3WIIL

Crystal structure of the fab fragment of b2212a, a murine monoclonal antibody specific for the third fibronectin domain (fn3) of human robo1.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
213
structure length
213
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNFLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDFSLTISKLEQEDIATYFCQQGNTLPLTFGAGTKLELKRAEAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-human ROBO1 antibody B2212A Fab light chain
publication title Structural features of interfacial tyrosine residue in ROBO1 fibronectin domain-antibody complex: Crystallographic, thermodynamic, and molecular dynamic analyses
pubmed doi rcsb
molecule tags Immune system
total genus 54
structure length 213
sequence length 213
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wiiL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wiiL01
1JF5A 3UROR 1MLBA 3ARBC 2J4WL 4O9HL 1MFBH 4EI6A 1A0QL 2R4SL 2AEPH 1QFWL 1N7MH 5J8OA 4KXZI 1WFNA 2NQCA 2MKLC 3CSGA 1FRGH 1WAAA 2EH7L 2GJ6E 2IANA 4L3EB 5IESL 4W70A 1IAIH 3H8NA 3HMWL 1BGXH 3UYRL 5DEGB 1A5FL 1PD6A 4XWOD 4LSVH 1I9RH 1ITCA 2J3SA 9CGTA 5IVXE 3LZFH 1RUMH 5A1AA 2EDHA 4EI5D 3D3VD 3PWNB 1I7TA 2ARWA 1NCTA 4H1LH 4MDIA 4U1GC 1UVQB 2DQHH 4YFDB 4RGMC 3K7UA 4PY7B 4X9BA 4LCIH 3IXTB 3B9AA 3QULA 1RULL 2R2BB 3H0TB 2G60L 5D7SL 4L8SC 1W72L 1PVHA 5BO1H 3NH7L 1LO4L 5JW3L 4DQOH 3DJ9A 5ALBH 5K33A 1DSFH 1MCIA 4O02L 4R4NC 1GRWA 3TBWB 1KJVB 3QDJE 1I8IA 3T0EE 2YWZA 1SHMA 4KRMB 1CT8B 2NR6D 3OXRB 2J5LC 3O45A 1X6NA 4K3EH 1CLOH 1EO8L 4IJ3B 2YD4A 3S35L 1J86A 4GMTL 5CFHA 5CJQH 1T2QL 1X44A 5I1CH 4WNQA 1FE8H 3H3KA 1LE5A 1P4BL 3GRWA 4HZLA 2R2EA 2HMIC 3FT3A 1RV6X 1U8JA 4AQOA 1S7XB 4OCWL 2GSGB 1DZBA 4DN3H 1WZLA 3ROLB 2V6HA 4XPGH 4ELMF 25C8L 3BIBX 5HHXH 4K2UL 5JLZA 4LPWA 5HHVL 1BBDL 1K8IA 2G9HB 1TZIB 4GKSB 3VGEA 3O3DA 4OZIF 4IMLA 5DJCA 2CPCA 1SVZA 5DMGC 4KI5D 1X4ZA 3GSVB 4Y8AA 1CLZH 5GS0L 4UILL 3FRPG 4LASL 2NY5L 1SYSB 1UA6H 2C1PA 1T5XB 3VDBA 4YHLH 2EDOA 4AIZA 1DBKH 2OJZL 3O6KH 5LBSH 5D5ME 1U8IB 2B4CC 1ACYL 4YHZH 2FJFA 1CICA 1F97A 2F58L 5EU5A 2FO1A 3B3IA 5B8CC 5TDOB 4YDIL 1S9XB 1MQKL 3KNBB 1DCLA 5JHDE 1CGYA 1JPSH 3T8XB 1EMTH 3TO4D 2ATKA 1KELH 1MH5B 4JY6B 4IRZL 5HHQA 1JTPA 4RWYH 1YN6B 4F37F 2CGRH 4JDVA 4Z7OF 4JFHD 1G7JB 1P2CA 5CP7A 2A74A 3WXVL 1VFUA 4CNIA 4Q58C 4LIQH 2EDRA 3D39A 1T1WA 2GTZB 1MCHA 4KK6C 1JBJA 4NQSB 1FFNA 3C2AL 3C9NA 1KJ3L 3ILPB 3FB7A 3LKRA 3RJDA 5DHYA 2ZUYA 1A1OA 3O2DA 4MNQA 2IWGA 3BP6B 1DN0B 4LLWA 4L8BA 3ZKXC 4D0CA 3QAZC 4F9PC 2P5WE 3CVHL 4G8EA 1VACB 3UMTA 4XMLL 4BH7B 5KVGL 1WF5A 2PR4H 5T1MB 1L6ZA 2R9HC 4PRIA 3QEHA 5HY9B 3WUWB 4OSUH 4I18C 2C4XA 5F9OL 4F58H 5F6IC 4QRSB 1LWRA 1EEYB 1QG3A 1IEAB 3VFTA 4XNMA 2X9XA 2AJSL 1JK8A 1BOYA 1N6QL 1YNLL 2X4RA 3P4MA 3CDYA 3SCMA 5CEZH 1HEZA 3IAPA 2OX5A 5F9WC 1CDIA 3TBVA 1D9KD 4F7TA 2JELL 1NCWL 4JREC 4FFYH 4HK0B 2ZOLA 4YUEL 2RAMA 3THML 1MEXL 2XTJB 3O11A 1LNUA 3D25B 5HYJB 5F1NA 5JORA 4G43B 3VW3L 4GW4B 1FH5H 4JAMB 1A4KB 3V5HB 3WIHA 5L8KB 3V8OA 3NPSC 1M6OB 1ZS8A 1T20B 2BC4B 4XCYA 5B3JE 3BQUA 4WU5A 1KCSH 5CD3A 4LGSB 3EGSA 3VG0H 5IVZB 3P0YH 3MO1B 3GHBL 4GG6F 3AREA 2WWMD 4HWBH 5HBBA 3S37H 3GMQB 3BRDA 4M7KL 4M3JA 4OZ4A 2ADGB 1VSCA 4TOYH 2H2SD 5T5FL 3MXVL 1E0OB 5SWZB 1R0AH 3KPRE 4ODXB 1N2RB 4Q6YA 3ULVH 3NFPA 4X83A 4TVPD 2ZP0T 3TA3A 1UQSB 4NKIH 2F15A 4MJIE 2BFVL 3VXOB 4K94L 2CDGA 5I0ZA 4S1QL 4Z6AT 4TNVF 5K9QI 2VLRD 4GKNA 2UYLA 3GBNH 2XA8H 1UB6B 2ZCKH 1QSFD 2X4QB 5B39B 5E1HB 3SGKC 1I4FA 3MRDA 3DX9A 4PRHB 1PG7X 5DR5L 1RIHL 1ZEAH 4OGAD 3IDGA 5IB3A 3TH3T 3OB0K 3W9DA 1QR1A 2XG4A 4QTHB 4J4PD 2MQ0A 3MLXL 4PRPA 3VXSD 4H8WH 2Q7YB 4Q6IA 5I18L 3IXAB 1INQA 2Y7QA 1FDLH 1FSKB 1I1AB 1LEKB 1J5OL 1OGTB 12E8H 4G6MH 2CLRA 1YY8A 1T1XB 4UB0H 3QNXA 3OAYK 4JM2D 4NN5C 5D72L 3TVMC 3UJJH 5D71L 1AI1L 2RR3A 4ZAKD 4NQEB 4J3UA 3OKDB 4HUVA 4Z7UF 5FYLL 3PABA 3QEQE 4DUWA 1INEL 4MWFB 4WEMB 1OTSD 1J1OH 5C07A 5EUOA 3RZCB 1KG0B 1Z0MA 2D7MA 3QRGH 4IDLA 3MBEC 3TGXA 4F3FB 3HE6B 3RL1A 5JO5B 3R0MA 5D1ZA 4IRSA 4R7DB 1F8TH 3CLEL 1E6JL 3UZVB 1H3PL 4OF8A 3DGCR 1J9CT 1BP3B 2VITB 3WL9B 3NCJL 2ZJSH 5E5MB 3GKWL 1DLHB 4NM4H 4Y4FC 5FKAB 4NKOA 2YBRA 2ZPKH 3IDIB 5F9JA 1ONQB 1TQCB 32C2B 5D1QD 3SQBA 5C0BD 1M4KA 3GRWH 1CI5A 3KHQA 4C54A 2PN5A 2F5AL 1MAML 1CG9B 4NRXB 4XHJD 5HVWA 3VXMB 3ARDA 1DJSA 1ZVSB 4LKCA 1T04A 2HN7B 5DMIH 1TVDA 1KCVH 3DLQR 1S7QA 4LEOA 2FJGA 4DN4H 1QKZL 3MSPA 3U79A 4HUNB 1UB5B 5L9DL 4P2RD 5L8JB 5IWLA 3P77A 5IM7B 1K4CA 4I0PD 4I48B 4DCQA 4HXBL 5GZOD 2DQTL 4R8WL 1AH1A 1XGQB 3OKLB 1U3YA 5C0AE 4L3CA 4WEBH 2O61B 5I75B 2DQEL 2HKFL 2XRAH 2HFEB 3QZWB 2W0LA 1KV3A 1JWSA 1UM4L 2HRPH 4ZSOA 1IGTB 2ED9A 3WIFB 5I8EA 1CGWA 4X6BB 3VRLF 5GS0D 4DKEL 1RURH 3NABL 4FQCH 3O8XD 1P1ZB 4XPFL 4M7LL 4XX1E 1N26A 4HUMB 3GMRB 4KDTC 5E8OB 4L4TE 4PTUB 2EZ0D 2HWZH 3JBG7 5I1HH 1U3HC 1FVEB 3RVWC 4JRYB 4L3EA 3VGFA 1N59B 3U30C 2P5EE 2HT3C 1HZHL 5DEGA 5HI4D 2E7BA 3HMXH 2WK2A 1ZE3C 4Z5RB 1GGCH 3RRQA 1QP1A 3PWNA 35C8H 2IGFH 4U2YA 4ZQKB 5BV7B 3BYYA 1UVQA 4UMGA 1LO5B 1YQVL 4HIHB 4PY7A 3IXTA 4JFDD 3KLAB 1S7RB 2R2BA 3L5XL 5C1MB 1F4YL 1NH6A 4MJ2A 3H0TA 3WFBL 2JB6B 4I0KA 4A2LA 1S9VB 