3WIIL

Crystal structure of the fab fragment of b2212a, a murine monoclonal antibody specific for the third fibronectin domain (fn3) of human robo1.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
213
structure length
213
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTISCRASQDISNFLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDFSLTISKLEQEDIATYFCQQGNTLPLTFGAGTKLELKRAEAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-human ROBO1 antibody B2212A Fab light chain
publication title Structural features of interfacial tyrosine residue in ROBO1 fibronectin domain-antibody complex: Crystallographic, thermodynamic, and molecular dynamic analyses
pubmed doi rcsb
molecule tags Immune system
total genus 54
structure length 213
sequence length 213
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wiiL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wiiL01
1F3DH 2XYCA 1A2YB 2F53D 5IB2A 2OJEB 1AJ7H 3GSVB 1AE6H 2CDGA 4H20L 3SJVD 2VC2L 4LU5H 2YD8A 2UWEB 1CICD 3U7YH 1L7TH 3AU1B 4DK3A 2DQCL 4H88H 4LQFL 3WHE0 5K9JL 5JORB 3SKNB 4UU9A 4K23H 1FG2B 1EO7A 1R5WA 4L8SC 5J6HA 2RFXA 3AMKA 4M8VA 4C58B 5FYJL 4M7LH 1D9KD 4ODTL 4WTXA 2FCBA 1TTFA 4G8IA 2XWJA 3MLZH 5EULV 3WNOA 4APQB 4BELD 3X13B 2PYEB 4U7SA 3C8DA 1QQDB 3MCKA 1AXIB 4OGXL 3FRUA 2JB5L 1R5IA 3GGWA 3IDGB 1BVKA 4HIJA 4IRSA 5J6GB 2NY4C 4LVEA 4M1CC 3TFKC 1HILA 2FIKB 2HFFB 4JFZL 4KDTC 3U30C 4ZFGL 4N0UE 4AIOA 4HSQA 3OKLA 4YDLC 3QI9C 4D9LH 3EOYG 3OKMB 2HFGH 3UDWC 1G0XA 4OTXL 4NUJB 1MQ8A 4WO4A 1U8LB 5I16A 5IB5A 1UKTA 3FN0H 5D93B 2M2DA 5TE6L 3KLAA 5EU3B 5IVXE 3MRQB 4XTRD 5T3ZL 3D0LA 4KKAC 3GMOA 3UTTA 4Q9RL 5DZLA 3BEWA 2NMSA 1N4XH 4R2GC 1QBML 3L1OL 1F45A 3MJ9A 5HYQB 3NPSC 1ZS8A 3QIUD 2YOCA 3RUGE 4L4VD 3SDXA 3KPSD 3Q0HA 2A9NL 5GSVA 4NRXA 5IOPA 4OV5B 3OXRA 4CL7A 3QH3A 2EC9U 4IJ3B 1BQLL 3EZJB 3SQOH 3QIBA 4PP1D 2UUDH 5E4IA 3EYUH 4PJAE 4EXPX 1AI1L 3BHBB 1KLGA 1EXUB 4XP4H 4TUJA 4MXWL 3B9AA 4X6FA 3R8BB 1KTRL 2P5WE 2FL5B 2ZPKH 3QCVL 4PJEE 5GS1B 3I3DA 2ORBL 2OYPA 1RU9L 5H8DA 4LCIL 2XY2A 5E9DD 3PL6C 5IMMA 3V6BR 1KIRA 1JWUB 3EO1B 3SO5A 1S9VA 1GOGA 1QKZL 2Q3ZA 2HJKB 4CU8A 4NQTA 3H9SE 4JFFA 2W60A 5DMIL 5DMJB 1L6ZA 3OKNA 1HOCA 2AJSL 4HXBH 2VXVH 2P5EA 2CSPA 5E6IA 4HV8A 4P57B 3U46A 1IGIL 3BZEA 1MFBL 3EDKA 4QXTA 4NN6C 3MOBH 5E70A 3FQWB 4GQ9H 3PV6A 2X10A 2IBBA 1MCWM 1NCAH 1YECH 2R4SL 4MD0A 1OCWL 3H42L 3IFOB 4OB5H 4U6TA 1OHQA 1FNHA 3MACH 5SX4H 3AS3A 4IOIA 3QQ4B 4ZFOB 5FYKH 1ZK9A 4Z7UA 2GJ6D 1PG7H 1PLGL 5D6DA 43C9B 4GBXC 2EDWA 3IKKA 3FT3A 1XCQB 4CVZB 3RQ3A 1FNEB 4PRAB 2CIKB 1F4XH 4U1NB 3CFDA 2NNAB 4HC1L 2XY1A 3VA6A 5JQ6L 1S7UA 1GOFA 3DYMA 1KSRA 4ZAKA 4BKLA 1E27B 3R06B 4G9FA 2GI7A 4QGYA 5ERWB 2VLJB 1HI6A 3VXRB 1I9JL 1YNLL 4AIZB 1YY8A 3LB6D 3FQXA 4MNGB 3OKKB 4HEPG 4QWWC 1I7TA 1ZHKB 3DECA 5B4MD 2OMNA 1MJJB 5HYJB 1PKQE 1RIVH 2FBJH 5E8OB 1IZKA 5HPMB 1CFVH 2Q6WB 2OTUA 5ICYB 4K94L 2Q8BH 4KGLA 5J1AB 1IGJB 4LCWE 3TNNA 3K4DA 3MREA 2BNRA 1T1WB 1P5UA 4R7DB 1NGQH 3I2CL 1PDKA 1DQDH 2X4OB 4NJ9L 3D3VA 4OZGB 4LLWA 4FNLL 1FGNL 4QOKD 5E2WH 3TV3L 4HGMA 2V2WB 1JI2A 1IAIH 2VAAA 4KI5C 4PJFE 3VI4E 3LPFA 4HD9A 3EO9H 1YUHB 1O0VA 4ZS6C 5ID1B 2DL2A 2IG2L 4N90D 4BK5A 1CG9A 3P73A 4W68A 1QFWH 2QADB 3GIZL 4YFLF 5D2LE 4ZUTB 2WQRA 3C60C 2JCCB 4FG6C 4NFDA 2H6PA 4HJ0C 1CLZH 5TQ2H 3TLRA 3RWGA 3CFBB 3K1KC 4MSWA 1W0VA 4JFEE 4OF7A 2EDRA 3HG1B 1T03H 5CZXC 5CJOH 4HAFA 3NCJH 3FQRB 3MNZA 1LO3L 1UFUA 2J88H 3FQNA 1WGOA 1YPZE 5DFWH 3ZKQD 5HHOB 2DLTA 1F3JB 3T0VA 3RL1A 4LDOB 1H5BA 2F74B 1CL7H 1K9TA 4K7PX 4M61B 4U3XA 4XP4L 3GMNA 5GSRA 5B8CA 1K8DB 3DX9A 1N6QL 2XWTB 1R24A 1MJ7H 4YHNB 3ARGD 4RSVA 3WJJA 5D2NC 1P6FA 5DK3A 1QG3A 1AGDA 1TXKA 2GFBB 2H2SC 4XZUB 2Y36L 3RGHA 3TN0C 3H9HA 3B6SA 5F96H 3B9DA 4GMTL 4ZPTB 3O41B 1A7QH 4FZ8L 4BQ8A 1T5XA 4LVHB 3C5SB 5DJ8B 1N8ZB 4PS4H 1U3YA 4U1HA 1FFOA 3OG4B 4GQ9L 4PGCA 5DLMH 5HDBE 4QHMA 5FECB 4OUOA 4N0FB 5B39B 4XPBH 3LY6A 5JMOC 1S7SA 4JY4B 2A73B 3QDJE 1FVCB 1NMAH 5K9OA 1RIHL 4XB8A 4P23B 3G08A 4FFZH 5CHNA 3L3KB 2HT3C 2XN9A 3B9KD 3QFJA 3CZFA 2HTKD 4KJWD 2BHUA 1WWAX 3I9GH 1F4XL 2AEQH 1FJ1B 2RIKA 2FJHA 4OZHF 2VO5A 3X3GH 3HC0B 1I3RB 1YMHB 4D3CL 1LE5B 3VMNA 1BZ9B 1UQSA 4U05A 3KXFE 4QXUH 5FDWA 1GRWA 5EZLB 5DR5H 1H8SA 1J0JA 1YN6B 2GK2A 3IFPB 2AKRB 1T20B 1A1MA 2HLAB 4JGUA 4Y19A 5MENE 5HVHB 2JJSC 3QHZH 5C2BH 4JEGB 4NM8H 5B38B 3OXSB 1T7YA 1HWHB 4JFHD 5BOZG 4FQXC 5MEQB 4ZUWA 3EYOA 4XRCA 1FNGA 1HE7A 2NXZD 5CD5C 4KHTH 5I1DA 1RURL 1LWRA 5AWNL 4U31A 3QNYA 2ESVE 5IK3A 1ND0A 4LCYB 2J12B 5D1XA 3P30L 2PW2A 3L3IB 1HH9B 4MAUL 5E2WL 2AJZB 2HVKA 2EE3A 4P5KA 2F8VA 2EDEA 5BMFH 1DBJH 2XICA 2MOVA 4ELME 3KNBA 3PWNA 5E08L 3WFCL 3SY0A 5FB8B 4OFYA 2AGJL 2BY3A 1KPUA 2DI8A 2FX7L 1HCFX 4JFXB 5C9KA 5KG9A 2AJ3B 4DOHE 2B8OT 1AIFA 1T66D 3E2HB 4OIIL 5TE7H 3GSOA 1U6AL 1IGCL 4NKDA 1Z9SA 4EUPH 1YDPA 5C2UB 4R4BA 5IUSA 4G6JL 4P2OC 1DQML 4HS3A 5JPMB 1LP9F 4D0DA 4Y5YC 1ETZB 4OGZA 3PABB 2PXYD 4OJFH 2VLRB 4GAYB 1BLNA 4NSKB 3S4SG 3UTSD 3DIFB 3VFGL 1NBZA 2O61B 2NX5D 1NDMB 3CIQA 1XH3A 4ZD3L 2N56A 4X4MA 1T7WA 5I75C 5I76A 3RKDC 2ZNXA 1KB9K 1G7LB 3GI9H 1P84K 1ZA3B 4JPVH 3TNMA 1A6AB 5BVJB 4EXKA 1UCBL 3BAEH 1F58H 