5IW1B

Crystal structure of b4.2.3 t-cell receptor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
233
structure length
233
Chain Sequence
VTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSLGHTEVFFGKGTRLTVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYALSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL RECEPTOR ALPHA CHAIN
publication title An allosteric site in the T-cell receptor C beta domain plays a critical signalling role.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 233
sequence length 233
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2016-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw1B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw1B02
3KPRB 3U4BH 4KKLD 3UDWC 3RVUD 2VQUA 5D2LA 3N9GL 5D72H 4ACPA 1LK3H 3ZKSD 1T83A 5T1KD 3T1FA 1I7ZB 5AG9A 1W72H 4PGBA 1JYXA 4Z8FH 2FHBA 3P77B 2JCCF 4U0RB 1BQLH 5GGTL 4HPOH 3V0VA 3W0WA 5DSCA 1DP0A 2BVYA 3FB6B 5GGQL 2BSTB 3W5MA 1NQBA 1RULL 1XGYL 4LLVB 4L8DB 4PJIB 1HKFA 3RHWF 1R3LA 1JWSB 1RJZA 3F65A 3UTQA 5HJ3B 1DQJB 5D2NC 2UWEE 2KKQA 4HBQA 4KQ3H 3RWJA 2E9JA 4G8FB 1SQ2N 1FFOA 3CH1B 3MLXH 4YXHH 2DL2A 4PRHD 4JFFB 1XFPA 3QUZD 3SGJA 3M1BA 2VDNL 3HMXA 2DIAA 3CDFA 4WTWA 4X7EC 2BVQB 2MNUA 4RMVA 4M1CC 4H26A 5F9JB 1M7IA 4NGHL 1JYWA 2OR9L 5CJQL 1CDIA 4LCCC 3HZKA 1CFSA 4FG6D 3TWCL 4PJFF 5JXEC 1FZJA 1QVOB 3FFCB 3HZYA 2V2TA 5K93A 2SEBA 3LQAC 1AY1L 3KPOA 6FABL 1PKQB 1YZZA 4EI5B 1UJ3A 4MJ6A 4UT6L 1HZHL 3GB7A 3LN9A 1MIEH 1FC1A 5GGUB 3X3FH 1MCEA 4MLSA 4X6DB 2YPLD 2G75B 1KIQB 1VGKB 5DK3A 3MLSH 3P0YH 3WKML 5I1KH 3D1MC 1Y6KR 2VXVH 1EFQA 2VLLB 2R1XB 4ZDHA 1S7WA 1MWAB 5AD0A 5EZJB 4JG0L 5IW3A 3TFKC 3NFPB 3TO2A 4Z9KB 4PRPE 2FYYA 3TVMA 1KTRL 2FBJH 1ETZB 5CZXC 1MH5A 3DX8A 1G6RA 4NC1E 2PR4L 5ELIA 3JV5A 3RTQD 3FB8A 4IHOA 1IM9A 1AXSA 5F9OH 3ZHKA 3DYPA 3MOBH 4IDLA 3RAJL 5SV4A 5GHWL 3HC0A 3E3QC 3P4LA 3SGDH 4WW2C 3DO7A 3WFBL 3WJLA 4QRSA 3W82A 5HHOB 1MCWM 4UT9H 5D7KE 1U2CA 2EXWD 4NYLA 5I73B 2BVPB 5EZIL 5HGBA 1J0JA 1NC2A 1WBYB 2VC2L 1LDPL 5DTFA 4AEIL 4LHUD 1KG0B 5LWYH 3MRGA 2F54B 3N1GC 2W92A 3CMGA 1QFHA 3CD4A 1KJVB 1T89A 1PJ9A 4WEMB 3TO4D 4DOHB 2R2BA 1ZGLP 2CK0L 3SDAC 1JPTH 1KELL 1X5KA 3S5LG 1FCCA 4NKMB 1RZFL 3VG9B 3IAPA 5LVEA 4TSAL 1UWEH 4NWTL 2DAVA 2HVKA 1WZ1L 1JNNH 5D8JH 2OBGA 4X9HA 3ZTJH 2Z31A 4KQ4H 1U2HA 4AJ0A 4QLRA 2ADIB 3MUGB 4MXQC 1BJMA 2GW5A 1A47A 5FK9A 3L3KA 4I4WB 5DJXA 5MENB 3ARZA 3SE3C 4WHYH 1HSBA 4LLYA 4Z7WA 4MDJB 1WC7B 1BP3B 2IAMD 5I75B 1J9CT 3VRIB 2AEPL 1IGCL 5D1XA 2JJSC 4L8CA 3L1OL 5LGJB 1WISA 3SE9H 1LEKB 3INUL 3MV7A 1L0XA 1JZ3A 2NTFB 4MS8D 5IJVA 3FO0H 3RWDB 1SJHB 4Q0XH 5JDSA 4R8WH 2RCSH 3D9AH 2OL3A 1AQDB 2V9QA 4F80A 5I1EL 5IW6B 3IDYB 3ZE2F 2VDLH 3PHQA 5F89B 2VXTL 2ZUWA 4ENEC 1JZ2A 1CL7I 1K6QH 4OCWH 3VCLB 2LQRA 3EYQC 4QY8A 5DJCA 3MREB 1D9KB 3ULVD 3DURB 1T5WA 3V95A 4X0KA 4NO0D 2YSSA 5KAQG 5CSGA 3BQUA 1IQWL 3MODH 4X8JB 3PWVB 4IM8A 1U8KB 2GJ6A 4J3WA 5GJTH 3O3BB 5L2KD 4AM0B 1A2YB 5JPMA 1GC1H 1OTTC 3T0BA 5KG9B 1GGIH 1G7HA 1P69B 2E27H 4OT1H 3F6LA 3HMXL 5CEZL 1QHOA 4NRZB 4MCYB 1HWGB 4Q58C 1DBKL 1DTUA 2KQNA 3KPMA 2EIZA 1CGUA 4F2MA 3BWAB 4Y16C 5IR1B 2NY4C 1H15B 4GW5A 2NXYB 5SWSD 4LFHG 3VU2A 1F6FB 4HX1B 4OGZA 3QUMA 4BZ1L 3D69B 1YEGL 4RBPK 4PTUB 3G04B 2BRRL 3L3IB 3MBEB 1TMCB 5I0DA 1E4JA 4H0IA 2JCCB 1HOCB 4KK8C 3L5HA 1NBZA 3VXQB 5E8PB 5KSUA 1GGBH 5EIQA 3FRPG 2CR6A 1CXKA 3S35L 3B2VH 2VISA 5GRJH 3F5WB 3I75B 3U0TB 2UWEA 4KVCH 5SWZB 1R5VA 2BNRB 2NYYC 3RBGA 5FCSH 3MLZL 1QFPA 4H5SB 3F7YB 3GMRB 4GW4A 4L3EB 4QRRE 2EDQA 4JRYE 4MD0B 3RL2B 2A6KA 4EUPG 2BMKA 3QDAA 1MCQA 3JWDH 3IFLL 4HT1L 2WP3O 3TBVA 1I7UB 4AT6B 1N2RA 4D9LL 2XYCA 4R2GD 1KYOK 1EMTH 4K8RC 1UM5H 3IS0X 5EU5A 5IESL 1TZHA 4K94C 3SDYH 2O5ZH 2FIRT 4ETQB 3GO1L 5BS0D 3MGOB 3O2WL 4YDJA 1KLGB 1EH9A 5A3IC 4QHKJ 5B4MD 1KXQE 5T3ZD 5HPMB 2X4UB 3STBA 3CVIH 2EDOA 1NLDH 1YEEL 1WUNT 5BMFL 1K85A 1KPUA 3H7BA 1YEFL 3BIBX 5ADOL 1I4FA 4P99A 1UXSB 3X12B 1NKRA 5I17A 3PL6B 2JIXA 1DN0A 4M48L 5IEKA 3VJ6B 4MJ5B 5I30H 4PJFB 4O00A 3QO0A 1VESA 4GG8A 4D8PA 3KPRE 1JNHB 3MRBA 3PXJA 5DJ6B 5DZLA 3AREB 4JZNA 3QXTA 5C0CB 5BQ7A 1D6VL 4LPCA 5JHLL 4AG4H 2WBJC 4M4RA 1F45A 3TCXA 2XTLA 2FEEL 3NCEB 4BFBD 4ODXA 4KI1A 1A1MB 2A73A 1IKFL 4LSSH 4UZGA 1IEAA 2IEPA 2NNAB 4I9WD 1AO7A 4AIXA 3AAZB 1QBLL 4TYUA 4Y5XA 3TZVB 5SX5H 3HZMA 2QKIB 2VLKA 5IIEA 2COQA 4PJIE 1A14L 1TZGL 1RIVH 2F58L 5MEPB 2HFFA 2X7LA 5DQ9B 2B4CH 4K7PH 1XGUB 1FNHA 1JNLL 4KHTL 4WEBL 2GJJA 4BQ9A 1P7QA 3Q6FB 4HLZH 4BH7A 3RVUC 4KVNH 5E6YA 5EA0L 3C2SA 3O4LA 4JVPA 3GMLA 4HKXA 1U8OA 4Z7QF 1VFBA 4JFFE 5HDOA 2K3TA 3CCHB 5B39A 5DWUL 1IC5H 1IBGH 4Y4HA 5CGTA 1AFVH 3CGTA 1ZT7B 5ALBH 5DJAA 1FFPA 4C56B 5FYKE 1UZ8A 1WZLA 2FWOA 1EVTC 1QSED 2QEJA 3O3EA 1N5AB 1YN6B 4XMPH 4ZXBA 2WINA 5D1ZA 4N0RA 5TGBA 1X5JA 4RX4A 5KAQF 3WL9A 3CFJB 1CICD 1IEBB 3FFCE 4XP9L 1J5OH 3BZ4A 2AI0H 2QHLA 2V6HA 5HVWA 1PKQE 3MFFA 3QEGL 3ILPB 3PWPD 3O6FB 3Q1SL 4QHUA 4KUZH 4NRXA 3QUZC 5FFLA 5I1JH 4X6DE 5D9SA 4JVUA 1NAMB 3UBXI 1YNKL 4I3RL 2H26A 4ODUA 2VYRE 2EIBA 2FO4B 2YKLL 1ZA6A 1EFXB 5ICXB 5DHVA 5FKPB 4OUUA 2OS7A 1MCCA 1I1YA 4HFWA 3BD4A 4FG6C 4HCRL 4OGYL 1BIIA 4ZUVB 4UIMA 