2DYPB 1NMBH 2VNCA 3C5ZB 2HG5B 1GCFA 5E08H 4I2XE 4WUUD 2J2ZA 3TBWA 1KJVA 4HEME 1MCRA 5HHMB 4NC0B 4KQ3H 1CT8A 3OXRA 5F7WC 3EDFA 1UADC 1UYWL 4Z7QE 4HKJA 5DQDH 2YA0A 1YEKL 3S3SA 5T1DL 2PUQT 3AVEA 3EO9H 2JCCB 2WLYA 1NGQL 1W8NA 3B9DA 1CK0H 2CDFB 1QFUH 3JWOL 3L6FB 2CLVB 3LRGA 4WFEE 3QG7H 1S7XA 1IQWL 3M8OH 4KJPC 3T3ME 3WIHH 3ROLA 1G1YA 2DBLH 4HJJH 4N5ED 4EBQL 4CMHC 3DRTB 2G9HA 1TZIA 4GKSA 4JKMA 2H2PD 5D70H 5C8JB 1AIFB 3WS6C 3GSVA 4FFWD 3E1F1 5BRZD 4YJZL 4XI5D 1A6AB 1OARL 4JGUA 4K3JL 1SYSA 1DANT 1T5XA 1KJ2L 5FYJH 2FX7H 4P48A 1JFQL 4PJ5D 1WAAF 1U8IA 5D2LF 5MERB 3T0VA 2ZG2A 1BD2D 4HIXL 1GAFL 2C4FT 5F9DC 1FYTB 5TDOA 1S9XA 2XZQL 3KNBA 4GQPH 5TPWL 4FXLA 1JYVA 1JYXA 3T8XA 3U0WH 4LP5A 4X4XB 1FZKB 5IT2L 1MH5A 4JY6A 3DVIA 1YN6A 1G7JA 2UUDK 4MZ2A 2QHLA 3RI5F 5I0DA 4DZ8B 2F8OA 1OPGH 3GMOB 3U82B 5EORL 4XPHL 1B4JL 2XN9B 4N0CD 1WBXB 4IIQB 1MCSA 4ONOA 1FCCA 2GTZA 1IE5A 1JNJA 4GG8B 4NQSA 3ILPA 1NFKA 4YEEA 1TJGL 5E2TL 4LSRH 3WN5C 4XVTH 1I1RA 1CGXA 1VFMA 3GB7B 3ZKQD 1BWMA 1T66D 3MX0A 1DN0A 2XTLA 3VFOB 4ZXBD 1SJHB 4AJ0A 1M7XA 2DLTA 1L4IA 5DJXB 3JZ7A 3P4NB 1MLCB 2K1MA 1JPST 1INDL 4KGJA 1JNLH 1K85A 1VACA 4BH7A 2DLHA 4LLVB 2X4TB 4WU7B 1LE9B 5T1MA 5CP3A 3FL7A 1ZXQA 5HY9A 3WUWA 1J8HE 5GSVB 1J0HA 4QRRD 1CE6B 4M43L 4QRSA 3MLUH 3QHTC 5DC9B 1EEYA 1IEAA 4U33A 5TE6H 2M26A 2VSCA 5TF1L 1D7FA 4LQFL 3GBML 3RKDD 5GRYA 2R15A 3TWCH 4WHYG 5E94B 1A4JB 1AGBB 3U9UB 4FZEH 4F9LA 3ESUF 4P0DA 3CX5J 4HK0A 3NCCB 3QNZB 5EC1B 5GJTH 1RUAH 2DJUA 5FYLD 3D48R 3D25A 2E9JA 5HYJA 4G43A 1WIUA 4GW4A 4PLOB 4JAMA 1ZTXH 1A4KA 4NN6B 3V5HA 5J4MA 5ADOL 3GK8L 4MAYB 1JZ2A 1M6OA 3QDGB 1T20A 2BC4A 3V9FA 1G6RH 3O4OB 5IVZA 5C0RL 3MO1A 4NRZB 1OTUC 5EU4A 3GMQA 3TN0B 4R96B 4GKZB 4BH8B 3MV9D 2ADGA 3RGHA 2HH0L 5C0IB 1ZGLM 1I8MB 5SWZA 4Q9QH 1C12B 1N2RA 4ODXA 4OQTA 4WO4C 3N85L 5KOMC 3N1QC 2MSPA 4FOMA 1AKJD 1UQSA 4O2FB 3QIUB 4PB9H 1B2WL 4CVWA 2X1PA 3VXOA 4S0SD 3UDWC 3QYCA 4JQIH 1DBBH 1U0QA 3LS4L 4P3DB 2EEBA 4M62L 3V0WL 3WNKA 4M4RA 4PJ9D 4JR9H 1V3LA 2IFGA 4F7PA 5E9DE 5BOPA 4FQPA 1UB6A 4RZCB 1LP9B 2X4QA 3DV4B 2B5IB 2V5MA 5B39A 3QHFL 3V8CA 3SCMC 1G9NL 3MOAL 4PRHA 1RZJC 1CD9B 4HV8B 3ARRA 2Y07L 4B53A 5JQ6H 2F54D 4WY7H 3RZWA 2OL3L 4RAUB 4MXVE 4QTHA 1YJDL 2DD8H 2FH8A 2Q7YA 3QJHB 3IXAA 3SGEH 1LEKA 1I1AA 3KR3L 1Y18B 5I1KL 1GGBH 1OGTA 5EDXA 3HRZB 1T1XA 1EJOH 1HSAB 1KIQB 3HI5H 1VFAB 5AZ2L 2OR9L 1QNZH 5A16B 3K74B 1NANH 1MWAB 2J8UE 4YFEA 1JHKL 4NQEA 2E6JA 3OKDA 4HHAB 3SDYH 4DKFL 3BKJH 2Z31C 3EJYD 3HG1E 2W92A 2V5YA 4YHKH 1OWWA 1V5JA 4WCYL 5F1OB 1E6OH 3U9PH 3LQAH 3RZCA 1LO2H 2X4OB 3TA3C 3BJLA 1CBVL 4F3FA 3HE6A 2VDNH 3SE4C 5JO5A 4XPAH 4MLIA 3EDEA 1A3LH 4M48H 2XY2A 5T5NF 2X5PA 2VITA 3WL9A 1HXYB 2WUCL 3MLSL 5E5MA 4NOFA 1DLHA 2D9CA 4F33B 5FKAA 3ZDZE 3IDIA 4HUUB 1ONQA 32C2A 2YUZA 3Q3GB 5HXMA 3RVXC 1CG9A 4NRXA 4CGTA 3QUYD 2Z8SA 3VXMA 4EI5B 3BN9D 3LQMA 3D3VB 3V2AR 3I9GL 3MACH 1ZVSA 5FDWB 1U36A 2HN7A 1NGWB 4X6CE 2ZUVA 1G0XA 2NTFB 3TM6A 1A6WL 1KN4H 1EAPB 2CMRL 1IAKB 3EYQC 1CQKA 5C6TL 4EZMA 5LQBL 1UB5A 3MQIA 1DQLH 5F7NC 5IM7A 1VEMA 2V2WB 3FMGL 1RSFA 1G7MB 1J18A 1UJ3B 2VDPL 3SJVE 3FN3A 1XGQA 3F8UB 4G42B 3OKLA 4PY8I 2OJEB 4U6XB 1KEGH 2O61A 5ILTL 3M07A 2HFEA 5I1IL 3QZWA 3ARGC 5IQ7H 2AI0H 2CIKB 2YOCA 5KSVB 1IGTA 5D1XC 3WIFA 1UFUA 4X6BA 4P2OD 2PTTB 4U4BA 2DM4A 2ZUWA 4I9WD 2Q20A 1P1ZA 2B0SH 3ZHDA 3GMRA 3O6FD 1NMCC 1Z9SA 1F90H 5E8OA 4WI8A 1UACH 5CUSL 2ATPB 2WINB 3B6SB 4PTUA 1T7WA 2EYSB 3G5XB 1VGKB 1FVEA 4JRYA 5EUOF 4CVZB 1AXTH 1ZLSL 1M71B 1N59A 1NBVL 3LKPB 5CJOL 3ARSA 4PJBB 3D6GA 1BWWA 2DTMH 1N64H 2EDWA 3PIQB 4LPCA 1PDKA 3ARDC 4Z5RA 1D5BB 1YEHL 3Q6FB 4M03A 1FAKT 2H45A 3R06B 4ZQKA 1FFQA 1LO5A 4HIHA 4JM2C 3KLAA 1S7RA 4RAVB 3RUGE 3N06B 2APWA 1XGYL 3TO4B 1S9YB 4HX1B 4U0RC 2JB6A 2AXGB 1S9VA 1IM3B 3OJDB 2DYPA 4YR6B 3C5ZA 2HG5A 4G3YH 4NQTA 3ZE1F 4PRNB 5HD8C 4U7MA 4D9LL 3H6JA 1AY1H 1JF6A 1G7HB 4GS7B 3G9AB 1Q9LB 1S3KH 4X9HA 4JQXA 4PJCB 4PGJA 1VCAA 2JCCA 4M5ZH 3GZKA 5EZIH 2CDFA 3ROOB 1HKFA 3QHZL 3L6FA 2CLVA 3MLZH 1Y0LB 1X5XA 1JVKA 4WHDA 4FQXD 1KB5H 1WLHA 2CSPA 3BE1L 5E0QA 5I76B 4JY5L 1NMAL 3DRTA 3VI4F 4MA1B 1RZGB 3ZTNL 3PP4H 5C8JA 1AIFA 2BHYA 1A6AA 2EDFA 4KKBD 5KAQF 3EDJA 1X9QA 3D0LB 2WM0A 4M7JL 4GBXD 3ZHKA 3RHWK 3GKZA 3AC0A 3OKYA 3RU8L 4M6OL 2CKNA 5MERA 4F80A 4OQTH 3MGOB 1MJJB 1FYTA 2DIJA 3WSQL 3G5ZB 2LVCA 1PG7W 1JRHH 3HLAB 5ISZD 5IOPB 3GSWB 3KPSE 4X4XA 1FZKA 1A7OH 2QQKL 4H88H 1NGXB 2APXA 1HILB 3DX7B 5T3XH 5JUEL 4OM0L 5DJ8B 5HGDB 1DQDL 2Y6SD 4DZ8A 3GMOA 2IC2A 1MY7A 3VDCA 5LWYH 4YQXL 1WISA 2XN9A 4OTXH 1WBXA 4IIQA 5JPMB 1E4JA 4Y7MA 2MJWA 4YDJB 1TIUA 4IEFB 5BMFL 3IU3B 4GG8A 4N1HB 4O5LH 5BJTB 3CVIL 1IBGL 3OKOB 1WTLA 2CO7B 2B4CH 4S1RH 4NNXB 3GB7A 4WVRA 4E5XB 4X98B 4MXQD 2FYYB 3WKML 3GSNH 3VFOA 3F62A 1L7IL 1SJHA 3CZFB 4ODHL 5DI8B 5DJXA 3UJTL 2Z35B 3FRPA 2XPGB 1HIML 1NJ9B 3P4NA 4M7ZB 1MLCA 1KCKA 4RA0C 3HR6A 3MGTB 2VR5A 4LLVA 2MNUA 2X4TA 3WXWL 4WU7A 1C7TA 1LE9A 4J6RL 3RA7L 2ARJQ 2B1HH 4NP4H 4NKQB 4N0RA 5M95B 5GSVA 1BVZA 4NYLB 1MFBL 4E42B 3SDAD 1CE6A 3C6LD 2VLRB 3M1BB 4P46D 1N7ML 3H42H 5CSGA 3A6CL 1QSFB 1JZ6A 1R5VB 4J7RA 4P9HH 3T0ED 5M7QA 4XVSH 5I1LB 1UEMA 4EOWH 2LU7A 4W4OC 5D96C 2WWKT 1IAIL 5E94A 