1U8IB 1WV7T 4K71C 4NCC2 1QSZA 4V1DB 3MA9L 4WDIA 5IW1A 4YAQA 3FL7A 1TCRB 4S1DC 3UZQA 2PETA 4KI5E 4ENED 1S5IL 4WUUD 3LKNA 1I8KB 3K8KA 2ZSVB 4PS4L 4DK6A 5IFAH 1KENH 3V0VA 1GGIL 4GG6B 5JDSA 3DVIA 1T0NA 4PJ8B 4I5BA 1ZEAH 4POZC 2NQCA 5D7IA 1T22B 2NZ9D 5FYJU 4TVPH 5TDPA 5SWZE 4WW2B 1E0OB 4PRIA 1JGDA 4WHTB 3GJFH 5MP6L 4U7MA 4Z5RB 5D7JC 2V7NB 4XAWL 5I73B 3DETD 1OD9A 5D7LA 1JPST 5GHWL 5I30L 4L4JA 3I9GL 4PJ9D 4KJQC 4PRPD 3RI5F 4HX1A 5C71A 3EOTL 3SBWC 1UC6A 3DX7B 1DDHA 4BA8A 3DJ9A 1LD9B 1UJ3B 3RGVA 4XNYL 3HE7B 4KUCD 2ED7A 5ICZA 3OAYK 5J9PA 1FNAA 4JQXC 4BZ2H 4XNMA 5L8KB 5ESAA 3CSPA 1GC1C 3PP3K 2IPKA 2I9TA 1EPFA 2ZCHH 2XOTA 3T0DA 5LBSL 4ZQKB 2QR0B 3QUXA 1UM5L 3ES6A 4CADB 1JYVA 5T33H 1MIEL 1UM6H 4ZOAA 5E0QA 4WTZG 2X1XR 3S35L 3MLUH 4P4KC 4AM0A 1PZ5B 4YDVB 2JKXA 3BESR 5DWUL 5D70L 1OP5K 2XIDA 5EO0B 2CUHA 1CDCA 2P44B 1A3LH 4ZO6A 2G9HA 2V7HB 3CSGA 4XVTL 2A6JA 5IW6A 2QHRH 3DURA 1FVDA 2X9XA 3L9RA 5CSZA 1KBGH 1QLEL 2P48B 5JLZA 2M26A 6FABL 3SKJL 2DL9A 4ZUVA 1ZTXH 5BMFL 1HINH 4POUB 3OTTA 1VGEL 4JZNA 3EBAA 1IQWH 3PGDA 3ZDYE 2W1NA 3W9EA 4C83B 1W0WA 2BRQA 5EU6B 4LF3A 3RWIA 4Y16C 1AKJB 4QRQA 3BIAX 1BAFH 3ESVF 4UDTB 3W0WE 1L9MA 3CX2A 3IDJA 4HIIB 3F7RA 4RIRB 1UA6L 4QHLA 2OZ4H 4XPAH 4EIGB 1MCDA 4L4TE 5D6CA 3D39D 2AXJA 3DSFH 1IZJA 1CWVA 5GGUB 2H8PA 1UZ6E 5AZEH 1HIMH 4F58L 1SYVA 5E8NB 1UXWB 1AR2A 1OPGH 3O2WH 1I3GL 4JM2C 5LJYH 3KYKH 3G5VB 4ODUB 4OZIF 3G5XB 4TTDD 1LEGB 1I85A 3OGOE 1F4YH 4HWBL 4R7NA 1ZLWH 1FGVL 1DZBA 1YQVH 2KUTA 4MXVF 5I18H 1EGJH 3NMEA 4TUOA 1X5LA 4XAKE 1QD0A 3ULVC 1CDYA 4OT1H 4GW5A 3NCEB 1Z9LA 3K74B 4FFYL 1SM3H 5C07B 5FO7B 4XVJL 3UTPD 5HGBA 1OAZH 1VFOA 5KVEL 5L2KD 5C0AA 2EKJA 4C56A 3FO1A 2WAHA 2AW2A 3WS3A 3WUWA 4EJ1C 1NAMA 3S96A 4GAGL 1D5IH 4G6FB 4WEMB 3QA3B 2AK4E 5DYOB 1KENL 4LEOB 3PXJA 2Z31A 1JGEA 1P7QB 3D87B 4L8DA 1MAJA 2IFGA 3PJSA 5ID0A 3BEVB 2GK0B 5T1LD 2CMRL 2UVFA 4K8RC 3X3FH 4QO1A 2D03H 2NXYC 2V2TA 1OLZA 3HRPA 5CP3A 1YA5A 3U4EB 4MJ5A 5F88A 1I1AD 4HQQH 4P49A 4RGNC 2NW2A 3KJ6H 3UTZB 5GGVL 4NQEB 3OX8A 2VR4A 4NT6A 4PJGE 4PFEA 5DHVA 2R1XB 5DSCB 4NHCL 2F5AH 5IMOA 3ZSSA 5HHNB 4RNRA 5KSVB 4GT7A 3MUGB 2FX8L 4DAGL 4ORZC 5TE4H 1OP9A 3LEVL 4G9DB 4OCXH 4BZ2L 4DKDC 1J10A 1Q72L 8FABA 4UDUA 4NKOB 1SBSH 25C8H 1J1XH 3N1GC 3GO1L 3MRJB 1U3HA 4PJIB 2JIXD 3VWJB 3MX0A 4OCWH 1S7QA 1HQ4B 1C08A 2VXQL 4NC0B 5F97E 5F7LB 3ZTJG 3FFCA 4I9WD 5HTSA 1OAXH 4RZCB 4P2QE 3WD5L 3PWUB 3WFDH 4MB3A 1ZT1A 1XF2B 1FFQA 1QSED 4E5XA 3BP6A 4UI2A 4JY5L 4X9IA 4X7TA 5D71L 5IVXF 4QF1A 2Z93A 4QRRB 1A3LL 2HVJA 3N1QC 1U92A 3VG0H 1OL0A 1FZKA 2HKHL 2P49B 2HLFD 3BQUD 5GRJL 3ZO0A 2VQTA 3RUGF 3ARFC 1PEWA 1NFDE 4PYGA 5C0EB 1MY7A 1MCIA 5HI4C 1RVFL 1WWBX 4Y0GA 5LGHL 4PUBL 3GDBA 5EZIH 4YXHH 5FF6B 1XIWB 3REVB 1MCHA 4HCRH 3MV8B 4Y4KC 5DQJA 3CH1B 5I1HH 2CJUL 1A6ZB 1YEKH 4KROC 3G6DH 4R0LC 2MPAH 3O8XB 2BNQB 1F42A 1NGPH 2DJSA 3SGKA 2ZUYA 1CS6A 4HGWB 5EO1B 1LK3L 4ZFOL 5MEOA 4LOUC 3WO3B 5EC1B 1H3GA 2JJWA 4PV8B 4N0UA 3T77A 1FDLL 3FB7B 3RDTC 3G5ZA 4PRBA 3VI3E 1RK0B 3RX8A 4P3WA 2OJZH 3O2WL 2Z0BA 5T1KB 1Q0XL 4AT6A 3MRGA 3L3DB 1BX2B 5F7EH 3OHXA 4MS8C 2WK2A 1TQCC 5FM5O 4DUXA 1U8NA 1YY9C 2R2HB 4ZDHB 4PJCA 3RNKA 1KPVA 2MQ3A 4IRSD 2OX5A 1JN6A 3P9LA 5H35A 5IHZA 4NZRH 1R3HA 4JN1H 2VLMD 4LIQH 4OKDA 3T0EB 3TGXA 4J1UB 4JHBA 5JXEA 2Q7YA 5KANI 1A7OH 3LS4L 4JZJB 1YEFL 4UILH 2BDNH 1S8DA 4QXGL 3U0PB 4DKEH 2ADGA 4PJAA 4XNUH 1OAZL 4PJDB 4WO4D 1NBVH 1BZQK 1K5NB 5EC2B 3B5HA 3QO0B 3JV6A 1NGXA 3LQZB 4I18C 5CILL 3UTTD 2BSTA 3C2AL 4B41A 4LSQH 4PJEA 1YNKL 1BJ1H 3HC3H 4MJIE 2QL1A 2BJMH 5T3XD 1B0RB 1RSFA 1G7MB 3H3KA 4ODWB 1Y18B 2FSEA 1IC5L 4FQJL 1HHJA 4LNRB 1IEAA 3H9SA 3JTTA 3QIBD 3ROOA 1CXIA 1KCUH 1X5AA 3CSBA 5D5ME 1U91B 2D03L 3QZWA 4Q2ZA 2NY1C 3WNPA 3RNQB 3OGCA 3F12A 5JHLH 4S2SA 4JO1H 1IEBB 4HQQL 3BGMA 3KJ6L 5KVMC 2R1WA 1Z3GL 1WUNT 2QSCH 4MWFB 2GITB 4ERSH 4HBQA 5CEXB 5F7HA 4RMUA 2VWEC 1ZAGA 3CVHL 5FO9A 2W0FA 4H5SB 3LKPB 4NFBA 3OV6A 5HHQA 4JFFD 4MNQE 5TE4L 4WENB 2FHBA 1WCQA 1F97A 3TZVC 2X4SA 3OQ3B 2X4TB 3ULVE 2Z91A 3UPCA 4DGYL 5FDYA 25C8L 1J1XL 2R0KH 2P5ED 4HJJL 3FT2B 5E6ID 1J1OH 1OT1A 4PJFF 4DN3L 3QEGH 4G80B 3UYRH 4WNQB 4A6YA 4YLQT 5CEYA 3L95A 2CXKA 1UYWH 3HZKA 3ZDXE 3GB7B 1LDSA 5I1LB 2AAVA 5GGTH 3OAZH 4YEFA 3T1FA 4C4KO 1FAIH 2W65A 3BH9B 3U7WL 1JHLH 1CFBA 3E0GA 2XA3A 1DVFC 2A2QT 5D1QC 1XFPA 4Y4FD 1UWXK 5I8OH 4J6RH 5FGBA 4GRLB 1H3TA 2FHFA 1LK2A 3A6CL 4UQ3B 1YJDH 2VDPL 3T65B 2VNCA 1I4FB 4DWHA 2ICWB 4AEIL 4ZAKD 1RK1A 1CZ8H 3BZFB 3PP4H 4NQDD 5DJCA 4LCWA 3V52H 4G9FD 4PJ5E 1CLCA 4YXHL 1FPTH 3BKYH 1LEIB 3EFFB 4OCRL 4RGNE 1VFBA 1L0QA 1RZIA 2EZ0D 4LDEB 3EYQC 1ACZA 4JHAH 1YEKL 4PJ7F 3G6DL 2BFVH 2D4DA 1KJVA 1N3NB 2MPAL 2P7TA 1QLRA 1SJEA 3G6AA 4ZOEA 3DGGA 1DJSA 3K3QA 4P48A 4QNPE 4KDWA 5GRUH 1IAKB 2JELH 3A6BH 3VE0A 2OXGA 3IJYB 3Q2CA 1MUJA 1KEMH 1AGCB 3NN8B 2H32B 3JWDC 4DEPC 4OFKA 1KCRH 2R0LL 5TDOA 5BJTB 3F7YB 2BNRD 5D2LA 4IS6B 3EW3B 3EDJA 4I2XB 3D3VD 3WL9B 5KOMC 2XNAB 4JFPB 1MCOH 4GRWE 4GMSH 2Y6SD 4GJTB 3NGBC 5FUOL 3PIQB 3O9WB 4LGRB 2K9UA 4EN3C 3FO2A 4PJHB 1KJ3L 4DVBA 1CFSA 4JFEA 4D94A 5CBAB 3VFOA 4LIQL 3S35X 4YFLI 3S3JA 1U95B 2DRUA 2ITDB 1TZIA 5F6HJ 2UUDK 4KTDH 1B0GB 3VFMB 1BD2E 1YPZA 2HWZL 