5IW1B

Crystal structure of b4.2.3 t-cell receptor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
233
structure length
233
Chain Sequence
VTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSLGHTEVFFGKGTRLTVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYALSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-CELL RECEPTOR ALPHA CHAIN
publication title An allosteric site in the T-cell receptor C beta domain plays a critical signalling role.
pubmed doi rcsb
source organism Mus musculus
total genus 51
structure length 233
sequence length 233
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2016-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw1B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw1B02
2XACC 2OTWB 3CSGA 4ZUWB 4EOWL 3EYSL 4I4WB 4XRCB 3JTSB 1VSCA 4G6KH 4P2RE 5EO9A 1S7VA 2AERT 5MEOB 3PQYA 1DVFC 2X7LA 2WM0A 2R69L 2H1PL 1OP5K 5ESQB 5INCB 5GGQH 2I07A 1OAKL 4DKAA 4HV8B 3MRJB 3G04A 1A21A 1AXSB 3JV6A 3FFCA 4MNQB 5FO9B 2AEWA 3ARGC 4DKEH 5IFAL 3HZVB 4YK4C 4HS8H 3MLWL 4BH7B 4D0CA 4LVEA 3D87B 2XN9D 4GS7B 3P4MA 3WUWA 3BDBA 3EGSA 3UPRB 5J9PA 1L7IL 1ZSDA 1JI2A 3QUYD 1ZEAL 2VDRH 4FN0A 4RGNB 1S7RB 4OCNC 3DMMB 4KK8D 4L5FH 4K7PX 3V5DB 4RIRA 4GW4B 5EORL 3VWKC 5FA3B 2XNAB 4YZFF 1A9EB 3K4DA 2ZWLT 3TC9A 1BZ9B 4HDIA 5JOFB 4F33A 4OZFB 1CTOA 1TTGA 5JZ7C 3CFJB 1FVCA 3DOSA 4B53A 4LCWE 2WK2A 1UH2A 4JO4L 5ITFB 3S98A 1MFCL 5D2NE 3OKKB 1YN6A 1UM4H 5CZXD 2V5MA 4MZ2A 3O3UN 1U58A 3FO9B 5IW6B 3BVNB 2AK4D 4P5TC 1BQLL 4CKVX 4AIXA 4NRYB 1I9IL 4M43L 1NMBL 2D31A 4BZ2H 4PRAA 3WFCH 3P4OA 4S1DC 5ICZA 4U6YA 1J0HA 5KVDH 4RRPG 2B39A 3ALXA 4ZG1A 4NUJA 3WLBB 4XVUD 5DJAA 3WBDA 3VD4A 4KDVA 1QFHA 2FB4L 1Q94A 3MYZA 4G8EA 2QHRL 4KI5C 1QNZL 3G5VB 4KHTH 4P2QA 3VXRB 3EOBB 5EUOA 3T8XB 5GS0C 4OD3H 4W4OA 3WO4C 5CEXB 3PIQB 3SGKC 4RFNB 4EIZC 4NM8H 4EOWH 3WD5L 3D9AH 3LAFA 1JTTA 4TUJB 1D3CA 1HN1A 4OLXL 4TNVF 4K3JL 1R5VA 3SDCD 4MAUL 4NGHL 3LCYA 4OI8A 1AJ7L 3DV4B 2R69H 2H1PH 4WFFD 2EDHA 4U1SA 3MUJA 3S96B 3N85H 1OAKH 2Z35A 3M17B 4QHUA 4S10A 3HMXA 4BSWB 5D7SL 5LVEA 1HIML 1Q9OA 1ACZA 5CUSL 4JFXB 1HXYA 4LCUA 2PXYB 1FFQA 5IFAH 5TDPA 3SQBA 5FUOH 2DLIA 2PETA 3U30C 1QRND 5IQ9A 4FFYL 1NGPL 1Y0LB 2RJMA 1IEAA 1T1YA 3NIFF 3VDBA 4GMTH 4ZXBA 1QSEE 3BZFA 2F54D 3WFBL 3IS1X 4ZFFB 2PTVA 3VE0A 2YD5A 5KSAB 2VDML 4PGZA 3U4EA 1ZK9A 3HE7A 3GSWA 2GHWB 4NQSA 2Q1EA 5CEZL 4Z7UA 1I8KA 3QIWA 1O7VA 4M61B 2ICWB 4X6CF 2D03H 4JO4H 3OL2A 4P2OA 5E00B 5KANG 3WL9A 4A6YH 3BKJL 4PY8I 1OGAB 3HE6A 1ND0A 1TZIA 1FRGL 1WSST 3GHEH 2DWDB 3QWQB 4CN1A 1JV5A 2VXUH 4XH2B 5F9WB 3WS6C 3FO0H 5JNYA 1IAIM 4PJGF 3B43A 1UZ6E 1FNHA 5ICYA 1I9IH 2I26N 3HAEA 2JCCF 3JVGA 4M43H 1NMBH 1QBMH 1KB5A 2HP4A 4KJPC 4X9BA 3UJJL 4JDZA 3B5TA 5HHQB 4C54A 4XNQA 3GJFB 4L8DB 2AJXH 4Z76B 4N0RA 4P3DB 4F3FB 1IGYA 2J8UA 5BZWB 3CLFH 4W4NA 3WKMH 4Y2DC 4YH6A 3FB8B 1OARL 4MNHA 3K81A 2XXCB 1W0WB 5DHXB 4HLZG 3RVWD 4MVBD 3N1PC 4IIQB 3MBEA 1EHLL 4U1NA 5IKCA 5HYSG 4LSPH 3X14A 5D1XD 1QRKA 2MQ3A 2HMID 3MRKA 3RGVB 2DMCA 1R0AH 4XAKD 1GC1L 3MUGB 2ICEB 1AJ7H 2ENYA 5EIIA 3DHMA 5EU6A 3V0WL 1NC4B 1MQKL 2YR3A 1S7SB 4JB9L 4HK3N 2H32B 1NCUA 4OFYA 2V7HA 3HAEH 5DSCA 5C09E 4OIBA 1R3HA 2P45B 4OZGF 1WC7B 2BNUB 2P46B 5F72S 3WLWD 4LLAA 4XZUA 3P0GB 1V3JA 3FQUB 4CADB 3VWJB 1H5BC 3D39A 3E1F1 1RK0A 3W81A 2VQ1B 1NGPH 5FYJD 2DBLL 1J8HB 5M95B 1RULL 3LIZL 3EOYG 5CZVL 2VDLH 2CDFB 2UYLA 3OGOE 3P0VL 4MX7A 5GSVB 5JQHC 1OTSD 1CGWA 1EH9A 3L5JA 4I3GA 4ELMF 5ITBL 4G42B 4MHHI 5JOPD 5CEZH 4MD5A 5FV1L 3OAYH 5IESL 1FYHB 3RWDB 1EZVX 3P77B 5DEGA 3BKJH 5BW7C 2DQGH 3IF1A 1Z3GH 1FRGH 4ODWA 1IGFH 2DQIH 5T5NG 4X9HA 3SDXB 4XCCL 3ULVE 4FQQB 1I8IA 1NGQH 2G5BA 4IS6A 1I9EA 2C1OA 1IGCH 1QKZL 1C5BL 3UJJH 5BRZB 5C07A 3GMPB 2ZG3A 3H7LA 3GDBA 4MJIB 2ADGA 1NCNA 2ZOLA 5EU4A 1FDLH 4YHMH 3U1SH 1N6QH 3TBVB 5HI3C 1ZLVH 4P5KA 4PJEA 4XNZC 3NACL 4WO4A 2R2EA 1NFKA 1WEJH 5EBMB 1J0KA 1OARH 4HPOH 4Z7NE 4EVNB 1SYSB 1MI5B 4X6DB 2BFVL 4JFED 2WBJA 3O6LH 4P57B 5I15H 2HG5B 2R1WA 4PJ9C 2X4PA 3G5YB 2DI8A 4KH2A 1F3JB 2G9HB 4CUCA 1ZAGA 3ARWA 4Q58C 3V0WH 3CK0H 5IVXB 4IOIB 3BJLA 1AO7B 2R0LL 1PKQA 5T3ZE 4E41A 4NQDD 1MAMH 4JQVC 3GBMH 4GKZB 2BVPA 3CU7A 5ELIA 2FJHB 2NY4D 4X4MA 1M71A 5SWSE 1JPFA 4RNRB 1BQHA 1NSNL 1UM5L 1VFBA 2Z4QA 3VMNA 5I0DA 3MRQB 4MA3A 4NN5C 4P46B 5IT2H 5F7MC 3KPPA 4FQXD 4G5ZL 3NFPA 3AREC 3FZUC 2DBLH 4HXAH 1XH3B 3V6FA 5GGUA 5FGBC 1RULH 3LIZH 3Q3GB 4PR5B 5CZVH 2R9HC 4C56B 4XNYH 3IDGB 2DS4A 3RUGE 4LCIH 2C1PB 5FKPB 5KN5B 2VLJD 4HIHA 5E1AA 5ITBH 3RVVD 3BW9B 5L7XH 3RWHB 3T2QA 3BP5A 4JFDA 4JFPB 3L3GA 4LBEB 3TJEL 3EAKA 1JPSH 1NC2A 1AD0B 2CKNA 1F4AA 1F45A 3E6FB 1QOKA 5CP7A 1RZGA 3S88H 3TA3C 4UOW0 1BJ8A 4NHUA 1AKJA 3S36L 4X80L 1RHHA 2ZP0T 1WAAA 3RTQA 3OKMA 3EO0A 2X4OB 1G9NC 3KHQA 4OD2B 3UZVB 2Q7YB 1GAFH 5FXCH 3MMEB 3BZ4A 3LVEA 5DHVA 4LLUB 2DQCL 1QKZH 1C5BH 4L3CA 3B9VA 4NHCL 1CIDA 2G75B 1YN7A 4WU7A 3WHXB 4YQXL 4O00A 1CU4L 4LLMA 1S5HB 1OW0C 4R7NB 4W6XB 3SJVE 3T0DA 1D9KA 4MJ5A 5E2WL 1KELH 2VLLB 3NACH 5F71A 5JORB 2IANA 5ACMA 1SYVB 4LPTA 3W9EB 1P1ZB 2SEBB 3QUZA 1XGTB 5DEFA 1CFVL 1KC5L 3HNVL 5IJVB 5FO7A 2DMKA 5I1GH 1ITBB 4M1CC 5F6HI 5D93C 1JNHA 