2R1WB

Crystal structure of s25-2 fab in complex with kdo analogues
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
219
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSYWGQGTLVTVSAAKTTPPSVYPLAPGAANSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab, antibody fragment (IgG1k), light chain
publication title Exploration of specificity in germline monoclonal antibody recognition of a range of natural and synthetic epitopes.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 219
sequence length 222
ec nomenclature
pdb deposition date 2007-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r1wB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r1wB01
1UWGH 1LHZA 3J7HA 4KJWC 1QR1A 1JGEA 2YEZB 4HIXH 3UTZA 1R3LB 1RJYB 2IQ9H 4BA8A 5F1SA 3LN5B 4HMEA 5EOCH 3QEQE 4P2OA 4LSVL 1PG7H 4Z7NF 1AR2A 3HG1D 3L5XL 1FNSL 4YHLH 4H0IA 4F2MA 2R0KL 2WIIB 2WLYA 1RK1A 4JO3L 3HLAA 2YPLD 5J12B 3K4DA 1S7SB 5CFHA 3HE6B 3GNML 3LMJH 2H2PC 4EI6B 5ABDE 3JV6B 1ED3A 1JGDB 1NH6A 1TCMA 4GRWB 3D3VE 5CZXC 4HIJA 4LLDB 5JZ7C 5LAXB 2I5YL 3QO1B 4C55A 4ZPVB 2FX8H 5FB8A 5KSBE 4NNYA 3NIGE 3NFPB 4EUPB 2HKHL 1XF1A 4PPTA 1INDL 3CH8A 1MY5A 2NY1C 1IJ9A 1G9NH 2WAHA 4OFYA 1DTUA 4XVSL 3VRJB 4MJID 1W0YT 1VFAA 4YUEL 4H1LB 4L8DB 2R0WH 3G6JF 4HMDA 3CX2A 3LKRB 3VFOB 3RVUC 1CDBA 3DO7A 5BQ7A 3JTSA 4FZEH 3IXAB 4Y16B 3VXNB 2OL3A 3NCCB 5D1XB 2OS7A 5TH2B 3KPPA 4IOIB 2GK0A 1JHTB 3STZA 4S1QL 5E6IC 1P7KA 4MNHB 5DEZA 1Q9WB 1MFBH 1CBVL 2CK0H 5HHMD 3CH1A 1U6AL 5T3XL 1EFQA 1T21B 4QHUB 1QRND 5E1AB 4ELMB 4BSWB 1NCAL 4NQCD 2XZZA 1OVZA 2ZUQB 4WI5A 3TVMD 3L6FB 3AS0A 3F6LA 3QEGL 2YN5A 5AEAA 3IB4A 3MNZB 3VFRA 2X4QA 3DV6A 4GAFB 4HUXB 4CNIB 3MRGA 1DL7L 3HS0B 3X12B 1A7PL 3RX5A 1GHFH 4P23B 2BNRD 3MGTA 5HDQL 2FWOB 4QOKA 1MCCA 5EBMB 3OAYH 5DMJB 3QNZB 4M1GL 1VKXB 1QFWI 3GJFB 2FLRT 2F58L 4TPRL 1FNEB 1AHWB 4U1GB 1FL6B 1F6LL 5CINH 4XTRD 4QRRB 5E5RB 1HH6B 3U7YH 3T2QA 3KR3L 5E8DH 4NP4H 2EEAA 4ONOA 1N4XH 4NFDA 4CRPA 2VL5B 4HKXB 1EO8H 5IF0A 4A6YH 3PQYD 3BHBA 4ZAKB 4AH2B 2HP4A 2RHEA 1KENH 5IB4B 4HX1A 3FFCD 3MRJA 5JPMA 4B41A 4OF8A 1NC2D 3GHEH 4P2RA 3IYLW 3QAZC 2BSTB 1S3KH 1P1ZB 2Y07L 4JVWA 1KB5L 4JO1L 5D1QD 1B6UA 3MLSH 4OLZL 3TYFB 4AENA 1DANT 4CAGA 1MIEL 4G42A 4OGAD 1XF4A 4Y5VB 3V6ZB 4KJWD 2VLJB 2QEJA 2HVJB 1OWRM 2WMPA 5HYQB 4NQEE 3EO1A 3G5YB 3P11H 2ICEA 2WINB 3C6LB 3DVNA 4F7EB 4YNYA 3DURB 5I71B 1IM9B 4ORGB 3DVGB 3OG4B 2IBZX 4TULL 3RWGB 3CGTA 1BVLA 5D8JH 1EHNA 1Z9LA 4OV5B 2DRUA 3GM0A 1T22B 6CGTA 2EDTA 1E0OB 4G6AC 1DCLA 3PP3H 1NCTA 5IVXA 1FV1B 1JF1A 1WIOA 3KPMA 3SPVB 3LIZL 3E0GA 5D7JB 4BUGA 2H2PD 5JW4R 2Z8SA 4LVOB 5C09A 4OCRL 3QA3A 4HQQH 1YEIL 5CZXD 4KJPD 4ODUB 4Q2ZA 1FH5H 5JZ7D 3TA3B 2EE3A 2VLKA 5GHWL 4ETQB 4XP5L 1PY4A 2XN9E 3QIWC 4HJGA 3SDDA 2R2HA 4LCYA 1XGTA 3ARPA 1D5MA 3LKSA 4LKCA 3WFHB 4LPTA 5FM8A 2A83B 3HMWH 5GSRA 12E8H 1UB6B 3VXTB 4XCFL 3OSKA 4X6DE 3VXRD 1MCOL 3MLTB 5KOMC 3RVUD 4CN1A 4WO4C 2BFVH 2DIBA 1MY7A 2IPKB 5LGJA 5DD5H 1TVBA 3CSBA 3BJ91 5D6DA 2BHZA 5DZLA 5B8CC 2NY2B 3K2UL 4E41E 4LP5A 3RWEB 1NCBH 1A5FL 2R4SL 5E6ID 3T0XA 32C2A 1HILA 3DXAB 1A1OB 4UQ2A 4NKOA 2NZ9C 2DD8L 2O5ZH 1N5AA 4FS0A 5SX4I 4NKIH 2XQBH 3RY4A 3MODH 3GSWB 1II4E 5T1KD 3WFZA 4I5BA 1IBGH 3W9EA 2PO6A 2ICES 1JNLL 4KV5E 5D4QA 4XBPA 3QYCA 3RWDA 5TE7H 2HJLB 1OAZL 1BF8A 1WWBX 1M6OB 3AM8C 3IF1A 3QDGA 2YZ1A 4OLYH 4WV1B 4M3JA 4CUCA 2DTSA 2ZSVA 1UJ3C 1MHEA 3LN4B 3FQNA 5GS0C 1QFUH 3MLZH 3QBTB 4LLQA 5HHQB 2EXYC 2GW5A 5J13B 1QVOA 1HHHA 3MMEA 1KGCE 3QDME 4J4PA 1S9XB 3OF6A 4BM7A 5INCA 2H32A 4I2XB 2V7NB 3ZDZF 1IGCL 2XICA 4ODSH 1Z5LA 3BIAX 1T3FB 3P9WB 4ELKA 3DROB 3WN5A 4EVNB 1ZVSB 4RDQF 3ARBC 4OGYH 4MJ4A 1RMFH 3HNSL 2HT4C 2QHRL 2VLME 5D71L 5EUOE 3VH8A 3TPUA 1NCWL 2W0FA 3TGXA 2VZ3A 5L2KA 3B5TA 3G5XA 4JHZA 5DWUL 4NO3B 1JFQL 1FNHA 1K6QH 2L4OA 1ZGLA 1E6OL 5DJXB 4HKJA 3ULVL 1A21A 4MQXC 1YMMB 1RUKH 5ITBH 2R0LL 1JK8B 1HYRC 4UDUB 1U8QA 1UM5H 4R8WH 3VFVB 3X3FH 5E24E 5LJYH 1SBBA 4RAHA 4UILH 3TNNA 5BXFB 4JDVB 2YEZA 4PJDF 4XP1L 1U3HC 4NQDD 4DKEH 1R3LA 1RJYA 3LDBB 1SJEB 3LN5A 4YDJB 3BW9B 1BAFL 3GMQB 1QFWM 2AW2A 4WIQA 3A6CL 2WIIA 4PJ9C 1I1YB 5EIQA 3S36H 1S7SA 3QIWD 3HE6A 1YYLH 3P4NB 4EI6A 3VXSA 4E5XB 1W72B 3JV6A 1KEML 3MACL 3FHAA 1JGDA 2QQLH 5E6YA 3QUZA 4LLDA 4W68A 2IPTH 2XKSA 2WSKA 5LAXA 5CD5D 3QO1A 1T83A 3F12B 1Q0YL 2GHWB 3B8SA 4ZPVA 2IFGA 3ARDC 5F1NB 3NFPA 2ZCHH 2LU7A 3AROA 3QFJD 3HPLB 4ZMAT 1OSZB 2Z8VC 3IFLH 4WO4D 3QIBC 3HI1B 1N26A 1NL0L 2WQ8A 1MOEA 1IFHL 4OCYL 4Q0XL 1L6ZA 1UFUA 4MMZC 5ALBH 4Y2OA 2UYLB 3VRJA 4MAYC 4H1LA 5ERWB 2P5WB 1R3IH 4OD2B 1CLZL 4MS8C 3LKRA 2FD6H 3RBGA 5I1AB 4WWKC 3IXAA 4Y16A 2B1HL 3VXNA 5D1XA 4RRPG 4X83A 5TH2A 4Y1AD 2Q8AL 1S7QB 4IOIA 2XN9D 3LQAC 4PD4K 1GAFL 1LK3L 1Q9WA 2FBJL 2J12B 1EZVX 5JIPA 5EZLB 4ZFOB 5E4IA 4U1LB 3PHQB 1RJCA 1T21A 3JV4B 4QHUA 3T77A 1SY6H 3UJJL 5E1AA 4R7NA 1VFUA 5DHXB 4IOFD 4BSWA 4ELMA 4C57C 1G6VK 3EOTH 1RZKC 3KPLB 3EDEA 3R0MA 1MCBA 3L6FA 5IFAH 2AXHA 3AU1B 3RJQB 3VXUB 5JUEL 5GS0D 3MNZA 3JUZA 3WO4C 2VOTA 3FRPA 4CNIA 4HUXA 2EXYD 5KSUB 2MKLC 4QRQB 3GI9H 1I9IH 4YDVA 4P23A 2P49B 1IGJB 5EBMA 2HJKB 3TWCL 3E6HA 1RHHB 1VGEL 2DQTH 3QNZA 