4RFOH 3NFNA 1N2RA 1MSPA 4Z9KB 2GUOA 4H26A 3DBXA 4L8SA 4ORGA 5HY9B 5IB3A 1JNLL 1R3IL 3AUVA 3OKYA 1ZV5A 4LSQL 2E7HA 3BUYA 3UJJL 3HC3L 4IDJH 3DUUA 5L7XH 3SDAB 4LLMA 1VSCA 1I7ZA 2ZKHH 1TETL 3O3EB 5HBBA 1WCBB 4FP8H 3V5HA 2CIIA 4PJXB 3TC9A 3VXQA 1JPGA 5DJDB 1QLFB 1SY6L 4U2ZA 5F1IA 3AXLA 4TUKH 1TPXC 4KDTA 1VGKA 4GRMB 3AY4A 4HT1H 4MMZC 3NCMA 1V05A 3EJYC 1CGTA 2CO7B 4NN7C 4XPGH 3IJHA 3QDGA 2HYMA 5CJQL 5JA9A 5EOCJ 4PGBA 4XHJC 1NCTA 4ZNEE 3ARBC 5GRYA 2FECI 3IKCA 5F7DB 1TIUA 4B7IA 5LGJA 4P2YA 3QDJA 5KN5A 3P0YL 3RWEA 5F7MC 5I6XC 2E8ZA 3TT3H 3L7FA 3ECBB 3FO9B 2D9CA 2DAVA 3MRCA 1DUZB 5DD0L 3VD3A 2I9LB 4OZFB 4NO5B 3UYRL 3ZYJA 3O0RL 3O6FC 2I07B 1I8MA 5F7FA 3QCTL 3CDFA 5JHDE 1GZQA 2CLVB 1XGUA 3QCUL 3RTQB 4KK6D 5T1MB 5LAXB 4KH2A 4PB0H 5T5NF 1SVCP 4GW4B 5HHXH 1RJYA 4NO0B 4P9ML 1WFTA 3MNWA 3PL6A 1VESA 2EECA 3BJLA 1LO2H 3IU4H 2XN9D 3GM8A 5IB1A 4J6RL 3QFJD 4OD3H 3P4OB 4PD4J 3NIDE 3FAXA 5F70A 2OSLA 1U93B 2F5BH 1J87A 2MWCA 1T21A 1VB9A 3UJTH 2F15A 4JJHA 4YGAB 2CXGA 2VDRL 4NKIL 1H3XA 5LXGL 1S9KC 4KJYA 4YBQD 2QQKH 3T1WA 4ZYKA 2BFVL 3QUKA 3NAAL 4Y19D 2P8LA 5L8LB 1T4KB 2HJFB 1FFRA 2JTDA 2VWEE 3EHBC 3SKOB 5F7KC 2ADFL 2JELL 2A83B 4ELMA 5DRXB 2DLFH 1K3IA 4XPFL 4GBXA 2Y07L 2YPLB 1NCWL 1KCRL 1OAKL 1RPQA 4HPYL 4LLUA 1NLDL 4N8VB 4W6YB 1FNFA 3UYPA 2D7TH 4M93C 2MMXA 5D1XD 3ETBF 3QIWA 4BUHA 3G6JE 1AC0A 4O9HL 2FZ3B 4M7KL 4PJBF 3RX7A 1EJOH 4LKXB 4U0RB 5EA0L 4YXLL 2VJXA 4Q6IC 3FO0L 2X4PA 2QHLA 4OFYD 2PCPB 4CDGC 4KTDL 4G7YH 4GW1B 2UZIH 2H3NB 4M5YH 2C3VB 5HI5D 4F3FB 2EYRA 1FNSH 4Z18A 5KSAA 4HIEB 4LRIC 2WUBH 4P5TC 2R4RH 4XXDA 4XWOC 4UT7H 3V6OC 1EFXA 2I5YH 1V8HA 1JGLL 1ZE3C 3BI9X 2VL5B 1W8NA 3TJHD 4OLWH 1D7FA 4F9PC 4N5UA 3KPPA 4RA0C 5BVPH 5I8EA 1U58A 3QNXB 5KW9H 4JQVA 1CFQB 2YD6A 5I19H 3HE6A 5FYLH 1REIA 3DO7A 3D25B 5C08E 3MMEA 5DJZA 2W0KA 5HVFB 5FUCE 4WHYG 3FB6B 2AXHA 3EFDH 3RY6C 3MLTA 4HT1L 2LE9A 4QRSA 3E3QC 1LE9B 2R2EA 2FBOJ 4FQ1L 4OLXL 4MJ6A 4LPWA 1RJZB 2WINA 1YNTA 1J9CT 1H8OA 2AQ2A 5DDHA 5EOCL 5HGHB 1G9NH 1B4JH 5FYJE 5SWZA 4M6ML 2MNUA 1I1AB 4JDZA 4RA3A 2QSVA 5CWSB 3HNSH 1QNZH 4H1LB 1FL5B 3B5TA 3H0TB 4F2MB 5C0DA 3MFGB 2E27L 3QYCA 2B1HL 5SWSE 1HKFA 5EDXA 1EHXA 2IH3B 2C7UA 4OM1L 4F7EB 4HH8A 1FV1A 3BFOA 4JO2H 3ZDYF 2PO6B 3RVTD 3KYMA 4NBYB 4YDLB 2J5LB 1WFNA 3NTCL 1FYTB 5EBWA 1UWGL 4XVUC 1QA9B 1A6PA 4RDQF 3SDDC 1VEMA 4PRID 1DBKH 5HHXL 3ULSB 2P45B 3KPOA 4NGHH 3VRJB 4Z7VE 4DGVL 1F11A 3OKOB 3SCMC 5HYEA 4F15C 4KVCL 5D2NA 1OW0C 2FWOA 4WVRA 5D7LD 4U1LB 2DB8A 2DBLH 5T3ZE 1FFPA 2YA1A 4EI6A 2FB4H 4BQCA 2W9EH 4Y89A 2B2XH 4MQXC 2DMBA 3L3GB 3UJTL 1AY1H 2F53E 5ACLA 2NZIA 2X4UB 1FCCA 3SJVE 2AJXH 3GNMH 5F7WC 5GJTH 1FCGA 5C86A 4YHIA 3CFEA 2F8OA 3BPCA 4MAYC 1JMZA 4U6YB 3QUXD 4H25B 2B7DT 1NCCH 2HKFL 4FS0A 5IB2B 1ZT4B 5JIIA 5FM4A 5A1AA 4PGDB 3FONA 1HXYA 1T1XB 4PGZA 5E8PA 4JG1L 4HUWB 1OT2A 5C3TA 3VD9A 1F4WH 3CFKB 1G7HB 4UU9B 5FHBH 1TQBC 3W0WA 2EIEA 4HK0B 1R5WB 5EZJB 3S3PA 3UJIL 4BM7A 4L4TA 2RFXB 5K59F 3RZCB 2F19H 1CT8A 3O81A 4AEFA 3L5WA 2FR4B 4HW6A 4G8IB 2XWJB 5GRVL 3BSZH 3DUHA 3RWDA 2R29H 4M5ZH 3WUWG 2EDDA 3MCKB 4OF0A 1J8HE 5GZND 4OF8A 4G7YL 4JPKH 3GGWB 5HHMB 4M5YL 1FNSL 1R3JA 1N64L 2CRIA 2V17H 1RHHB 3T3PF 1HILB 3CX5J 4LCCA 3RVWC 1AGFA 4FQXA 3TBVA 3H3BC 1GOHA 2VIRA 4LBEB 4RMQA 3TVMA 2C3XA 1N6UA 5IKCA 3QDMA 3OKLB 5D1ZA 4Z76A 5BVPL 1K8IA 1LILA 2WW8A 2IQ9L 5GISL 4OCYH 5KJRH 4JRXE 3KPSE 4IM8A 4NNPL 5I19L 1MQKL 2K7QA 4HKBB 3FCTA 3KLAB 1HEZB 2YEZB 3D0LB 2V9QA 3GMOB 2ICWJ 3IYLW 4RBPK 2HTLC 1CXFA 4QY8B 4PLNC 1ZS8B 3SDXB 4YDIH 2AK4A 2DMCA 3U6RA 4TRPH 2OL3A 1A1OB 4DFHA 3DV4A 1KPRA 3GM0A 4HJGA 2J8OA 3EAKA 3QIBB 2GKIA 5E9DE 1IM9D 2V9RA 3ROLB 5F3BA 3DXAB 3VFNB 2IQAA 3OF6A 3MBEB 4TUJB 3MLYL 1KCVL 2XTJD 4X6FB 3P9MA 5C0AD 4C56D 1Q9KB 1QNZL 1XF5B 4EVNB 5L9DH 3BWAB 4Z95H 4XMKH 4Y5YA 1AP2B 2H32H 3BPOB 3VWKA 1EMTH 1FFNA 1KIRB 3GEWB 5B3JF 4PJGA 4V2CB 1J8KA 5CKAA 3CXHJ 2BMKA 2WSKA 2Z31D 1J7VR 4JO2L 4P2RA 2W60B 2X7LA 4YO0A 1R3KA 3LHPH 3O3DB 4ZS7H 8CGTA 1HOCB 1S7XB 3V6OE 2IPUG 5FA4A 1X7QA 1HSBB 2VDQH 4HIXL 3MRHA 2P5EB 1FSKC 3LN4B 2ZG2A 3U46B 4E41A 1EZVX 1JRHH 2Y5TA 2WV3A 3E6HA 5CEZH 1YQ2A 4ZTOH 1M7DB 3WFZA 4MD0B 5M7QA 1MCNA 4Z7WE 3FOLA 1RAMA 4JFDB 2O5XH 1D5BA 1UGNA 4P2QA 5C9JB 1I1FA 2MCG1 4S1RL 4WU5A 3BPNB 3MR9A 1ODAA 2AV1A 1P53A 2BSSB 3MV9E 1A22B 3K2UH 2PTTA 4L5FH 3D9AL 3HFMH 5I0DA 4ODSH 3QEUB 3WCYA 1WBXB 2R2CA 2YHGA 4FOMA 4ODBD 1FL3B 5C0JA 1U3HD 1VADA 4KTEH 1NFDA 5F9WB 4MA1B 1S7UB 3FFCD 3BGFB 1NCCL 4OD2A 5ISZE 4NUGH 1TTUA 4KKCC 3ILQC 2VH5L 4L8CA 1NPUA 1YZZA 3OG6B 2Y7QA 3F5WA 4TQEL 3TN0B 1DBAH 2VL4A 2BRRH 2DIAA 4M7JH 5J1SC 5KAQG 4RWYL 5JO5A 2KZWA 3OWEA 3SBWA 5F7UA 5KVGH 1UXSA 1AD9A 4O2EA 1KJ2A 4HFWA 5I1CH 5IBUB 2EEBA 2NW3A 3VFPB 4N1HB 1MCJA 5IROC 1HQRB 1H0DA 4JQXA 3BSZL 1UB5A 3TNNB 1JPSL 1MHEB 1T2QH 4Y2DB 4YFDB 4IMKC 4K3JL 4PG2C 1C8PA 4OZFH 2BVOB 4UZGA 1LO5B 3D3VB 4ODHL 5GRXG 4WV1A 1ZLWK 3AC0A 1V3MA 4YHKH 2ZG3A 3VFUB 2YK1H 3GRWA 4P4KA 3UBXB 5DC0A 3ELAT 4X6EA 4M7ZB 4CJ0A 1UVQA 4EIZC 2X1WL 3P73B 2QQNH 3QZWG 3EYFB 2FEEL 2AI0L 2DWDB 3ET9F 2DQUH 4Y5VC 1D6VH 5EIQA 5LCVH 3PGFH 2FO4A 4N0CC 1M05A 5CLTA 3QPXH 4JM4L 2VE6A 1TZGH 2YPKA 4LLYA 3NIFE 4KMLB 5EFIA 4GKZA 