RY7B 3G5XA 4QRTA 5GJSL 1YYLL 1Z2KA 2BY2A 1MCQA 1S8DB 5BV7C 4WNQB 4E41A 1KCKA 2QJDA 4NGHL 5FK9A 3D39B 4OGZA 2VAAA 3MODL 2HFGH 3ZDZE 1AGDB 4BK5A 1IL1A 2ICWA 3V5HA 2IBZX 4ZOBA 5E5UB 3OKLA 5D7IE 2EE9A 3IYLW 4HXBL 4P46C 3QXWA 2W9EH 4LCCB 4XWGH 1TENA 4Y5XC 2OCFD 1UA6L 3HMXL 1QSFD 3MRMB 5GGSB 2YPLB 1JF6A 3BHBB 4FZ8H 4JFEA 1FZOB 4PLKC 3S37X 2ED8A 5HYSG 4PV9A 1OTTC 3KXFE 3R1GH 4R2GD 4RGMB 4PFEA 1OPGL 3KDMB 4GQ9H 3MLTA 4KK5D 4YDVA 5J57B 4J1UA 5D9SB 4XVSL 1GGIH 5JIHA 3L3HA 3C87A 3H42L 1JZ4A 1JPGB 3BDXA 3BQUA 3H42H 5D1QC 5IVXA 2R29H 3LPFA 3MV01 1NPUA 3V0WL 4AT6A 2BJML 3TO4B 1OPGH 5EH1A 3QQ4B 3O6LL 2R56L 5SWZA 3R1GL 4R4NC 2SEBB 3U9UA 4PS4L 2OL3A 3BZEB 4LSPH 4X4XB 4GBXA 4MD5A 2VDOL 3WFHA 4LVOB 3QUXD 1GPOL 4MZ3A 1TZHB 1AHWC 2UVFA 2DQGL 5FFLA 4RMQA 1OCWH 3GGWB 5GSRB 4WFFD 2ESVD 2W9EL 4OZFA 3DSFH 2EEBA 3QIUA 5L88H 4OSUL 1YEKL 2ICWI 4UIMA 3CSYA 4Z8FL 3ILPA 3DRQB 2EZ0C 1MRCL 3OAYH 4PJCA 1W72L 4XP5H 4NHCL 4KU1A 3VFTA 3MJ9H 4JY5H 4H1LA 3MODH 3DIFA 2H6PA 5A16B 3QI9A 1AGEB 3LRGA 1NC2D 1CT8A 4YC2C 3Q2CA 2PCPB 4GW1B 3CXHJ 3S96B 5IV2B 4WHDA 5JW4N 4FQXA 2DS4A 1UJTA 3MRJB 4XVJH 5T1MB 5I0ZA 1I8IB 1MHPH 3DMMC 3U79A 1AI1H 3RWFA 3D0LB 1MH5A 5DJZA 3JVGC 5F7KC 2OS7A 3CX5J 1EGJL 4E42B 4OM0H 3W11C 1EAPB 5ESVA 1M4KA 1JGEA 1W8NA 2E9JA 5F3BA 1YZZA 2VLJA 2QADC 3QPXL 3MQIA 5ICZA 5C2BL 1B0RA 5DD0H 2DMKA 4LIQH 3KLHD 3QIUD 1A6ZB 1YEGL 4J3OC 2P49B 5T1KD 4KHTL 4Y19B 4GLRH 4RAVB 5IHUH 2ZCKH 3NA9L 2B0SH 4PR5A 5DJXA 1LDPL 4QYOA 4YDLB 2VC2H 3B8YA 1NEZB 3GJEA 4P2YA 4CU7A 4O9HH 3F58H 2V5YA 4LKCB 4GUPA 4XBPB 5FYJU 3MCLL 2WAHA 1DVFD 4FQXC 4PIRF 2HJLA 3GM8A 1J86A 2H9GB 3Q48A 5ACLA 4AENA 3HE7B 1E4JA 4LLYA 2YZ1A 1UWGH 3WLWC 3O2VH 5LVEA 2W0KA 4PRHA 3FT3B 4F37F 5K9KA 4UV7H 1OLZA 5ERWA 5CD3B 1KN4L 4BELD 5J4MA 4HULB 1CIDA 25C8L 3BPOB 5KN5A 5JW4Q 3Q1SH 4L9DA 1IC7H 1ZLWK 3GKWL 3BSZH 2AK4E 4J4PA 