3SE4A 1WFTA 1VKXA 3BDXA 3GJFA 3L7EB 1WVZA 1SEQH 1MJ7H 4TSBL 1ZGLM 1FNEA 1AHWA 4JY4B 3T04D 4RMWA 2R8SH 2LQRA 3GBMH 1IL1A 3GJFK 5L2JB 4QRRA 3O6KL 2HT4D 4N90D 1HH6A 3KYKH 5ETUB 3EYVB 5IB2B 2ESVB 2VL5A 4HKXA 4HWZB 5DUML 1F58L 2UY7A 4AH2A 5DD1H 1GGIL 1L7TL 5IB4A 5FO9B 5EBWB 1IC7L 1G7JB 1YNTB 3IVKB 2D7TH 1ZHLB 2BSTA 2BY3A 2X4TB 1P1ZA 3VRIB 2P42B 5L9DH 3TYFA 2YMXH 5F7EL 4L1HA 4UV4L 1EAPB 3MLXH 1DQJB 3QDMD 4Y5VA 3V6ZA 1A6VH 2VLJA 5IJKC 1U3HD 5KVDH 2K1MA 5HYQA 2JCCF 3G5YA 2WINA 3C6LA 1JN6B 2NY0D 2HFTA 2XZCL 4NJAL 5DJYB 5BRZE 4ORGA 1N0LA 3DVGA 2P8PA 2APWA 4DGVH 1QLEH 3RWGA 4OV5A 4PJ9D 1T22A 2YA1A 4LLVB 4X9IA 2V9QA 4WU7B 4EDXB 1FV1A 3SPVA 3RHWF 3HE7B 1C12B 5C0EB 4JR9H 1VACA 5E8NB 5K9KB 3SGEI 2OP4H 5DGQA 3GI8L 2OYPA 1NMCB 5E1HB 3IFOB 4ODUA 2ITDB 1KUMA 1O7SA 3H42H 3MBEB 4G6KL 3TA3A 4ETQA 1C08A 3OAZH 1VB9A 2QBWA 2D4FA 3ARDD 4FXLA 1DLFL 2AJUH 4MCYB 1CXHA 1UWXH 4MQ7B 5E08L 1D5IL 5KSAC 2J5LB 1QBAA 3U9PH 1YPZF 3WFHA 3QIBD 2IPUG 3V6BR 4OIIH 3MOBL 3O4OB 4DQOL 4ODXB 1YNKH 2FLBT 4MAYD 2Q87A 2A83A 5EU3B 1UB6A 3SKNB 3VXTA 4N8CH 4WUKH 2I25N 1UCBH 2FNBA 3D85D 1A0QH 3T0EC 3MLTA 3DSNA 4KDTA 3RGVB 4MS8D 1QSED 2AEIT 2VXUH 4WWKD 2IPKA 5HHOE 3GK8L 3V4UH 1K3IA 3RWEA 2DJUA 3KPSB 1F4AA 3DXAA 1A1OA 1CU4H 2EECA 2E8ZA 5JHDE 4RFOL 3EOAB 5A2LH 3WIFB 3RWJB 1KJ3L 5IG7B 5TQ0H 1G0DA 1XCQB 1J9CT 3GSWA 1YNLL 2E7LA 2JB6B 4UT9L 2YUZA 4JRYB 2NY5L 3ARZA 2NY4B 4NN5B 1OM3H 3ARGD 2HJLA 4IJ3B 1M6OA 4RIRA 3E3QE 5EU6B 1UZ6F 1RZ7L 4WV1A 2IADB 5IVNA 4HWBH 5FO8B 2XZAL 1X4XA 2J6EL 4DOHE 5HHQA 1RU9L 3MLWL 1FL3A 2CXGA 1LO0L 4KUCF 2J8UB 1EFXB 5CGMA 4RFNC 1S9XA 4GRMA 3G04B 2APFA 3BZFA 1Q72H 5D2NC 4OTXL 3ULVF 3U30B 4XPBL 4I2XA 5CJQH 4J8RB 2VZTA 5F9JB 2GSIB 1NGXB 5A2IH 4Y19D 1T3FA 3DROA 4EVNA 1ZVSA 3P0YL 2WBWB 3RTQC 2BNUB 2DJ4A 4OB5L 1T7YA 2O5YL 2PYED 2W1NA 3UPRA 3BZDA 3K8KA 2PKDA 3P4LA 2QQKL 1MWAL 1VGKB 4I18C 4NO3A 3VFWB 5C3LD 1AGCB 5GSVB 5DJXA 1MAMH 1IMHC 2C7UB 3L3IB 1YMMA 4ZUSB 1JK8A 2UWEB 3DETC 4FOMA 4UDUA 4P2QE 5CUSH 3VFVA 4X9GA 4P46C 2I07B 3DX9B 5BXFA 1FYTE 4JDVA 4L8SC 3BAEL 5D93C 2F53A 4MAUL 1SJEA 4PJ7F 4YDJA 4D9RE 3WHE0 3GMQA 5ICXB 1NLBL 2P5EA 3GMRB 1JP5A 5I1KL 4S1RH 4POZC 1I1YA 4ORZC 3BZ4B 3SGKC 4QF1B 3Q5TA 3P4NA 5C07B 1HH9B 4PJHF 2ENSA 1CK0L 1CFNA 4E5XA 1W72A 5KSAD 3QJFB 2CO6B 3F12A 1QTYT 1P84K 3UJTL 4DGYH 1KTKE 4FP8L 5DA4A 2W9DH 5F1NA 2KH2B 4TUKL 2GUOB 4O58L 3EBAA 3WJLC 3T0ED 5JA9A 3HPLA 4JFDB 3UTSE 1ZSDB 3QI9B 1OSZA 1GC1L 4Z7UF 3HI1A 4M7JH 5KN5B 3EFFB 2BXYA 2UYLA 2L7UA 4HJJL 1C5BL 2IANB 4Q97A 3TZVC 5ERWA 1UWGL 2P5WA 5IJVB 4HIXL 4OD2A 1CF8L 4HD9A 5I1AA 4ZS6C 2IQ9L 5IMOB 1B9ZA 5EOCL 1IVLA 4MMXC 5EH1A 2QSCH 5EOCJ 1PG7L 3N0PB 4U6TA 4GXUM 3KPNA 4YHLL 2YUVA 1F02I 2AK1H 5EZLA 3ZHKA 4ZFOA 4FQXD 4U1LA 1WEJL 3PHQA 3TT3H 2RAMA 3JV4A 5DK0B 1FO0H 5ACMA 3C8DA 3KPLA 3AU1A 3MRPB 1JIBA 4Y2DB 3VXUA 4RMTA 1V5JA 3AS2A 2GTZB 5AZ2H 1PZUB 3GMLB 4IBLT 2GY7B 3L3HB 3RX7A 2V7HB 1KB9J 2FX8L 4UMGA 3LB6C 2YD1A 5KSUA 4P9HC 4QRQA 1N2RB 4GSDH 5HHOD 1KNOB 3BPLB 5LBSH 1AGDB 1Y6NR 1WGOA 4HK3N 2HJKA 5F9OH 1G9NL 1RHHA 4DZ8A 1BECA 1RZFL 4PJBB 1RSFA 3L7EA 2ERJC 5TQ2H 1OPGL 2P7TB 1E4KC 1OP3K 4JY4A 3RTQD 3ZKNC 5CEZD 4I9WE 5L2JA 5KW9L 5ETUA 3EYVA 2DMKA 4NBYB 5IB2A 4HWZA 1UKTA 2DI7A 4HAFA 5BV7B 3OJ2C 2J1KA 4EOWL 1FCCA 4HIEB 5EBWA 3S8WA 1CIDA 4D94A 1G7JA 5DJ8B 5J8OA 3QIUB 3IVKA 4G5ZH 1ZHLA 1SBSL 4HWEL 3DETD 2YD7A 3D9AH 4JRXE 1SQ2N 4P46D 1KPUB 2FX7H 1EAPA 4OM0L 5HI4C 1DQJA 1QYGH 1Y6MR 3JVGC 2W60B 5CBAB 1JZ8A 1QO3B 1GHFL 4OZHE 1JRHL 4U6XB 1JN6A 4Z7UA 3L5JA 5DJYA 3CPLB 1YQVH 4F58L 4RISH 1PBYA 3ARRA 1SMOA 1GZPB 4CMMB 2VO5A 1TIUA 4P5KB 4POZD 4KXZI 3GIVB 4LLVA 4WU7A 3IXTB 4EDXA 1BQHB 4S0TD 3K7UA 1I3VA 2NX5E 3HE7A 1C12A 5FGCB 1LO5B 4XAWH 4PR5B 5EC2B 5E8NA 4WI9A 5K9KA 4QCIB 4JM2B 5CINL 5F1IB 2AJYL 3IFOA 2ITDA 3IT8D 4J3XA 3MBEA 3K4ZA 4G7YL 4A6YL 4PJXF 2ZCKH 2ARWA 2A9NL 4PJIB 1KENL 4MCYA 1UKSA 4MQ7A 1FC1A 2XKUA 3WL9B 3GHEL 4FTVE 4LPWA 3EUUA 1EA9C 2H1PL 1S3KL 2R69H 3H3BC 1URLA 3MLSL 5EU3A 4P4KC 3SKNA 3TZVD 4JB9L 4D9RD 1CFTB 5LCVH 2QHLA 3RGVA 4K9EH 4LRNL 4HKZB 4CVZB 1X5FA 4OFDA 2CRIA 2BERA 2B8OT 1IQWH 1R3JB 1M7IB 3ALWA 5GXBB 5D8JL 3NGBC 4LEOB 1CXEA 4O2FA 4H26B 3KPSA 4F7TB 3LRSB 1EJOH 3WNMA 3PL6C 1RZJC 3WNOA 4U7KA 1C1EH 3S34L 2AXFB 1AXIB 3EOAA 4HC1H 3RWJA 3WIFA 4TVPD 5IG7A 2X4NB 1XCQA 3C6SB 1LQSR 3EO9H 1M71B 2JB6A 2X40A 4S2SB 3BPCB 2Y36H 3R8QA 3UTSD 5D9SB 1F00I 4FFZH 3LB6D 3HNVH 5I18H 2Q6WB 5EU6A 4KRMB 2G5RA 4R0LB 5TPWL 3M45A 3WLWC 2IADA 3SKJL 5EIVA 3V5DB 5FO8A 3K2MC 4HUVB 5BVJB 3HMWL 5JW4N 2XQYK 4O2CB 4WI8A 1I1AB 1PGRB 2J8UA 1EFXA 4K2UH 2EZ0C 5JORB 1ZEAH 2DQUL 3ZKND 4O2EB 3SOBH 3G04A 1IZKA 3FRUB 4G8GD 4M6NH 2ED8A 1FGVH 1N6QH 1CFBA 5DD5L 2V17L 2AV1B 2IFFH 1H8OA 3ZSSA 4J8RA 2GSIA 1NGXA 2QL1A 4RAUB 3QEQB 1A1MA 2BY1A 5HVHB 1GL4B 4V2CB 1A22B 3RU8L 1DBKH 2NY6B 3T2NH 2XQBL 3MODL 3PXJA 4NUJB 4X9HA 3RWHA 3MOAL 3BGMB 1CGVA 5HI4D 2GFBB 1IBGL 1VGKA 3MRIB 3VFWA 5JPNB 2VDRH 3WXVH 5GSVA 5TE7L 2C7UA 5DRXB 3L3IA 1T89C 4ZUSA 1NGYB 4N0UE 1CGXA 4GO6B 2UWEA 4PG2C 5I1DA 4TRPH 4P9MH 1C16B 2UZYB 2NW3B 5KSBB 4XCNB 1OAXL 4KPHL 3DX9A 1QFUL 1BFVH 3NPSB 2NMSA 3MLZL 4TOYL 2YXFA 