1A4JA 1AGBA 4W6XB 3SKOB 3U9UA 1NCCL 1IT9H 2AVGA 4WTWA 4LSVL 1I9RL 5CSBA 3VXSB 1EX0A 1FG9C 4FA8A 4ZFOB 3I6GB 3QNZA 5EC1A 3LZFL 1RUML 2FZ3B 1U42A 4N8CH 3V7AE 2VWEE 4L5FH 8CGTA 2X2YA 3ULUE 4APQD 1OGAE 4LFHD 2EH8H 4GLRI 4KWUA 4F57L 1NBYB 4UI2A 3RIFK 4MAYA 2MHAB 1MIEL 5TE7L 4LCIL 4ZAKB 4YBHA 3T0AA 4PGEB 2VXSH 5FYKH 4NRZA 2OCFD 5BO1L 2BVPB 3TN0A 4R96A 2IF7A 4GKZA 4DQOL 3MC0A 4TTDC 1F4HA 3HB3D 4H26B 4BH8A 4OIBA 4D94A 3QEGH 5C0IA 3TF7C 1DR9A 4JFXB 1C12A 5CCKH 2CIIB 3BHBB 5IKCB 3PGFH 1CLOL 3EJJX 3QIUA 4GRWH 4I3SL 5D7IE 1SMOA 3NA9H 3DRQB 5I1CL 1H5BB 5KSBE 5ACZB 2X09A 4P3DA 4D2NA 1JZ4A 4UAOC 5D6CB 5DZNA 1C5BL 4X80L 3GNMH 5D1QB 5C0BB 4J1UB 4RZCA 1P5VA 3KG5A 1LP9A 3QUMH 3DV4A 1PW3A 3B5HA 3NFNB 4XMKH 4PS4H 1W72B 5IK3B 1ED3B 1Y6MR 1GH7A 4HV8A 3B2VH 1S5IH 2XQYK 5FK9B 2AJYH 2KKQA 1V7ML 2NCMA 3ILQD 5JXED 4ODTH 3LQZB 4RIRB 4RAUA 1JGDB 4NJ9H 4AYFA 5FB8B 4MX7B 1UA6L 1KBGH 3QJHA 4NC2B 1A8JH 4YHLL 4JVWA 5B21A 1Y18A 1JTOA 3O6KL 5LBSL 5B3NA 4OZGE 4HBCL 5I15L 3HRZA 4YHZL 4P2RB 2NW2B 5FGCB 1HSAA 5E4IA 1KIQA 4I0PB 4MNGB 4CVUA 2AERT 5C71A 1VFAA 1XF1A 5A16A 5EBLB 3MLTA 1QFHA 1MWAA 3GMLB 1IGJB 5TJWK 3OHXB 3VXTB 5BV7H 2GKIA 4LCWE 5IBUG 4HHAA 3JWDC 4JFOB 1A1NB 4RWYL 2RJMA 3O3UN 4NC1C 4ZS6C 1FJ1B 4HBQA 4HS8H 4P4KC 3BZEB 1X5HA 3F7YB 4LIQL 3SBWC 2X4OA 3O8XB 4FS0A 2DKSA 4JFED 4POYA 3MUHL 2EE3A 3P3YA 1OM3H 2NY0D 1NCDH 5AWNL 3SE3A 1OW0A 1I7UB 3HPLB 4EUPB 1ZKAA 1HXYA 5ANMB 2VUOA 2BMKB 2PF6A 2KBGA 5JPNB 4F33A 4HUUA 4OLWL 1HXMB 2YD6A 3K0WA 3N1GC 3Q3GA 1I3RB 5DJDB 4HMCA 1AJ7L 4YHMH 4HJ0D 2BVYA 2C9AA 1GC1C 3K46A 4CKVX 1J87A 4LHUD 1CDJA 4EI5A 4HQQH 3D3VA 2DM3A 5FDWA 1NGWA 4OSUL 1JNNH 1EAPA 1AP2B 4JFDB 4X0KB 2R0LH 1IAKA 2AK4D 4ZUTA 4N90E 1MRDL 1BOGB 4P23D 1I1CA 2V2WA 1BZ7B 4MQXC 1G7MA 4G80B 2P8LB 2FIKB 1GOFA 1Z9OA 3C08L 4WUUB 4D0DB 4U6XA 4G42A 2OJEA 2L4OA 4G8GE 2XICA 4GW1B 5DYOB 3DOSA 3SDDB 2CIKA 3HZYB 2XKNB 3QXTA 5KSVA 3CVHB 4NQCE 1JP5A 1WZKA 1FH5L 1QBLH 2F8XC 1MI5E 3RZCC 2NYYD 2PTTA 3LH2L 1MHPL 2DQDH 4Z76B 4MD4B 3FAWA 2W59A 4XZUB 1CL7L 1MF2H 1KCSL 2GIYA 3QUXC 1EZVX 3O4LD 2ATPA 2WINA 3B6SA 5EU6D 3VG0L 4IHOB 4OUUB 2EYSA 3G5XA 1VGKA 1MFNA 2VZSA 4QHKI 4CVZA 5FHBH 3MRFB 1M71A 4N1EA 4JE4B 4W81A 1CGSH 3MNZB 5BRZB 2VH5H 4PP1D 4RNRB 3LKPA 2ADFH 1R0AL 2VL4A 2YD2A 4OFPA 1MFCL 4PJBA 3ULVL 1U2HA 2UWEB 3CJJA 1OLZA 2D7OA 4CRPA 4PJ5B 1PQZB 3PIQA 1D5BA 1CXHA 4Y88A 5C70A 1B0RB 3Q6FA 4N0UE 5JNYB 3PL6D 4DAGL 3LDBB 1BD2B 5GGUB 5I19H 3R06A 3HUJB 2I60H 4HWUA 4NRYB 3IDXH 4LCYB 1MJ8H 2AP2A 5C0DB 4RAVA 3GBNL 3TO4A 1I85A 1S9YA 4HX1A 3BVNB 5MI0B 4KY1L 3WHE0 2AXGA 4D9QE 5GIRA 1IM3A 3OJDA 4YR6A 2WZPD 3LEYH 3AS1A 2NX5E 1ZEAL 2DQIH 2WMPA 4PRNA 4YDLB 4OT1L 4ELME 1IGMH 4H8WL 3MRRB 1G7HA 1IGYB 1Q9LA 3MV8E 3V95A 4OZIE 1IQDB 2YK1H 4G6ML 4PJCA 3SGJC 3W9EB 4UB0L 3ROOA 1TMCB 3IU4H 2ZUXA 1Y0LA 1FZJB 1WICA 4YGVB 4JO3L 4NQVB 4ZXBB 3CSPA 4FFVC 2AQ2A 1DBAH 1HWGB 1ZSDB 4NJAL 3S36L 3HAEG 5I76A 1RZGA 4G6AD 2Q1EA 2ORBH 2VQTA 4ALAH 1OAUH 3LAFA 3SKJL 1J1OL 1CXIA 4IOIB 2BNRE 4ZYKB 4R3SB 4HXAH 4FMKA 3QSKB 4QRRB 3QRGL 4Z7OE 5FHAH 2OZ4A 2AAVA 4XT1C 2VDMH 1R3HB 1QLFB 2XY1A 1HHJB 5D93B 2X42A 3MGOA 5C08E 3K4AA 2ZJSL 1MJJA 5EA0L 5I1DB 3TBYB 3G5ZA 1ZK9A 3HLAA 5IOPA 2WQRA 1G9MH 3BKYH 5I6XC 1N6VA 4YHOL 3UJIH 1NGXA 1HILA 3CUPB 3DX7A 5DJ8A 4U6VH 5HGDA 4FQIH 5MP6L 4LNRB 4KUZL 4XCEA 1K4DB 2Y06H 4KXZH 5JPMA 1KCVL 5DEFB 1MVFA 3HCVB 4CU7A 5D7JC 4YDJA 3GM8A 3IU3A 4DN4L 3MOBH 1RIVH 3FJTA 3NFSL 5BJTA 2P5ED 2XACC 4HUXB 5E2WL 3OKOA 3VFNB 4X5WB 4NNXA 5AAWA 3N9GH 4E5XA 4X98A 2FYYA 1QPXA 2BSSB 3BPCB 3MV9B 5DLMH 4LRIC 5L0QB 3CZFA 5DI8A 3V4UL 4QHUB 5HPMB 2Z35A 4ZTOL 2XPGA 3V4PH 2I5YH 4JPWL 1AKJB 1JJUA 1KLFA 2JCCF 3MGTA 4R0LB 5D2NB 5HTSA 5L6YH 1RURL 4FQCL 4NYLA 5K9JL 3ZKNC 4E42A 2AW2A 2VLRA 3M1BA 1X7QB 4PJ9B 4C57C 2E7LA 4KHTH 5D4QA 5DRWB 2YSSB 5E6ZA 4P2QD 1QSFA 4RMVA 5ADPH 1R5VA 4GRLC 5I1LA 4XCCL 3MODH 5I1HL 1MFAL 3IS1X 3O6MH 1NEUA 1EGJL 4K7PY 3TV3H 1CR9H 1EHLH 2F54B 3SKOA 4J4PA 2ICES 3VXSA 4X6EB 4UNUA 4OBSA 3S88H 3HMXL 4GG6E 3S34L 4ZFOA 3I6GA 3OG4B 2FZ3A 4Y19E 1HCFX 2AGJH 4B41A 35C8L 4YDVB 1A9BB 5IBTL 1NBYA 3OXSB 3VFMB 3PUCA 4DEPC 5JDSB 2MHAA 2PYFB 2HFFB 1IAMA 2IPUK 4OFDA 4ZAKA 4WRLA 4PGEA 1DTUA 4N9OB 3MCKB 4BM7A 3QT2A 2BVPA 2LTQB 4H26A 1QSEE 1ZHLA 4QKXB 4Y5VB 1EEQA 1UCTA 4JFXA 5C0JA 2WQ8A 4KQ3L 2CIIA 1R3IH 3BHBA 5IKCA 3STZB 4FP8L 3B5GA 2HJKB 3DRQA 5C0ND 1H5BA 5C9JB 3EO9L 5ACZA 1XGTB 4WIQA 1QFUL 3VFWA 1A7PH 1V8HA 4RFNC 2DLIA 5D6CA 2BVOB 5D1QA 2Q8BL 5C0BA 3WIHL 5DMYA 4J1UA 1Q0XH 4K3GA 4POZD 4GH7B 1DFBL 1KTRL 3T2NH 2KH2B 1W72A 5IK3A 5IJKA 1ED3A 5EOTB 5JMRA 3QUYB 5D70L 1BFVH 3BGFC 5FK9A 4LAJH 2VTFA 3HC3L 1Z3GH 3LQZA 4RIRA 1JGDA 5FB8A 3I3DA 4MX7A 2ERJC 3C2SA 4Z7UE 3CLFH 3K8KA 1EAJA 3Q1SH 1YMMD 5AD0B 1QPPA 2Y4SA 4P2RA 4K7FB 2NW2A 2O5YL 4I0PA 4MNGA 1EHXA 5EBLA 5C0CE 2PTUA 3GMLA 1IGJA 1MHHB 2JJTC 3OHXA 3VXTA 4QHLB 1R5WB 3FTGB 5CD5C 3B9KD 4JFOA 1IRAY 5T1LD 1A1NA 3TJEL 1QUNA 3UBXI 3ARPA 1FJ1A 1MCKA 1UENA 4L4VD 4XVUC 1G9EA 3BZEA 3OKEB 2CRYA 4OZHB 3TFKC 4P2OB 4FN0A 3F7YA 4QY8B 2RQ8A 1AO7E 5IVXF 3O8XA 2YEZB 4OCRH 3PQYD 4WI4A 3ULVD 1KJ2B 4Q9RH 3E6HB 2ADIB 2EIEA 4U1NA 1MJ7H 2YPKB 3O6FB 3G04B 1WZMA 