1QLEL 1RZJL 1SEQH 1KEMH 5A40E 2FJGA 2P5WA 3T1FB 4C56B 3O3EB 5DC9B 2CD0A 4P4KB 2H2PC 5EUOF 3M17A 1NCDL 3RIAF 1AR1C 4UAOC 2E5EA 1FGNL 3VRIB 1JWSB 1A6PA 4L4JA 3EO0A 4XCFH 5T1DL 5AZEH 5T3XD 3F7VB 4LHQB 1U8NA 5DQ9A 1QNZH 5IESH 2ATPA 4PJ7E 2BVQB 3BUYA 4S1QH 3QG6B 5E6IB 4LHUD 4W4OC 1TJGH 2ICEA 4KROB 3RJQB 5E2UL 1A21A 5IROA 3GMPB 4ODWB 3OKKA 1A02N 5EU3B 5EBLB 3R4DA 5EFIA 3V79C 4LAJH 4UV4L 1NC4D 4P3CL 3T2NH 2X4SB 4NC1E 4BH8B 3ARBD 1WEJL 3QEQB 2JJTC 3RGVA 2D31B 5D5ME 5E2WL 1EFXD 1OP9A 1AI1L 3H0TA 4NQXB 5HJ3A 3T2PA 1YPZA 2JB6B 5HYSA 4JO3H 1IEBB 3RWDA 1BJ1J 1O7VA 4DQOH 5DMKB 4WU7B 3RI5K 5BW7A 1UXSA 4UQ2B 1L7IH 4JREB 5EIQA 3OTTA 4UIKL 4X9BA 1IGCH 2NYYD 3DHJA 4PG9B 3IJSA 4WUKH 4X5WA 4PJFB 4NM4L 2CRIA 1V7NL 3BKJL 4ZNEE 4Y4FC 5ITBL 3V6OA 2IADB 1R3HB 1MRCH 5J1SC 5CEZH 3S36X 4Z8FH 5T5FL 1RFDL 5B21A 2O5YL 4EQ3A 3NZHL 1J0JA 3GMLB 4J8RB 2AW2A 1JNLL 3TH2T 1Q94A 2J8OA 4LSPL 5IHZA 3HC4L 1NFDE 3NAAH 5EOQH 3QBTB 1V3JA 2H3NB 2ZNWA 4LLQB 4PJ5B 3X12A 5HHMD 2W60B 4Z78B 3EDEA 5EO0A 2XZQL 3U0PB 3D85D 4PJFF 2ZOLA 4ZS6D 1ZSDA 3FN0L 3T8XB 2NW3A 1NANH 2E3VA 3MSPA 1NANI 2FJFA 5K9JL 2OTUB 3L9RA 1I7ZA 3E6FA 2ENSA 3MV8D 4QT5A 1DANU 4OD3H 4I4WB 1FL3B 1JF5A 4CUCA 3O6FA 5DS8B 1DQJA 1JWUB 2R23A 3G04A 1J87A 5DLML 1CGYA 5GS1B 2C1OB 2EDJA 2EE3A 3IFOA 3CDCA 4OIBA 3EOBB 4NQDE 4HLZH 5LG1A 1BECA 4WO4B 4DVBA 3GMOA 2CKBA 3GMMB 1DQJB 1JWUA 2R23B 4GRWH 3NIGE 1IT9L 1MJJA 1DN0A 1NDGB 5E8PA 3HC0A 5SV4A 2AXFB 3VFPA 3QEGL 2VWEE 4L4TE 4XNZC 3O6ML 4UB0L 1TZIA 3FQRA 4QRSA 3SDXE 5EC1A 4RISH 4HJ0C 1UQSB 1HYSD 5GJSH 2RBLA 5HHME 4OT1L 4KKAD 2OR9H 2WINB 1X5FA 1MOEA 1SYVA 2Y36L 4MWFB 1F3DJ 5F9OL 4ZFZA 1B9ZA 2C1OA 4D9QD 3NH7L 4U3HA 4J3SA 5SX5K 4PJDE 4U6HB 4YHKL 3MX0A 2HFFA 2GW5A 4NUJA 5EO9A 1KF9B 2NLJB 1XZ0B 1FZMA 5CD5D 3C08H 3UPRA 1UWXK 1DCLA 2BRQA 1HWGB 3C60B 3FRUA 4OCXH 1DQLL 1QR1A 2FX9L 4JN1L 