5JIHA 4AEEA 4LARH 4HUUB 1CL7H 2RFXA 2P8LB 1I1RA 1EBAA 1VSCA 2DLEA 5T3XH 4J3VA 2UVEA 2EO9A 5L2JA 2HKFL 3T0AA 4RGOH 4EOWL 3DXAD 5E2WL 5FKAA 2O5YH 5HGDB 4WUKH 5C0FB 4NQUA 1FNEA 3SKJH 5JW4Q 1N4XL 5I2IB 4ALAH 5HD8D 4MLIA 4WW2F 5EC2B 4NJ9H 4S1DD 2Y5TA 1WFUA 1PY9A 4N8VA 5GJSL 4EN3A 2F54E 1G9MH 2YHGA 1J1OL 4QYOB 4IRJB 3BZEB 5JQHC 3GKWH 4DOHE 2R4SL 3X3GL 4BKLA 5EU7E 1A6AB 1T21B 2FATH 4X4YA 2J3SA 1QKZL 5EZLB 4XAWH 1T22A 1DL7H 5ACMA 5SWQA 3L3GA 2VNCA 2Q8BL 2KBGA 1JNJA 1XGTA 2EXWC 3WHE1 1BZ7B 5MENE 5GZNC 5SX5K 3G08B 3VFMB 1YNLL 4NZUH 2NY2D 2XIDA 1NGYB 4U1NA 4YHOL 3DI3B 3MRCA 4I3SH 4X7FC 2BZDA 4JZOA 1P4BL 1XCQB 4G42B 1HHHB 1TQBB 3TO4C 3C9NA 3CFEA 5F7KC 4DN3L 2GJZA 1QBBA 4P0DA 4QRRA 2BJML 2BY1A 4JRYA 5T3XD 2E6JA 3CXHJ 3IXTB 2J2ZA 5T5FH 2H32B 4KPHH 5EH1A 3U0WL 4TNWK 1HHKB 1O7SA 1VACA 4EI6B 4G43B 5IBUG 4KV5E 3SCMB 1IAKB 2W9DL 3DV6B 5HDBE 1KGCD 2O5XL 5H94B 4DN4H 4PJCF 4JPVH 4NIKB 4U05A 3SGKC 1NGPL 4OZHF 5BJTB 3GGWB 1H8NA 2IQAB 2GUOB 1A6TB 1NBQA 2IAMC 3OX8B 3LKPB 3PWLA 4FZEH 3QEUA 4M1GL 4YHIB 3MJ9H 3AY4A 1S9WA 4Z0XA 3BVNA 2PXYD 1WICA 1S8DB 4MS8C 3PDOA 1H9VA 1LO2L 4EEEA 1KPVA 1JN6B 4J12A 4F7PA 5AAWA 1KFAL 1OAZH 3JWOL 3N1FC 2ID5A 3KPSD 4HJJH 3KPRA 1DBBL 4MX7A 5D93B 1JUFA 4JM2B 3MLUH 4TUOA 3K2UL 1JZ6A 2J8UA 3TPKA 2LU3A 1CN4A 2CLVB 4NZTH 1TPXC 3ULVC 2KDGA 5IV2B 2KZ1B 2AJUH 5FA3B 2R0KH 3HNVL 2O26U 3P77A 4ZMAT 1QTYT 2NY5L 3TCLA 4TUJB 3S5LB 2FIKB 2R4RL 3FB6A 2JCCE 3C08H 4U2YA 5GGRY 2BSTA 4X8XA 2ESVD 5CLWA 4LLVA 1IGJA 3HNSH 3QFDA 4OKDA 4ZNCD 4PJIA 1YEJL 2IPUK 4F7MB 1JWSA 4CNIB 5HJ3A 4ZFOB 2IH1B 4LVOC 1DQJA 1A5FL 3SJVD 1IM3B 5IMMA 4NKDB 2Q76B 1ZWIB 4G8FA 2H1PL 2BNRE 1GRWA 3CH1A 4KTDH 4PGDB 4L3EE 5D6CB 3JZ7A 5I8OH 1A6WL 2DBJA 2AJVH 1FN4B 3ULUD 3O6ML 3QQ4B 3GSQA 3KG5A 1FL3B 2MMXA 1RJYB 4JGMA 3ALPA 4HUVB 4LSPH 5D2NB 4R7NB 3U4EB 5F9JA 4AEHL 1EA9C 1SEQL 1AE6L 5DVOA 3WSQH 4H8WH 5IHZB 3ARBA 5IGXL 3MLVH 1OSPH 2ADJA 3E6HB 3VXSB 4D9RE 2OTPA 1OWRM 3MRNB 5DZNA 4OGXL 1HHIB 2WUBL 3CMOL 1P4LB 3VFGH 1KLUB 1QVOA 3FFCA 4R4ND 1INDH 4QO1A 1PKQA 4EI5A 4PJFE 1EO8L 1CDJA 3ZT7A 4ZPVB 5GGUA 4Y5VA 1RAMA 5EZOL 4LCCB 4X6DA 1MFAH 1VGKA 4OTXH 4X80L 1I3UA 4R2GC 5C0CE 2NCMA 2R1XA 2VLLA 4LHUG 3NFSH 3BO8A 1MWAA 1L7TH 4QRQB 5EZJA 1PX3A 2FR4B 4YZFF 4YLQT 3NFPA 4OCRL 3EYOB 2CXGA 3ALWA 4YBLB 3SY0B 5B4MC 1ETZA 1KENH 2Z93B 4J3SA 4GMTH 3O8XA 3HG1D 1B0RB 3EYVB 2QQNH 3H9SD 2H3NA 3E8UL 5JR1L 3FOMB 4PYGA 1A3LH 3V6FB 1RZJH 5D1QD 4YE4H 3MV01 4P2RB 5HYJA 2XZCH 4HUNB 4PJGF 1RURH 5EORL 1MQKH 2AV1A 1WIUA 1H3GA 4MAUH 4JKWA 5FM4A 4LIQE 1F6LL 1KIPB 4HXBL 2F54A 5A2JH 3A0OA 3SPVB 4WW2B 4NHCL 5C0EA 1KJVA 1J10A 3EYUH 3MV11 5EBLB 1PLGH 4XTRD 1D5XB 4M02A 4C56E 4EUPB 4NKMA 2R56L 1CZ8H 5JNYB 2J5LC 4M7ZC 3QDJD 1B0GB 1FZKB 4HK3N 2GHWB 4Y4FD 3GJFA 3WFZA 4JY6B 4YPGB 5JOPD 1VFMA 1G9NL 3NAAL 2Q3ZA 2X5PA 1A4JB 3GNML 4JFXA 5T1MA 3VXMA 5L9DL 1FV1B 3SDAB 5MENA 1BFTA 4OB5H 1DEDA 2XNAB 3B3IB 3VRIA 1E0OB 2VAAB 3BKJL 4GMSH 5TFSH 1KC5L 5LGJA 3G9VA 3C8KB 3KNBB 5TQ0H 3B43A 2V5RA 4RMWA 3BN9D 3RWDA 1SJHA 1GGCL 1NMBL 2ZUQB 3ZTJG 3JV4B 4J1UB 4NQED 4LCIH 4OSUL 1FZMA 3C5SB 5IW6A 4HKJB 5DRXA 5F89A 4RGMC 5AZEH 4WHYG 4LRNL 3VCLA 1CICC 4PRDA 1BZ9B 1D9KA 1OL0A 3QG7L 3ZE2E 3O3AB 1T6VN 4JHBA 3CFCH 4FQ2H 1J1PH 1OARL 4PJCB 3UAJD 3ZTNH 3EYSL 2K7QA 1E6OH 4X8JA 3PWVA 1DJSA 1U8KA 5CLTA 1OAUH 3T2NL 3O3BA 1QRKA 4AM0A 4S0SD 1N0LA 2ZOKB 5HHXH 2X89D 4NWUH 2WIMA 5FB8B 5C0BD 5J6GA 1Y6MR 2FEDD 4JFEA 2EDHA 4TQEH 1S5IH 1CXIA 5E8OB 2F53D 3FTGB 2CD0A 1B90A 3EOYG 4NRZA 1ES0B 5MEQA 2YK1L 2IBGA 1S9KC 4AQ1B 5DJ0A 2B4CC 3CUPB 3BWAA 3VE0A 1YY8B 4LLDB 5IR1A 2AP2A 2L0DA 2VQ1A 5E9DB 5FYLH 2EKSA 2HTLC 5IMKA 1KIRB 2FJHB 4HX1A 4QTIH 1D6EB 4I0PD 3D69A 3MNZB 1XT5A 4JE4B 2M2DA 4PTUA 3RL1B 1WIOA 3VGAC 3KXFD 3L3IA 3H42H 4RIRB 3MBEA 1A6VL 5M94B 1KBGL 2JCCA 2DQTL 3WXWL 4JCLA 4Y16B 1U91B 4Q9QL 4KKAD 2NY4B 2ATKB 1G7QA 5E8PA 4S1DC 1FHGA 4PJ5D 3SDXF 1LO4L 2VSCA 3F5WA 4XVJL 2IALB 5CWSB 2WK2A 1HIML 5JHDB 1BWMA 2BNRA 3UTSD 4H5SA 1CXLA 3F7YA 1VB9A 3GMRA 4JHWH 4PR5A 5MERB 4MD0A 5FOBB 1ZVHA 4JFQB 3K2MC 5GGTH 3IVKB 4RQQB 1MREL 1X7QB 2H6PB 1KN4L 4TULL 5GGQH 2GSGB 1Y0LB 2ZJSH 1CT8B 1RULH 1XGYH 2XA3A 3I50L 4ETQA 4YNYB 3MGOA 3CLEL 5GQBA 1QPXA 1A7QH 1KLGA 4RISL 4PV8A 1RZKH 5E99H 2X4UA 2NY2C 4R90L 3MGAA 4CVWA 2ITCA 5C08D 4OUOA 3W81A 1UXSA 3K4DA 3PGFL 2YS4A 3ARYA 3X12A 2R2HB 4Y2DB 1INQB 5FYLD 4MJ5A 4WV1C 4PJFA 2VDNH 4PREB 2HFEB 1NMCC 3WNNA 1SEBB 2R23A 3BH9B 1CVRA 5DMIL 4JZJC 3FQXB 1X5FA 3QI9D 1LEIA 4KY1L 3FAXA 5EIIA 3FO1A 4LEXL 5C0CA 2OR9H 5KZCB 3VFOB 2HRPL 5H35B 2G5RA 3ZKND 2EH8L 3E2HC 3B83A 1OD7A 4P3CL 5FOJA 2C3XA 4XCYB 1N64H 4RZCB 2B5IC 3TWCH 2NNAA 3AAZA 3L3OB 3TZVA 3FFDA 2DI9A 2CH8A 3ULVF 1KTKE 2QKIA 1AY1H 1X5IA 4UT6H 1HZHH 2PXYC 2WBJB 3MLWL 3BRDA 5MEPA 1K5NB 2W91A 3JV6B 5DQ9A 4EQ2A 3QXWA 1XGUA 3OKYA 4Q74A 3C6SA 3AS0A 5IG7B 3DRQB 2EE9A 4QHKI 2FEEI 1DLFL 4KK9D 3T4YB 1DFBL 2D7MA 4NN5C 2DJ4A 2G5BB 4UI2A 3CCHA 4KHXH 4MVBD 4Q6YA 2WIIB 2W0KA 4Z7QE 5TQ2L 2Y06L 4OJFL 4LGRB 4GBXD 3KPLB 4HQQH 4HIIB 5GHWH 1PY4A 4MQTB 2B1HL 1J0KA 1A3RH 1N5AA 3WFBH 3NABL 1YN6A 4ZTPH 4G7YH 4MZ2A 4WUUA 4M61B 5T1KB 1INEH 3VXSE 5IBUB 2HJKB 