3WIIL

Crystal structure of the fab fragment of b2212a, a murine monoclonal antibody specific for the third fibronectin domain (fn3) of human robo1.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
213
structure length
213
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNFLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDFSLTISKLEQEDIATYFCQQGNTLPLTFGAGTKLELKRAEAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-human ROBO1 antibody B2212A Fab light chain
publication title Structural features of interfacial tyrosine residue in ROBO1 fibronectin domain-antibody complex: Crystallographic, thermodynamic, and molecular dynamic analyses
pubmed doi rcsb
total genus 54
structure length 213
sequence length 213
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wiiL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wiiL01
1T4KB 4PRAB 1YEGL 4ZOAA 4PJBE 3CFEB 2E6JA 2R0LL 2NNAA 4WU5A 5M95B 4D0CB 4M4RA 5FEBA 2LAGB 3VFTA 5DS8A 1U8MB 3AXLB 1BBDH 2P8MA 1QPPA 5DD5H 3TPKA 2CD0A 2VC2L 1JPFB 2ZG3A 4ZYKB 1PG7L 2VR9A 4F58H 1QSEE 5ID1B 1DBJL 4TYUA 5AAMA 2F19H 2XTJB 4PJEB 4YH6A 1CXKA 2JKXA 3OKEB 3N85H 4ZOBA 2A6DA 4FMKA 3IFOB 5TDNB 5FF6A 5FOJA 3REWA 5E2TL 2RQ8A 1URLA 4PJCB 1UG9A 3N06B 3RWIB 1P2CA 4TSCH 3D85A 3PWVA 3NA9L 4WGWB 1QA9B 3MYJB 3GSNB 2GJJA 4Y19B 1M7DA 4P4KD 5IB5B 1R5VB 4OFKA 5IG7A 1I3GH 3FHAA 1A8JH 1AXSB 4OZGE 5ILTL 4XVJH 5CP7B 1A1MA 4JFDB 4IMLB 2Y9RT 1FCGA 3S8WA 2W9EL 2B2XL 1QR1B 3GSOB 3L3OA 3SKJL 4NDMB 4GH7B 2P48B 4FABH 3L5IA 2NY0D 1AD0A 5T5NG 4QXTB 5IEKB 2V5RA 4PV8A 5LWYL 5DD1H 1I7UB 1RJLB 4ZO7A 1K5NB 4U1GB 2P45B 4HKBA 1YQ2A 3SGEH 2AJUH 4JM4H 3GDBA 3K74B 43C9A 4PGCB 4HAGA 1S8DB 2HWZL 1AJ7L 4L5FL 3BSZH 4OQ1A 3MYZA 1RI8A 1J0JA 1WBXA 1QHPA 2F74B 1KC5H 2PKDA 2NX5B 1BQHA 3V5DA 1CLYH 4AIZB 3V5HB 1JHLH 4OLEA 3NAAL 2UYLB 5T3XH 1F6FB 2GTZA 3FRUB 5JA8B 4R9HA 5TH2A 1O7VA 3NN8A 1NBVH 2J88H 1BF8A 4KJQD 4Q9QH 4G6JH 4XI5D 4LCUA 4M61B 3EDKA 1G7QB 3KR3L 2IH1A 3BUTA 2FR4B 5EUOE 1BGXH 5EULV 1L7IH 4LKXA 1CD9B 4MGXA 2ADJB 5DVMA 1IAOA 1KJ3L 3L3JA 4PJBF 3WNLA 1U95B 4YPGB 4G9DA 1OLZA 2VXTH 1A2YA 2F58H 5IFAL 3OKMA 5IHUL 1DSFH 3ARRA 1NAMH 3RI5F 4X7SH 1MVUA 5C0RL 3LIZL 5GGRB 1SJEB 4EOWH 3H42L 4H20L 5BJTA 3VFRA 5E9DE 4JO2L 4AL8L 5HYJD 5IW1A 3F7YA 3CVHA 2FX8H 3ELAT 2PW2A 1FFNB 3BPOC 4PJ8D 4OGZA 5BZDA 2R29L 3GIVB 3A67L 4R4FH 4HT1L 1F8TH 4HEPG 4HIXL 3AROA 4JFYA 4EI5D 3GBML 2XWBA 1BEYL 4OZGF 5EBGA 1JPST 3IJYB 1I75A 2YD5A 1JP5A 4PRHB 1GC1C 1AO7E 5IB3B 1KEMH 1YY8B 4L8SA 4YDIL 3NIGF 3UDWC 1YYLL 4IRZH 3OGCA 5AYUL 4UT9L 2VL5B 1MQ8A 3RL1A 2YUVA 2X4UA 2HYMA 4PJ8A 4YHIA 3DMMC 1OAXL 2I9TB 5FCUH 4Q0XH 1IL1B 2CSPA 4Q6IB 5E5RB 4XP6L 4Y5XC 4P46D 3RL2A 3FJTA 5C8JB 5JOFB 2LFGA 1DBML 1DEEA 2K1MA 1FO0A 4U1MB 3TC9A 3D9AH 4NQEA 3U0PB 3RWJA 1JRHH 5D93C 4C55A 5CJQL 2R2BA 1LEKB 5TFSH 4MAUL 4IRSA 1NCUA 4D9LL 3D69A 3H6JA 3VXPB 5IR1A 1CU4L 5HI4D 3V7MA 2GQHA 4CVXB 4GRWB 3IAQA 3U46B 3OSKA 3RBSA 4L8CB 2W9DL 3TJEL 2DYPD 3DROA 3BWUC 2VDNH 5LXGH 3U0WH 3K1DA 1NFDA 4ZPTA 3GI8H 3QDAA 3UPRB 4ODUA 4XP4H 1MHPL 5CSGA 3MSPA 5EUOF 2OMBA 2VXVL 2W92A 1WCBB 5M94B 1NGZB 5TE6H 2X9WA 4F7MA 4OLUL 5DK2B 3VD7A 1FNSH 2AQ1A 1KN2H 4OM0L 1F4XH 4XBGB 2NW2A 1NGWB 3IF1A 1MLBB 5MEND 4XGZB 4Z78B 1Z0MA 2DYPA 3UEZA 1PKQE 2FD6L 3T4YB 1BP3B 5CD3A 1N5AB 1P4IL 1OF2B 2XN9B 1DDHA 1I1YB 1YDPA 2UZYB 2PW1A 4GT7A 5IFHL 2N7AA 4Z5RB 3PWLA 3SOBL 3RGVD 2FEEI 2OZ4L 1W72L 3MRNB 3VXNB 4WW1A 5F8RC 4LNRB 1NMCC 1EJ6A 2P44B 3ETBF 2PO6D 3ZKND 3G5YA 5LBSH 4NO2A 3TH4T 3L3DA 1NLBH 1T83C 2J5LC 1OW0C 4PY8J 5ALBH 4TNVK 5JZ7D 1OT2A 3GKWL 4BFIB 4Y4FB 2FO1A 3LH2L 4IIQB 5HHXL 2IPKA 3TEUA 1QRKA 2ENSA 3AREA 4PGJA 5IMLA 3N1PC 3SDAC 15C8H 3RWFB 1J5OL 1EMTL 4NQDB 3MUZ1 4L4VB 5DJXB 1UENA 1A0QL 5LVEA 1V3MA 3LKOA 4FFZH 4OBRA 3WFBH 5E6ID 3JV0A 3BVNB 4NQSB 5TE7H 2AEPH 3MV7A 4MSWA 1BBJB 4X7FC 1B3JA 5C0DB 5D7IF 1H0DA 4ODWB 3BH9B 5GQBA 5C09D 4CU6A 2V6HA 3KJ6H 4PJGE 1UZ8B 3V52H 1IZJA 1KV3A 1BQUA 2H41A 1QO3B 1EFXB 4JRXB 4BQCA 4UQ2B 3VCLB 1QG3A 5JW3L 5ERWA 5JW4R 2KZ1B 4ZS7L 5IEHB 5EB9A 5JIIA 1FNHA 4TQEL 3FZUD 3WIHH 2ED8A 3FQRA 3DX9A 3IU3B 3PL6B 5E6IA 1JK8A 2CXKA 1OT1A 2IAMD 5BS0A 5E5UB 5TF1H 4F2MA 4WUKH 2B20A 5E2UL 1JWUB 3NBNA 5C0CB 5L9DL 2V7HA 5BO1L 4QHKJ 3H0TB 5ADPL 3ZKMD 1LEIB 4NO3A 3CSBA 2VLLA 5T1KB 2GITB 5JPNA 1A02N 5GJTL 1PKOA 1U8LB 5F3HB 1WVZA 5L2JB 5DD0L 3D1MC 3EFDL 4OCMC 1F6LL 2IANA 5JR1L 4ZMAT 4IOIB 2FJFB 3OXRB 3SDDA 4FQHA 1R5WA 1WT5A 5GS1C 3MRLA 5ISZE 2IAMA 1QVOA 5D1QC 3FCTB 4M8QA 4NKOA 5T1DH 4QRQA 1ZXQA 4JKPL 3T8XA 2NY5L 4Y0GA 4OCRL 5EU6D 2W0FA 1XIWD 2F5BL 2ATPA 2DQFA 1RZJL 1M7IB 3LVEA 3S3JA 1IGTA 3ES6A 4V1DB 4YFDB 4K3HA 1FGVL 4L9LA 3UJIH 5GS0C 3ROLA 4BH7A 4GW1A 2HT4D 4QO1A 4S10A 4JKLA 1CZ8L 1NCWL 2PETA 4M93C 1FLRL 3PWJB 3MV8A 3MODH 2WP3T 3IGAB 3VXME 3U7YL 3HKFA 1CGUA 5B4MD 5I0DA 3VXUB 1A6VL 2X1XR 3T4AB 2HRPH 4JREC 3O8XD 5EUKA 2BVPB 1Q1JL 3RU8L 5TQ0L 5CUSH 3P4NB 1I7RB 3CXHK 3WEXB 1XIWA 4AM0A 4EBQL 3VA2C 1Y6NR 2VZUA 3BH8A 5ELIA 3PWPD 4MWFA 1EEZB 5IGXL 4S1QL 5ID0B 1NAMB 4JCLA 2EYRB 1NANI 5KTEL 1DLFL 3LCYA 4DGIL 4PJ5B 5GRUH 1EBPA 4XTRD 3V6ZA 5GRZA 1DQMH 4PJGF 2NYYC 1S7RB 2PCPA 1CLZH 