3EJJX 3BVNB 3TH3T 4GXVH 4L5FH 4ALAH 5ICXA 3VW3H 2GEEA 3GMRA 4MHHG 4X7DC 3H9SE 2V5YA 4PRHE 2BNQD 4J23A 4FQ1H 3BZ4A 4L3AA 2MCPL 4QF1A 4ODSL 4PJEF 2J8OA 3D2UB 3X17A 3OJDB 1IGIH 1NFKA 4BZ2H 2ZUWA 1U92B 5C07A 5BMFH 1HH9A 1MQ8A 2CLRB 4OGYL 4HG4K 3MSPA 3LEYH 1RMFL 1KG0B 3V7AG 1BWWA 3S7GA 4YBQD 4YAQB 3KLSA 5DR5L 3L95B 4P4KD 1DDHB 4Y4FC 1K6QL 2GUOA 4K94C 1NAMH 4NJ9H 4JFDA 5HYEA 4MNGB 1ZSDA 1J8HE 1D9KB 1YEHH 3QI9A 4TQEH 1EXUB 43C9B 5KN5A 4OLXH 3EFFA 2WZPD 5F89B 1UM5L 4R8WL 2X41A 4BSVB 3EOBA 4LVHC 1FNGB 5C86A 3FL7A 4LBEB 2VQUA 1T1YB 4UILL 1AO7D 3SE9L 3BZEB 2P43B 5IJVA 3OKMB 3H9YA 3PL6D 4DKEL 3CC5A 5IMOA 1RZIB 1JGUH 4HH9B 2EDHA 1MREH 4ZTOH 3EZ8A 4G3YH 1T4KB 5IROA 3S36L 4Y88A 1G9MC 5JXEA 4M1DL 3BX7C 1YYLL 1U3JA 5DK0A 4HXAL 3CFIC 2QQLL 5CAYB 1JZ7A 3WLWD 3MRPA 2BRRH 4Y2DA 4LSPH 2ATKB 2GTZA 4M03A 3GMLA 3DYMA 3RX8A 5L0QC 3L3HA 2MCG1 3QXVA 3HB3C 2ZCHL 1KNOA 1AGDA 1HHJB 4JVUA 4GBXB 3IFLL 3V52L 4DW2H 3MXVH 2B2XL 1H9VA 2LFGA 5ALBL 4PGCB 3W2DH 4PJBA 2R9HC 3WFBH 4J3SA 2P7TA 1R3IL 4RMVA 1F5WA 4FFYH 1KOAA 2HN7B 4I1NB 4QGTA 3O2VH 1HI6B 3QUXA 3UBXG 1YYMH 3QDJD 4HIEA 2EH7L 1F4YH 4W70A 4LSTH 4OGXH 1TQBB 1ORSB 1SY6L 3QIUA 5DJ8A 5EOQH 5B22A 3RVVC 4ZYKB 3TCLB 5L6YH 1EPFA 5FYLH 1IM3B 1VFOA 3EOTL 2BVQB 3L3KB 1VDGA 5IFAL 5JMRA 1KPUA 2VLRD 5DHVH 3BKYL 2WANA 1W0VB 1YC7A 3QRGH 3DTXB 1JRHI 4RAVB 4JQXC 2W60A 4YXKL 1QO3A 1I9IL 1PG7X 1S7XB 4U6XA 4FG6C 3CPLA 1OLZA 2V2WB 1B0GB 3SO5A 1GZPA 4CMMA 4BQBA 2DQTL 4P5KA 2ICCA 3GIVA 1Q1JH 3V7AE 5DJ6B 2AK4D 1SEQL 2Y4SA 3IXTA 1MJ7L 3BIKB 5IESH 4PRDB 3STBA 5D96C 2GJ6B 1LO5A 2R8SL 3RGHA 4PR5A 5EC2A 3GBML 4MA7H 4OZFG 4E41B 4QCIA 4JM2A 4YBHA 4RWYH 1EHXA 1IE5A 2BC4B 5F1IA 4BZ1H 4D2NA 4YPGB 3KYKL 4LQFH 5IVOA 4PJDB 1YJDL 3WXWL 3O3EB 35C8H 4PJIA 3VFUB 5DD1L 4Y4FD 2X4PB 3HMXA 4PS4H 3EO0B 5IIEB 4GLRI 3WL9A 1A1NB 3ZTJG 1H0DB 4C56E 4LAJH 2NXYD 2DDQL 2D7TL 2N7BA 1EGJH 5L9DL 1DUYB 3QUMH 5BS0A 3ZL4H 1EHLH 3BI9X 1I3GH 3MLXL 3UDWC 1A6VL 5TF1L 1P4BH 4R6UA 1NCNA 4X6EB 3TPKA 3DRTB 5IMKB 1VEOA 2NY7L 4HKZA 4CVZA 3C2SA 2VWEC 4PRHD 3DV4B 4XPTH 1NDMB 1KC5L 8FABB 4IEFB 1M7IA 4G9FE 4DGVL 3VMOA 4XBEH 3I50L 4LEOA 2A77L 4H26A 1OGAB 4IHOB 4F7TA 3LRSA 4XPHH 3K81A 4JR9L 3MV11 4OKVB 4ZTPH 1L7IH 1ONQB 2YRLA 3TNMB 1Z9MA 2AXFA 1KULA 3VXOB 5C2BL 2A6KB 2X1XR 2X4NA 1ETZB 4L1DA 3C6SA 1I7ZB 3SEPA 1IGMH 1M71A 3QWRA 4S2SA 1WAAE 3BPCA 3H42L 2ZG3A 3VE0B 5E03A 4JPIB 5D9SA 1JYXA 3HB3D 3NH7L 2AJUL 1R3KB 4W6YB 2Q6WA 1FNAA 2Q76B 4R0LA 5J11B 2ADFH 3U9PL 4GG6E 2Y5EA 5T1MB 3PWPE 4OIIL 5FM5M 3V5DA 3VG0H 1YQ2A 4WEBL 1N59B 3EYUL 2UZXB 4ZQKB 4HUVA 5BVJA 1FSKB 3RNQA 5IOPB 2R9HD 2NYYC 4O2CA 4WUKL 1UCBL 1I1AA 5DS8B 5F44A 2BZDA 3QXDB 1JTTA 4HK3J 5JORA 2DLFH 1R5VB 5D72H 4TSCH 1RUMH 1J87A 2J88L 3MX0A 3RIFF 3V4PH 2AV1A 4QHMB 3V4UL 1ODAA 2BOBA 5DHYB 5CZVL 3WIHH 4RAUA 1AI1H 3N50A 3QEQA 5DQ9B 5EO0B 4F8TA 4EI5C 5ADPH 1A3RH 4R9HA 2CXKA 3WIIH 1MAJA 5MENE 2B0SL 3RVVD 3DUUA 2XNAB 5TQ0L 3BGMA 5INDB 2GFBA 3MRIA 5JPNA 2AS5M 4EXKA 3Q6GH 4OGZA 3AMKA 4HIHB 2ORBH 3D3VA 1OM3L 4PGZA 5DRXA 1IAOB 5B4MC 5JDJA 3CUPB 2PW1B 1EJ6A 1NGYA 5AAWA 2EC9T 4LPCA 1C16A 2GCYB 2NW3A 5KSBA 3PGDB 4XCNA 3MRLB 3O3DB 5J0BA 2GJZB 3MRBB 3RZWA 3BVNA 4IRJC 5E7BA 4DKFL 4RA0C 2Z35B 1Q72L 4WFFE 3UYPA 1H5BB 3N1PC 1N3NB 2AJ3B 5CJQL 3S97C 2DLTA 3D2UA 4RGNB 3S96B 4QHLB 4Q9QH 3CDGB 2X1OA 1U92A 5I15H 2CLRA 4P2YA 4K55A 2Y6SD 3MC0A 4KDWA 1KG0A 4XRCB 1LWRA 3QNXB 4YAQA 2XWTB 4ODBD 3L95A 3QWQB 3DHMA 3DO3A 1DDHA 2BMKB 1T1WB 5DDHB 3PE9A 5E5MB 2MTPA 4MNGA 1D9KA 1MAML 1T1ZB 1EXUA 43C9A 5F89A 5JOFA 5EU7C 4J3VA 1Z6JT 4X6DF 4BSVA 5EDXA 1FNGA 5C0BE 4LBEA 2X70A 5F97E 5K9OA 1T1YA 1JGLL 4P59H 4QGYA 3OKMA 3TH2T 4YC2B 4OM1H 4Z7WE 2A1WL 3VCLB 5I1HH 1RZIA 1ZVYA 4ZS7H 4OLWH 1NMAH 5JQ6H 5TDOB 4AIOA 4HH9A 4NIKB 5DD6B 5HYFA 1HNFA 4I0PC 4OCNC 5E99H 5K59E 4X5WB 1U8LB 3OZ9L 4S1RL 4IDLA 3FN3A 3OKKA 4AG4L 3HZKB 1T4KA 3X3GL 5HHXL 4WCYH 5IW6B 1EIBA 3T3PF 4F9LC 5T5NG 5I17B 2DYPD 1HK6A 4MX7B 3BH8A 4OZGE 1KPVB 4V2BA 3KPRD 2ATKA 3T1WA 3EZJB 4LASH 3TF7C 2HKFH 4DGYL 4LCWE 4APQC 2ZUVA 4HUWB 1NFDB 2W9DL 2NYYD 2QADD 3D87B 2V2XB 1P69B 2C5DC 3F7RA 1HHJA 4ZDHB 1TTFA 4GBXA 1LE9B 3LSOB 3PWJB 4AQOA 1BF2A 2P48B 4FXKB 4CN6A 4M7JL 3LZFH 1BJ8A 1A7RH 1X5XA 3D18B 5MP6H 4PGCA 4JN1H 1HSAB 2R4RH 1YN7A 3U82B 3I3BA 1CICB 2X89A 4EI5D 3O8XB 1LE5B 1YEKH 3WNKA 1Q9OB 1T6VN 3VFGH 1MLBB 4ZUUB 1BIHA 2QSCL 3SN6N 5EBLB 3IDXH 1ZA6B 1A47A 5GS2H 2D31B 5J6GB 2AK1L 4DJMA 4OZFH 1HI6A 1PKOA 3MRFA 2F54B 3TT3L 5EUOF 1FVEB 3PWPD 5I74C 1KN4H 1ORSA 3P0VL 5B4MD 3TCLA 4X4XB 4ZYKA 3EHBC 1FO0L 1IM3A 3L3KA 4NBXB 2A2QT 1R0AH 2C1PA 5AZ2L 3SDAB 1W0VA 3S35L 3ZTJH 4MGXA 3DTXA 4MWFB 4RAVA 4U1HB 1BFSA 2IMNA 2CD0A 5IQ9A 4P2OC 4IRJD 5LBSL 1S7XA 5F9OL 5MEPB 2V2WA 1B0GA 2OR7A 3ARXA 3S36X 1JNHA 3AREB 5DJ6A 3SCMB 3M8OH 3BIKA 3I6KB 3EYQC 1KJ2H 4ZOAA 5TQ2L 2GJ6A 4QEGA 2YKLL 3FO2B 4E41A 4I48B 2Q86B 2VDMH 5SWSD 4YPGA 3UJIH 1NCDH 2MQCA 2AERT 2XRAH 1UA6H 2EIBA 3O3EA 2CDFB 5JHDB 3VFUA 2X4PA 2JJWA 5L88H 3EO0A 2Z92B 4OF0A 5B39A 3M1BB 1A1NA 3QP3A 3G5VB 4HXBH 4G5ZL 1OB1B 5HDBE 1DUYA 4QOKE 4HZLB 5HGDB 2JK5B 3ULUC 4JFFD 3C09B 2FX7L 5F1KC 5KAQG 1QYGL 3V6OE 43CAB 4WFFD 