1JPGA 2IJ0C 3FB6B 1T89A 3F6LA 1U3JA 1QSFA 3SBWA 1H3XA 2NY4C 3O3BA 3OF6D 4PJAE 5B3JE 1RZFH 4OD1L 3IT8D 1BMGA 4XPBL 3BH9A 3CFJB 3VXNA 1OARL 1CVSC 3HI1B 4NFDA 5FO9A 4PG2A 3AB0B 4OV6F 3D9AH 1HXMA 3IVKB 3VA2C 1ZWIB 1T5WB 4L9LA 2NY6B 3U36B 3QNYB 5FCSH 1ZA6B 2IGFL 2VLKE 1H3UA 3ARDD 4JM2A 3WNOA 1FNFA 1CQKA 1M71A 4NZJA 5HYEA 3ULVH 3AVEA 2D31A 3KYKL 2ITCA 5A2KH 1J0IA 1F45A 2CR6A 4KK9D 3VGAC 4WHYG 2NY6D 5BVPH 1A6VL 1KT2A 2EC9U 3E6HA 3IGAA 4U7SA 4X7TB 4OUUB 5L0QC 1GIGH 3RY6C 5CIPB 3VG9B 2N1KA 3DJ9A 3FRPA 2I9TA 4Y0GA 2OTUA 4M6NL 4DUWA 1YC7A 3KXFD 2EDDA 5MHSD 2FIKB 1JYVA 4YHZH 3OAZK 4OAWA 1M7IB 3IJYA 3QDJB 3ETBF 3PWJB 5D7SL 3V5KB 3DECA 2R9HD 5I66A 2MKWA 4S2SB 4ONFL 3MOBL 3K8MA 4GXVH 2IFFL 3FT4B 4MJIA 4JG0L 4KY1H 4LHJB 3IETB 4N9GB 3WHXB 3MR9A 2VKWA 3L3IA 1DLHB 3GJFK 4YXLL 1L0QA 3T65B 2VLRE 5IFJB 2VLRA 2EYRB 1YC8A 2EKSA 4HF5L 3HUJE 4MNGE 4NKOB 1K4DB 2YKLL 3EYVA 3CU7A 4IIQB 4K3HA 3VXSD 5L6YH 5IB2A 1CLCA 4JFZL 3DRTA 1YECL 1NUGA 3MJ7A 3VI4E 2YD7A 3SDAC 4DGVL 4JG1L 2IWGA 1LEIA 5AEAA 4JHAL 3RL2A 3RVTC 3J8F7 3FQUA 2VMFA 4GKZB 5CUSH 1RPQA 4LCIH 2VLMD 2R15A 4ZO9A 4X6CE 4GSDH 3NIFF 1BVLA 4MB5A 1PKQB 3BWAA 5IB2B 4WGVB 4JKWA 4TNVF 4EBQH 4F7CB 4WHTA 4EN3A 1GCFA 4RA0C 1DUYB 3A6CH 2Q3AA 4U6YA 3SOBL 1KFAL 5F7WC 2APBA 3OKDA 1BBDL 5I1LB 2PW2A 5TDNA 1OVZA 2FWOA 2BMKA 3W39B 5I17A 5ERWB 5CP3A 3MRHB 2Z31C 4I3SH 3N1QC 1OGTA 1QFHA 3GMPA 1E0OB 4OLYH 4X9HA 1NCTA 3REVB 5IFHL 1WZLA 2IBBA 2UYLB 3FO0H 1HK6A 5DD1H 1FRGL 3G6DL 4K2UL 5F9JA 4P48A 1MAJA 5C09D 1ERNA 4XC1L 3VE0A 4M1DH 4ELMB 1TCMA 3QIWC 1MCHA 2BCKA 1PQZA 3AY4A 4KI5D 1SBBA 2R9HC 2HT3C 2FWOB 4NUGH 3L3HB 3SO3B 3TCLB 3V7AE 4QXTB 3QCUL 1B0GA 4P2OA 1YQ2A 1BQLL 5ICZB 2ICWJ 5C6WH 4GQPH 1PG7X 3VG9C 3BPCA 4L9LB 1PYWA 3CMOH 3FOLB 4LLDA 2Z91A 1HXMB 3B9KC 3EOAB 3U1SL 4NOFA 3DXAA 1KCUL 4F57H 3N85L 4X98B 3GBLA 2GJJA 4ZTPL 3PWUA 4S0SD 