1W0VB 1F6AA 3M17A 4PY7A 4YDIL 3CVIL 3P4NA 3MRDA 4FHBD 4TPRH 3RRQA 4LAQH 4HAGA 1LGVA 3ZDXF 1EIBA 3MNZB 4Y16A 3D18B 3IFNL 3VXSE 3W5MA 3CSYA 2WBJA 2NY3C 5ITFA 4XGZB 2VQ1A 4Y4HB 3HB3C 1U8MB 5D5MA 5DD6A 5B8CB 1X6LA 1N5AB 4YWGL 4FTVB 3V0AC 3W11C 1D5ZB 1GGYA 2R23B 3DX9B 3NBNA 2D31B 3ULUL 5L9DL 1IGTA 1R24B 2DQJH 4Z95L 4XMKL 4HMDA 3ZE1F 4JM2A 1A7NH 3ZT5A 1A4KA 3HMXL 4WFGE 2XZAL 4PIRF 2A6KA 4MCYA 2DQTL 3U4BL 4IRJA 5DQDL 4KRPD 1J05A 3N85L 4IIQA 4NQXA 4KI1A 4ZS7L 3S36H 4MNQA 4O02H 4X80H 4OFVA 2NY2C 4APQC 3ARZA 3SE4C 1YEEL 1KIQA 1FFOB 3WS6A 3R1GH 5D96B 4F80A 4QNPF 1NCDH 2R2BB 1FLRH 3TBTB 4AZ8A 5CEZL 4GAJL 4YNYB 2FATL 5IB4A 4LNVA 4DVRL 3KHOA 1DE4B 1O7SA 3BP4A 3HC4L 2F54E 1S7SB 4Z0BH 4HS6A 2VXTL 1SHMA 1VERA 1SEBA 4P46A 3GSQA 3HPLB 5K9OB 1NFIA 3ZHKA 1JV5A 4ZOCA 3LQAH 3CCHB 2YPVH 1BECA 4DKFL 4GRWF 5A3ID 3ZYIA 2HJLB 4FFWC 3DARA 4ISVA 5FA3A 4I13B 4KTEL 1R5VA 1MCKA 2AK1L 1CXLA 1CK0H 5FV2A 5A2LH 4GG8A 4QHNB 1S7WB 4PJ5A 4FQ2H 4MVBD 2J6EH 2BRRL 3LKQA 4IJ3C 2JJTC 1RMFL 5DRWB 1KXTB 3K7UA 5IQ7L 3MRKB 4QYOA 2WMPA 5HD8C 4KMTL 4JB9H 5GS0D 2XACC 2UYLA 4Z8FL 5ETUA 5L8JB 1EA9C 5GS1C 3EYOB 5EU7C 2BOBA 3X12B 4YDJA 4RAUA 1B6DA 1JTOA 4ZSOE 4LCWD 4ZXBB 3QNYB 5DD1L 4R90H 5HGDB 2VDOH 2PW2B 4F57L 1T3FB 4KJPC 5E1HB 2ZCLH 2BK8A 5DMKA 3OAUH 4QTHB 1UB6B 4P5KB 1U8KB 3GSNB 2DYPA 4BUGA 5LQBH 1FNLA 3MV7D 3K2MC 4GXVH 5GJSH 3QPQD 1NSNH 3MJGX 5BQ7B 3FHQA 4U1IB 1QFUL 2DICA 2B0SL 3JTSA 5GZOC 3MTRA 3Q6GH 1OAQL 1BD2A 2Q86B 1AIFB 2PNDA 1HK6A 4CNIA 4R8WH 5DTFB 2KQNA 1QFOA 2A0LC 4GKNB 4L1DA 3UTSE 3BVNA 5C92A 1RUAH 4HS3B 1MCSA 4GKSB 1HDMA 2CRMA 4X6DF 3GMLA 3I84A 4TTGA 4JRWA 4NCC1 4TPRL 5JOEA 4LAQL 4JFED 1BLNB 4FXGA 4Y4KA 1LDPH 5CMAA 5D8JH 5FK9B 4LFHG 3DVNA 4R0LA 5BXFA 2NR6C 1NGZA 5JW3L 3MFFB 3L5XH 2A6DA 3GI8L 4LVNB 5GS0L 5DRZA 4RCAA 1KB5A 3UAJC 3RDTA 5FGCB 2YBRB 1RY7B 3OJMB 4ONFL 4WUUE 2CD0A 3O11A 3DTXB 2HAZA 4AEEA 4WI8A 3KYNA 4KHXH 4F9LA 4RMRA 3MGTA 4WDIB 4ZNEA 3QJHB 4K3GA 1E6OH 1JF6A 2YKLL 1ACYH 4MA7H 4NN5B 5DQ9A 1H15A 3LKNB 3Q5OA 5F93C 2QQLH 3DMMA 1KN2H 1OGAE 2NY4D 2VDMH 4M1CD 1Q8MA 2WP3O 3VXOA 1IKNA 1BEYH 1AQDA 3O6ML 1CR9H 5JOFB 5TF0A 1IAOA 1C7SA 4HWZA 3V0VB 4TOYL 1NCDL 1FLRL 3WJLA 5J56B 3QI9D 1LP9B 4KTYA 4O51A 1ZHBA 3O3BB 1A6VH 3QDGD 1BOYA 3C08L 4FQHB 4XBEL 4HS8L 2E9WA 3WIHL 3VDAA 1J0ZA 2DQHL 2YUWA 3IT8D 3QDJD 2FX9H 4R2GD 2AXFA 2YPVL 1N26A 3CFJA 4LFHD 5D7LB 2AEIT 2C1OA 4N5EC 3BP7B 2MQCA 1MF2H 3HUJE 2I25N 7FABH 2QSQA 4BSJA 3RGVB 4P2CG 4YHML 1RUPH 5ICZB 3MJ9H 2J4WH 4NBZB 2XZCH 3I6KB 5HDQL 2UWEE 5HGAB 1U3JA 4QHUB 1PX4A 1AQKL 5DJ0A 3TA3A 1CDUA 5A2FA 3ES6B 3QXTA 3PL6D 4HWEL 5SX4I 2ZUUA 3SHSA 3QEHB 3C9NB 3ZYZA 3A0OA 4FZEH 3TESA 1XR8A 1WICA 1HKLH 3QHFL 5FV1L 2PYEE 2DQIH 1BOGA 3OR6B 1ED3A 3BKJL 1EEYB 2G9HB 3GMQB 4LPUA 3PUCA 1KTDA 4J3UA 3S5LB 4NWUH 3C6SA 4KZDL 2ZCLL 1S9YB 2V5YA 2GTZA 4AG4L 3G6JA 4KZEH 4X4YB 2Y4SA 4LVHC 2APXA 3FT4A 4YQXL 1INDL 1DFBL 2AERT 2W9LA 4JZNB 4J7RA 3PGDB 3W9EB 3KPQA 1W0WB 4GBXD 1DVFA 5D1QA 4YPGA 3OL2A 4G8GB 2IBGA 5C0GB 5I1GL 3TJEH 3I6GB 4L3CB 1JYXA 1M6OA 4FXKA 4QHLB 1KEGH 4I4WB 5KS9E 3S88H 1BIIB 3HRZB 4KY1H 3QIWD 1OP3H 5IV2A 3CMGA 5F7NC 5L88L 3PQYA 4P23C 3F58H 4JFQA 3QUZB 5L2JB 1TVHA 3VXNA 3O2DL 5CZVH 4X7DC 3MRPA 2XG5A 3BD3A 3FQTA 4YIQB 2OQJA 4JZOB 5DK2A 2ERJC 3IF1A 4S11A 4XNQA 4UAOB 4N9GA 3W81A 1IAII 3TCLA 3LVEA 1P7KA 4QWWD 1WVZA 5C08A 2J3SA 3LD8B 5KSAD 3UTPE 5EUOE 3AB0B 3BMWA 3TYGH 1FP5A 1E4KC 1EFXD 1A8JH 2BSRA 3CPLB 3TT1H 2BY1A 4YFEA 4GW5B 1QSFB 5ADOH 5HVHC 1YEIL 4U6HB 4DFIA 3VH8B 5BW7A 4YZFE 3UC0H 5IHUL 1BFVL 2BC4A 1XF4A 5TF1L 1YEDA 2B39A 3HE6D 3WIIH 4WI6A 3PXHA 1JMXA 1CD1A 1PGRB 2R56H 4MA7L 3VXUB 4NZUL 4KI5D 1KN2L 2VDML 1ORQA 1BEYL 1EBAA 4X83A 3TIEB 1CR9L 5SWSA 4NJAH 4MX7B 2ZUTA 4WI7A 2GW5A 4TSAL 2KKQA 2G75A 4L8DB 4ZPVB 4M7LT 1KULA 3K0WA 3UO1L 1CL7I 2QKIA 3P4MA 1NDGA 3Q5TA 4OZIB 1M7XA 3B8SA 2IALA 2V2TB 4FG6D 4Z77A 1N59B 4HJ0D 1F5WA 5SWZD 5F88B 5D72L 5AG9A 4PTUB 1U8JA 3WFHA 4UQ2B 4Z7VA 2V5TA 4WUKL 2NW2B 1CU4H 2EH8L 5KSUB 5DHVB 2YMXH 4TNVF 4PD4K 4KRMB 4XBGA 5DURB 1JNHA 2AJYL 4KK9C 4LSSH 4O5LL 4U1MA 4OUUA 4I9WE 5E56A 4HKXA 1HXMA 3O6KH 4QHKJ 1KIPA 4UDUB 2HFTA 2VLJE 4QRTB 3VXRE 4XBPA 2F53A 3VU2A 1B2WH 3BRDA 5I1IL 3P4LA 5AEAA 4I0PB 1I1YA 1ONQA 1S7QB 2J7LA 5I66A 4X7SH 2YD4A 4LSVH 1ZVSA 3NCYP 5EOQH 5HYJE 3FAWA 4WEUD 2HG5A 5B3NA 3HZVA 3ARBA 3GJEA 4HZLA 1KN4L 2H2SD 1VENA 3F6LA 1ZT1B 4E5XB 3BP6B 3CUPA 1RV6X 3MSPA 2LAAA 2VZVA 1HKLL 4QF1B 2Z93B 2ZWLT 1U92B 4D8PB 1DBBH 2O5YL 1FZKB 1ZHNB 1AO7A 4U1GB 3PHOB 5T5FL 2NY1B 4ZUSB 3D48R 4DJMA 1YJDC 1WIOA 1NUNB 4KZEL 3TM6A 5HI3C 1H8NA 5GRVK 2RAMA 4R4FL 1HHIA 3GHBH 4JQIH 4XP5L 5MEPB 1J8HA 1RZKH 3BXNB 1L6XA 4PJ8C 4DKAA 5GGRY 4MXQC 4P3CH 3TJEL 1RFDH 3FKUS 5BO1H 5B21A 5DI8A 2MHAA 4W4OC 3ORJA 1TDQA 2JCCE 3R0MA 3S88L 4WW2C 3V4UL 4L4TD 1A7RH 3WNLA 4LLQA 3T77B 2C3WA 2G60L 5JR1L 5I73C 3F58L 4NYLB 1A0QH 5DGRA 1I8LC 1XF3A 4NZDA 4XPHH 1OTUC 4JRXA 3KPSA 1G9EA 2XQBL 1SQ2N 2Q3AA 5HHOE 5IVXB 2AP2A 1YEGH 4HC1A 1UJ3C 2VLKD 3OJ2C 5I1KL 2L0DA 1EERB 3HE7C 4G6ML 3RNKB 4KVNL 3T4YA 4A2LA 3P9LB 3RUGB 1MWAL 5F6IB 3AM8C 4FQXD 4Z7WF 5J57B 3AREA 4XP9L 3TVMD 1JF5A 1HHGA 3QDMD 5ADOL 3MO1A 3BW9B 5CD5D 3MRNB 