3WIIL

Crystal structure of the fab fragment of b2212a, a murine monoclonal antibody specific for the third fibronectin domain (fn3) of human robo1.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
213
structure length
213
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNFLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDFSLTISKLEQEDIATYFCQQGNTLPLTFGAGTKLELKRAEAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural features of interfacial tyrosine residue in ROBO1 fibronectin domain-antibody complex: Crystallographic, thermodynamic, and molecular dynamic analyses
pubmed doi rcsb
molecule tags Immune system
molecule keywords anti-human ROBO1 antibody B2212A Fab light chain
total genus 54
structure length 213
sequence length 213
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wiiL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wiiL01
3HNSL 3QFJD 4IIQC 3S6CA 1MWAL 5I1KH 3DRQB 3TO4B 1FFPB 4PJDA 1G7IB 4NKMA 4AIZB 5T3XL 1T3FB 4JG1H 5FA3B 2EIZA 2D2OA 1GGBL 4ODUB 1MIML 4JDVA 2P8LA 3IXAB 1S5IL 5D7JD 2Q86A 3G5ZB 3H6JA 3BIBX 5GZNC 3A0OA 3U36A 4RFOL 4LKXB 2D7TH 3MRBB 1WFUA 1QR4A 2Y5EA 1PY4A 4MJIE 1SEQH 3KYKL 4MA3B 1DBMH 2AI0H 2YUWA 4CVXA 3U7YL 1X5ZA 1J0HA 5I0DA 1MHPL 2DKMA 2BNQD 3O3BB 1OAYH 1IQWH 4ZG1A 1B9ZA 2XWTB 1TETH 4JPWH 5FM8A 5EU3A 1HH6A 2BP3A 4OUUA 1CLYL 4DCQB 5BRZE 1IEBA 3FQWB 3VXMD 3BESR 1OTSD 3BQUA 2VXUL 3ZLQC 1S3KL 3FQXA 5IQ9B 2VABB 3Q2CA 1YN6B 2EKSA 2EDLA 2HT3D 3P11L 3QUXC 5ICZB 3QI9B 1MCOH 3GJFA 4LCCB 3LRSB 2OK0L 1RULL 2ORBH 5HHQB 2EYSA 5ADPL 1LK2A 1I1RA 1G9ML 3B9AA 2X42A 3R06A 1H0DA 2VXTH 3CNKA 4PPTA 3KPRB 5EBMA 3EJYC 2Y9RT 4PRIB 4KVCH 5CILH 3ULVL 4PP2B 4F7CA 4AJ0A 2G9HA 4KQ4H 1B3JA 5IT2H 4PGEA 5EWIL 1R3KB 2XRAL 2FR4A 1C5BL 4QLRA 5C9KA 2V2WA 3KLAB 2ZZUT 1MPAL 5D1ZA 1FZOB 2OL3L 4NRXB 5TDOB 2H3NB 3VXMB 3JTTB 1EZVX 2DLEA 1UWEL 1AP2B 4OT1H 5B39A 4PY7A 2CD0A 1MFEH 3VH8B 2XTJC 4JR9L 4LLWB 4TSAH 5J0BA 5KAQG 3G6JB 3L6FB 1WZ1H 1T5WB 2OJZH 3C5SB 2X4PB 3D3VD 3DI2B 4QXUH 4RWYH 3TJEL 1QSZA 4YPGA 3WFDL 3TT1L 3P0VH 5FECB 4WU5A 1FYTA 3WXWH 2CLRB 2Z8WC 5EA0L 4GMSH 4TUJB 4M43L 4YGVA 3GB7A 4KKNA 4HC1L 2D7TL 2IEPA 2FATL 3AY4A 1FIEA 5GIRA 3PNWB 4JE4B 2AI0L 2BHZA 4JM2B 2RFXB 4Y7MA 5F6IB 1XGQB 1FVDB 3ZTNH 3QDJD 1BQLH 2BSSA 4YHNA 4FXGA 4LMQE 4NOFA 4TPRL 3GBLA 3NAAL 2P8PA 1HQ4B 3IS0X 5AEAA 4WRLA 4XI5C 1F11B 4R8WH 3H9SB 2DLHA 1Z3GL 4OCNC 4PRBB 5DD0L 4NQVB 2A9NL 3BWUC 4GQ9L 1U8QB 1GRWA 4TNVK 4HS8H 4X8JB 1RIVH 3U30B 5E9DA 5L9DH 1HSBB 1A6UH 4ZTPH 5B38A 3C08H 2VZ3A 1DZBA 1MI5D 4J6RH 4M62L 4OLWH 5DHVA 3RX7A 3AM8A 1FFNB 3O2DL 1DVFD 1R6VA 2X89A 3IJSB 4K23H 5TH2A 1WWAX 3S9DB 4N0FA 5FDWA 4D0BB 1UKQA 3BXNA 3ARYA 3LKNB 3OB8A 1JNLL 3DVIA 5DF0A 4DVRH 5D7IF 4BQ8A 2YEZA 1KXVC 4Y4KC 1HH9B 4PJXA 4XGZB 4Z5RB 2OQJB 4XP1H 5TDNB 4U1JA 4D2NA 1CCZA 3N06B 5F97E 5F9WC 1CXLA 4P2OA 4NC0B 1UH2A 4M48L 4U4BA 3MMEA 1X5YA 3PHQA 1UQSA 4HK3N 3QEQE 2WIMA 1VPOL 3HN3A 3U1SH 4XWGL 5D7LB 3BGAA 4OV5B 4GW5B 5T1LA 5BV7L 2B2XL 3HZKB 1HCFX 2B0SL 4ENED 1I1AD 4MCZA 2JCCE 4P23C 3BZFB 4OZGE 2LTQC 2NX5D 2NY1B 4XXDA 3VU2A 4MQ7B 4EBQH 3ARFB 1LWRA 3JWOC 5EH1A 4PRDB 4WI4A 1IGJA 4POUB 5FYKL 2HTLD 3TN0D 4P46A 3T1WA 1M4KA 4M7JH 3ZYIA 3CPLA 3UAJC 3PGCB 4CW1B 2NY3C 4PLKC 4Z7OE 1CXIA 4UIMB 2OL3A 5ACZB 4JM2F 2MHAA 5INCB 2P43B 3TCLB 4K9EC 4TSCH 3VD9A 5K33A 4CN4A 4BQBA 5E1AA 3CU1A 1GGUA 5DLMH 5IMOA 4AEIH 3EOAB 2YPKA 4EN3A 1DSFH 5D70H 3B6SB 5CZKA 3O2VL 2HLAA 1Y0LB 3RTQB 3O4LD 1A6VH 1EZVY 1F3JB 5TH2B 5JIIA 2DQFA 4G8GD 5KSBE 1T7XA 4Y4FD 4PRAB 4NNPL 2G75A 1BWMA 1E28A 2B4CL 3WHXB 2R56L 2DTMH 1OAQH 5J56B 3W9EA 1INDL 1CIDA 3CZJA 3MLUH 1RMFH 2VRAA 2OMNA 2YS4A 3HZYB 3LPFA 4FQ1H 1N5YL 4HH9A 2EH7H 3AS0A 4PJHB 4C56B 3BAEH 3E6FA 43CAB 3EHBC 3KNBB 1CFQB 2EZ0C 3W9DB 2XQYG 1HWGB 2WMPA 1J11A 1J12A 2LVEA 3C8DA 4WEBH 4R3SB 4UINL 3H7BB 1XCQB 3O9WB 4GRWH 3WFCL 3W11D 5C0RH 3IU4H 4LU5H 2BRRH 4XNYH 4ZFFB 4NJAL 1FV1A 3O41B 1AXIB 4PB9L 2E7LA 3NCJH 2ZWLT 4ZOAA 4JFPA 3QFDB 2NY2C 1D5BA 3QDMB 4JJ5B 3MRHA 3GMQB 2CKNA 4PJAF 4ZUWB 4U6XA 5ISZB 3RBSA 4G42B 2MQCA 1OVZA 2OSLA 4LVHB 2V9QA 2A6DB 4Y4FB 1MJJB 4PJCF 1UB6B 2HH0H 5A3ID 5ID1B 5IP4A 1SM3L 1N6UA 4O51B 4F7MB 5IQ9A 2FX9H 3WN5C 2QJDA 3C5ZB 5JQ6H 4M5ZH 4UB0L 3QG7H 4ZO6A 1JGEB 4W4OA 2B20A 4O9HL 3PF2A 4OKVA 1AC0A 1QQDA 5EOTA 1UKSA 4PGBA 4UDTA 4DVBB 3BIKB 4Y0GA 4NRZB 2O61B 4NN7B 2IAMA 3SBWC 4LMQI 1I3GL 4I3SH 3EKCA 4HSQA 5JIPA 3V2AR 4F7CB 1CLOH 4UV7H 2YXMA 5JZ7D 2XICA 2APWA 4YXLH 3G6DL 3S88H 2NTFB 1BLNA 1J87A 4UQ2A 5DGQA 2V2WB 2V2XB 4YQXH 3OXRB 4JHBA 2FSEA 1BGXH 1I8IA 1EX0A 4X9IA 3DPBA 5HHXL 3QZWB 3SDYH 1NCBH 4OAWA 1GGTA 3IJHB 4XT1C 2AK4E 5I1GH 5DA0B 2OTUA 3QDHA 4POZD 2YPVL 2DLTA 5CJ8A 5IGXL 1A6TB 2EE2A 2R56H 2VAJA 2LU3A 3KJ4C 3QPXL 4LSTL 5KSAB 4Y19B 3ZKND 3ESUF 1FRGH 1YY9D 1A4KB 1BOGB 4FQXD 2VISB 4H0HB 3IFNH 4CADA 4GOSA 2PW2A 5HTSA 3OWEA 2F5AH 4M6ML 3S36L 3LS4H 4UMGA 4Y19D 1REIA 4LPCA 5DS8A 4LLMA 2WINB 1IGMH 2EDNA 4QKXB 5GJSH 5CD3A 3ZDZE 1F4XL 5F3HB 4QF1B 4O00A 1XF4B 4NQXB 3KPNA 4P2RE 3LN9A 1YPZA 2AEPL 3MSPA 1S9XA 1WV7T 3ULVE 4Q97A 4OLZL 4XHQA 3RWIB 4U6VL 5KG9B 1W2KT 4WW2C 3R1GL 4LHUD 2SEBB 3PG2A 2OI9B 2Q1EA 