3EYSL 4X6EA 3WKNA 3DRTA 5IMKA 2YRZA 3MBXH 3QFDB 1I9EA 3DV4A 2DQIH 1YQVL 3H3PH 1NDMA 3V0WH 8FABA 3B3IA 1BD2D 2X44D 1SY6A 4I0PD 2D03H 5C0RH 3NTCH 4L4VE 4EIGB 1OGAA 4IHOA 2XWBA 3G9AB 5JNYB 4KRNA 1HKFA 2DKUA 4Z8FH 1HIMH 3TNMA 4OKVA 4XAWL 1ONQA 1NBQA 4X6CE 4WTZG 2MKWA 3VXOA 1EEYA 4P2RE 2A6KA 1ETZA 4AEHH 1T03H 2XY1A 4U49A 3KPQB 1NC4B 3VE0A 4LSQH 1IEAB 4JPIA 2ZCKL 4APQD 5KVGH 4S10A 1DBBH 1R3KA 1JJUA 3VFSB 4B53A 2Q76A 2F15A 1V3LA 4N1HB 3QT2A 3CMOH 3FTGB 5T1MA 2R69L 4LCIL 3S5LG 4A2MA 4S11A 4A2LA 1BOGA 4UIKL 4GG8B 1N59A 4ZQKA 4ZO7A 5IOPA 2VUYA 5DS8A 1IGTB 1D3CA 5LCVL 3QXDA 4O51B 5FEBA 3QWOA 4P2QB 2KQNA 5IVXE 4PLNC 1H8NA 3MLRH 5HY9B 5AWNH 4K9EL 1OAQL 4GRLB 5C09E 3ROLB 1UXSA 1IQWL 4QHMA 4JFQB 5DHYA 1VFMA 5IHUH 1N0XH 3RVTC 4DTGH 1OSPH 2VLKE 5EO0A 5I1EH 4G43B 1EJOL 5C9KA 3O4LE 1RV6X 1C1EL 1PW3A 5DRNB 1I1RA 4LRIA 3EHBD 2XNAA 3S3JA 2FO1A 2W07A 5BS0D 3EO9L 4M61A 4RMRA 5INDA 4K3HA 3BEWB 2Y36L 3DVIA 3EDKA 4XZUB 3ARFB 4FFZL 1EAJA 4HIHA 3HNVL 4JPVH 4AT6A 5I18L 4AIZB 4P2OD 1IAOA 5IBLC 3CUPA 2PW1A 3PGDA 3MRLA 5T5NF 5LWYH 3O3DA 3ET9F 2GJZA 3MRBA 1QBLH 3T2OA 5GISH 2YUXA 3EYQD 3JWOC 4K2UL 1ZEAL 4UQ3A 2GI7A 3SOBL 4GFTB 2Z35A 4M6NL 1JBJA 1FGVL 5F71A 1N6QL 1H5BA 2EE6A 4KKBC 3GMOB 1N3NA 2IFFL 5ESAB 3RWFB 3VI3F 2AJ3A 4N9GB 5J89A 3SDDC 1KCKA 3S96A 3EOYG 3MUGB 3NACH 4XMPH 4OFYD 4CN4A 1G0XA 1UJTA 3O6FC 3FQUB 4HHAA 4XRCA 1DBKL 2D7PA 2E3VA 3QNXA 4MJ6B 3QDGE 2EDKA 3B6SB 3T2NL 2EYRB 2FHBA 3ULUD 2XWTA 3VMNA 9CGTA 5TDPB 2AVGA 2BMKA 1T1WA 5DDHA 3AAZB 5E5MA 4L4JA 1T1ZA 1ES0B 1Z3GH 2E9WA 5C6WH 3MV9E 5D6DC 3U7WH 4P9ML 2HRPL 3ARVA 4U31A 1L4IA 5BVPL 4L9LC 2FGZA 3L7FB 3AUVA 1UACH 3IFNH 1TITA 5F9WC 3F65A 5CILH 3VCLA 4GXVL 4L5FL 1EK3A 4ALAL 3UTOA 5TDOA 3LKNB 5DD6A 3VW3L 2PO6C 4X5WA 3GKWH 5J7CC 3HZKA 5ECJE 3MR9B 5L2KE 4NWTH 2BOCB 4HWBA 4TTDC 4OV6F 4XP9H 1IGIL 5IW6A 4BZ2L 5BMFL 3LRHA 1HEZB 1NPUA 4QOKD 3OQ3B 1A6UH 4Z77B 4EN3C 5I17A 3MROB 3NCFB 4MX7A 1KPVA 1QLRB 1T5XB 4DEPB 1UH4A 4HUWA 1NFDA 2V2XA 5E2UL 3WV0A 1WSST 1NAML 4FQCH 4G8EB 4NJ9L 3WKMH 2VDKH 4ZDHA 4JRXB 2FX9L 2H26B 1CDGA 3GZKA 1YEHL 4UBDC 4JY5L 1LE9A 3LSOA 2JIXB 3PWJA 5T3ZD 5GZOC 1I7RB 2H3NB 2PNDA 3GMMB 4FXKA 3R0NA 3JBG7 4OLXL 3D18A 4XHJC 1HDMA 4NPYB 4QT5B 4JFXB 4QTHB 1XIWC 4N0YH 1HSAA 4XWGH 1LD9B 1X4ZA 1K4CB 3RVTD 4G6JH 5DD3H 1CICA 3O8XA 2LTQC 1LE5A 4LHUG 1UWEL 1Q9OA 2R39A 1MLBA 4ZUUA 4TUJB 3HR6A 1JGUL 2VKXA 4M6OH 5EBLA 1ZA6A 1LP9B 1MREL 2D31A 4ZTOL 3IRPX 3UXFA 2NX5B 4G3YL 5J6GA 1SYSB 2R2EB 5F96H 1RJZB 4XNYH 4DKAA 3RBSA 8CGTA 2F54A 2VH5L 1ZAGA 1FVEA 2YK1L 1TPXB 4YK4B 1FG2A 5IBLD 4I3RL 4X4XA 5HYJB 4Y89A 2DOCA 4NQSB 1DLHA 2R15A 3PGFH 1ERNA 1F3DH 5AUMB 2BRRL 4M1CC 4LSPL 4MQSB 3SDAA 4MWFA 3BRGC 4U1HA 3HG1B 5C09D 1CD0A 1JTOA 4FABH 1XCTB 4DFHA 4BFEA 1QRKA 1CXKA 5MEPA 4RRPA 4DW2L 3MXVL 5J12C 1JZ5A 3W2DL 3AREA 3HE6C 3SDDD 3RKDD 1B0WA 1QA9B 2SEBB 4JREB 3SCMA 2IALA 3NBNA 3I6KA 5CKGA 1BM3H 2GSGB 1Z9OA 4MD4B 3FO2A 2ZCLH 3QUZC 4FFYL 2PYFB 2Q86A 4KGLA 1T83C 3QHZL 4YHOH 1WZ1H 2R0ZH 2F8XC 4P49A 3E8UH 4RMQA 5JHDA 3KWWB 1D5ZA 2CDFA 3TT1L 1KN2H 3O2VL 3K8LA 3BUTA 2VB5A 1NBVH 2Z92A 1E27B 4TSAH 4OJFH 3M1BA 4LSRH 2H45A 1F4YL 4LSTL 3G5VA 4R3SB 4JDZB 5CCKL 3TN0A 2L7JA 4U0RC 1OB1A 1YY9D 5L6YL 5ELIA 4HZLA 4MNQB 4GH7B 4PIRF 5HGDA 2JK5A 5J9PA 5I8EB 3F7YB 5FFLA 43CAA 4H88H 3C5SA 5D1XC 3F7VB 5D70H 5EORL 2DQGH 2ZP0T 3QHFH 3QFDA 2B4CH 4WJ5B 3C5ZB 4ERSL 4K8RC 1EO5A 2PO6D 5IFJA 1DQDH 4PJAB 4L3EE 5FKAB 4X5XB 4D0BB 4RSVA 1Q1JL 4K3DH 1BJMA 3QQNA 7CGTA 5JNYA 3IKKA 5IESL 4TTDD 3ORJA 3FT2A 3QDGD 3VD4A 5D1ZC 1RK0B 4MA7L 4EN3D 4RWYL 2LVEA 1CD8A 4LQFL 2LE9A 3KPQA 3WUZA 1NC4A 3S35X 3WEXB 5CIPH 3SGDH 4M8QB 3EIFA 2ADJB 1IEAA 2PN5A 1RVFH 35C8L 4O5LL 4P23C 5EU4B 1K85A 4PS4L 3OF6D 4CMHC 2VLJE 2X09A 4Z5RB 5CJXA 1U9KA 1WIUA 4UBDD 4PTUB 5GZOD 4AYFA 3FTGA 3SE4C 4XCCL 4ZUWB 1EGJL 3FT4B 2CUMA 3L5WA 2W92A 4GG8A 2VDOL 1XIWD 3ZL4L 4C59B 1EHLL 4XVJH 1AHWC 1I3GL 3MREA 4FQPA 5I30H 2WWKO 4O51A 5CEYB 1P4BL 4P2QA 4YDIL 3BPOB 5HY9A 2RB8A 2F19H 3H3KA 4EUPH 1CGWA 3L3DB 3ROLA 4XPTL 4IOSD 3KPOB 1UENA 2CKBB 1GSMA 4Z7QF 1INQB 1NC2B 4XI5C 4FQQB 3B83A 4G43A 4XVUC 5D1QB 2N1KA 3QUYC 4N5UA 4H1LH 4ZTPL 1L7IL 4QWWD 3H9SB 5DRNA 2EDLA 3QRFM 2NXZB 4Y5VC 1IGML 3BEWA 4HEPG 4PJGF 5KS9F 5C7XL 1PLGH 2ZOKB 3ARFA 1JNNH 1F13A 5I71C 4PRIB 2DQJH 3O41B 3HPJB 4UT7L 1WISA 1IILE 2ADFL 5DVOA 4LLYB 1HCFX 3IJSB 2X5PA 5GGSY 3VG0L 4LCCC 5KTEL 3AFLA 2IBGA 3ARYA 3HE6D 4ZPTB 4OZHF 1OLLA 2XFXB 3VXSD 2ICWB 3DXAE 3L5HA 3NIDE 3CZJA 4PLJD 3CVIH 1RUML 3QUZD 1RFDH 1XAUA 4P3DB 3TA3C 3GMOA 5ESAA 3RWFA 2X1WL 4JEGB 1G1CA 4N9GA 5C0FB 2MPAH 1RUAH 3WIHL 2NY1B 5JTWA 3QUMB 3MUGA 1YN6B 1IZJA 4YFDB 5ADPL 1A3RL 4MD5B 4OD1L 5GGVH 3GJFH 3VJ6B 3FQUA 3B5HA 3VGFA 3K1DA 1PX3A 3B6SA 2EYRA 5D7KE 1CL7L 1N64H 5EO9B 5TDPA 5HVFB 4KDTC 5DD0H 3AAZA 1GPOL 3ZE0E 3Q6GL 1AC0A 5FK9B 2ORBL 3IKCB 1ES0A 3UTTD 2BVPB 5D1XD 4EDWH 2E9IA 3OXRB 1VCAA 2Y5TB 2AJSH 5E6IB 1N7MH 3VWJB 2D7OA 1WK0A 4K8RD 2NY3C 3L7FA 4HC1A 2A0LC 2XA8H 4I2XE 1FN4A 4MXWH 1FCGA 1X5LA 4G80B 4LEXH 4IIQB 3K0WA 5T1KB 5D1ZD 1RZJH 3LKNA 3OKYA 2E7LC 5EZOH 1CD9B 4HK0B 1JPFB 3DMMC 4WEMB 5I16B 1Z9SA 3MR9A 2UZIH 2BOCA 