3ZKSD 1E4KC 1SY6H 1I7UA 3HPLA 3MFGB 4JZJC 5GGQH 4EUPA 4YHNB 4LSRL 3BGMB 5ANMA 2BMKA 1YPZB 1TJIH 2OI9C 4JJ5B 5JPNA 3QWOB 1HXMA 4XNXL 5DD3H 2B5IC 2QLVB 1I3RA 5DJDA 5DHVB 1K3IA 2VXVL 5HGBB 5F97E 4GQ9L 1KEMH 1JNLL 3MRHB 1GOGA 1WWBX 4XNZB 4RGNE 4JPKH 1VA9A 1U95B 2VR9A 4WDIB 3UTPE 1G7LB 4IOFD 2O5ZL 5IEKB 4PRDB 1CL7I 1LP9F 4HF5H 4XC1L 1AP2A 4JFDA 3DV6B 4X0KA 3MLUL 3UTQB 1CXFA 3SKUD 1T0NB 4PLKD 3C60D 3UTTE 2NZ9D 1BOGA 2ITDB 1LGVA 2NMSA 4H20L 1BZ7A 4G80A 4BZ2H 2P8LA 2OZ4H 3AY4C 2FIKA 5IHUH 1UXWB 3L5JA 4WUUA 3WJLA 4GAFB 4BELD 4D0DA 1XIWD 2PKDA 2QSCL 1IGIH 3FN9A 4WUKH 4YX2H 2R0KH 2XWTB 4RFOH 2Q8AH 4GW1A 5DYOA 1ROWA 3MREB 2E3VA 1F4WL 2ZUQB 4G9DB 3SDDA 1KXTB 2EE6A 1RUAL 2R0WH 3HZYA 2XKNA 5IROA 4CN6A 4YO0B 3QI9D 3CVHA 4ZUUB 3KLHD 1HHIB 1ZTXL 4KVCL 1FGNH 4NHCH 5CEZE 3FONB 4Z76A 4MD4A 4FQ2H 4N0FB 4XP6L 4Z7VB 4OGXH 4XZUA 2XG5A 4FQXB 1G6RL 2A1WH 3CXDH 2F19H 3ZT5A 3UZQA 1PG7H 1X5GA 4IHOA 4OUUA 1B9ZA 2FB4L 3CH1B 4YXKH 3TZVD 3MRFA 5FUCE 1D6EB 3MNZA 5BRZA 3OJ2C 1FORH 4RNRA 1HDMB 4LGRB 5DRNB 1YNKH 4Q9QL 1ZHBB 4WFHD 2UWEA 4GBXB 2APTA 5HI5D 5IB2B 4YPJA 4MCZB 3FQTB 1PQZA 4PJ5A 1B0RA 3FHAA 2DI9A 5JNYA 3LS5L 4TVPH 3CFCL 1BD2A 5GGUA 2QHRH 1DBBL 5SX4I 3HUJA 2VDQH 3QIBD 4LCYA 4JR9L 5C0DA 2AEWA 5IMMB 5ISZB 3EBAA 2DM2A 3CFBB 3BVNA 2NTSP 6FABH 2DKMA 2OS7A 3VE0B 3Q6GL 3E3QE 1GGUA 2QL1A 5JQ6L 1YY9D 4JFZH 1XGUB 2F8VA 4K9EC 5E2UH 2DD8L 2VYRE 3MRRA 1IGYA 2YA2A 1N4XH 3JSSA 3F7RA 1V3JA 1P6FA 1IQDA 2W9LA 4OLZH 1IKNC 4WI9A 2QTEA 3NOIA 4WEUD 7CGTA 3W9EA 1EJOL 2FR4B 3HI5L 4R90H 3IDYC 3NIFF 4M1GH 4RMTA 1FZJA 1QNZL 5DFVC 3RWIB 3GMPB 1WAAE 4YGVA 2X10A 2A6IB 2IANE 2R8SH 5D2LE 5F88B 4NQVA 1GGIH 2KZ1B 4HWNA 4ZS7H 4ZXBA 3C87A 3DWTA 1ZSDA 3B43A 3SDYL 3BKJL 1A0QH 4GAGL 1BX2B 4IOIA 3W39B 3T65B 1E6OL 4MAUH 1BZQK 4R3SA 3U9PL 4ZYKA 4EXPX 1U6AL 2NY3B 2OL3B 1LO2L 4KFZC 5JW4N 4ODVH 4PLNC 4QRRA 3SDAB 2AJUL 1QVOA 5IESH 3P11H 3HMWH 1RUKH 4P46B 4P5TD 3UYRH 3UBXG 1A5FH 1A3LL 4M48L 4KAQH 1R3HA 1QLFA 1HHJA 3GSRB 4WV1B 3DETD 3DHJA 2ENSA 3BWAB 2NY4C 4KI5F 3T0EB 1RUPH 3WD5L 1U93B 5CEXB 3MV01 4RDQG 5I1DA 3TBYA 3RPIA 2E7CA 4K8RC 4DKDC 3TYGL 1JF1B 1F4AA 5GJSH 4XP5L 3GO1H 4KC3B 1CDUA 3CUPA 4NWUH 4WJ5B 4JQVC 4WHYH 1RULH 4MD0B 3BUYB 4APQB 4LNRA 2G60H 5D7SH 2QJDA 4BQCA 1K4DA 5GS2D 1A02N 3MZTA 5DEFA 3HCVA 3NH7H 4FZ8L 5JW3H 4YK4B 4NBZB 2IBZY 3IFNL 3T3PF 4HUXA 1Y6NR 3VFNA 4X5WA 3GI9L 4XHQA 1EO8H 3HAEB 2BSSA 3BPCA 3H3BC 3MV9A 4IS6B 4PGDB 1F45A 1Q9KB 2IQAB 3L7EB 4GMTH 5FM5O 5CZVH 1KEGL 5IG7B 4QHUA 4EN3D 5HPMA 2Q7NA 5JA8B 1P4BH 1CTNA 5ICZB 4PJCF 5HI3D 1AKJA 2AI0L 3WLWC 4I0CC 1DANU 4NBXB 3FQRB 4R0LA 5D2NA 4OIAA 2KL6A 2QADD 4NT6B 5HVHB 2R2CA 5HHVH 2B0SL 2H3NB 2HRLA 3RP1A 1X7QA 4PJ9A 3CDFA 4LVHB 5DRWA 2VLJD 2YSSA 5GS0H 2APBA 4UILH 4LASH 3K4ZA 1GYAA 3EHBC 3ZDYF 3GSXB 5ICYB 2E6PA 1AXTL 2F54A 1NL0L 1VADB 1A3RL 4Y4KD 4X6EA 5GGTH 2DTML 1N64L 4X7DC 2Q87A 3RGVC 2UV3A 4R9HA 4YDIH 3OG6B 1MQKH 4X7EC 2CR6A 4V1DD 2DTSA 1YECL 4OZFG 2YMXH 4TSBH 4YDVA 1EFQA 3QA3B 3OXSA 3VFMA 4IRZH 3NN8B 5JDSA 4PPTA 2PYFA 2HFFA 3WNOA 1JYWA 5FO7B 1KGCE 1KNOB 3WXVH 5F1IB 3CXHK 4KKLD 1LDPL 3MCKA 4MNQE 1AFVH 3EOTL 2F74B 5CBEB 2PCPB 3LIZH 3Q0HA 4LPYA 4G3YL 1T0PB 3PXHA 1KJ3H 4Y5VA 5GRXG 4X6DB 1T7VA 4L8DB 5CJ8A 3EIFA 3RTQD 3FO1B 1EK3A 3AXLB 5I74B 4XC3L 1S3KL 4PRIE 3STZA 1RUQH 4JFEB 5FM4A 3KJ6L 1I8LA 2NY0B 4H0HB 5HHNB 2HJKA 4ZNEA 1IC5L 5C9JA 4M5ZL 1XF3B 3H9ZA 1TFHA 5EPMB 1XGTA 5EZIL 3MLZL 4WWKC 4Y5YB 3VCLB 2A6DB 1MFEH 4XMLH 2BVOA 5J3HD 1HYSC 1KB5L 5HJ3B 1KIPB 3VH8B 5TF0A 4KUCF 4DFIA 2DLEA 5C0GB 3ARXA 1XGRB 5L7XL 1QSVA 5EOTA 3QUYA 3AB0C 4LHUB 3MLRL 1KTDB 2AJSH 1IEHA 3CZJA 2XZZA 3VGAB 5ESVB 2YXFA 5FECB 2NY6C 3W5MA 5CWSB 3HPJB 2AK4B 5AD0A 4K7FA 2JELH 1HH9B 4P23B 5HSFA 3INUH 3GDBA 1VESA 4YUEH 1MEXH 3BEVB 1CFNB 3O2VH 4KK9C 5E5RB 3BH8B 3VW3H 3AM8C 4PJIB 2O93L 1MHHA 5FYJE 4QHLA 1R5WA 3FTGA 3MJ7B 4H88L 1PKQB 2W0KA 4JHWL 1WFUA 5T3XL 1WIPA 5E8DL 2V9RA 5MEQB 2DOCA 1LEGB 3O9WD 3OKEA 4OZHA 3QUKB 4EKXA 4P2OA 2CUMA 3GHBH 4GRMB 1ZV5A 3HE7C 1NLDL 2YEZA 4HS3B 3H3PH 5C0EB 1KJ2A 3E6HA 1J0JA 2ADIA 4LMQE 5FGBA 2YPKA 3O6FA 3G04A 2PO6B 4EDWL 5EC2B 1H5BC 1OAZL 3O4LB 3MXVH 5EU6B 4PRBB 4YHNA 2APFA 2B4CL 1IC4L 3BGMA 4S1RL 2O5XH 1YPZA 4JJ5A 3IJHB 4Y1AD 4YAQB 4KV5F 4TRPL 5ID1B 3QIWD 3QWOA 3GSNL 5DURD 3BESR 2OR8A 1OAKL 4MHHI 4K94H 4HULB 4S1QH 2C3XA 3DVGB 4KPHL 5DVLA 5HGBA 1RVFL 3GJFB 2XKUA 4PRPE 5CZXD 1UC6A 2EYRB 3MRHA 4M8VA 5E56A 3V6OA 4LLDB 1Q8MA 3PL6B 3JVGC 1U95A 4LP4A 2GW5A 4WDIA 2B1HL 4NP4L 1KENL 1G7LA 5IEKA 4PRDA 3MJGX 5DR5H 3MLWH 5DRZB 1RIHH 3U4EB 3DV6A 5GGVH 2IAMD 1NAMH 2GJZB 2WBKA 4PYGA 4JKKA 3UTQA 3VD9A 1T0NA 3ARUA 3H42L 4Y2DC 2ITDA 5F3BB 4XVSL 2FHBA 3ULSB 2VZVA 2E9BA 4EOWL 5CIPA 1F4XH 1UXWA 1IT9L 4ZO9A 2VKXA 2XWTA 5F70A 4PJ8D 3MREA 1MCDA 1TQBC 4LVOB 4G9DA 1AI1H 5D71H 5EUOE 4YO0A 2XV6B 2YPVL 3MR9B 4ZUUA 1HHIA 1NGYB 3SDCD 2QR0B 1CVRA 1IAOB 2NY5C 3VA6A 3FONA 4LRNL 5FYLH 1Z2KA 1INEH 1FNAA 4N0FA 4Z7VA 3PNWB 1NUNB 1KSRA 2VXSL 5J57B 4OCXH 3QCUL 4Z95H 2UVEA 5FA3B 1OCWH 3CH1A 4UDUB 1D6EA 1QFOA 1ULVA 4JVPA 1E6JH 4N1CA 4BQ6A 1H3PH 1HDMA 5E8NB 5JZ7C 5DRNA 4IRJD 1ZHBA 4NIKB 4OAWA 3CFKB 3GKWH 5EOCH 3L3DB 3PGFL 5IB2A 5K93A 4MCZA 