1RUKL 2KPNA 4Q74A 4YO0B 3D3VD 4W68A 3TVMD 4PJDA 3QEQB 4XP9H 4UB0L 1JHTB 1DQDH 1J1PL 4I77L 3DUUA 4GKOA 3TV3H 3HPLA 2VDOL 5DGQA 3LH2L 1DQMH 2K7PA 4P59L 5DRNB 3K1DA 4S1QL 4PJ8C 2X1PA 3VI4E 1PYWB 3HMWL 5DUPL 5HGHA 5FYLE 1OM3L 3EJYD 1LDPL 2P5ED 5HGGS 4OTXL 1Y18A 4IDJH 4UQ2B 5J3HD 3NABL 5DMJB 5KVGH 3ULUC 3ZHKA 4PV9A 4G5ZH 4WI2A 2V2TA 2QV2A 2MPAH 4ERSL 1DLFL 2W1NA 1DBBH 2AQ2A 2ORBL 5DUBB 2HVJB 2CUHA 3BMWA 4R4BB 5KOMC 1KULA 2YRZA 4P99A 5CBEA 1D5BA 3MLZL 5DJCA 1IGMH 3LN5B 4GRLD 3TNNB 2HFEA 5JW3L 1EAPB 1IEBA 1XIWC 4KMTH 1GZPB 3TJEH 2CDEA 4YEEA 5IMMB 2PN5A 3VD9A 2VLMD 3UYPA 3BEVA 1A9BB 4JFQB 2BNRB 3MUHL 4NQVB 1NLDL 4HK0A 2FO1A 4Q2ZA 3VGBA 4GMSH 5MEQA 1MCPH 5DD1L 4LFHG 3T0ED 4TNWF 3TBSB 4PJ5B 1PX4A 3DARA 3WXWH 1YEIL 4KRPD 1X5ZA 1NBZB 3WUWG 4KROC 1NCWH 5KTEH 3TYGL 1NCDL 1T1ZB 1ZT1A 3A6CL 2DQCH 5HGBB 2AXGB 1Z9MA 3GJEA 1A6UH 3QYCA 5CJQL 4YQXH 3RY4A 3MNWA 4OZ4A 5C0RL 3SPVB 1EV2E 4NT6B 3BEWB 1GOGA 1J5OL 1E27A 5L2KE 2AI0H 4L8SA 1MEXL 4UNUA 5E2WH 3HA0A 4R3SB 3JTSA 4AL8L 5IFHL 4NN6B 2XIDA 4G8GA 4J3TA 4BQ6A 8CGTA 4J6RL 2Q8AL 4ODHH 4UNVA 4PFEA 4PJBF 1UWEH 3O9WA 2C3VA 2OLDA 3BP7B 4JFOB 2Z8VC 5JXAL 4O2FA 2GUOA 4HV8A 4MQ7B 1A1OB 3GIVB 1RUKH 5HTSA 2VDPH 5E4EB 1JGDA 3P0YL 1IKFH 1K6QH 2GTZA 4PJIA 1QR4A 2G60L 4R96B 4PG9A 4Z78A 3OB0K 3WDIA 1DP0A 5C0AD 2HYMA 3SDDA 2B8OT 2P5WE 2PCPA 4IMLB 2VDOH 3E0GA 3LH2H 5E8DL 4JRXE 2MQ0A 1C5CL 1B6UA 2YPLB 5MHSD 1I1FB 1VFAA 3H9ZA 3HMWH 4Z77A 3HI5H 5D6CA 3VFWA 3C6SB 4C57C 2MJWA 4BELD 1A1MA 2ZCLL 4OTXH 3V5DA 3CX5J 2CMRL 4YBLC 4GW4A 3I3DA 5FA3A 4KJYA 4APQD 2ZUXA 2EEDA 4F7EB 5IK3B 1ZHNB 1JZ4A 4CW1A 3RPKA 5JMRA 4ZUSB 1VENA 3FB7B 2PW1A 3QSKB 4XP4L 1Q0YL 5GSRB 4AEHH 3H9SA 3VJ6B 3K8LA 1FCCA 1FYTA 4JO2L 2IALB 1IT9L 3QEHA 3GSRB 4WUUA 1AGEA 1Q9WB 2FDBP 2QADB 3LRHA 5HSFA 5I2IB 2ZCKL 15C8L 4GQ9L 2YK1L 4FMFA 1I3VA 3EJZC 3B9AA 4Z7WA 4L9LB 4LP5A 3GMRA 2NY2B 5DD1H 3IXTB 5JXEA 3SDXF 3ZKMC 1KV3A 1NANI 1PG7W 4TRPH 2E6JA 3I50L 2D7QA 4M3KB 2ATPB 2DLEA 3D2UA 3IJHB 4O9HL 4OV6F 5LWYL 2CRIA 5A40E 3UMTA 4KRMB 3V4VH 1BZ7B 2K3TA 1D5XB 4OGXL 1IGTB 3ILQC 4KTEL 3BD4A 1MEXH 1P7QD 2LQRA 1CXIA 4OZFH 3UPAA 2AGJH 5IFHH 2LTQB 4U7SA 2GJ6D 2EDQA 4ODVL 3QDJD 4J6RH 4X6DF 2DQDH 3MACL 2HLFC 5IUSA 3DV4A 3T1FA 3GO1L 4XP6H 5JXAH 3KPSD 4NC1C 1K5NA 5MENE 2IPUG 3T1WA 1C8PA 3MRRB 1KTLA 5HI5C 1ZA6A 5IVXF 5HYIA 1G7LA 4YDKL 1OAZL 3MUY1 2XFXB 1H0DA 3QAZB 4DAGH 3DVNA 3W0WB 5E8DH 3GSNB 1G0XA 1AHWC 5EB9A 3QDME 2IGFH 4PGBB 2VDKL 4U3XA 3V5KA 1CS6A 3B9KA 5JHDD 2R4RL 2CLRB 4JM2C 2XN9A 4P9MH 2ZCLH 2CMRH 3V4UL 1OLLA 3LHPH 4ZFFA 1CDGA 1ZHBA 1MCDA 3BZEA 4I0PD 3O8XC 5DRXA 1PY9A 2PYED 3QIBC 2EKSB 3OR6B 5FOBA 2AV1A 2OTPA 5JW4M 1H3VA 4GBXC 3RKDD 3TN0D 4EI5D 4YIQB 4D8PA 3C60B 2XWTB 1Q8MA 4XP4H 5GGRY 1Q0YH 2HJKA 1JZ3A 4QYOB 1QBLL 5CKGA 2Y9RT 5F1IA 5GRYA 5ACZB 4JO2H 2EYRB 3DTXA 4JKPL 3DX9B 4XH2A 1P7KA 3E3QE 4HH9B 3VFMA 2ZCKH 3PJSB 2YK1H 1NLBH 5DQJA 2R8SL 5HGAB 1UB6A 5I1CH 1JMZA 4IJ3C 5EZIH 2NY5H 5HHQA 5ISZB 3TIEB 4LVOB 3O2WL 2CK0L 4Y4FB 5C0IA 3MJ7A 3S4SA 4Y88A 2VAAA 4DCQA 5LWYH 1X5KA 1BWWA 1N6UA 5C08E 2VN7A 1HHIB 3DROA 4KY1L 4KTEH 2EYSA 1P53A 1M7IB 1ZA3B 3C2SA 2IAMB 5A2JH 4Y16B 3QXDB 2XZQL 3KDMB 4L4TA 5F8RC 5I1IL 3B5GA 4W6WB 4OQTL 4K23H 1X5IA 1MIML 3GO1H 4JN1L 2XG4A 4OJFL 1S7SA 1DLHB 3L6FA 5TE7L 3LD8C 5T3XL 4PJXE 2I60H 3SDCA 5L8JB 2P8LB 1DBMH 2IWGA 4NZDA 3KXFD 4M62H 4WV1A 3REWB 3CSPA 2GI7A 4QNPE 4YDKH 5HHVL 1EEYB 1DFBH 4Q6IB 1Y6MR 3GGWA 5EZOL 3QUKA 3TLRA 4V1DB 5J1AB 3QI9D 4G6MH 2X4UA 1BWMA 3IU4L 3BP6A 2F5AH 2A6KB 4K7FA 1ORSA 4X98A 2YC1B 2D9CA 2VDKH 4L1HA 2FSEA 2CDGA 1T83C 4U33A 1KN4H 4L1DA 5I30L 4X7FC 1C7TA 3K0WA 1U3HB 4KI1A 4Y8AA 5E6ID 2PW2A 3IKCA 1FSKC 1OB1B 43CAB 1U93A 5FUCC 3MYJB 5CSGA 3IFLH 2F54A 2HT3D 4XBGB 4POYA 2AABH 3RWDA 1SM3L 4MDIA 4R2GD 2Z31D 1AGFA 5GPRA 1ITCA 4M6ML 5HPOA 5C9JA 2UZYB 5B8CB 1G0YR 3FTGA 4NKIH 4ZFZA 4L3ED 1ZKAA 5TPWH 4H25B 3SE9H 1I9RL 5KSVB 4KK9D 3B83A 3MLRH 3OZ9L 2E7BA 4NN7B 1P6AB 2JJVA 1IQWH 5CMAB 1CFTB 5IBTL 1LE9A 3DVGA 5D7IB 2P1YA 3BQUB 3ISWA 1P4BH 3WNMA 2XY2A 2QQNL 1HKLL 3VXNB 1BQHG 3CSYB 3SCMA 4K94C 1JNLH 3LZFL 3ARGB 2A0LD 2VWEC 3O2WH 4NJAH 4G6AD 1U8PA 2X4RA 2X5PA 4XXCC 5ALCL 5GS2D 5L9DL 2OJEA 5D72H 4KKCC 4OM1L 4YK4B 4XVJL 1KPRA 3GMNA 3AMLA 2K7QA 4DTGL 4KZDL 4U1MB 4RBPH 5ADOL 1UEMA 4KY1H 5IG7A 3VRLF 1RZ8B 4PJHE 5JDSB 4FQ2L 1GGTA 4UT6L 5T5FL 4CDGC 3JTTA 4RFOL 4NRXA 4OUUA 4NPYA 3D48R 4TSCH 3VWKB 5I1IH 3BKYH 1YDPA 1X5HA 4JY4A 1KIRB 1MJ7L 1BFTA 5TE7H 4OJFH 5B4MC 5D1XA 5T3XH 4O5LL 4JAMA 5IIEA 2FGZA 1AO7A 4NYLB 1SJHA 5B3JE 5KSBF 5J4MA 3QIUC 4JVWA 4YFEA 4FZ8H 4LQFL 3WIIH 4PLKC 5HHVH 5D7LD 1JVKA 2NY0D 3VFNA 2DLHA 4V2CB 5FO8A 5EZOH 1IAIL 5DFWH 1T7YA 2B5IC 4P5TB 1FNGA 1MCFA 1QR1B 1HWGB 1OT1A 2H41A 4HUWB 2VO5A 1BJMA 2OMBA 4FFWC 4UV4L 1LMKA 4GXVH 5IJKA 2B4CH 2PKDA 4GJTB 4WI3A 5I30H 3VFGH 3FMGL 2PO6C 2DD8H 2VNCA 4FXGB 4HW6A 4ZUUA 4AEIL 1KNOA 3VGAC 3MRCA 2C1PA 1PD6A 2I9TA 2P8MB 4JRYE 3KYNB 1XZ0B 1OCWL 1VFUA 3BAEH 1G84A 3QWRD 3WO4B 4OKVB 4CAGA 2QJDA 3GBNH 4MNQD 1LNUB 1XF1A 2V9RA 3EUUA 3RWFB 4M6MH 4AENB 3AS3A 4HQQL 1ACYH 1AGBB 1BVKA 4F37K 2N56A 5MP6L 3BUYA 1BMGA 4OKDA 4ODXA 1W72A 4N9GA 1U91B 4RMSA 