4X83A 5MEOA 5DI8B 4ZPTB 3TH3T 4RFNB 3C09C 1I8IA 4LQ1A 4WHCA 3HI5H 2YD3A 1DP0A 5CWSA 3SGDI 1IGIH 5MEPA 1IGFH 2LFGA 4F33A 1S7UB 3UTOA 3FHQA 5HI5C 5KVFL 5KSUB 2MSPA 2HFEA 1NEZA 1JNHB 3T65A 5AUMB 1BM3H 2CDFB 5JXAL 5HHPA 1S7VA 3BGFB 1V3MA 3WHXA 5CLTA 5DD3L 4NQDB 1ODAA 3IDIB 1MCSA 4JVPA 2LE9A 3CSBA 1MFCL 1K8IA 1CFVH 1FVEB 4JHZA 3U30B 5AZ2H 2C1PB 4HX1B 5KSVA 5SWQA 1RZGB 5IBTH 2DKUA 3BHBA 5FF6B 3VGGA 3NFSH 3HRZA 1FAIL 5EC2B 2HRPH 2D7MA 3PDOA 3QIWB 5IB4A 2O61B 4X8XA 3LSOB 1C12B 4MA8L 2VDRL 2A6DB 5ISZA 5KSBB 3GMOB 4O2EB 4KKCC 3ARUA 4J3VA 4XB8A 1CF8L 4F9LA 4RGNC 3O3DB 5FB8A 3QUMH 3BYTA 1BD2D 5E99L 3KPLB 1OTTD 4AQOA 2FSEA 3HUJF 3U6RB 1A1OA 2Y23A 1XGQB 1AKJD 2F54B 2NZ9C 3CDGB 3WNNA 4M7LL 5J56B 4D0CB 4K9EL 1I7ZB 3E6FB 4M7LH 1HHIA 3RUGB 3EKCA 1P4IH 3KHOA 5C9KA 1WJ3A 1BIIB 4QHLB 5LCVH 1FBIH 3PWVB 3VW3H 5E99H 1JF1A 3CDFA 4JFQA 4JO4L 3TV3L 1CF8H 5E2TH 4ETYA 2H8PA 4FMKA 4U1JB 3VMPA 4JDTL 3Q5TA 3O2DA 1ZOXA 4HFUH 2FATH 4CJ1A 2V7HA 3QUXC 4O2FB 3FN3A 3KYNB 3WJJA 3GO1H 3RRQA 2QQQA 3KPSA 1HSAB 2MWCA 2VDMH 4OZIF 2CRMA 3GSVB 1HKLL 3VXPA 4K7PH 3KG5A 4KDWA 2P5ED 1U8PB 3GSWA 4KXZH 1Q72H 4HCRH 4F7PB 5HTSA 3QDHA 1LK3H 5ESAA 5DFWH 4DVRL 5D5MB 5ADOL 1X5YA 4GKSA 4BQBA 1DBKL 2C4XA 4UAOB 3VFRA 1H0DB 1BM3L 5JXAH 3P30H 3JV6B 3KLAB 4DAGH 2DTSA 2HT4C 1JUFB 2ZNXA 2VLJB 1KBGH 4NKIH 4GRWB 3RWCA 1UJ3B 5HYSB 1PJ9A 5IB5A 1KTRL 3BXNA 4HQQL 3QYCA 4LRIC 1NGQH 2V2WA 1TQCC 3DX7B 2RHEA 1BLNB 5C0AA 2CLRA 1KCUH 1MCOH 4HBCH 5BJTA 5EBWB 2RB8A 2XN9B 3LEYL 4P9HH 1NGWA 1UXSB 4UQ2A 1IZKA 5F7NC 1S8DA 4F8QA 4LMQI 4NKOA 1FN4A 1NCWL 3IS1X 1LNUB 2YR3A 2ZOLB 4I48B 4JM4H 1HH6A 3AY4C 4JFFE 2NY3C 4F9PA 4FXKA 1JV5A 3S37L 3OPZH 2YD8A 3TBVA 4BH7B 2G5BA 3EFDH 4HGMA 1G6RL 2FX7L 4TPRH 2BXZA 1XEDA 2BSSB 1QA9B 2VLKD 1BBJB 3FT4A 4UT9H 4Y1AA 3BGMA 4QKXB 4GBXC 5CLWA 4QNPF 1PKQE 4R0LC 3FO0L 1K8DA 2R4SL 3BD5A 