5GGTA 1WT5C 2OR9L 2Y72A 4RGOH 3CXDL 4PJCE 4ZAKA 1PLGH 4EDXB 2NLJB 5DJAA 1YEKH 4PG2A 5ITBL 5EOCJ 2V2XA 4KJYB 4F8TA 3MTRA 1TZHA 5JQ6L 4ZXBA 1E4WH 1LNUA 1DTUA 1MI5A 3IJHA 4HK0B 3S7GA 4P5TD 1SYSA 3UTOA 5F1SA 2Z31C 1FQ9C 3KYMA 3VGDA 4JRYB 3TP4A 3JV6A 2VDNL 1R3JB 2W38A 5D2LA 3UDWC 4YH6A 5AZEL 3VI3F 3M8OH 2WAHA 1KN4L 1BIHA 4XMKH 3LN5A 4YXLL 1SYVA 3DV4B 3K1DA 1DE4A 2YUVA 1YN7A 5KVDH 3UTQA 1H3GA 2HFFB 2ZJSH 2HFTA 2VL5B 1MSPA 3E0GA 3X3FH 2NW3B 1I7TA 4ORGA 2NX5B 4X4XA 5E2UH 4HZLB 1D6VH 2F58H 2YK1L 4OZFA 1IAOB 5F1OB 3EYFA 3SE9L 4QHKJ 3IKKA 1Q0YH 2BZDA 3PWJA 5AYUH 1DQJB 4QRPE 1JK8A 4W68A 5IUSA 3L3JB 2ZG1A 1AFVL 1HSAA 4HIHB 4G43B 4M6NH 4P9MH 1EO5A 3SDAA 4D9QE 1VEPA 3HS0B 4WI8A 1NCWL 3V6OC 4L4VB 1X7QB 5JW3H 1U58B 4LOUD 1P7QB 5F8QC 2JIXD 4FQ2L 3I9GH 3DVGA 1AE6L 1ZLWK 3L3IB 1IGML 4FNLL 2I27N 1LEGB 2NTSP 4I0PA 5D71H 3CUPB 1AR1C 2C1PB 4MAYB 4IOFC 5C0AB 1BBJA 1YYLH 4JO1L 5IESH 1ZANL 5F1NB 1FAKT 1WVZA 4ISVB 1CT8A 4KH2A 2OTWB 3SKUD 1NUFA 3G6JE 1HEZB 1AGEB 4M7LH 3OJDB 5IIEA 4EI5D 4PRPD 4OV5A 1RJZA 1JHTA 3R1GH 5K9QI 1MCPL 3OJ2C 5E24E 1QA9B 4PJBF 4PYGA 1EMTL 3DX7B 2XTJB 5K9KA 3KXFA 2VDML 4EI5B 2ERJB 2P8LB 3IXAA 4OQ1A 2Q86B 3QULA 1I9RL 1OB1B 2GJ6D 5KVEH 1MHCB 5CP3H 1QTYT 1X44A 2IPUK 3F58H 5IB3B 4HZLA 2QEJA 5EZOH 1PEWA 4FFYL 3WN5A 1N2RA 3PWPE 3UBXB 3QFDA 3DVNA 4AT6B 5BS0D 1G7QB 1TITA 4DUXA 1LO2H 4ZPVB 1BX2B 1DLHA 4M6OL 1J1PH 1JPSL 1F5WA 1A5FL 1IZJA 3W0WB 3K80A 5IKCB 3UZEA 4FFWC 1GGBH 4K3DH 4ZDHA 1QLEH 1U91A 3CFKA 3X3GH 1OSPH 1MJ7L 4LCIH 4Z7NE 2Z4QB 2AJ3B 2GJ6B 1XGTA 4OFKA 2DS4A 5D2LF 1XGPA 3ZSTA 4ZO7A 1IC4L 1NCDL 3HUJF 3G04A 3FMGH 2CO7B 3WDHA 4OCRH 4XVSL 1I8LA 2YK1H 4L3EA 3LRSA 2EEAA 4BELD 1FVEB 2ZKHL 2CSPA 1WISA 2CRIA 1RZ7H 4PLJD 2C7UB 4JO3L 1SBBA 2APXA 4G5ZL 1ZTXL 1JHLL 1RD6A 4QRTB 3RZCA 1FNAA 1TMCB 3HNSH 3GUTB 4DQOH 4KHXH 4I77H 4F15B 4NQCA 4Y4KB 4WUUA 3QCTH 1HWHB 5D71L 3OG6B 4NKDA 4LPTA 3DROB 1JF5A 5D7LD 3G9AB 4RFEA 5TDPB 2OSLB 1YYLL 1JWMB 3KPLB 1KC5H 1NMBH 3IDJB 4XXCA 3W39B 5FYJE 3K2UH 3LS5H 2YPLD 1UENA 3P9WB 3GHBH 5EPMB 1OGAD 3GSWB 2A9MH 2A1WL 2EC9U 5IF0B 3MV9B 1V7NL 3RU8H 1J0ZA 5HGBA 1NCNA 1XF3A 3SE3A 1NGPH 4KROD 3MV8B 2GK0A 2E7MA 5FB8A 2C3XA 5LXGL 2H45A 3PDOB 1XMWA 4LPUA 1PAMA 4OCSH 5I1AB 4YC2C 3UYPA 4J2XA 3CK0H 3VXSD 4FP8H 1PQZA 3MUY1 3ZDYF 3VWKA 4XWOC 2WBJD 3RBGA 3DXAA 2ADGA 5E6YA 1NANI 4S1SL 3TZVC 1UT9A 3BEWB 1FZJB 1TVHA 3NIGE 3HA0A 5J1TC 2KH2B 3LQAL 4OV6F 5JOFB 1RFDH 4U1IA 4HEPG 4U1GC 1MFDL 2AABL 1UWEH 5GGTL 3OKOA 3G6JF 2PO6D 4C83B 1RK1A 5EO9A 2X4QA 1WCBA 4JRXA 3OF6D 3DX9A 3FQNB 1RZGA 3EO0B 4XC1L 4OLUH 2ENYA 4M6OH 1KJMB 2DWDB 1P4BL 5GHWH 2R1WA 2CGRH 5HHNA 5MEOA 3V0VB 1HQ4A 4JLRA 5C6TL 1NFIA 3PHOB 4Y1AE 5IG7B 2E7CA 3MCG1 1U8QA 4TUKL 3VG9B 3QQ3B 2DL9A 3HG1B 4U31A 1BVKB 1OY3B 4I18C 5TDPA 3CX5J 2V2TA 3VD4A 5HXMA 1Z5LA 1T83C 1JRHH 2VAAA 4MA7H 3NMEA 5CIPH 2DF3A 1I9EA 4LF3A 5I17B 3SOBH 1QR1B 2OMBA 3D85A 4I5BB 1GC1C 3CSYA 4TYUA 4BFIB 1G7IA 3GSUB 3S35L 3F7VA 3TWCH 1B0RA 5FA4B 1IL1A 4Z5RA 1HHHB 2CQVA 1MFEL 4JR9H 5I1EH 5C8JB 4BZ2L 2A9NH 1MNUH 4JKKA 1EHAA 2YC1A 5BZDA 3MRPA 5L9DL 2EYRA 5B8CB 4P5KA 2WWKT 1OF2B 4OLWL 3U7WL 4APQA 4H1LA 1KC5L 5BOZG 3HZVA 2B1HL 4AK1A 2D4DA 5C07E 4OM0L 3LS5L 3E2HB 3LPGA 4CAGA 5EA0H 3GHBL 2FR4B 1XGRB 2A9ML 1CR9L 1ED3A 1VFAA 3NN8B 1ZMYA 1ETZA 2VYRE 3RU8L 1DEDA 3T0EB 1NCTA 3D3VA 4MJ5B 4S1RL 2DYPA 5J12C 8FABA 4YHML 2MFNA 4XP1L 2E27H 3HMXH 4Z78A 4FP8L 1K4CB 5IFHL 1P2CB 3P0GB 4KV5F 1IC5L 5HYSB 4RCAA 1X6NA 2HT4C 4S1SH 4Z6AT 4WJ5B 4YE4L 2CK0L 2L7UA 4JKPL 3VXNA 2IFGA 4ZS6D 3LKRB 4LCCA 2NY0D 1ADQL 4QY8A 4L8DA 5ESAB 3X11B 4P2QE 5JOPE 1R5VA 3QEHA 1V5JA 4HS8L 1ZEAL 4G8IA 5D1ZC 3BO8B 5F7EH 3O2DH 4V1DE 1P4BH 3V79C 1T1ZA 2BY2A 2YD8A 3P9MB 5FYLE 3C60B 1NKRA 1P7KA 1NC2B 1JGUH 4GKSA 1Q9WB 4OZFB 5IOPB 4TUKH 1FE8L 5L8KB 4HUVB 4G7YL 5HYJD 2YR3A 4P9HC 4JFDE 4A6YA 1AHWA 1NCAH 2X4TB 4PJIF 5TDOA 3DETC 3KLHD 3BRFA 3C8HA 4MDJB 3ZO0A 1A7BA 1G9NH 4XWGH 1UCTA 4LIQH 2AQ1A 5KS9F 4MDIB 1ORSA 1HXYB 4XVJL 4FQHA 4NNPH 3IF1A 3QDAA 4DOHB 2GHWB 4NO2B 2E9BA 3NCEB 4MAYA 5SWZA 5HHPA 3GMLB 4KAQH 3ARPA 3QUYD 4Y2DB 4MX7A 4G3YL 1CZ8L 4Y4FA 3ARWA 4RIRA 1T21B 2BY0A 4BSWB 1A47A 4MQTB 3UTZA 2CLRA 5FYKH 2EYSB 5JIKA 3TO2B 3L5HA 1P4IL 3WCYA 4F7MA 5GS1B 1MCBA 5GS0C 4UINH 5E8OB 1I8KA 1TJHL 4PS4L 2ENSA 4FFVC 2BRRL 1AHWC 5IVXA 1RHHA 3IAGC 4D8PB 3ARVA 1I7ZA 3UJJL 1JTPA 2GSIA 4C4KT 3BHBA 1A1OB 4N8VG 5I6XB 1W0VA 5DMIH 4PLJC 4S1RH 2OP4L 2UWEA 3MLXH 4XVUC 3RWJB 5JW4R 3T0EE 1U42A 4P3DB 3O2VH 3HPLA 4OI9A 3U9PH 2KKQA 1FO0B 4XXDB 4M6AA 2UYLA 3P4LA 1R5IA 3MRIA 1A9BA 3UCRA 3NACL 3MGOA 4HJ0C 4NQVA 4LCWB 3V5DB 2EDTA 2B4CH 1HHKA 3GSOA 4ETYA 4HBCH 3STZA 5FGCE 1SM3H 2ZCLL 2XTJD 5EU6D 4PLOB 4GRWF 3VI3E 5BVPL 2FX9L 4WUUD 3OKLA 4IRJC 2F53B 5D1QA 3MLPA 1MCKA 4L8SC 4GW4A 5TE4L 1I3RA 4PGZA 4JM2C 5HHMB 4LDOB 1U9KA 3CVIH 4IMKA 3D0VB 3AXLB 2NXZD 2BSED 4PTUA 5IMOB 1JGDA 5F7EL 1T1XB 1QLFB 2EKJA 3T0WA 3T0BA 1X5HA 2EIZB 1MFCL 5L7XH 2MTPA 3UTPD 3D3VE 1BP3B 3RGVA 4Y4HB 2VXUH 2XZQL 2UZYB 3QAZC 4R7DA 1RJCA 5E08H 4MJ2A 3MUZ1 1LEKB 1DBJH 1MQKL 3BEWA 3C87A 1BZ9A 1IRAY 5MI0C 2WBJA 5E8OA 1ZS8B 3K8KA 5CZXC 1AQKL 1FZKA 5CD3B 1S9KC 3ULVF 1RIHL 3RY4A 1DL7L 2DM2A 