2RCSH 3IFPA 2OS7A 4LLUA 1RZKH 4RDQG 2V7NB 3ZKNC 2E7CA 4JG0H 5TFSH 4IOFC 1CYGA 4GQPH 1TVBB 1NGZB 1ZLUH 4XVJH 1UEYA 3MLTB 1SYVA 3W11D 3IJYA 5EU7C 3GUTA 5I74C 4Y19E 3U30B 2VSDA 4IDLA 5ADOH 2GCYA 1UZ8B 2VH5L 5CGYC 4Y4KC 4HCRA 5EFIB 5F97E 2RR3A 4UT6H 2XRAL 4JDVB 3CAFA 4AJ0A 4JKLA 4YJZL 5FAAA 4FFVD 2DQHH 3UBXI 3QEQA 4PGJA 5KJRH 1R5WB 4JFEA 2DLTA 4WTWA 1H3UA 1YYLL 2DLFL 4WFHD 1MJ7H 1U2HA 1W72H 1LEGB 5HJ3A 2IC2A 5DJ6B 3TT3L 3CDGA 5E70A 1BREA 5GGRB 1A47A 4PD4K 3C5JB 1IAMA 3OGCB 2HJFB 5C71A 2HFFA 4IRZH 1Z9LA 3GMOA 4K71C 3VXRD 1I3UA 3MCLL 3MGAA 3SDAD 4UTAL 1T03L 2JJSA 4EDXB 5C1MB 3BJ91 2BHZA 3ZKXB 2DQEH 3S8WA 4UV4H 1MLCA 1XGPA 4RZCA 1B0RB 3S36X 3ULSA 2BZDA 1JYWA 3JSSA 1CE1L 1T7WA 3LEYH 1MY5A 4FTVA 4QRQB 4HCRH 3Q2CA 4R7DA 4FQXA 2A6IB 1I4FA 1NGWB 4Y2DB 3TNNA 3WEXA 3O4LE 4ZYKA 1PSKH 3LKPA 3MJ8A 2I9LB 2YXMA 3KS0J 2VN4A 4ZNEA 2ZPKH 3ILPA 2FYYB 1QFUL 1FL6B 4LSRL 4X6EA 2HFTA 4Z5RB 1KPVB 2FECL 5DRZA 5GHWL 4WNQA 1PLGH 5DWUH 1V05A 5DD0L 1NMCC 4OM0H 3C08L 3D85B 1J7VR 3T77A 1A7PL 3VMPA 3CH8A 3ARDD 3DIFB 3U0WL 2XKSA 2R2CA 3B4NA 2X70A 1PQZB 2XTJC 3OKOA 2M26A 5GGSA 3T08A 3GB7B 1T6VN 3CFCL 1DN2A 1L7TH 4YPGA 2ZNWA 4M1GL 5GRUH 3NCEB 4AZ8A 3IDIA 3KLAA 2NXZD 3L5IA 2R23B 1S78C 4X4ME 6FABL 5I76A 3OAUL 1Q9LB 3VH8B 3PWVB 2ITCB 3RL1A 4S0TD 1X3DA 2JJTA 3T04D 1QBAA 1M6OA 4M00A 2BOBB 2BXZA 5TJWK 1ULVA 4H8WC 1YYLH 2DLFH 4MXQD 4RWHA 1V3KA 1EVUA 3TT3H 1VPOH 4BA8A 2MOVA 2JELL 3D3VA 5DQ9A 1UCBL 2PR4H 3ZE1E 1K2DB 1NFIB 5I66A 1SEQL 4LEOB 2W0FA 2DI9A 1HZHL 1X5JA 4LAJH 3CIQA 2HT4D 1NGYB 3W39B 1F11B 3FAWA 5D5ME 4I0KA 4NQED 1WAAE 4P4RB 5D2LA 2P5EA 3BPCB 5D71H 3CFKA 1IC7L 1ZT4B 1JBJA 4HF5L 3RGVD 2VE6B 3VD5A 4MWFA 2NW2A 5I8KL 5I8EA 4QOKE 3BH9B 4U05A 4XNZB 2VXVH 1HINL 5HI4D 3NFSH 2ADJB 3GMQB 4JHWH 5I2IA 3SE3C 2BSSA 5F89B 1A7BA 4LSRH 1VGKA 5IB5B 4PJ9B 5EOTB 1XR8A 3KYKL 3GSNL 2WV3A 1RZFL 4NC1E 1AC6A 2E9BA 4YHLL 4PRHE 2OYPA 1YJDL 4EUPB 1A3RH 4QEGA 1A7PH 2N1KA 5D7IF 5BXFA 1J8HD 2VLKE 4K8RL 5E8EA 1ED3A 4K2UH 2APWA 1A6WH 3T0EA 4NRZA 2EDYA 4UZGA 3U0WH 1P84J 1INQA 4PJDE 1L0XA 4OZHA 5C7XH 2HAZA 4P5MB 5IB4B 5F8QC 3UBXA 4PB9L 5DA4A 4ELKB 4F7TA 1J11A 2AKRB 3CFCH 3VCLA 1IM3B 4D9QE 5C0DA 1KJVB 2MHAA 1K8IB 4PGEA 5IWLA 3CFIC 4XNUL 4X5WA 3WXVL 1KCSL 1TQBB 1RUML 2WMPA 3EFDL 4XXDB 3H3BC 1FN4A 2CUIA 4MB3A 2A74B 1PEWA 3UCRA 3UDWC 5BV7C 3MRRA 1R3LA 3IYLW 5H94A 4WDIA 1JZ6A 1FVEA 2X4NB 2X10A 1WWAX 4FHBD 1UACH 4TULL 3L3KA 4HS3A 4G8IA 1FJ1B 4JGUA 4Y4HC 2VZVA 1R3IH 5C2BH 2UVEA 4JDTH 3PP4H 3S34H 4MJID 5IW1A 2J6EL 4NKDB 2NR6C 1U41A 1MCHA 2NY3C 5HDOA 3TA3B 3S4SG 3C5SB 3OXRB 4LCCA 1HZHH 2Y6SD 1DCLA 1N26A 2CLVB 4M93C 3TYFB 4OCSL 4M7JL 4ZS7L 1DE4B 1QO3B 3L5HA 3RVXD 4P2RD 5DK0A 4M1DL 4R9HA 3WNOA 3PWJA 1BD2E 1WCBA 1IC7H 2Z0BA 1GIGL 5JPMB 3L3DA 4ZPVB 1NUDA 4MGXA 1S9XB 3VRIB 1SMAA 1K9TA 1MJ8L 3MRBA 3PG2A 4HF5H 1MF2H 4MJ6B 4ODBD 3C60A 5IQ7H 4KI5F 5CJXC 5SWZB 3ARYA 4H5SB 3BIBX 4WI4A 1HINH 3JBG7 1DUYA 3QZWA 2EYRA 2BJML 2KZ1B 4B50A 2FL5A 4DZ8B 1U8JB 2A38A 4NZUL 2YBRA 2FO4B 1AGCA 1KYOK 5BO1L 1IQDA 4LASL 3D0VB 4HUVA 4LLWA 3X11B 5JHLL 3QR2A 1EGJA 1MJUL 3IXAA 3KYAA 5D93B 4O2CB 3H6JA 3ABZA 3HI6L 4OCWH 4YHLH 1ZVHA 1YJDH 3VXUE 4JN2A 3RP1A 4P46D 1D7FA 1M05B 5JLZB 1IAOB 2AJVH 2RFXA 1ROWA 3QQ9D 5E8NB 3U82B 2R4SL 3U7AA 1J87A 3P3YA 4C56D 5HHNA 1FC1A 3ESUF 4PJ8B 4PB9H 2EXYC 2NCMA 5HVWA 2W9LA 1QLRB 2J5LC 4J23A 5DUML 4CBPA 5DDHB 1CBVL 4XPHL 4GRWE 1IFHH 1HHKA 2WIIA 5IB1B 4OLUH 3JWNC 3DO7A 4OI7A 4HMEA 1P7QA 3V9FA 3I6GA 3H42L 3FT2B 4PGCA 1UWXK 1DLHA 2AV7A 4UQ3B 3LKQA 3OJDB 2FCBA 2Y23A 3WCYA 2BVQA 1PZ5A 2YWYA 3TBWB 3P2TA 5CLTA 3ZDYE 5DJZB 1T2JA 4H20L 4V1DA 5TDNA 4IRSD 2NTSP 5GISL 2F53D 5DO2D 2J6EH 3QQ4A 4X8JB 3FOLB 1KN2L 1A02N 3WHE1 4WUUE 1XFPA 4K3EL 2EE6A 3NCJL 4LSVL 2FHCA 5AWNL 4J7RA 2XXMB 4OCSH 4KROB 3QDGB 4M7JH 4ZS7H 4I5BA 4N0UB 4L4VB 3Q5YA 1MCWW 3MYJA 3FQXB 4M1DH 5JHDA 1UXWB 4KGLA 2P8PA 1EO5A 5F9DC 1H15A 2FJGB 2XA8H 4I0PA 4FQLL 1KENL 5F9OH 5FCUL 4W4OC 5KZCD 5E2VH 3EKCA 1J0ZA 2BNQE 4UIKH 4G9FD 2A83A 4NQCD 3V5HB 1ORQB 4NZUH 2OCFD 2FJFB 3L1OL 3KR3H 4UBDC 1MCQA 3P4NB 5BO1H 1P9MA 4LASH 3THMH 4PLNC 4OZIE 5JHLH 1IMHC 5E9DA 4J2XA 1CFTA 1MQ8A 1MJUH 2BRQA 3HI6H 2M2DA 1FFPA 3MQIA 3OG4B 3LQAH 2V5TA 1KT2B 2CH8A 5HD8D 2EXWD 2A2QT 1DUZB 3X12A 4L8BA 1JWMA 1BBDH 3FT3B 2JB5L 3FCTA 4QHKJ 3ZE0F 4QTHA 2NW3B 1JGEA 5GS0L 2AEQH 1CBVH 4J3XA 4PIRF 1YEKL 4XPHH 3QNYA 1KTDA 4FQJH 5DD6A 3TO4B 1QSFE 4YBLB 3DRQB 4X5XA 4U1JB 1T22B 4ZXBC 3LQMA 3T4YA 2Z8WC 2GY7B 4OF3A 2FGWL 4PJFE 3HE7C 2OR8A 1I1AD 2E8YA 5F3HB 3S6CA 2VL5B 3EIFA 1GL4B 4PJGA 3KPOB 4JGJA 4FG6C 3LQZA 3LKNB 4MAYB 3QG7H 2W60B 4P2OC 4Z7VA 2Y5TA 2AJZA 2R56H 2WWMC 2JB6A 5C0JB 2AEPL 3TO2A 1MFEL 2DYPB 3ECBB 5GISH 3KXFA 5K9KB 3T3MF 2Q76A 4DFIA 2XWBA 1YMHB 4XHJC 5D96C 2G2RA 1CFNA 1P4IL 1SEBA 4QO1A 5JR1L 2NXYB 3JVGC 4LSVH 3PHQB 1BX2B 1ETZB 4TTDD 4F9LA 4PJAE 1TZGH 4X6FB 2AK4E 5F1NA 4BH8B 1FBIL 4Z6AT 4LLVB 1Z2KA 2R1YA 4S1SL 5E6IA 4GUPB 2JTDA 2WBKA 5FK9B 3UTTE 12E8L 5KAQF 2CIKA 3PF2A 1KENH 4M9PA 4L29A 4H0IA 5DJ8B 5I1LA 1A0QL 1P2CA 4C4KT 5I17B 2WAHA 3TPUA 2H2SC 2UWEE 4HEPG 1G1CA 4Y1AE 4P3CL 4HEME 4H1LB 1XR9B 3O3BA 4JCLA 3VXPA 1JL8A 4L3EA 