1LE9B 4IHOB 3HRPA 4M61B 4ZUTB 5T1LA 4EVNA 1W0WB 5D93B 1RIUH 3NFPA 4Q74A 4HS6B 3ISWA 4Y4HB 2J6EL 5DVKA 3EO0B 3ZKQD 1N59B 3QUMB 2X70B 2BMKB 3W39A 3DPBA 3GMNB 3O8XA 3RIFK 1P7KB 1LDSA 1EDQA 3WKMH 3A6CL 3MNWA 4BFEA 3M07A 2YD1A 3HPJA 3GUTA 2Z35A 1NCWH 1MVUB 4C56A 4HV8B 4N0UA 4KMTL 4HEPG 1PX3A 1P2CA 2PTVA 1EHAA 1HOCA 2GHWB 1AP2B 5C0BE 3VD9A 3QDGB 5JHDD 1YJDH 4GAJH 4LPTA 1FFRA 5E2JA 1G9MH 2CDEA 3D48R 3U82B 3DV6A 5JOPD 3WFEH 4NNPH 3FB6A 1YECH 5EFIB 5ALCH 1UCTA 4UIMB 5E70A 2E6JA 5HHOD 2ITDA 4ZTOH 3VRJB 3BZ4B 1IZJA 5BRZA 2L7JA 1FZJB 2DBLH 3IKKA 3NABH 3I50H 1HHKA 3VWJC 2HT2D 1Z9LA 2SEBA 5IW1A 4DAGL 1CGSL 2HJKA 3P30L 2DD8H 3SKMA 1CD9B 2IFFH 4OQTL 43CAB 4ONFH 3JVGA 4MWFA 3SCMA 1LK3L 4HWBA 3WN5A 4CU6A 1NGPL 5MERB 3BAEH 3T0VA 4YHZL 3V6FB 1RMFL 4XMPL 1MIML 3CPLB 4WRLA 3IJYB 2X4UA 4M6NH 4OD2B 4DFIA 4X4YA 7FABH 3R8QA 4NFCA 1NL0L 5CSBA 3BRGC 3KJ4C 3U7AA 2I9TB 3HAEA 3QUYA 5J12C 2W91A 2X09A 3RWGB 2J1KA 5T1KA 4X9GA 2VKXA 3IGAB 3KXFA 4P99A 1LE5A 4MJ4A 4JZNB 4XZUA 1U0QA 4OLUH 4UBDC 1HHJA 4JO4H 1ZK9A 1J8KA 1JK8A 3G5ZB 4LPYA 5CS7A 4XXCC 1ND0B 1JI2A 3DMMA 1FBIL 1KGCD 5E94A 2OI9B 4JFDE 4U1HB 1XGPA 4AL8H 2DLIA 2AERT 4BZ2L 1CFBA 5JOFA 2EDWA 1A2YB 1TTFA 1RK1B 3VXMD 5EWIL 1NUFA 4HIHB 4XPBH 3QRFM 2ADFH 1NLDH 5JNYB 1MRFL 3MRPA 3QUML 1PVHA 4RFOH 1IILE 4QHUA 5EO0B 2BNQD 5CJXA 1U95B 2XTJC 3VXOB 3MXWL 3RL1A 2NR6D 4JE4B 4MA8H 4LLWA 4Z7WA 5CP3H 1IGML 2EDEA 5C2UB 1NAMB 4NBZB 1UB6A 3LRSA 1FG2A 2X4QA 3NFSL 3L5WA 5IBTL 1S7TB 1QZ1A 4XX1E 2W38A 5I1JL 2P5EA 3I85A 4ZNCD 3AROA 2BZDA 1IAKB 4JQXC 4PY8I 1MI5D 3THML 4AT6B 3QDMD 3P4OB 1W8OA 2FYYA 4Z0BL 1JGVH 1KUMA 4LCUB 1ITCA 2OR9L 5JNYA 5DFVD 4JFPA 1T1WA 5SX4H 1LVEA 1T83A 2NX5E 3LHPL 3OJMB 1S7XB 1VADA 4LVHB 4OFKA 4N5UA 5EZIL 1FL5A 5HGHA 5HDLA 3P9WB 1KC5H 1MCWM 1SM3H 2NXYC 3RVUD 5JHDA 3FQXB 1YEIL 1IGIL 1DANT 2IAMA 5GGTH 4K55A 2CJUH 1U42A 