5MEQB 3H9HA 1IM9B 4FG6D 3OAYH 1GIGH 1IILE 1A4JB 5CILL 4NP4L 4Z7WA 4OD2A 5DMKA 3OAYK 3HC0A 4HIEA 1MUJA 4YHPB 3VW3H 4NQXB 3QUKA 1LE5B 5GGQH 3FKUS 4GQ9H 5IQ9B 4U6HB 3BPNB 1CL7H 5KANI 2YSSB 4MDIA 4X8JA 4P5KA 3B6SB 1ZHNA 4XX1E 5DJDB 4ZS6C 5DO2C 2YZ8A 3MNVA 1EEYB 5JOPE 5E8PA 5DYOA 4H1LA 3RY5A 1NMBL 3D2UA 3T3ME 3TBVA 5KVGL 4B0MM 4ZAKA 4X99B 3F62A 4U3XA 4WNQB 5B39B 3TVMD 1FPTH 1I9JL 1YMHB 3VRIA 4EI6A 12E8H 1MY7A 3PGFH 4G3YH 4LLWA 5I8EB 1JWSB 3D0LB 2AJYH 1IGML 4O9HL 4W70A 1KTKE 1P4LA 1P9MA 3B3IA 4RISH 1TTGA 3CZFB 3RAJH 3HUJA 1S78D 4OLVH 4ODXB 4RGNE 1ROWA 2UWEF 2CPCA 3BHBB 2JCCA 5EO9B 4F9LC 1MREL 3GSVA 4WFFD 2HFFB 3F5WB 3GRWH 2FRGP 2HFEA 2LABA 3CFCH 1I3UA 5B39G 4JAMA 1L7TL 3TN0B 4EQ2A 2EDFA 2FX9H 4OCYL 3KYAA 4NJAL 3T0EB 1F58H 4I9WD 2J6EA 4ODVH 2HFGL 4P57A 5JMOC 2Q7NA 4PJ7E 4X7EC 1I8KB 4YGVA 5L8JB 5IJKA 4WJ5B 2EO9A 1VHPA 1I1AC 1X7QB 5IJVA 4FQ2L 4QF1A 4J1UA 2DICA 1AQDA 4U1LB 3ZKSD 1A14H 3DUUB 4RAUA 4OKVA 5TGBB 1F3DJ 4X6EB 1T03L 2X09A 3N50A 3RWGA 2V2TA 1HSBA 1QKZH 5IBLC 5BW7C 4TULH 1HNFA 2FIKB 3LRSB 4XNUL 2JJSC 3IXTB 2NR6C 4FZEH 1RUAH 2G60H 1J1OH 4OFDA 3UBXA 5D4QA 1GPOL 3CAFA 1Q72L 4LVHC 2NPLX 4D8PA 1IBGH 3IJHA 1J8HA 1EAPB 3IDNB 1K8IA 5C0AD 3QI9C 1HHHB 2P5WD 1KJVA 1UM5L 2NY1C 3QIBC 2NXYC 1AR2A 4KHTL 3HRPA 4JFFE 2O61A 3QRFM 3C6LC 5FUOH 5GGRY 1D6EB 4E5XA 5H35B 1G0XA 4JFZH 4LQFL 3VXQA 1G9ML 1BM3L 1H3VA 1NCCL 3O2WL 4M5YL 4L3CA 3NABL 3GGWB 5DWUH 1A6PA 5DEGA 4CRPA 4QRTB 4TSBL 2QQKL 5CKGA 2HTLD 3HE7D 5LQBL 1R3IL 2O26U 3QUZC 2OI9C 4XRCA 5BZWB 1MCDA 5F1IA 3T3MF 3MLXH 1NC2D 1SYVA 3UJTH 2JB6A 3GMRA 5FYJE 1RZGB 4U31A 5E5MA 5E08L 5JNYA 5J6GA 1ZT7A 2VMFA 3VFGH 5K93A 1AE6L 1SJHB 3CIQA 1PYWB 3EYSH 3RWHB 2G2RB 1UT9A 1MCWM 4YDLC 4S2SB 1QPXA 1XF5B 2D31B 3OR7B 3S96A 5DMGC 2H26A 1X5HA 3NH7H 2X4TB 1LO5A 2QHLA 3K80A 1W0WA 1UFUA 3MACL 3QP3A 3HE7A 4Y4HC 4PJDB 4AH2A 5JQ6L 1EX0A 1IC4H 3AM8C 3RVTC 4QRUB 5DHVA 1I9IL 5CEZL 5FOBA 3DVNA 3O4LE 4X83A 5FA4A 5SWSD 3VGAB 1HH9A 5F1NB 4NJ9L 4UU9A 2VLKD 4QHLB 4ZTPL 2BVUA 5KN5B 3CMOL 4FXKB 3SKNB 3VFMA 4IS6A 3V0VB 5DD3L 3KLSA 4JGUA 4Y2DC 3W39B 1XZ0A 3CX5J 4ELMB 1DL7L 2ITCA 3GM0A 3PQYE 5D7LD 3IDMA 3PWUB 1UB5A 1T1ZB 3AAZA 4JN2B 4V2CB 3DO3A 1OSPL 5KAQG 2Y5EA 5FKAB 1CTNA 4XCYA 1KJ2A 5B38A 1IKFL 3QCVH 3VE0B 1FH5L 5FYJU 3QEHA 4OAWB 5D2NC 4FFWC 2VLKA 3WS6C 3V6OA 8FABA 1MAML 3WNPA 4N0UE 5DMIH 4YAQA 1FNEB 1FL6B 5C6WH 5D8JH 4WGVB 3CD4A 1P69B 2ZOLB 2X4QA 4NRXB 2L7UA 5I18H 4LLMA 3MRRB 1S9VA 3B9KB 4UI2A 3NPSC 4JDZB 2CDGB 1DANU 3P73B 4MNQE 1F5WA 1R24B 3IS0X 4XNYL 4FQJH 3QUMA 4RBPH 5F7FA 1A21A 2DQJL 2GAZA 4ZNEA 4RBPK 5L7XL 4JLRB 3IJSA 3SQBA 3LKNA 1JZ2A 1IAIL 2OMNA 3NGBB 4N1CA 3RKPA 5D1XB 1KEGL 4M43H 3MJ7B 3OZ9H 4AG4L 5FHAL 3QNYA 3QJFA 5KVDL 2YA1A 2BNQD 3TBSB 5IHZA 3BZ4B 1KTLA 1T6WA 1D5XB 4G8IB 3MGAA 1I7ZA 3KPMB 4RFNB 1YECH 1WWCA 2X6MA 4X6DA 3P4OA 3ZDYE 1QYGL 1ZOXA 1UKQA 1EO8L 1MCQA 4ENEC 3A6CL 4RGMB 3MOBH 1R3JA 3BKCH 4OLZL 3I2CH 2X2YA 4E41D 1I8IB 2I27N 4OGYL 1MCEA 4S0SD 2ITDA 1T6VN 3EYVB 3G5XA 3VXTA 3BXNA 2BNQA 1ETZB 1QFUL 2YKLL 3HC3H 5GRJL 1REIA 3NCYS 4KUZL 4QLRA 1OAUL 3P3YA 2VDOL 3RVWC 3U2SB 1ZVHA 2H2PC 2VXUH 1VEOA 4KZEH 4G6FB 4U05A 5DLML 2R0KL 4GKSA 1GGIH 5DRNB 4GG6A 4MA7H 2BSSA 1OGTB 4UAOB 1MFEH 4DN4L 1ZA3B 5C0BB 1DN0B 4NKIL 3IAPA 2G9HA 5TDPA 4PJXE 4OIAA 3GJFH 1S9WA 1ZVYA 4PTUB 3V0AC 5CSBA 4PRNB 3GJFK 1IAIM 3LRHA 2AEIT 3C08L 1LILA 2N1KA 2ZCHL 1T7WA 4JZNB 2A73B 5TF0A 4KAQH 5F9OH 3DMMD 1XGPB 3DV6B 1NGPH 5HGDA 2ERJC 2H1PL 3EZ8A 4K71C 2Q3ZA 2VQ1A 2XZQH 1W0YT 2ZUUA 1CFQA 3GHBH 3PUCA 4OJFH 3TGXA 2A1WL 4YNYB 5FKPA 5JPMA 3MFFB 2PYEE 3W9DA 4BQBA 5J6HA 2FWOB 1J18A 3OKNB 3TIDA 4X7DC 3PXJA 3IDIB 3T04D 2Y06L 1ND0A 1YNKL 5I1JH 3P9LA 4JG1L 3QZWB 1YMME 2CMRL 3GUTA 3BGMB 4MB5A 3BP4A 4JO1H 4Y5XA 5A40E 1FRGH 3LKPB 1S5IL 4HF5L 5KSUB 3KJ4C 1NCDH 2IPTH 5J1AA 5DSCA 4MXVE 1FVCA 3GNML 3ZDYF 5C07D 5EA0H 4LVOB 4UZGA 2K7QA 4P23B 2OJZH 2YHGA 3JWOL 3M8OH 1XGTA 1NGQH 2GI7A 3O3AA 4BZ1L 5F8QC 2YUXA 4ISVB 3QZWG 3CLFH 4MCZA 1I1CA 4ZD3L 2GJ6D 4XBEH 2ZCLH 4KMTH 3DARA 4X8XA 3RIAK 1G9MC 4B41A 3LS5L 1U92A 4LIQL 5ITFB 3ABZA 5MEPA 3G5VA 3NCEB 4XNQA 4HBCH 2YN5A 2P24A 4ONGH 2C3VA 1QBLL 3BKYL 2V5SA 5K9JH 5E4EC 2GCYA 3C60B 3GMMA 5C07A 4QRRA 3DVGA 4LHUD 2ZUVA 1WISA 1KCUL 1EGJL 2C1PA 2BY2A 5DEZA 1JFQL 1BIHA 2YK1L 3TCXA 5CWSB 1MFCL 1UYWL 4GKNB 2GJ6A 4PJXF 4N0YH 4G5ZL 4PRIE 5CJXA 1OPGH 2VUOA 2EYSA 4U6TA 4QOKB 2WBKA 2OCFD 5E2JA 1DBAL 1QZ1A 4N8VB 3SDAD 5JIKA 3U9UB 4AEHL 3H3PL 5T1LD 1GOFA 1JNNL 1UACH 5FYLL 3V5KB 1KN4H 5BVPL 5ITBL 4ZFGH 1J05A 1WBZA 3T65A 7FABL 5K59E 2XKUA 5K9KA 3MGTA 1M05B 5DJ6A 2FX7H 2VSCA 4U7KA 1OW0A 2X1PA 3JV6A 1WZLA 5JTWA 1FZKA 3QT2A 5JW4N 2Z92A 4Y4KB 2XTJC 1IT9H 3X11B 3S3SA 5LCVH 5GSRA 4MCYB 3SDAA 4N8VG 1BBDL 2GK0A 5DD5L 5JW4M 2GTWA 5JLZB 3VDCA 1BFSA 1ZHBA 4HAFA 4F58L 5KSAB 2F19L 3WJJC 5KS9E 3N85L 1AGCA 3WXWH 1RJCA 1CE1H 1DBBL 4NKDA 3D3VE 4U0RB 3MR9B 4O00A 3QXDA 3MRBA 3I75A 3QEQD 4TSCL 3N1FC 3TO4B 1BVKA 2H6PA 4R6UA 2AP2A 3CK0H 1EO7A 4KH2A 3RNKA 5IVOA 2E9JA 1I3GL 4CVUA 1HIMH 5ACZA 4N0RA 1FN4A 4I48A 4XVJL 3V4VH 1AKJD 4NQCD 2AEWA 4N68A 4G43A 4U1GC 2BNUB 5D1QD 1WIOA 5IV2B 4FABL 3K2UH 3WNNA 1WFNA 2PXYB 3X13B 1G7IB 