5KSBF 5D7KE 4HUUB 4AL8L 4F57H 2YPVH 1KELL 5IVOA 3MRDA 1CDBA 4R0LB 4PRDA 3MV01 3OF6A 3TFKD 4OZIE 1MAJA 1AD9B 1OGTA 1QYGH 4DZBA 3V52H 2OXHA 3QDME 4GW1B 2DLIA 4EN3C 3HMWH 4G3YH 2I5YH 3SKMA 3RWCB 4XH2B 5I30H 3MOAH 3QIBC 1JK8B 1B90A 1T89A 5IWLA 3O6FA 1TQBC 2A6IA 3O11A 4NBXB 1DBKL 3I3DA 2P48B 4HK3J 1P7QA 5MHSE 1HYSC 2DQFB 4TNWF 4GO6B 2N56A 3S88L 3QO0B 2YA1A 2K7QA 4WFGE 3TIDA 2D9CA 4UU9B 1YNLH 3W9EB 1T1XA 2VABA 4XP5L 1ZK9A 2G75B 2H2PC 1XR8B 5ICZA 3BKJL 5I8OH 4KROC 4NN6B 2I60H 5FV2A 1BJ1H 3HAEB 1KEGH 3NACH 5DWUH 2P5WD 4TULL 1L7IL 1ZT1A 4RGOL 4LSPL 4HGMA 4XNZC 2ZCLH 2V5MA 5IW1B 4RBPK 2FATH 4JG0H 4FQLH 2Z93A 1QPPA 1PZ5A 4HS3A 5IV2A 4BSVA 4R2GC 1I8LC 4JM4L 3G6AB 3TPUB 3QCVH 1XCQA 3O9WA 4J8RB 4XCCH 4LCYA 3W2DH 3OG4B 4LKCA 3IDXH 1RUQH 2FECI 5KVFH 1CU4L 4U49A 3L5WB 5LCVL 3VFOB 1FZMA 3REWA 3KLAA 2VDKH 1QKZH 3V6OE 1WIPA 2DM4A 4LFHG 5JHLL 4YXHL 3FFCD 1T1WB 2JELH 4JDTL 1NCUA 3QFJE 5GRVL 2V5YA 1TZIB 4FXKB 4MS8C 3V5HA 3HI5L 1IE5A 5DVOA 2A6KB 3DO7A 3T1FA 1XIWA 3AM8C 3SDAB 3EYUL 5D6DA 5C9JB 3GZKA 2CDFB 1A6UL 4UNUA 4K8RH 1OT2A 4LSVH 4M93C 2D31B 4YIQA 4J6RL 4BZYA 1MJ8H 3BYTA 3OXSB 2FD6L 4NKQB 3EFDL 3S4SA 1DDHB 3QPQD 3FT2A 1JV5B 1TTGA 2HYMA 2LU7A 1OTTD 3O4LE 5TF1H 2ITDB 1SBSH 5IBLC 4BM7A 4HFUH 4F57L 3GIVB 1V8HA 3N85H 4P9HH 5L2KA 4YDLC 3D48R 4MD4A 4G8GB 4BQ9A 4C55A 5HD8C 4R3SA 2MKLC 3H7BA 4LQFL 4P9ML 5BO1H 1HKFA 1QHOA 2XWJB 4LLDB 2IF7A 3VD7A 5D7IA 3MX0A 1ZT1B 4N8VA 3LOWA 1S7UA 3JBG7 1MLCB 3WL9B 4X4ME 3STBA 4LLYB 1ZGLP 4KTDH 2MQ0A 2QR0B 4X7DC 3LZFL 3UBXI 4CN1A 1BFTA 4XP9L 2VIRB 1DBKH 3P40A 2DYPB 1QACA 5IMMB 2W91A 4JGUA 4GKOA 2FJFA 3QDGD 4K2UH 1N3NA 1CK0L 2ZUVA 2GFBB 4FFZL 1JI2A 4GLRI 3HMXA 1UB6A 4UZGA 2F8VA 1HN1A 3PJSB 4P3CL 5HI5C 3A6OA 3S37H 1DBML 3U7YH 1KEGL 4OZIA 1W8NA 1EMTH 4Z7OF 3QCUL 5C9JA 5HHVH 1IGFH 1NSNH 4LBEB 1A21A 3VI4E 3FO2B 4I2XA 3ZT5A 1CDHA 3QCVL 3FB7A 3WFHB 1X5LA 3CFBA 5DFTA 3QIWC 3VGFA 5EZOL 4FFYH 3DYOA 4PD4J 4L3EB 2HLFC 3DUUA 2ZUSA 2R8SH 3FO9B 4TVPD 1FLTX 1KIRA 3DBXB 3HE6D 1HZHH 4XWOD 4KDWA 2NR6C 4X99B 3IRPX 5AYQA 3MRIB 5C0EB 4NM8H 2DQEH 3BZ4A 5HSFA 1KTRL 1MJ7H 4QHMA 1KPRA 4X0KB 3BPLB 4U1GB 3L5JA 4XPGH 1L0YA 3J7HA 4NJAH 2I07A 3ILQC 1UXWB 2LU4A 2VE6A 2FEEI 2P8MA 1IC4H 3U4EA 4ELMB 4Z77A 5JR1L 1ZVSB 1IM9A 1UZ6E 1BOGA 3KLHC 4WNQA 4HFUL 3NZHL 3FONA 2O5XH 3CU7A 2PW1A 3MNVB 5KVGH 2EIDA 4ZAKC 1MPAH 3GMOA 3EOAA 3O8XD 3LD8C 4B7IA 4U1MB 5I17A 1JHLH 1KT2A 3SJVB 4L3ED 5EU7C 2ZUUA 1AXTL 1F4YL 1HEZA 4LLAA 4KUZH 4MSWA 2YD1A 1WZ1L 3QCTL 5D2NE 5FGSA 4Y5YA 1LVEA 4JFXB 4R97C 3KPRA 4WV1C 2EC9T 1ZS8A 1C12A 4ONHB 3MNWB 1WFTA 1U3HC 3VJ6B 1JWSA 4HWNA 5EORH 5L0QB 2FRGP 3WFZA 3MNZA 4HUWA 2DQGL 3FO9A 2NZIA 5ESQB 1V7NH 4PFEA 3D0LB 3NGBC 5I75B 4KJYA 3IDMB 5C0NC 2WQ8A 3QI9C 4YGAB 1T5WA 3V0VA 1G7QA 2ZKHH 4POYA 3QUKB 4HJJL 1WTGT 3MBXL 2QQNL 2NNAB 4CJ0A 3GMQA 4MB4A 5TJWK 4QHMB 1HCVA 3PDDA 1S7RB 4YPGB 3CSBA 1KIPA 2E9JA 4WFFE 3VGGA 3PXJA 4AMKL 4U33A 3SGJA 2BDNH 1MFDH 2VZTA 2EXYC 2GJJA 4Y4HA 1M7XA 4LLUB 3QDGA 1RUAH 4K07A 2AK4A 4LVOC 3VXNB 3LN5B 3HNVH 1F2XK 2HVJB 3R4DA 3VFRB 1EAPB 4RMTA 4I5BA 4XI5D 3T65B 1PKQE 2CDGA 2YUXA 4PV9A 1KB5A 4YAQA 4ZMAT 3FO1B 5FYLL 1LE5B 3DLQR 4WU7A 3PGFL 5IJVB 1FFRA 3MR9A 3BDYH 3H9SA 3OL2A 4NRXA 5A2LH 4PJFF 5ENWA 4U3XA 4OCSL 4W4OC 2NPLX 3FT4A 3LKQB 2HJLB 1K5NA 3VA6A 1X5XA 2WBWB 3INUL 3JWOH 1UYWL 5FAAA 3DRTB 4AH2B 3OKNA 1K3IA 5EOQL 1UKTA 2AJSL 3VXRB 3D0LA 4QRPD 5JHDA 4YFLI 4LOUC 2R4SL 2BXZA 4RA0C 4HXAL 4IRSA 3E8UH 3ROOB 1M05A 3GSNA 3M17A 4P23D 4BUHA 4M1CD 4X5WA 1BBDH 5SWSD 4Q9CA 5SWZB 2HT2D 1FL6B 1CTOA 3KR3H 3N0PB 3U7WH 4M7JL 1XF5B 3U0TB 2PO6C 2RFXA 3HAEA 3UJTL 4D0DA 3MRJA 5CJOH 2VITB 1MCRA 1S78D 4HV8A 5T1LB 1HNGA 1N64L 4NPYB 4PJ9C 3WUZA 5EN2A 3VRLE 5ISZE 3RAJH 4K9EL 4UQ3B 1A64A 2DQJH 4XRCA 1N0XH 1NCCH 4JG1L 1JHKL 4JVWA 3SOBL 4J8RA 3O8XA 4KY1L 3TIEB 1LGVA 2EIBA 4KPHH 1S7VA 1FFOB 2NY4B 3WE6A 3PP3K 4J23A 3UXFA 3X3FL 3DVNB 4YE4H 3TH4T 1RMFL 3H7LA 3QNXB 5F71A 2HJKB 4U0RC 4WW2F 4KXZH 1ADQH 3FN3A 2BDNL 4OLVL 4I9WE 2DKSA 2CKBB 2DAVA 5CHNB 5C08B 2EDYA 3GSQB 2P5EB 4CMMB 2NW2A 3RVTC 1KLGA 5F89A 2WUBH 2EH8L 1A7QH 4M6NL 3DMMA 4G9FD 3ARUA 3QHFL 5EUKA 3EAKA 1G1YA 3UPRA 1D5ZB 3KPSD 1NFKA 2NY5L 3JWDL 1HHGB 2BOCA 3PP3H 3SJVD 3R0NA 4QYOB 2R1YA 1EJOL 2ICES 2AW2A 5F7LB 2E7LC 1MJUL 3HZYA 3LRHA 5DI8A 1P9MC 3QUXD 2CUIA 3VXOA 4L29A 4MNQE 4NQUA 1OP5K 5DUPH 3HPJB 2YC1B 3PABB 2FB4H 3V4UH 3W11C 5ERWB 1RK1B 3SE4A 1MF2H 1DQJA 4JKPH 2X4UB 2UV3A 4PGCB 1F3DH 3BHBB 3FO0L 5M7QA 1MCPH 3WDIA 3ZHKA 4WUUB 3ULSB 5CCKL 4LVNB 5HHOD 1YMME 1MFBL 4R4NC 3QUMA 3VE0B 3QIUA 2CDEA 5C86A 4HCRA 3NN8A 3RTQC 2ZUYA 4PJAA 4JFPB 4PGJA 2HT4D 2JCCB 4WGWB 4KQ4L 5IT2L 4WWKD 2FHBA 4KJWD 4QOKA 4OBRA 4GSDL 2A6DA 2V2TB 2FZ3A 3PJSA 2OL3H 5D7LE 1YNTB 2YSSA 3QUYA 3P0YL 2J88L 3DURA 1U95B 5D1QB 4OJFL 2J4WH 1NLDH 2PYEB 3GBML 3D85B 3NBNA 5L2JA 5TGBB 3PWPA 4PTUB 2V9TA 2J12B 3RWFA 4K9EH 1J18A 5FYKU 1BGXL 3SGDI 4RWYL 2OTPA 4U1KA 3RVUC 2NY6B 3VFPB 4KY1H 3TT1H 3ZKSD 1PG7H 4PIRF 4PP2A 3B2UC 1NDMB 5IGXH 3V7AE 4LLQB 3D39B 3JXAA 4IRSD 3Q0HA 1OAZL 4M1GL 4H1LB 1P1ZA 2VN7A 2VZVA 4KAQL 1H3WM 3RJQB 1WLHA 2FX7L 4YK4C 1HYSD 1JN6B 1LO5B 1ED3B 4M93B 4OQTA 2IWGA 1YUHB 2JIXB 2E6PA 