2X4TA 1GGCH 5J8OA 1MCCA 2DB8A 4F58H 3R8BB 2VUYA 3K74B 3GI8L 3PWLB 1LE5B 3QULA 3VFOA 4JHAH 5FV2A 3WN5A 2OZ4A 3D18A 3SKNA 1NFDE 5IBLD 4UILH 4WFFE 1NEZA 5A3ID 2ZG2A 1JP5A 2YA0A 3EYOB 4JPIA 5FDYA 5EBLB 4JZNA 1M7DB 2VZOA 1KF9B 5SX5K 3SGEI 1ZTXL 5ENWA 3NBNA 3HLAA 4JM2B 4RMWA 3TCLA 1NDMB 5A16B 2NY6C 1MJJB 3C6LD 1KTRL 3MV9B 3QH3B 3MRFB 1IZJA 1OAXL 5LQBH 3FONA 4KUZL 1F6FB 2VABA 4QCIA 43C9A 3VMOA 4LLYB 5EPMB 3O6ML 4GBXB 4NNXA 4RAUB 1QRNE 1R3KB 2FWOB 4GO6B 3RY6C 3QXTA 2EZ0D 1KG0B 4DVBB 4P23A 4NWUL 4YBQC 3UTZB 2F54E 4S11A 1G7PB 1HI6B 4MA8L 5DYOA 2BSED 5DZOA 3RDTD 2LFGA 3NIGE 4QF1B 1OP3H 1KEGH 2ICWI 2YPKA 2AEPH 1MFEH 3ARFD 2EH8L 2UV3A 4N1CA 1FZKB 2OZ4H 1V5JA 1NQBA 2NMSA 5D7LA 4WRLA 2CPCA 1FZMB 4MXWL 5EZLB 4D0DA 3HZYB 4R26L 1Q9KA 4FMKA 1AXTL 1QQDB 5JIIA 5DMGD 1C12B 4RMQA 5F7UA 4KK5D 1CD9B 1DQLL 1YNLL 3QPQC 5IVZB 1RIHL 3RL2B 4WO4C 1A6VH 4GW1A 3LKOB 5A1AA 12E8H 4ZD3L 5GXBB 3PWUB 35C8L 1A0QH 4Z5RA 3FT4A 3PE9A 5T1DL 3QWRA 2EDLA 3W0WD 3KLHC 3EO1A 1G6VK 1OTTC 4YE4H 1DR9A 4P3CH 2HH0H 3P30L 3GRWA 4QHLB 3L3IB 4JLRA 4FP8L 1RVFL 1F5WA 4XCNB 4K8RD 5C92A 5C09B 2VAJA 5ANMB 1U8MB 1GOHA 1QFWM 3GI8H 3VA6A 3PP3H 5FECB 1KPUB 2HT2D 4X9GA 3QA3B 4LF3A 3V7MA 2V2XB 5C6WH 5JA8B 5F7KC 3FQNB 2HRPL 3MRDA 5T33H 3OB8A 4DN3L 3OKLA 1ZT7A 4GG6F 1SQ2N 2ADFL 1CVSC 3O6FA 3ULUF 1JRHH 1QPXA 1FSKB 3T2OA 1FO0B 3FB6B 3TM6A 3S35L 4KUZH 1UADC 5DD3L 5ICXA 4Q9QH 5IB3B 3VXSD 3WJJC 1D5MA 1KCVH 5FYKU 1YYML 3O6MH 5MERA 4QRRB 2GAZA 3JWOH 3TEUA 4TVPH 1RUPH 5FYJE 4XVSL 1L9MA 3VRJB 4NWUH 4Y4FD 4MA8H 3RWCB 4OFDA 3KPMB 2F74B 3SY0B 3F7PC 4XP5L 1B3JA 3DURB 4QGYA 4QY8B 3SJVD 5CKAA 4LMQI 3UBXG 3RTQC 1EEQA 4X6BB 5DQDL 3AXLB 4TPRL 2BCKA 3SOBH 2IAMD 3ES6B 2Z93A 1A7RL 4MXWH 2WLYA 5C70A 2JK5B 1JK8A 5IMKB 4RGOH 5HYJB 3V6ZB 1T1XA 3QJHA 5C6PB 5J6HB 1YNLH 3LRSB 1D9KC 3NAAH 5EWIL 4LOUC 4LAQH 1I3GL 2ED7A 1INEH 1T21B 4NO0B 1LO0L 5ESAA 5JMOC 4ZD3H 5F70A 2AAVA 2BK8A 2XICA 4UINL 5SWQA 35C8H 4YHOH 1WV7T 3QUZC 3L9RB 4CMMB 5TE6L 1X5FA 4JPWL 3KPLB 4NP4H 4RA3A 1MHCB 1N3NB 4JKKA 3S7GA 3QHZL 3KPNB 1G9NL 3MV8B 3NZ8A 3H0TB 3W2DL 3NOIA 4JFEE 4K9EL 3I6KA 1U3HD 4ALAH 1FNEB 3QIUB 3L95A 3OX8A 5DVLA 3ARDA 3FOMB 1WK0A 2Q86A 3MRPA 5I1AB 1HDMB 2EC9U 2FIKA 2FHFA 4LSTL 4B5EA 1YEEL 4LKXA 5FDWB 1QEWB 1NJ9A 4PRBA 2EIZB 2OR9H 3FFDB 4XXDA 4C4KO 3KPRA 4DN3H 1OTUC 3QHTC 3CFEB 1E6OH 5C0FA 4NQDE 1ZLWH 4HJGA 3GM0A 3QZWG 2PO6B 4OUOA 4LPCA 1DVFD 4O2EB 3P11L 3RVUC 1VHPA 1JPST 4FQ1L 4YDJA 2EKJA 1TVHA 3W9DA 2WUBL 3TNMA 4EUPH 3FN9A 4F57L 5JW4N 3ARGD 4XVSH 5T1KB 4LKCA 3SE8H 1CL7L 2DTSA 2YKLH 4GKSB 3OKEB 3GSUA 3QNXB 1MY7A 4ZNEE 4N90D 4XP5H 3LDBC 4K3HA 2VLJE 3EJJX 5EO0B 1QLFB 3IDYC 1HSAB 1QFOA 2NY7H 1QO3A 3Q6GL 4PGDB 4YX2H 3G6DL 3GKWH 3C8HA 4DEPC 3TZVA 4NNYB 5CP3H 3ULUL 5GRZA 5C0EA 3VXQA 3WNNA 1CXKA 2ZZUT 4YHZL 3DO3A 3VWKD 4HHAB 3JV0A 5D6DA 5I8OH 3KPQB 3IFNH 3PNWB 4NQEA 3L7EB 1VACB 1A64A 1ZV5A 3MRMA 1MUJA 2ZOKB 1GPOH 5I74B 5LGHL 4R4FL 2X9YA 1U8JA 5JZ7D 4P4KA 1YEGH 1IAII 2YSSB 4PRPA 2D0FA 1LO0H 1UB5A 4HK3J 3X11A 3O3EA 1TJIH 2P5WD 4HPYL 2P44B 5DXWA 2HKFL 2AJSL 3KLSA 3O9WC 3P73A 2XTLA 3HC3L 3MGOA 4PUBL 4CL7A 4JCMA 5JLZA 2CKBL 3PDOB 4HMDA 1HQ4B 3PL6B 4S1DD 4X99B 1MLBB 1C08A 3HPJA 2IQ9H 4LEXH 1G9NH 4KKNA 4NO5B 1YUHA 3ZKQD 1T89A 5HYSB 3W2DH 3VGGA 4K9EH 5K93A 3S3SA 1X5GA 1RK1A 4YEFA 4ZFGH 1ZS8B 2BERA 4FOMA 4KKBD 1H3PL 3NA4A 2N4IA 3QUXA 4K71B 4PRIB 2Z9TA 5GS0D 1C16B 32C2B 4RGNC 3AAZB 2ZUUA 4DGYL 3DMMC 5LXGL 2QQLL 4O4YL 3BKCL 4JM2F 4PRDB 2VLRB 1S7WB 1IM9D 1F3DH 1I7UB 4HKZB 3ZLQC 4G43B 5C8JB 2Y25A 1CLOH 2OQJB 1J88A 3QFJB 3MRHA 5FUZL 1CICA 4MXVF 5IEKB 3JUYA 1EEZB 4PP1C 3QCUL 1E6JH 1X5YA 3I75A 4NOBA 2ZSVA 1FFRA 3T2NH 3U6RA 4RWYL 5E08H 1TMCB 3VXMD 4CJ0A 1LK3H 5KS9A 5GZOC 1CL7H 5EN2A 3MZGB 3EOTL 3Q1SL 4NDMA 3I9GL 4ZTPL 4GLRH 4I48A 4WIQA 5EU3A 3UPCA 1SVZA 4XPBL 4KHXL 1BFVH 3LPWA 1K8DB 1UFUA 5DC9B 4OV5B 3CCHA 4YGVB 5JXEC 3QUMB 3HI1A 2AXFA 3Q6GH 3ORJA 3MODH 3HCVB 5L0QB 4JFFE 2VLME 1V3MA 3ULUH 1IC5L 5GZNC 5E5UB 2BRRL 5CD5C 4QRPB 4HIJA 4PV8A 3X13A 3IAQA 3QEUB 4P2RA 4YHYB 4RMVA 2Z91A 5F7EL 1UKSA 4R4FH 1N5YL 4Y89A 2FJFA 3WE6A 2B1HL 4X9IA 1D6EA 1MH5A 4YUEH 5FGRA 4HPYH 25C8L 1RJZA 3OHXB 5IOPA 2YD2A 4U7MA 2B2XL 2BXYA 3FB5A 4J3WA 3QDMD 1NCAL 2OXGA 4BKLA 1PGRB 2YZ1A 1MHEB 1EIBA 3D25B 3MCKB 4O02L 3LKSB 2A6DA 4JRXB 5FYKL 1WZKA 5T1LA 3FT3A 3I3EA 1AFVL 1RZ7L 5F1KC 2PXYC 2YHGA 5IEHA 2BC4B 1FIEA 1PKOA 3KGRA 4ZS6D 4PJCB 5A43C 2NY5C 1K4DB 1BFOB 1G0DA 3MA7B 3ARBB 2FECI 4KXZI 4FFZH 3B9KC 3U0PB 4MLIA 2DM7A 8FABA 4LCYB 1JPGA 5LXGH 5C0AE 2QQLH 4KDWA 1QBBA 2Y7QB 4YBHA 4HWZB 2OSLB 2D4DA 1YPZF 4H0HB 1LGVA 5BZDA 1V7ML 5F3HA 5MHSE 2DIAA 4JVPA 4LCWA 5IGXH 5D2NA 3MV7B 4KK8C 4YNYA 3D85D 2P47B 3BXNA 1I7TA 1JWSB 1XGQB 5FUZH 1I3RB 4C83B 4MAYA 1WQVT 2EDKA 4WGWB 2IPTH 5BOPA 2MWCA 5F1OB 5JDJA 1ADQL 3K2MC 3QCUH 3BE1H 1XF4B 3VFRB 2DYPA 3ECBA 4OD1H 2XWJA 3A6BL 2HN7A 4F7PB 3HC0A 1XCTA 5F9WC 3I9GH 3GHBH 4XPBH 4BQ8A 1KLUA 2XG5A 4IRSA 2FD6H 4LLDB 3RA7L 1NEZG 2F53A 3M1BB 4UIMA 4G6JH 1FC2D 2P7TB 2OTUA 4X6FA 3F65A 3B3IB 4P0DA 4FABL 4DKFH 3P9LA 4BH8A 5IMLB 4GSDL 4ZFOA 4H26A 1IC5H 1BOYA 5J6GB 3G5XB 4GUPA 4W81A 3C9NB 1RZIB 1FORL 1I1RA 