4U7SA 4PRAB 1ZMYA 3MCLH 4P23D 4Q9QL 3RDTC 4PRBB 4WV1C 3U6RB 2Y7QB 4NKMB 3MROA 1QLRA 2ZNWA 3HUJB 5J13C 4Z0XB 1T5XA 3VFPB 4FQJH 3PXHA 4KQ4H 3BD4A 4JRXA 4QRRD 1C7TA 1U0QA 2JIXA 1I7RA 1DEEA 2H3NA 3GMMA 4M7KL 4R96B 2DBLL 3MUY1 4NPYA 3JUYA 4QT5A 4JFXA 1I3RA 1ZHNB 3TBYA 1K4CA 4YFLF 4OZHA 2BVOB 3M07A 4XVUD 1TZIB 2BJMH 2MHAB 3QUYD 4ZS7L 1HQ4B 4OLWL 1NMAL 3N1GC 4TUJA 5JQ6L 5I1CH 1CLYH 1LP9A 2NX5A 5E99L 1SYSA 2VLJD 5IK3B 2R2EA 3X11B 1RJZA 1S7UB 3KYNB 1I9JH 1KFAH 4WCYL 5T3XD 4YFLI 4AEEA 3MV01 3BP7B 5HYJA 1HSBB 4NQSA 2QSQA 4K7PY 4X7CC 5AUMA 2KPNA 4NQDB 4LASL 5H35B 2HKFL 2XI9A 3LDBC 4OSUH 1MCRA 2PXYC 1JVKA 4K3GA 4C56B 3VG9B 1HHIB 3X13B 3HG1A 2CSPA 3RWCB 4LFHD 4R26H 4LSUL 3LZFL 3TA3D 1A7RL 4KK5C 1CGYA 1NSNH 1PQZB 4JN1L 5DQDH 2R4RL 5IBTH 1QA9A 2SEBA 1MH5B 2X4SB 2GSGA 1MRFL 4MD4A 4WDIA 4WFGE 3OKEB 3SDCC 3WDHA 1YEKL 4U1IB 2PYFA 4G9FB 3N9GH 1FFPB 5IKCB 2F5AL 1MI5B 3CDCA 2L0DA 5GRYA 1FZMB 3IDXL 3DRQB 5GGQH 3VXUE 1PEZA 3KWWA 5IFHH 5GRJH 1BVZA 1PYWB 5FUOH 4DGIL 1E27A 4JY6B 1KN4L 4R3SA 4JDZA 5DJ0A 5C6TH 4MNQA 3U0PA 4ZUVB 4P0DA 1R0AL 4L29B 5I8EA 3MJ7B 3I85A 3F7YA 2A0LD 3DXAD 4X7EC 4NCC2 2FDBP 2IG2H 1A4KB 3F7PC 1P6FA 4GG6B 3F7VA 1S78C 4Y1AB 2XQYG 4XC1H 4U3HA 3ULVC 1ND0A 4WUUB 2EKSB 4OBRA 3VGAC 4JKMA 3C5ZA 2FB4H 3BWUC 3OGOE 4PJAA 5FKAA 2FJFB 3IDNA 4D0BA 1CFSA 1F42A 2ESVE 3PJSA 1G7IA 3WS3B 3B2UC 4D9QE 3HI5L 3M8OL 3UBXB 2G60H 1KJ2L 2C4XA 1P9MC 2FEEL 3RDTD 1AE6H 3RWIB 5D7KD 1NCCH 1RK0A 1Y18A 1ROWA 1NBZB 4O00A 1NCUA 3UJIL 1NCDL 3WEXA 1UXWB 3RVXC 4M8QA 2ADJA 4KMQA 3S88H 5EZIH 1UA6L 3SO3B 5MENB 1TJGL 5FHBL 5EU4A 1BIIB 1CDHA 5L88L 1UH2A 4Z5RA 5BZDA 3VFMB 4W81A 3TJHD 4YGAB 4PTUA 5AD0B 3CXHK 4HXBL 1BFTA 3AVEA 5C70A 2A6JB 3FQXB 4NWUL 4ZUWA 2AGJH 3FT4A 3RAJH 1JL8A 4YE4H 2BCKB 4X99B 5GGUB 1HHKB 3ARBB 4KQ3H 1WJ3A 3SDXE 5AG9A 5CEYA 3QQ9C 5B21A 3NCYS 4OZFB 4YXLH 1A6WH 4ZXBC 3L3DA 2DQIL 3KPOA 3H3PL 3OGCB 3T4YA 2ZUSA 1K5NB 3VXQB 2VMFA 2CKBA 2D03L 5C0RL 1INQA 1NC2A 4FQQA 3BGFC 3BMVA 1UEMA 5DFWH 1S9YB 4MA8H 5D6CA 5DHVA 1YMMD 2Q1EA 2PW2A 1KEGH 5E00B 4PRPD 1HIML 3CFJA 3H9SA 4LKXB 5KSVB 1RUQH 4KAQH 4AEHL 2FJGA 3BJLA 3VA6A 1T03L 3MUHL 1FORH 4ONGH 2F53D 4HF5L 4G9DB 2ZOKA 5TDNB 4HDIB 5KVGL 2DQEL 4PRIA 1DBBL 1P6AB 3O41A 3HPJA 2CMRH 4DVRH 5CSZB 2P5ED 1BQLH 1KJ2B 4PJ9B 3UTPE 1UYWH 3CMOL 2C3WA 3IJSA 4HFWB 4KK5D 2WBJC 4KZEH 3GSVB 4P4RB 4ZPTA 1J8HA 2E6QA 3HE7C 2XFXA 3ARWA 3KPSE 4HBCL 3BOVA 5TF0A 1J11A 2QTEA 2ICWA 3SDCD 1HOCB 3MLRL 5AWNL 4PJFB 4JFPB 4U7MA 2C4FU 4NQTA 4P3DA 3VI4E 3STLB 2NNAB 1TNMA 1CLCA 4Z7WB 5HSFA 5C0FA 3QQ4B 5IHUL 1MCQA 1EGJA 4ODVL 4JRYE 5GGTH 1OSPL 3CNKA 4JFOB 3QUMA 1D6VH 2J5LC 1YN6A 1OP3H 3KYAA 5I1EL 3QIBB 4Y4KB 2CH8A 4MD5A 2DM2A 1WCBB 3VJ6A 3GEWB 3O4OC 1CL7I 4H25B 2DKSA 2R56H 1VENA 3D85B 4HKBB 4X7FC 3ZE2F 4AM0B 4X4ZA 5EO9A 2F8VA 1K4DB 1JWUA 2P5WD 1S8DB 1XGUB 1BEYH 2OL3L 2A6IB 4KUCD 4MVBD 2E7BA 1YECH 4AEIH 5CS7A 4WWKB 5JQHC 4JPVL 5FK9A 3IKCA 5E2VH 2BVPA 1S78D 3OXRA 3M17B 3ULVD 2J4WH 5CWSB 2Y5TA 4OFIA 5E6IA 4ETYA 5CJ8A 1AFVH 2VE6B 3VWJA 1SM3H 2LAAA 1FJ1B 5LWYL 3BN3B 3B2UD 3BKCL 4JZOB 1OARH 5GISL 2LVCA 4G80A 5FXCH 4IIQA 5TE4H 5T1KA 1EO7A 4GXUN 3VXUD 3BE1L 4QHNB 1ZHKB 4HK0A 5CLTA 3BKMH 2NY4C 5I16A 1LDSA 4GKNB 3RVXD 3HC4H 4YQXL 5CLWA 4KWUA 1FVDB 4Q6IB 1ZHBA 2BRQA 4JZJC 1DE4A 5GGRY 2P1YA 4PRAA 4BZYA 1F2QA 4PRBA 4XMPL 4LLAA 1ZT7B 1I75A 1L0XA 5HI5C 1J1PL 1WAAF 3U6RA 5K9QG 4NKMA 5ID1B 4U4BA 2LABA 3C8HA 2UWEE 5JR1H 4KTYA 5I19L 3BEVB 3HUJA 4JRWA 3RP1A 4Z0XA 3VFPA 3I2CH 2XA3A 1FIEA 3OWEA 4HT1H 4CVUA 1DJSA 2DB8A 3BWAB 3MNVB 1T80A 3WIHA 1Z3GL 1TQCC 4R96A 3MRDB 4ZXBD 3U7WL 1JWSB 3GSOB 4LVEA 1ZHNA 2XTJE 1DUZA 4MB5A 1CT8B 2BVOA 3ZE1E 1UACL 3IFNL 1TZIA 1RPQA 2MOVA 1JZ2A 2MHAA 4ESKA 5CILL 5C07E 4GAGL 3LS5H 4JKWA 1HQ4A 4FA8A 1MCWM 3B2VH 1ZANH 2AJVH 4WW2B 4WI2A 4NZTL 2HLAB 5T1LB 5IK3A 3GKWL 3X11A 1S7UA 4XVTH 3KYNA 1FE8H 3REWB 3CK0L 4NWTL 1RIHH 5HPMB 1MCNA 4JFDE 1A6UL 3BP7A 5IQ7H 1EUUA 4QHKI 4JQIH 1HSBA 5EB9A 1A3LH 1E28B 2A73B 3RIFK 4H8WH 5HBBA 4NQDA 5H35A 1V3KA 4OKDA 2NY5C 4GMSH 3KHQA 3HE7D 3FB6B 4TNVF 5E2JA 2IANE 3O11B 4C56A 1WWAX 1HHIA 1BGXH 1Z2KA 3X13A 4FQCL 3RUGE 2ZG2A 1ZLUH 3WKML 2VDKL 1J8KA 2ZOLB 1X3DA 3RWCA 4YR6A 4F9PA 1QD0A 2D9QB 2P24B 4HGMA 2CKNA 5FF6B 3H2WA 1PQZA 3VDCA 4KROC 5KSAB 1MH5A 4G6JL 5DD3L 3MJGX 2X4SA 3CFEA 3IAGC 4JG0L 5DI8B 4U1IA 5ADOH 1ACYH 4G9FA 5KANI 1QSVA 1FFPA 1MI5A 4KH2A 2X10A 4M6OL 1FZMA 3DRQA 3T0EB 1JGVH 1KTDB 5FA4B 1PYWA 3RGVD 3QI9C 4XNYL 5ENWB 2Z4QB 4MA1C 2Z31B 3LH2H 1LVEA 4JY6A 1HKLL 2YHGA 1WAAA 1MFAL 1EEUA 5JO5A 5D7LE 1X5JA 3PGFL 4L29A 4FZ8H 2PR4L 3MJ7A 1F3JB 1F3DJ 1WF5A 2JJVA 3T0BA 4PJBE 1A4KA 4O9HH 4GG6A 4Y1AA 1NQBA 3FMGH 4HGWB 1QHOA 3JV0A 4WUUA 1QHPA 5DQJB 4FABL 2EKSA 1M05B 3ZKMC 2GITB 3MV8B 1QBML 3CSPA 5L8JB 1FPTL 1E6JH 2FJFA 2IBZY 2NY4D 4Z0BH 2FEEI 1JYNA 4AMKH 5C0GA 3G9VA 3WS3A 5JXEC 3QO0B 2VN4A 4MDIB 3MRRB 3RNKB 3IU4H 3UBXA 1OAKL 5EU6D 2GY5A 1BM3L 1NKRA 2X2YA 5FUCE 2G2RB 3RWIA 3FOMB 2ZCLL 5K59F 1IC5H 1NBZA 2O5XH 3CXDH 1KBGL 4YHOL 1WZ1L 4NM4H 1UXWA 5I9QC 2DM4A 3E8UL 3O4LB 5MENA 1KN2L 1EFXD 2R2CA 1BIIA 1NBVL 1CDCA 3SGJC 4TSAL 5FGRA 4OJFL 1F4HA 4R2GB 3VFMA 4LSRL 