4H5SB 1WICA 4TPRH 3DTXA 1QSEB 3RGVC 3QNYA 3T4YB 4WTWA 3IDYC 5D1QD 3QHFH 5F88B 4OTXH 1FNHA 5DVMA 5IB3A 4DQOL 5DD0H 3ESVF 2FGZA 1YQ2A 4HIIA 4XBEL 5DQJA 2VLRB 3EYSH 5DMIL 4GMTL 1N6QL 2BNRD 4PRHD 4S1DC 4RGNE 5C09E 3IFPA 1U8HA 5E08L 1WIOA 5L6YL 2XPGB 3QQ4A 4N0UB 1IKNC 4N0YL 2C3VB 5C0CA 1MCSA 1B0RB 1QUNA 2DDQL 5HVGB 1DVFC 2P42B 5M95B 5DUPL 4OKVB 5GGQH 3BIKA 3WDJA 4OGYL 4XPBH 1TQBB 2H2SC 3BGFC 5ITBH 1JNLH 4DVRL 5D7JA 2HVJA 5CEYB 2Y36H 1GGCL 3FB5B 8CGTA 4JY5L 4YBLB 3G5YA 5D2NC 4ODUA 3V0WH 4JDVB 4NFCA 3P9MA 3BPNB 4X6BB 1JNJA 2W0FA 5EC2B 3WJJA 2UWEB 1VPOH 4OZIF 4HUVA 2JB5H 3MOAL 1G9MC 2VNCA 4LKXA 5IOPA 3FFCB 2RBLA 4CDGC 4RFEB 5BV7H 2PTTA 1P4LA 4QRTA 2B2XH 2GITB 1BQHG 2M26A 1EEQA 1JGLL 3W0WD 2J88H 3SKOB 3MRFA 3FT4B 2VLKD 2XZQH 5D93C 2ZSWB 3QUXA 5DMKA 3H9SD 5C07D 3CDYA 4C59B 3TLRA 4YHLL 1FBIH 4OLUL 4F33A 1G0XA 5IMMA 1HXYA 3QEGL 1BQUA 3C8KA 5HYSA 5KSAD 5CBAB 2CGRL 4U1LA 1DL7H 2GSGB 3P3YA 1XZ0A 3BKJH 4X7TB 1K4DA 2BERA 5KN5A 1IEBB 1A7RL 4B50A 5FCUH 3SE9H 4X7EC 4PJ5E 4TN9A 2VDOH 4GXVL 3B4NA 5C0BB 2ADFH 2GK0B 4PJXE 2ILLA 1JUFA 5IEKA 4TNVF 3X12A 3P4MA 1CFSB 3S4SB 4AM0A 1T5XA 3GRWA 2HFGH 2GSIB 3IDXL 5KVFL 1PJ9A 1PY9A 2EXYD 1PGRB 4LRNL 4WDIB 1PFCA 4GRWE 4LARH 1WJ3A 2AJVH 1I9JL 2JJVA 5JHLH 3DUSB 1ZLSH 1IEHA 2EO1A 2NY3B 3U6RA 3EW3B 2JJTA 4PTTA 4FQ1L 5D1XA 3SCMA 3PWJB 3QDJB 4N9GB 3ARTA 3HCVA 2CRMA 3W5NA 2R4RL 4WWKC 4ACPA 1IAOA 4PJGB 1YNLL 1N6QH 5I8CA 2A73B 1INQB 2MJWA 4TVPH 1OW0A 4F37K 3HG1A 1A14H 4YNYB 4LHUA 2BHYA 5CEXA 2F53A 1TLKA 3B5HA 1Q9LA 4JFFB 4EVNB 5C0EA 3IF1B 4POZC 5I74B 4EOWL 3AXLA 5L88L 2CUHA 2DIAA 2V6HA 4OCXL 2NXZB 3F7VB 1VGEH 3C6SA 5DMJB 3RVTD 4ZXBD 4B41A 5C0DB 4Q58C 4P4RB 1A6WH 3IU3A 3ARGC 2IALA 4K3EH 4I4WB 1J5OH 2VLJA 4U6YA 3GKZA 1U36A 1UM4L 2XY1A 1CU4H 3WKML 4OB5L 1YEIH 3DMMD 1TZGH 4LIQE 5IW6B 2HN7A 3BKMH 2YA2A 1WC7B 1WBZA 3TEUA 4KTDL 4XCYB 4AG4L 1BZ9B 4QRSB 3GIZL 1LO0H 2XZAL 3EBAA 4LDEB 5ALBH 3BKCH 4G6ML 4PJFE 5B8CA 1FIGL 5GJTL 1SEBA 1S78C 1J8HB 3QEGH 2Y07L 2YPLE 3NIGF 3T77B 3JV5A 2DQUL 1CICC 1UWXK 4P3CH 3OQ3B 4NN5B 4XP4L 5A2FA 32C2A 2G2RB 2VLMD 3UYRL 4X99A 4P9HL 2ZNWA 1U93A 2PN5A 3EYVB 3O3EB 3SGKA 2VQTA 3D2UB 5CGMA 3KLSA 2XTJE 4MA8H 1Q9LB 4YQXL 4LRIA 4NQCE 1RK0B 3WS6A 1A8JH 2DJUA 1A7OH 1YNTA 2YSSB 4DFIA 3DURB 3DSNA 4IBLT 1FLRH 2HFGL 2LAAA 4XAWH 1KXQE 1AO7B 3C5JA 4FTVA 3WO3B 1T03L 5GPRA 1NFDB 4MNHB 1F4AA 4IRJD 3RL2A 2IH3A 3EDFA 1G9NC 4QO1A 3FT2B 1EV2E 4P2OB 3DX7A 3ZL4H 2ESVD 3SPVA 2R4RH 3UTPE 3HI1B 4OZHB 2C7UA 3FJTA 4WFHE 3S36H 3UTTB 5JPMB 1AJ7L 1ZKAA 3RHWF 2XN9E 5C2BL 5DQ9A 4JB9H 5C0IB 1I1YA 5F6HJ 1YEJL 3QCUH 1P6FA 3BZFA 1A4JA 4LK4A 4YR6A 5L88H 4DZBB 3UJJH 4HJGB 3TZVA 4JFOA 1MUJA 1AR2A 4JGJA 5DO2C 2V7NB 5ENWB 3SO3C 5KVGL 1JZ4A 1TPXB 2XWBA 1I1FB 1U3HB 4Z7WA 1QO3A 1G6VK 2H41A 1P84J 4UNTA 1OP9A 5DD5L 3VXRE 3IETA 2AABH 1YEIL 3QDMD 3FL7A 1Q72H 1TZGL 3BKYH 2AGJH 3LEXA 2V7HA 1CFBA 5EC1B 3QR2A 5JXEC 2BNRA 1MVUA 3PHQB 2FYYB 3MC0A 3OAYH 2DQEL 3PV6A 4HKBA 5B22A 1EAJA 1F8TH 2CR3A 5MHSD 4JHWH 4LPXA 3VWKB 1MVFA 1NDMA 3VGAC 2XZZA 4P49A 5L2KB 3IDGA 1CF8L 2BVQA 1OSZB 4BYHA 4R4BB 3NFSL 5JOFA 3AS1A 5AZEH 3MUGA 4ZOBA 3IAPA 4D0DB 1KJ3L 5CINH 2VB5A 1O5DT 2JLLA 2Z91A 3MJ9A 1S7UB 1UA6H 2MCPH 3F7YA 3W9DA 1YPZE 3MBXH 1P5VA 4AEFA 1GGIH 4X6EB 3GMPB 1FLRL 4YBHA 1MI5B 1TZIA 2X41A 5GGRA 1IBGH 1T03H 1LK3L 5JOPD 2FLRT 4HGKC 3R8QA 5J6GA 4WI7A 1L6ZA 5HGHB 1JPGA 5EU6B 1QYGL 4FFWD 4YDLB 1KCSL 3FOLA 1QSFE 1RZJL 3DSFH 3GM8A 3HMWL 2X70B 1JRHI 2DLGA 1MI5E 2DQGH 1QOKA 2GCYA 2VXSH 5I30L 3QXAA 1OT1A 2IMMA 3NCYP 1DDHA 4KJQD 5FYLD 5C2BH 3ROOA 1AE6H 4U1MA 4EDWH 1OAUL 5HYQA 3C5ZA 4PRHB 1I7UB 1IFHH 3RWHA 4FOMA 2LVCA 2FYYA 3X12B 5ADOL 5IESL 1JNHA 5IB1B 5IFHH 3EGSA 1WCBB 4ZO8A 2R2BA 4M7KH 5FUCE 4XNQA 3CAFA 4XP5H 2P5ED 4QHNB 2PNDA 4ZFFA 4Z9KB 1W0WA 5EOQH 4BKLB 1ZAGA 3L3HA 5JHDB 4P0DA 5DJZA 3V5KB 5EULV 1AP2A 5B39B 1RUAL 3VXUE 3Q6FA 4LSPH 1CIUA 3NPSB 3SCMD 4PJ7E 4XNXL 2VDMH 4R0LA 5CZVH 1NANH 3ET9F 2HKHH 5DDHA 4GUPA 3C8KB 1VFMA 2DQIH 3LHPH 1ACYH 5CUSH 1ZLUK 5F3BB 4D9RD 2VE6B 4IJ3C 3HUJE 1KTLA 5LCVH 2CKBA 1ZHLA 2YKLH 3OAZK 2G60L 2ZUXA 2HG5B 5FUOH 1T7YA 1NGWB 2HMID 2P44B 3V6OA 2W9EH 1FG2A 1A5FH 3WFEH 1JUFB 3AUVA 5T3XD 4ODSL 2FO4A 3SGKC 5KS9B 1QLEL 3WKNA 1KSRA 1J0KA 1WEJH 2XKNB 5E00A 5FGBC 3VFGH 2HN7B 3HKFA 4DGIL 5I1IL 2FNBA 3MRNA 2AJSH 3HC4H 2C3GA 4MSWB 1KEMH 1ZHKA 3I6GA 2R4SH 3UTTE 3ZKQD 5E7FA 4N8PA 4HGWA 2H32B 1DQDH 4HXAH 1XF4A 4NQXA 1C8PA 1R3HB 5GRVK 3VFOA 4OLVH 3IFLH 1KLFA 2VDQH 1BBDL 3KXFE 3NZ8A 3O4LA 2AKRB 5IFAL 2E8ZA 3G6AA 1HKLH 4X6CF 1RZJH 4Z7QE 4QRRB 4KDTC 1G7JA 1ZTXH 3T2NH 2VWEE 1G0YR 4OGXH 3UDWA 5T1KA 1PX4A 1J8KA 1LP9A 1PYWA 1N64H 3BEVB 3DTXB 4KC3B 3IVKB 3PHSA 3PIQA 1EXUB 1JTOA 2PXYB 4M61B 3FONB 5DJ8A 2Q8AL 3BN9C 5CLWA 4XGZA 2P45B 4ZSOE 4QCIA 2VZUA 3L7FB 3D6GA 3TJHD 4ZXBC 4XX1G 5IHBA 5GS1A 3LRGA 2J7LA 4PG2C 4HDIA 2A1WH 4ALAL 5IW6A 2BK8A 3M07A 3ZYZA 3LKPA 4M7ZB 5D1QC 1ZVYA 4IRJA 5IVXB 3FQUA 5EOCL 4LLVB 5HHVL 2JB6B 3MLWH 2J5LC 3VG0L 2QR0A 3BP5A 1A6AA 4XVTL 1GCFA 2NYYC 5EBMB 5LGJA 5J13C 3T77A 5FEBA 4ZFOA 3WJLC 3TNMB 2NLJA 3UO1H 3HB3D 4JZJA 5I73B 1T66C 1G6RA 2DQHL 4Q9QL 4HHAA 2JIXA 2V5TA 5INCA 4YHYC 4YDIH 5LGKA 5HI3D 