2VR4A 3MLYH 5H94B 3IKCA 1B4RA 5DD1L 1CG9B 3OR6A 1WAAE 2JK5B 5CEXA 2AXHA 3FO9B 4NSKA 1TZHB 3JBG7 5GS0D 4KWUA 5IMMB 1BVLB 5HHVH 2AJUL 4JM4L 4WI3A 3MRDB 3E8UH 2F15A 1KBGL 3BSZL 4FTVB 1KPRB 1IZKA 1KC5L 4N8CH 3SDXA 5GS1A 2X4SA 4MB4A 1CLYL 5D1QA 5BOPA 3KPQA 4LAQH 5T3XL 4OF3A 3MLUH 1WUNT 2J2ZA 4M1GH 5DVLA 3NCJH 3D18B 1OGAD 4P2QB 3TBYB 1NBVL 1PBYA 2GSGB 2J88L 3FN0H 3MQIA 2FB4H 1I3RB 2Y7QB 3H3BC 5HHNB 5EFIB 1JWMA 5JDSB 4HXAH 4XXCA 2P8PB 4LLDB 4UNTA 4X4MA 4CW1A 5K59F 1BGXL 3BEVB 1HWGB 3ESVF 1L7IL 1RK0A 4GMTH 4ZSOB 4KHXH 1H8NA 2ENYA 5F6HJ 1XR9A 3ZMRA 2R9HC 4CMMB 2NYYD 2E9BA 3UTPD 1M71B 2IFGA 1VGEH 2F58L 1DSFL 4CMHB 4GKOA 4YC2B 2DI7A 4PGBA 1NAML 2APTA 2CDEA 1F2QA 5IMKB 3SQOH 4KDVA 2XYCA 4EOWL 3GMOB 4P2OA 4CU8A 4ZO9A 2LU7A 4OCSL 2WIIA 4K7PH 2WLYA 2OK0H 3KHOA 3MV9B 4Q9BA 5KS9F 5KVEH 3GJFB 2CKBH 3LPGA 3ZHDA 2MCPL 2FX8L 4OV6F 1BIIA 2VWEE 2ICCA 4ZS6D 1MSPA 5DO2D 2ICWI 5DVOA 4R4FL 2XNAB 1F8TL 2DKMA 3MCLH 2YN3A 4ZOCA 3V8CA 1WICA 3H7BB 3D85B 3PWVB 5C08A 3GMLB 2VZ1A 4LMQI 2X44D 4IHOA 1EV2E 5DQJB 1M7DB 5D9SB 2NY4C 5E8OB 4Q6IC 3TZVB 1MHHA 3SE8H 4I4WB 4O51A 3VJ6A 2RB8A 3WKMH 4R2GB 1UM6H 1HI6B 3LKQA 3ZSSA 1RSFA 3HRZB 1INEH 1EPFA 1YMMD 4G6AC 5AZEH 1KEML 1JF1A 5C0EB 1A1MB 4IRZL 4KJWC 4AJ0A 5KZCD 3VFWA 3CDCA 1J9CT 4MAYA 3QDGE 4WTZG 1RUML 5FCUL 4Q0XL 3TH2T 4LCYA 1PVHA 3L5XH 1AD0B 1TDQA 4L29A 4PJ9B 4EUPH 2J8UA 1WAAF 2N4IA 3VGFA 5GRVK 1E6OH 4DVBB 3VMOA 1JTPA 1FVEA 4ODSL 4W4OA 3D9AL 2AV1A 3JWOC 3CDGA 2CIIA 1JRHL 4H88H 2A83A 4HMEA 1WBXB 5TFSL 4KDWA 5HHOB 1BQHB 3U9PH 2Z8VC 1L6ZA 2MHAA 3NOIA 1MCJA 4LHJB 1I1AD 1MJUH 2GTZB 4JFEB 5TH2B 5DC9B 1KLGA 2FYYA 2VDNL 1IQDA 3U0WL 4F9LA 2Y36H 5KVMC 5LXGL 3C8HA 4UINH 5HHME 3GI8L 3HI1A 3P4MA 4X80L 1GOGA 2A0LC 4DOHE 1HXMA 1G84A 3O45A 4P5MB 3UO1H 4XP4L 1NBZA 4OGXH 4X5LA 2B39A 5IBLD 5CBAA 2F53A 4QRPD 5T3ZL 4F33B 1TNNA 4XAKD 3WHE1 2BC4A 2NR6D 5CFHA 5TE6L 2IH1B 4BJLA 4WI5A 3FMGL 5IVXF 1BQHG 4WY7H 1MCFA 4X6FB 1F02I 1KN2L 1IAOB 4PRID 3L3JB 2X5PA 4NWUL 3QI9D 3QXAA 5T33H 3I50H 3EYFA 3JUZA 4L3ED 1G7MB 3EYOA 1A2YB 4Y16A 2NY1D 1KT2A 1QLEH 2NXYD 1NJ9B 4QEGA 3C6LD 1DUYA 1MVUB 1P53A 2PTTB 3GB7A 4G8GA 1W72A 4QRPA 2HAZA 5D2LA 4XPFH 3VFRB 2H9GA 5J0BA 5EBLA 4R7NB 1LK3H 3SN6N 4OD3H 4BSWB 4PJAE 3QXUA 3LRGA 3QUZD 4IIQC 5SX4I 1FCCA 2PW2B 3OAZH 3UMTA 1U93A 3I3EA 1WEJH 3OAZK 4L3EA 4LAJH 5LBSL 3KPRE 3MC0A 3QIBA 4JRWA 1NLBL 4YHLH 3UTTE 3WFHA 5ALBL 1HHGA 3P77A 2XWBB 3RWCB 2X4RB 3W11C 2FJGB 5DMGD 2DLFH 2BVTA 5K9OA 4MDJA 15C8L 4EIZC 2I07B 4Y4HD 1C12A 3OGCB 3RVTD 5EU7C 3RL1B 2X4UB 3EO0A 2BFVH 4MJIE 4YHIB 4FFZL 3WFBL 2Y6SC 2IPUK 4WUUD 4Z8FH 1DQLH 2AEPL 3FT3B 4Z95H 3ALPA 5F93C 5GJSH 5GS2D 5F3BB 1CDCA 3DIFB 1NH6A 1BD2A 2M26A 3Q5OA 3PL6C 1MCSA 4HUNB 4HDIA 5ESAA 2DTSA 1X5FA 3DGGA 4Y2DD 3KJ6L 4KI5E 3T08A 3V52L 4NQEB 4I0PB 1LO3H 3RWJB 4OI9A 1UWXK 3ZTNL 5HGGS 5L0QB 4ZFFA 4IRSB 1QEWA 2W0KA 2IADA 5IR1B 3QXTA 3WIHL 4LCWE 3QDJD 1IQWH 3X17A 2Z4QA 3RY6A 5TF1L 4RZCA 3WCYA 4FFWD 3IETA 5H2BA 1U58A 4F9PC 1NFDB 2PTUA 4ZPTB 1GZQB 4P3CH 5BRZE 4HUUB 4DFHA 3C5JA 4X98A 5KSBA 1L9NA 5C9JA 3WN5B 4HK3N 2VERN 5I19H 3KS0H 4RMQA 2R1YA 1AD9B 3KPLB 1HNGA 4F7MB 1EERB 4NM8L 3QDMD 4OCNC 5HDQH 1P6FA 4XAWH 4NRZB 4WFGE 5BOZG 1T3FB 3MLZH 3BJ91 2C7UB 3IF1B 5D2NA 3OXSB 3BPLC 3WS6A 1AR1C 5T1DL 3FO0H 3VFVB 4NO0B 3BYTA 1DDHB 4KDTC 4GAGH 2PW1B 5AG9A 1KIRB 4LPCA 4FFVC 3S98A 5C1MB 4PJAF 4MNHB 4KV5F 4RMTA 3UJIL 5GGSA 4WHTB 2LU3A 4J12A 4EN3A 4IM8A 1X4ZA 1FQ9C 1OSZA 3BMWA 3MODL 4U7MA 4WW1B 3SE4A 4ENED 3QUYB 1KIUA 1RIVH 5CSZA 4MD4A 4PJBA 1LO2H 1KIQA 3QH3A 5F7MC 1FG2A 3G5YB 4LEOB 1C08B 5CUSL 1RZIA 5FIEA 3LN9A 3V4PL 1N26A 2IPKB 2V5YA 2DQHL 3ZHKA 2EDOA 1S3KH 2K9UA 3AREB 1CQKA 3WFDH 4GW4B 3DBXA 1SJVA 4JPIB 1KB9K 3K7UA 3O3EA 5T1MA 4U33A 1RMFH 1VB9A 1RULH 2VXQH 3O11A 3RVWD 4TNWK 2H2PD 5C0FB 1AGEA 5FYKE 5GISH 4NC1E 3F7RA 5GRUL 3MNZA 4AYFA 3MV7B 1IGCH 1RZFH 1DQML 4MSWB 2BMKB 3PV7A 3BPNC 1H0DB 3HZKB 1TJHH 3OB8A 1GIGL 5AYQA 1KXTB 4YDJA 3H9SD 4CU7A 4UIMA 3VW3L 3CFJB 3CCHA 1FYTE 4OCWH 5GGQL 3O2DA 3NFPA 5T5NF 1U2CA 1S7TB 3PHSA 4K8RL 3FQRB 4OQTH 2XXCB 3HS0A 1CL7L 5EOCJ 1JK8B 5EN2A 4XHJC 2BNRB 5BS0B 3ULVE 1UXSA 1FGNH 3FT2B 2B4CH 3OF6D 1MWAH 5I75B 1NC4D 5MP6H 1GVIA 1JYWA 4Z18A 1KB5A 4NO3B 2VLLB 3H9SA 3HCVB 2ZOKB 5DRZB 1DBKH 2RAMA 4GG8A 5SWQA 1SMOA 3IT8D 5J11B 4PBVC 4FMFA 1FPTL 1KJ2H 2J12B 2OTWB 4EUPB 1ZVSB 4HH9A 12E8L 2A9MH 3PGFL 4G3YL 1G1YA 1BMGA 2AJYL 4P2RE 4CDGC 5J4MA 3SDDB 1N64H 2R56H 1R5WB 1YN6B 2MCG1 2DIBA 1VFMA 3MREA 3PGCB 4KQ4H 1QVOB 4RISL 5FYKU 3AGVA 2B1AH 3REVB 1HCVA 5HHMD 3O6KH 2XOTA 3RAJL 3ALWA 4PY7A 4JZJA 3T0EC 4OLVL 3OF6A 3D5OF 3T1WA 2JJUA 1N6UA 3GHEH 5IVZA 3I6GA 2ATPB 1IGTB 3ES6B 1CBVH 4JPVH 4C56E 1UH2A 4EUPG 3ROLB 3EJYC 4GW1B 4KXZI 1ZHKA 3WLBA 1H3PH 1T7XA 5EBMB 1F58L 3MV8B 2NTFA 3D39D 4ODVL 4XCNB 1HE7A 5CZXC 2GHWB 1VEMA 4KY1H 5ETUA 5IIEA 3K8KA 5FO7B 4KVCH 5EUKB 3DVIA 2AV7B 1RZ8B 1A14L 5CAYB 1YEKH 4AM0B 5FK9A 3KPSD 1QKZL 3FHQA 4MWFB 4K2UH 3KYKH 4TULL 1NCTA 5IM7A 4KI1A 1Q9LB 4FZEL 5B3JE 2DM7A 1RUAL 2G60L 3F12A 1J1OL 2APXA 3DOSA 4U4BA 2EIZB 3SJVE 2NW3A 3KPRD 5DUBA 4EDWH 3MUY1 1IBGL 5B3NA 1U8HA 2HKHH 1T5XA 3L9RA 5DA4A 2YC1A 1KLUA 2FECL 2F8VA 