4OZGF 5D2NB 4PREB 3MOQA 4XC3H 4U2ZA 4CU6A 2A6JA 3FQXA 3I3DA 1V05A 4U6VL 3ZHLA 2AEPL 2WNGA 1WC7B 3IS0X 2DQHH 2BCKA 4X99A 5AYQA 5GGUA 1HHKA 3ARBA 1KT2B 5CSGA 4H88L 2MWCA 3F5WA 2MQ3A 5D70L 4Z76B 4OZFA 5FGCE 2W38A 2B4CL 1GC1C 2HT3C 4AEFA 3LEVH 3DOSA 3OGCA 2NW2B 1K5NA 3VXQA 5F8QC 1U8KB 1DQDL 3QUXC 3KXFE 4LL9A 5LXGH 4K3DL 1EMTH 1F4XH 1S9YA 5JDSB 3QIUC 5HYSA 1A6AA 4KK8C 4OCXH 1OD9A 2H8PB 4LKXA 4F7PB 5KSVA 4F7MB 1GGCH 5DC4B 3WFEL 3LS4H 4GW4B 3GB7B 2BY2A 4TNWK 5D93B 5DXWA 3MRNB 3V5HB 4U1MB 4G9DA 1H3PH 1RVFL 4RCAA 5TDNA 4QYOB 2HMIC 4HDIA 4JKLA 4DVBB 3E2HC 3I6LE 3TVMC 5CSZA 1KJ2A 2JJSC 4PJ9A 1QBBA 5D5MB 3VWKB 4HFWA 5GRUL 3ULUF 3GSVA 1PSKH 4P4RA 4OF7A 4TVSa 5C07D 3MV9B 3T2PA 1GH7A 5I30L 4DUWA 5JOPE 7FABH 1HOCA 2C9AA 4PJFA 1UKQA 4JFPA 2F19L 3P30L 2I27N 1G9NC 3STLA 2NNAA 4YIQB 3PWLB 1QSFD 4Z7WA 3NCJH 4OUUB 1BBDH 3QQ4A 5JW4Q 2IF7A 4JFDD 1WBYB 2CUHA 3QI9D 1IT9H 4Y4KA 1ZKAA 5HXMA 1WCBA 2UVEA 3VRLF 4H25A 1UGNA 4KFZC 1J0ZA 4PV8B 1NGPL 3S5LB 4HKBA 4AM0A 5B38G 4K23H 1K4DA 4MZ2A 1YC8A 1S8DA 1XGUA 4MD0B 2A6IA 3AC0A 1PLGL 4PD4J 4DK3A 5FV1L 4DUVA 2GK2A 4UB0H 1JNNL 3JWDH 4W6XB 3NFSH 5HDBF 5BV7H 4OZGA 2DQJL 1PFCA 5CWSA 2X1QA 2VE6A 4LCWA 4OGAC 3ZKMD 4EEEA 3C08H 1FLRH 2D2OA 2FBOJ 1DN2A 3EFDH 3TBWB 1XR8B 1JPTH 3VFNB 3LEXB 5JXED 4IDJH 4JZOA 4C83B 1KYOK 4KKNA 3UCRA 5CIPB 4AL8L 3L9RB 1MFDH 3L3GB 1RFDL 4JO4L 1T7XA 5TGBB 1TDQA 4QHNA 1ZHKA 2NPLX 1NGZB 2AI0H 1U93B 4Q6IA 2MPAL 4X6CF 3WNNA 1CR9H 4OQ1A 1ZT7A 4KJPC 5ID1A 3GUTB 2FSEB 2BSED 2OJEA 4LCUA 2DS4A 3QG6A 2CO7B 5SX5K 3MZTA 4N5EC 4C58B 5I1IL 3PHOB 3ZYOA 5DD0L 4G8GB 5HPOA 3BWAA 1P4LA 3MNVA 2EIDA 4R4FH 2XWJB 3C60B 1R6VA 3HMXH 3MRDA 4RDQG 2JELH 2HT3D 4YDKL 1N7ML 1JWSA 4XPAH 2VDQH 3GSOA 4P3WA 3O45B 4FHBD 4BFIA 3QUXD 5IVXF 1T0PB 2F8OA 2XA8L 4QTIH 4U1JB 2RJMA 3BDYH 4JFHE 1Z0MA 4MXWL 2K7PA 1CT8A 1FLTX 5C0IA 3QIUD 1AGFB 4KK8D 1T66C 3LVEA 1L0QA 3FFDB 4CKVX 4LEXL 3AB0C 3FRPG 2WUBH 4WW2A 4PJCB 1FL5B 1B4JH 2HLAA 5EZOL 5T1LA 1I3UA 4JPKL 1NUDA 3REWA 2DQDL 1KJVB 5DT1H 2UZIL 1EZVY 2HMID 5HPMA 3MCLL 5CP3H 4MNGE 4Y5XB 5FUZH 1E28A 1MCEA 2A73A 3NPSC 4JGMA 1MJUH 1RURH 4KKAC 3FB6A 3O11A 2R29L 2OX5A 4KQ4L 4R97C 2ZOLA 4PY8J 2YD8A 2P24A 2BNQB 2D0FA 5FF6A 3V6OA 4JFED 4XXCA 2WW8A 2OMBA 4J3UA 3FO0L 3TO4A 1FAKT 5KSAA 1DFBL 1A7NH 1YEGH 4YHKL 3AY4C 5F9DC 2WQRA 5DI8A 5I8OH 3RKPA 2BJML 3BN9C 5E2TH 3ZDXE 1IRAY 4R4BB 2G9HB 4L3EB 4X7TB 1A6TB 4L4VA 4P4KB 3W11C 4NM8L 1F8TH 1TVDA 5I1CL 3WHXB 5GIRB 1AKJD 5MEOB 4M7LL 1KTDA 1KLFA 2HWZH 3I6LD 4QRPE 4X6CA 1G7HB 5ENWA 2Z4QA 2Z31A 2I24N 4AJ0A 4IRSB 4OZIB 2BHUA 1KTRL 1AO7B 1AXSB 1LK2B 1MFCH 3INUH 3Q5OA 4OCLC 1DBMH 1SMAA 2EIEA 2VTFA 1F3JA 1F6AB 4X98B 4F57H 1I8MB 1UQSB 4LHUB 4HGWA 3MJ8B 1M05A 2GITA 3MV8A 3SBWC 4R26L 3THMH 3DX8B 2CR6A 4O02H 5I2IB 1NSNL 4M7ZC 5D7IB 5DQDL 4MDIA 5ESVB 3MRRA 3RNKA 5I73B 2ADIA 1BBJA 4BQCA 3MV7B 2G2RA 2WWKT 3FOMA 1D5XB 4KZDH 1UM4H 3LQMA 3GSNB 3N9GL 5BW7A 2R23B 3UP1A 5A40E 5GGQL 4X5LA 3O4LA 1MCJA 5E9DE 5IR1B 1MLCA 2A74B 2IMMA 5GRJL 1FZOB 2DICA 4N5ED 3G5ZB 3B9DA 1HINH 5FUOL 1U36A 2IC2A 3MJ9A 4MJ5B 5D2NA 3VXMB 4PREA 4OT1H 5CD5C 1IGFH 1YEDB 1G6RB 4NO5B 1WC7A 3T4AB 3QEQD 4PGDB 4RMUA 4DAGH 1KT2A 3FQRB 1EBAA 2OM5A 4HWNA 4OCSH 1J5OH 2IG2L 3CVHB 3SDYH 1WBXB 4BUHA 1MJ8H 1T66D 4UNUA 2GJ6E 4XC1L 5F70A 4ENEC 3P77B 2DL9A 3X14B 2NW2A 1HNGA 1U8KA 4PJDE 5DVMA 1JUFB 2Y72A 3D3VD 1CDIA 2C3HA 4M5YH 5JDSA 4M4RA 2G60L 2QSVA 5I76B 2DN7A 2GAZA 3I75B 4GRWF 4OAWB 1AE6L 2H8PA 3H9HB 3IETA 2VLRB 4F7MA 1NCCL 3SGDI 1IQDB 1A64A 3PP4L 4K7FB 3GB7A 3MUZ1 2NZIA 3WBDA 4U1MA 5ESQB 4UOJA 3UYOD 3S88L 4KKAD 5DMKB 5GQBA 5GJSH 4IOFC 4DVBA 4WFHE 3QDHA 4MDJB 2BK8A 1U8JB 4YFEA 1KTLB 4POYA 4LPXA 3BFOA 5D5MA 2AK4B 2AGJL 3RAJL 3VWKA 3QH3B 4QXUH 3H7BB 1W72L 2VR9A 1Q9KB 2AQ2A 1EBPA 2ZUYA 1CFVL 1P84J 3MV9A 3MCKB 4KQ3L 1TJIH 1OGAE 3BN9D 2HFEB 2OTUB 3QUKB 4WTZA 5E56A 4ZNEA 3MYJA 4PJ5B 4YXLL 1A6WL 2YPVH 3W11D 3ZLQC 4KRPB 4YPJA 1TMCB 3PWLA 4NC1E 3U4AA 4DN3H 4OUUA 5BCAA 5DC0A 4JKPH 1WBYA 4WEUD 4MA8L 5EWIL 4ELMF 3D39E 1KEGL 4LVHB 4QY8B 2Z0BA 3W0WE 3GO1H 1WBZB 3S5LA 1IKNA 1RUQL 4KAQL 2FCBA 3CX5K 1FORL 1L6XA 1F4WH 3G6DH 4HJ0C 1AC6A 3BQUB 4MD0A 4ONGL 5DVLA 5AYUH 3TYGH 1I4FB 1I85A 4U3CA 2N56A 1AQDB 1NUNB 1OT2A 4NO0A 4ZFOL 1J12A 1DVFB 3OV6A 4JHAH 1H3UA 3QG7H 1FFNA 1UM6L 2ZUTA 4KZEL 1XR8A 1NLDH 3VFNA 3LEXA 3H0TB 4C83A 1AD9B 3MA9H 2AQ1A 4PGEB 5CIPA 2NY0C 3UEZA 5CJBA 3L9RA 3L3GA 3IDUA 4L8BB 1HE7A 5TGBA 5GS1B 5L0QB 5KZCB 4XMLL 4FNLH 4XCEB 1U93A 4LSVH 3L5XH 1CGUA 1FNSH 3T09A 1D6VL 5J11C 4EBQH 3CLFH 5DLMH 4M9PA 4HPYH 4JPWH 1N8ZB 2OTPA 2I9LB 2O26U 4KHTH 2FSEA 4XNZC 3GUTA 2R56L 4Z7VB 1FSKC 4NQED 1GVIA 3CU1A 1E4KA 2EDDA 4EUPA 2X89D 1YJDC 2HJFB 1UB5B 1J0JA 1BEYL 3PHOA 4G8GA 1YECL 1X5ZA 4X80L 1QKZH 1ZWIB 2VZVA 4R4ND 5E2VL 1RULH 2XWJA 3C60A 4ENED 1XF2B 2UY6A 1AFVL 1SM3L 3O45A 3I6GB 4L8DA 3F62A 4I77H 3B9AA 1LGVA 4U1JA 3VFOA 2RGSA 2JCCE 4RGNE 4LU5H 1AGFA 4NC2B 4LRIC 3FFDA 2E7MA 3SKOB 3RY6C 1WZMA 2LU4A 1JHTA 3T08A 4PJCA 1FL5A 1S5IL 4MNHA 3IAQA 3BKML 5C71A 1RY7B 3HC4L 3O2WL 1T2QH 3NIFF 5C8JB 2EDFA 3MLUL 4S1QH 2PUQT 2DI9A 4Y5XA 3BYYA 1TJHL 5CGYC 1X5YA 4WENB 4HZAA 4PY8I 4UOW1 