3OKNB 4MXWL 4NGHL 4UOW1 2FJFB 3V4UL 5HVHC 1A1NA 1CL7I 2V5RA 1PVHA 4GRMB 1XEDA 1RSFA 3BUYA 4PJ7A 5DVKA 4YXKL 1DQDL 5IHZB 4GRLA 1NC4D 4L1HA 2Z8RA 4WFFD 4G6FD 3V95A 5KZCB 1U8IB 2O5XL 1GIGH 2NY7H 3MFFB 3RTQD 2DN7A 3O6LH 2Y7QB 4NT6A 3S35H 5I74C 2BVPA 2Q3ZA 3KWWB 5KSBA 4YHPA 5LAXB 5I66A 1B6UA 3MRDB 3T0AA 4WENB 3BVNB 4OGXL 3QO1B 4FRWA 3QUMH 1I7RA 4LCWA 1JPTH 1VDGA 3P4OA 3QIBD 4WI9A 4XB8A 4FQXA 4Z7VF 1MNUL 4OIAA 2BX5A 4IMLB 2XTLA 3NCYS 3SCMC 5AAMA 4KQ3H 5L6YH 5D2NA 4AH2A 1KIQA 3JV4B 4B7LA 1UVQA 2DDQH 1INQA 4PB0H 4ZUVB 5T1MA 2QSVA 5C08A 2Q8BL 2Y25A 1G1CA 2IANB 1OLLA 2AAVA 5GGQL 4FMKA 3WNLA 3MRKB 4P5TB 5BW7C 3QO0A 3GMNB 4DN3L 5F9JA 3S8WA 1F3DJ 1HHHA 5LGHL 1MHPH 3O4OC 3BZEA 1F00I 3MV7B 4HLZH 3VFUB 1S7QB 1MH5B 4Z7UB 2GY5A 1RJZB 2KL6A 1U8PA 3MRPB 1LP9E 2JB5L 2QADD 5ANMA 1A2YA 1A22B 4WGVB 4OTXL 4GAGH 1GH7A 5GGSB 4RGMC 5FOJA 4N1EA 3RGVD 5KS9E 4ZFGL 4HWBH 1MOEA 2AJYL 1NH6A 3T0EC 3BJLA 2BSTB 1F13A 1TCMA 4HS3B 3RX5A 5IV2B 4JKWA 4YDIL 4MA3A 5GGVH 4MXWH 2XNAA 4LCYB 3A6CH 1Z0MA 3T0DA 1ONQA 4L9LB 3TNNA 3B9VA 1YJDL 1A7RH 3ARFD 3PGFH 4LHQB 3TA3C 1GGCH 3QUZB 5I18L 5FKPA 1MY5A 4I3GA 5IVZA 3BDYL 5B38B 5AD0A 3KYNA 4NCDA 4TOYH 2KZWA 35C8L 2VLRE 1NCAL 4YDVA 1C5CL 5DMYA 4NBYB 2A77H 2R2CA 4RX4D 5EWIH 2BVYA 3UTSE 1XGTB 1NGZB 3LSOB 4D9QD 3QWRA 3CFJB 3FRPA 2OI9C 4NKMB 3WHE1 1WAAF 3C60C 4NUGH 3LAFA 3DJ9A 1N0LA 4YEFA 4TVPE 5DI8B 4X7FC 1FBIL 4RQQA 2R9HD 4JN2A 4H25B 1X4ZA 2RCSL 1NAML 4NNYB 3V4VL 4OZHA 1G7HA 1SY6H 5JDJA 4NM4H 1EHXA 2Q8BH 4M43H 4EOWH 4MNQD 3MA7A 4YHIA 3TBYA 4GXVH 3DROA 2D0HA 3BJ91 4GBXA 5EO1A 3EZ8A 2GJZA 2DQJL 5D8JL 4KZEH 1TZHB 3P9LB 4Q0XL 2XI9A 2PYFA 2YD6A 5HHPB 5HHOE 2VKWA 1YMMD 5IB5B 4MWFA 1ZGLA 2GFBA 1ODAA 2R29L 5HI5D 1KTLB 4J7RA 2I9LB 3NAAH 3DI3B 2X4PA 4HBCL 4OI8A 3TO2A 3OBAA 5CGTA 3SDCC 1LEIB 1HZHL 1GZQA 5DJ8B 3PWUB 3IRZA 3KDMB 3EOYG 1D5XB 4MXVE 1RK0A 2X4SA 4TVPL 5FUZL 1QR1A 1IM3B 1LO0L 2XZAH 1A14L 3C08L 1U8MB 2ZSVB 4JFEE 1N59B 5INDB 4X5WB 5FHBL 3CFBB 1WQVT 4JEGB 4HH8A 3S5LA 5LG1A 3QUYC 5FA4A 4XXCC 1W72L 1U8OB 1Y6MR 2UYLB 4G8EA 1R5IB 3LEVL 1C08A 5FO8B 1YJDH 3JWDH 1LO5A 3NIFF 2RJMA 1OM3H 4A2MA 3CLFL 3MUGB 4E42B 1J5OL 5BOPA 4BK5A 4JFQA 1CGYA 4P2QB 3G08B 2AXHA 4KTEL 1ZHBB 4F3FB 1GC1H 1IGTB 3EJZC 1TVDA 4X7SH 4DTGH 3AY4C 1X4XA 1B4RA 4ZPTA 2ICWA 2E6QA 3GEWB 4AL8H 3WE6B 1KPRB 3C5SA 4M5YL 15C8L 3RRQA 1JGDB 4P23B 2W60B 4NUGL 3ZTJH 4G42A 5KN5B 2EDQA 1CS6A 5DJDB 1D3CA 3V52L 5BXFA 3T04D 5J6GB 4Y8AA 1FCGA 5TQ0L 1RZKC 3HAEH 1BVLA 1O7VA 3K8MA 5GJTH 3RZCD 4P5MA 4LP5A 5FOBA 3BPOB 2RHEA 5CKGA 1ZA6B 1CFTA 1MWAA 3CVHL 2LTQB 4ODTH 3PWUA 2WBJB 1CG9B 4O58L 5J6HB 4GRLB 2FJGB 3VFTB 4IHOB 5D7LA 1T0MB 3G5XB 4S0TD 3FB6A 1OPGL 2EE9A 3ZE2E 1RUML 4MA8L 1FGVL 4WDIA 4U1SA 3I84A 4QRQB 2PR4L 1C1EL 1YNKH 2GTZA 3U36B 3VXSE 4R4BA 2CMRL 3PWVA 2IBGA 1PG7L 1T1ZB 4AMKH 2BXYA 2BNUB 2JCCA 3OAZH 4HUNB 3VA2C 5FIEA 3HE6A 4GS7B 5A2KH 3RNKA 1E4KA 2A73A 3MV9D 1OLZA 2BNQB 3TGXA 4FQLL 3LEYL 3O11B 3BAEL 1J1OH 1U8JA 1VFUA 4PJ9A 4CJ1A 5ACZA 3BXNB 1F8TL 2CK2A 4CBPA 5E2TL 1HH6B 2IC2A 4YO0A 4YLQT 1FGNH 2K9UA 1UJ3A 5BRZA 2Y5TB 3JTSB 2XYCA 2IADB 2ICWJ 5DYOA 4TVSa 2APFA 5EO0A 4I4WA 3FRPG 4NQSB 1UYWH 4JPIB 3BMWA 5ID0B 1OM3L 5FOBB 4K8RL 1QEWB 4E41D 1MJ8L 1F6FB 3MRGB 4S1QH 4PJIA 4Q6IB 2D7MA 2N4IA 1Q72L 2QLVB 3FT3B 4KXZI 1I7UA 5K93A 3VFMA 3LKSB 3IGAB 2X4RB 3MRNB 4OGYH 1SBSL 4YEEA 3MYZA 4JRYD 4Y16B 4WO4D 3QQNA 4I9WD 1EGJL 2Z35B 3PGCA 3IDMA 3ULUE 3CDCA 4LQFH 2SEBA 4L9LA 4JFEB 2MNUA 3KG5A 4MYWB 3O3BA 5CJOL 1BZ7A 5MEQB 4UTAH 4U6XB 5ISZA 2C1OB 1VESA 2NNAA 4LASL 3UEZA 1KPUA 1YEHH 4NO5B 1T20A 4WY7L 2EDJA 4Y4KD 4MHHI 4MA1C 5JLZB 1JHKH 4OSUH 1C7SA 2VH5L 1ZT7B 4RDQG 4OD3H 5DR5L 3ILPB 1A3RL 5D7JB 5CEYA 3ZYOA 4FFZH 4Z7VB 1X5JA 5HHOB 5F9DC 3SDYL 1A2YB 1NCBL 2A6JA 3C09C 5GS2H 3EO1B 4JN1L 1JYNA 3ARRA 1H3PL 3UPCA 3MRJB 3VG9C 3BP7B 4FQJH 3BI9X 3HI1A 4QRSA 3ARBD 4G9FA 4YUEL 1RZGB 4X9HA 1KULA 5CD5C 2ADFL 4P57A 2A74A 4FZEH 1DBAL 5ITFB 1H5BB 1Z9LA 3WUWA 3MR9B 1AGCA 5E2VL 2DQIL 3ZKNC 2OS7A 1XH3B 4GG6E 3MLTB 2NY5H 5DK2A 2CXKA 1M7DA 4EDWL 4Z7UF 4ZUWA 1KCVH 3BWAA 3WO4C 1SJEB 3F8UB 4GQPH 1IFHL 4XCEA 5DRWB 5IR1A 1PZUB 3VXMA 5ADOH 2AQ3A 4UUJB 1V05A 1A3QA 3ZE1E 1Z5LB 4Y5YC 4JZNB 2FB4L 3VH8A 1B2WH 1X4YA 1V3LA 4L3AA 1WEJL 4CMMA 3ARDB 1QHPA 2ATPA 3PL6C 1IGCH 3FO0H 5JW4N 1ULVA 3QIUD 1T20B 4S1QL 2OZ4A 1WFNA 4PJAE 3CUPA 3QUZD 4IIQB 2YZ1A 1QQDB 4UV4L 5EOTB 1CLZL 3CXDH 3MRRA 1CFNB 3BE1L 4JY6A 2CLVA 1PLGL 4MJ4A 4PJXF 4OCXH 1J88A 2OQJA 1YEKL 3MRLB 1CT8B 1OSZA 3FFDB 1YEFH 4NRZA 2O61A 4MMZC 3ZT6A 2CIIA 1OARL 3SGEH 3QEQA 1BQHB 2X1QA 1CD1B 1X5GA 3BFOA 1JNHB 5IB1A 4AZ8A 4NO3B 1Q1JL 3P0YH 1U8IA 4ODWB 4OJFH 4WI2A 2J4WL 4UTBL 3BPLC 4QTHA 2ESVE 4V2CB 2X4UA 4KJWC 2D0FA 4WY7H 3AAZA 4WFHD 4AEHL 3B5TA 3BT2L 1I3VA 5DRZA 5DJYA 2E7HA 3DARA 4ODSH 1L6XA 4XMKL 1H3VA 4KK9D 4EDXA 3BKCL 4ONFL 3GRWL 2YWYA 4I13B 4G6FB 3WS3B 5HGHA 2IANE 3HC4L 1HINH 3REWB 4RFOH 3MV7E 4YBQC 3ZDZF 1V3JA 2VDPH 1WGOA 1RVFL 2W60A 1A4KA 3TT3L 2PYEA 5GZND 4WCYL 4NQED 4OCMC 5E2UL 5EUKB 1NEUA 4JN1H 1H3PH 5C0FA 1IVLA 4JZNA 5HDLA 4OCWL 3OHXA 3RWFB 4D0CB 4N1HB 4P5TA 4Y16C 1OAYL 3VWJA 1DUZA 3VG0H 1NKOA 4DN4H 1DBAH 2VDLL 3OTTA 3QISA 4JPWL 