3FQTA 3BD5A 3QP3A 1RZKC 1S7WB 2BNQE 3SE8H 4U31A 2N7AA 1OVZA 2F5AH 4H1LB 1F3JB 3LEVH 3DO7B 3D1MC 3CK0L 3B4NA 4HS6B 3TP4A 3GNML 4WW2A 5IMMA 4DW2L 5ISZA 3CFBA 3QUML 1AXIB 4ONGL 1I9EA 3J7HA 1Z6JT 3FB6B 1S78D 2OMBA 3VE0A 3B2VL 1S5IL 1BQLL 2EEDA 3NBNA 1QKZH 4UINL 1PZUB 1MJUL 1XGUA 4ZSOE 2N7BA 3KPTA 3VI4E 4HXBH 4I8DA 2DM7A 2QSTA 2AKRB 3NCYS 4R8WH 2EEAA 5ENWB 3TBSB 4I3RL 4KROD 2FR4A 3L5IA 2NY2C 5SV3A 1YYML 3RWIA 3EJZD 3GMPA 2A6IA 3WV0A 5F88A 1UWXK 4PY8J 4L3EE 3R1GL 4DKEH 4KHXH 3NABH 5F96H 5K59F 4XNUL 3VWJD 3BO8B 4R2GD 3SOBH 4XPFH 4M7LH 5JW5B 1ZHKB 2R56L 3UTSE 1BX2A 4C56D 3W39A 3T65A 5K9OA 2OL3A 3TO2B 1A7NH 1QBBA 1T5WB 3FCTB 1JCKA 4MB3A 2UVFA 4P46A 1OM3L 2YD9A 1HZHH 4PJ7B 1UZ6E 4P2QB 1TZGH 2IALB 2RCSH 5GS1B 3GSRA 4WV1A 3BWAA 4G8GD 4KQ4H 3T0EA 3MTRA 4XBEL 1U93A 3S4SB 5HYSG 2I26N 4NZDA 3TESA 3IVKB 4KK8C 3VG9B 3BDBA 4XXDB 3ARBD 4PGCB 1JF1A 3ARYA 4TTGA 1FHGA 5J11C 3AMLA 4YHML 5C86A 4X9GA 1YQVH 2R4RL 4WJ5A 4RBPH 4L1HA 2DIBA 4MD0A 1IILE 3HUJF 3BUYA 4APQA 3LN5B 3H9SE 3D69B 2H6PB 1HWHB 5D6DC 1B88A 3KLHC 5E99H 3STBA 4NFDA 2I07A 1JNNL 2VO5A 2R0LL 3BPNC 1WFTA 4PUBH 2E5EA 3KWWB 4J3TA 1MCBA 4ZPTB 1J12A 5EO1B 3HAEA 1AHWB 3CFDB 3BMWA 4IS6A 4PGDA 5KS9A 1Q9KA 2IQAA 1ZANH 3L7EA 5IG7A 1NGQH 3VA2C 5ICZA 3JWOH 4HWEL 1IQWH 4QHMB 2PYED 2VR4A 3FQRA 3ARFC 1C5CH 1QBLL 3UBXB 4NT6A 2H1PL 2MTPA 4FXGB 4D9QD 3W11C 4R4ND 3BRFA 2H3NA 2AV7B 2EICA 3ZHLA 2NX5D 2VZTA 1MF2L 5JW4M 3BW9B 2VB5A 1J0IA 4QXUH 1DN2A 4BFGA 3GSXA 3NVQA 5ICYA 1FNSL 5ITFB 4O00A 5FHBL 1A6UL 1CGSL 5JXEA 1VADA 1YA5A 2VH5L 2HMID 5A3IC 1WT5A 4HIXH 3PV6B 1GAFH 5TQ2H 1OP5H 5TPWH 1YMMB 3H9YA 5DHVH 4BUHA 2UY6A 3QA3A 1HQ4B 5DMGD 3NN8A 5FYJU 5FO7A 3IDXL 1KNOA 3R4DA 4OCNC 3OKNB 2XQYG 3L3KB 1MJ8L 5F1IA 5I73C 4GOSA 1CQYA 5EORH 1YZZA 2JB5L 2H32B 4D3CH 2F74A 4MA8H 1T89C 3B9KB 5CBEA 2PCPA 5T1LB 5IQ9B 3FFDB 1FPTH 3F6IA 2DQIL 1EUTA 4L4VB 1MHEB 4X6DA 2ARJB 4JO4L 1B0WA 1TJGH 4L8DA 5E2TH 4YHYB 1IGML 15C8L 3WNNA 3FO1A 5C08D 3AXLA 3PQYB 1L6XA 4JFEA 4R0LC 3TC9A 3WE6B 5FIEA 2YK1L 5HHNA 1XT5A 2LU3A 5T3ZE 1D5ZB 4UV4H 1CGVA 1S7UB 1KACB 1XF3A 5EPMA 1SM3L 1VEPA 3P30H 5IMKB 3IU4L 5ABDE 5IGXH 4Y5YA 3VCLA 5CLWA 4D8PB 1RZ7L 2A6DA 1HHHB 4UOJA 3MLPA 3JTTB 4PG2A 5HJ3A 1KIPA 3LRSB 1BBJB 3VH8A 1DBAL 2A9NL 4KK6D 5C0GA 1XGRA 3MV7D 2V9QA 4DKAA 1L0XA 4M43H 4LHUA 4P99A 3EAKA 2CK0L 3N1MC 5C9KA 1KTDA 4W6WB 2XTJE 5HYJE 5ESVA 1WSST 1JWMB 5FECA 2FGWH 4NPYB 2VMFA 5CWSA 2VJXA 3HPJA 3IJSB 3C60B 2AK4A 4AT6A 1NC4D 4PG9B 1WZ1H 1HH9A 4P23A 3WFEL 5F7DB 3BEVA 4TQEH 2R9HD 1CFNA 1ES0B 2DAVA 3RPKA 1XIWB 3BH8A 1A3QA 2WV3A 4PJIA 3PF2A 3MJ7A 3UJIL 2A2QT 3GK8H 5F7FA 1K6QL 1PKQA 4YZFF 5SWZE 5KSAC 5F7HA 3RNKB 3QQ9C 3QI9B 5MEQA 4FQIL 1LEGA 1EVUA 3F7PC 2HJLB 1MCFA 4JANB 4GRMA 3NGBB 2UZXB 5JXAL 1KFAL 4HS3A 5C0EA 3NIGF 2IEPA 3BZDA 3MMEB 3MOBL 1RIVL 2HH0H 2PO6A 2X4PB 4JFFB 5EC2A 3O4LA 5EU6A 4PRBA 4B7LA 3T1FB 3QO0B 4WWID 5L2KA 3IJHA 4YAQA 3TZVB 5ID1A 1B2WH 2X1XR 1QHOA 4M4PA 3RAJH 2NLJB 3P2TA 4PRHE 4CBPA 5A2IH 1K9TA 1OT2A 3DVGA 3AS0A 4PJEB 3LS4H 4NCC1 4U1MB 4M62H 4GLRH 4OLVL 3GJFA 2BOBB 2EYRA 2J8UB 4LLDA 1U8KB 3PL6A 4JHAL 1T21B 2C3WA 1G9NH 3MOAH 4IMKA 3U4EA 3QIBB 2CJUL 4Y89A 5DRZA 3SGDI 2Y07H 2GJZA 4KHTL 3BP5B 4ELKB 1YJDH 5ADPL 5F3BA 3RY6A 5D7KD 3DARA 3ULSA 1FBIL 4NQEE 3MODL 4KRPC 2FNBA 3TV3L 1OTTC 1CR9L 1EHLL 1VEOA 2VOTA 2LQRA 1NFDB 3S88L 4U1HB 4AQ1B 3VRIB 3CDGB 4QGYA 3HNSH 2OR9H 3QPQC 5FFLA 1UH4A 3OR7B 3BOVA 3MR9A 5BS0D 1AQDB 1NGYA 3S9DB 2J8HA 2X4UB 1ADQH 2QR0A 2EDXA 1IAOA 1H8OA 3WFCL 5GSRB 3RIAK 3KXFD 3U4BH 3PNWA 2AK1H 1FV1B 4WCYH 3V6ZB 1REIA 3DO3A 3WO4C 2D7PA 5FA3A 2EIDA 3DSNA 5ITBL 4OZHF 5J13B 3OJVC 4YBLC 4UDUA 2ILLA 2GYSA 5E8NA 2EXWC 3ARTA 3TVMD 3VXME 1I75A 1A47A 2WUCH 3CFKA 3HAEH 1R3IL 3MLSH 4DZBB 1MCWM 3L3DA 4DVBB 5IV2B 5FYKE 3D9AL 4P5TB 1S7WA 1DP0A 3BPLB 3IRZA 3LN4B 4H1LA 1F3JA 3DO7A 2CUIA 2CXGA 4HS6A 5FUZL 4J12A 4PJGB 1IC1A 1RY7B 1Q0XL 3MBED 4G5ZH 3FZUC 1GHFH 1A6WH 3DYMA 1AO7D 2FJHB 3FB6A 5EO9B 2CMRH 5J12B 1XGPB 5D7LD 1Z3GL 4Y4FD 2HJFB 5I66B 1MIMH 3FFCD 3FMGH 5D9SB 1R3JB 4UBDC 4R4BB 1CDYA 1T22B 3CLFL 2VDPH 3MOQA 2Z93B 2AKRA 2WBJC 3Q1SL 1LMKA 2CXKA 2GAZB 5ENWA 4CVXB 5JQHC 3TBSA 3L7FB 1P9MC 4OFYD 7FABH 5I1IH 1H3WM 3HZVA 1HSBB 1MAJA 1LVEA 1NEZG 5E4EB 4HLZG 3TCXA 4JRYE 5CLTA 4EN3B 1EBPA 3GJEB 3BH9B 2ZWLT 3TNMB 3ULUC 5I1JH 3BO8A 3RWFB 5JW5A 1ZHKA 4RQQB 4Y16C 3CSBA 5LGJB 4M61B 5EU7E 2QADB 3VXUD 5L2JB 4Z7VF 5DC4B 3RFZC 3TO2A 1T5WA 3I6LD 3FCTA 4OCRL 4Q9RL 1QBML 4OCMC 1SMAA 3O41A 1NBVH 2VLJB 4PJ7A 1WVZA 4P2QA 3JUYA 4XAKE 1SY6L 2IALA 5GS1A 5CJOH 5GGQL 2CUHA 3S4SA 5KANI 3JTSB 4UQ2B 3IVKA 5IW6B 4FQJL 4TUOB 4UZGA 1NAKH 4QHKJ 4PGBB 4WW2C 5DD3L 4XXDA 4AY0A 4PGCA 1AGFB 4Y4KB 1FL5B 1X3DA 2FEDC 4OF6A 2XYCA 3QB7C 3QDAA 3MRBB 5HYEA 5DK2B 1KEML 5HHME 2I9TA 4V1DB 4JDTH 3LN5A 2IG2L 2H6PA 1U3HD 3FQWB 3RVWD 4M7LT 1KULA 1EHNA 4WW2F 2HT3D 5EFIB 2JCCE 5D7IF 3LPGA 2C3GA 3KWWA 5KSBF 4RRPG 2GHWB 3KJ4C 5DD5L 5C6PB 1M7IB 4ZPTA 1WUNT 4QXTB 4YPGB 5EO1A 1AHWA 3CFDA 5IHUL 3L3GB 1CYGA 2H26B 2BXZA 4WUKL 2DL2A 2F53D 4YX2L 5E2JA 4X9IA 1Q0YL 2Q8AL 3RTQB 2R0WL 4Z9KB 4QHMA 2VLME 4AEHL 3ALXA 3KHOA 5LAXB 1CFSB 3UBXA 2NY3C 4JY5H 4FXGA 4XGZB 3QCVH 