4I2XE 3R06A 1NMAL 2AJ3A 3CXHJ 5I17A 2FEEL 2IBGA 1CR9H 2H26B 1LVEA 4MS8C 4WFED 1BP3B 2APTA 4YZFE 2XZAL 1N5YH 5MEPB 4K55A 5E0QA 5IHZB 1WF5A 2CO6B 25C8H 3GK8H 3BDXA 4G9FA 5C0CB 3MREA 4JPVL 4NQCA 3S5LA 5BV7B 2B2XH 1DBJH 1A2YB 1NCAH 4QWWC 4P9HH 2GJ6E 3VFPB 3QDJE 4OIIH 1UA6L 1JHLL 4Y4HB 4AH2A 3HRZA 1QVOB 4WCYH 1AFVH 1RZ7H 3MLSH 3QJFA 2NX5E 2EIEA 4MCZB 3DSFH 3KPSE 2VXTH 2NY3B 1QSEA 3H9HA 2GFBA 1B4RA 4ZO9A 1KJMA 2YXFA 1MWAB 3QISA 4Z0BH 4PJ7B 4OT1L 5LG1A 4UTBL 4S1RL 3PXJA 4HUXB 5H37H 3MBXH 1U8OB 4S2SA 3RKPA 1JMXA 4YR6B 4LIQL 3VXTB 3FJTA 1NBVH 2C4FT 6CGTA 1RZJH 1Z9OA 1WBYB 5ILTL 3X3GH 5FKAA 4PJ9D 5GIRB 1RJYA 5DTFA 1G7JA 2A73B 2BY2A 2GK0A 3A67L 4JY6A 2PTTB 2UY7A 1AY1L 1YEDB 3UTZA 1U8NB 4Q9RH 3FO1B 1LO4H 1H3TA 2UY6A 1CD0A 2EDWA 1I1AA 1TDQA 4XCYA 1JHKL 2PYEE 1UENA 4O51A 1Y6NR 5EO9B 3WSQH 3A6BH 1T2QH 2ZUSA 3PWNA 1S7VB 4OLZL 4LPYA 1F00I 4M7KH 1GOFA 3PQYB 2X7LB 3OF6A 5GGTA 1C1EL 3QO1A 5HHMB 1JWUA 2I07B 3RRQA 4HS6B 4ZOBA 5A2LH 3BGFC 3RA7H 3G04B 2O5XL 2ZUWA 3JV6B 3AFLA 3ARED 3FZUD 1N7MH 3SCMC 1TJGH 3CZFA 4FABH 4GSDH 1I7ZA 3UTPD 3MA9L 5LJYH 2R9HD 5D9SA 1HQRA 4D0CB 2J5LB 3NIFE 1D5ZA 2B4CC 3P4MB 3Q5TA 3WUWB 3EGSB 5J9PB 1ZSDB 1X5XA 1UQSA 4J12A 4HJ0C 1EUTA 5JW4Q 4NNPH 5KSBA 3HUJF 4DN4L 4RIRB 2EDOA 3TA3D 1IILE 4MVBC 2HWZL 1S8DA 4K3DH 3BKMH 3E6HA 3VA2C 4X6CE 4XCNA 1N0XL 5FEBA 4NQXA 4HDIB 4N5UA 5FGSA 4F33B 4MA1B 5GGTH 1FVCB 4ODSL 1YY9C 4K94L 4HT1H 1JHLH 4WGVB 4PJGE 5IR1A 4MCYA 2JCCE 1U58B 4GAYA 3RIFF 3KYOA 3WS3A 1RZKC 4XWGL 2FHBA 2QR0A 1U3ZA 4OT1H 2D31B 4PRAB 3P4OB 2YRPA 4U6YB 5IJKC 4HKJB 3V7AG 4XNMB 3D0LA 4LIQH 2XKUA 4NUJB 1J9CT 1ZHLA 5KVEL 5DJAB 4EN3A 4HC1L 4M1CD 1Q94B 4G8EB 3C6LA 3CVIL 4P2QB 3F7RA 3KLDA 5EUOB 3WIHA 5T3ZL 2DDQL 3KPMA 3DGGA 4DUVA 2BOCA 2Y5EA 4BQCA 5IFJA 3RIAK 1LEKA 4DUXA 4NO3A 1JHKH 1CE6A 2J12B 2IFFH 4PJ8D 3U9PH 1OAUL 1R3JA 2ERJC 1R5VB 4OLZH 1QP1A 3QXWA 3RDTA 4X6BA 4U1SB 2EECA 4Y19D 1F2XK 4KJQC 4WU5A 2Z35B 4QHUB 3ARFA 4MLSA 5KOVC 5BCAA 1FNSL 4OZGE 2A9ML 2O5XH 3K3QA 1Q9OB 3T0AA 4U6HB 1FIGL 3CH1A 1FO0H 1HXYB 1A6PA 5FA4A 5T5NF 4LCUB 3UJTL 4ZDHA 4OCRH 3OR7A 3VFSB 1CIUA 2Q7NA 3VD7A 5CJ8A 4P2YA 1AQKH 3NZHL 1XIWD 2ED9A 5IQ9B 5L88L 1BEYL 1IEAB 2ZUYA 1J0YA 4U1LA 3WIHH 4ELME 2X05A 1JF1A 4ZXBB 2VDQL 3BZFB 1HXMA 1GRWA 1S7TA 2YEZB 2Q6WA 3VE0B 1JIBA 3EYFA 3U4EB 2HWZH 4IOSD 3HE7B 3SBWA 3ULVH 3OB0H 3GSWB 3WFZA 4ZAKD 3OAYK 4NQSB 5F3BA 1Z5LA 4Z7UB 1I8KB 3QIWB 3GSXA 4KROD 3S35X 5BS0D 1T0MA 4U4BA 4M6NL 5SWSA 4X7DC 1QUNA 5I1AA 4P2OB 1X6LA 3WL9B 3HE6B 1ND0B 1TZIB 2OBGA 2EH7L 4ODTH 4CJ1A 1JV5B 4PJCF 5EH1A 5D96B 5JNYB 3QWOA 5ICYB 2JJSC 3HAEB 4H88L 3RUGA 2E9JA 1KB5B 5E8PA 4JDZB 3RJDA 5F7HA 2EDRA 5D7LE 2ZG1A 5FGCB 4XNQB 4IBLT 1ZHKA 5KVEH 3UTSD 1IGYB 2J8UB 4HC1H 2GQHA 4D9LH 4PG2A 4MNHB 1GGIL 5T3ZH 1Z0NA 2XKNA 2DDQH 3QCTH 3VXSA 2CQVA 1SY6A 3MBEB 2ESVD 3MLUL 2R2BA 4KRLB 4U1NB 5IKCB 2GEEA 1DZBA 3CPLA 2AS5M 4WJ5A 3X14B 1OAUH 4Q7DA 3MRKB 3T0BA 4JANA 4MNQE 3KYMA 4NFCA 5EIIB 1QFWL 2ITDB 5EU6B 3SJVA 4OF6A 4PY7A 1OQXA 1VADA 2V7HB 4EQ2A 4HFUL 5DSCB 1FIGH 4HIXH 1RI8A 3UC0H 2A77L 4FNLL 3TWCL 5DJDA 3BD5A 1VB9A 3A0OA 3NN8A 2XQBL 3BIKA 4JRWA 4JQXA 4XZUB 1FLRL 2QSCL 1VGEL 2XZCH 2J8HA 4GAJL 3BYYA 5TF1L 1F4WL 4JFHD 3S9DB 1AR1C 3D39B 1RK0B 5CFHA 2R2HA 1S7UA 1WZLA 4YHPA 5EULV 3TH4T 3EJZD 3MC0A 4MX7B 1HYRC 3BPOB 2JJTC 1KIPA 2AEIT 1PFCA 2I24N 3PL6A 2UUDH 3IU3A 3ZKMD 4HG4J 5JQ6H 4LSUH 1BFSA 3QUML 1WFOA 3VU2A 4MD5B 5FYKD 1JZ7A 5HHOD 1TLKA 4ZO8A 4XP1L 1ZGLP 1CF8L 1S7XA 2WIMA 3EO9L 5DEGB 2VERN 2VQUA 3IF1B 2V5YA 4ODWB 3ILQD 4MD4A 1UYWL 1JI1A 3O3DA 4N0CC 2I5YL 1NDGA 4PJ7F 4KJWD 1I8IB 1OSZA 2G5BB 4IS6B 3SQOL 2C1OB 3MRLB 3DYPA 4OLYH 5BVJA 2L0DA 5K59F 2HLFD 5C07B 4Q97A 3VXRE 1IKNA 3EW3B 2ADGB 2ZOLB 5EU4B 3V79C 4P5KB 4PJEB 2O61A 2AK1H 4KKAC 4YHIA 4WO4B 3MJ9A 5DJYA 3QT2A 2R2EB 1DVFA 4HLZH 5HI5D 1CZ8L 2Z92A 4H8WL 3RWGA 2GITA 3CMOL 4LHUA 4MSWA 5M7QA 2QADC 4NBXB 5HHXL 2D7NA 3B8SA 4JR9L 4HKBA 3MLUH 2WBJB 3FRUA 5FYLH 2GSGB 2NY2C 2R1WB 3T09A 4OV5A 2X4PB 4LVNC 3CFBA 1V7NL 1XF3A 3CC5A 1JGUH 4JM2D 1WIUA 4TUKH 3MV9D 5L2KA 1OWWA 3T0EC 3O8XD 3G6JF 1PKQB 3QIBD 4G6FD 4XBEH 4E41B 4HULB 2NNAA 1T04A 4KRPC 3GFUA 4GBXD 4RQQA 2X09A 1MCSA 2BVPB 1AH1A 5EZJB 2B0SL 3TWCH 1M71B 3U0TB 4X4YA 1JPFB 1BQHB 4KVNL 1VFBB 2Z4QB 4MA3B 4TQEL 3V6OE 1F4WH 3MJ9H 5J0BA 3KPPB 3NFPB 5I1KH 3F58H 1MNUL 3V6FB 5GGUB 1MHPH 3L3HA 2P5WA 2WZPD 5HDQH 5I75C 3L3JA 3DRTA 4WI8A 3CXDH 2YUZA 4JRXA 5FFLA 4HIHB 2X2YA 3BP5B 4JFDB 1OGAE 4YHKL 1REIA 3L3GB 4MDJA 2WNGA 3QAZC 3U2SA 4OLWL 1NC2B 4JPKL 5E1HB 3WMSA 3BHBA 4XP1H 2R0WL 1ZVSA 4GAGH 5CP7B 3BRFA 1RZGB 1MRCL 1YJDC 3ALWA 4YC2C 5AYUH 4LDLB 1AKJB 3NFNA 4UT7H 1RHHB 5BMFL 5H8DA 3RTQB 3OKMB 1FHGA 4PP2A 1M4KA 2Y7QA 5I19H 3EO0B 4M6AA 3BMVA 4M7LL 1LD9A 2I5YH 2R29H 1OAYH 3BZ4B 5DHVB 3SGKA 4L3CB 5DVKA 3SO5A 4U0QB 1KEMH 4G7YL 4DGIH 3DWTA 3G9AB 5HPMA 3BPNB 1YN7B 4WU7B 1XGQA 2OL3A 5EU5A 4C83A 2X4QA 5BV7L 2X1OA 3C60C 1DSFL 1GCFA 1D9KB 1N64L 2DKUA 4MJ5B 1IM9A 5F6IB 4ODUA 3S5LG 4G6KL 5EUOF 1XF4A 2IANB 4PJBE 1EMTH 3STLA 1JF5A 4P49A 3PHOA 4WI7A 2JIXD 2ENSA 2OJZH 1GGYA 3QUZB 5DEFB 3GIZL 5GJTL 1VESA 5FO7B 1R24B 3B5HA 3VXMA 2YD8A 1G7HA 5D1QD 