2X42A 1TDQA 4B7IA 5LAXB 3HE7D 5EZIH 4JGUA 3CFJA 3VFPB 1IEBA 1KXVC 3FO2B 3B6SA 4AEIH 3R1GL 4JKLA 1B4JL 4POUB 3BZFB 3U0PB 3ULUC 1ONQB 1NAMA 3ARQA 4B7LA 3IFPA 2CK0H 4P23D 2QQLH 2Q20A 2VUOA 4WFFD 3HAEG 1RZFH 2FO4A 3MRHB 1D5IL 2CDFA 2A6IB 1EFXA 5HI4D 3REVB 4PRHB 2VABB 3QUZB 3VMPA 3D0VB 4UMGA 1RHHB 1F6AB 4ZNEE 2MHAB 3O3UN 4ZO9A 2RJMA 4WGWB 3DV4B 2P5ED 4M43L 4QEGA 4HUUA 4R4NC 3RA7H 2P8LA 3BXNB 5DUML 2NX5D 2AEPH 5HGDA 5C0FA 3L1OH 1ZVYA 4NHUA 3ARSA 3INUH 4A6YH 1ZS8A 1BD2D 4FFZL 1VEOA 4LSVH 4P2RE 3WLWD 4GAYA 1B4RA 4MD4B 4YXLH 3FONB 5ADPL 2XZQH 1FFQA 5F7LB 5EC2A 2OSLB 3QIWD 3SKNB 3E3QE 3EFDL 4IRJA 4XAKE 4PB9L 3G6JF 2IPUG 5HVHC 3IU4L 5KJRL 1UM4H 1YECL 4XPHH 2CKBL 4M9OA 3F58L 1DLHB 1UWGH 4XCCL 2YPLB 4X98B 4PB0H 1T21A 2D4FA 1EXUB 3OF6A 4A2LA 2D9CA 1NMAL 5EZLA 1IC7L 4RWYH 4MGXA 1IQWH 3EIFA 1E4KC 5DGQA 5D1QC 4WU5B 4P46C 3FAWA 2P4AB 5IHUL 3RTQB 3UPRA 3G08A 3IXAB 1WK0A 3VFMA 3WS6C 5CEZH 3UO1L 1NGYA 4H8WC 1DBKH 1OAKL 3U30C 2ICES 1AJ7L 5CD3B 3NACL 2JE8A 1MAMH 2X70B 2NZ9C 4KC3B 1XCQA 3SDXB 4M6NL 4S1RL 5E4EC 1DUYB 4J7RA 3HC3L 1FSKC 1BFSA 4JVWA 1WV7T 1GOHA 3IXTA 3IETB 2H32A 4S10A 3CVHL 4LSUL 4NDMB 4LHUB 1W8OA 4JKPL 5CCKH 4JREC 4EI6A 1HILB 4G43A 4Y4FC 5HHQB 3EJZD 3SCMA 5IQ9B 1IAKA 3DV6A 3TO4B 1UGNA 3S35H 5KVFH 3CPLB 2WM0A 5BJTA 3GGWA 1MNUL 4UQ3B 2GUOA 4UUJB 1A6TA 4PJCE 1AP2B 3OX8A 1JHLL 5DVNA 4E0RA 3QHTC 3BPNC 3MLZH 2CUMA 3EBAA 3VI3E 3QEHB 3S8WA 1HN1A 1M1SA 4YHZL 2F8XC 3U6RB 2YPKB 2GIYA 3BN9C 3O9WC 1MIML 1JL8A 1JN6A 1J88A 5ICZB 2D7PA 3D5OF 4D9LH 1OCWL 1U8LA 2EDDA 4JM2A 1RZJC 2R8SL 5DEGB 2I5YH 4PY7B 3RVTD 3GO1H 4LCWB 5E9DE 2DQEH 2CLVA 5JW3L 4BSVB 1AI1L 2XT1B 2LE9A 5IV2A 5CEZD 4OCNC 3OKOB 3HR5B 1MF2H 3KS0H 4MB4A 1PSKH 1YEDB 4XVUC 1YEFH 3MSPA 1U95A 2HA1A 3NCCB 3S5LA 1Z0MA 2FIKA 2C4XA 3RX7A 1BOGA 3O6KH 1I1AA 4M48H 2C3WA 5CSZB 2MPAL 5HHVL 4WEUD 1S7RA 3IU3B 3T77B 2FEDC 4YPJA 1VHPA 2MOVA 4ZFOA 2IH1A 3THMH 1P7HL 5E6IA 1IM3A 4OD2A 4BQ6A 5FEBA 4NKDA 4NO0B 4PV9A 1FE8H 2QHRH 3A6CH 1D6VH 4XBPB 1LO3L 4P4RB 4PGDA 5D6CA 3ARWA 1FBIL 3GMNB 5L2KB 5M95B 1IKFH 1BJ1J 1FN4A 4I0PC 4Q97A 3QQ4A 4LAQL 1FL3A 1QBLH 2VZ3A 4LVOB 1RJYA 3BISA 4Z76A 4HUVA 4QHMA 4R7NA 3U4EA 4PYHA 1T7WA 1A14H 1TZGH 1IT9H 4WFHE 4KKAC 2XXCB 3ZDXF 1JF1B 3TVMD 2FGWL 5SWSB 1JNLH 4KHTH 4WEBH 3GBNL 4CAGA 3E6HA 4QOKD 3MRNA 3RUGF 3MV9D 2KUTA 1HHIA 3HPLB 4MA8L 1P4LA 5BVPH 1KLUA 1YQVL 1UACH 3AROA 1F8TH 2OXGA 3I3BA 4XXCA 5DWUH 4ZPVA 1UWXH 3HI5L 4KUCD 1R0AL 4LCCA 5DJYA 3KAAA 3NVQA 4FXKA 4O02L 3L5JA 4JFYB 2Z0BA 4TTGA 2D2OA 1FRGL 1NC2D 1ZT4B 3SBWA 5JXEA 4LL9A 2FX7L 4LDEB 2FR4A 1CXHA 1MOEA 2JB6B 3RNKA 3Q3GB 3EYOA 3SY0A 1T0MB 4YZFE 1EO5A 3WN5A 1ZXQA 4OF8A 3P2TA 4WI2A 1MFDH 2X4OB 3QDGD 1I8IB 1T03L 2VKXA 1AXIB 4R2GB 2IH3B 3Q1SH 3TP4A 3TBTA 1DUZB 1K2DB 1S7UB 1B0RA 3OSKA 4YFEA 1FO0B 4DVRH 5HGHB 4XMKH 5BS0B 1CU4L 4F9PA 3FRUA 3EAKA 3FOMA 1SJXA 1YNKH 3OTTA 4TVPL 3L5WA 3UBXG 3V6FA 5HY9B 3PQYD 4KTYA 3T4AB 5EUKA 1F3JB 1FNGA 3QI9C 4JO3L 1NDGA 2YKLH 4XGZA 3VH8G 2OQJB 4NO2B 3ZKNC 4JFHD 2YOCA 1MFCL 4YO0A 4UT7L 2X4QB 4BUHA 3SPVA 5KS9B 1M05B 4HCRH 5CEXA 4OGYH 3CX5J 4LSTL 3NZ8B 3GIZL 4G3YL 3VG0H 1D5XA 3G6JB 4YX2L 5DMKB 3V5KA 4EUPA 3KYNB 1JZ5A 4DEPC 5MP6H 2HKFH 4EOWH 2Z91B 5JNYA 3EDEA 5TDPB 1B0GA 1KB9J 2OJEA 5C7XL 2E7CA 3B9DA 5FDWB 2XG5A 4W4OC 1N4XH 5CBEB 1I7TA 4JY6A 4YPGA 3NPZB 4KK9C 4RA0C 1A4JA 5SX4I 1OSZB 5IP4A 3S98A 1FV1A 5IM7B 1J1OH 3BQUD 1FIGL 3B3IA 2VIRB 2XNAA 3HN3A 3IYLW 4MVBC 2J5LB 2VAAA 2GJ6D 3MOQA 4M7ZB 1K3IA 2E7HA 5C0RH 5JO5A 3KNBA 3LY6A 4GBXC 3NGBC 4EVNB 5LBSL 3TBSB 1QKZH 4D9QD 3MZGB 3ULUF 3VDCA 3R8QA 5BRZE 3RKDD 4UILH 3JV4A 4PRHE 2HFGH 4J1UA 4LHQB 4UOW0 5HBBA 5CSBA 3HLAB 2Q8BH 3W2DL 2JJSA 3VMNA 2PN5A 3HE7C 1T5XB 4YHLL 2QJDA 4LK4A 1YNLH 3QDMA 3O3AA 4BSWB 5BZWB 3HB3D 5GGVH 3HI6H 4JN1L 4KI5D 1QSEB 2JF1A 4GKSA 4PJCA 1FJ1B 4UINL 1BGXL 3LB6D 4JB9H 4U6TA 3BYTA 3RWIB 3VFNA 4MB5A 1YN7B 4DKAA 2ZOKA 4RGMB 5FB8A 1CICB 5DMJB 5E8OA 3GSNL 5HI4C 3U0WH 3PWPB 1ES0A 2R2EA 3QHFH 3TF7C 3WFDL 4KZDH 3M8OL 1QA9A 2W9DH 2YPLE 5A40E 3CUPA 2O5XH 4HS8L 4LLDA 5E9DA 3OKMB 3ME0A 4G6JH 5EBGA 1NGPH 1KIRA 2EIDA 2EDNA 1D5MB 1YNTB 4GKNA 3MNZA 3GZKA 3BD3A 1KF9B 1W0WB 4M1GH 5L88H 2HLAA 3GHBL 4GRLD 4JFZL 4LHJB 1CTNA 4RIRA 2XZZA 1MJJB 4WU7A 3WLWC 4HHAB 1WQVT 1GZPA 4Y16A 1U91A 2ATKA 1GPOH 1L6XA 2Y07L 4NBZB 2G9HB 3JWOH 4DGYH 1PW3A 3QIWC 5FCUL 4AIZB 1DBBH 1C08B 4XRCB 4NCDA 1I1FA 1NFDF 3DXAB 2IALA 3WFEL 3P73B 1TTGA 2D0GA 1AKJD 3K2UH 4YK4C 5CWSA 3SDXE 3VGAB 4HWZB 1N26A 2X9WA 2OZ4A 3O41B 4X7DC 5I16B 5BXFB 4JFOB 1UH4A 3TPUB 5MERA 2N7AA 1PG7W 4GAGH 3HNVH 5FOBA 1QRND 4JFQA 3V7AG 2NY5H 4KRMB 3L9RB 4RQQA 1X7QA 4GQ9H 4H88L 3HAEB 2GSGA 2VR5A 2PYED 1CT8A 5EUOF 1N8ZB 3DI2B 1Z3GL 3DROB 2H41A 2OJZL 4PRID 1G7IA 4M9PA 2APTA 1PG7X 2G60H 1A5FH 2EZ0D 4JAMB 1AO7D 1VGEH 2Q1EA 2YA1A 3ZYIA 2ZOLB 1QFWM 2EICA 3VRJB 4DZ8B 4L4VB 2VLKD 4URTB 4OM1L 1A6WH 5F97E 2WNGA 2D9QB 3RUGB 4RAVB 4Y2DA 1INQA 4U1JB 5HVFB 3O6MH 4PREA 2HJFB 5I76B 2HFEA 4XPBH 5FV2A 4K7PX 1P7QD 1SEBA 2NY2B 2VLRD 3MXVL 4LAJH 3RNQB 4JGJA 3FQXA 3O4LD 5HYSA 1RV6X 4AEHH 4LCWE 1SEQH 25C8H 1AE6H 5ITBL 1R3HA 2V7NB 1T83C 5EPMB 3D18B 5CIPH 2W0LA 4N0UB 4WV1B 