2APWA 4PJAB 4LPYA 3CK0L 3CLFH 1KC5L 2GSGB 2P5WB 1CE6A 2BSTB 2VQUA 3MLVH 1QRNA 4K7FB 1UWEL 1CXEA 3QG7L 4Q6IA 3GMRA 1X44A 4BQBA 1BFOB 2AK4D 4YC2B 4JR9H 4XMLL 2P8PA 5DUMH 4KK8C 4L3EA 3H9SB 1C16B 4IMLA 2XXCB 4LRIA 3TO4B 3V6OA 2DKMA 5K93A 3MZGB 3OF6D 5J12B 4E9LA 3Q3GB 1K3ZA 4F9PA 1ADQL 3KPRD 1CFTA 5IVZB 2APTA 1R3LA 2BVPA 4XCEA 3CXDL 1MCPH 1NBYA 3KDMB 3UEZA 4S1QH 3VWKD 1KNOA 1FZJB 2IC2A 4EN3B 5H2BA 3BH8A 1OWWA 2VUYA 1EBPA 1KTLB 4HUUA 3ARUA 4WI4A 5GGSA 3X14A 1MHHA 2H26A 3NPZB 1I7RB 4P2RD 3MV9A 5E03A 1OM3L 2I60L 3VDBA 3QXWA 4UUJA 3RKDD 4LSRH 4LIQE 2X9WA 3RPKA 4XTRC 1AGEB 1TJHL 2RBLA 4E41D 4LCUA 3DLQR 1CBVH 4F7MB 4A6YB 1I7UA 1V7MH 3DWTA 4LP4A 4KWUA 5ISZA 1OAYH 5DD5H 2IGFH 3SDCA 4LK4A 2IFFL 2GT9B 4PP1C 4Y1AA 3VXTA 1G7IB 5D7SH 4G8FB 5C0RH 2PR4H 3R4DA 4NQDE 5I2IA 4G9FE 1D5XA 3P0VL 2AEPH 3NIFF 1PKQB 4R97C 4ODXA 5C7XH 1NLBH 1A6UH 4X0KB 4PJDF 3VFTA 2OL3L 3RWFB 5DHXB 4POZD 3FB5A 2GIYA 2VXUH 5CLWA 5DJCB 1EX0A 3BD5A 3V4PH 4FQPA 1GCFA 4X9FA 3SDDA 1D6EB 5F7YC 3PWLA 1S9WB 2C4XA 4JO3H 4LVOB 3WFBH 4P3CL 4LHUB 3WFEH 1EZVY 1PQZA 4PJFB 3M8OH 2ADIA 3TBYA 5IJVA 2DQDH 1A7RL 3EGSA 2MCPH 2APFA 4DTGL 3ZHDA 1QBAA 4MA3A 4OLYL 1MFNA 1NKOA 3WMSA 4Z7OE 2EDNA 2OS7A 2Y5EA 2CDEB 3GMPA 4PG9B 1V7NL 5IESH 1JK8B 5L0QB 4X9HA 5E94B 3D2UA 1WTGT 3DUSB 1IQDB 4QTIL 3BT2H 3FO2B 2EKSB 4P4KD 1T1ZB 4K2UH 1WLHA 1G9MH 4ZFFB 3VWJC 3KHQA 4M1DH 3VXSA 1TZIB 4IEFB 4R26H 3BP5B 4V1DE 2YD7A 1YPZB 1YYLH 3GSRA 5INDB 4Q0XH 1IGMH 3DBXB 4LSTH 4CW1A 4EBQH 4MDIA 5IFHL 4NRZA 3BD4A 1DQQA 3MYJA 1EEZB 4PJ7B 3RL2A 1ORSA 1HNGA 3BUYB 3BIKA 4NKMA 1PKOA 4OKVA 4I8DA 3MROB 3HMWH 1VKXA 1MIMH 3O4LD 4GG6E 4JR9L 3D85A 4LLMB 4QT5B 5JOPD 4WJ5A 5TH2B 4Y16D 4KU1A 1JZ3A 2WBJD 1I8IB 3DYOA 3LSOA 3V5HB 3GSNL 3KYAA 5DFVD 1JGVL 5EOTA 1F2XK 3VFVA 3BRFA 4LSUL 1KJMA 3RJQB 1RJLB 4E0RB 2QQQA 2I24N 5CBEB 4I3RH 5EWIL 3B9VA 1C12B 3IJHB 4S0TD 4JM2D 4PGBB 2HRPH 2EIZA 4HKJA 1GPOL 1VACB 5HJ3B 1G9NC 3IKCB 4Y5XA 3L3OB 4BFIA 1GC1L 4LLVA 5BS0D 2F54A 5GQBA 1J1PH 4IRJD 1W72B 4PR5B 5KSBA 3W2DH 2X44D 3DVGA 2NLJA 3V6ZB 3VXMA 3L7FB 2VXSH 4X7CC 3VD7A 3MRCB 3ULVD 4FFVD 4BH7A 3ZE0F 2DTSA 3DYPA 3PHQA 1A1NB 4W6XB 1VFUA 1MPAL 5LGKA 2XFXB 3QG6A 4N0YH 3LKOB 5IIEA 4O2FA 5AZ2L 1V7ML 4BQ9A 2XN9E 4PRHD 4AY0A 3LPWA 3KXFB 1T2XA 4IHOB 3DHJA 1OAYL 3RWCA 1JWSB 1Q9WB 3SPVA 3IETA 3HAEB 3T0EC 2W0PA 3O45A 1WJ3A 1WBYB 4P46D 1YN7A 5MENB 5F9OH 4YHYB 1LEKA 4JZJC 2XG4A 4TULH 5DK0A 5IB1B 2DMKA 5IR1B 5ENWA 4E42A 3D69A 3UZEA 1UACH 4X98A 1BF8A 4X6CF 2E8YA 1SMOA 1A3RH 3X11B 3UROR 4Y19E 4WWKB 1XGRB 4L29B 1NAMH 3O3AA 1VFAA 1T21B 2OR9L 5I74B 4HIHA 4K8RD 4ZSOA 5I0ZA 5E2UL 1Q9OA 3REWA 1DUYB 2ESVB 2R0WL 3IFLH 4KJYB 1BBDH 4JLRA 4RGND 4OCSH 3HKFA 5AUMA 2ED8A 4BFBD 2VUOA 3ESUF 5GRWA 4KKBD 4MD4A 2DQDL 3VXPB 5CP3H 4NNXB 2MCPL 4ELMB 1MY5A 4Q6YA 2GY5A 3TPUA 4JANA 3IU3B 5JIHA 3T2NH 4LLUB 1ZVHA 5J13B 3G9VA 5HHPB 5DHVH 3IDNB 4ONHA 3MXWL 4NOFA 2PXYA 1QYGH 2XKNA 4OAWA 5FCUH 1UM4L 3JV4A 3OPZH 5A43C 1FE8H 3IXTA 3KPLA 4HHAA 4F15B 2JB6B 2GJZA 4LEXL 1FLTX 2HTKC 5HVWA 1FO0L 4F7TB 1M71B 3BT2L 4KJWC 1CQYA 2DYPD 1OSPH 4K2UL 3STLA 4MJ2A 5CIPA 5IGXL 5C07E 3LIZL 4R26L 4UIMB 4CMMA 3FTGA 4NHUA 3ZT7A 1TLKA 4Q0XL 1BD2D 3FN9A 4KUCF 1E28A 1S7TA 3V6FA 3RPIA 1HHHA 1M4KA 5C09B 4JFOB 4J3VA 4MD5B 3KPPB 5HI4D 1CTNA 4U3HA 1IKFH 5I8EB 4IMKA 3VGHA 4FQLH 3HMWL 4EOWH 1MIML 3CDCA 3HA0A 1OLLA 2APVA 3DX6B 3MJ8A 4HDIB 2VABB 1OD7A 3HE6B 3KR3L 5F89B 4Y4KD 3GMMB 3VGFA 1I9EA 3I3EA 2PUQT 5DJZB 4KROD 1PSKH 4DQOH 1EO8L 5F1NB 4D0BA 3RAJH 1LQSR 4WY7H 5HYSG 5FKPA 1OGAA 4EI5A 3MLTB 5DEGB 4S10A 4PLJC 4R3SB 3KAAA 4UMGA 4XCYB 1DSFH 5ALBL 3RDTD 4NQEE 3QO1A 1YNTB 3WHXB 3QAZB 3HNVL 1KTKE 2YC1A 5EIIB 4XI5D 4Y5VA 3S4SA 1JHKL 1NEZB 2AV7A 3U0WH 4OGAD 4H0IA 5DVMA 5LWYH 3W2DL 1G7QA 3UPRA 1NJ9A 2IAMB 1XGYL 2WUCL 1JUFB 2CKNA 3DMMD 3TYFB 3UTQB 1P2CA 4PJIE 4H8WH 1RZ8B 5J0BA 1Z2KA 4HWBA 4N0YL 1HN1A 3HUJA 3KWWB 4AH2A 2HRLA 3KYMB 4G6AC 3CC5A 3F7VB 4KAQH 3O9WC 5E8DL 1AD0B 1A2YA 2OJEA 2WP3T 3GSVA 1GGBL 2UWEA 3AU1A 3KPOB 4X99A 4X4XB 1CLYL 4IDLA 4HKZB 1U8HA 3CH8A 1FG2A 4MB5A 4TULL 2FWOB 2J8UE 4HFUL 5EORL 2Z35B 4P9HL 3RJDA 1RUMH 1UACL 4X6BB 2RB8A 1FFPB 4UTAH 2WIIA 5FOJA 2D7PA 1HYSC 2WBKA 3WXWH 4HLZG 3JWOH 4APQA 2PYEA 3SE4A 2KZ1B 4YJZL 4PB9L 3MV8E 3SDAC 5EUOF 4N8CL 1T0MB 3IDGA 4MA8H 1KB5L 4YHIB 4ENEC 3RIAK 3TA3D 3CFEB 4YBLB 5J6GA 2EXWC 4GSDH 2FIKA 3OZ9L 2HFFA 4UV7L 3AVEA 1JTTA 1QBLH 5JUEL 1O7VA 5INCB 2VITB 4NWTH 2IADA 4YZFF 5E8PB 3NA9H 3OKMA 3WKNA 5IWLA 3T2NL 2EYTB 4NUJA 3ZE2F 3NH7L 3W0WB 1U8LA 2GCYB 5C3LD 4O4YL 1UADC 5EU3A 3MRQA 1FSKB 3V0WH 5IG7B 5KS9A 1CLOH 3BKCL 1JNNH 1CXHA 2YR3A 5JW4R 3L5WB 1R0AH 3VMOA 4D9QD 2H1PH 4BSVB 4JKPH 3T0EE 1OSPL 4X4ZA 4OV5A 1P69B 4QEGA 2YSSB 3CMOH 1FZMB 2R9HC 4F37K 5DJ6B 1WAAF 1E4XL 4A6YH 2QTEA 1WQVT 1DVFD 5D1QD 3WIFB 3BHBA 1EXUA 4HXAH 4LCCB 1QHPA 3TBVB 2VIRB 2FL5A 3TVMB 2X5PA 5IKCB 1AGBB 1H3VA 1DLFL 2NYYD 2MKWA 3QRGL 5D1ZB 4Z76B 2WWMD 3PQYD 1K8IB 4FQLL 1JWUA 3PWJB 3VFSB 3EO1A 3ZT6A 2JK5B 2HJKA 5D7KE 3PNWB 4HF5H 1N6VA 4J8RB 4UNUA 4KQ3H 4NZTH 3EYQD 1UKQA 2X2YA 4OFDA 3TO2A 3WO4B 4LDLB 5C08D 5D9SB 3O6LH 3TPKA 4RFNB 2XA8H 4FQIL 4P57A 5DHYB 4LP5A 4LSDA 2XTJE 5F6HI 4O58H 