4L9LB 3ZTNH 2AV7A 3AFLA 5HYSB 4FQ2L 3W81A 1AR2A 2HT4C 3EYSL 1FYTE 2A1WL 2F19L 3B2UC 1PG7L 4NO0B 3BW9A 5I9QB 3MCLL 4M7JH 1WWWX 3MRKB 2AJXH 3KLDA 5ITFA 4YXKL 1OP5K 3ALWA 4M6OH 2C3HA 3VWKC 3L1OH 2VKWA 1A6TB 3PV6A 4KJPD 2XN9E 4LLMB 2PETA 4Y5XC 2EECA 2J6EL 1YMMA 2YXMA 4QT5B 3MUGB 1J05B 3T1WA 1HQ4A 2AEQH 3GJFH 5JUEH 1NCNA 3OKNA 2FRGP 3L3KA 3OSKA 2DMBA 4YQXH 2H32A 1G6RB 2GI7A 3EJZC 3B9KA 3GSUB 6FABL 3C8DA 5T1LA 5IQ9A 2HVKB 3FFDA 4KKCC 4XWGH 3S8WA 5BMFH 3UPCA 3RDTC 4L4VA 1MHEA 2NY1B 4JRWA 4EQ2A 1VDGA 3NACH 2ARJA 3O9WB 3VWJC 5ESQB 3HFMH 2YN3A 4LSTH 3VXQB 3S5LG 1FNLA 5C2BH 1J1PH 3PQYA 1K2DB 3WKMH 3WE6A 3AU1B 4OLZL 5DJ2A 5HPOA 5DXWA 1D5ZA 1JI2A 1S7UA 5CHNB 5KS9F 2NXZC 1PZ5B 2FIRT 4ZFOL 4R90L 5IMKA 4Y1AB 1EUUA 3ZL4H 3ZZ1A 4D8PA 4MQSB 1HHHA 3QIWB 2R8SL 3JTTA 1GGIL 4ZS7L 4POUB 5I71B 3LRSA 1BBJA 3RA7H 3WJJA 4JFQB 1CXKA 2VE6B 3T77B 1OHQA 2ZNWA 3RWDB 5JOPE 3UYPA 2EDEA 3VD3A 3A6CH 4MAUL 2V2TA 4ZOBA 1NKRA 4ODVL 1JWMA 3V0AC 5ICXB 4NPYA 4R97C 3P11L 2BX5A 2IAMB 2N56A 3G6JB 5IFJB 1RUKL 2R69H 2DDQL 2VDRL 1NCCH 3BUTA 3C60A 3IJSA 2A6JB 4KAQL 5CGYC 4PG9A 4ETQB 3FO9B 1RUPL 3MUJA 5A2LH 3D5OF 4Y4HC 5F7DA 3RWEB 1RJCA 4ZO6A 1FO0L 1ES0A 4N9GA 4PJXB 5IIEB 4K23H 3E8UH 2WUBH 4F57H 3MYZA 4PJ8B 3Q5TA 5GJSL 3GO1L 2CQVA 1JI1A 4ESKA 1MIEH 4NWUL 5TE7H 4MA7L 3RNKA 3QI9A 5KANG 4F8TA 2HJLA 2RB8A 3SDCB 4YC2C 4JANA 2CKBH 5E6IC 2PW1B 2YD1A 1F42A 4LOUC 4K71C 5ALCL 1LK2B 3EW3B 3MMEA 2Y9RT 1OB1B 3IGAB 4FTVD 1CGUA 2X4PA 4JFFA 3VFPB 1TDQA 4LCUB 3C09B 4ENEC 3T1FA 3QO0A 4X6DF 1F11B 4PJAB 1LP9E 3L95B 3TZVA 4I3SH 5CAYB 4PG2C 3D2UD 2NLJA 5CZVL 5AZEL 3TPKA 4IRJB 5FYKU 4UDTB 4PJEA 2PXYC 3ZYIA 3QFJD 2Q6WB 4U1MA 3NZHL 2BOBA 1C5BH 3QUZB 3DI3B 4M93C 3KPOB 4X80H 1OTUD 2J8UA 1D3CA 1U8KA 1MCWW 3T2OA 1T21A 2RBLA 2D7TH 2D2OA 3QIBA 1V7MH 4JGMA 3BP5A 4WO4D 3DMMC 4ELKA 4MJ5B 2Y36H 3WFDH 1J0ZA 3HZKB 5I15H 4HBCH 5C09D 3CDCA 5IFAL 1NFDA 5T33L 4LVNC 4U1HA 5GGTL 3VRIA 3CDGA 1CLYL 4U7SA 1GZQA 2VZ1A 3OR7A 2ZUSA 1AQDA 4AH2B 2IFFL 2X4UA 3O0RL 2YMXL 1NCAL 4TSBL 3SCMD 4KROB 4DWHA 5GSRA 4PJIF 3LD8B 3K8LA 1BAFH 2KDGA 4NM8L 4JCLA 2PO6C 1FV1A 1PX3A 3V6ZA 3MJ9H 1G7IB 1AFVL 3LIZL 5FUOH 4R2GB 2UUDH 2BRRH 3OAZK 1XZ0B 3A6BH 1EGJA 4PV8B 5AWNH 4C56B 1T03L 1KT2B 3D3VE 1L0QA 4DZBA 3EDDA 3HMXA 4DVBA 1RUQL 3DI2B 5CJBA 5IV2A 4P5TA 4OLWH 1SJVA 3ZKMC 4RMRA 2Z31D 5DO2C 4ZFZB 1YC8A 2MKWA 5F7LB 2JJWA 3QH3B 4FQ1H 1AJ7H 1CLCA 3LN4A 3WUZA 4X6FB 5A2JH 1ZLWH 4KMQA 5EZOH 1MFEL 1F3RB 2ICCA 2XKSA 1BPVA 1DQJB 4PJGA 3TA3D 4X5XB 3O81A 3RY6C 2R1YB 5F21B 1B3JA 2E9WA 3NIFE 2D0HA 2FJHA 1ZHNB 2R29H 3OZ9L 5EO9A 3LPFA 3DGGB 4M1DL 1XGPA 4HDIB 1HE7A 4HIEB 4BQ9A 1MRDH 3N1PC 2HJFA 5I66A 5D9SA 2FECI 4J23A 1R3JA 4R4BA 1T22A 1QRNB 2Z93A 5C3LD 1RU9L 3C08H 3R0NA 4Q2ZB 3NCFB 2GAZA 3RVXD 4CVXA 3HN3A 3ZLQC 3VXPB 3L7FA 3NCEB 4DJMA 3INUL 2DMCA 1NGZB 2AQ1A 1GXEA 1HSBA 1I7RB 3O2VL 1TXKA 3K81A 1HINL 4U1GB 1ACZA 2DRUA 5IVNA 3O6LL 4RGMB 1KB5B 1U58B 4EN3A 3GJEA 4KI5E 5EG6C 3OF6A 3LH2H 1MHPH 1TNMA 3BH9A 3EYQD 3TNMA 3RWFA 4PJBE 3ME0A 4RQQA 2PYEB 1PBYA 3CAFA 1CL7H 2H32H 4L8SB 5KG9B 4M61A 5LGJA 4G8IB 5L2JA 2JJSA 3DSFL 1MAKA 3H3PL 1H8SA 2NX5B 2VLJA 3ARGD 4TVSa 2J5LB 3P0VL 3OB8A 1MFCH 3ELAT 1DVFC 2O5XL 3JTSA 4UQ2A 5INDB 5IW6A 5D1XD 4TUOA 5IEHB 3WNPA 3ZMRA 4OZIB 2OMNA 4PGBA 4PLJC 4OCSH 4JFHE 3T3PE 4Y4KA 1AGFA 5EZLB 1FL5A 4DAGH 4JGJA 2NPLX 5TQ0L 3MRBA 5DGRA 3SO5A 5DK2A 4QRUB 1FVCB 5DZOA 3AROA 4N8PA 1ZT1B 3JWDL 3WBDA 2YRLA 4V1DA 2L7JA 1VKXB 4PBWD 3FQWA 4NWTH 4KY1H 5KVFH 4PJCE 5EFIA 3SKNB 3MLWL 5GGVL 1NAML 5J9PB 1AXSB 4OT1H 4OZFH 1NEZB 5GISH 1M7IA 1RZ8B 3ARDD 4YPGA 3H2WA 1F4XL 3L3GA 1FGVH 2H26A 3GSNB 2BNQD 1TJHH 5B8CB 3KPQB 3RTQA 4PJDB 3ZDYE 5SX4H 4QOKB 3QDMD 4BZYA 5E7FA 4JO3H 4WENB 1GC1L 3BP4B 5LAXA 1CFSA 4M9PA 1HH6B 4NJAH 3S36H 1JIBA 4LCCC 1T83C 4HC1H 4XGZA 5F9AC 4L9LA 3IJYB 3T0XA 5HYSA 3T2PA 4M5YL 5HD8D 4KU1A 3SKJH 3E2HC 2C5DC 4OCXL 5HDOA 4Z95L 4NO0A 1OOAA 3MV7B 4ZD3L 3MRKA 1OCWL 3QQ3B 1NBZB 4G8FB 1RK0B 1PKOA 3GJFK 1A6TA 1DQMH 5EOCL 3ZKXB 5EA0H 5FOBB 3BAEH 2QSQA 2GY7B 4LLMA 1KN2H 2VZ3A 3QAZB 4QT5A 3MUGA 2IPKB 1NC4B 1J05A 3SE8L 2JKXA 2BJML 4YHOH 2MCG1 4X7CC 3VFSB 4JG0L 3LEVL 4JKLA 1J88A 1FAIL 1PY4A 2VSDA 4PJHB 5MP6H 3MRIB 3UTSD 4KUZH 1G6RA 5FA4B 5F6IB 3GSUA 5EN2B 4GMSL 2HVKA 4RGNC 3VMOA 4TVPE 1LHZA 4G7YL 3NFSH 3O9WA 5ESQA 4C4KO 1DUYB 5E2WH 1BREA 4G9FD 5TDPB 3VXQA 4LPVA 2A83B 5F9WB 1K2DA 3DXAD 1WITA 3AU1A 4XMPL 4JREB 4GRWB 4EXKA 4NN7C 3V4UH 2VLRE 1JGLH 4YIQB 3WDIA 5CHNA 3CC5B 4ZTOH 1PZ5A 4JPWH 4UUJB 4GG6B 4Y1AA 2CH8A 5C7XL 5LKNA 3QIWA 3MRCB 3F6LA 3WO3B 1A7RH 3NPSB 3H9SD 3T0WA 4JFQA 4KHXL 2VE6A 3QUMB 4EJ1C 5K9JH 1XMWA 5F96L 3T77A 4LAQH 4XP4H 1F58H 2BSTB 3RWDA 1H15B 3PHSA 5GGRB 3SOBL 3VXSE 2D0FA 2DS4A 5DD1H 1KIRB 4J3XA 4RDQF 1A7NL 4XCCH 4HEPG 1MFAH 5ICXA 4XVJL 5E7BA 1EGJH 2IAMA 3G6JA 3HA0A 3MUZ1 5BW7A 5IFJA 1UGNA 2A6JA 5T5NG 1D5IH 1TZGL 2RCSL 4OCYL 4ETQA 3TCLB 2FWOB 5FUCC 3FO9A 4KQ4L 1IM9B 5CJXC 3S34H 3RWEA 2YD7A 4X7SH 4TN9A 1FFPB 4PJXA 5IIEA 4Z7WB 4JJHA 4I13B 2ZKHH 5IBTH 4PJ8A 3S5LB 3OPZL 1C5DB 1Z9LA 4HAFA 1KLGB 1XEDA 4KV5E 1BFOB 2RGSA 5HYQB 2RFXB 2XNAB 5BS0B 3SDCA 2W9EH 1RHHB 4FMFA 5E99L 4OLXL 1PEWA 2PW1A 3KXFB 