1U8NB 5D96B 1NCAH 3ARGC 2Q3AA 3HS0A 1ZLWH 3I2CL 1Q0XH 3DIFB 3X12A 3QEGH 4E41D 4HT1L 2FWOA 1E4XH 3ILQC 5I66B 3MQIA 3OJVC 1H5BC 1DL7H 2BNQA 2KQMA 1HHGB 4WVRA 3BYTA 2VDPL 4M48H 5DMGD 1AQKL 1UT9A 4XPGH 3L3OB 1MF2H 1FL6A 4LAQH 1LO4H 2EE2A 4M1GH 2NTSP 4R4BA 5C2UB 5F3HB 2ATPB 2G9HA 4L3EA 3LS5L 4X7TA 4E42B 1A6TA 4XHQA 4TPRH 4P4KA 1ZANL 3O6MH 4B0MM 1NEUA 4RNRB 5FYJE 3WHXA 4ZAKA 1DSFH 5MEOA 2ILLA 4HJ0D 2CIIB 1I9RH 5IHZB 1FE8L 1G7HA 5J1SC 1HZHH 4FMFA 1NFDE 1RIHL 4ODHH 4NGHH 4IRSA 4WI3A 4MYWB 2IH1B 1ZOXA 5IQ7L 5FYKE 2R2BB 3FO9B 1KGCD 1LK2A 1A3LL 3ZE0F 3RI5K 3PWNB 4H8WL 1OGAD 3KYOB 4QLRA 2FIRT 1F6AA 3CFCH 1KB5H 1FBIL 2HVJA 5I1GH 5HGAB 1T7ZA 4F7EA 3DURA 4LHUA 3GMNB 1IM9A 3MJ8A 4YDLC 2ARJQ 3ZDYE 3T3ME 1CFQB 3DX8A 5LGHH 2VKWA 2C3GA 3SDXB 1JPGB 5I2IA 5D7IA 5FV2A 2VLMD 4XCYB 2Y9RT 5ESVA 5D7JA 1P7QD 4NHCH 1M7XA 4TULH 3E1F1 3MV7A 2F54E 3KPRB 1D5XA 5ADOL 3FQWB 3GSNA 2KL6A 3LIZH 2R23A 1YEFH 5A16B 5D2LB 5FGBA 5IR1A 5ILTH 2A74A 2W91A 2QQQA 2OTWB 5F72S 4M5ZH 3G5ZA 4PTTB 2EDYA 3LH2L 4KC3B 4MJ5A 2IGFH 5GHWH 4X6FB 4LGPB 3VXMA 4BFBD 4G7VL 3LN9A 1SEBB 4LSSH 1YEDA 4NO5A 2HH0L 1QEWB 4RX4D 5J57B 3T4AA 1CICC 4FZ8L 4PGDA 4EI5B 3FQRA 3O8XC 5F7UA 1TETH 3CVHA 4O9HL 3TBTB 5DSCB 1WBXA 3T1FB 3FMGL 1MEXH 3P77A 4I13B 4N8VG 3JZ7A 1UEYA 3X14A 5DC9B 3NN8B 2E7HA 1E6JL 4Z0BL 1MPAL 1JUFA 4AMKL 4LARL 3IU4L 1IC4L 2ZKHH 4PG2A 4G6ML 1A5FH 5I76A 2VXSL 4OAWA 3I75A 3BPNC 2VLRA 1LDPH 1IC5L 4Z9KB 5CGYD 1IQDA 3CXDL 2X4OB 4K7FA 4M43H 5DJCB 1XGRB 1PVHA 4FQXC 4NM4L 1BFOB 4XMKL 4IRJB 5ESQA 5DMKA 1FFOB 2BVYA 3SQOH 2V9RA 1HQRB 4MDJA 1UG9A 2APTA 1U8JA 1JNLH 3ILQD 1KTLA 3O3AB 4UUJB 5IBUG 3D0LB 2AV7B 4PUBH 5JIKA 2DQCL 4XC3L 1IKFH 3LN4A 4HG4J 3AREC 2AK4A 1FHGA 1OAZH 3QH3A 4CDHA 3SCMC 4NBZB 1Q9KA 4K71B 4P5MB 4FQLL 3TJEL 3QQ3B 1OW0A 3ZZ1A 5FYJH 3MCKA 4OFPA 1SVCP 2HFEA 2OTUA 3QUKA 5E94B 4PJ5A 4H0GA 2V7NA 4AZ8A 3LEVL 4R7DB 2ZPKH 5JLZB 5FYKH 1NJ9B 5E5UB 5KJRH 1MQKH 4IS6B 5F6IC 3WLBB 3FB8B 2OR9H 5LXGL 1EMTL 5BOZG 1I7UB 3IAPA 4FXGB 3TN0C 4OCXL 1IGCH 3WD5L 4QY8A 3L1OL 1WBZA 3C09C 4NKDB 2W65B 3LS4L 4JGUA 4UV7H 3E3QC 4KHXH 3BQUA 1DEDA 3DUHA 4HLZG 1H3PL 1NBYB 1OTTD 1I4FA 2EXWC 2DLIA 4OCWL 1AQDA 4U3XA 2DQFB 3U79A 4I0PB 1DVFA 5F9AC 4FQ2H 4GS7B 2DLGA 3L5IA 3QXTA 1PSKL 3IDYB 2JJTC 3H0TA 1AD9A 1KIPB 4O4YL 3P4OB 3BW9A 4NRXB 4FN0A 7FABL 4L8BA 5TFSH 4XP1H 4JHBA 4F37K 5GS1A 1S5HB 5CHNB 2XTJB 3ZKXC 3WUWG 1GGUA 4APQB 4XCEA 2WIMA 3NCJL 1BBDL 4PY7B 5CJXC 1BX2B 5HHPB 1IT9L 4G8IB 1TZHB 1WT5C 3LOWA 3K1KC 1N8ZA 3MLPA 1MCIA 1QUNA 2I9LA 2NLJB 1H3TA 2DMCA 2JB5H 4Z7VA 4HS8H 4YHPB 1CICD 2HJFA 1UB5A 4LMQE 1FZKB 3Q5YA 5BRZD 3O8XD 4UB0L 3VFTB 1ZWIA 3JWDL 3CZFB 3DPBA 4YXHH 3NFSL 5BV7L 1XF2A 5SWZB 4NRZB 4MB3A 2OBGA 2JE8A 1JNJA 3I6GA 3C08L 3RUGB 3EFDL 3MYZA 2F54D 4OCYH 1IFHH 1JPTL 5I74B 2AJXH 4IDJL 3QEUB 2I9TB 1EH9A 5J3HC 5BS0B 4NYLB 3SKOA 1PKQB 1S7QA 1MFDL 1QR1B 2V2TB 4J3OC 1I1CA 5DJZB 1BPVA 4JQXA 5EZJB 2B1HH 5M94B 2AI0L 5GGRB 5DMIH 2Q8AH 3LMJL 5C8JA 3WHE1 1CIUA 1CR9L 1GAFH 1LK3H 1X5GA 3HZMB 3KPTA 1RK1B 3HLAB 1JMXA 1CLOH 3ARED 4EXPX 4PJXE 4GKSB 3SCMD 1U8NA 3QZWG 2EDQA 1G7LB 1JPST 3DIFA 1IGJA 1DN0B 1IAMA 5JUEH 3HTLX 3ME0A 5D7LB 5I66A 3DI3B 3DGCR 4R4FL 5GGTA 2FZ3B 2COQA 2JJUA 3EDFA 3HMXL 2W0KA 1HHGA 1VEPA 5JHDD 4XPAL 2Q7NA 4AQ1B 3V0AC 1JMZA 2R0WL 3KJ4B 4OFVA 4XWOC 3FJTA 1VGEH 3VI4F 3A6BH 5ISZB 1JTPA 4FZEL 3TN0D 4XNQB 5F3HA 2ATPA 3UAJC 2M8XA 4E42A 4K9EC 2WUBL 2ESVA 3O81A 2WM0A 4RNRA 1B4JL 1MFBL 3UDWA 2CDEB 1S7WB 2CK0L 2X7LB 5HGHB 5BQ7B 1T1XB 3JTSB 3EYOB 4XP6H 5FO9A 5IHZA 1V7MH 5DT1L 4JHWH 1YNTA 4RA3A 3TO2B 2X4TA 3VRIA 2EXWD 1GGBH 2IH1A 3ZTNH 2QQNH 4NC0B 5FUZL 2R2BA 2APXA 5E4EC 2YXMA 3FO9A 3PWNA 3KYOA 4U33A 4PJ8C 1RURL 2J8UF 1OWWA 5HGAA 3CSGA 4TN9A 1IEBB 1ZLSH 3K3QA 3GMNA 4HH8A 5FCUH 1AY1H 3DV6B 1NC4D 2YR3A 1CFQA 2VITB 3SDXA 1JPGA 4N1CA 2XZCH 4NJAH 1LP9E 1IARB 4XCYA 5C0EA 1RZGB 2VISB 5I8OL 5E2TL 3KPRA 1ZXQA 3U7YL 1OAYH 3BD5A 5FM4A 1ZLVK 3FQWA 5E8DL 4NP4L 1N4XL 3KXFB 2W9LA 4AK1A 5HYJE 1WICA 4DEPC 1EO8L 1F8TL 4YHYC 5B3JE 3I9GH 5A16A 1YMHB 5D2LA 1REIA 3H9ZA 2HWZL 2OTWA 3GI8H 5GJTH 4P2QD 4PTTA 1S7RB 5I1JH 4WHYG 2UWEF 4X6FA 4E0RB 1FYTD 3HG1E 3BHBB 4ZNCD 1SEBA 4YBQC 4ODXA 1DLFH 1R5IB 1RIUH 3MRJB 4JFZH 1CDYA 1QEWA 4PB9H 3TCXA 1D5IH 1MFCL 1GOGA 2YPLE 4EI5A 1IAIH 1BZQK 3MRKB 3NVQA 3TBTA 4LPVA 5DSCA 3P11L 4D9LH 2CDGB 1U41A 3T1FA 5J3HD 2VR4A 5FCSH 3NN8A 3BRFA 3SQBA 3THML 3O3BB 4OF6A 3SE3A 3ZE1F 4BFGA 4O02L 3OKDB 1CVSC 3IDMB 3OMZA 4HQQL 3MTRA 4WTWA 4XX1G 4LK4A 3G6JB 4YEFA 4KZDL 1UM4L 1FH5L 2VUOA 3T0AA 2X4OA 4JRYA 5DJCA 1XGRA 2VXVH 4MNQE 4PJEE 1BFOA 5EU5B 4RFOH 4IRJA 1DQLH 1TZGH 1KJ3H 5CKAA 1FFOA 4UDTB 3W39B 1HQRA 1ZLUK 1RZ8B 5E2WH 1M1SA 3Q2CA 4UUJA 3O3AA 2AV7A 2DM3A 4IM8A 1MCDA 3SDDB 5HHME 4JREC 12E8L 4M02A 4P5MA 5DURB 4PJAE 4XWOD 3KYMB 2J2ZA 3O6FB 4OCSL 1J5OL 3DARA 1RI8A 1F11B 3SDYL 2J6EH 2BFVL 2BHYA 2EICA 5GSRB 1MJ8L 5E94A 2OZ4H 2EDJA 3UAJD 4KU1A 4JJHA 5F9JA 4R7DA 5JLZA 1NCBL 1NJ9A 3UZEA 2WLZA 2KKQA 1SYVB 1HN1A 4IS6A 2BNUA 3QULB 3WLBA 3FB8A 1TVBB 4M5YL 4TNVK 4XPBH 2GJJA 4FXGA 2OI9B 5C0ND 3P3YA 2O5ZL 4NKIL 4L9LB 4OB5H 2W65A 4NKOB 4R90H 3MGOB 1AGCA 2EYSB 4PJ8D 