3CFBA 4Z7WB 3MRCA 1SJXA 5FUOL 5IWLC 3I6KA 5EZIH 3HC0B 4JFZL 5CP3A 1A7NH 2R39A 5ANMA 3QUKB 5FUZH 3QFDB 5CEZD 4JFQA 5DWUL 4YHNB 4HK0A 4Z7UE 3ULVF 1A6UH 4MDIB 4P5KB 2APWA 4HFWA 3BD4A 1ZHNB 2BSTA 1MI5E 5AZ2H 4JM2F 3X3GH 3FFCE 3MLXL 2FSEA 2ZG1A 3DX8A 3UJTL 3IFLH 5HI3C 3TYFA 4H1LB 4ZODA 3D2UB 3VFGL 4ZAKB 3EYSL 3UTSE 4NO5A 3ARWA 2XTJD 1I8MA 1JNHA 1HEZA 3RRQA 3S4SA 3VGAC 1D5MB 3DV4A 1HDMA 2XTLA 5IB2B 4GS7B 3NH7L 2VO5A 4LLWB 3WD5H 3TO2B 3AS0A 4DKDC 2MQCA 4NQUA 2YD3A 3X14A 3CFEA 1IC4L 1XMWA 4Y19D 2I25N 3AXLA 3HUJB 1RJZA 5ESQA 5FUCE 2G5RA 4H1LG 3EOAB 2IPUG 1JPFA 2AJZB 5ID1A 4JFDD 1YEJH 3L1OH 2HFEB 4Z7QE 2BHZA 5I1GH 4HJ0C 2EIEA 4JAMB 3OKEA 2G75A 3JWDH 4LVNB 3QHTC 4P57B 2VL4A 4YGVB 1IGIH 3FOLA 4WEBH 3MYJA 5L2KE 4Y19A 3O41B 2VDLH 3QCVL 3ZT7A 5IB5A 1R5VA 5IJVB 2D2OA 1AQDB 3QXWA 1K3IA 1KYOJ 4RAUB 4OKVB 4HK3J 5CP7A 4JFDA 5D8JL 4RMVA 2NX5D 1T89C 5DGRA 1QR1A 1FV1B 2V2TB 2B0SH 1NDMA 4NDMA 4U1IB 5B3JF 3E6FB 1MPAH 1T21B 4QXTA 3NGBC 3PABA 3ARFB 2DQIL 4DUWA 3BP6B 3VD9A 1F4AA 3UBXB 3D6GA 3KXFE 4WRLA 2Z93B 1K5NA 2EDKA 4FQJL 1QBMH 5CEYA 5ADOH 3IJHB 1J8HB 1J1XL 1H3TA 1K8IB 2ZNWA 4RGOH 3V7AE 4PGCA 1L0QA 1S8DA 2R4RH 4RFNC 3WSQH 1I9EA 2F74A 4RNRA 4NZJA 4M43L 3OZ9L 2QQNH 1B0WA 1MEXH 3R1GH 4G9FA 3MLSH 1G7LB 4RGMC 3ARVA 2EH8L 1FIGH 3FRUA 4L3CB 4LF3A 5DEGB 2VN7A 4TOYH 4B53A 3EOTH 3L7EA 3EDJA 3UBXG 4FP8H 3EZJB 4DCQA 4XRCB 1DLHA 1G7JA 3G6JE 5F1IB 1SYVB 1JYVA 3GMRB 1OD7A 3GSUB 5E5MB 2CXGA 3MOBL 1XCTA 5J6GB 5JNYB 1G7QA 3BKCL 4PJGA 2R9HD 5SWZE 1AXTH 2FLBT 3LV3B 1Q8MA 4JQVC 4X9GA 2JF1A 4PJFB 1IC7H 2AJSH 1G1CA 3S96B 4K8RC 1U95A 2APFA 4YPGA 1LO5B 1U8NB 4LKCB 3HC3L 4UAOC 1TMCB 4DEPB 2C3WA 4AH2B 3IXAB 4JG0H 4KMLB 3BWAA 4M7ZB 2VLRE 5FV1L 1AQKH 3QA3B 5ECJE 1LP9B 2VXUL 4CN6A 3DVNB 4HV8A 1Q0YH 1SJEA 5FA4B 5JXAH 4KZEL 2ESVE 1HH9B 3S36H 4A2LA 4NOFA 4PRHD 5IB4A 4MA7L 3T2PA 5E2VH 4JE4B 1MFEL 4IS6B 2MFNA 2WLZA 1XZ0B 4JY6A 2ITCB 2NY4D 1MWAB 5INCA 1IARB 3IDMB 1UB6A 5D96C 1UB5B 2FCBA 5ISZA 4ZFOB 2WINA 4G6AD 4HEME 4FNLH 4PRPB 4XCYB 4XPGH 1NDGB 1KJ2B 1YEHH 4KJWD 3TIEA 3NVQA 3BISA 3CXHJ 4NZDA 2GY7B 3QEHB 5K9QG 4NKQB 2O5YH 4KAQL 5F9OL 3GSWA 4PRHA 3FT4B 3KHQA 5IB3A 1DFBH 8FABB 4Q9RH 4F15B 1NGPL 4DGYH 2VL5A 3FO1A 4PJIE 2X4QB 1PEZA 1YEEH 3MNWB 2XZQL 4X6CE 4LLMB 3GHBL 3TT1L 1S9VB 1GGCL 4Q6IA 3DPBA 2FJHA 5DHYB 3VXMA 4YHMH 1QSFE 5C8JA 5JOFA 2D7NA 1GZPA 3QUMB 3UROR 3BAEH 4YHOL 5C7XH 4OD1H 3N9GH 2GAZB 5I1JL 3CX2A 2R4SH 1ITCA 4LVOC 1CGWA 5ALCL 3LKNB 4P23C 4PB0H 3VXPA 3SCMA 2QLVB 1GRWA 1NGYB 4MD0B 1EJOH 4CVXA 1DE4B 2A0LD 1UH4A 3U46A 1NCDL 2IPTL 5IHZB 5FA3A 3I02A 4DTGL 1KTLB 4L8CA 4KUCF 5JIHA 3RX5A 3MUHL 3G6JF 5HGHB 1GH7A 3B8YA 3UPRA 2YPLE 5E00B 1ZHLA 3BQUB 2OJZL 2DJUA 3M8OL 5JHDB 1NGQL 1WCBA 4X0KB 3VFNB 4TVPL 3VWJA 4X4ZA 1R3JB 2FZ3A 2DLGA 3CLFL 1YUHA 1QBBA 4XBEL 2LE9A 4KMTL 4OZ4A 5ICZA 1ADQA 1KGCD 3GI9H 3WDJA 1HSAB 2ITDB 3G5XB 4XBGA 3SBWC 4PP1C 3VXTB 2VITA 3BXNB 3SO3B 4Z78A 4X6BA 3SE3C 5FYLD 5F7YC 3T4YA 1EZVX 3S97C 2R2EA 5FM5M 2VRAA 1OF2A 2XN9A 2CIKA 4Z0BH 2FBJH 5E6ZA 4Z5RA 3WYRA 2CUIA 4HIIA 2XZAH 4NQDD 3LEYH 1KG0A 4IDJH 1E4XI 4L4VD 3VXSE 2BSSB 4PJHE 2ICEA 4N0YL 3VXNA 3QYCA 4RFOH 4OFVA 1E0OB 1OPGL 2G9HB 5MI0B 3RX8A 3HA0A 4EXKA 3BDYH 3HTLX 1S9WB 4LARH 3W11D 3B2UC 4M7LH 5C2BH 4OZIE 1FORH 1NLDH 1SYSA 4BFIA 4Y4FA 4Y4KC 2WQ8A 1UACL 1QFWI 1KN4L 3DSNA 2CRMA 3QFJB 1EFXD 4JRXD 4ZFGL 2Y6SD 4PJIF 3WO4B 5ACLA 4X5WB 1RZ7H 5DJXA 4X6CF 2HJLB 2HJKB 3DTXB 4NFCA 1UCBH 2FX7L 4PLJC 3RVUC 4NN7B 2VQ1B 4MQXD 1JGEA 3PL6D 3K2MC 4J3OC 1CFQB 4JVPA 5KSAC 1IT9L 4NQSA 4OT1L 1ZT1A 5FKPB 3BE1H 5JPMB 5LCVL 4RWYL 4ZUSA 4ZG1A 3W9DB 2XPGA 2MKWA 1A9BA 4PJ7A 1D5IH 3U7AA 5C0CD 1OY3B 4U0RC 5HI5C 1OQXA 4ODWA 3AVEA 3H7LA 4FFYH 5HGAB 1ND0B 1CWVA 5T1KD 3TO4C 2GY5A 3EYUH 5BVJB 1CXLA 2KUTA 4JO3H 1QO3A 5F89B 2WIMA 35C8H 3DRTB 4AMKL 4U6YA 3WXWL 5HPOA 4G80A 2ZWLT 1CE1L 1XGQA 1MRFH 2P7TB 3IU3A 2P1YA 3ILQC 2JIXB 5D5ME 5I2IB 4GLRH 1U9KA 3LHPH 3LB6C 3CK0L 2PF6A 1PFCA 2PXYC 3SKUD 5IF0A 2EXWC 2BVOB 3VD3A 2NMSA 4AT6B 1HIML 4JRYE 3I84A 1LEIA 1U8JA 1XGTB 3V4VL 5T3XD 3O3AB 4OZHB 4V1DD 1U8LA 5D7JC 5F3HA 4MCZB 2X41A 4Q2ZA 1QQDA 4JFFA 2PR4H 2YD8A 1AR1D 3CDFA 4S1RH 3RDTB 4HS8H 3K2UL 4IOIA 2FJFA 1U92B 3OXRA 2IBZX 3RIFF 2O5ZH 5MEPB 2ZCKH 3MLYL 3G5VB 2P24B 2HN7B 2YXFA 4FFVD 5CKAA 5E95B 2C3VB 3ARDB 4D9QD 3U7WH 2AEQH 4J3SA 4QRRB 4KK6C 3BJLA 4XPTH 4XCCL 5HHVL 3U30B 3E8UL 4YX2H 1M7IA 5SWZD 2QQQA 5EZJB 4V1DA 1NEZA 4P59H 3VG9C 1K85A 2VISB 1J88A 4WCYH 1TITA 1K3ZA 3MLUL 3ARGC 3PWJA 4M1GL 3NCJL 3IGAA 4OZIF 3ARTA 4KDTA 4PJ5D 3VXUA 3HAEH 3T4AA 4QWWC 3C09B 3FN0L 2BVPA 2Z91B 2FB4L 2GFBB 3O4LA 3P4NA 1NFIB 3RJQB 4HXAL 1IM9D 1TZIA 5HPMB 3WEXA 2Z0BA 4CMHC 3K1KC 4YC2C 3MV01 4KKLC 4OFYD 4U6XA 1J05B 3T65B 4HXBH 4KHXL 4H26A 1EEZA 3MGTB 1HN1A 1G9NL 4PREA 4GAYA 2Z92B 1VGEL 1Z3GH 4PJ5A 1P7KA 1U41A 1MRCH 3S88H 2VLJB 1OTSC 5F88B 4MMZC 3SQOL 4Y1AE 3ZDXE 2GK0B 2UVFA 2GTWB 4K7PL 1IM9A 1ZLSH 1DQJB 2OK0L 4I3RH 5GIRA 1UWEH 2VH5L 5KVEL 2BSED 4GMSH 3V79C 4XHJD 4YHPA 3TZVC 4NQXA 4ELMF 1LE5A 1AGCB 1ORQB 4K07A 4R2GC 2I24N 1FDLH 4NHCH 4U6HA 3HZVB 3ZT6A 2YSSA 2R0WH 3QXDB 3EGSB 3MRBB 1Q9KB 3I75B 1N0XH 3VXOB 1BVKB 2NY6B 1KCLA 4MNQA 1QR4A 