4XCYA 4RZCA 2A74A 1T2JA 1H8OA 2A6JB 3D48R 4OGXH 3CMOH 4HMDA 1NMCB 4NC2B 3L3OA 1OF2A 2GAZB 4JZJB 2GI7A 1TXKA 1EO8H 5I74B 1U93B 1V7NL 3QXAB 1EBPA 1JIBA 4ZTOH 2B5IB 3DRQA 4AK1A 1TQCC 2VOTA 3T4YA 3RVTC 5L2KE 4OCRH 2BVTA 2HFTA 5BCAA 4JY5L 2G5BA 2PXYB 3LKRB 2ZG2A 1CXFA 3EDDA 4W6WB 3UXFA 2XA8L 3IFOB 4J3TA 3KPLA 3KPSB 5TH2B 2WMPA 3DLQR 5A1AA 1KCUH 2FHCA 4HIIA 2P48B 4L8BA 4NQVA 4NN5B 5SWSE 3OAZK 4M61A 5T1KA 4OAWB 2YZ1A 1X9QA 2HJKA 5F1IB 4OM0L 4Q6IA 1T20B 1WTLA 1OGAD 5F7EH 4F9LA 2EYRB 1UJ3C 5SX4H 4HXBH 1N5YL 2ESVB 1QR4A 1G0YR 3BZFA 3U0PA 4NHCH 1ONQA 1I8MB 4YDIL 1A7NH 1SJEA 3SJVB 1TETL 4GSDH 4WHTB 2R56H 3MRHA 1RU9L 5ICYB 3FB5B 1QFUH 5BRZA 3REVA 5C2BL 2R0ZL 3TVMC 3VD4A 2VABA 3QUZA 4HFUL 4L4TA 1F6AA 4MHHI 1QNZL 2BSSB 1KB5A 1G9NH 3NAAH 2MHAA 2AK1L 4ESKA 4PGEA 5L9DH 3D25B 3JUZA 4C59B 1HKLL 5INCB 4LEOB 4WIQA 5BS0E 3PHOA 3QCTL 1GOGA 5HI5D 3VFUB 3T3PF 3BKJH 5LGKA 1R3IL 5C09A 3WJLC 1CF8L 2VXUL 3ISWA 5T3ZE 5F7DB 4MXWH 2OZ4L 4FQXA 4QGYA 1I9JL 4OLWH 2D7TL 1GGCH 4MD4A 1NMBH 4QHNB 3FONA 4G6AD 3CZFB 3UJIL 3A6BH 1UQSB 2JB5L 2OSLA 3SKNA 3F7VA 3W39B 5JW5B 5KS9E 2QSVA 4DKEL 3BAEH 5F6HJ 5J4MA 1T89C 1W72A 4LRNH 1DLHA 2YPLA 4X98A 3G6JE 5F70A 5GRZA 4UV4L 1KN2L 4HD9A 3EUUA 3KVQA 4OZIF 1T1ZB 2FCBA 4L9DA 3RX5A 3EYSH 4EXPX 1F4WH 4JKKA 2PTTB 3T2NH 2OK0L 1WGOA 4WU5A 4I9WE 3BPLB 1MCSA 3RTQA 1MFEH 3EOBB 3WYRA 1ACYL 4ELMF 3WDIA 3HG1B 4HH8A 3G6AA 5D1XC 3H9SB 3O6LH 1MRDL 2NY6D 3B5GA 5D1QB 3B9KD 5T1DL 4AH2B 1NFDB 5DD5H 1DUYA 1W2KT 4LLQB 4WWKD 5GISL 3IETA 2ZKHL 3KPRD 4R96B 3RY4A 4TSBL 3FT4A 4ODBD 4NDMA 4LHUA 3U30B 4FA8A 1A6VH 4PJHA 3RIAF 1HILA 4IMLB 4WI4A 4D2NA 3TNNB 2V2WB 4ZOCA 3TO4A 5E4EB 5IVNA 3MCLL 2IFFH 1N6QL 2AQ1A 3CPLA 5EUOB 1FSKB 4O51B 1QSEE 4UQ3A 4M6ML 4UUJA 3BT2L 3BQUC 1AP2A 3QDJB 1I7RB 1CLYL 4WTXA 3QEHA 5K9JL 4JREB 4Y4FB 3S88H 5GS0L 3OHXB 4K7FB 3U6RA 3ARVA 2YPKA 2EDRA 3UBXB 2VXSL 3UC0L 2DKMA 1U42A 3OAYK 3PWPE 3RKDC 1MREH 2FD6L 2YRLA 1A7OL 1YUHB 4TULH 1LO5A 3VH8B 4CVXB 3I50H 5HYEA 1F2XK 2GCYB 5DEGA 5GSRA 3NCYS 5GSVA 4LCWA 4XCEB 4D0DB 4BSVA 1ZLSL 2DKSA 3CSPA 1EHXA 4R90H 3HB3C 4KI5C 4M5YL 3RFZC 5J1SC 2EC9U 5F9AC 4NQEB 1OAYL 4RGND 3PGFH 3IDXL 3LB6C 2HG5B 5I66B 1EIBA 3IJYB 3OXSA 3P0VL 5CSZA 4WJ5B 3ARBD 1AGBA 3MYJB 3MPCA 3IU3A 3T77A 3H8NA 4MMZC 1N0XH 3DXAE 1GHFL 3OR6A 4LEXH 4NO0A 2I60L 4YDKL 1FVDB 2HRPH 4NT6B 2EH8H 4XHJD 2AXHA 3B5HA 4XBPA 4P4RA 4P3CH 1FNSL 3FQRA 3GMNA 5L2KA 4KKNA 2KL6A 1FIEA 5C0BB 2O61B 2X4PB 3HFMH 3CNKA 2FZ3B 3R06B 3ABZA 4X4ME 1HEZA 1UCTA 2F53B 1KB5L 2XV6B 4GRLC 2Y4SA 1JRHL 2QR0B 5KVDL 1JF1A 1ERNA 1TVHB 4K3GA 4I0PB 1OY3B 4YHKL 4L4VE 3O8XD 1UM6L 3JWNC 2FL5B 3TJEL 3KXFB 1YY9D 1DFBH 1UVQB 3H3BC 2DM3A 3RUGE 5E08L 3LRSB 1LK3L 1AR1D 4YBQC 1XMWA 4J4PD 4MYWB 5C0AD 5JORB 2Y06H 4Y1AD 1W72L 4OJFH 3D6GA 5HYJD 3LAFA 4PJ5B 3MX0A 3ESUF 4JFYA 4XB8A 4Z8FL 4JPKL 4P57B 3G5VB 4C55A 3OL2A 2B1HH 5I1AA 3UTSB 3NABH 1G7PB 1MVFA 2F54D 3ALXA 4N0UE 2JB6A 3VD5A 3Q3GA 1CD9B 1T0MA 2ICCA 3DX9B 3WIIL 5T3XE 2EZ0C 4W6XB 5D2LF 3ES6B 3BPOC 1PZ5B 3DGGB 3N0PB 4Q9CA 3EDJA 1RUPL 1T2QL 2X4OA 1I8IA 1H3TA 4PGJA 3CXDL 1C5DB 4G80A 1VCAA 2EDEA 2GQHA 5B8CB 2ZSVB 1DUZA 1K2DA 4UNTA 4ZPTB 1KGCE 4YXHL 3QRGL 5HGHA 5BS0A 2V9RA 1MEXL 3QUXD 5HY9A 1WEJH 3QNZA 4TPRL 4QNPE 4R97C 4X5WB 1QPPA 4NUGL 1F5WA 4S1QH 3T4AA 1FL5B 3DSNA 1F3JA 4RRPG 4P3DB 3VXMD 5C08B 3GJEB 5JIIA 3KJ6H 1OAXL 2OQJA 4NO2A 4KWUA 1NCUA 2X4QA 1IC4H 4B5EA 2QTEA 4Z7OF 3JWOC 5KS9A 3FCTB 1MLBB 1S7TB 1NBYA 1M05A 4NBYB 3NZ8A 3KPSE 4MQXD 4YDLC 4LVHC 4W4NA 3IJHB 4JJ5A 5DMKA 3QI9B 4MWFA 1HI6B 2P44B 5EU4B 2EDBA 4K7PY 1UH3A 3CZJA 2EC8A 3NA4A 4FFZH 5FDWA 1RIUH 2NY5C 4OZIB 5CBEA 2K7PA 5ADPH 5FA4A 5BV7L 4QHLB 2VXVL 1OSZA 1KJ2L 2W59A 4OFIA 5IM7A 3HI1B 1HE7A 2BSED 3IU4H 2VIRA 1YECH 5KJRH 2CKBH 4OCXH 4ELMB 3F58H 4J3OC 1BVKB 3SJVE 2BHYA 1JGEA 3EO9L 4M3KB 3TBSA 3GMMA 4JFED 4ZYKB 5ID1A 5TDOB 1FVEA 1ZLUH 4RWHA 3HLAA 4NPYA 1J05B 3GUTB 1EZVX 5E6ZA 1P6FA 5IHUH 4UT9L 2WP3T 1T5XA 4GBXB 3NGBB 3MRLA 4BSWA 3VGEA 5BZWA 4LMQI 1CR9L 4BA8A 3NACH 1VADA 1QSEA 1JI1A 1FJ1A 2R1YA 4MA1B 4Y5YB 3GSXB 4U6YB 4M6NH 4S1RH 5KW9L 4AL8L 3HC3H 2F19H 3HE7B 4MNHB 1CICA 5C92A 3VXPA 4BZYA 4TTDD 3TH2T 5EOCH 3ULSB 2X4TB 4N0CD 5FYJH 5L0QB 3CVHH 2YUZA 4KUCF 2CDEB 3VFRB 3WO4C 4JKPH 5CMAA 5F96L 4U1HB 4M6OL 4X6FB 2NTSP 3KHOA 4HZLB 5K9QI 4ONHB 5DD0H 3MLYL 3F7PC 4E42A 5LCVH 4O5LL 3OKMA 4P23B 5B38G 4ZFGL 1EERB 1YNTA 2B20A 4F7EB 5HI5C 2I25N 3BEVB 1P1ZB 1U3YA 1FYHB 2HP4A 4I5BA 4KMLB 4U1IB 4ODSH 4IJ3C 1MJJA 1QHPA 2EE3A 5IB1B 4HHAA 1S78C 5SV3A 1CQKA 1MIMH 2LAGB 4BH8B 5ESAA 2FHFA 2P5EB 2EECA 4PD4K 3HG1E 3Q5OA 4Q0XL 1RFDL 4O2FA 4R8WL 4D9RD 2NX5B 3MBXH 1C08A 3H9SE 4FZ8L 4XRCA 5TDNB 2FO1A 2R8SH 4OZFH 3DXAA 2APFA 3P73A 5FGCB 1A1NB 4LVNC 1DQML 4HWZA 3O41A 4HS3B 1BD2B 1NFDE 2DRUA 3LQZB 5I16A 5JW3H 5BXFA 4JFOA 5J11C 2OR8A 4WRLA 2PYFA 2EO1A 1K6QL 3DRTB 2HWZL 3PABB 3BN3B 3QIBB 5KSVA 3U9UB 3QIWB 3L9RA 4X4MA 1ACZA 1OT2A 1U8NB 1UENA 2XTJD 5C0CD 3HAEA 3BOVA 1OTUD 4YK4B 5HHVH 3MODL 3DROA 5GJTL 4DZBB 3RZWA 3VXNB 4P4KD 3S4SA 1GC1L 2FX8L 5EUOE 5A2KH 3AMKA 4JAMA 1GGIL 4DVBB 2ZUYA 2ZOLA 4GOSA 5F7MC 4CADB 3QDJE 4OT1L 3SE4A 3VRJA 1A6PA 1X6NA 