1LK2A 3IGAA 2VDKL 1OB1A 1I1YB 2Y25A 2BZDA 3VFPA 4YWGH 5GS2H 1A14H 1FQ9C 4PUBL 3VD5A 4LCUA 2D03L 3E3QC 2I25N 4FHBD 1HHGB 5F71A 5C0BE 1F11A 4PJAA 4QRPD 3L95A 4FP8H 3MPCA 3ULVF 1AQKH 1VHPA 4OIIH 1ZANL 4NN5B 1JPTH 4IRJA 3TVMB 4X5LA 2FL5B 4UDTA 2VZOA 1M7DB 4S1SL 2Q6WA 1ORSB 3MXWL 3RVVC 3QUZA 5MEPB 5MEOB 2GSGA 1AE6L 1Q72L 3KPOA 5HGAB 4AL8H 4S10A 2Q8BH 4EVNB 4HG4K 1C5CL 1L7TH 1DFBH 4TTDD 4H8WC 4P2RE 3EFDL 4MNGE 5AYUH 5TH2B 1EIBA 3HC3H 3MBEB 1GPOL 2GK0B 1H3VA 3EYOB 4LSQH 1DLFL 3PDGA 3X14B 1AO7B 1B0GB 1MCOL 4QXUL 4MJ5A 5HGGS 4XXCA 3HZKA 5D7LB 3UTZB 1FL6B 2P24B 4Y4FB 3BWUC 3FFCB 1Q9WB 2HFGL 2O5YH 3REVB 1H9VA 5E24E 3PWPE 4EQ3A 2YPLE 4OLYL 5TQ2L 3TNNB 4PV9B 3CU1A 4AH2A 4R7NB 5KVEH 5DQ9B 3NGBC 4OD1H 4E41E 3TJEH 3W0WD 5ANME 5EWIL 5FM5M 4S1DC 1JV5B 1G7IA 4D3CL 4U6HB 4MA8L 2G5RA 3Q5YA 5DRXB 1FPTL 1XZ0A 4OI9A 4PV8A 4C56A 2WP3O 3VXUB 3BEWB 4HKBB 5T1KB 1KT2A 1ZLWK 2FX9L 3ZTJG 1TPXC 1R6VA 3X3FH 5BQ7B 3BP6A 4XNXH 4J3SA 4P4RB 4RFEB 4UV4L 3DHMA 4JFDE 5F93C 4O58H 4ZS6D 3QH3A 4JVUA 2VXVH 4P4KD 4X6FA 3P30L 1TITA 5F6HI 5IGXL 4GQ9H 4G6FD 1FIEA 1MCEA 3P9WB 4PJEF 4JRXD 3KAAA 1U8QB 3EOAB 1H3UA 4FG6C 1DQJA 4U1LB 5EIVA 5IHLB 4X5XA 2R1YA 4WUUE 4LHJB 1X5JA 2O5ZH 4XBGB 3OTTA 4HK3J 1JHLH 1ZHNA 5FO8B 1JPFB 4XC1H 2WBWB 3DGGA 4KJQC 4HDIA 3UXFA 4OM1L 4HIEA 5KAQG 1CICC 1U3HB 2EDBA 4U1KB 1OL0A 3RWCB 4H20H 3U30B 1RJZB 2FGWL 1LQSR 5K59E 3SY0B 1U8OB 1QRNA 1ZGLP 2ZUUA 2QSCH 4Q2ZA 5ACLA 3VXPA 1WZ1L 5DTFB 4Z77B 4HCRH 2IPTH 1NGZA 1F4WH 5C0FB 5IB1B 4TQEL 3IFPB 1I7RA 4KVCH 2F53B 2ZUTA 1KB5A 1U58A 3NAAH 2X05A 3LMJL 1SEQH 2VXTL 4XP6H 2PYEA 3QXUA 2BHZA 5KG9A 4L8SA 5CSZB 4IBLT 4MQXD 4KJWC 4A6YB 3DX8B 4G8IA 1UH2A 4OF7A 4PJ5E 4OFKA 1N0LA 2C26A 3EOBB 2FB4H 1WBYB 3DPBA 1BD2E 1FZMB 2NX5A 1YC7A 1SYVB 3HUJE 3C8HA 3MJ8B 3U6RB 3GM0A 3OMZA 2PNDA 5INDA 3QCTL 4YXLH 1I9JH 5IEHA 2GK2A 4QRQB 3RZCD 3RAJL 4ZFGL 3LS5H 5EZLA 3BKML 1NCBL 1N8ZB 2DQUH 3CFCH 1BF8A 3ZYJA 1OD9A 4P3CH 4QRUA 1FVCA 2EXYC 2YKLH 3QUXD 2CR3A 4CMHB 1ZT1A 1U8MB 5D2LB 4XP1L 2Z91B 1VKXA 2J12B 5FV1L 4PJGF 4Y0GA 4OD2B 3SKNA 3Q6GH 4I1NB 1NGPH 1MRCL 3TEUA 5J9PA 1AXSA 4UIMB 3X11B 1NEZA 3DUSB 1P7HL 3L3OB 3S3JA 3SO3C 4BYHA 1F6LL 2VLKD 4HH8A 3GSNA 1R5IB 5B8CA 1W0WB 1F6AB 2VQ1B 4PJDA 3HNSL 4KK5C 5HHOD 4GO6B 4M02A 4QOKA 2HTLC 3BQUC 5ID0B 4P9MH 4QRRE 4NO2B 3BP4A 1ADQL 2IH3B 4ETYA 1HH6A 1MCPH 5F44A 3AREC 1DL7H 1U3ZA 5GGRY 3X17A 1PX4A 2EDQA 3FQUB 3IJYA 4MWFA 4UTBL 3U4BL 2QQQA 2AK1L 4GAGH 2CRMA 5LXGH 1U6AH 2DQCL 4TNWK 2GEEA 1KG0A 2HLFC 3MV7A 2AJUH 1NUGA 2WW8A 3RVUC 5J0BA 3QQ3A 3WDJA 4R7DA 1NBZA 2VDOL 3WN5B 4GSDH 4G8FA 3BSZL 4HGMA 1RK0A 5FYLE 4P59L 4KTDL 4D9RD 5A43C 1P84J 1QLRB 3WD5H 3AS3A 5FOBA 4WTZA 4FFVD 4F9PA 1YEFH 2OLDA 3VDAA 4DGVH 4QXGH 4X7TB 2HFTA 1NC4A 2HA1A 4XTRC 1PLGL 3TYGH 5KVDH 3RHWF 1EJ6A 1UM6L 4XP5H 4ZOAA 3VFSA 4G6KL 4PJHA 3MRIA 1JWUB 4PGZA 3TIDB 5FA4A 4FFZL 4G5ZL 4Q6IC 1GHFL 5EN2A 3UAJC 4OF5A 4W6YB 3U0TB 4FZ8H 1UWGH 4F15B 3IYLW 1A1MB 3OAUL 3IFNH 3VXRE 4Q7DA 1DUYA 3KPPB 5LCVH 5TDPA 1MIML 5SWSD 3VI3F 4K55A 2A83A 2W0FB 3GI9H 4I48A 2VUYA 4I5BB 4FTVB 4OLUH 1WCBB 5EBGA 5HDQH 5I8KH 3JV4B 4YIQA 5SX5H 7FABL 3CC5A 3MLYH 5I16B 1NLBH 3GIZL 1TENA 4NQDD 1K5NB 1P7KB 3F58H 4UUJA 4GG6A 3FOLB 1A6PA 3IFLL 1XF5B 4YHPB 2MWCA 3MRCA 3D2UB 2H41A 4HH9B 5D7JD 5JOFB 1YUHB 2F54E 3QFJB 3QUMA 5IW1B 3ECBB 2NXYC 4WFFD 5I1JL 2BSTA 5D1ZC 4IRSC 1H15A 5GGRA 4IM8A 1RMFH 3G5VB 1KIRA 5B4MC 4YH6A 4K9EL 4YZFE 5CJ5A 1NBQA 1KCLA 1AR1C 4KMTH 1NL0H 1T4KB 4WO4B 1A3RH 5C6WH 4WI2A 1M05B 3TCLA 2FWOA 1IM9A 1UH3A 4EIZC 1YNTB 1E27B 2HKHH 5CILH 5CBAB 3NIGE 1NAKL 2B1AL 5GRUL 2VLMD 5C09B 3I3EA 3GHEL 4Z7WA 4TUJB 1YECH 2XQBH 3ZKND 4MQTB 5DEZA 5I8OH 3LV3B 3MRPB 3S5LA 2Y5EA 2H8PB 4C58B 5EB9A 1C5DA 1KLGA 5HDLA 3QG6B 2NY1C 1V05A 2P43B 1BFOA 3SGKA 5HYQA 1IL1B 2RFXA 2XNAA 4GRLD 5BS0A 4JDTL 5IWLC 1LDPH 3SCMB 3V5DB 3GMNB 2W07A 3EOTH 2VISB 1KTLB 1RHHA 1TNNA 3UX9B 4ZNEE 3WS3B 3KXFA 2GY5A 5JMOC 5J7CC 4MB5A 1I1YA 3MLVH 5CINH 3RIFF 3WNMA 5TE4L 1T2XA 3T2QA 1HHGA 1GJIA 3EFFB 4XC3H 4JPVH 2KQNA 3KJ6H 1OAQH 3S3PA 5JIPA 1IC5H 4JN1L 4PP2B 3TVMA 3SE9H 4OD3H 4K8RL 2FL5A 2A9MH 5A2KH 1M7DA 1T3FB 2XZAL 1ORSA 1AD0B 1UZ8B 5MEOA 4OKVB 4LEXL 3JV5A 5HGAA 4EVNA 2YD5A 4PJFB 2Z31B 2YS4A 4U05A 1QO3B 1DEEB 5L7XH 1IGCL 1BVKB 2VXUH 3QCVL 1R3LB 4LKXB 1G0YR 1T7ZA 5TH2A 2DJ4A 3MLRH 3OKMB 3BZ4B 3PWUB 3MBEA 2GK0A 3DTXB 3EYOA 3X14A 1AO7A 1B0GA 3MRLB 1NC2D 2AJXL 2X1QA 4DOHB 2XXMB 4NZTH 5D7LA 1P7QD 3UTZA 1FL6A 3L1OL 2P24A 4Y4FA 3FFCA 3IDJB 1Q9WA 3G6JF 3REVA 5EUKB 2VLLB 3FKUS 4OZHE 5MEND 3S6CA 5HYIA 4K07A 3MBXL 1I4FB 4I9WE 4LU5L 4PV9A 3TNNA 5C3TA 1D9KB 4R7NA 5DQ9A 4OFYA 3BKCH 3LQAC 4PD4J 2AEQL 4PJXF 4JHWH 1RJYB 1Q1JH 5E8DH 3RY4A 4TULL 1UZ6F 1NUFA 2LAGB 1Q9OB 2BSRB 1GL4B 1JV5A 4U6HA 1CU4L 1NLDH 2GJ6D 2HT2C 3QO1B 5ERWB 4XWGL 5DRXA 2AXJA 4IJ3C 2Z92B 4M9OA 1HKLL 5LG1A 1I3VA 3PGCB 4EDWH 3NACL 2VERN 1OAZH 4HLZH 3HFML 3IKKA 3VXUA 3BEWA 4HKBA 4LSTL 5T1KA 1IC4H 3V6OE 1FNGB 4RMQA 5C2BL 1J1PL 1B4RA 4P57B 3QUZC 1XCQB 4TRPH 5BQ7A 4UTAH 5CD5D 1OAKH 3IRPX 1IZKA 3E6FB 4PJAF 3ARGB 4P4RA 2X89D 1D5XB 2ED7A 4CDHA 4KPHH 4R6UA 1RVFH 4XVUD 5D1XB 3ZL4L 1JHTB 3TFKD 1U8QA 3EOAA 1BECA 5J6HB 4U1LA 4MYWB 