5GXBB 1EEYA 5E2WH 4NYLA 4F37F 1RIHH 4PJ9C 3SE8L 4I1NB 5ACZB 1T1WB 1UM6L 1PJ9A 4I48B 1OP3H 1INEL 4X99A 3HMWH 5AZEL 2KQMA 3AUVA 1TNMA 4WNQA 1P7QB 3GO1H 5B39A 1YMHA 2FO4A 3NZHH 2DD8H 5I8EA 1JWSA 1CLCA 3T0ED 2VQUA 3L5XL 1JPTH 2EICA 3U0TA 1JZ5A 3EIFA 5T3ZD 4OCLC 3O9WA 3MA9H 3VXRB 4H0HB 1E6OL 3CZFA 4JJHA 3VG0H 3OR6B 3RGHA 3AS3A 4NSKB 4Q97A 2ICWB 3EJYD 1INDH 5EO9A 4E0RA 2OQJB 3CFDB 3F5WA 3QISA 3RX7A 1WWBX 1CD1B 3SDXB 5D6DA 5CZXD 4ZUVA 3U9PL 3TN0A 1IGJB 2RBLA 3KPQB 5I30L 3H9YA 1TVHB 1MJUL 4LSVL 3T0EA 4YUEH 2Y36L 4UINL 4WJ5A 1MFDL 1X7QA 3UO1L 2DS4A 4OGXL 1YC8A 3ARUA 4K3DH 4HCRH 1JWMB 4U1LA 3B9VA 3DUUA 2HKFH 3P9MA 4HKXA 4L4TB 4O02H 4XP5H 1BJMA 5TGBA 4CW1B 3NMEA 5FDWB 4J3UA 4TUKH 1K2DA 1RK0B 4WY7L 2JLLA 4JDTH 3EJJX 2FIKA 3LRSA 4G7YH 5FB8A 3T0VA 3O6MH 5H8DA 3BDXA 3T2QA 4HUVB 1HXYA 5T33L 4N1HB 1C5BH 3RI5K 1QLEL 5I9QB 3ZDXF 4PGBB 4XB8A 1HHHA 4P2OB 2WIIB 2JTDA 3P4LA 4DUXA 2DQCH 4XPFL 1ONQB 3HC4H 4N1EA 4J6RH 3MXVH 2XWTB 3DECA 2I9LB 2F54E 4QRTA 5HI3D 3C87A 4KZDH 1WEJL 3MRIA 5C08B 4YHLL 5BZWA 1EH9A 2PYEA 4IHOB 1BFOA 2Q86B 5I0ZA 2IBBA 3VJ6B 2DLFL 1QRNE 4GRMA 1SJHA 4M6OH 1PYWA 1XGRB 3BKJH 3RWHA 3TM6A 2G2RA 3S34H 2CDFB 4KK8C 3IFNH 1JZ7A 3D25A 5HYFA 2D31A 1XF5A 4MAYB 2BFVL 1KB5H 4I0PC 3WJLA 5DK3A 4Z8FL 1DQLL 3DXAB 4L29B 5L0QC 4IRSC 1CF8H 2J8UB 4PJDA 4Z95L 5GJSL 4QTHB 4UBDC 3WNOA 3Q48A 1B88A 3EDEA 4HJ0D 5F1NA 5F9AC 4FN0A 1G9EA 4QHLA 3WFEH 2AV1B 3N1GC 3CDGB 1F13A 1LO3L 2CIIB 2RFXA 4FXKA 3SKNA 2A83B 3W5MA 1VPOL 4KGJA 4P3DB 4KKCC 3C5SA 1IQWL 3CJJA 2NXZC 5C0IB 3WN5C 1YY9C 5B8CB 2JJTC 2AXGA 3PWUA 2AABH 1T1ZA 3BESR 4JN2A 5DRXA 3BO8A 1Z6JT 2FYYB 1IQDB 1DEDA 5EZLA 3PXHA 2Q76A 3HI1B 1QLRA 3C5ZA 4P3CL 4NZRH 1ZMYA 1ZLVK 1HXMB 5CBAB 1MAJA 1MCWW 5I19L 1IRAY 1E6JH 1FL6A 1FNEA 4HWBH 2BP3A 5HDQL 1J87A 4NRXA 2N7BA 4XAWL 5E8EB 1BX2B 1OM3H 1QFOA 2P43B 2XWJA 3B9DA 3B9KA 4HWNA 3IAGC 2ORBH 3V6FA 3EYFB 3P73A 4MVBC 1R24A 1RV6X 4Y16B 4E42B 1KT2B 4UV4H 2BSRB 3FO0L 5E6YA 2QL1A 1T89A 3BZDA 4YGAB 2YD6A 4GAGL 2BRQA 3QUYC 4G8GB 5DC4B 3HG1E 5D2LB 4LP4A 2H9GB 2ZSWA 5D1XA 5HYJB 4R8WH 3HAEB 3UC0H 4HWEH 1PG7X 1X44A 3BW9A 3AREC 1G9NC 1D5XA 1ACYH 1PDKA 1RIVL 2C26A 1LO2L 2J3SA 3KPMA 3WFHB 1NAKH 3RQ3A 3P77B 4EI5B 4ETYA 3DWTA 4G6FD 3H8NA 4LMQE 1S3KL 25C8H 4QRSB 4TTDC 4K8RD 4I18A 2P5EE 2ZKHH 4ODTL 3WFDL 4RQQA 1I8IA 3U4BH 3O0RH 1RMFL 4OTXH 4PG2C 5C0BD 5KS9A 3HAEG 2AK4B 1RULL 2VXQL 2XICA 2LU4A 3D3VA 1OP5H 3BD5A 5I1HL 5GISL 2OR9H 1U8IB 1IGCL 1RZFL 4ETQB 1OP5K 2IALB 3HE6A 1TFHA 4P48A 5IP4A 4MX7A 1NKOA 1TJHL 2DMKA 5ESAB 3DGGB 4QHMA 1QSVA 2CLRB 3W0WB 1BFVH 4HUWB 2VJXA 1OGTA 3L6FA 5E8NA 4ZFFB 5I75C 4OCWL 1ZA3A 4QKXB 1PY9A 2CO7B 4JCMA 5J11C 3LKSB 4PTUA 1YPZE 2EYTA 1FGNL 4PRNA 4CDHA 3IETB 3FFDA 1EHLH 5H2BB 1U58B 4D9RE 1T2XA 2B4CL 1T7YA 3IDXH 3SDDC 1MWAL 3K46A 1WT5C 5MP6L 4ZFOL 2A73A 5J7CC 4OM1H 3BP5A 1DBKL 2J1KA 1KJ2L 4GBXB 3VWKA 3DV6A 1J0ZA 2R1YB 2A9ML 3QQ3A 5KW9H 4LGRB 4E9LA 4WDIB 1D9KA 3JZ7A 1N64L 4YWGH 1WC7A 2R56L 2UUDH 3J8F7 5T5FH 1K6QH 4G7VH 2X05A 4KQ4L 1J7VR 2B1AL 4WW2A 3SE9H 2UUDK 3O6KL 3GRWA 3DHJA 1WTGT 7CGTA 3OKNA 4KTEH 2LTQB 1AC0A 4P23D 1T2QH 3IDIA 3QEUB 1T0NB 5DFVC 3GHEL 1SMAA 5CBEB 1JHKH 4WHYG 3S37H 3QZWA 1CBVL 4JPVL 5A1AA 1T1YA 4DGVH 2OS7A 5GGSB 3J7HA 1H3PL 2V7NA 5EIIA 4UQ3A 5KSUA 2BX5A 4BSVB 3Q1SH 4HX1A 4KY1L 5I73B 4MD4B 4PJBB 4KVCL 1KIQB 3QH3B 2PO6B 1TJGL 1YEKL 4JHBA 5L8LB 1AHWB 4ISVA 4X9HA 5SV3A 4PP1D 5HGBA 3LS4H 5JIPA 3DBXB 1QSEB 3GBNH 1Z2KA 4K2UL 3KYKL 4M00A 3O3EB 5T1MB 5ITFA 4QOKD 1AGEB 1E4KC 1JGVH 2NY2C 3RP1A 3MNZB 2C3HA 1BWWA 3C60A 4PGDB 1G7PA 1GYAA 3IRZA 2X89A 2HKHL 2CQVA 2AKRB 1QRND 5DUMH 1F45A 2LQRA 4YDJB 3SBWA 4ZUTA 5CWSA 5EZIL 1R3KA 4GKNA 1A7NL 2VKXA 3B2UD 3B83A 1P6AB 4FS0A 5ESVA 5FUZL 4ZAKC 4O5LH 1N4XH 3G08B 3QDGA 3HR6A 1YPZF 3CVIH 2X70A 3HS0B 4WV1A 4Y4KD 1A6UL 3ULUC 4QOKA 1DUZB 3QQ9C 5AZ2L 3SEPA 1DCLA 1UXSB 3X3GL 2GSIB 4GS7C 4J3TA 2CJUH 3U9UA 2YD2A 2JE8A 3IFLL 2A74B 2NZIA 4CADA 2AJVH 5IMOB 4PLJD 3RVUD 2RCSH 1KB5B 4X7TB 2Q6WB 5KSAD 5SWQB 4PP2A 3WD5L 2DIJA 2BERA 3FL7A 5HI5D 3BZEA 4Y4KA 3X11A 3KPPA 3TO4D 5I74B 3OV6A 2BVEA 2R0ZH 3S35H 4UT7H 4EIGB 4JZJB 4G8EA 4EQ3A 5JLZA 4LVNC 1CFNA 3I6GB 1M6OA 1MFBL 1YEJL 3L1OL 5I1LB 5IJKC 4XC3H 5I1GL 1QFWM 3ILQD 4FQIH 1Q94A 3OHXA 5GGVH 3LB6D 4YE4H 1ZHKB 2PXYD 1JTTA 3MR9A 2EXWD 4JN1H 5HDLA 2NTFB 4LSQH 3OKDB 4EZMA 2Z8SA 3TO4A 1IGIL 1IFHL 5D7JD 2VDLL 4O2CB 4C58B 3ARBA 2DQDH 3ARFC 1KPVB 3WKNA 4FTVD 3FQXA 5HVWA 1CFVH 1VENA 2DLEA 3UZVB 5E9DB 5FK9B 1GAFH 1CFBA 2B0SL 2H32H 4X5XB 3M07A 1FNLA 5IV2A 5IM7B 1MPAL 2PXYA 4KK6D 2ILLA 4BH8B 4P2QD 4HWZA 1EBAA 5GRXG 1ADQH 3MLRH 2NW3B 1CG9A 2JK5A 4NC2B 3FO9A 1QBML 3UTTA 1D5BA 5ADOL 2VB5A 1R0AH 3K4ZA 1KTDB 1KCSH 1U8HB 5IMMA 4RGOL 1T5XB 2YC1B 1KLUB 3WSQL 3ARGD 3OJ2C 1OLLA 1AO7B 2QQNL 4RRPA 1MEXL 1OAKH 3R1GL 1JF5A 4QWWD 4C4KO 4BSJA 1FIGL 3R06B 1MFAL 4MJIA 4OFPA 4TOYL 3BEWB 1DR9A 3WHXA 2QSCH 3EOTL 1TVDA 4UOW1 3TBYA 4HFWB 3Q0HA 5MENE 4FP8L 3SHSA 3OG4B 4KKLD 2FSEB 1I3RA 3DX8B 2YD1A 4OLYH 1SBSH 5EFIA 3TYFB 3RBGA 5JDSA 4DEPC 3JSSA 2P8PA 1AXTL 1AIFB 4M7ZC 3BEVA 4XMKH 2WV3A 5C0NC 1WZKA 1BF2A 1I8MB 3S4SB 1IC7L 2AJSL 5GRWA 3DV4B 4F57H 3N1QC 3TVMB 1HDMB 1OTSD 