3AY4C 1J0IA 4L4VA 4DZ8A 1LO3H 2NY6C 1JGDB 1G9NC 2HT3D 4DCQB 4KTEH 5JOPE 3RUGA 1ND0B 4U1JA 3JVGC 2B2XL 1Z9MA 1EGJL 1FL6B 2HJFA 1F2QA 5DD1L 2AQ3A 5BOPA 4EXKA 1O5DT 5C8JB 3RNQA 3Q0HA 2CRZA 3OBAA 4YR6B 3EOTL 2V7NA 1J7VR 1TVBB 5EO0B 2PTVA 4NKOB 5EPMA 3D18A 1KV3A 2FGWH 5EOQH 2X6MA 3GBNH 4N0UA 3HR6A 5IT2H 1QSVA 3CU1A 3WIHH 4KRPD 2A6JA 4D0BB 1GGBL 4MA8H 3B2VL 1G7LB 4NQEE 1KEGL 1IQDB 2UUDH 5E0QA 1DVFB 1YQVH 4RFOH 5D2LB 1BJ1H 4MNQD 4GS7C 4KI5F 4WUUD 4ZQKB 2FDBP 4AYFA 2X4SB 3HI5H 3QXAA 4O02H 1HHJB 3V4UL 1FRGH 3SKMB 5CBAA 3JWDL 1RZGB 2DLGA 3V0VB 1FAIL 2Y7QB 3WIFB 3T09A 1TVDA 1NANI 2O5ZL 2PXYA 5C0BE 1F42A 3LKRA 3UTQB 2F53E 4RMRA 2VQTA 4N8VG 3CVIL 5CFHA 5DRWA 3RWJB 5TH2A 3KPSA 4RGNC 1FFOB 5IFAL 1ZK9A 3MTRA 1BOYA 3ARBC 1OVZA 1CU4H 3K8KA 4TVPH 4OAWA 3QISA 5F1IA 1T20A 4YXKL 3MRJA 1E28B 3WDHA 3KXFE 1S9VA 4Y2OA 5C9KA 1KNOB 1UEMA 4XHJC 2ZSWB 1MFCH 1R24B 2EYRA 2WWMD 4JO4H 2Z35B 4EI5C 1JTOA 1V8HA 3K0WA 4Y5VC 4PJ8D 3PV7A 1U8IB 1PG7L 4PLKD 4LSTH 4PJ5E 4G3YH 1KCRH 2V2XB 4K71B 5HHMD 3SJVA 4YX2H 3QHZH 3HZYB 4WHTA 3UTSE 4Y89A 2BOBB 3UROR 2I07B 2BXYA 3BP5B 4YH6A 5C7XH 5DI8A 3GB7B 2VDQL 4UIKH 4ZFZA 4EZMA 3O0RL 1Z6JT 3HNTH 3D39D 1XGRB 5EBWA 3V5HA 3CDCA 4K7PL 3KR3H 4F57H 3O8XC 3D25A 4HUXA 3GSVB 4ETYA 1YY9C 5AD0B 4PRAB 2LTQC 3MACH 4KVNL 4LEOA 3MJ9A 4RFNC 5INCA 4LNVA 1FIGH 1PD6A 1AR1C 3ARPA 5FGSA 1EAPB 4J4PC 4XWOD 5F7DA 3TVMB 1F4HA 3S34H 4NM4H 1IC5L 5LBSH 4QOKB 5C08E 2YC1B 3UYRH 2BY2A 3FB8B 3MV9B 3CZFA 5ALBL 2XRAL 5F9WC 1UQSA 3HHRB 1T7YA 4TVPD 5JW5A 5FYLE 3TT3H 3W2DH 2APWA 3IT8D 4XMPL 2YA2A 4QRSB 5FO7B 1CIDA 4N90E 1SM3L 3H9ZA 2AABH 4NYLB 3V7AE 3VG9C 3OKKB 4JN1H 4K23H 1NC2B 2AI0L 5E2VH 3U4AA 2DMKA 1T1ZA 3EZJB 5DTFB 2GSIB 3BKML 2PTTA 3QUXC 2Q6WA 4MJ4A 4YJZL 2WWKO 4OZIE 2V5MA 3F8UB 4GO6B 4F37K 1UXWA 4U49A 5MI0C 3DPBA 3QDGB 2DQIH 3GSNH 2ED7A 3HG1A 2HLFD 4KMTL 4N0FA 4P5TA 4JM4L 3M8OH 4IRSD 4ELME 4ELKB 3H9SA 2HVKB 2PF6A 1CD1B 2CO6B 3REWA 1TCMA 4HS8H 2GT9B 1E4KA 2R2CA 5D1QA 4AH2A 1LMKA 4MQXC 3PQYB 1VFUA 5DJXB 1MCRA 1YPZB 2WQRA 4LARL 2YRPA 4Y4KD 5FYKU 4LLQA 1OAQH 1CL7L 3WS6A 2ZUUA 3JBG7 3I6LD 4LKXA 4JM2D 3QO1B 3ARTA 1QSFA 4RGOL 2X44D 3KWWA 4WUKL 1ZLVH 3ORJA 4IMLA 3TN0A 3GIVB 4JG1H 1CLOH 4X7SL 1PKOA 3SKJL 2X1QA 5F6HI 3TNNA 5IVZB 4OI8A 5FCUH 5EUOA 4OBSA 4WCYL 4NJ9L 2NW2A 5TPWH 1G9ML 4LCYB 3QDJA 3BDYL 4R4BB 1I1AD 4YHML 1ZOXA 3OHXA 4K7FA 4QY8B 2DB8A 3UBXA 2Y36H 4DW2L 5E6ID 2E7LC 4X0KB 1ZGLM 2YSSB 1YUHA 5DR5L 4XAWL 5FUZH 3QEQD 1DL7L 1KCVH 2D3VA 3EOAB 3VH8A 4CVXA 4YQXL 4Z0BL 1XCTA 5FIEA 2GCYA 2GJ6B 3NCYP 5IROA 4GRWH 4GG6B 3GHEH 4XVSH 3RY6C 5JPMB 2W38A 1RZ8B 4LSQH 1G7HB 3GRWL 2CSPA 1K3ZA 5KVMC 4HK3J 4QRTB 3UJTH 4PJ9D 4OM1H 1KJMA 4NQEA 1K4CB 4HKZB 5TE6L 2HG5A 5I66A 3DVNA 5IVXB 3QDHA 4WJ5A 3MYJA 3WUZA 5I1CL 4TTDC 4N0CC 2NX5E 3MXVH 1EZVY 3V6BR 3S3PA 5FGCE 12E8L 4KPHL 4JLRA 4NT6A 3WD5L 1WCBB 1BD2E 4AMKL 4PFEA 2M26A 15C8H 1AGCA 2FECI 5C0BA 2MJWA 5KSUB 2O61A 1NANH 4JPVL 4X9BA 2F53A 4JRXA 3KJ4C 4JY4B 4RMQA 6CGTA 3W11D 4KJYB 4O2CB 4QGTA 5LXGH 1AD9B 1RUAL 1CE6B 1R5VB 3P11L 4FZEL 4GW4B 4NJAL 3PUCA 2R1WB 2VLJE 4UTAL 2BMKB 5ALCL 1TVHA 1IGYB 4I0PA 1KOAA 4LFHD 3DIFB 3O45A 2VLMD 3HZVA 2FL5A 3V5DB 4HJJL 1S7QB 4GRLB 5GS1C 1UVQA 3MLUL 2AKRB 2VRAA 3RJQB 2B0SL 3LRSA 4M93C 4YDJB 4K3JL 4FQJL 5CJ8A 3ZT5A 4M1DH 1JRHI 2XA8H 1NCBL 1U92B 4PJ5A 4C54A 5GPRA 2XTJC 3G5VA 4PS4H 5IMOB 1JYNA 2NW3A 4JCMA 1AKJB 1XR9B 3C08L 5I17B 1G7PA 4P4KC 1GXEA 3HNSL 3QO0B 3DX9A 4OM0H 3RGVA 2J6EH 5FUOL 3DGGA 3WNPA 1QRNB 5I8KH 2J8UF 4FQQB 1B0WA 4LPYA 5B38B 1A9BA 5D2LE 3BFOA 3AVEA 1A4KB 5B8CA 2HT3C 3DVIA 2PYEB 4MA3A 4EJ1C 4R3SA 4PRIB 5CINH 4YDIH 4YAQB 2A73B 3VA2C 1IEAB 2YD1A 4WDIA 2XN9A 3BPOB 5E2JA 1AO7B 1HXMB 2CRYA 5F1NB 1FL5A 1CXEA 1TETH 4P3DA 3DHMA 3HZMB 5C08A 1G84A 1RU9H 3GJEA 1I85C 4LSPL 2FGZA 2VLKB 5IIEB 5C2BH 2R0ZH 3D87B 3QWQB 4RMUA 3IAQA 1SMAA 1MLBA 1S7TA 5IKCA 4KRPC 4IOFD 4BK4A 3RWEB 4R97B 1Z0NA 4M5ZH 1P7QB 4WI8A 4BH7B 4Z7OE 2VLRB 5IBLD 3IJHA 5E2TL 3OR7B 3VFGL 3J8F7 3O4LB 3LEYH 4HKXB 1HI6A 5CJOL 1U8OB 1INDL 3HRZA 1R3IH 5EU4A 1TLKA 4R7DB 2AGJH 3X13B 3P30L 2GTZB 5H37H 1FNFA 2ARWA 5B39B 5CEZE 4KDTA 1I9JH 1RSFA 3GSUB 4GQPH 2D7TH 3QDMD 2WBWB 1RMFL 4YDLB 4QHLA 3WV0A 4LVHB 3BYYA 3CLFH 1VERA 1MAKA 1UJTA 3RI5K 2FWOB 1L7TL 1U8PB 3HI1A 4DKEH 3O3EB 4JDTL 1KTLB 3LQAL 4UOJA 5C2UB 1EJOL 3SO5A 4ELMA 3CFBA 2ZNWA 1BVKA 1KCLA 5GGTA 3WL9B 4UV4H 1KN2H 2A2QT 4ZYKA 4TNVK 4GMTL 4QHUB 3TYGL 3QBTB 4NRXB 5D96B 1DEEB 2QQNL 5HVGB 1TCRA 4TSCL 1A3LL 1NC4D 4NOFA 5AZ2L 1ZT1B 4Y19A 1S9XA 3G5ZB 1ACYH 4LCUB 3G5XB 2WWMC 3R0MA 1RURL 4OUUB 3A67L 1HYSD 1IAII 4PJ8C 3LQMA 5ESQB 4Y5YA 4PLKC 4Z7VE 3N1PC 4NZDA 4QOKE 1ZHBA 3L7FB 2P42B 3MV9E 4MNHA 4Y8DC 2EYTA 3EJYD 2XWBB 1OGAB 2RFXB 1JF5A 2ZKHH 2CDEA 3VFRA 5L2JB 1MELA 3H0TB 2VR4A 1FGNL 4OFYA 1UYWL 4U1HA 1S7XB 4P2OD 4PLNC 4ONHA 1HK6A 4M7LL 3HE6D 4P23A 3SDDD 1KT2A 1F97A 3BUTA 4N8VB 1IILE 1N59B 4QXWA 3BEVA 1P84K 3WO4B 4OB5L 4XWOC 2BRQA 2HJLB 5K9JH 4U1IA 5I1HL 5TFSL 5IB1A 4YEEA 3DVFA 3QDGE 4KXZI 4BH8A 4X4YB 3TC9A 1HINH 1A7OH 3ESVF 4R4FH 1AGEB 2NX5A 4JQIL 3D0LB 5SWQB 3L3GB 3VWKA 3ROLA 4OD3L 4Q7DA 1A1NA 1BAFL 1KPRB 3PQYE 4ONOA 5INDA 4Y2DD 