4AIZA 1QRND 3TV3L 1FPTL 1CLYH 1WFOA 1YJDC 4PRHA 1V3MA 1UEYA 5GQBA 5JPNB 3FN9A 3UO1L 3H8NA 3EYSL 4FHBD 4FNLH 2VL5A 4OZGF 3MRQB 4X9BA 2DTSA 4ZODA 4NO0B 4U1IB 4E42A 1ZANH 4EI6B 3CMGA 4UQ2B 1XGYH 1F90L 1KYOJ 4OLEA 5J89A 3C6LA 3NIDF 1A02N 2BNUA 5BV7C 3GK8L 4WTXA 4Q2ZA 1BMGA 1G9MH 4X6CE 2DI7A 2XWTA 5HGDA 1KFAL 3M1BA 1ORSB 2YA0A 1KJ2L 2Y36L 3LN4A 1AY1H 4RAVB 5EU3B 3I6KA 3MQIA 3EOTL 4NQDE 1PYWB 3LVEA 1U8HB 5E8NA 1PDKA 4NC2B 4HIIB 3KPQA 5DD6B 4I0PB 2B7DT 2EDHA 5D2LB 3QFJB 2AV1B 3LQZA 4LGSB 5E8PA 2OXGA 1JF1B 5HGAB 1MWAB 3PGDB 1DUYA 2ZUWA 1Q1JH 2WINA 4OT1L 2AGJL 5E99H 1FO0H 5SX5K 1LO2L 4JFHD 5CMAB 4MNHA 5D6DC 3T3PE 1MH5A 4Z7UA 4M1CC 4ZOEA 1ZHKB 3I6GB 5F9AC 2W9LA 3BT2H 1VENA 3KR3L 4N0RA 4G8FA 4DZ8A 4WHYG 2FL5B 5C2UB 5AG8A 5GRUL 4MMXC 2D7QA 3MRQA 4AIOA 3TO4C 4NNYA 5DUML 4PGDA 1WWBX 4YXKH 3DV6A 5IVXE 3BX7C 2P5EE 3UZQA 1N5AB 2AXFA 1KCUH 2WLYA 5SX5H 5JW5B 2RB8A 3SE4C 1BD2B 1NFIB 3T0EA 1LEGA 5E6IB 4YO0B 1NGYA 2B8OT 2AJVL 4JO3H 1I9JH 2EEDA 3UZVB 2P5WA 4X5XA 3OKMA 4HW6A 3BOVA 4ZSOB 1A1NB 4MZ2A 2GYSA 3BH8B 2FEEL 2P8MB 5F7HA 5K59F 1CXKA 4MVBD 1CGTA 1E27B 1IBGL 1LK3H 4GQ9H 4D9RE 2F53D 5GIRB 5K9QG 2AJYH 3EFFB 5CJ5A 4X6FB 4IMKC 3MNVA 3MXWL 3MO1A 4MQSB 1GOFA 3V6BR 2H6PA 2VN4A 3MJ8B 3HE7A 1K2DB 2J8UF 1FVDA 1NMBL 3F65A 3OKEB 3RWGA 4KU1A 2EH8H 3OAUH 4LRIC 5I76A 4Q6IA 2PYED 5E8EA 1FZKB 4Y5XC 2R2HA 3GK8H 3KXFB 4NCC1 3QIBA 3GKWH 3LDBC 3SDCB 4XNUH 1KGCD 5CEZH 1A6AB 5I1CH 4R96A 1YEDB 3PDGA 5I19L 1U8OA 2VLME 1NGPL 2ZCKL 1AY1L 4GXUN 1XIWD 4YC2B 1IC7H 1LD9A 3TNMA 2X4NB 1S9YA 5FM5M 3VJ6A 3WKMH 4M48H 3GJEA 4X8JA 1MQ8A 2VWEC 3SQOH 1X5IA 2H32H 1VFAB 2JJSA 1JWMA 1V7ML 3DV6B 3W0WA 3NA9H 2A83A 4UUJA 2J2ZA 1MFBH 4Y16D 1EO7A 3GIZH 2YEZB 4TNWK 4ZNEA 5T3ZH 4RX4A 4TTDD 3LKNA 3CX5K 4LSUH 4LEXH 5EBGA 1QBLL 4HIXL 5KSAA 1IZKA 1BECA 1MCJA 5I8KH 4U7SA 3BRGC 4NZTL 4X6CA 4JAMB 4HWZA 3A6CL 4M3KB 4U1JB 2W9DH 5SWQB 1ACYL 2QADC 5CUSL 2BCKB 5C6TH 1NAMH 2MPAH 4CADB 5BV7B 4L8BB 2Q3AA 2XN9D 1FFPA 5HI4D 4MAUH 2ADIB 3U9UB 1IT9H 1CL7L 5CJQL 3HAEG 35C8H 5HYQB 3RQ3A 3QULB 4FTVD 4UBDD 1KCUL 2E3VA 1AGCB 5DD3L 2A77L 2P49B 4ZFOB 3P4OB 4U1HA 4MNGB 3VFGL 2FX8L 2R29H 3QXDB 1NFDF 4R96B 3R0MA 3AREA 1O0VA 5IHUL 5H35A 1SJEA 3VXPA 1S7SB 1AQDA 1KTDB 3QEUB 3T09A 4NUJA 3CLEH 4JLRB 3ARQA 1CE1L 1BX2A 1JYWA 1KXTB 3DGGA 3TBTA 4BZ2H 3IKCA 2ED9A 4GRLD 3GSWA 4J3TA 2O5ZH 2UVFA 3DIFB 3C6SB 2R23B 2ICWB 1X5KA 1EBAA 4OQTL 5FHBH 5A43C 1HKLL 2WZPD 2AK1H 4JCLA 2Z8SA 1U8JB 4ELMF 4NM4L 2R39A 3T2NL 1DR9A 3L7EB 1RU9L 1X6LA 3HR5B 5LWYH 5F96H 4RBPH 4KZDH 4KMTL 1CR9H 1K8IB 4XBEH 3U4BH 2ITCA 1MREL 5FK9A 4MQXD 1YYMH 2CIIB 2IG2H 1IAKB 4M1DL 4MNGE 1TENA 1PG7X 3RIAF 3S3SA 2NXYB 3E6FB 43CAA 1LE5A 3BDBA 4WU7B 4HFWB 5DC9B 5JPNA 4ODWA 1SYVB 4YX2L 4KRNA 1DE4B 5C08D 4DTGL 4EIZC 5I66B 4NO0D 1ND0B 4ALAH 1Q9KA 3WFBH 1KF9B 1NLBL 4H0IA 4LLYA 4M5YH 4MB5A 3D9AH 1FNEA 1UJTA 4KDTA 5BZWB 3LH2L 3O41A 2JJSC 4XNMB 25C8H 1X3DA 2NY0C 1R3KA 4ELME 5C92A 5L2KE 4TUOB 5GS2D 4IOIB 5IVXF 3MGOB 3BMVA 3QQ3A 3U7AA 3T3MF 3IFPB 3IFOA 1ZLVK 3IDIB 4NZTH 5DHXB 1U3HA 1EFXB 5E8DH 3FQTB 4ODTL 3LEVH 4XHJD 1T22A 3B6SA 1Y0LA 2F8XC 1CLOL 5T1KB 5FGBA 5F6HI 4Y5XA 1QFWH 1GGIL 2KQMA 5JHDD 3NFPB 4MB3A 5A16B 4XCNB 3PV6B 5ACMA 4MJID 2HT3C 1T1YB 5DJ2A 4G7VH 1EK3A 3QH3B 4WWID 4P4KC 3S5LB 4NPYA 5B3JE 1S7WB 4GJTB 2X10A 2BNQE 3D18A 4RQQB 4UQ3A 3DX6A 3VXUD 3PQYB 2P46B 3LEYH 4E0RB 2Y06L 1VKXA 1MY7A 5TQ0H 4GKNA 4JZJB 1QP1A 2BC4B 4U6TA 5DJXB 2Z93B 3EO9L 4UT9H 4BSVB 1AO7E 4BH7A 3TO4D 1P4IH 5IFJB 5IBUG 4LRNH 3UPAA 4OQTH 4LARL 3QWRD 1OAUH 4NQCB 3OJMB 4Y4HD 4LKCB 1IAII 3I6KB 4Q6YA 1J0IA 5IB2A 3FOMB 5DK2B 3QUML 4PR5A 1E4XI 4LPYA 1A6TA 4Y8DC 5ID1A 4UDUB 3VWKC 1LQSR 4JGMA 2I9LA 2X09A 1F58L 1HDMB 5CWSB 1KCLA 3DO7B 5AWNL 3SDDA 3W82A 1LE9A 4OD2A 1HOCB 1W72A 5F1IB 4L1DA 1T5XB 4JQVA 1S9WB 1MFAL 5D72H 3GM0A 2NYYD 3RA7H 3J8F7 3I50L 2AJ3A 1NLBH 1VGEL 1IILE 2CKBH 4JHZA 5DFVC 1I8MA 4L29B 5HI3C 1J1OL 3HUJA 4G8EB 5DT1H 3DXAE 1E4WL 5LGHH 5LJYH 1ROWA 3KXFD 5DHYA 1M1SA 1QVOB 3EGSB 2ZUQB 4HLJA 4QXTA 4UBDC 4ZTOL 4PY8J 3SY0B 1T0PB 2GK2A 4UI2A 4BKLA 3GDBA 3C09B 1WK0A 1AHWB 2X4TA 5FUOL 4PGDB 4JRXE 3G9VA 4FXLA 3KS0H 2VQ1B 3WFEL 4AG4H 4XB7A 2C4FU 3W81A 3QWOB 2BOBB 2FH8A 4JKMA 1SMOA 2UVEA 5ISZD 1I3UA 5EU4B 3MV8E 1LNUB 2X7LB 2ZJSL 3CFDA 4KRMB 5EIQA 2Y07H 5EU6A 1HI6A 4CUCA 5JORB 5C0BD 3IDJA 2ZPKH 4XP4H 5ALCL 3MLRL 4DCQA 3KDMA 4L3CB 3UYRH 5D93B 1E27A 4RMWA 1U92B 1ZA3A 2JE8A 1FG2B 1KG0A 1EGJH 4ZS6C 5AYUL 3QDJE 3BN3B 5FA3A 4X6CB 2XPGA 3QQ4B 5C0FB 1JFQH 1AFVH 5IJKC 3RY5A 1AKJB 3CSYB 4BFIA 4G9DB 4PV9B 2APTA 2EXWC 2DJ4A 1T0MA 3G5XA 4UTAL 4PJDE 3VFTA 1B0GA 5HPOA 5JIHA 1YEHL 2EDBA 4U1SB 1H0DB 2X1WL 3FB7B 3WFHA 4GKSB 1BREA 3TVMB 1WBYB 3STLB 2ZG2A 3QXWA 1G7PB 2FGWL 3I2CH 4UOW0 4KKBC 1YUHA 2H3NA 1ZLVH 4MJIA 3QHZH 4JRXB 4TTGA 1BF8A 1B2WL 1FNGB 4X7CC 2PCPA 5TFSL 4M7LL 3SHSA 2QV2A 2G5RA 2RCSH 5DRNB 1MCHA 4BH8A 2YRLA 1KJMA 2DWDA 3V4VH 2BNQA 3VDAA 3FB8B 5DWUL 1P5UA 1MHEA 1MFAH 5D72L 3PV7A 4OF6A 4LAQL 4PJ5B 2PXYA 3MXVH 4M61A 4PJ9B 5DJDA 5DQDH 1NGZA 4JG0L 3DIFA 4Q7DA 5CGYD 3OR6A 4NN6C 1NAMA 3CSGA 3OAYK 4J4PD 1NGWA 1K4CA 2EYTA 1U3JA 1L4IA 2NY3D 4PLKD 5DYOB 1CXHA 3DVFA 1UWGL 2GSGA 