3FQWA 4XCFL 3C5JB 3SE9H 4P59H 3FHAA 2GY7B 3QEQB 5E5MB 3QDHA 4OIAA 5F3BB 2IQAB 2WLZA 3QQ4A 4ZFOA 1GIGH 3P9MB 1F00I 2PKDA 3LN9A 1SJXA 43C9A 5FYJD 1NCBL 3T8XB 4Q74A 1RUQL 2VDLH 4CVZA 4XVSH 1FNEA 4JY6B 1FFNB 4OM0L 4XHQA 2CIKA 4ONGH 4H8WL 4LRNL 4D2NA 5SWSD 1GJIA 2JIXA 2NNAA 4R4NC 2N7BA 4OLVH 3MRFB 1MRFL 3TP4A 3R06A 1GZPB 4NQSB 5FA4B 2Y72A 1P4IL 3QP3A 1HYRC 3VFWA 4U0RC 4ETYA 3RKPA 2VLJA 3VXRA 4AIZA 2W0LA 1ZSDA 1BQSA 1ZHKA 5GS2D 3RU8L 2DDQH 3LKRA 1MJJA 5HYJA 4CRPA 3FOLB 5E8OA 1RUML 1D5BB 4P2QB 5HPMA 1QR1B 4WU5B 3MR9B 4MNHB 3IDXH 4G5ZH 3WXWL 5J1AA 2PTTB 3MA7B 4K3DH 1ZA6A 3LQAC 4X5WB 3WNKA 3RHWK 3EYVB 2AEWA 1F3DJ 2X4OA 4OZGA 3CDGB 1CGXA 3G04A 4RFEB 2W91A 1RD6A 2AABL 4MA8L 3WXVH 5JW4Q 4C57C 3EJYD 1Y6NR 2V2WA 3PG2A 5IM7B 4NRYB 4JE4B 3JWDL 1WZMA 1PY9A 4GSDL 1DQLH 1AFVH 3ARBD 1YUHA 3GSUB 5E99H 5C0BE 4M02A 1X4YA 3ULUE 3SDXF 4HGKC 1GGUA 4X9GA 3MRBB 1XCTB 4ZUTA 3GSWB 4YR6B 3QT2A 2HMIC 4I2XE 2NY2B 1AO7D 2JCCA 3CVHA 1VA9A 1W72H 4JO4L 1I1AC 3O6FD 3U9UB 4HFWB 1OP3K 1TJGL 3CFBA 5ITBH 4U1JA 3R8QA 3LS5L 2ICEA 3WN5B 3FQRA 3RHWF 3CMOL 2VAJA 3H3PH 5CEZE 12E8H 5HHOA 4WV1B 1J8HD 2PO6C 1F3JA 3GJFB 3MRLB 2J5LC 1J86A 2F74A 4OD1H 4HXAL 4U6XA 1U8PB 3UTOA 3MXVL 2B4CH 1J12A 2NTSP 1PZUB 2RGSA 1QACA 3HAEH 5DJYB 5AYUL 4YE4H 1QEWA 4YHNA 5HHVL 3NACL 4AK1A 4PJCE 2F58H 1L4IA 1OQXA 2W59A 2GFBA 4XZUA 5DT1H 1S3KL 4JRXD 1T04A 2FO4B 2ZSWB 4ZPTA 5EIVA 3E6FA 5CD3B 5DJ8A 2XA8L 2EYSA 4Z7UF 4G3YH 1ROWA 4GKZB 4X8JB 3EHBD 2FLRT 1Z9MA 4CVXB 4J4PC 3M17B 4MJIB 1WBZB 1PEZA 2DLHA 1E6JL 3MOAL 3ARED 4P59L 3ARRA 3CSYB 1FL6A 1X5XA 5FECA 2EDTA 4N0FA 5B39A 4RGOL 2GTWB 3HR6A 4G7VH 4UINL 4OQTL 5D5MB 5HYIA 3FQUB 4JY4A 5DD6B 2A73A 3DRQA 3WSQH 1FVCA 4GUPA 4BZ1H 4P23A 2ZJSL 3L3KA 4U0QB 1MEXL 1CVRA 1N7MH 1E4JA 1OB1B 1QRND 3OKDB 1BF2A 3B2UC 4NC1C 5DVOA 3I75B 1FJ1A 4MCYB 4IRJB 5CJXA 1J05B 3RZCC 1S7RB 3HC0A 1I3RA 2YD2A 1YMHA 1LE5A 4IIQB 4L3ED 1BZ9A 4MNQB 3HNTH 4WW1A 5EZLA 2VZTA 1RZJH 4XWOD 2Q8AH 3IFPA 3NZ8A 4U6VH 4ACPA 2AKRA 4DCQB 1T20A 3E1F1 2HLAA 3TCXA 4C59B 4AEHH 1EAPB 3NFSH 5AD0B 3BZDA 5B38A 3OXSA 5J4MA 4Y4FA 2BZDA 2DOCA 3QUYB 2PYFA 3FRPA 3KPTA 1XZ0B 1II4E 2R0ZL 4CU7A 4HS6B 1SEBB 1PAMA 5IMLB 4M43L 1CGSH 1BM3H 3MV9D 3BN9C 4OCLC 5EBLB 1U8QB 4NQDA 1IT9H 4P3DB 3MGOB 1MI5B 4W6WB 4WO4C 4OI7A 1IM3B 1AJ7L 1AE6L 3L3IA 4LU5L 1P9MC 3U7YL 1L7TL 4L9LA 4LASH 4H88L 5DS8A 2X1OA 4FQQB 4O2CA 1DQLL 1SY6A 4K23L 5GGRB 5ISZD 3DX8B 4PJ5B 3F6IA 1IC1A 3GUTB 2Z4QB 3SDCD 4M7LL 3QIBC 3L3JB 3RIFF 4TSCH 4JFXA 4Y1AD 3WHE1 15C8H 3MLZL 1K6QH 4QYOB 4J3TA 5DC4B 3THMH 2FIRT 4XWGH 1A6TB 4MB4A 3ZTNH 3MBEC 1ZLVK 1DEEB 1K4DB 1JZ4A 3IDMB 2ZOKA 1JHTB 4LLDA 1ZLUH 5JPMA 5ESQB 1KIUA 5GXBB 3BPOC 1HH6B 2ARJQ 3PABA 4OCNC 3MV7E 4XVUD 4NSKA 4HH9B 3SDDD 2LABA 2O5ZH 3DIFA 1MNUH 1UEMA 1NDMA 3SCMD 5ESVB 4D9LL 4GRWB 4ZO8A 1FZOA 2HFGL 4OD1L 4PV9B 3V9FA 3LKSA 1EK3A 3FN0L 1G7LA 3HZMB 3L6FB 5T1DH 1P6AB 1X5ZA 1Y0LB 1ZA3A 1A6AA 2NTFB 4MQXD 4DZBB 3JTSB 3FN3A 1U8IA 4YH6A 1N4XL 4V1DA 3JZ7A 2MSPA 1UH3A 5FUZH 1TCRA 4BFGA 1KV3A 1MCQA 1WF5A 4M8QB 3B2VH 3C6LA 3BPNC 3FOMA 3MUJA 3MCLH 3KS0H 3SQOL 1PJ9A 1I8KA 3D2UD 2RJMA 2ZSVA 3OJDA 3UX9B 3EYUL 5BV7B 2YZ8A 3DOSA 3IDYC 1A14H 3D0VB 1X5FA 4GG6A 5IEHA 5CMAB 4Z7QE 2ZPKL 4PJ8A 5F9WC 5TFSH 4MA1C 2DTMH 3VXSD 1ZHLA 3PGCA 3BGFC 1K85A 1T22A 3CNKA 4G7VL 4WW2A 4JDVB 5DJAB 2A6DB 5KTEH 4WHTA 3WSQL 1WZKA 2YXMA 5KZCB 4Z5RA 2EZ0C 2FEEI 2V7NA 4UT6H 1YMMD 4WFED 3O11B 3MJ7A 4Z78B 2A74B 1IE5A 1I8LA 1Z5LA 5EO9B 4ELKB 4S1SH 4CMHB 3BYYA 4HXBL 2VXVL 1KLUB 3MGTB 4PBVC 3DX7A 4WFGD 2ICWI 3D85D 1LD9A 3H9YA 3MOBL 1JWMB 4BZYA 1EVTC 3D5OF 3QDGE 1NCAL 1YECL 4S0SD 1FYTE 4YHOH 3VXOB 1MREH 4OB5L 4Y2DC 1AQDB 3L7EA 1IARB 3RVWD 1N5YH 3SDYH 5BRZB 1OY3B 3MACL 1S5HB 4KV5F 4HWZB 5FYKL 4ZQKA 4AEHL 1PG7L 3HPJA 4UIKH 4CADA 1EUUA 4X6DB 1S78C 3SGDI 3WLBB 5JHDB 4XC3H 2NY5H 1C5CH 5EZOH 2E7LC 1T1YB 3MUY1 4PREA 3LN5B 1L7IH 2F54D 2ERJB 4M7ZC 4XP1H 5EO0A 5F8QC 1VPOH 1BM3L 2DM3A 3N9GH 1GAFH 2HTLD 2VERN 5DUPH 4MZ2A 2ZCKH 3BRGC 1JZ7A 2V7HA 3VXMD 1F90H 3V7MA 2DI9A 4KXZI 2DWEA 2X1QA 1X3DA 2EDYA 3VRIB 2FH8A 3STZB 4U1SB 1TJIH 4G6KH 2XTLA 3KPNB 3J8F7 4C83A 1RIVL 1ZANH 2FBJL 3NCCB 1CFVL 4OBRA 5EU6A 5DJ0B 4TSCL 3TA3B 1KELH 4UDTA 4AQ1B 2Q8BL 1OGTB 1GVIA 4XWGL 4RIRA 4Y4HC 1H5BC 3W9DA 5B8CC 1NGQL 3T04D 2V2XB 3V7AG 5DEZA 4YUEH 1DQDL 1CDIA 5MERB 1J0IA 5E8NA 1UXWA 1K4CB 4RX4A 5HXMA 2V5MA 1BOGB 1IAIL 2FYYB 4ODUA 3EO9L 1J0HA 2VN4A 2VR5A 2BHZA 3G5XA 1KTDB 1LEGA 1CQKA 2P24B 1CF8H 1A3QA 4HUNB 3TBWB 3VW3H 2GTZB 3G6JB 3TH4T 3O3UN 1XMWA 1GHFH 3FT4B 1QFWL 4PRNB 3RY4A 2FJGB 1BJ8A 5ACZB 2DBJA 4QXWA 4OCMC 5D96C 1MCCA 3GHEH 3V5KB 1RZKC 1CLZL 2NY6B 5TQ2L 2GAZB 2D0GA 5C07A 1J5OH 3E8UH 4X7FC 3H7BB 2JJVA 2QSTA 2CLRA 4KK6C 3T2QA 1M6OB 1JYNA 2D9QB 4FXKB 1QRKA 4YHLH 1T03L 5D7IF 3B2VL 1BQHB 5CJOL 3NCJL 1ULVA 2J88L 2BCKB 3MCG1 4DZ8A 4I48A 5I1JH 4JFQB 4KKCD 3VXNB 5E00B 1X5KA 1CL7L 2X42A 3ILQD 1A14L 2OCFD 5DYOA 4Z6AT 4LEOA 3FQTB 1P7QA 2OQJB 5IBTH 4JDTH 1OARH 2YD3A 2DTML 1CXKA 1MJ7L 2EIBA 2GK0A 3BEVA 4OLZH 3NCFB 2OTWB 1TCMA 1F4HA 1A7PH 3DXAE 3PDGA 4PRDB 3RI5K 3QUMB 2J2ZA 4D0CA 1IBGH 4YBQC 4NO3A 3NCBB 5F96L 3UTZA 2NY0B 1A7QL 4NQEA 3V8CA 5CCKH 3U48A 3ALPA 