4IJ3B 3UPCA 4HS3A 1BD2A 3MGTB 4TVSa 3S37L 5CKGA 1ZLSH 1YPZE 3GSWA 1Q9WB 3HKFA 3TIEA 1A6ZA 5FXCH 5D5MF 5A2IH 3QIBA 3CFCL 3U9UA 3QIWA 2Y6SD 1CWVA 1OAYH 1J1PL 4M7LT 3ZDYF 3MRCB 1U8NA 3IDXH 1JI2A 3IB4A 2QL1A 1E6OL 4PJ7F 5E1HB 4LVNB 3EJJX 3C9NB 3CFEB 4DZBA 2GJZB 3VFSB 1FZOA 5J11B 4WW1B 2VLJA 2AEWA 2HLFC 1AHWC 1GHFH 1NGXB 4MQSB 4DVBA 2AJXL 2I60H 3BDBA 4CADA 4IRSC 3UYPA 1VACB 2OX5A 1FNSH 3MUHL 5ERWB 2YD3A 4W81A 4DCQA 4HULB 1LVEA 1ND0A 2EH7L 5T5NG 2R69H 1DBAL 2ZUXA 4G6FD 5D93C 4JM2C 4S1SL 3FL7A 3PWLB 1JRHH 2ED8A 2GJ6E 1LO0L 3QEUB 4JQXA 5K59F 4GG6E 5GS0D 3H42L 5DQDH 2NY6B 1IVLA 1G1CA 3BVNB 4LF3A 5KVDH 3B9KB 4NKOA 3PDOB 5C6TL 4E41B 1NCWH 4BQ8A 1RIHL 4NNPH 3UZVB 4Y8AA 3B9VA 5JIKA 4WWKB 3PP4L 1G7LA 2OLDA 3QAZC 4MX7B 1EEYB 1IQDA 1JUFB 1JTTA 3QPQD 1DVFA 4TUOB 5IVXE 1I1AC 5E08H 4A6YA 1FYTD 2J8UB 3PIQB 1V05A 3PGDA 4NC0B 4ZQKA 4WFED 4JHWL 2X4SA 1P9MA 1KLFA 1R5IA 5E6IC 1WFTA 4KI5E 1HHJA 4XH2B 5LKNA 4JPKH 5J9PB 4XNMB 3SKMA 1RZGA 3TCLB 5JQ6L 4ZUUB 3V7MA 4XP5L 4KMQA 4CMHC 2Y7QA 2P24B 2QSCL 2ZJSL 3WIFA 4GS7B 1EEZA 1IGJB 3QFDB 3WIIH 5FHAL 4U1KB 3DMMD 3HMWL 2HVJB 1A7QL 1XZ0B 1RZKL 1NH6A 1RUPH 5E99L 1T2QH 4PJAE 3AU1B 3TIDB 4FFWD 3CXDH 4PJ9C 5IMMB 2I26N 4JFDD 3T0VA 1QEWB 5J0BA 3QRGH 4FRWA 5BRZD 1MEXH 4K8RL 1AXTH 3EHBD 4FQIL 4L4TD 4TPRH 2BY3A 4EDWL 4KRNA 4NUGH 1U58A 3WNMA 1S7SB 3GSQB 2I9TB 1WFOA 5IWLA 1SVZA 1E28A 2VDML 3I3EA 2YZ8A 1OAXH 4KJQD 1KNOA 2C3GA 2ZSWA 4I0CC 1R24A 4RGNB 2VDPH 2Z35A 3F6IA 3MC0A 5C09D 1NGZB 4XXCC 1CFNA 3ARBB 4JPIA 1KJ3H 3NCMA 4K3HA 4FOMA 1U8IA 1CD8A 3L5XH 3PE9A 2ADJB 4Z78B 4FQXD 1N64L 5J13C 2V2XA 5I15L 1BFVH 1EUTA 4KH2A 3W11C 4R0LC 3SBWC 4HXAL 2CK2A 1MCKA 4UDTB 2BOBA 1IGTB 4HKBA 2I07A 3BP5A 4KK6D 4TRPL 1FNAA 4GKZA 2BNQE 4YBLC 4JANB 4LPVA 4Y5VB 1QRNE 3WN5C 1XGRA 5E7FA 1CIUA 3K1KC 5BV7H 1KJ2H 3BO8B 3GSVA 2PYEE 5JLZB 4PRAA 5E94B 4BQCA 4RBPH 2GK0B 4F9PC 5IUSA 4PRIE 3BW9B 4XXDB 1EAPA 5JDJA 1N6UA 4KHXL 4I2XB 1IAIH 1BECA 1AO7E 4Z7VA 3EO9H 4QOKA 2YC1A 5F7NC 2FSEB 3MV9A 3O8XB 2VLKE 3WS3B 4HQQL 3X14A 3VDBA 2P7TB 2LTQB 4RFNB 1XIWA 2YN5A 4PJEB 2H3NB 1QBML 1A3RL 5GGRB 2DYPA 4ZTPL 4G7YL 4MJID 4WI5A 5FO7A 5C0AB 1INEL 3SKOB 5J6HA 1X4XA 3MUY1 4Y1AB 2VLRE 4MAYB 1IAIM 4J8RA 5HYJB 3F12A 3O4LE 2NLJB 1CR9H 3OKKA 2AV1B 2NQCA 5DYOA 3T1WA 5F9WB 3P9WB 4GRMB 1IGIL 2GSIA 1NUDA 3WXVL 5EB9A 5IB5A 5KW9H 4AL8H 5C0EB 5JUEH 3QDGA 3IF1B 4DTGL 1A21A 2QQLL 4KXZH 3C60D 1CS6A 4KGLA 5J3HD 5F96H 5T5NF 3GBML 4M6OH 4ELKA 5K9QG 1CD1A 2I27N 3KHQA 3QUXB 5HYQB 2GT9A 4HDIB 3MLYH 5JW4M 4HBCH 4O5LH 3GJFB 2YD7A 3PQYA 5IBLC 4ZFGH 5MI0B 1JWMA 3VD9A 1MCPH 3BSZL 1YPZA 4JFXB 5T1MB 2ZUQC 3VXMB 3JTSA 3BMWA 3RA7L 2JJTC 4M6AA 4HC1H 1XF1A 3QO1A 5F72S 2P45B 3GDBA 1KUMA 1F11B 4ONGL 4YWGH 2X1PA 4LCWD 5DGRA 5D5MB 3GIVA 1X5ZA 4A6YL 4LSVL 4OCYH 1IARB 3BGMA 4MD5A 5IVZA 1F00I 1RFDH 4LOUD 1QQDB 5C07D 4DFHA 4YXLL 2XZQL 4FZ8H 4PJ7B 3HCVA 3I2CH 3QULB 1FZMB 4LCYA 5FGRA 1DQMH 4I3GA 2LAAA 3BI9X 2MQ3A 4R4BA 5DRXB 1UM4L 4XPHL 1EEUA 4OLVL 4PRDB 1UWGL 1HQRB 1OGAE 2HWZH 4FQCL 4PB0L 5CJBA 5J06A 3HUJA 4XMLL 4DUVA 1BVZA 2A1WL 4RRPA 3QUYB 1NFIA 1XF4A 1T0NB 4RWYL 3FT3A 3EOAA 3S3JA 3PDDA 2RAMA 2OCFD 4GG6A 1QLFB 4HGWB 2XKSA 5CGYD 1CGWA 2FX8H 3KPQB 2J1KA 5GGVY 1RZ8A 2A0LD 5J6GB 4OLZL 5E1AB 1NLBL 4JFEB 3O2VH 2ICWJ 2JJUA 4QRTA 5MEQB 1BF2A 3PP3K 1A7PH 2CMRL 2W9LA 5C1MB 5DJ0B 1K4CA 4HKZA 5DFWH 4POYA 1MAML 5IVXA 3EYFB 3RIFF 3VE0B 4KKBD 2B2XH 2EDFA 1EGJH 2VQ1B 1E6JH 2EKSB 3EJYC 5IMKB 5DD1H 3F7RA 3ARGD 3C5ZD 4PJDA 1FP5A 1ZTXL 4JPWH 5E24E 3BWUC 4PP2B 3S7GA 3ZHDA 1MHEB 3EOTH 4P2OC 1WCBA 5CCKL 4ZUSA 4HCRA 3HE6C 4XPAH 3KLAA 4W70A 1B3JA 1B88A 3SDDC 2UZXB 1G7QB 2ZCLH 1H3WM 5KVFL 1KEGH 2BSRB 4JY4A 4LLMA 4PJAA 5HI3D 4KJYA 4O2CA 2YUXA 1AD9A 5IVOA 5F88B 3NN8A 1CE6A 4OBRA 1BWWA 1OTSD 4L5FL 4D3CL 1FLRL 3KDMA 3KS0J 3M07A 5DJDA 2F5AH 2R1WA 4PR5B 3V4UH 2IPTL 3U2SA 1IGYA 4GAJL 5E8EA 4P9HL 3DIFA 5KVGL 3KJ4B 5C6WH 1FAIH 4TN9A 3V5DA 3ZE0F 1S7QA 2CKBB 4GRLA 3BPCB 4UDUB 4Y2DC 2AKRA 3K4AA 2I5YL 2DQEL 1WBZB 2ZG1A 2ZG3A 4PV8B 4H20L 1YEHL 5DXWA 1P7KB 2Y6SC 1U92A 2ITCB 3B2UD 5C0GB 5IMOA 5IFAH 1MF2L 1PSKL 3V52L 3WEXA 5ABDE 5E5MB 1C8PA 1AKJA 5GRVL 1XR9A 5GS1B 5B22A 4G9DA 4BQBA 4X6CA 4E41E 2P5WA 5F8QC 3O6KL 4PG9A 4JM2F 2BNQA 4M93B 4B41A 3UJJL 1QRNA 4YXKH 1DSFL 3THML 2R23B 4FQQA 4IDJH 3RVWD 1BMGA 1LEIB 5B38A 5EIIB 3FO1B 2XTJB 1A4KA 1FE8L 1JP5A 2J8UE 2QHRL 2PYEA 3A6CL 5JW4N 4P2QD 4HUKB 3OJDB 1I1CA 5D4QA 1PG7H 1BBDH 4PRIA 4P4KB 4YAQA 2YD5A 2YUWA 1VKXA 3CVHB 5F7WC 5F1NA 1HXMA 1EX0A 3FFDB 1KTDB 4Y7MA 4ZS7H 1KEML 3SO3C 5GS0C 1T6WA 2AXFA 2P8MB 5IBTL 2VDQH 5GGSB 1JK8A 1IT9L 5DDHA 2ZUTA 5IMLA 3O0RH 1TITA 5EBMA 2APXA 3C6SB 3RWEA 3FOLB 2VLRA 4HWBH 5E5UB 2UZIL 4KKLC 3QPQC 3OR7A 4F58L 4XC3L 2P43B 5BVPL 2FJFB 3KYAA 5DUBB 4R7DA 1UACL 1F8TL 3X13A 2GTZA 4JN2B 3IGAA 4JO2L 2CLRB 3GSUA 4Q6IC 4Z7NF 4KRPB 4IOSD 4HS6B 2DWDA 4F9LC 2BHZA 2XRAH 3T2QA 4RGNE 4HK0A 5L8LB 3GM0A 3MV8A 4FQ1H 4HAFA 1T66D 5JOFB 4MNQB 5IFJB 1FORL 1U8PA 4XNYL 1KTLA 2ITDA 3DMMC 4WUUB 1CYGA 1TFHA 5ID0B 1SM3H 4ZUTB 4HGMA 1V3KA 4FFWC 1MFDL 3B6SB 5GZOD 5H37G 3UTPD 3VFWB 3QWOB 5EULV 3BKMH 3EHBC 3E6FA 4PJBB 4DVRL 3GEWB 2R0LL 3AS3A 