2KL6A 2XIDA 4LCCA 4R3SA 3U48A 1UXWB 1NMAH 4GG8B 3DBXB 4NNXA 2CKBB 4F37K 2WLZA 1JGDA 5IP4A 1DBAH 3BEVA 4OFYD 4KV5E 4XVTH 3ZDXF 4EI5D 3RZCA 3KVQA 8FABB 3R8BB 2X4SA 4OD3L 4N68A 3W5MA 3QFJD 2QHRH 2QQLL 3P0VH 4H0HB 2Z92B 3QEHB 1JGUH 2X4UB 4OD2A 4PJEA 4ZFFA 4IRSA 4QGTA 4M48L 4PRDA 1XCTA 2HVJA 4TVPD 5JPNB 5L2KB 2NY2D 1DL7L 3QPQD 3GIVB 4GMTL 1TVDA 2X7LA 5B4MD 1Z3GH 4AEHH 5F7HA 3HC4H 2D4FA 3ZL4L 2VLKA 5J6HB 1AD0A 1ZMYA 2Z8RA 1P1ZB 4F9PC 2D7TL 4YHML 1J88A 5DD1L 4WY7H 1E4KC 2HKHH 2LAGB 2Q8AL 1Q9OA 3VRLF 1FLRH 4NM8H 4J8RA 1KYOK 2X1OA 4P0DA 4LSSH 3BPLB 1X9QA 5CEZL 2EXWC 2GFBA 1KG0B 4X7SH 3IDJB 2EIDA 1J8HE 4HJJL 2YXMA 5INCB 4LASL 4BSJA 5BQ7B 4G7YL 4QRUB 3T4AB 5HHPB 3ULSB 1RIHH 4M5ZH 5I6XB 5BW7C 4R90L 3S9DB 2BX5A 2N56A 4GKNB 3RKDD 4JVUA 1NGYB 3SDXB 3STBA 3UBXI 1Z9SA 3DNKA 4JN2B 4JAMA 3AREA 2Q76B 2VZ1A 2GSIA 1MVFA 2OTPA 4G43B 4A2LA 3WV0A 2WIMA 2JIXA 4GKNA 1REIA 4MNHB 4LKCA 4O51B 1LD9A 1C5DA 4PG2C 4LCIL 1U8LA 1R3JA 3GJEB 3QSKB 1PLGH 3PQYD 5C3TA 4ETQB 2AQ3A 3BX7C 5I2IB 1KACB 4AY0A 1R5WA 1BREA 1TPXC 3KYOB 4R26L 2H32H 1R3KA 1HHHB 4WW2B 5H35B 1RU9L 3CVHA 2IEPA 5E1AA 4JFZH 4NPYA 2G9HA 4KRPD 1TJGL 3TN0B 4EOWL 1CDGA 4X80H 4HF5H 1G9NL 4XCNA 4AQ1B 4XB7A 4L3CB 4FQXD 4S1QL 2I27N 1BEYL 3ARWA 5GS2H 3LD8B 4NN5B 2DWDA 2CO7B 2HLAA 2BVQA 3BUYB 5AZEL 1QD0A 2DAVA 3IKCB 1U8NB 4QLRA 3G5YA 1FGNH 1C5CH 4CVWA 3ULUE 4PJXB 4G6KH 4HIXH 3HG1E 1KTDB 1HQ4A 1KB9K 2KZ1B 4XPTH 2E7LA 5D7SH 4PJDB 1HIMH 3QA3B 1YNTB 3O11A 4C4KO 5E08L 4ZFFB 2G9HB 3QUYD 1JP5A 1I9JH 1D9KD 3MNVB 4IIQC 2CLVB 5MEQB 4HH9B 2ZOKA 1TQCB 3GSNB 2XACC 2NY7L 2L7UA 1OP5K 2FD6H 4N0UE 1DSFL 3VFMA 4ENEC 3S3SA 1A6VH 5BVPL 5GS0H 4P2RE 5CEZD 4CW1A 1XGTA 1VEPA 5DYOB 4Y5XB 3FB5A 4YHYB 5IVXE 1U3HB 3KYKH 1QSEE 3ILPB 1BWMA 1Q0YH 3H9HA 3MCLH 2A2QT 5F1NA 2V17L 4NQSA 1CGTA 3TJEH 5F88A 3MLRL 2V9RA 3S36H 4O9HL 5IB1A 3NCJH 3JV6A 