4M4PA 5FECA 3BW9A 3F58L 1D6EA 3E2HC 1D9KC 4Z7VA 1JHTB 1KCVL 12E8H 5HHOA 4UTBH 4ZUUA 1BFVL 1AGEA 1DUYB 2JELL 4OGAC 3MGAA 3ALXA 3O2WH 4PJHF 3B8YA 3EO1A 3IDNB 1CWVA 3SDAC 3PNWA 1J1PL 4CVZA 3TBWB 1OP3H 2H32A 4XRCB 3QRGL 3LKOA 4KI5C 5D1XD 5ICYA 4LSVL 4RWHA 4UILL 1E6OH 5EDXA 2GQHA 1AXSB 1T7WA 2YD7A 4OF7A 4IDJH 3SDDC 3GSOB 1TCRA 3K46A 5E5MB 3QQ9D 2DRUA 4IEFB 4NO0A 4UV4H 3HG1D 2ZSWA 3QUXB 3TT3H 1ZVHA 3U6RB 5T1LD 1DLFL 5D1XB 4LLWA 1HILA 1H8SA 1UA6L 4JM2D 3IJSA 3K2MC 1G6RB 2F9BT 5EU5A 2YHGA 1GZQB 3VGBA 4WUKH 3HLAB 5FM4A 2LE9A 4U2YA 5JNYA 4HUXA 4XNZB 1ZGLB 1MHEB 3RGHA 5C09B 4I77L 2OTWA 1BJ8A 4PJGF 5F7KC 1DQML 15C8H 1BQSA 5A3IC 4F9PA 3G04B 5I2IB 5I0ZA 3FHQA 1NPUA 4RIRB 5E8PB 5HD8D 5FO7B 2BNRE 1GL4B 5C09D 1QSEE 2VR4A 5C0ND 3VXTA 4I0PC 2VC2H 3QHZL 2BSSB 4RMSA 4FQPA 4NOBA 4YFEA 3K1KC 4EKXA 1YMHB 1EAPA 5TFSH 4F7TA 4JPKL 1G84A 4XMLL 4G8GA 5CZXD 3DX6B 2CJUL 1ZWIB 3E6HB 5E8EB 4KK8C 4XTRD 4EQ3A 3QDJA 5LAXA 3K0WA 1Q8MA 2W0PA 2JJUA 3O4OB 4JQIL 4LHUB 2VLRD 3CMOH 3VD5A 5DRZB 3KPLA 1ZT4A 4U3HA 2R15A 4K3HA 5J11B 2JJTC 4QOKB 4JRYE 1I75A 5E9DD 4XAKE 3UTSD 2A6KA 3LDBB 1NEZG 4PR5B 4WI6A 2EDFA 12E8L 5SV3A 1XF3B 5J1SC 2QKIB 3H9YA 4W81A 2IALB 3U0PA 4H8WL 2P7TA 2BFVH 3SO3B 3L9RB 3HC3H 2FJGA 3CC5B 1RZKL 1NDGB 3KYMB 1QLRB 4QOKE 5D96C 5GSRB 3WXVH 3MJ7B 1E6OL 4EI5C 5DD1H 2VLKA 2YKLL 1FL6A 4IDJL 3OX8B 2G60H 2OLDA 3EOTH 2OJEB 1FDLH 1FORL 1RY7B 2X4QB 2Y1VA 4KTYA 5JR1H 1C5CH 2ZOLB 4OCLC 3W5MA 3L3OB 3OKEA 3S96A 3ZDXE 1B4JH 1CVRA 3BH9B 4AQ1B 5KAQF 3RNKB 1XH3A 3L1OL 2AK4D 3FCTB 5B4MD 4CKVX 3QIBB 2B4CC 3F6IA 4DGIH 5I1IH 3RWJA 2HP4A 5DQ9B 2BVTA 4KKCC 5IJVA 2CRYA 3MACH 4JFYB 5JW4M 5CJXA 2IAMC 4PJIE 3SBWA 2HJLA 4JQXC 1R24A 1DQMH 5D9SB 4HF5H 3IFLL 5CD5D 1ZHLB 4ZQKB 1J1XL 3QDMA 1AQDB 1KTDA 4Y19E 5L0QC 3PL6D 4RZCB 3REVB 4Z77B 4RISH 3ZDYE 2D7PA 2DJSA 1NBVH 2CLZB 4OM0H 2D4FA 3OHXB 4NQSA 3BGFB 1BFOA 3CVHA 4XP6L 3LQZB 4NSKB 1BJ1J 3MRRB 6FABL 4JY4A 4P2RD 2J8UE 2ADGB 2XG5A 3ALPA 2M1KA 5DURB 5GRYA 1NJ9A 3ARXA 2W07A 4R2GB 3Q5TA 1GPOH 5H94B 4HGWB 4G80B 4U7KA 4MXVF 5BQ7B 1QLRA 4HJJH 2XA8L 1F97A 1IC5H 1B0GB 4YFLF 1MRCL 3EO0A 3SQOL 1J0YA 2KUTA 1M7IA 1V7MH 3B3IB 2K7PA 4GXUM 2MKWA 4JFEA 4OF0A 4YWGH 5MEQA 4HUWB 1UXSB 2GJZB 4Y5VC 1ES0A 5T3ZL 1KNOB 3HNVL 3F7QA 4WW1A 2VLJD 2VUOA 4BK4A 1GAFL 1SY6A 2NXYC 2V9RA 4PJEA 4XVTH 1T2XA 2CDEB 3HC3L 2PYFB 5BS0B 1WZMA 3TH2T 3QYCA 3GKWL 5D7SH 4XNUL 5CEZL 1FN4B 3IKCB 3QFJA 1T2JA 1JGUL 2AV1A 5I19H 2P24B 4NP4H 3SEPA 4LGPB 3NPSC 5DD6A 2WWKO 1IC7L 4UT7L 2X4SB 2Z0BA 3MV7D 4ZDHB 5DS8B 1MEXL 4HWEH 3ES6B 4NGHH 3JWNC 4O2EB 2Q6WA 1HQRA 3INUH 4LLUA 2JB6A 3U46B 3L1OH 3RDTB 4LIQL 3VDBA 5INDA 4TSBL 1JVKA 2FX8H 3MCKA 2PTVA 1XIWC 4XZUB 3UJIH 2R0KL 2YUZA 4PY8I 1T1YA 1BD2E 1OF2A 2LAGB 3MZTA 1CLZH 3BE1H 3SDCA 1QRNE 3A6BL 2HAZA 5HDBE 2IAMD 2W0LA 1CZ8H 1NC2A 3KPOB 2F5BL 2NY7L 2FSEB 5ITFA 1I8IB 4MLIA 1YY8A 3EJYD 3MA9H 1MCWM 4GKNB 1NBVL 4PS4H 3WD5L 3GJFK 3JSSA 3SDXA 3S3JA 1DN0B 3C2AL 5F96L 4ETQA 4KZDL 4KKAC 4MAUL 6FABH 1IT9L 3OKDA 1OWRM 1K9TA 2VZ1A 3B2VL 3PWNB 5CIPB 4OUUB 2R0ZH 3FOMA 1NGYB 1P9MA 3U9PL 1FVCA 4NRYB 4DKEH 3OKKA 3PGDA 5DUBB 3MLYL 4PB0L 4R6UA 3FAXA 3KHOA 5GZOD 1U95A 5CBEA 4E5XA 2P24A 1IKFH 2M2DA 3MFFA 4MLSA 5I16B 5F1KC 1HXMB 5DK0A 5SWSA 2KPNA 4OD2B 3DMMC 3NFPA 1RZJC 4I0PD 3O6FC 4OIIL 4LNVA 4XCNA 2R2BB 2X9WA 1OP5H 1XGUA 5IWLC 1BOYA 25C8L 2FO4B 5E2TH 5LQBL 4HX1A 5CSZB 4QXWA 4DN4L 5JO5A 2D0GA 4Q9RH 1U8LA 2BHUA 3PWPD 5CJBA 4QRRD 1KENL 4WEUD 4XTRC 5C0AD 1U41A 4MAYD 5DJCB 4HD9A 4F2MB 4NFDA 4NO3A 3LKQA 5MEND 3HE6B 4AY0A 3FQNA 1ORQB 2W0FB 5EC2A 3L3JA 5IROC 2JK5A 1JI1A 3KPMB 3ZE0F 3UROR 1AIFA 2RIKA 2CIKA 3D25B 1U0QA 2L7JA 1RZFL 3EYFB 5DJXA 4X9GA 5IMKB 1IMHC 1CD0A 3UTSB 5E6IA 4M9OA 1F90H 1CI5A 5IQ7H 1RIHH 1MF2L 4JREB 1DUZB 1FAIL 3A67L 4DKDC 3DVGB 5I18H 3JTSA 4P2OC 5I2IA 3GSVA 4K8RD 2H8PB 4L8BA 1XF5A 1M71A 4BFEA 4QCIB 2QTEA 4Y5VB 5HVWA 4NC1E 3P4NB 3GMOB 1HOCA 3LQAC 4PJBB 1LEKA 1A1OA 4DGYL 5E8DL 1GZPB 3C2SA 4OSUL 1NLDL 3OKYA 4I48A 3GBMH 2VH5H 5ERWA 4Y16A 3EDDA 3AB0B 1A3RH 3AREB 5F21B 1PD6A 3B2VH 1OGAE 2DM7A 5JA9A 4Z7UE 4WHYH 2EDDA 3BN9D 3BP6B 4YHZH 1S7SA 2ARJQ 3FAWA 3QEUA 4M02A 5GGRY 3H0TB 3KPQB 4JKLA 5ESQA 1ITCA 4Z0XA 4TULH 2H2PD 3C5ZD 1T4KB 2EDOA 1OAZH 2QKIA 1MCCA 1UH4A 1JF1A 2NY6C 5HGAA 4K3GA 3WIHL 5IMKA 4LPVA 1ZT7A 4FZEL 4N5UA 4K7PY 3AROA 5JLZA 3L9RA 5D8JH 4Z8FH 1I1CA 3FRUB 4KZEL 4O02L 3ARBC 2HLFD 2MMXA 3RKPA 4PJBE 5IK3B 3P73B 1UB5A 4RMRA 3CFKB 3RGVB 1NAMB 1A7PL 2C26A 5BRZD 1N4XH 2Z31B 1RJYB 2PW1B 4LEOA 3VXME 4GRMA 1UEMA 1SHMA 1QKZL 4R2GD 5TDNA 3VDCA 3TYGL 4RMQA 3TVMD 5T3ZE 1XR8A 5EZLB 4MAYC 3BYYA 1PG7W 5IHZA 2FL5A 5IMLA 1ADQA 5CSBA 2YRPA 4P57B 4R4FH 4EI5A 5MERA 5M94B 2HKFH 3ORJA 1KB5B 2BVEA 5IEHA 2GTWB 3OJVC 2R69L 3L95B 1MLBA 5AWNH 3VWKD 7FABL 3EFDH 4CNIA 4WO4B 2AXFB 1UC6A 4D3CH 4P46D 1HSBA 2DB8A 3O3AA 4OGAD 2ZPKL 4RAHA 2FWOA 3MLRH 3KPPB 3RA7L 5TQ2H 1G7PA 1AXSA 3ULUF 1D9KD 5ILTH 1JYXA 5I1CL 4NQEE 4PJ8A 4M8VA 5BJTA 5E03A 2CKBL 1LDPH 3TVMC 3CLFH 5IKCA 5A2JH 4AEEA 2J6EA 2NW2B 1BEYL 3B9KB 5HDQH 1GC1L 1XAUA 3MBEB 3H3PL 1QG3A 4XMPH 1GYAA 4N8CL 2DI9A 5FDYA 1R3LB 3B8SA 4NQDB 2DQTL 1NMAH 3U2SB 1JZ3A 3MJGX 5IW3A 1F3JA 4QXGL 4KV5E 