1GCFA 4J4PA 4LCWA 2ZZUT 4CMMA 3JVGA 3EO9H 1M71A 3X14B 3D85D 2ZPKH 3KNBB 4JG0L 4D9RD 4C54A 2EECA 1AQKL 2B4CC 5IMKA 3TZVD 1Q0YL 4MZ2A 5JXAL 3GMOA 1I4FA 1RJZB 5ESQB 3DETC 3MOAH 1JI1A 5BRZA 4R2GD 2X7LA 3O81A 3PHQA 3ZTJH 2ADIA 5CJOH 3MV9A 3GJFA 5E2VL 1HOCB 1MFNA 3S4SG 2G75B 4WTZA 1N7MH 1TTFA 4YDVA 3NZ8B 4Q74A 2EH7H 2R2CA 3ROOB 3V6OC 4PJ9D 2XNAA 4P5TA 4LVEA 1U8KB 4YHKH 4F15C 4QXUH 5KVFH 2VDRH 4P9MH 3H7BA 3GMLA 4FNLL 3FOLB 4XPGL 2WUBH 5DQJA 1YEHL 4CAGA 5D9SA 5E8OA 3TZVA 4OLXH 4I4WA 1T04A 5C09E 3VGEA 1KXQE 1HI6A 2O5YL 3HRZA 2K3TA 1DFBL 1NBQA 5C0EA 4Q9RL 5HHOD 1KB9J 1T0MB 2X42A 2DBLL 2IANE 43CAB 4HQQH 1NDMB 1YEEL 3NIGE 3MJGX 3HPLA 4JFED 4HKJA 3SGKC 5A3IC 4PJ9A 1OAZH 4M03A 5IVNA 3PABB 3V6BR 1KIPB 4TVPD 1EHAA 4LU5H 1XFPA 3MTRA 4M48H 4U1JA 4K3EH 4DVBA 3BAEL 5CEYB 1NQBA 4OD1L 3N9GL 1TJIH 1TPXB 3MRKB 4HH8A 4WIQA 2EE2A 2R4SL 3VH8B 4HLZH 3CH1A 4RNRB 5HHOA 3CDYA 4PB0L 3BQUC 3DURA 2PNDA 4NOBA 1UQSA 4G9FB 2VDKH 5FYJH 1QFPA 4JB9H 5CIPH 1GGTA 4JFEA 3CPLA 4LF3B 2OM5A 4D0BA 5F6HI 3E0GA 3L7EB 2R0LH 4DCQB 1DLHB 1G7JB 4LFHG 2WK2A 3SO3C 4P5MA 1AGDB 5EU6E 2D7MA 4F33A 1XCTB 4PJGB 1JNHB 3NPZB 3VH8G 4C83B 3UCRA 5F72S 3Q3GA 3NIFE 3QPQC 3KPTA 2DJ4A 4N5UA 1W0VB 4X6FA 3C9NB 1JTOA 1H3XA 1EO5A 4G42B 2L4OA 3IU4H 1LMKA 1IAII 1G7MA 3DLQR 4KRPB 2BOBA 1NJ9A 1WK0A 3BWAB 2R1XB 2W1NA 5MI0C 4U2YA 1YEIH 2PTTA 4HV8B 3F7VA 1M1SA 1X5AA 4JM2A 1RURH 3E3QC 4WFED 1JZ3A 2FBJL 1C1EH 4HC1A 2XZAL 1O7SA 3LEYL 4R7NA 4IDJL 5IB4B 5CHNB 4BSWA 3JTSA 3PWPE 2Q8AL 3OJDB 2W9EH 4RFOL 1ZK9A 2XY1A 4JY6B 3WO4C 4P2RA 3BDYL 4LARL 4LRNH 5INCB 4K94L 4TUOB 1UB6B 4M7LL 1X5IA 3RHWF 5ISZB 5F7UA 5C2BL 2AQ3A 2WINB 1NLDL 5LWYH 4KK8D 3RWCA 2X4RA 3GSQA 3TIEB 1KFAH 2FJGA 4NQED 2EKJA 4I0PD 3NFSH 4D0DA 2K7PA 3GSWB 1I9RH 4F7EB 4L5FH 2I07A 3LQAH 1RZ7L 2ATKB 4IRSD 1J0YA 4W68A 1UCBL 4UBDD 4C56A 3FO1B 2GUOA 3T0XA 1NUDA 3BE1L 1HHKB 3B4NA 3QXVA 3FT3A 2FJHB 5F3BA 3VXMB 3DIFA 1D5IL 1MCRA 5AD0B 1GZPB 2I26N 4KKCD 3H3KA 4Y2OA 4ZO8A 4FFYL 2JCCE 5D7IE 2DI9A 3EYUL 2NXZD 1YY9D 4I0PA 4JO3L 1TCRA 1NL0L 4TTGA 35C8L 5E7BA 5GHWH 5FCSH 5I8CA 3SCMB 1OAYH 2MTPA 5GS0H 1MRFL 2IG2L 1JVKA 1F4WH 1KJ3H 5EOTA 3I02B 5FA3B 3TCLA 3LHPL 3RDTC 1GZQA 5HHQB 5IHLB 4K3JH 2CH8A 1SHMA 4HUUA 1ZHLB 2H32B 1WJ3A 1CTOA 1Z9SA 5C0RH 1WTLA 2QKIB 1MLCB 4WFFE 3WN5A 3VWJB 3ARDC 3NIFF 5FM8A 1A3LH 2JJTA 2FZ3B 5J1TC 1YUHB 1AD9A 3KPLA 1UGNA 4JO2H 2PR4L 4LCCB 5ICZB 3CUPB 4MVBD 4OZ4B 4AL8H 3U30C 3WXVH 4S1RL 4HS8L 4NRZA 2AJXH 2IGFH 1KJMB 5F9JB 2ZCKL 4CKVX 2VITB 5GZOC 1T3FA 3OX8B 4Z7UA 2C7UA 3QUYD 2FHCA 4MS8C 4NQTA 3A67H 4I9WE 3OXSA 9CGTA 4X6BB 1ZAGA 1MI5A 3U7WL 4G6MH 2AEQL 2E7LA 3FFCA 5CJXC 3VFVA 5MERA 4XPTL 5C0GB 5I1CH 4NO0A 2R2EB 1BVZA 2YRPA 1A6AB 2CIKB 4YX2L 2VAAB 1BEYH 1KIRA 3ARED 1N3NA 1A9EB 3Q6FB 3C09C 2YPVH 4MNHA 1F3DH 3BIKB 4HIIB 2DWDA 4P59L 4S1DC 5JORA 3UTSA 1KG0B 4WHTA 2ICEB 4WCYL 2E9IA 4R97B 2WANA 4KVNH 2X4NB 2VLMD 3T2NH 4NKMA 5FGCE 1MCOH 3QHZH 3VFSB 3QUYA 4WVRA 1V8HA 4TTDD 3MV7D 4LEOA 1Q38A 1C08A 4XX1G 1SYSB 2H8PB 5C0AE 4I0CC 2GJZA 4RGNB 3ULUF 2P5WE 4GW4A 4U6VH 3EBAA 4DK6A 1S9XA 3W9EB 2YPKA 3DMMB 4JPIA 4HXBL 5IT2L 1KNOA 3FB7B 4LP5A 1JGEB 4JPWH 5CS7A 5C0FA 4N5EC 2HT2C 5BS0D 2BNRD 4NFBA 1CGXA 1ZKAA 1ZT1B 1Z3GL 4ZUSB 3FONA 1MRCL 4TPRH 3S88L 3TJEH 5IKCA 2NY7H 2XPGB 2CKBA 2ZUQB 1A9BB 4PJ7B 4ZNCD 2BMKA 1C5CH 2JCCF 5L2KA 3HZKA 2XI9A 1ZLSL 4PG2A 3RA7H 1UWEL 1P5UA 4ESKA 3QHFH 1A47A 3QCUL 4GMSL 1CT8A 4BFEA 3U36B 3CFJA 2IAND 4U6YB 4GSDH 4G80B 3S37X 5MHSE 3FOMB 1S7TA 1A7RL 1XGQB 3ARPA 4NHCL 5GZNC 1IEBA 3SDDD 2R0WL 2X1OA 3PF2A 2BNRA 1N59B 3UZQA 2QR0A 1L0XA 3ZTJG 1WZ1H 1LVEA 1T7VA 5DT1H 5EWIH 5E2WL 3FT2A 2DJSA 1RIHL 5IF0B 1ORSA 2FNBA 1B6DA 5SWSE 1IGFL 1U3HB 5BMFH 4NZTH 1DQDH 5CCKH 2OTUA 1U8JB 2VLKE 3HMWL 3HCVA 2ZOKA 5DRZA 3V6OE 3VGDA 3GO1L 4EUPA 4GRLA 2OTWA 1ZVSA 4Q2ZB 1QQDB 3NZHL 4JFFB 4U2ZA 2IBGA 2DD8L 4YBHA 2W91A 2E27H 4XMPH 3MXWH 5ICYA 2OZ4H 3MV8D 1JPTL 3T3PE 1YN6A 2XA8L 5D7LE 5DFVD 3CX5K 1V3JA 3PGCA 4WEMB 3MA9L 3ARYA 4R4BB 3REVA 3VG0L 4QHNB 5D71H 3OKOB 4HULB 4TRPL 1F97A 4JQIH 3G6JA 4WO4A 3MJ9H 1INDL 4LHUB 1U91A 4ZNEE 2FLRT 5HHXH 3LMJL 2YWZA 4RMSA 5CIPB 2XA3A 2UWEE 3C8KA 4IOFC 4J3XA 2L0DA 2Z8WC 1NEZB 1BJ8A 2Y72A 1EMTH 2D0GA 5F7KC 4XXCC 1UWGL 1A0QH 5EBMA 4YUEL 4XCNA 1CK0H 2EXYC 3N0PB 5FO7A 2DWEA 4Q9CA 4TNWF 4JR9H 1WQVT 1LE9B 4HLZG 1N2RA 1NUNB 2AV7A 4NCC2 4X6DE 5C70A 1RZ8A 4K3DL 3O4LB 4FQCH 4MXQC 2HH0L 1TZIB 4LHUG 2ESVA 2HKFL 5I9QC 4O02L 4XP5L 3KDMA 1IC5H 1KACB 4TUKL 4U6XB 1I85A 2NY2D 1NEZG 4KTDH 5TE4H 3QG6A 4JDTL 5HYIA 4P2OC 4H26B 3U79A 4HS6B 1Q9LA 3O6ML 5D1ZA 4PREB 4TQEH 2BNQE 3MRJB 4GAYB 4K94C 1C5BL 3PQYB 2EIZA 4R4NC 1P7KB 4FZ8H 3WV0A 1DANT 3BI9X 5F1KC 2EDWA 4GO6B 4ACPA 4XZUB 5A16A 2D0FA 3D2UD 1KPUB 5F9WC 5BO1H 4ZAKD 2DQCL 4YR6B 5GIRB 3HC4L 3ULUD 4AENA 4LPXA 4E41E 4GG6E 4WENB 3MXVL 1E4KA 3OAUH 4N0UB 1SQ2N 3QQ9D 5GS3A 4MNGE 4XCEB 5EC1A 5DQ9B 4PJIA 1AC6A 3QFDA 4YHNA 4KZDL 4X6CA 4XH2A 2EEDA 3O2DL 1EHNA 4MAYC 1ES0B 1JGDB 4LSRH 1CGYA 4MNQB 1QSFA 1RQ5A 4NYLB 4DKFH 4MA1C 3BKJL 2NTSP 3GKZA 5ABDE 4WHDA 3WDIA 3S34L 1D7FA 5CINH 3GEWB 3I9GH 1D5MA 2FO4B 4BFGA 5IB2A 4W4OC 3T3PF 1KB5L 3TO2A 1JHTB 4F7CB 3OKLA 3ZKXB 