4Q74A 1ZV5A 5JXAH 4NUGH 1NBYA 5GJSL 2VAAB 3U4BH 2DBJA 4OLYL 2DQFA 3O9WC 4I0PA 4XBPB 2I07A 2Z8RA 2HTLD 3JV5A 3IDGB 4PJBF 1U3YA 4KJQC 4OF5A 4QXUL 4I9WD 4EQ2A 4XT1C 1CN4A 3IF1B 3QR2A 3FFCE 1CQKA 3U0TB 4F9LA 4RGMB 1Q38A 5FYLE 4EN3B 1TJIL 4WGWB 1KIPA 1ADQA 3P4OA 4NRXA 2YA2A 3UPAA 4LLQB 3ZT6A 3BAEH 4UTBH 1HHHB 1S5HA 5CHNA 2YPVL 5HVGB 4DN3L 4URTB 4PY7A 4LSDA 4JKPL 4JRXD 5I1KH 1BX2A 5HHPA 2JIXD 3QJFA 4G8IA 1TZHA 4PRIE 1Z5LB 4GQ9H 2ED9A 4YJZL 1XIWB 4IRZH 1PG7W 3GO1L 1CK0H 1QZ1A 4F15C 4YHPA 1QG3A 1GCFA 2N7AA 3G6DL 5FHAH 1FZKA 2X9XA 5AYUL 5C0JB 3V4VH 3K8MA 3VFTA 4I3GA 2NXYC 3CZFA 1RUKL 3TYGL 5ITBL 3X3FL 3RFZC 5SWZA 4J6RH 3MUJA 3HC0B 4NRZA 4MXVF 4JHAL 2NX5D 3QG7L 2IANA 5SWQB 1GC1H 1T7WA 3RUGA 2FEDC 1NLDL 3TP4A 3MA9L 1INEH 4JM2F 5HYJD 4NYLA 1PKQA 2V2TA 3ESUF 3IGAB 1CF8H 1J0YA 5DJZA 5B38B 3MZGB 1F2XK 4FNLL 4PJIF 2HYMA 5EZJA 2P8LB 3VXRE 4EIZC 4FTVD 4LQ1A 5GGRA 4WWID 4EBQL 4XGZB 3CLFL 3HZMA 5DLML 4HPYL 4JPWL 3CJJA 2IPTL 2XV6B 3CLEH 2VLLB 1WEJH 4KHTL 2VSDA 4QRPB 3RZCC 2O61B 2IEPA 2V7HA 4GKSA 3F58H 3VXSB 2BP3A 1G84A 1N2RA 1I8LC 1G7LA 3QUZB 2YOCA 1DN0A 1QKZL 1G1YA 5D7LA 2HAZA 1RULL 2ZUXA 5KBNC 2FZ3A 4PV9B 4RBPK 5FOJA 1QQDB 2X6MA 4I77L 3BT2H 3LPWA 4XNMB 1CD1B 2FD6L 3B9VA 4UAOB 4N9OB 4LU5L 3FQTB 4U0RB 5ISZA 1RZFH 4XNQA 4MNQD 1OPGH 3LHPH 5HGHA 2CDEA 1S7WA 1MHPH 2X7LA 3RIAK 1T1XA 3BKJH 3EYOA 1YY8B 5KW9H 3UTTB 3HUJE 4L4TB 1T2QL 1CDUA 1PEWA 4HSQA 2D9CA 3B9KC 3TO2A 3KNBB 2CKBH 3C5ZD 3VWJC 4Y5YB 1F6FB 4EOWH 3O9WD 5JW3H 4UI2A 2AEWA 5E9DB 4ZD3H 1JPSH 4G8FB 2EDEA 3T77B 4KJQD 4PBVC 4PGBB 4YWGH 4R7NB 4WHYH 1SBSH 3N1FC 4HWEH 3KLHC 2D7QA 5CBAA 3GI9L 2XYCA 4IIQC 5AZEH 1IEBA 1Q0XL 5D1ZB 4OM0H 3RJDA 1E4XL 3ALPA 3HI6H 3C87A 2AABH 5KVFH 3RL2B 5B39G 3VDAA 4YDVB 2VITA 1MVFA 1JRHH 3DYOA 3FB7B 4M48L 4ZOCA 1BQHA 4Y4HC 5MHSE 4CMHB 3S4SG 4F58H 4WTXA 1RZGA 3E6HB 4XPGL 1CI5A 1MF2L 3BXNB 1XZ0B 2VISA 4LAQL 1LO4L 3QHTC 1H8SA 3KXFA 4X9FA 3O6ML 4RWHA 4LNVA 1IL1B 1DSFL 1YMHA 3KHOA 4QO1A 2FGWH 4NQDE 1I9RL 4HUNB 2AJYH 1S7RA 2Y6SC 1HZHL 1E4WH 5FAAA 4G7YH 4ODHL 3MRHB 5DJDB 4E0RA 4NGHL 2A9NH 5KSBF 3NIGF 3HN3A 2YMXL 1R5IA 5EFIB 4GOSA 5FYLD 2ADGB 2FL5B 1CFTA 2H1PH 5FOBB 3CFCL 3QUYB 5KVDL 2FEDD 3LAFA 4GLRH 3MRKA 2EDRA 5I1GL 3H9SD 3RY5A 2CDGA 5C0CB 2B39A 3NCYP 1JF6A 2NXZD 4JB9H 1R3JA 2CRMA 4GJTB 3KG5A 1QLEL 1MI5E 5CP3A 4LRNH 3O3BA 5SV4A 3P73B 1OGTB 5LGHL 5I8KH 5F7KC 5C0AB 3OKDA 4TUOB 3QFJE 4PRID 2RR3A 2P8PB 3IDMA 4NHCL 5DEFB 5GRVK 5DRZB 3CFKB 2OP4L 3G6JA 2ZG1A 4LCCB 5CSBA 2QV2A 3RZCD 1J8HD 1YEFL 1VACB 5EU5A 3S34H 4JZNB 2EC9U 5EO1B 3VG9C 5MI0C 2AQ3A 3D39B 3S3SA 5ILTL 3SJVB 2APVA 4M5ZL 2EEBA 4M3KB 2VN7A 1RZ8A 4UDTA 3W39A 2IJ0C 4QNPE 4F9PC 3W0WB 2IGFL 1C08B 1KCRH 4Y1AE 3P9LB 3S9DB 3W5MA 4IMLB 4X8XA 4LSSL 1YNKL 4WUUE 5DVKA 2QADC 4N8CL 5HHNB 5TPWH 1PAMA 2NY1D 1A0QL 5F3BB 3MLYH 3KYMA 1G7QB 3SKJH 1ZK9A 3O6FA 4O2EA 1TETL 1F11A 3OAUH 3FRUA 1I8KB 2VXUL 4MJ2A 3SKUD 1MEXL 2Y23A 4QRUB 1A7QH 3TIEB 2DQUH 1OL0A 4KRLB 1SYVA 3ETBF 3QULA 3ZDXF 2V17H 1CU4L 3NCBB 2ZKHL 2DAVA 3B9KD 1LMKA 2GIYA 1BZ7B 1KB5B 5ALCH 3VWJD 4L9LA 2NY3B 1LDPL 4NUJA 1UZ8B 5EG6C 4ZO8A 4M43L 4Y7MA 3MGOA 2EYSA 2V5RA 3RU8H 4S1DC 3KLHD 1MRCH 1JE6A 3T3PE 3EW3B 3SQOL 1T0MB 3MOAH 2BVTA 2VAAA 4N90E 3DMMB 3P0GB 4PUBL 5IWLA 4L9DA 4HWBL 1IKFL 3IDGA 2X05A 4JQVC 3H7LA 1GRWA 3WSQH 4J3WA 4RIRB 1N5YH 25C8H 3RDTB 4Y4HD 3U0TA 3DBXB 2GYSA 5FYJL 2IQAB 4EN3A 1OAXH 2WP3O 3KJ6H 4KPHH 4TOYH 1FL3B 4HCRH 1J0HA 2M1KA 3BP4B 4LDLB 3SO3C 2ZPKL 2GKIA 5FYKL 5HVWA 2JCCB 3K46A 5KJRL 1VA9A 4GRMB 1B0RB 3OJDA 1BZ9B 3BZFB 1MQKL 1CXFA 2YN3A 2PF6A 2OR9L 3BIBX 1CTNA 2MCPH 2OJZH 4YHZH 1XIWA 2ZNXA 4Z78B 4UV7L 1FC2D 1S7VB 1WFUA 4KHXL 4I8DA 3UPRB 5C0JA 2RQ8A 3HNTH 4NN6B 1T2JA 4M4PA 5DR5H 4YH6A 5CUSL 5IB5B 2HRLA 4OLVH 5MHSD 3HC0A 5LG1A 4PJFE 2V5MA 4Q9CA 1AIFB 3WDJA 5SWQA 1OAUH 3BZEA 4FQ2L 3FONB 1WWCA 4PRPB 1YPZB 4BJLA 4BELD 2OSLB 2G75B 3P9MB 1EEQA 5HDOA 3SE9H 3IS1X 2VYRE 3IGAA 4LLUB 5TFSL 4G6AD 4DFIA 4YBLC 2F53B 5B38A 3HZVB 2PXYB 4NQUA 2P8LA 2OQJB 4C56D 3PHSA 2FATH 2H6PB 4H0HB 1B4RA 1GGYA 3ZHDA 1A7BA 3OR7B 3F8UB 2P5EB 1QSEE 4XGZA 2W0LA 3N85H 1FFQA 3NABH 4KV5F 3LY6A 2VLLA 3J8F7 2GTWB 4UOW0 4M1DH 2JB5L 3BESR 4QRPA 2O61A 2BXZA 1CFNB 4HS8L 4HXAH 4KY1H 5GS0H 3SDCB 1FRGH 2XT1B 2NCMA 4ZFZB 2Z91B 1WWWX 5GPRA 3VGHA 4G9FD 1MAKA 4YXHL 1MI5D 3KS0H 3AGVA 2WV3A 4PV9A 1QQDA 4HULB 5ANMB 2A6DB 5JMOC 4HAGA 4MQTB 3V52H 4LIQE 4Y4KC 4D0CB 4XNMA 1CD1A 2B2XH 2AJXL 3FQTA 1AXTH 2H2SC 2EIZB 4G6FD 4P5TB 2ID5A 4NN7C 4HEME 1JCKA 2BX5A 2HN7A 2OXHA 1SJXA 4NCDA 2NZ9D 2YD2A 1XH3B 1YY8A 3UTTA 5DZNA 4S1DD 4L4TA 5DMIL 1E4JA 2V5SA 3KPNB 3NMEA 3KNBA 4WUUD 3VGAB 1KXTB 4Y5YA 1KIQB 2BVQA 1OP5K 3HCVB 3NZHH 1FP5A 3VGBA 5E9DA 4GMTH 1CLOL 2DLHA 2EH7H 4G8FA 4Y19E 4PGBA 1AR1C 1E4XI 2QJDA 4GSDL 3BH9B 3VGGA 5D1ZA 2PYEE 1B2WH 3BKYH 3UZQA 1QFOA 5DMYA 3D1MC 3SKMB 4YXKH 3RL2A 4Q6IC 5MEND 4DKDC 3FB7A 4PRDA 3EJZC 1NMBH 3BXNA 4DZ8B 1XZ0A 3A6BL 2BC4A 4U2YA 4UNTA 4PJDA 4KGJA 2C26A 4LOUC 4NZRH 2AXJA 3ARBD 4PJ7B 3QCVH 3MLVH 5GS2D 4XP6L 4BK5A 1WITA 5IIEA 1V7ML 4JDTH 1H0DA 1W8OA 1YJDH 4JHWL 4ZXBB 3WXWH 3MRHA 5DJDA 2ZZUT 5C08B 1GGBL 4FFVC 3ZTNL 4U1SB 2QQNL