1J0JA 3RDTD 1R0AL 3MV7A 1FNSL 1MHHA 5BQ7A 1KACB 4JRWA 3MMEB 4P48A 2Z31A 1HINL 2GI7A 5HPMB 1QSFA 2X4OB 2IH3B 4XZUA 1BQHA 1RVFH 3QSKB 5IBTL 3QRFM 1EEYA 2QSCL 5ALCH 4YHZL 5L8LB 1D9KB 1KJ2B 2X9YA 4FQCL 3FO1A 4N68A 3MXVL 2NMSA 3QAZB 3CZFA 1FZMB 3WSQH 4NQDD 5CJQH 1FO0A 4R7NB 3ARFA 4OI7A 3L95A 2DQDL 5J4MA 1VFBA 1J8HA 3TV3H 4WW2A 3WS3A 1XCTA 2CMRH 3GI8L 5DTFB 4JFOB 2FZ3B 3O81A 4P2QD 1HHIB 4UAOC 2ZCHH 1Q0XH 4QWWD 4NYLB 4P5MB 5IHUH 2ERJC 2Q20A 1BFVH 1QO3B 3QIWA 3U48A 3MRMB 4YHKL 3CLEL 1K4DB 1CE1H 1LE9B 2ADJA 3I2CL 2IGFH 2UWEF 4OZIB 2VKXA 3HLAA 3P30H 5CP7A 1S9WA 4EN3B 4IRSB 5J13B 4GG8B 1H9VA 1EFXD 1TVHB 1JMXA 1FGNL 4NHCH 1KFAH 3U2SA 2Y4SA 4X98A 5DRXB 4D3CL 4OFYD 5HYJE 1U2CA 4CRPA 5FM5O 2FEDC 1VEOA 3GNML 5EZIL 5DQDL 1CDYA 1R3HA 3V6FA 1PEZA 4Y88A 3CXHJ 1TVBB 3NZHH 4QHUB 1CTNA 3QEQD 3MLZH 4MNQA 1YYML 3VXPB 3HPJA 2NZ9C 2IG2L 2DM3A 2AKRA 2R1XB 4YZFF 2VQ1A 4M1DH 2DICA 1UM4H 3K81A 4F9PC 2YD9A 1F6AA 5C0IA 2FHCA 4MNGA 4LFHD 4Z7WF 1S5HB 3BKML 4OCYL 2PXYC 1YMMA 1OQXA 3CX2A 1NC4A 5CBAA 4BQCA 5E8NB 1YPZF 4PJAB 3D3VB 2EE6A 4MJ5A 3AS2A 2F53E 1NMCC 1T6WA 4O51A 1QFOA 2X05A 5ESVA 1CDJA 1LO4H 5C71A 3D87B 4WNQB 4ENEC 3TZVD 5DA4A 1KG0B 1FNLA 5TE6H 2VOTA 2EDEA 3KPRD 4PBXA 5DUMH 5IVNA 4RGNB 3RHWK 3C9NB 5MEPA 1Z9OA 3WNPA 4QHLA 2UUDK 1AC6A 3T0ED 2J5LB 2J8UB 4FQCH 1K8IA 4OD3L 4QEGA 2ATKA 3RKDC 5HY9B 5CMAA 3I02A 4EUPG 3NFNB 4P59L 2VXQL 4HX1B 4KI5D 3IDNA 4WUKL 3QI9D 2WW8A 5E1HB 3SKNB 2VLKB 4DEPB 5KJRH 1NUNB 2WP3T 3NA4A 3VXOB 2HA1A 3STLA 5F9OL 5ICYB 2Z92B 3V7MA 4PJFB 1S9XB 1NBYB 2ZCHL 3L3OA 3EUUA 1ND0A 5DMKB 4HMDA 2VQUA 3LPWA 3WIHA 4NO5A 3CCHB 1X9QA 4LSRL 4KMQA 32C2B 1B6DA 3OAUL 3P30L 1HYRC 5E2VH 2K1MA 3H0TA 3H9HA 1T6VN 4DGVH 3EO9H 3D1MC 2C5DC 4FXKA 5F6IC 3EJJX 1YECL 5D2LE 3MV8D 3WLWC 3RUGB 3BQUB 5SX4I 2DWEB 3GGWA 4DW2H 4DFHA 5C09A 4EUPA 4Z7NF 3BO8A 3P4NA 4XX1E 4XCFL 1A7NL 1NFDA 3RL2B 3RWGB 2FBOJ 3MLZL 4W70A 3MJ8A 2UZIL 3ZE2F 5E6ZA 1MCEA 1YPZB 4JFFE 3QIWD 2R2EA 4NQTA 4JFDB 2BVPB 4ONHA 4V2BA 3LKOB 3V9FA 5I6XC 3GSXA 2GT9A 3EDJA 4IHOA 1RUKH 4QGTA 1T89C 3RUGE 1TPXC 5IFJA 3E8UL 4XPHH 1JP5A 3UTQB 4JQVC 1LD9B 1MCIA 3E6HA 4O4YH 5GGUA 5I8KL 3V5DA 5IJKA 1HHKB 4QRPA 4BA8A 5ETUB 2XN9A 4P46C 2AEIT 3LIZL 3RZWA 2QSTA 4N8VB 1AGDA 4JHWL 4ZPTB 3H42H 4ZTOH 4GRWB 1KLUA 3UJTH 3B2UD 4G6AC 4GG6A 2D7NA 2OCFD 4TQEH 3HZMB 1G7LB 5TE6L 2E9IA 2IPUG 3HHRB 4WFGD 1U3ZA 4Q74A 2J8HA 4R97B 3MREB 3RAJL 3OR6B 3K8LA 4Z7WE 1NCCL 5DD3H 2ED7A 3LEXB 3K7UA 2R0WH 1OTSC 3N1MC 3GRWH 3RKDD 5I71B 5SWQA 3FFDA 2DBLL 3JV0A 1ZXQA 4FQQB 4NKOB 3SN6N 2BNRB 2J1KA 2H6PB 3RI5F 4ZUSA 2HG5A 5C08E 1T80A 4R90H 3SDDB 4WFEE 3ZDXF 4E41A 4GBXD 4WCYH 2EO9A 2LFGA 4QXTB 3ALWA 3MJ9H 4WWKB 3KYOB 5F72S 5ID0A 4J1UA 4JM2A 1YN7B 1KCSH 2EDWA 4YDKL 5DEFA 3DSFL 3VXSB 4PUBL 4WO4A 1RU9H 1QBML 4JFED 3FFCE 2OZ4L 5CP3A 2VJXA 2UWEE 4CVUA 2IBZX 3IXTB 3BP5B 5D1ZB 1KTKE 1VGKA 2YBRB 1MCOL 3T2PA 1EJOH 1TDQA 1DQTA 1CICA 4PRPB 4KI5F 3GSQA 1AIFB 1EO8H 3HG1E 1HSAB 1XGYL 1MCDA 3D0VA 5CEXB 2I9TA 3D39D 3TA3A 4X0KA 1IGIH 2AJZB 4HHAB 4MVBC 1NEZA 1LP9B 3CFDB 3D9AL 1KJ2H 2E8YA 5EO0B 1XZ0B 1HIMH 4LAQH 2EDKA 5E7BA 1PSKH 3IU3B 1QEWA 1GAFH 2JF1A 4Y4FC 2F5BH 1F4WL 1L7TH 4H25A 3LHPL 4GSDH 2X89D 3MA9L 4MD5B 1AO7D 4JREC 2F74A 1JYVA 1PW3A 2IBBA 1F02I 5FYKE 1DANU 2OJZL 1E6JL 2IFFH 5B21A 5C0JA 2Y7QA 4QHNA 5E99L 4KK6C 4X6DE 1UM6L 4UT7H 2HJFA 2WIIA 4JO2L 4XNMA 1MEXH 2A74B 2AJUH 4P2OD 4BFBD 5EG6C 4LSSL 1U8NA 3GFUA 5DJCA 1KNOA 3VW3L 3OGCA 1S7TB 4TSBH 5IB5A 2XQBL 5DEZA 3VXUA 4UILH 2PCPB 4G6JL 3GHEH 1U2HA 3UJIL 2R0LL 1IKFL 3DO3A 5FKAA 3L3GB 1KLGB 3R8BB 3VCLB 2B5IB 5EFIB 2I25N 4ZPVA 5F3BA 5JA8B 4PRPA 3FB8A 2D31A 1BQLL 4OZ4A 4X9FA 2BY1A 3TIDB 2NR6D 3MV9E 2MOVA 5CP7B 1K3ZA 3T1FB 4D0BA 4PJDB 3NCBB 3U79A 4HKBB 5CJXC 5TGBA 3Q1SL 2X6MA 1P7QD 2DIJA 4IS6B 1BIIB 1C5DB 2ZNXA 5TE7H 3WD5H 4HIJA 4ZFZA 3P2TA 3PDOA 5F7UA 3C2AH 4QF1A 3U46A 1GOGA 3QDGB 4A2LA 4MCYA 1S7QA 1YC7A 4FZ8L 4L8CA 1SMAA 4JRXD 4E0RA 3RWIA 1CQKA 3GIVA 5E4IA 3TPUA 3V7AG 2Q8AH 1F58H 3HZKA 3VXQB 5E56A 4GH7B 4N90E 4PREA 1RURH 2ARWA 4RFNC 4KROB 3ZT7A 3MLTA 2VC2L 3G08A 1U8KA 2QQLH 2BJML 4E41E 3NH7L 1V3KA 1QSEA 4JPKH 4C58B 4H5SA 5C0BE 1YY8B 5DRWA 3JZ7A 4X6DB 1Q38A 4HQQL 4NQEB 4M00A 4ZXBB 3AAZB 2ZCKH 4NFBA 2K3TA 5F88A 5DT1L 3TBVB 2GJ6E 3FQXB 4NN7C 5ESVB 3O3DB 1UVQB 4ZUVA 2YXFA 5T1MB 1F3RB 3VXRA 3GJFB 3PXHA 5C0GB 1WWWX 1BAFL 1C16B 3O0RH 6CGTA 4DUWA 4HLZG 3OB0K 3TH3T 3MV8A 4GS7C 1I4FA 3DV4A 4TTDC 1RZFH 5I16A 3VFVA 4H20H 2EICA 1PX3A 4G80A 3LSOA 5DEGB 4NZDA 3T4AB 4C57C 3GSUA 1CGSL 3D39A 3TA3D 4U6HA 3AFLA 4LSUL 1E28B 2AQ2A 2CO6B 4LEXL 4JO2H 1PQZB 4HIXH 1QBLH 1BIIA 3FN0L 3N1QC 1C5DA 5DHYB 43C9B 4U1NB 1AH1A 5T33L 3KNBA 2R2EB 4HH9B 4AENB 1A6PA 3CH8A 4GAJL 4I3RH 2XQBH 3WHE0 3GHEL 3T0VA 5FCUL 5DD1L 1SVCP 4HWUA 2R0LH 1UM5L 2GITA 3DUUB 3EYQD 2VDOL 3BZDA 3DX9B 2Z91B 2PTTB 1FDLL 1FORH 3HI6H 3PHOA 4ZD3L 4PJ7F 2NXYD 4S2SA 4JFZH 4WHDA 1GIGL 2X7LA 4KJPD 5EO1B 5SX4H 3H9ZA 4UDUA 4ZYKB 5J1AB 3QZWA 4J3UA 2C3HA 4U3CA 1XF1A 1ZLSL 3ZYJA 1YN6A 2EKSB 5JORA 1FVCB 4NRYA 3H2WA 5F1NA 4QHKI 1ACZA 4DKAA 1ZGLM 1JPFB 1I9IL 2WM0A 2DLFL 4FQIH 2VDRL 5FYJD 3MRMA 2HKFL 2OJEA 4ZFOL 1JZ5A 2P7TB 4KQ3L 5HVHB 1BF2A