4TVSa 3T0WA 1CF8L 3U0TB 3WO3B 3O9WB 5HXMA 2XZCH 1YQVH 5B8CC 5JW4Q 5KG9A 5FXCH 4POUB 4AEIH 2WWKO 3EOAA 3WFEL 4E0RB 2AJZA 1TVBB 3QRGH 3T1FB 5DJ2A 5FGSA 1J1PH 4ZUVB 2J8OA 3PV6B 1JGUH 4S0TD 2E7CA 5IGXH 2CGRH 5FO9B 3RZCA 1I8LA 2AABL 3ARFD 3BN3B 4PS4H 3IKKA 4X6DF 3HN3A 4DGIH 1RK1B 4NZRL 4O58H 5TPWH 4WFHD 5HD8C 3O41A 1J8HD 1RY7B 5DQDH 4GKZA 2V17H 4NUGH 4LLYB 5E4IA 4B7LA 3VFUA 4Y16C 1GGYA 1L4IA 3P9MB 4HKXB 4HWBL 3MA7B 4IRJA 1K2DB 5CILH 3HZMB 1FV1A 3VXSA 4PJHA 4U1IA 3E6FA 1OM3L 3M17B 3VU2A 1JRHI 3SGDH 3WIFA 5FB8B 2ORBL 4F3FA 1T21A 3CU1A 1HXYB 5I8KH 1FNGB 4PJXB 3ARFA 3HLAB 3KVQA 3BP6A 3ZT5A 4X9FA 4UV4L 1YA5A 3E1F1 2Z93A 5C07E 5IROA 4OZIA 3KLAB 1PEWA 2Q1EA 5DD6A 1X5GA 4GG6F 1WIUA 4Q6YA 2R1WA 2FHBA 4LSDA 2GJ6E 4R8WL 2GT9A 3UYPA 3UC0L 1XCQB 4X7CC 1I7TA 3QIWA 1G7LA 3DX7B 1SEQH 3OJMB 3X12A 1RHHA 2WZPD 2NCMA 5DGQA 1OCWH 3MRIB 4XVSL 5F7WC 1UC6A 3IB4A 2R23A 1IM3A 2PYEB 1NAKL 5C0ND 1MVFA 3EJZC 1BFOB 2XIDA 3GSUA 1S7VB 25C8L 1IGYA 5ENWA 2ZKHL 1B0RB 4GRMB 3H9ZA 3LV3A 3LPWA 5E03A 4X4XA 3U4BL 1YMMB 1W8OA 4DN3H 1IE5A 2QADB 1JMZA 3D25B 3O0RL 4PJFA 5MHSD 4OTXL 3EOYG 1KCRL 1MH5A 1U8NA 4NM4H 4LKCA 3DETD 4HMDA 2OR9L 5JOEA 4KMQA 4POZC 4W4NA 5DURB 3IXAA 5D5MA 4PRPD 1RVFH 5JXEA 3QA3A 1WBYA 1LP9A 2AGJH 1OWWA 3RY6C 5IFJB 3MCKA 1BFVL 4RCAA 4OQTA 2H3NB 3ILPA 5C86A 5HBBA 4HS3A 2RFXB 1HINH 2NZ9C 1T03H 3C5SB 3LKRA 1U8OA 1A1OA 3RWDB 1MWAA 2AXGB 4GBXC 1D6VH 2ZUTA 5IOPA 1I1AB 4ZFOA 5DRXB 1O5DT 3BO8B 2AJ3B 1UADC 2LV4A 5GSVB 4PRPA 5EZLB 2DQTH 4I3SH 2Q76B 4FOMA 1QLRB 3C5ZB 1NDGA 1H3UA 2NY5C 2QQLH 4Y8DC 4V2BA 4OM1L 1IEAB 1RZJC 3PWNB 3FT4A 4N9GA 2IH3B 1X4XA 3TT3H 5A3ID 2LTQC 1JIBA 1QFHA 2APVA 1LO0H 5KW9L 4QXGH 4EDXA 3MCG1 3MNWA 4UUJB 1GSMA 1G9MH 4YWGL 2XWJB 1BM3H 1K6QL 4PRIB 4G7VL 5DHYA 3V6FB 3QWRA 3Q5YA 3QEQE 4TSBH 3SE9L 1XF4A 4EN3C 1E28A 1R3IH 3NCYP 2NY1B 1T2QL 1EFQA 3BQUD 3DI2B 3SE4C 2ADFH 3QO0A 3GMPA 1JHKL 3S37L 5I73C 3PG2A 1RU9H 3D48R 5E08H 3SGKA 3KWWB 4NQCE 4DGVL 4Z77B 2ZSWB 1NGYA 4MD0A 1A64A 1DE4A 1DTUA 3BW9B 1AHWC 3Q1SL 3VFPA 2X1QA 2VQTA 4ZO6A 1FBIH 3MACH 5HGHA 4I5BB 1CIDA 4HJJH 1MCBA 5E00A 4I0KA 3QPQD 3BQUA 3UJJH 4Y1AA 4HPYH 5JHDA 4X0KA 3VFNA 1ZEAH 4NJ9H 4I18B 3IFPA 4X4ME 3LS4L 4RQQB 5IW3A 4OV5B 5F7DB 2C5DC 2V9TA 3MROB 5TQ2H 1IEHA 1HSAA 5KS9B 3VMPA 3TH3T 4TUJB 3EKCA 1AGBB 4PV9A 6FABL 3D3VB 1HHIA 2KQNA 1JGVL 1OGAE 1FZOA 4ELKA 3SKMB 5DJYB 4U1SA 1ZLUH 3PP4H 3HE6B 2VIRA 4KTYA 4MX7B 1IKFH 1RAMA 1ZLUK 1CICB 4QHMB 5DUML 5HDBE 1OARL 1F3RB 1A7QH 1CQYA 3QFJD 4Y2DB 2C1OB 4U1KA 3L6FB 3GSNH 5E8NB 3U1SH 1CVSC 4UMGA 4AIXA 4O5LL 1N4XL 3DUSA 3CVIL 1MCHA 4UOW0 3UTPE 2W9LA 1CN4A 4NRYB 2EYTB 1H3WM 3FFDB 3UYOD 2CJUL 2D7OA 4N90D 5KSVA 1NEUA 4LQ1A 2AJVL 1X5LA 3S5LA 2RCSL 1ULVA 5I74C 1GGBH 1XF3B 1TQCB 3QFJA 3BP5B 5DHXB 3L5WB 4JZJC 5IESH 1CVRA 4X5WA 1ED3A 2Q8BL 3VWKB 2HJLA 2HJKA 1LHZA 3DTXA 1HH6A 3QQ3B 2BHYA 1IAIH 3RTQB 1HWHB 2WBWB 3MRFB 1BZ7A 1KEGH 4FQLH 1D9KB 1WC7B 2JIXD 5KVDH 2D0HA 2J8UE 3QO1A 2J7LA 4R96B 3MRHB 1IAKB 4WW2B 1Z5LB 3BD3A 2R0ZL 4OUOA 3S35L 1KF9B 4ODHH 3VFOA 1CL7I 5HGAA 4JQXA 3RZWA 3G6AB 4GW5A 2FIRT 5BVJA 3OGOE 2PYFB 3CSPA 4XC3L 2OR8A 5F89A 5E1AA 4Z7VE 1T1YB 3DRTA 3L3HB 4FQIL 5GGVL 1FFQA 1K8DB 4YE4L 3MX0A 4WI8A 2PN5A 3RDTD 3OKKB 4XP9H 2V7NB 5EIIB 2P7TA 4UQ3B 3STBA 3FB5B 3TNNB 4JN1L 3LY6A 1LO4H 2OL3H 2JIXA 4LSQL 4HD9A 2V2XA 5I2IA 4HX1B 3ARDD 3HMXH 4QRRD 5J12B 2NY3B 3BFOA 4PGZA 2BVOA 4HUKB 4AT6A 5J8OA 3MRMA 3GK8H 3TLRA 2F53E 3MMEB 1JZ4A 3N1MC 4NNYA 1CFVL 3JTTB 4OSUH 4OZHA 5FYKH 1S7UA 5HGBB 2R0KH 5GZOD 2EE6A 4MS8D 1JUFA 1GAFL 4KKAC 1WGOA 4NNPH 2QSTA 3RDTA 3LZFH 1JPSH 4DN4H 5GGUA 4PYGA 2F54A 3ET9F 4OB5H 2J4WH 1ADQL 1MHCA 2BVQB 3I3BA 2FL5B 2HN7A 3MLRL 3ARDA 1B4JH 1G7PB 1WV7T 4S1DD 4DJMA 1R0AL 3WUWG 1ZE3C 1KCSL 5HDBF 3P0YH 4AQOA 1DJSA 2C9AA 4QRPE 2IFFL 1RIUH 4N9OB 4FQXA 4PB9L 4XAKE 5EZJA 3ULVH 4ZFZB 4ZUTB 4RFEB 3BX7C 1R3KB 4NZUH 4PLNC 1OAKL 2VISA 4XP1H 4EXPX 5ESVB 4JY5H 4CVZA 1JE6A 3QDGB 2J8HA 4FQ1L 4HC1H 2X70B 4WV1B 3AS2A 4YJZL 2QSCL 1XF1A 4L3EE 3TVMC 4JANA 4KRNA 2VLJD 3K8MA 2Z91A 5JO5B 3PNWA 4OLYL 1SBSL 2GFBA 3FAWA 5E7FA 3MLWH 2D4DA 4RDQF 1NFIA 4CADB 3ZYIA 5HPMA 2WQRA 1NC4B 4XHQA 3HI5H 3MRQA 4XMKL 3DVFA 5EU4A 1U8PB 2RHEA 4N5ED 3E2HB 2HT2D 3OQ3B 2HJFB 4H8WL 1FZMB 4F57L 4H25B 4PP2B 1RFDH 1H15B 4PLKC 5IW6A 2J8UF 5GPRA 1JNJA 1BWMA 3BZEB 3F58H 4XMLH 2W59A 1NBYA 3KPPB 2ZPKL 1SVCP 2VLJA 5F88A 1BD2E 1CXFA 2OXHA 5HHMB 1IKNA 4G8EB 4DOHB 3MOAL 1DQJA 1CFNB 4NBXB 4YO0A 5CJOL 4Z7VF 5GZND 4A6YH 1M6OB 1X6LA 3JWOH 1P7QD 3MGOA 1Q94B 1N7ML 1ORQA 3O3DA 3OHXB 5FO8A 4AY0A 1Z9OA 2EH7L 3BP7A 4NFDA 3LPFA 1NFKA 5DF0A 3HZVA 2I60H 4YHKL 1YN7B 4QXUL 4LNVA 4WUUE 4XCFH 3EGSA 5KVFL 2VDRL 1Q9KA 4P9ML 4WI6A 3TA3A 3DJ9A 3BT2H 3VXRD 3VXOA 5JDJA 4P4RB 1S5HB 2RIKA 2WP3O 3NA4A 3ARBB 5KSBE 1T1WA 2FDBP 4LCIH 2X9YA 3FQXB 5F7HA 3PDOB 2VKWA 1FC2D 1P7QA 3BIAX 1Y18B 2Q3AA 3EOBA 3G04B 1RZKH 1TPXC 1HQRA 1U8QA 4HQQL 4PJAB 5F7EH 4FHBD 5JW5B 1WSST 3QDJE 4PD4J 1OAZL 4G5ZH 4HWZB 5D2NE 5AUMB 4LU5L 3VXRA 4M48L 4K3EL 1XF2B 4IOFD 3MO1B 5J9PB 3QULA 3UTTB 1D5BB 1HKLH 2ICWA 3O6FB 1MJJA 1TJIL 5D2LF 5DR5H 4L4TD 2OQJA 2A6KB 3CFDA 3BUYB 1JNNH 1GXEA 1K4CA 1CD1A 2P5EA 3LQZB 3PHOA 