4XMKL 1DEEA 3IFNH 2O93L 4EIZC 2N7BA 3IFPB 2AJ3B 2IBBA 1FQ9C 1ZT1A 3G5ZA 1FAKT 2J12B 3RHWK 4KJQC 1RQ5A 3MJ8B 4LCUA 3G5XA 3WDJA 2M1KA 4KMTH 1JGUH 2CDFB 5C0ND 1MJ7L 3HPJA 4PRBA 5JPNA 4JM4H 3I6KA 1WITA 3C5JB 5ESQA 4I2XE 4FQXC 2N4IA 3WJJA 2V5YA 3MNVA 3L7FA 4HUWB 3ECBB 4CUCA 3DTXB 1NCAL 2QSQA 2XWBA 3VG0L 1OGAA 3H3PL 4MSWB 3NOIA 2DOCA 5BZDB 4KK6C 3CK0L 4PJEE 5MP6L 4ZAKA 1GYAA 3H0TA 2YN3A 5CIPA 4NHUB 5EFIA 1S7XA 3S36L 1PEWA 2YWYA 3MYZA 4PJ8B 4X7SH 1JFQL 5C0AE 4Y1AE 1ZS8B 3RI5F 5HYJE 1P5VA 4WI9A 2ADGB 1JTPA 4GAYB 3VGHA 3OQ3B 4XBGA 5C71A 3CSYA 5HHMB 3NIFE 4WCYH 5HYSG 3NTCH 1N59A 4PGZA 3BDYH 2HJLA 4YHMH 2DQGH 2R9HD 4PBVC 4ODTL 3D2UD 1VA9A 3D39B 1J0HA 2GK2A 5C0RL 3RTQC 4DW2H 3ZL4L 2ZWLT 5DR5H 1AGEA 1Q9KB 2ZCKH 4YQXH 4L4VD 4Z0BH 4UILL 2D7OA 2HFGL 1Q0YL 3D0LA 3MLRH 1KPRA 1U3HA 4ZO6A 3MGTA 1X5GA 3VXME 3GRWH 1Q9WA 3UPRB 2AVGA 5HHPA 2BNUB 5GGVL 1TENA 3HI6L 4FHBD 4OV5B 5TE6H 5D5ME 4FQPA 1JMZA 3Q6GH 3ZDYE 4JB9L 5L6YH 5I1CH 3FT2B 1I9EA 2H8PA 3VFSA 4WW1A 4UBDD 2EKJA 4PJ7E 2VITA 3C60C 1EEQA 1QACA 1NGXA 12E8H 2VKWA 5J3HC 4XNUH 1EHAA 5JTWA 3TJHD 5DC0A 3WD5H 4PBXA 1NCDL 3QHFL 5DJ8B 4AMKH 4KZDL 5ERWA 4BSJA 4GXVL 3RWFB 5BV7C 5FM5O 1BM3H 1C1EL 1OOAA 1G7JB 4G6JL 4ZOAA 4P5MA 4JR9H 3VI3F 2AV7A 1CG9B 4DJMA 1AHWB 1RUAH 1T0PB 3CDYA 5MEOA 4E0RB 3P11H 4IRSB 5L88L 3WNKA 4L1HA 4U6HB 4NJAH 2A77L 2HMID 3B9KA 1QSZA 4UTAH 4JFEE 5K59E 5ALCH 4E41A 1J8HA 1XR8B 5E4IA 3JVGA 4LOUC 1GPOL 1RHFA 2CDGA 4Y4KB 3BESR 4DGYL 2E3VA 4WWKA 4UOW1 1G9EA 2YEZB 1EEYA 1Q8MA 1U8LB 1F90L 2B0SH 3PIQA 3QQNA 1OM3L 2VO5A 4K3JH 1KULA 3LPWA 1IZJA 4FQJH 4ZUWB 5DMYA 3RZCA 4OQTH 1NCBH 3QYCA 2DLTA 4GAGL 4XH2A 3SGEI 3VXTB 5J9PA 4XNMA 1F4XL 1QFWL 1YYLH 5F7FA 4ZUUA 1U95B 2LVCA 2K9UA 3QAZB 4GQ9L 2W65A 4IMKC 1BOGB 2P24A 1I1AB 4M00A 5CGYC 1CLCA 3EW3B 1S7RB 3DETD 2A0LC 4U1KA 5FUOH 2HVJA 1XZ0A 2G60L 3F7QA 5E6IB 3AU1A 3TIDA 2LV4A 4OD2B 1VGEL 3AM8A 4PV9B 2CR3A 3QEQB 2A83B 1Z9OA 3SDCA 1QEWA 4GUPB 4CMHB 4KKBC 2AK4A 4PGCA 2OI9C 2R15A 3G6DH 5FECA 1CK0L 2DLIA 1Y18B 3B4NA 4RNRB 3EGSB 3GSNB 1S7SA 3ARGC 3C5ZC 3PHSA 2I9TA 1CI5A 1JHKL 4XPBL 4Z76B 3LKOB 1V7ML 4QHMB 4PJ9B 2YPVL 3I9GL 25C8L 5JMRA 1NGZA 1BQHG 1G1YA 2BVUA 4X6EA 3TM6A 3T08A 3WFCH 4Z78A 3P0GB 2DBLH 2C3VB 5HI3C 3BP6B 5E2TH 5EN2B 5CJOH 4UDTA 1L4IA 3DJ9A 1IGTA 2YA0A 4M03A 5L8KB 3UZQA 3P30H 5BW7C 4JANA 5CKAA 1MJ8H 1SHMA 4HAGA 2MWCA 5DJYB 3I84A 3JV0A 3NIGF 5ENWA 3BHBA 4FXKB 4ZTOL 1X5HA 1RMFH 5J13B 2XTJE 1U8QB 3MR9B 4R0LB 5DUPL 5JLZA 5E94A 4JDTH 1GC1C 2UY6A 3LQAH 4AENB 2GK0A 2DJUA 3BW9A 3AB0C 4MDIA 1EJOH 1Q94A 2DMBA 4XXDA 3RNKB 1BBJB 2DICA 3EO0B 2NR6D 4I2XA 1PZUB 3WN5B 3PJSA 3B2UC 3RX8A 2FSEA 3J7HA 3DSFH 4YHNB 3WS3A 3TBTB 3TYGH 2P7TA 4P5TD 1KCUL 3B8YA 5B3NA 2Z92B 5IB2B 4PJEA 4TSCH 3FRUB 5GGRA 3FMGH 3VGBA 3L5WB 4OLUL 4J4PA 3DYOA 5C0AA 1WZMA 5AZ2H 3SKOA 4Y1AA 4AQOA 4MAYA 1E4WH 5EUKB 1FNGB 3RVWC 2FX9H 4XNXH 3IDJB 1NDGB 4XGZB 2NLJA 1F13A 5F7EL 3A67H 4YO0B 1JPGB 1OPGH 1NAKH 4AIOA 1QSFD 4GRMA 5FO8B 3TN0D 3O81A 4HWEL 4OIIH 5CEXB 4QRPD 2GFBB 1K4DA 4KDWA 1A7NL 3IF1A 4EUPH 3V5KB 4MNQE 2YD2A 2C7UA 5DA0B 4GSDL 2EDLA 2EIEA 3PXHA 1TJGH 1I3GH 3LEVL 1FGNH 1UYWH 1QFUL 3KYOA 4WUUE 2OJEB 5D7JD 2XWJA 4FFYL 3W9EA 3QUXA 4M7LH 5HYQA 3JWDC 1OB1B 2C1OB 4HDIA 2Q86A 1I7TB 2APVA 3LS5L 4B0MM 1CTOA 5GRXG 2ADFH 4L3CB 4PJBE 1MAJA 4LDOB 1OQOA 5I1HH 1F11A 4P3WA 2IFGA 5D5MA 5JO5B 4Z77A 4MXWL 1HCFX 4OLWL 4X99B 1M71B 1T66C 1FDLL 1QQDA 1VFAA 4YUEL 4XCFH 4PJ7A 3A6BL 4J3UA 2EDXA 4JQIH 3QULA 4U1LB 1W0VA 4OD3H 1BAFH 3BAEL 3S37H 4LRIA 3HS0A 4U0QB 2Z9TA 1HQRA 3QDMB 5GZOC 2Q7YB 4OZ4B 1UADC 4U1SA 3PNWB 1WWBX 3BH8A 1H5BB 3DYMA 3QUYA 4GKSB 5IB3B 1T0NA 4H25B 1F4WL 3TEUA 5DJ2B 4O58H 1SY6L 1QLFA 3VFNB 4BZ2H 4HGWA 5HHME 3KPQA 1J11A 1WZKA 5KTEH 3VWJB 3MRMA 5E1AA 2MQ0A 4N8PA 1UZ6F 5C0NC 1FGVH 2P46B 2AJXH 1MFEL 2KH2B 4JRXD 1NSNH 2E7LA 1DQDL 2R2EB 3O2DL 4TUKH 3K81A 4OFDA 1QA9B 3O6LL 3D39E 4MXVF 4YBHA 1R3KB 3EYFA 2EH7H 1NC4B 2WZPD 2APBA 1DBAH 3RY6A 5DD5L 2Y23A 4GKNB 4S1SH 5I1IH 1LO0H 5GGSY 4PP2A 2HLAB 3U7WH 3SGEH 1MHEA 1JJUA 4WU7B 32C2B 2IQ9H 5EIVA 5C6TH 1GZPB 4M3JA 3U7YH 1RIHH 5HD8C 4G8IB 4RDQG 3GI8H 4HUMB 3PP4H 2IFFL 2BSRA 4TVPE 1I1FB 3QNXB 1T7VA 5F88A 2R9HC 1BEYH 3QH3A 2JK5B 5AYUH 3BZDA 2E8ZA 1XGQB 3QJFB 2VR9A 1P2CB 1T04B 4P2OB 1A9EA 4XP1L 3QRFM 3S88L 3HE6B 3RGVD 4PJHF 2MCPL 3U1SH 3SDDB 1IKNA 4O4YH 3SE4C 2DQDL 5T1LB 5JQ6H 1NGWB 1EVUA 3BIKA 5CJXC 4XP5H 5IF0B 2X05A 2QSCH 2CKBA 2ICWI 4K3DH 4G6MH 3BPCA 2VB5A 4UDUA 1IAMA 1U0QA 5FHAH 4EBQH 1G7IB 3HMWH 3ZE0E 3T65B 1WBZA 4PY8J 2DD8H 35C8L 3ILQD 3IDNB 2XN9D 1P7KA 4NQCA 2UVFA 5C0GA 3X17A 4JKMA 5E5MA 4K8RH 4LSDA 5GS1A 4FQIH 1SJVA 5I1DB 3TYFA 2P1YA 1DQTA 4EDWH 4UBDC 4CVZB 4LPTA 5HDLA 4NO3B 5E8DH 4N90D 4U33A 4RMTA 3I6LE 1A8JH 2VDMH 4DAGL 4LMQE 3TJHC 5D71L 1N0XL 5HYSB 5FUCE 1R3HB 3L6FB 5I74C 1DANT 3BRFA 3OJDA 3EDFA 4WWID 2PO6A 4YFDB 4P4KA 1NBVL 3EZ8A 2ZNXA 2A74B 5I15H 4HJ0D 3HFML 1G9MC 3CVHA 5DURD 4HXAH 1MHCA 1KTDA 1OF2B 3OAUH 1U6AH 1ZA3B 4TRPH 1LNUA 3RQ3A 1L9NA 2P8MA 2HMIC 5GGSA 3V8CA 5GS2H 2E6PA 3FO9B 4QXGL 5IHLB 1YMMD 3ARDA 1TNNA 4PUBL 2VZ1A 4E9LA 2V5SA 4G6FB 3TBYB 3QEQE 3FOLA 5D7LD 2FJFA 1EDQA 