4PYHA 1U8OB 5KSVA 1SEQH 3MUGA 2BVQB 2A77H 3B3IB 1YEDB 1C1EH 1KFAH 4OF5A 3C2SA 2XZQH 5DLML 2BNUB 4NKOA 4XPBL 3SDYL 1OGAD 1Z6JT 2Q20A 4ZXBC 4EI5D 4PJIA 3VWJA 1HQ4A 1NC2A 2G75B 2X89A 3ZDZF 1Q0YH 1BIHA 1G1YA 1NMAL 2QKIB 3AS1A 32C2B 5E4EC 4PGJA 4FFZL 4UBDD 4JFDE 4PLOB 4RZCA 1NDGB 5AAWA 3PWUA 4PP2B 3K4ZA 1RUKH 1OF2B 4N0CD 3ARDB 2LU4A 2AEQL 1X4XA 3N9GL 3X3GL 1GAFL 5DUBB 5DUPL 3MLXH 2EDJA 2FDBP 4FMKA 2FJFB 4QXUL 5CGYC 3DV6B 2J8UA 1QTYT 5DR5L 5F71A 5C0EA 4UOJA 2VZUA 5CJBA 1ES0B 1CE1H 3TJHC 4DGIH 3IVKA 4LMQE 5D2NE 2E6QA 3QHZL 5C2BL 4NM8L 1JPTH 3HB3D 5FF6A 1XIWA 3REVA 2F53B 3W11D 3MV8A 3SJVB 3CH1A 2FGWH 1CICB 5I66B 4HPOH 1NQBA 4YX2H 3O8XA 4CN6A 3FFDB 1QPPA 4YBHA 4HGWA 3SKMB 1SJHB 2GJJA 4KHTL 5EO1A 4HZLB 5K9QI 1WIUA 4YUEL 4LVNC 5EC1A 4J12A 3FB7A 3SQBA 3T3MF 1D9KB 1MFAH 3QSKB 1RK0A 2IANE 3ARVA 1AXSB 5T1KA 4APQD 3IJSB 2PYED 3L3DA 1DBJL 3IS1X 5IJKC 4F7CB 2P47B 1T5WB 5J8OA 2DD8H 2R2HA 4QRUB 4Y7MA 4NN5C 2NPLX 1I9RH 3ULVH 2XKSA 2YN5A 3T0EA 1HHIB 3GBNH 3GKWH 5TE7L 1TZHA 3QNZB 4NDMB 3U83A 4J1UA 1J5OL 3GBLA 4KK5C 3U0PA 1IC7H 2X70B 5DI8B 1AHWA 5C0IB 4G43B 1FC2D 1RULH 2HP4A 2Z8RA 3QO0A 4OJFL 5KBNC 3LQZA 3BIBX 2LV4A 2VLKE 3MYZA 4LLQB 3HLAB 4Q97A 1OWRM 1T6WA 1DQJA 3U0TA 4NOBA 4AIXA 1FN4A 2D2OA 3QIUB 4L4VB 3VGEA 2YA0A 3KPSB 2R15A 1FG9C 4LNRA 3QDME 3GI9L 3Q48A 3RGVC 1I9IH 4JPVL 4TYUA 3MNVB 3BAEL 1IM9A 4Y2OA 5HD8D 5HVGB 1F58L 4YDKH 4FTVE 3DPBA 4JREB 4IOFC 4R97B 3O2VH 1Q9LA 3AREB 3QQNA 1G9MC 1IEBA 5I9QC 3FMGH 1T6VN 3TBSB 3X17A 5FO8B 4HBCH 2FD6H 4I3SH 2D7QA 5E9DB 3UPAA 4MWFA 2GITA 1Q94B 1QBBA 5IFAL 3C5ZA 4H5SA 3FJTA 3G5YA 3MLSH 5J3HC 4UOW0 1BGXH 2XZQL 2YD9A 4HMEA 1WTLA 2X4TA 4AL8H 1ZEAL 4TVPL 4XMPH 2NCMA 3QQ9C 2EDOA 5H94B 2P8PB 2AJUH 4G80A 3KPRE 1Q0YL 4WNQA 5GZOD 1MCLA 3ZSTA 4GRWH 2VOTA 4IMLB 4C55A 4M4PA 1HHKB 1MFDH 3GB7A 1DP0A 5I1LA 1RUKL 1MHCB 3V79C 2A0LD 4HEME 3RA7H 1X4ZA 2W9DH 4NQCE 3BH9A 5GZNC 4P2RE 2GJ6B 3MLXL 3EJZC 1ZVYA 2BVPB 4MYWB 4U49A 4JGJA 3VCLA 4GRLA 4Z7WB 1KNOB 5H2BB 1O5DT 2ZUQB 2B1AH 4UQ3A 4E41E 4R96A 4KPHH 3T65A 2ZCHL 1I4FA 1UENA 1ZOXA 2ICWA 3MV9B 3NIGE 1Q1JH 3OAYH 1JL8A 3LRSB 1EVUA 5T33L 1UM6L 1OTTC 3QUZC 5BV7H 4BSWA 2BY0A 5EN2B 1LEIA 2BOCB 1WC7A 3L3HB 3EFFA 2ZOLA 4M4RA 2G5BA 2VLJD 3IDIB 3MLUL 3VXRD 3UAJD 4UAOC 1I85C 1XGTB 4MQTB 2PW1B 1N3NA 1I7UB 3LD8C 2VMFA 5C0CE 5HYJD 1FYHB 4PJCF 3AB0C 2WM0A 5CINH 1IAKA 4YK4B 5C0BA 2AXGA 3IJYA 4LPVA 4OZ4A 2QHRL 1A7BA 5KAQF 1KBGL 2Q76A 3NN8A 2H32A 3U4AA 4K7PH 1P4BH 1YEHH 3B43A 5BJTA 3F7YA 4ETQB 5I2IB 4HWNA 1XGQA 1ZTXL 1D5XB 1HINL 2C3HA 2E7BA 3HMXA 4LARH 4W4NA 4I2XA 1IQWL 4P9HC 3BISA 3KYOB 4PJAF 5FKAB 3ZLQC 4X5XB 4QOKB 5EBMB 3PIQA 3O9WA 1BAFL 3EZ8A 5L6YH 1PG7X 1YYMH 4PJHA 1EFQA 4PJEF 4OZHE 3P77A 5KVFH 1RQ5A 4LKCB 2OZ4L 4XPAL 3GBNL 3GKWL 3U36B 1U95A 2ITDA 3DSFL 1B0GA 4MLIA 1XAUA 5AZEL 1HIML 2QADD 1OPGL 1GGCH 4N5ED 5HY9A 1XR9B 1EEQA 3KYKL 1ZKAA 3WNNA 1K2DB 5B39G 3EGSB 1F4YL 5FHAH 4J3WA 4MA3B 2X4RB 2R8SH 1YQVL 4FMFA 4WGVB 4F7PB 5I18L 1KUMA 1YC8A 4J3XA 5FYKU 3SDAA 1EGJL 1IGYA 1EV2E 4FQCH 5DJXA 4PJXA 5HHOD 4OT1L 3U1SH 2R69H 3DROA 4G8EB 1QLFA 1KXQE 1SM3L 5GS3A 4YDKL 1MVUB 4GRMA 4GXUN 3O2VL 5IF0B 4I0PC 5BZDA 3FMGL 1MH5B 2MTPA 3ARGB 4XCCH 1EO5A 5ELIA 1D5IL 1BJ1J 5F7DA 3O4LE 3HN3A 5JOPE 2X4NB 1DQQB 4KGJA 5B38G 1CD0A 2UV3A 3AS0A 4QCIB 3OR7B 1JNJA 1BVZA 4HLJA 1INQB 1FIGH 4Z0XB 3BIKB 4M48H 3FRPG 3ECBA 4OKVB 3FO9A 1E4WH 4OLUH 5E95B 2A1WH 3X3FL 2I9LA 4OZFA 4U1GC 5GIRB 4XMPL 3N1FC 3D85B 1H3PH 2AJUL 4NO5A 4WJ5B 2BVUA 3MLRH 2I07A 3BO8A 1JP5A 4LMQI 4JHWH 4LGSB 1IC4H 1B88A 2ZZUT 3RTQA 5LAXA 2OLDA 3NABH 1CDGA 4NNYB 5BS0E 1A9BB 2W9DL 3P11H 2F5AL 1KXVC 2ICES 4NO0A 5DXWA 3QR2A 1MRCH 4P23D 1OSZA 2A6IB 3MZTA 5JW5B 3B9KB 4OCXL 3SGKC 1SBSL 4JAMB 5ICXA 4BFIB 3P4OA 1NGYB 4KPHL 2WNGA 3VI4F 1RIUH 1G7PA 4OCWL 1U93A 1F02I 3K46A 2NLJB 4PRHE 1TFHA 2XRAH 4F33A 1OAXL 4I0CC 1P4LA 3WFDL 4AMKH 4H8WC 5D2LF 1PVHA 1UCTA 3QG6B 1F4AA 4O2FB 1T4KA 2HJFA 2ICCA 4YHZH 5JZ7D 1CD9B 1BBJB 3UBXI 3VG0L 3SKOA 2MFNA 1SJVA 3OB8A 4MHHI 5F6IC 3WE6B 2A83A 5ANME 3QUMH 4L8BB 2VC2H 5DRXA 1ZGLB 4KUZH 3T09A 5I17A 1VCAA 2DQCH 1G6RB 2LAGB 4LQFH 1OAUH 2YPLA 2R39A 5CFHA 4G42B 5JXEC 5K9JH 1YN7B 1YEHL 3TIDA 7CGTA 1LEKB 2NXZB 1Z9OA 4N8VA 5IW3A 5DK0B 2P42B 1YPZF 5ENWB 5EZIL 4E42B 5J06A 2ARWA 4HCRL 4QHKI 4ODTH 2FZ3A 5I1HL 1VFAB 4LKXA 5L6YL 1GGTA 1V3JA 3JWOC 1NGPL 3M07A 4ZSOB 3IGAA 1CIDA 4XCNB 3REWB 3MV7A 2OR7A 4YC2C 3PF2A 3M45A 2JB5H 4G8GE 4GW1A 4XP6H 1TENA 2H3NA 2C3VA 1GSMA 4F3FA 4PY8J 2OJZL 2EXYC 3TO4C 2QLVB 4WHCA 5F9DC 3WIHA 4JFZH 2DN7A 3QXDB 4K9EH 4MD4B 4WFFE 5J12C 2VDKH 5F7EL 2HT2C 4ZFGH 4KK9D 5GS2H 2R8SL 4JANB 4MCZB 1FVEB 4OTXH 1FRGH 1CFQA 1MCFA 5HDBF 3RFZC 4NZRL 2VLRD 4JN1L 2PXYB 5TE6H 5DRNB 4UNTA 4OAWB 5T3ZH 4MDJB 3D25A 4Q9RH 1NUGA 2R69L 3UTSB 4W81A 2NX5B 1A7OL 3CAFA 1QBMH 3FB6A 3L1OH 5TGBB 4UILL 3GIVA 1PYWA 2BDNL 5A3IC 2SEBA 4DKEL 5KVDH 4XNUL 2A9NH 1UH2A 4X6CB 5EU4B 4OQ1A 3STLB 1NBVL 1LE9A 2ZUWA 2C4FT 1QSFE 5IHLB 3HS0B 1BQLH 3V5DA 4Q58C 4CMMB 3UCRA 4XCCL 4NHUB 3D1MC 2Y25A 1AI1H 2VISA 4V1DD 5JPNB 4JRYE 1E28B 2ZP0T 4MXWH 1T7XA 5EU5A 2BJML 2Q87A 1G6VK 4MVBC 2Z92B 5CWSA 3VXUE 4RQQB 3C6LD 1HZHH 4H1LA 1BZ7B 2ORBH 1RU9H 