1JNHB 3DX8A 1MWAL 4LVOC 5DMIL 4PJDB 4F7CA 1P7HL 3G5XA 3DUUB 4HS8L 3HPLB 1ZANL 3BN3B 4ONGH 2BSRA 5IROA 5E99H 5GJSH 5HGHB 4QRRD 2VDRL 1IL1A 4TSAL 5HDLA 1A14H 2OR7A 4L5FL 1J86A 1J8HE 2B0SH 4FQHA 3NPSB 3SKMA 4Y16C 1Y18B 4KVNH 3NH7H 3Q6FA 4ZUTA 1GGBH 4N1HB 3B9DA 5TQ0H 5MENA 4TQEH 3OTTA 1ZLSL 4PV9B 4JZJA 2V2TB 1I9JH 4UDTA 3DHJA 3P9MA 2EE2A 5CBEB 1D5BB 5DJCB 3OKDA 4LRIC 1CK0H 4Z7UF 2HFEB 4LMQE 3WS6A 3QDMA 1UM4L 4YHKH 1H3XA 1HCFX 1IEBB 5H2BA 2EO1A 2CDEB 3VD3A 4OLWH 4KKCD 2W9EH 1BAFL 1J18A 3EDEA 3SDXE 3TP4A 4AT6A 3BEVB 1G7MA 5T3XE 5D1ZA 4HK0B 4Q2ZB 3LQAC 3INUH 5MEQB 3IDYB 2HLAA 4NO0D 2H6PA 4M7LH 2NYYC 4MJIE 2J7LA 1ZT1B 2NTFA 3MFFA 2LVCA 4OD3L 5LGKA 2PTTA 1LEIA 4G7YH 3GJEB 3REVB 4J4PC 2J8UF 1UH4A 5D7JB 3MNWB 4OZ4B 5AEAA 1DSFH 1E27B 4NM8L 4BJLA 4L8SB 1N64H 1MI5E 4X6DE 3D9AL 1U8QA 1IEHA 5B8CC 4UT9H 4G8GB 5CHNA 3QIUD 3T3PE 1DDHA 1HHGA 1CXHA 1CCZA 2IG2L 4WI9A 2UZIH 3N50A 3SHSA 5K9QG 3O9WB 1H8SA 3GIZH 4R0LA 2C3VB 3N85L 4R8WL 5GJTH 4HS6A 4NN7C 1X4ZA 4N1EA 4O2FB 2GUOB 5IVXE 3BQUC 3LB6C 2E7LA 4HIEA 3QQ3A 5DFVC 1KLFA 1MWAH 4FFWD 5DMIH 1QSFD 1JGDB 2GTZB 1XEDA 4PJIB 5C08A 1SMOA 4PG9B 4Z78B 2PO6D 1B4JH 3SDDB 2PCPB 5FUOL 1ZANH 3H8NA 3ROOA 4P3WA 4C58B 2VUOA 4Z0XA 1CL7I 3IS0X 1RUAH 1VFAB 4Z77B 1KXTB 5D6CB 3VFWB 4TSAH 5HGDA 4X7SH 4GMTL 5T1KD 1A1MB 1I8LA 3HTLX 5TDOA 2CGRH 1QHOA 4C56E 4PJXA 4N0YH 4KJYB 1ZLSH 1JYXA 2OX5A 3TIDA 2FH6A 4CW1B 4DGVL 3KNBA 3V8CA 1GH7A 2PW1B 2D03L 1MFBH 4IRJA 4A6YL 2UVFA 3H9SB 2WINA 3HMXL 4DFHA 2E5EA 3GHEL 1FYTB 3RZCD 1KJ2A 4I18A 4IOFD 2VXUL 3QEHB 4CRPA 4WUUB 1AGEB 3FO0L 1BAFH 2ZSWB 5EC2A 1NH6A 1F8TL 4NKMA 4Z7WB 3MRNA 3JWDL 3GMRB 1QBML 5HVHC 3UTTD 4HKJA 1HH6A 4XNMA 3FO2A 4Y4KD 2AJXL 5E94B 4QRUA 4G8FB 3CLFL 2FR4A 4F9LC 2F53E 3WKML 3H3KA 3DX7A 4Y1AD 3QDAA 3D2UB 3UTQA 4J3VA 1HH9A 3SE4A 3HC4L 2C9AA 4PJEF 1HCVA 4JZOA 2ARJQ 4LSPL 3CFDA 3MZTA 3I6LE 1EERB 1JNNH 1R0AL 1HYSC 4X7CC 2IG2H 4PRID 1NBYA 4XT1C 1U8IA 4TNWK 3T1FB 4R8WH 1KJ2H 1K5NB 1OP9A 4XB7A 4G9FE 1KTLB 3V4PH 3RWIA 4NQCE 4U6HA 1ZA6B 4HWBA 4F15B 1KB5L 3GJFK 2VLRD 5BVPL 1G7LB 2DJSA 2JE8A 1CT8A 1ERNA 2NPLX 1XF2A 2PYFA 3ZL4L 1H0DB 2X89A 2DQFA 4PJHA 4YDIL 4E0RA 3DVNB 3AREA 3LEVH 2FATL 3VFSA 3VFTA 2F8OA 5FGBA 3TBYA 4HUMB 3CD4A 2CRMA 4OGAC 4JJ5A 1KIQA 1HOCA 3V5KB 2RBLA 3B9KB 2VDLL 2XN9B 2YEZA 1ZHBB 3BZEB 2HFGH 3X17A 4JM4H 5DRXB 2IJ0C 5FOBB 2AV1B 3C8KA 1VKXA 4DGVH 3CUPA 1S5IH 4BUGA 4V2BA 4D8PB 3WFHB 4P23C 4BYHA 1CFSA 2HJKB 3HMXH 2BNRE 2DQGL 1JFQH 2XTJD 1Z3GL 5F1IB 1IGFL 5I1DA 2DQIL 3DTXB 3EDJA 2YD9A 1P7KB 1MHHA 3VFMB 3PGDA 1NGQL 3VFVA 3G08A 1F8TH 2C3GA 5DQJB 3ROLA 1UB6B 3JWDH 3ZKXC 1IGCL 3DECA 4Y5XA 4I0CC 4ZQKA 1BIIA 4JRYA 2OI9B 1S78D 4AM0A 4KDTA 2AK4B 4UUJB 1T1WA 2FZ3A 4M5ZH 1FDLL 4YHML 3U1SL 1N6QL 5EC1A 3IETA 5C0IB 3MJ7B 3S4SB 5I8CA 5ETUA 2VAAB 4DCQB 1WEJL 2LAGB 5CIPA 3VRLE 2WP3O 1IC1A 2F9BT 4RBPK 1A7OL 4HPOL 2R39A 3HC4H 1FPTH 4D0BA 4OGZA 4WHYG 4CN6A 3DROB 4BZ1H 3FQTA 2EYSB 3O6LL 5I15L 1R5IA 1T3FA 1JZ2A 5DJ2A 4L4TB 3JWOC 3OKYA 3VGHA 4WWKD 5FHAL 3OV6A 4L8CA 1EO8H 2CRZA 2ITDA 3CK0L 4GH7B 5KSBE 1JUFB 3ZZ1A 3L6FB 3SDCB 1MAML 4OGYH 4QRSA 1KB5H 3BDYH 3GBML 4WV1B 5BVPH 1BECA 4Y19A 2JKXA 5GGSY 4KQ4H 1A3QA 3MV7D 3ZL4H 3GGWB 3QUKB 4YDIH 3VXOA 4OCMC 1AR2A 2X4UB 5I1HL 2FATH 3BP6B 5CGMA 5IT2L 3QNZA 4K7FB 1ORSB 4X98B 2APFA 1LK2A 1RJLA 4HXAL 2FSEB 4XTRC 1YECL 2CDGB 4ORGA 4RDQF 5J7CC 3FQRA 4WEUD 2R0KH 3O6FC 4M48L 4XNYL 4LHUG 5DFTA 4JFYA 2PW2B 3IKCB 4LCIL 3DLQR 1XIWA 1U93B 1OHQA 5L7XL 5EOQH 1EJOH 2F54B 4QTIL 2BP3A 3KS0H 3NIDF 3IDJA 1JPSL 3EDKA 4MDIB 4RFEA 1AGFB 2CKBA 5K9JL 3UEZA 1M1SA 2VR5A 4ZAKA 5C9JB 3T2PA 3S88L 2ID5A 1IAKA 3LN4A 4NCC2 2FEEI 3FTGB 4ZFZB 3N06B 5BS0A 1WIPA 2EIBA 3TJHC 1CGSH 4BUHA 3RNKA 1GAFL 5FF6A 3CDCA 1LE9B 3BGFB 3MRLA 3DVGB 5DZLA 3HZKA 4OBSA 5F96H 3O4LA 2VR9A 3SCMB 2C4FU 1LP9F 2XY1A 1U8PB 2X4RB 2OJEB 5C0CD 5I0ZA 1KELL 2IMNA 3G6AA 1U8KA 1KPRB 3GMNB 1KFAH 1A7OH 3MV01 3GMMA 4QKXB 3FN3A 3LSOA 5IG7B 4Y4HD 4XWOC 5I1GL 2GSGA 1F97A 1WITA 3DETC 4WEBH 2X6MA 1NCCH 3JTTB 2VITA 4NRXB 4OUUB 4NPYB 2NY3D 3E8UL 3B8YA 4XP9L 5FHAH 3MLXL 1YDPB 1FV1A 1DQDL 2PUQT 2Y06H 4JY4B 2D9QB 3TV3L 4E5XA 1IBGL 2D0HA 1DQML 5D1XB 4LU5H 4JAMB 3S37L 5IIEB 1SJHB 3W0WE 3CLEH 4PJIF 1RIVH 4PTTA 1FFOA 4WW2A 1EK3A 1CDBA 3T4AA 1PEZA 3ARDC 5EZJA 2DI7A 3U0TA 4CNIA 3VFNB 5FO8B 3U46A 4IDJL 4Y7MA 1B0GA 1FNGB 5I1HH 4YXHL 5KVGL 3HG1D 1TQBC 5BJTA 4OF0A 5EDXA 1A5FH 4WFGD 3CNKA 3F62A 1YECH 2MPAL 5GS1A 1EBPA 5CEYA 3U4AA 1QSVA 2VC2L 4M48H 1DBBL 4ZUUB 1KNOB 3PQYD 1FZJB 4Y5YA 4WHTA 3MRCB 5HHMD 2I9TB 1X6NA 1IGML 3L3OA 1HSBA 1QPPA 5IB2A 1H3WM 1S9WA 4UNTA 1HEZA 4KMTL 4LHJB 4QTIH 3M45A 3V95A 1JGVH 5ABDE 4NBYB 5KSUA 3FFCD 1NBQA 3UYRL 5K9JH 1Q1JH 4KAQH 3I2CH 4GMSL 3MRIB 5F93C 4E9LA 4MXQC 1BVKB 1MCPL 3RBSA 3ZO0A 2DM2A 5D5MA 1UM6H 2EXYD 3BUYB 3VXSE 2ERJB 5HHOA 4ODXB 1W72B 4N9GB 3WXWL 2DM3A 5ISZE 3RWEA 3IFPB 3STZA 3T0XA 4Z7WF 1NCWL 5KTEL 4K9EC 1OGTA 3VG9C 4IHOA 4QOKA 3MGTA 3TZVC 5L2JA 3DNKA 1A6UL 2FBJH 5AAWA 2WUCL 1JCKA 3KG5A 2AI0L 5D6DC 3RFZC 1CFBA 1P6FA 4JO1L 1AD9A 3MRGA 3IJYB 3GUTB 1AIFA 4ODHL 3F6LA 3SGDI 1NAMA 4P4KC 3UX9B 2GCYB 4KUCD 1UWEL 3U83A 4Y5VA 4PRHA 1R24A 