1MLBA 1AD0B 2IH3B 1SHMA 2B0SL 1AD9B 4FQJH 5DZLA 3OKMB 4KK5C 5KANI 3FJTA 3BRFA 4PLKD 1DDHA 2F53D 2FX9H 3MGTB 4JN1H 3GSWB 4XP6L 4R0LB 5DD0L 1KG0A 3GSVA 2HVJB 3RWCB 2I9LB 5GGSY 3U0TA 3G6AA 4AEIH 2DDQL 4H20H 3VFNB 4ONGH 5DUPH 1U92A 1J1PL 2NY1C 3K0WA 1R24A 1EAPA 3MV9E 3K4DA 1H0DA 3EYSH 3NH7H 3MV9A 4WFED 5KZCD 4O4YH 4I18A 4XAWH 4X6EB 4Q0XH 4BSVB 4OF3A 5BRZD 2DKMA 1UZ8B 1OD9A 1NC4B 3TBSA 4OZGF 2Q8BH 3L3DA 5E9DE 5EG6C 3WSQL 5T1MA 5EOCH 1VFAA 1TZGH 4WI2A 4XP9H 4NC2B 2VDKL 5HHQB 4TOYL 1UM4L 3QO1A 5FK9B 3RUGF 2FL5B 4PJ9A 5TF1H 4OUUA 1MFBL 5BJTB 3LEVH 4IS6A 2YD9A 3I02B 3AAZB 3BKMH 5GISH 5C9JA 4NHCH 4XP5L 1WFOA 4QRUA 1NH6A 5I75C 3JWNC 3LCYA 2CLZB 2EDYA 3PF2A 2BNRD 4KQ3H 3OL2A 4OBSA 3CX5K 4I18B 4OSUH 2A6KB 2PTTB 3CH1B 5EORH 2YWYA 2W07A 2JLLA 3H3PH 2BVYA 4G43A 3MBED 4PJHE 5I1KL 1IBGL 3PABB 3CFKA 4HX1A 1I7UB 4MXVE 1IE5A 2AK1L 4Q9QH 2FH6A 4OLXL 3S88L 2F54E 2CH8A 3LIZL 3UYOD 4PUBH 3QIUC 4IOSD 4NO2B 1KULA 1F3DH 3RA7H 3SQBA 2R0WL 2OJEA 2ZPKL 4HWZA 4LKXA 1Y0LA 2EICA 4UU9A 2BNQE 4XHQA 1LE9A 2O5ZH 4HS8H 3QIWA 4LHUA 5IBUB 3J7HA 1JNLH 3HG1A 5HDQH 1I8MB 4HUUA 2VLLA 1DFBL 3QQ9D 1RIVL 4MQ7A 4XI5D 2O5YH 4IOFC 5CEYB 1MCCA 3FAWA 1OAKH 1R5IA 4RGNB 2J8UE 4ZFZB 5E5RB 5TH2B 1WBXB 4QHMB 2CR3A 1WFUA 4KROD 1GZPA 1WFNA 3L5XL 1UEYA 4P9ML 5IEKA 4KJYA 4ZS7L 3K81A 3FFCA 5E6ID 5BXFB 5D7JB 1ZVHA 2GAZB 3B9KA 3I6GB 3STZA 3ROLB 4CMMB 3N9GL 1JBJA 4UIKH 4HUWB 1YY9D 4MQ7B 4Y7MA 1P2CB 2DQIH 5GGUA 1E4XL 2YEZA 4HH9A 3WIFB 2C3XA 1EMTH 1DN0B 2GJ6D 2F5BL 4DQOL 2Q6WA 1A7QL 1YYLH 3S3JA 2Z35B 2BSED 2DI7A 4M6OH 3NPZB 2K1MA 1TVHB 1L9NA 2L0DA 5D7LE 1JZ6A 5T3ZH 5J3HD 4HGWB 3TT3L 1VFBB 5BMFL 4X6EA 3SKJL 3RWJA 4PJ9C 4G42B 3QIBB 4LEOB 2AEPH 3MXVH 4NP4H 2WP3T 2EIBA 5BCAA 2B7DT 1CBVH 1KEGH 1U93A 4YE4H 4JHWH 1I4FB 5IIEB 3LQZA 3O4LE 5KVDH 3X13A 5HYIA 4GRLD 1OGAE 4RAUA 4HT1L 4WDIB 4Y16B 1MF2L 5HI4D 2YMXL