5ITBH 5CGTA 2EXYD 1ITBB 32C2B 1IGJA 3QDME 1A7OH 2VDKL 5FYJL 7FABH 1JHLL 4JB9L 1OHQA 1TVHA 1XGUB 2XFXB 4KKBC 4OF7A 4MJIB 2EC9U 1U42A 3NACH 5J3HC 4MXQD 3WHXB 4OLWH 4M1CC 4WTXA 4Q9QL 2X40A 4APQA 4G6JL 4P2OD 3ZHLA 5DI8B 3RPKA 1NMAH 4YHYB 4L4TA 5D6CA 1B9ZA 4KRPC 4OUUA 3KYMA 5FDWA 2VZSA 3DRQB 3VA6A 4XNZB 1BPVA 1IMHC 2Z31B 4R4ND 4MA8H 4RRPG 1SY6H 5IVXE 5HTSA 5I66A 3IU4L 5ICXB 4LCWB 2IC2A 4HUVA 2WW8A 1DBBH 2VXTL 3JV4B 1UJ3B 2JB5H 1YPZA 5C08D 3AB0B 1CXEA 2Y5TA 3RUGE 5JHLH 1EXUB 4X7SL 4ODBD 1YEIL 4HIHB 2OYPA 3LN4B 1JN6A 1I4FB 1RURL 2A2QT 5BRZB 1AP2A 1F4HA 5LGKA 2X7LB 1C1EL 3PHQB 3O2VH 2ADIB 1SVZA 1CGSH 2C4FU 2BRRH 1ONQA 2XWTA 3LAFA 2DQUH 4MAYD 2I9LA 4YDVB 2H45A 3LOWA 2XRAH 3DXAD 4LRNL 4P5TB 1EVTC 2HLAA 2MJWA 2WM0A 1SM3H 3O6LH 4MJ6A 3KPOB 1KTRL 3MPCA 4JFHE 2EDRA 5KSBF 1QLFB 2Q86A 4YFLF 1KFAL 1VFOA 5EPMA 2HVKB 1T04B 4P4KA 2VNCA 3S9DB 4D2NA 2ARJB 3NFSL 3H9SE 1XGRA 4ZUUA 1I9RL 3OTTA 1KBGH 3LQAL 4FQQB 2CDFA 5AWNH 2EKSA 2DDQH 3AMKA 1NANH 1EUUA 4LHQB 2BOCA 5KOVC 1EUTA 5IQ7H 4YDKH 1Q9WA 5I8OH 3HPLB 3BMVA 3DXAA 4HKJB 5EOCH 1KUMA 1A7PH 2V5MA 4QTHA 3SCMC 1FAIH 3GM8A 4MA3B 4U1JB 3QEGH 3L3GA 1ZA6B 3D87B 1S9YA 2F53D 4CUCA 1JV5B 2ARWA 2OL3B 2X4OA 5GHWL 3CH1B 4L8BA 4P3DA 1OAYL 1ZT4A 3DURB 5GS0L 1NCAH 1UQSB 5EIVA 5C0IA 1F4WL 5C3TA 3VWJC 5HD8D 5B8CA 1S7SA 3CPLB 4LCCC 1INQB 4D0BB 4P2CG 3B9EA 2FBOJ 5TDOB 4Y16D 3QDHA 4K3GA 4HW6A 3SPVB 2BXZA 4K3JL 4ZPVA 5IBTH 3EO1B 1I1FB 4K23H 4G8GD 2E8YA 2KPNA 4CNIA 4MD5B 4HG4J 1A3LL 4OCSH 1IAMA 2QHRH 4JVUA 2AERT 3Q3GB 4H0GA 3FN3A 1FNSL 3WXVL 2MCPH 5E8EA 1BX2A 2AJXL 1FYTB 1CIUA 1F4XL 4LSSH 2IGFL 4YFEA 2FGWH 3RUGF 1Q9OA 2VDPH 3D39E 3HNVH 3ZLQC 4E42A 3GJEA 4JFPB 3QIBD 1V3KA 4G6ML 2BSRA 4R97C 2BOBB 1ZSDB 5I1CL 2OP4H 4PFEA 3F7VB 2PUQT 4JM2B 5EO0B 2YPVL 1J12A 3L3IB 4H8WC 4R0LB 2KL6A 3KPSE 4Y4FC 5ANME 3UTQA 5HYJA 4KV5E 2CRIA 3HAEA 3JTSB 5DJ0B 2AK4D 4RGNC 2F8OA 4KVNL 1XH3A 3T2NL 3SKOB 3EJZD 2Y23A 1MCOL 3QHZL 3DUHA 1RUMH 4P2RB 4Y5YB 1HYRC 2NY4B 3QUXB 4DUVA 2YRLA 3TFKC 5DJCA 2D7PA 4F7PA 1BD2D 4AEFA 1CDBA 3FB8B 4EI5A 4CN4A 3GSQB 3MJ8B 4ODSH 4QRSA 3W0WD 3W82A 2MMXA 5DVKA 4U6VL 4D0DB 4FXLA 3V2AR 2ZUQC 3IYLW 3WBDA 3BIBX 2R8SH 5HYSA 3IDGB 4LRIA 4POZD 2FGZA 3WFZA 5HVGB 4W6XB 4C56B 4N0CC 2AK4A 2GUOB 4RA3A 3S6CA 4JPWL 5CEZE 5I6XB 4LASH 5FHBH 2F9BT 5TE7L 2COQA 1RJYA 1MCKA 5DEFB 1U8IA 4TPRL 4ETQA 4A6YB 2NY7L 4P46A 5HVHB 1A6TA 1C5CL 2IALA 4X80H 1X3DA 2NZ9D 4QTIH 5JMRA 3RA7L 1VKXA 3L7FA 5INDA 3T2OA 2CLRA 2Q7YB 3W0WA 3QHFL 5T3ZH 4HUWA 1R5IB 1TCRB 4GBXD 2XTJE 4PJEE 1U0QA 4GSDL 1U3HC 5I8CB 3FMGH 3AS1A 3LKSA 4PJCE 3ZE0E 5EOTB 4M6AA 3WE6A 4NWUH 3TCLB 4GUPA 1WZ1L 4YLQT 4JJ5A 4WUKL 5DT1L 5EWIL 3CFKB 3LEVH 1WZMA 4ORGA 3P30H 4Y19E 3SJVB 5CD5C 5BMFL 4NZTL 1DQDL 5CCKL 3O4OB 3OWEA 4I2XA 4AK1A 4M6MH 3G5ZB 4JFDE 4GBXA 3VDBA 2MPAH 2W0LA 3RIFK 1OTTC 3UXFA 4EN3D 4YXHH 2E27L 4XMPL 3MXWL 4WDIA 3SGJA 2EDYA 5C71A 3ZE2E 4N0FB 2BY3A 5H37H 4Z7UB 4IJ3B 3TPUA 4MLIA 5D71L 5EBWB 1MI5B 5MENA 2VSDA 4J2XA 1OD9A 3WIIH 3FFCB 4JQIL 3QEUA 5MERB 1T0NA 1CDJA 3MJ9L 5CBEA 1LK2A 1ZWIA 3QNZA 1N3NB 2HTKC 3KGRA 3MJ6A 3B43A 2DWDB 2IWGA 5JORB 3OPZH 3UTSB 1QSED 1KYOK 2NX5E 1BAFH 1A5FH 1QOKA 4G9FE 4U3HA 4OZFH 3RGVA 3HNTH 1FE8H 4WU7B 4BSVA 2Q87A 3FQUB 4NKMB 4HCRA 3TBTB 4PPTA 1JMXA 1CK0L 2HRPL 5FGRA 1LD9B 4JR9L 2PO6A 4RSVA 3ZL4H 1F6AA 4RMUA 4MJ5B 4BZ2H 3KPNA 4FQCL 2AK1H 2GJZB 3OB0H 4FXGB 4HSQA 1IC5L 1AHWA 1V5JA 1MQKH 2A9NH 3QQNA 4DVRH 3OB0K 1S9XB 5GGTA 2OTPA 4KTDL 2YPKB 1QSEA 5TE4L 3ZTNH 1FFPB 3ARSA 1KNOB 1DN2A 1DVFB 4M1DH 4LLVB 3S7GA 5LG1A 5ACMA 4FZ8L 1CYGA 2VE6A 4R7DA 3FONB 4JFHD 4PGDA 4UTAH 5IKCB 2CKBB 4EJ1C 5L2KB 3ECBA 2VAJA 1CLZL 5IB1B 2Y25A 4UDTB 1NUFA 2AKRA 3JWNC 5LJYH 1M4KA 2JJVA 5C09A 2I5YH 1PX4A 4PJEF 1RUPH 2WWMC 2ZUYA 4OZGA 1YZZA 4KC3B 3LQAC 3V95A 1CT8B 3OAUL 5IHBA 4JY4A 4GQ9L 4PJCF 1VADA 3G08A 4NM8H 3ZE0F 4JHAH 1QBAA 1IEBB 1MHEB 5I1DB 4MMXC 1DUZA 5MEOA 4F37K 1XR8A 2QR0B 2GSIA 2B5IB 4LSRL 3VI4E 3KXFB 4P99A 4QGTA 2E8ZA 3ZKXC 2A74A 3MLTB 5IMOA 1ORSB 5DMJB 1NPUA 4DKFL 4D3CH 3O9WC 3QNXA 4X7TA 2OTUB 2RGSA 4PRHE 2Q6WA 4IOSD 4JGMA 5CINL 3I9GL 4MQTB 4GRLB 5DZLA 2M1KA 2DIAA 4RA0C 3EDDA 3QIUB 4UV7H 3ZE2F 2DAVA 3BPLB 5ICYB 5FV2A 5EG6C 1CXIA 1VEPA 5D6DC 1NGXA 3MOQA 4H0IA 3MUJA 3TN0C 1T20A 5E94B 3ZYZA 2XZCL 1YQVL 6CGTA 4O4YH 3HNSH 3G6JB 4AEIL 4WO4B 5E99H 1U91B 5I1KH 5EU6A 3V4PH 2QJDA 3GRWL 2DQHH 5I1LA 3C8KB 3V7AG 3QRGL 3GMNA 3CFCL 5E9DD 5SWZB 1MCCA 1J1PL 5EUOA 2ED7A 1O0VA 1G0YR 1JGUL 2FX9L 1BOYA 3CSYA 4OF8A 2CGRL 4GRWE 4L9DA 5IK3A 4PTTA 1QSZA 3QAZB 1GGUA 3NTCH 3OKDA 4LGPB 4PS4L 5CLTA 1BECA 2W65A 2WNGA 4O58L 5TPWL 3JV5A 2DWEB 3F65A 4HWBA 3FRPG 2LAAA 1N2RB 1B6UA 3OKYA 4O2CA 4KKAD 3O8XA 2VLRB 4PG9A 5DQDL 3STLB 3KLHC 1CGVA 2XQBH 2NLJB 5KANG 2V17L 4NUGL 1KPVA 5DK0B 2P46B 1UJTA 1YEDB 4NGHH 2ESVB 1F3JA 3KDMB 4LIQE 3TYGH 1A3RH 5E9DA 1AO7D 1V7NH 2D9CA 5SX5H 4X5XA 3QG6B 3QQ4B 2DMCA 3SDCB 3PWPA 3L5HA 1H5BA 5SX5K 5I1EH 5D1ZB 4BH8A 3RVVC 3HR5A 4K8RH 5I8KL 3E6HA 3QJHA 3GSRA 1MJ7H 3Q2CA 3U6RB 1S7QB 4Z76B 3HI6H 3TNMA 3SDYH 1KTDA 4IDLA 5A16B 2XN9E 1CE6A 4X4YB 3U4EB 4HKZA 2VZVA 5J13B 1KCVH 4AENB 5D7KE 1AXIB 1AO7A 3KYNB 4WI2A 5BQ7B 5EC1B 1KGCE 2IF7A