2J7LA 5E03A 1HHKB 4NO5B 3TT3L 3GUTB 1KENH 4XBGA 5F7KC 4KDTA 1NMCB 2EKSB 1E4WH 4P2CG 5FO8A 1JPFA 5DFWH 3Q5OA 5FGRA 1U3HA 3TT1H 1ZGLB 4U1KA 3QDJD 3RWCA 1U8PB 2P42B 3HR5B 1RJZA 4FXKB 3DUUB 2OR7A 3SY0A 1U8OA 3T0BA 2R69L 5C92A 3EZJB 1SVCP 3ZE2F 4Z7VE 5DTFA 3RBSA 4U1SB 4Z77A 3U7YL 1U92B 5C0FA 5IB1A 3IFPA 4NHUB 4LSUL 4NZUH 4QTIL 2YPVH 4EDXB 1O5DT 4URTB 5ETUB 2BNQB 2F53A 4K23L 3E8UL 2WUBL 3N50A 4JM2B 4C55A 4LRNH 4FNLL 4R4FL 5IBLC 3QDGA 4MVBC 2X7LB 1IZJA 3QDMB 4U0RB 3CNKA 5EIIB 3OGOE 5CSZA 3PV7A 4G7VL 4A6YA 3DX8A 3SGDH 3QCUH 1OQXA 1MCJA 5D8JH 2XZCH 2CKBL 3EOBA 5MHSE 1WBYA 1FZMA 4YFLF 1SYVA 5J06A 3ABZA 1YDPB 1I8MA 3MJ8A 3U6RA 4KZEL 5DMJB 2XWBB 3SDXB 5ISZE 1VGEL 3BZFB 2KPNA 5I8EB 4O2FA 1ZT4B 4QRQA 2BRQA 1FO0B 3H7LA 3BXNB 5JHDD 1N8ZA 4P3WA 3LKSB 3IAGC 1FP5A 1KB9K 3CK0H 5H2BB 1NCUA 3VGHA 1U8MA 5D2LA 4DW2H 2Z91A 5IFHL 5F89B 4ONGH 2LFGA 3WS6A 3TBTB 2D7TL 4OD2A 1KXQE 1BQLH 1JE6A 4UINH 4X4ZA 4NO3B 1MJUH 1S5HB 3A67H 4UIMA 3UTSB 3X11A 4YHIB 1OQOA 3DUSA 4F9LC 3L3OA 2Y36L 1DBJL 2XTJC 4JY4B 3RVTD 3WFDL 1CVSC 2ZZUT 1RPQA 4QYOB 4G9FB 1R5IA 4I3RH 1W0WA 1F6AA 3H9HB 2VQ1A 2G5BB 3DXAB 4HPYH 2P5WD 1YYMH 2R1WB 5ID0A 3FN0L 4FQHB 4NO2A 4V2BA 4DVRH 2IH3A 3R1GH 2QQNH 4XNUH 4UT9L 3FQUA 1BAFL 2R56H 5AEAA 3MJ9L 2P44B 3H9SB 4HKJB 3G08B 4K7PL 4QRTB 2VXQL 4X8JB 5BVJB 1RQ5A 5FUOL 1JZ7A 3MA9H 2BRRL 4XCNB 4Z8FL 3WN5A 3A6BL 5IUSA 1WTGT 1QLRA 4XBEH 5DFVD 1J7VR 2DI7A 3BDYH 1BIHA 3KPLB 1XR8B 4UNTA 4XAWL 4WW1B 2HYMA 4X7TA 4ORGB 2YRPA 4FQ1L 1P84K 3FO2B 2R4RH 2PTVA 3QXWA 5EZOL 1T1YB 3GBLA 2JJUA 5E2VH 1JWUA 3TIDA 5KS9E 2NTFA 3U0TA 4MS8C 4X7FC 1FSKC 1I1AC 1YYLL 1FNEB 2R29L 2R0ZH 2NY4D 1A1MA 2W60B 4EEEA 3KPPA 2AABL 3I02B 3TJHD 5SX5K 1Y6KR 3KPRD 1WEJL 5D96B 2W0FA 4K8RD 1UJ3A 4L1DA 4I5BA 3UPAA 4FTVA 4KKAC 4QXWA 1WCBA 3BT2H 4MJID 5IR1B 3F65A 2A77H 1IGFH 3JV4A 1Z0NA 5I16A 1OSPH 1RZKL 4XBPB 1H0DB 1K5NA 1P7KA 4QRPB 4DK6A 4HWEH 3FOLA 1XF5A 4YHPA 3AMKA 3D2UA 3EKCA 4PJDF 4Z78B 3GI8L 4HH9A 3KYMB 1P69B 5JOFA 1YUHA 2H1PH 3QFJA 3DVFA 4P9HC 3ECBA 1RIUH 4ODSH 5IW1A 1DBML 3ES6B 3HE6C 4N0YH 4JG1H 3QRFM 4F7MB 2ZNXA 3G5VA 1F5WA 3SHSA 4XRCB 1SQ2N 4UOW0 3IDUA 4NCDA 1FNSH 3F7QA 1MCQA 1A6UH 1TQCC 2P8MB 4NCC2 2L7UA 1T4KA 4WO4A 3BGAA 1M05A 2BCKB 5C2UB 1I3GL 1MCCA 5I1GL 3WLWD 3V52H 1YNTA 1E27A 5CBAA 3K1KC 1CIUA 3UDWA 2EC9U 1W0YT 5C09A 4OCSL 3REWB 2MPAL 4TUJA 2GQHA 4UAOB 3EUUA 3LV3A 2EIZB 1EERB 3MRPA 4X6DE 4YBQC 4DGIL 2H8PA 3QEQD 3QG6A 1IL1A 1SBBA 3EHBD 2JB5H 3QXAB 4F8QA 3V5DA 4JFEE 3GMNA 4PJHF 4NWTL 2VISA 5KVFL 1KTLA 2GTWB 3O3BB 1JPGB 2DB8A 4R26H 3WS3A 1C7SA 4FRWA 1TETL 3W0WB 4AEFA 5DS8B 4JO4H 3RGVD 5I75C 1G6VK 1MFDH 5GISL 1SY6A 2E8YA 4RMWA 4NZRL 2FBOJ 15C8H 3GMMB 1X5AA 3EFFA 1HCVA 5DGQA 1FGVL 1IKFH 1QLEL 1TJHL 4PP2A 5FAAA 5JIKA 4GRWF 5BVPH 5JW4Q 1SM3H 5FCSH 1T3FA 3LY6A 4XNYL 5IVOA 3U36B 1JYNA 1AD0A 4TSCH 1RZ7H 1UZ8A 3B8SA 2XWJB 4H25B 4OKVA 5EU4B 4J3VA 4PJFA 2Z31A 1QO3A 3WEXB 2A9NH 3D18B 3QQNA 1DEEA 4P4KB 2AK4E 4HC1L 1BVKA 1R3LA 2JIXD 4LKXA 4G6FB 4JRXB 4NBYB 4A6YH 2CK0H 2OTWB 3OKMA 1NAMB 3BZ4A 4LLYB 3PWUA 4OKDA 3DTXA 3SE4A 4KUCD 2HVJB 3D0LA 4PJIE 1VERA 3MRLA 5EU7C 3R8QA 3TPUB 4GKOA 1A7QH 3QISA 4U1JB 1EHAA 1PKQE 3STLB 4LQ1A 5C0AD 3L3JB 3IDJA 4WWKD 3WFEH 4DGYH 3FO0L 5H94B 5BV7C 4NUJB 4F7PB 1DQML 5EUKA 2VLLA 2YWYA 1HYSD 3KDMB 3BAEL 1KN2L 1YEJL 1D9KA 3FRUB 4ZPVB 4MQ7B 3GSWA 4M1CC 1K6QH 4Z7WF 1RJYA 3C5ZC 2JTDA 3O4LE 5EU6E 4NKMB 4KMLB 1MREH 4XCFL 2FO4B 5L2KE 1Q9OA 2BSRA 4L4TD 2NY6D 1RAMA 4AENB 4F37K 4LF3B 5JXAH 1KFAH 2J8OA 3QO1A 5ERWA 4PD4K 2Z92A 4JQXC 3PGCA 3ETBF 1ORQB 5I1EH 2VN4A 1FNGA 4KK9D 4P57A 4AG4L 1XCQA 4M00A 1JGVL 3LB6C 4CL7A 3MRNB 5JOEA 1ZLUH 1I8KB 3E6FA 2J6EA 5GHWL 3ARGA 4UT7L 1UWEH 4NDMB 1JGLL 1D5XA 1NJ9A 4OLVH 5D1XA 1TTFA 5H37G 3W5NA 3CCHB 1JHTA 1A7BA 5J6HA 1A7RL 3HE7D 4MCYB 4JHAH 1HHKA 1J11A 4NO5A 3GUTA 4YE4H 2EKSA 4LAQL 4XP4L 1F58L 3QUXB 2CJUH 1BM3L 3P9LB 2OK0L 2B2XL 2WNGA 1NPUA 5DD1L 4Z0XB 4Z18A 1ZGLA 2VDLH 2FEEI 1J0KA 2WLZA 1KXVC 3KYNB 1U8PA 2F5BH 1FBIH 3HR5A 4FXKA 3DUUA 3ZO0A 4KTYA 4X4YB 1YEIH 4HGKC 2FATL 1D5IL 1SEBB 4U1SA 3SPVB 1VFBB 3VXNB 1U92A 2VLKB 1LEIB 1MOEA 4NHUA 4WFED 4X7SL 2X70B 4EDXA 1MRFH 3CXHJ 1FL3B 1QFWI 5E95B 5ETUA 2BNQA 2BSED 2ZKHL 3QJFB 4IIQC 5KOVC 4Y8DC 3WFCH 4JM2A 4ZMAT 4NGHL 4Y2DD 5HHOB 2X7LA 3VFVB 5TDNB 5EIIA 3QDMA 2CD0A 1EFXD 2W9EL 4JKWA 4QHNB 1NFIB 1Z5LB 5IF0B 5ITBH 4LSSH 3GSQB 3HI6H 2HTKC 1HI6B 2DQGH 4MXWH 3NZ8B 4OQ1A 5LVEA 4YWGL 1BJMA 4O2CB 1YDPA 1A14L 2ZCLL 1U8NB 2XWBA 3SDXA 2ESVE 4BFBD 3BZFA 1NSNL 1ZT4A 3PWPD 2YPLD 3D9AH 1AQKL 1FO0A 1G7QB 3BXNA 4OIIL 3GSOB 4YXHH 1JPTL 3O2WH 4OB5L 2W91A 2X1WL 3LKSA 4E41D 1ZA3B 2W38A 5H2BA 5FUZH 1KTKE 4KVNL 4AL8L 3RNQB 1IMHC 4TNVK 5F89A 1L7TL 1WCQA 4CN1A 3NFNA 1CD1B 1XH3B 2Z0BA 2XI9A 4LSDA 3TBTA 5JZ7D 3LPWA 4K7PX 1U9KA 3S35X 5AYUL 3O2DH 4NO3A 1S5HA 3UTSA 3ZDXF 1CDHA 4ONHB 4YHIA 4LSQL 1B90A 4JY4A 3PP3H 3M17B 3V79C 3WYRA 5ACMA 4QYOA 2FX8H 4NN6C 4P49A 4G9FA 1II4E 5SWSB 3CMOH 4MAYC 3H9HA 3Q2CA 2G5BA 3DXAA 2ICWI 1TCRB 5TFSL 1FIGH 2R1WA 4LBEB 3O4OC 5I6XB 4FQHA 5KVEL 2A0LC 4OFVA 4OD1L 5K9QG 4PJ7E 4NQDB 1J8HD 3G6DL 4P2QE 3TN0C 3X3GH 3BP7B 1DEDA 3MRJB 1RZJH 5HVGB 3H9SA 5D7JB 3SDDD <