1P5VA 1ADQA 1NKOA 2VLKA 1MVFA 2VDPL 1IKFL 3E8UH 1K6QL 1U95A 4JFEB 3MLXH 4XBPA 1QLEH 3RX8A 1AHWA 2W91A 4NQTA 1IBGH 5HJ3B 3CDGB 3GSOA 1CGUA 3S37H 1T89C 1GJIA 1H8OA 4YHNA 3VI3F 5DHVH 3HI5L 2HFFB 2H2PC 4WTXA 2DN7A 3QUXC 1CDYA 3GMOB 1JYVA 4P2QD 3O8XA 3PWPD 3N1MC 3GMLA 4J3SA 2VXQL 4YXHH 1WGOA 4GT7A 4RAVB 1MLCB 1XGPB 2NY4B 4RZCB 4D94A 3SKUD 1U8HA 3ULSB 1C5DA 4UBDD 3OKNA 1IGIL 1EFXD 2VC2H 4FTVB 4R7DB 4FQXB 2FX9H 4AEHL 4FQCH 1I4FB 5C0ND 1EA9C 2XA3A 3WEXB 1CICC 4ZYKB 2P42B 3LKPB 4JFFD 3AUVA 3MJ8B 4XCFH 3UYRH 5HDBF 5C86A 3ILPB 1CG9A 4R90H 1MREL 1ODAA 3ZTJH 2VISA 4X6EB 3OPZH 1SJEA 5DRZB 4WNQB 4ZODA 5D7IE 3DSNA 4M8VA 5DLMH 1RJCA 4PYHA 1BD2A 1L9NA 1TNNA 4TRPL 1ZWIB 2ZKHH 1G7IA 3T77B 4XPAL 2RB8A 4CMHC 5C9KA 1XGRA 3C09C 3V4VL 2X70B 3REVA 2P49B 4N90E 5KANI 5D7JA 3OKOB 5GGSB 2WUCH 2DTMH 4RMRA 1ZOXA 3HE7D 3CZJA 5DJXA 4LSSH 1TZHA 4JO1H 1JE6A 2AGJL 1EFQA 3HR5A 3DX6A 3OSKA 4YPGB 4A2LA 4FG6D 4X0KA 3IDIB 3KLAB 1HWHB 2DQDL 1ES0A 5B21A 4P2OD 3F7YA 4PB0H 5I76B 3V0AC 4XP6L 3VXUA 3CVHA 5IHBA 3RL1B 3AM8C 4G9DA 2E7HA 2JIXA 3PUCA 5F44A 1M6OB 4GG8A 3SKJL 2AJUL 5J57B 1MCRA 5D1QA 4DAGL 5LKNA 3D3VB 4KU1A 1UVQA 5KAQG 2E6QA 5DQ9B 5HYFA 4XC3H 5DK2A 2IGFL 4YPJA 3IGAB 5SX5H 1A4JA 3C5ZA 5EO1A 4KZEL 3MJGX 5I66B 2W0FB 4KC3B 3TO4C 4P9ML 2HTLD 1U36A 3LHPL 3EFFA 2VXQH 1UXSA 3EYVA 2H2SD 5DHYA 4ZOCA 3AU1A 4KI5E 1QFWI 5D2LB 2P5EB 3CFKB 3PDDA 3C2AH 1SVCP 4R97B 1TTFA 5CEZD 1IGIH 3F8UB 3CXHK 4MWFB 2NW2B 2CD0A 4U1IA 5I8EB 5SX4I 1K4CA 4NWTH 3DVIA 4HAFA 2NZIA 4MAYC 4HAGA 4YXLH 4HKXA 2LE9A 3UO1L 4OFYD 1YMMD 2ZSWA 1NLBL 2BSSB 1J05A 1MREH 2QEJA 5I1CL 2AJYL 4P9HC 1VGKB 5EZIL 2NY5L 1XR8B 2DAVA 1QTYT 4LVNB 1KSRA 4Z7QF 2NXYC 5E94A 4IRSC 5C3TA 3MLYH 4G8FA 3VXME 4J1UA 5I9QC 2NY6D 4LSDA 4XPAH 5BXFB 5E8EB 3BPLB 3QO0A 1ED3B 3T0EB 1MFDH 4NRZB 4KQ3H 1INQB 4OZHB 4MQTB 2BNQA 4RAHA 4KRPB 3UBXB 2RQ8A 2DOCA 5E7FA 4M8QA 2ATKA 4EBQL 4F7TB 3RU8H 3VCLB 1UJ3A 3OJ2C 1N59A 5C0DB 2MHAB 4PGEB 4OZIA 1RZJC 4X5WB 1BBJA 4YAQA 4JFZL 4K23L 4PLJC 5E95B 1I8MA 2QLVB 4I3RL 3BT2H 3U36A 2NX5D 1FN4B 5INDA 4UMGA 1F6AA 1MRFL 3QPXH 2C7UA 2FX8H 2I60L 4XMPH 5E2UH 2WSKA 1DBML 1DEEA 1R3LB 3BP4A 5SV4A 5I75B 4OFKA 5IF0A 1QA9B 1RFDL 3LKRA 4M62L 5CINH 5H94B 4WDIB 3H7BA 1FVEB 3SKJH 2AJUH 1DFBL 2VZ1A 1ZXQA 1JYNA 3L3KB 4HS3B 4G8IB 4G6ML 3ZDXE 1QSFA 2F5AL 5IW1B 5F21B 2J88L 4M9OA 4YC2B 5HD8C 4KZEH 5C0AB 1KN4L 2DM4A 4LCCB 4PJFA 5C2UB 3QUYA 1DQQA 5IMOA 3KLHD 2EIDA 4M6OH 5DK0B 1OTTD 3PWJB 3IFLL 1WCBB 5F88B 3O2VH 4ZNCD 2AABL 3L3DB 4ONFH 1AQDA 3MRBB 4U0RC 4JO3L 3WFHA 3WFDH 1UKTA 1S9YA 4Q6YA 2CSPA 1DQJA 4NKIL 1DUYB 3QZWB 2D7PA 4MNGA 5TPWL 2VZ3A 3SE9L 2FL5B 2QQKH 3MLRL 2YBRB 3UO1H 1AGCB 3SEPA 1IQDB 3ZSTA 4HUVB 4LLWB 1IQWL 3ZTNH 2AJYH 2JF1A 1OWRM 3RZCA 1P4BL 3IXAB 4PJAA 4UV7L 4BSVA 1XGYH 2AK4A 3F7VA 4UUJA 1JNLL 4NJAL 1NCBH 1HHJA 4U1HA 4JN2B 4J8RA 3VGDA 3ZE0E 5D72L 3OJVC 4QLRA 3UTTA 2RFXB 1RD6A 1DL7H 3RWJA 3QRFM 4RCAA 1CLYH 4LDOB 4MQXC 5HHNB 4JG1L 4JGMA 5CJ5A 2UWEA 4PBVC 4EBQH 4Y1AA 1HK6A 1GZQB 2BMKB 3NGBC 4JFDD 1XMWA 3WNPA 5TH2A 2MNUA 4YFLF 1FL5A 1HHKB 2F5BH 2WIIB 2V2WA 4TSCL 5ECJE 3BKYL 3DO7B 2DKSA 4JFZH 5DVNA 1G9EA 1P7QB 3DI2B 2IADA 3DXAD 3I6GB 4I3RH 1DEDA 1JUFA 4PGCB 2AV7B 2BVYA 1MRFH 3LKQB 3MXVH 3LMJH 5DJ0A 1NFDA 4WFEE 5IHUH 1RFDH 1T6WA 4FZ8L 2BVQB 1BQUA 1OSPH 4JJHA 3WIIL 1PZ5B 3T3ME 3KPSB 4JVUA 5TDNB 1MCOL 3A6OA 5I16A 1ZVYA 5K33A 1QZ1A 4FZEL 4F8QA 5ID0A 2J88H 4KK6C 5C0GA 3QQ4B 4LOUD 2GJZB 4GXVL 3G5ZA 2B4CL 1FNFA 3O2DA 5DRWA 1TNMA 1U0QA 2IAND 2W65A 3EZJB 3OG6B 3AY4A 4TSBH 4ENEC 1YEHH 3SKOB 3VFGL 5E5MA 2DD8L 1KACB 2GK2A 1QRNA 2QKIA 3QUZD 4I5BB 4QHMA 2DIJA 2H8PA 1YEJH 4ZPTA 4EN3C 5JHDB 3IFOA 3BAEL 2P8PB 5ALBH 3C6LC 3GBNL 1H15B 4JO3H 4I0PB 4TN9A 4YFDB 3MNZA 1AI1L 1ACYL 1XCQA 3QG6A 1FVDA 4HZLA 4EI5B 2A83B 5GRWA 4N5EC 3TCXA 2CIIA 3HS0A 3ULVC 1DANT 3QHFL 2HJLA 2RCSL 2FH8A 1WZ1H 4MMXC 3BO8A 1C7SA 2EYTA 5E9DB 4QHNA 5I1JH 4UV7H 1RZKL 4J3UA 5HVGB 1FFPB 5J11C 1OTUD 4JG0L 3BWAA 5TFSL 2VXSL 4PRNA 1U92A 2R1XA 3O2DH 4OI9A 4HGWA 2XOTA 1FCGA 3PDGA 3BOVA 4WW1A 3X12B 4L8BB 1JWMB 3IKKA 3RVUD 1GXEA 2EC9T 1P69B 4HUNB 4OBRA 3FCTB 4QTHB 1OPGH 5FYJL 4JG1H 3MR9A 4Y0GA 1JGEB 1YNTA 4YDVA 3BGMA 3QNYB 4GW5B 1KTDB 4KK5C 1NANH 5DD6B 5C0BD 4Z7OF 4BSJA 4FQIH 4KKLC 4X5XB 3UTPE 3WKNA 2DQHL 3N9GH 3K2UH 5KJRL 3TF7C 4XGZA 3T4YB 2ZNXA 1W72L 3SBWC 4QGTA 5CJBA 1LO5A 4BM7A 4QXTA 4WVRA 4EDWH 4WWKA 1RSFA 4PJGB 2WWKO 4IRZL 2VZTA 1OP3K 4EI6A 3LQZB 1FFNA 3IJSA 3VW3L 4AG4H 4Z7VB 2Y5TB 3QP3A 4MYWB 1MCOH 4U2YA 2AJZB 2JB6B 1EXUA 1A4KA 3TO2B 3L5WA 3KXFB 1WUNT 2Q76B 4FZEH 3MTRA 3RHWF 2DQEL 2XWBB 5HVHB 3U9UA 3R0MA 2YUVA 1I1YA 4G8GD 2G2RB 1CFNB 1SEBB 3LEYL 2FNBA 1FZJA 4HCRL 5CCKL 1QD0A 5SWZE 5D2LF 3IDNA 2J2ZA 2J1KA 5F1NB 3MO1A 4MD0A 4LLQA 1PSKL 2R1YB 3IRZA 3EOAA 5EIVA 3ZYIA 5E6IB 2ZPKL 3LS5H 2CIKB 5DD5H 3D69A 1NL0L 1AI1H 4L29B 3RZWA 1WWCA 3MRIA 5I1LB 5I73B 5DVOA 1AE6H 1P2CB 4QRTA 1PLGL 3TPUB 5DWUL 1L0YA 2KZWA 2DWEA 3OAZK 3ZTJG 3U4BH 4OM0L 1A6AB 3DJ9A 2X4SA 3QHFH 1I75A 1WJ3A 1WT5C 3O3BB 4RGND 1E4WH 1G6RA 3VXPB 3DMMD 4L3EB 5IM7A 4MHHG 2X4TB 2CUMA 3UJIH 3I02A 4XCEA 5JIKA 1G7QA 3PP3K 2VXSH 4KVCH 3SDYH 3B6SA 3QULB 3OXSA 3VFOB 