3NH7H 4C4KO 1I85A 3SO3B 2IADA 5DUBA 4PD4J 4N9GA 1WFNA 1UH2A 4JN2A 3GSRA 2CLRA 3P4MA 1C7SA 3ZSSA 4LQFH 1YDPB 4Y19D 4HS6A 4NQXB 5IK3A 4OLEA 3PWJB 4OZFA 1BVLB 3GMQA 4OFKA 2YD6A 4J23A 4K8RD 4Z7NE 2DDQL 5JOFA 1JPFA 4MNQA 5IFJA 1QBMH 4L8BB 2H45A 3DETC 1JHTA 1FYTB 4NQVB 2VJXA 4HLZG 4KJPD 5ID0A 4NFBA 4ZUTA 1RUMH 4Q6IB 3JSSA 3V0WH 4G9FA 5KSBF 1FG2B 2AW2A 3VFWA 2LABA 2EDTA 1CGSH 3QWOA 1IGIH 4PJBA 4OFYD 5HTSA 1T1YB 3WXVH 2IBZY 1SBSL 1LWRA 1LP9F 4LLAA 3DMMB 2GY5A 4ZSOB 1WEJL 2AJ3A 4FMKA 1SJEB 3NIDF 2DLFL 2LU7A 4S1QL 4DTGH 3RWHB 3RDTA 3MJ8A 2F15A 4JFDB 2WQ8A 3GBMH 1CCZA 3KJ6L 3QJHB 5BRZB 3C5JA 3S4SG 1IC4L 4L4TB 1REIA 1I9RL 2NY7L 4AY0A 2VDKH 1KB5B 4HUWA 1LHZA 3ECBA 2VLME 3DTXA 3BSZH 3QPXH 4PGEB 4G8GB 4MSWA 5BZDA 3PHOB 4UB0H 2VH5L 5IOPA 4ONGH 3VD3A 5C09B 3VXUD 4P9ML 1T3FB 3VWKD 4RDQF 4PJ8A 4WI6A 5AEAA 5E2UH 1BF8A 2E8YA 1LD9B 3WIHA 1RZIA 4L9LC 4FQXB 1RIUL 2ADGA 2JELH 5JA9A 3V6ZA 4UNVA 1WJ3A 4JEGB 1TJIL 5KS9F 3IAGC 3QIBD 1UKSA 3AC0A 3RRQA 1CFVL 2MKLC 3F7VB 5CP7B 1ROWA 3WHXB 4LVEA 4APQD 2I9LA 3F62A 4Z18A 2NR6C 2CIKB 1W72B 4BM7A 4QXUH 4OCXL 4OLVH 1J86A 3BPLC 3D39A 4FQCH 2WW8A 4N1EA 4E5XA 2VLJD 3SE8H 4XMLH 2A1WH 4P5TC 5AUMB 1Q9KA 2OR7A 5EOCJ 2AEIT 1WBXB 4OD1L 5DVLA 2NZIA 4OLZH 1BQHB 1NLBH 1WF5A 5DF0A 4LLUB 2BNUA 2D03H 2IAND 3G6AB 2QQKL 2CMRH 4OV5A 4HLJA 2VXQH 3TN0C 4WY7H 5J1AA 4MJIB 2D31A 2XZAH 3KPNB 4RAHA 3FT2A 5I71C 4XTRC 1FH5H 3P4NB 2F19L 3DOSA 2V5TA 5DZOA 1ZTXH 3OG4B 5EOCL 5FYJL 1URLA 3FT4B 1DVFD 5D7JC 1ZEAH 4PJHB 1MCOL 5DJ8A 2GITB 1ZLWH 3RWFA 3QDME 5DD0L 5LCVL 3TNMB 1QUNA 4PJXB 1G7JA 2OTUB 1I9IH 3C60B 1CG9A 1AHWA 2XICA 2GTWB 3IDMB 4D3CH 4L5FH 5IROC 1FLRH 4IRSA 4DGIH 1TJHL 4F33A 5FDYA 4U6HA 3ZLQC 2YMXL 4ODSL 2JJVA 4M7KL 3I3DA 2IPTH 5BV7B 1XR8A 1KJ2B 4GAJH 1UKTA 1Z5LB 4P9HH 4Y4KA 5KVGH 2DIJA 1LO5B 2YEZA 5H2BA 1HH9B 3MBXL 4XNQA 4GLRI 5GSRB 5GSVB 5BO1H 3CFDA 3VXRD 3DECA 4H20H 1J1XL 1X3DA 4LPUA 3QNYB 4ZUWA 1YEHH 5MHSD 4ZG1A 5C07B 3VXTA 2ATPB 3L3JA 3R4DA 3V52H 2D7QA 3UAJC 3MRQB 2YRZA 4BK5A 2X1OA 1ZHLB 3CSGA 5LGHL 3OXSB 3ZDZE 4HMEA 1AGBB 2VWEC 4TNWF 3ULVH 3UJJH 5GZND 5HPOA 1DSFH 2DQCL 5IFHL 1YEKH 3OR6B 3H9HB 3QEQA 2A83A 4GUPA 3FQRB 4KTEL 1QFWI 1Y18A 4RNRA 4OZGF 3EGSA 3GSNA 1ODAA 1OP5H 2XKUA 1HEZB 3OWEA 1VEPA 4OFPA 1A3QA 1NCNA 1KEMH 4X9IA 3LKOA 3V8OA 2E6QA 4PJ9A 4FS0A 2F5BL 5IBTH 1ZKAA 2WWKT 4P5KB 5AWNL 5F8RC 4ZD3L 4KAQL 1SYVB 3TT1L 5KN5B 1U36A 4M62H 4ERSL 2OI9B 1RK0B 4I18B 5EOQL 2OYPA 1HHGB 4OLYH 5IT2L 4XPFH 3WIHL 2C3VA 4XNZC 2UZIH 3BP6A 3ARGB 3C5ZB 4G8EB 4F58H 4XC3H 3RPKA 1TZIB 2CGRL 5EN2A 2PTUA 5JW4R 1I8LC 1C5BH 1XIWD 3CIQA 4RFOL 4WGVB 1CE1H 2DYPD 4JO2H 3RGVC 1MHHA 5KSBB 1NUGA 1RK1A 3U46B 1ZGLA 4NFCA 1U8QA 5DD6A 1YJDL 3MR9A 4R0LA 1LP9B 2VN4A 5B8CC 3QWRD 1FORH 2DWEB 2IG2L 3NIGE 4K9EL 5I1AB 4XNYH 2ZPKL 4G7VL 4AENA 1JBJA 5CAYB 1BBJA 3L3DB 4ODHL 4CL7A 4RAUB 3EO0A 3ILQC 4O9HL 5ETUA 2VZUA 1AQKL 3O3DB 4G80B 3T3MF 3SQBA 4YHNA 2FRGP 5D7SH 4Z7UB 5EO1B 3WE6A 1FO0H 4QNPF 2Z92A 2R0LH 5IB2A 1ZLWK 1BX2A 4UQ2B 3AB0B 1IL1B 3QNZB 2Z8WC 5T3ZH 5ESVB 3C87A 2ZZUT 1PFCA 3IDJA 1CDHA 1MJ7H 1QLRB 1MFBH 4NP4H 3QFJD 3VFTA 4X5LA 3KGRA 1JPGA 2FLBT 4JO4L 1DR9A 5TF1H 5FO8A 3A6OA 4KDTC 1NBYB 3ZE1F 4HJ0C 1O0VA 5CEYB 1NCAH 2GFBA 4JQVA 1KCRL 4JJ5B 5ANMB 2DQJL 3H3PH 4MWFB 2AJSL 2KPNA 3K4ZA 3MXWH 4NSKB 5JXAL 3CK0H 3QHZL 1UB5B 1FYTE 5DVKA 2X40A 2WSKA 4P2QB 2DI7A 2CLZB 3S36H 2QSTA 4WFEE 1JFQH 4UIKL 1AC6A 1OB1A 1ULVA 2A9MH 2C1OA 2PNDA 4XZUA 4XP4L 3S97C 4ONFL 3HNTL 2OXHA 4Q9BA 1JGVL 5L7XL 3KR3L 4F57L 5FA4B 1MPAH 5FAAA 5GRVK 2BHUA 4L3CA 3VDAA 3MACL 5FO9B 3KYMA 2PW2A 1RZKC 2D0FA 4ODTH 1YEIL 4JO1H 4ZSOE 4HIJB 1EO7A 5KVEL 2F8VA 1OP3H 1G6RL 3ZL4H 3S34L 4NM4L 1JGEB 4H0GA 3MNWB 4JFDE 1OGTB 3GMMB 3ZKMD 4X99A 1M71A 5T33H 4R26L 1OT1A 4XX1G 3UYRL 5ID1B 4IEFB 4Q2ZB 1BHGA 1RJCA 2X1XR 1MCLA 3LZFL 1FVEB 4EQ3A 4MA1C 1Q0YH 4U1LA 2JJTA 4Y5YC 4L4TE 4NPYB 5EC1A 4KJPC 1LE9B 3TT3L 4KDVA 4WI7A 3MLTB 2YWZA 1Y6NR 1OP5K 2XKNA 1SVCP 1NCCL 2AABL 3S3SA 5C0JA 4G8GE 2Q7YA 5L0QC 3MRLB 4OZ4A 2QV2A 4I13B 4K23L 3PNWA 5C09E 1H5BA 5E2VL 2E9IA 1VADB 2WUCL 2R1YB 5IB3A 3GMOB 4H25A 5DJ2A 3U36A 2J6EA 1JGLH 4P23C 2VE6A 3D85D 4PP1D 3VXPB 3VWJA 2DQIL 1RZ7L 1F3DJ 4OCLC 4KZEL 1MCJA 1J87A 5CMAB 3ARFB 1NCDH 1UZ6E 3GMPB 5ACZB 4PRPA 1U9KA 4GXVH 1P6AB 5DVMA 4JDVB 1R3KA 3UTZA 4UAOC 4E42B 1NC4A 1C1EH 2ZP0T 4GLRH 4H0HB 1QD0A 3K1DA 3OAZH 2DMCA 1ZHNA 2IGFH 4MXVE 1JYVA 2VDOL 2EC9T 1OAQL 4I5BB 3VWKC 5JZ7D 4LBEB 2A77H 2B39A 3CX2A 32C2A 4XPGH 4HH9B 2ENSA 3BP7B 1JWUB 1CLOL 4JG1L 4NOBA 4F3FA 5ESAB 4CGTA 2C4FT 3NCBB 4BFIA 1BLNB 3QIBC 4G8IA 1PBYA 5TE4H 5F3BB 4O2FB 4KU1A 1MSPA 1MCFA 1A7RH 4X4XB 4APQC 2VDRL 2OL3L 3C2AL 3QNXA 1K8IA 1F90H 4Q9RH 5TPWL 4X4ZA 4M8QA 2JK5A 1ZMYA 4MJIE 1XGQA 3QJFA 1OM3H 1P2CA 1T04A 2P5WD 4P2OA 1Q9LB 4RCAA 2BNQD 2PYFB 4M4PA 3HE6A 1S3KL 3SDDA 2Y36L 5D7IF 1F4XH 1QFWH 5T1LA 4LSRH 5KSVB 1NGWA 4PJHE 3HAEH 5IF0A 3GSOB 5FUZL 3KYKL 4OZGB 4HW6A 1KCVL 1ZVSA 3G5YA 3D2UB 4OKVB 3GHEL 4XVSL 3PF2A 3S4SB 3T65A 4PJXE 4LSQL 3IDNA 1I3RB 4AEFA 4JQXC 3K74B 3UJTL 2FNBA 1CK0H 5I1DA 2ED9A 2CO7B 4CVZA 4NO3A 1JHKH 1S5HB 3LOWA 3QUML 1Z9SA 1ZHKA 2DQFA 2NY3D 1V7MH 1DVFC 2YPVH