3H0TA 4F2MA 4WUUB 2DQEH 1KCUL 5HI3D 4OLUL 2A1WL 5FGBC 3T0BA 3LEXB 2OR8A 1QKZH 1CI5A 2PO6A 5JHLL 4URTB 5DMIH 2LU7A 1S9XB 3QI9A 2FH6A 4JO1L 5C6WH 4PJ8D 4MXQD 4OZIE 3UDWA 4D0BB 2AJSH 3IRZA 3JVGC 3P2TA 2ENSA 3AGVA 1FYTA 4NQVA 2QSCL 1JF1B 1QA9A 1IGIH 4ERSL 1MFBH 4XNZB 4YHPA 3ULSA 3VRJA 3B9EA 3ARYA 1D5MB 3OKOA 3QWOA 3QO1B 4LVOC 2R4SH 1OCWH 4XXCC 1HSAB 3H42H 2DM4A 3S4SB 4I77H 4GAFB 4U1LA 3MRMB 1OTUD 2Z8WC 4PJ9B 2R0KL 5K9KB 4PRPB 1J1OL 3SE8H 4CN1A 3QEGL 2H9GB 5E1AA 3L3GA 4ELMF 2CKBB 3P40A 2XPGA 3PWVB 2X4UA 1UYWL 3O2DA 2C26A 3PWPE 1NGWB 2R1YB 2JF1A 5GGTL 2VZSA 2OTPA 1S7VB 5IEKA 1FAIL 5L0QC 4HC1H 4AH2B 1JHLL 3M1BB 5JQ6H 4H25A 4YHZL 3CC5B 5F3HB 3OJVC 5I8OL 3S6CA 4HUVB 1ZT4A 5E2TH 3QUML 4PGDA 1ZT7B 4OFPA 1T1XA 4KUZL 1I9JH 1YNLH 3EKCA 4HUWA 4X99B 1YJDL 1OAUL 1U8HB 5CSBA 3CFKA 1G7HA 1UWXH 1JZ5A 2HFEB 4JFYA 1CZ8L 3PP4L 4HK0A 1DCLA 5EZJA 3V52L 1FPTL 3BKYL 3RZCA 2WIIB 4KK8D 3MRRB 4OF3A 4K94H 1PG7W 2FR4A 1A9EB 2Q7NA 4JHAL 1ZLUK 1KCLA 4LQ1A 1OTSC 3F62A 2ITCB 3I2CH 4RGMB 1WZLA 4ZOBA 4NJ9H 5GRUL 4F8QA 4FNLH 1FGNH 3A6BL 4PGEB 3VFRB 4XP6L 5EU6D 1AKJD 1YC7A 2GSIB 3B83A 1NMBH 4QGTA 1KEML 3TV3H 3BDBA 1RHHA 5F8RC 3L5JA 4KI5F 4NZJA 3HZYB 4K9EL 4LBEA 2VDKL 4ZUUB 3D39B 43CAA 3AY4C 2IG2H 2IADB 3W5NA 5EUKB 1MCOL 1KCKA 1WISA 5DMGD 1MRDH 4GMSL 4M6OH 4D9QE 4RX4D 3GIZH 1FRGL 5C8JB 3QQ3B 3F8UB 4HKBA 4JCMA 1I75A 1P1ZB 4KMQA 1HEZA 2YEZA 1P9MA 5KS9B 1C5DB 4YEEA 5J11B 2CR6A 1LMKA 4WU7B 5C0FB 4N68A 1DN0B 4QY8A 1MCRA 4RFOL 1T89C 5KVDL 3P0GB 2VZ1A 1A1OA 1PX3A 3KGRA 1LO3H 1YEJH 4M3KB 3PQYE 5C07D 3ROLA 4HUMB 2WIMA 3ISWA 4IDJL 3DXAA 3VFNA 5L7XL 3MBEA 4BYHA 2XKUA 2BVYA 3R0NA 5EUOB 2B4CC 3QXUA 5L2KB 1N6QH 1Q9KA 2ZKHL 1XF5A 4EVNA 1HZHL 3BWAA 5C0NC 1AP2A 4FP8L 2DQEL 3RBSA 4YHYC 4G6FD 3DI2B 4TUKL 1NANH 2Y36H 4P4RB 1DLHA 1P7QD 5EPMA 9CGTA 4RRPA 4GMTH 3O3DA 4FZ8H 1S7XA 2O26U 4WWKC 3TO2B 1VEOA 4XPGL 1HSBA 4JVUA 5T1LB 5I74C 5CP7B 3LN4A 4WFHD 2YS4A 1G7JA 1NEUA 1CD8A 3C60A 4O00A 2CDFA 1M7DA 3B8YA 3S34H 4TN9A 2EH7H 4NQED 4I77L 3TT3L 4JFDA 5C9JA 4JKMA 5LVEA 4P5MB 1KGCD 3A67H 4JGMA 3SE8L 2BSSA 1DL7H 2EEDA 1H3WM 1RIHH 5I8CB 3HR5B 3QEUA 5J13C 1WBXA 1MELA 4FRWA 5FIEA 1LNUB 3EO0B 1FL3A 3RWJB 3VWJD 4PB0L 2JIXB 4ONOA 3EOBB 1NC2D 3QIWC 2X89D 5I1EH 4D3CH 2C1PB 5CAYB 1NUFA 2YUZA 3W39A 4EZMA 1LO2L 3NFPB 2NY7H 1X5HA 3IU4L 3VFWB 1XGPB 1UZ6F 5E2TL 1MWAA 1RZJC 4OD3L 4OLEA 3INUH 3TN0A 1QSEB 1ZSDB 4QRRD 2F5BL 3LKRB 5KSAC 3PE9A 3BQUB 3MRIB 5FYLD 3AAZB 2QQKL 3VFPA 5JW4N 1HQRA 1KT2B 1ZA6B 2IF7A 4RAVB 1MHEA 2IANA 1RURH 4Y2DA 1AH1A 5AWNH 2M1KA 2BVOA 4JQVC 1XIWD 1LO5A 3G04B 3ZKNC 3HE6C 3MV8D 3P30H 2CDGB 2DLFL 4MAUH 1NC4A 3N0PB 1BMGA 1NMBL 5FAAA 5FGRA 3O8XD 2BNQD 3JUZA 3VFUA 1AO7E 4MMXC 2E7LA 4WRLA 3UBXA 5JNYA 5E08H 3WFCH 3ZKSD 1BVLA 2D7TL 5J6HB 3BPLB 1ADQA 2AGJH 4CAGA 3EYFA 1MRDL 2FX7H 4M6OL 2ARJA 2DWDA 3QAZC 3N1MC 1EJOL 2ID5A 5T1KD 3VRLE 4OIIH 3BYTA 1U6AH 1IGCH 3CVHB 3ZKMD 4G6JH 3FRUB 2VLKA 4LAJH 1DQMH 2JJSA 1R5IB 2IAMC 2UZIL 4B5EA 1BVKB 4HIJB 4U1JB 1VEPA 4IRSB 2WUBL 2R4RL 4Z7NE 35C8H 1CDBA 4UT7L 2ICEB 4M6AA 3T0ED 5CJ5A 3D18A 1FORH 4X9BA 2I5YL 3IRPX 1YEJL 1OOAA 4PJGF 3VFGH 1RHFA 2MQ0A 4OLWL 4XGZA 4ZD3H 2F8XC 4Y4HA 3LQMA 4GFTB 1U8MA 4U6XB 1N5AA 1WFUA 4FTVA 4PJ7E 5IB5B 1D5ZA 2R23A 4WO4B 5I16B 5KW9L 2X9YA 3WKMH 2EDLA 2D31A 5FYLL 1QEWB 3EUUA 4PLKC 1G6RH 3UTTB 2BY2A 1UCBH 3BEWB 3MA9H 3NIGF 3EFDL 1T04B 1CCZA 5GSVB 4NRXB 1TVBA 5IOPB 3OXRB 4FXLA 5SV3A 3QH3B 5D7KD 1UKSA 1S5IH 3E6FB 5IQ9A 2EYSB 2G2RA 1G9NL 1KLGB 1E4XI 1B4JL 1GGIH 2R2BA 3TBTA 4NO2A 3KPRA 1FL6B 3HNSL 4P2OA 3GJFK 4YNYA 3S34L 3LCYA 4HWUA 1QRNE 2EH7L 4YBLC 2Z8SA 1NFDF 1DE4A 5IMMB 4Q9CA 1SYSA 3A67L 3C5ZD 1DL7L 3DRQB 1S9VB 3RVUD 5MP6H 3HPLA 1NCNA 4NQCA 4GUPB 4L3EE 5IBLC 4XAWH 4JFFB 3CCHA 5ACMA 3OKNB 2HJLA 2XWBA 5GHWH 5I30H 3IXAA 4KC3B 4M1GH 5E6IB 3EOTH 4HV8B 5MI0B 3BZEB 1BREA 3JSSA 1DBKL 5CZKA 4NGHL 4QXTB 1ZXQA 5I1EL 4XNYH 3PV6B 4WW1B 2NY7L 5TJWK 4QHNA 1S7WA 2Q1EA 3NZ8B 3INUL 3GK8H 2COQA 4IOSD 3VI3F 1T83C 2DBLL 3BDYH 5CIPH 1CDJA 4IOIB 3O4OC 5LBSH 2FB4L 5DRWA 4Z7UB 2W9EL 1UM5H 3MRKA 2B2XL 1MIEH 3S35H 3FT3B 4Y4FB 3T4AA 1AY1L 3IDYB 2PYFB 5ALCH 2NY5C 2HH0H 4GRLD 4LCCC 5C0CA 3E3QE 2AJXL 3GNML 3QULA 2WBWB 5DWUH 3TVMC 5GJTL 5D70H 2ZUSA 3X12A 2MJWA 3CFDB 5D1ZC 3MUHL 4ZAKB 4BKLB 4NQDB 4ZXBA 2IBZX 4G9FB 4XVTH 4B53A 5HGDA 4PLJD 1QUNA 1T3FA 1HI6B 1QLEH 3HI5H 3WDHA 4QTHA 4L9LB 1UB6A 1YY8B 4Y1AE 5D7JA 1U8KA 3FQXB 5DS8B 3SKJH 6FABH 3WO4C 1F4WL 3GSNA 4O2CB 1I7TB 4RFNC 5FHBL 1VGEH 4L1HA 2WLYA 4OZHA 1FIEA 2QV2A 5BQ7A 5C0BD 4U1IA 2YXFA 2F19L 3CGTA 3ULUD 2OTUB 4WCYH 3B4NA 3I50H 2Q86A 2ZNWA 3MREB 5DTFA 1UA6H 2BNRB 3KVQA 4GKNA 2R29L 4M5ZL 1A5FH 2JE8A 3U9PH 5D5MF 1QO3A 4ZNCD 2ZOKB 4LLWB 4F58H 4JPKL 4LLDB 4G6AD 2FRGP 1IAIM 1WT5C 4GKSA 2CKBH 3O9WD 1I3GH 2VAAB 3VWKC 2V17L 35C8L 4JM2F 1L0XA 5FYKE 1FORL 5FK9A 4HWBH 1FGVH 3QB7C 5CEZD 4OZFG 1QFWM 1CG9B 3ZKXB 1FZOB 3MFFA 4OCYL 5KJRL 3LKSB 3WKML 5C09E 2VZOA 3ULVF 2YBRA 1HYSD 4KKLC 3ARXA 1G6RL 2EDHA 2H6PB 3DTXA 4FFYH 4PBWD 1XF1A 3HCVA 1KLFA 3RWGB 2N1KA 4MSWB 4XVJH 3FB8A 3QJHA 5IJKA 5KVEH 1U2HA 3SDAD 3O4LA 4TRPL 3C6LB 3FOMB 3K80A 4RBPH 3FQNB 1JIBA 4GAGH 3OJDB 2EXWD 3N06B 3RL1B</