1FH5L 2H3NA 3NPZB 3QXVA 3WN5B 3D18B 4ISVA 1L7TL 3SKNB 4OZHF 3BZDA 5GRUL 1T20A 4GG6E 1NEZB 5JO5A 5FYJH 3Q0HA 3ULUE 1L6ZA 4JPIB 3UDWA 4YXKH 4JZNB 4PP1D 1T7ZA 2Y72A 5ENWB 3O45A 3HLAB 2ZJSL 3TCLB 5GZOD 5F7DA 1U6AL 3O6KH 5J1TC 4N8VA 2AXJA 3O3AA 4N9OB 3DI3B 3FONB 2VABB 4QCIB 43C9B 1AGDB 5KVFL 4FXKA 3PL6C 3WNLA 1K3ZA 3BSZL 4NNXB 4AIZA 1VPOL 3UYOD 5JXED 5L6YH 4P23B 5TF0A 4MJ4A 1G6RH 2PR4L 4FS0A 5DF0A 5GZND 4WTZA 5DYOB 3AB0C 5CD5D 1S9VA 4KTYA 1A6ZA 3VW3H 2YPKB 4NQDA 4HD9A 1KBGL 4MQSB 4RAVA 4J3OC 5BS0E 5D7LB 4N0UE 4L4VE 4ETYA 2Q87A 5D71L 5CSZA 4Q0XH 4M02A 4D0DB 2HVKA 3WFEH 2EO9A 1Q9KB 5DURB 3ET9F 5DA0B 1N8ZA 4FXLA 1IKNC 5CCKH 2VXVL 2DRUA 1VFMA 4CU8A 3NFSL 4JHWL 4HXBH 1UWGH 1WTLA 4GW1B 4KWUA 1CGXA 2GSIA 2VLJA 4HJJH 1NL0H 2YN5A 1T80A 2P24A 2XI9A 2PXYD 5AZ2H 4BFIA 3FT4B 3UTSE 5CD3A 4EEEA 1L6XA 2ED8A 3EO1B 3HNTH 3G6JA 1LWRA 1ZWIA 4HWNA 1A3RL 4JLRB 3B9KD 5L0QC 4K2UL 1A6WL 1W0YT 5C7XL 2ESVE 2VIRB 1MOEA 5KSAD 1FG2A 3O4OB 4OLVH 3QQNA 1FH5H 3L5XL 4YHYC 5CWSA 4LF3B 2BSTA 3B2UC 1DBKH 5F7WC 4OSUH 5HYQA 2AVGA 2EDXA 1TXKA 3MRDB 2X1WL 1KYOJ 1ZLWK 1MVUA 1OGAD 3OKLB 1ZT7B 2ZJSH 3O6FB 1U6AH 2ILLA 5F7FA 4ETQA 1EEUA 5ICXB 5KVFH 1UACL 1D5MB 5MERB 5B39A 3UROR 3BSZH 2GAZB 1X7QA 4JFHE 1R3IL 3UP1A 5C2BL 1MCIA 4JDTL 3PP4L 3S34L 3TVMA 1YY8A 2XPGA 3DBXA 3IGAA 2H9GA 1T5WA 1AP2A 3EYQC 4MZ3A 2HTKC 3ARBC 3V52H 1N2RA 1KBGH 4NJ9L 3LEXA 5FYKE 4KKBC 4MS8D 5HHOE 4OFPA 2BCKB 3PWPA 2Z93B 4BQ9A 3R1GL 3ETBF 3MOAL 3MNVA 2X9XA 1ZGLA 4L4TD 5E7BA 3BIAX 1MF2L 3SDAB 5J89A 5D7KD 5IQ7L 1JK8B 2D7TL 2GT9A 1NC4D 3EYSH 1T1XB 3QJHB 1HILA 4LP4A 4QWWD 2NLJA 3LY6A 4OQ1A 1EFXA 3VG0L 4XPFL 5ESAB 1CD1A 4GRLA 3TH3T 4DOHB 4A6YA 5SWQB 4OCYL 1CLCA 5EUKB 4JFFA 4OCWL 5F9JA 4KGJA 2C5DC 5AUMA 2K1MA 3VWJD 1XF5A 2AJVL 4WI6A 3MLWH 3NZ8B 3RAJL 3I6KB 3L95B 1L7IH 3OX8B 5I1EL 5CSBA 1ZEAH 3ARDB 4PY8J 5IROC 1CGTA 3L5XH 4N0FA 3MRPB 2Q86B 1IFHL 4PTUA 5DMKA 2FIKB 4OFVA 4LKXB 4OLUL 3DYOA 1NJ9B 4PRBB 5EORH 3MV9E 3DUHA 5CBAA 5JW5A 3KPRB 5C0FB 1JN6A 4UI2A 4HJGB 1F4XL 4MXVE 4P2CG 4JZJC 2NXZB 5T3XD 1QA9A 1SJVA 5T1MA 1EGJL 1MFCH 4U1KA 1BVLB 3W82A 4YDJB 1TVHB 5BRZD 2IH3A 1OVZA 3W9DB 3NVQA 3TNMB 4HLJA 4XB8A 1U8LA 1TJHL 3SCMD 1BQLH 4L4JA 1BF8A 4LKCB 4B41A 2CLZA 1PDKA 5FB8A 5C0AA 4X7TA 4Z7VF 3GSUB 1TPXB 5D1ZC 2QHLA 1A1NA 1F3RB 3LV3A 4G80A 2DKMA 4NJ9H 1MI5D 2FB4H 3C87A 3VG9B 2QHRH 4ZS6C 4HJ0D 1QNZH 3TZVB 3GSVA 5F88A 4ZSOA 3R1GH 3MOAH 4X5LA 3VXQB 5C0EB 2XA8L 2F8VA 4O58L 1T4KB 5F9OL 2D7TH 4APQA 4JHBA 4PJBB 4NQEB 3IT8D 4NC2B 5E2VL 3WD5H 3TH2T 4UIKL 2Q20A 1MUJB 3MRMB 4OLXH 4LIQE 4K3JH 3E3QC 1AO7D 4MAUH 4NGHH 4P4KB 5ERWA 4PRPB 1YY9D 3KR3L 3VG0H 3THML 4XPFH 1UB5B 1V3LA 2W92A 4XC1L 3O3EB 1F58L 4KV5F 4X8XA 4M7ZC 1UC6A 4OCYH 3MUZ1 5D7SH 4R0LC 3P73B 3F7QA 1HIMH 3MGOB 5JPNA 1YMMA 2V17L 5CUSH 3LQAL 2E7LC 5ANME 1T0NA 1WWWX 2YUXA 5J56B 4P48A 1C08B 3HPJB 4I2XA 1BBDL 1YUHB 2MFNA 3RAJH 1DN0A 5I71B 2VSCA 1UGNA 1RK1B 3RPIA 3HRPA 5I1EH 1N5AA 2AEQL 4FFYH 1GZQA 2BMKA 3QUXB 4FQJL 3FQWA 3HB3C 1F6LL 1CI5A 3WFBH 1YPZE 2C4XA 4M3JA 5B38A 2X1QA 4NO2A 5ESVA 2GTWA 2VDMH 4I3SL 5GQBA 3IAPA 4MB5A 2DIBA 3RY6A 1I8LC 4OF7A 4XI5C 4PREA 3T65A 3GSQA 5FUCE 2GJ6A 1A3LL 1I7RA 3QDJA 1F4XH 4QRRE 1EGJH 4MA1C 4Q9BA 3DV6A 3MRHB 4KJQD 2NX5A 3KPTA 5MI0C 1CICB 2PF6A 3KPSA 3QG7L 4UU9A 4IRJC 2R56L 3I75B 2ZSVB 3BISA 3U6RB 1TJHH 5KS9B 4F7MA 4I18C 4K3GA 5EN2B 5AD0A 3JV4A 2IBZY 4M7LT 4NDMB 2GJZA 4WI5A 4I48B 2CK2A 5EU3B 5IV2A 2C3HA 3SKOA 1A6TA 2KQMA 4CVWA 4RISL 5DT1L 3CCHB 2VWEE 3HI1B 4EZMA 4CMHB 1YQ2A 2AXFB 1TZGL 3C09B 5HYJE 3I6LD 3CJJA 1BHGA 5TGBA 4GRMA 4D3CL 5EOCJ 4HIJB 3QEQD 4O58H 4PV8B 1ONQA 2PYEA 3X13B 5JW4R 1EHLH 3SE4C 4P2RB 2XQYK 1BGXL 2Z91B 3TN0A 4EI5A 1GYAA 4B0MM 5HHPA 1NGXA 5DK3A 3NTCL 1GC1H 3WE6B 1HNFA 3BWUC 3RVTC 4XC1H 1D6EB 1MH5B 4TUOA 1F58H 1MQKH 4LPWA 2BX5A 1RJZB 5IOPB 4JB9H 1P4LA 3RBGA 1GGCL 4YLQT 3V8OA 4QT5A 4F58L 3FB5B 3MV8E 1Z0MA 1IGJB 2V17H 4HUUA 1T5XA 4CDHA 1TCMA 4BKLB 4JHAL 1X4YA 5CLWA 2IPKA 5EBWA 2A6DB 4HMCA 4UILL 5T1LB 4I8DA 1CXLA 5IEHB 1OF2B 4FTVD 2DF3A 3GBLA 3JWDC 2RIKA 4GW5A 3EDFA 1DJSA 3P0VH 3K4ZA 3WJJA 2RGSA 8FABB 4X6CA 4I3SH 1JPGB 5LQBL 1RAMA 2BNRD 4CVXA 4GKNA 1A7QL 4ZO6A 5BZDB 5IESH 4I9WD 1A3LH 1Z9SA 3BH8A 4LCWB 4PJ5D 4QHKI 1WFTA 3IDMA 5D2NB 4YNYB 3QIWC 3BXNB 3DXAA 4NKOA 1I7TB 3VDCA 2JCCA 1DQTA 4LSQL 2YD1A 1KEGL 3HE6C 9CGTA 1FZOA 4XCCH 2XWJB 5LBSL 2HN7B 2OZ4L 3H3PL 4MNGE 3HC0B 4S0SD 1XCTB 3AS2A 1HKFA 3PV6A 5F6HJ 3QI9A 1KLUB 1TQCC 4IRSB 3PABA 4LPUA 1U2CA 4Y5XC 4LHQB 2F53B 4RISH 5DT1H 4U2ZA 3ZMRA 3NCYS 4UIMB 5I9QB 1AR1D 4KDTC 2OTUB 5GGVY 1MCBA 1IVLA 4HGMA 3P9LB 1QHPA 3UZEA 4ZFOB 4H26B 5H35A 1KCLA 4D3CH 3ZDZF 3ZE2F 2ZUQB 5DI8A 1A6VL 5EU7E 2BVOA 2IQAA 4N8VG 2BFVH 3PGCB 3R06B 2AJ3B 3HUJE 1I85A 1BGXH 3MROA 4RMTA 3MBEC 3MPCA 5LGJA 4F2MB 4JKWA 2LU4A 2Z31A 4YE4L 1A6AA 2HH0L 1FL3A 3NTCH 3IVKA 2YPLD 4X4ZA 4KPHL 5KG9A 5KZCB 4CN4A 5DS8A 4CVZA 4LGRB 4OZGA 4WTZG 1KLGA 4G9FB 3MREB 3S5LB 4NQCB 5E2TL 2IH1A 2R0LH 3HHRB 3O11B 4N0CD 4ZUVA 1E28A 4UDUA 1BLNA 5FHBL 4ZMAT 5K9OA 1PY4A 1S9KC 1NSNH 1UM5H 3WIFA 4AH2B 3HRZB 4PRIE 3QJFB 3ARZA 3QFDA 5T33L 3LS4L 2BVEA 4KKAD 4ELMA 1QSEB 3H9HB 2GFBB 5FOJA