1G7IA

Crystal structure of hen egg white lysozyme (hel) complexed with the mutant anti-hel monoclonal antibody d1.3 (vlw92f)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYYTTTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFFSTPRTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3
publication title Estimation of the hydrophobic effect in an antigen-antibody protein-protein interface.
pubmed doi rcsb
source organism Mus musculus
total genus 30
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2000-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g7iA00
5DXWA 1U3JA 4HWBH 4E5XA 3BXNA 4NQEA 3UTSA 5FO9B 4HGKC 3HN3A 1IM9A 4XBEL 2AJYL 4JFZH 1ED3B 5D72L 3C60C 3P73A 4EZMA 2Q20A 1BGXH 2DB8A 2AJXL 3RUGE 5DDHB 5BZDA 3P9MA 4HLZG 2V17L 2IBGA 1GH7A 1W0VB 5IIEB 2AGJH 4MD4A 4IRJD 1MFBL 4UTBL 1T2QL 2DQEL 4KKBC 4LCCB 1T04A 4YDVA 2R0WH 2R56H 4F37F 3HMXH 1NFIB 5ERWB 2PN5A 4F33B 4I3SL 3PWLB 4LLVA 4ELMA 3OKKB 4RFNC 3CUPA 4M62L 1OHQA 4JFYB 2YPLA 3H8NA 4XP9H 5E8EA 4XNMB 3UEZA 4G7YL 1JZ8A 1N6QH 3MRQA 1AKJD 2ATKA 1Y18A 1MQKL 4LVOC 1LDPL 1MQ8A 3O6MH 1U8JA 3FOMA 4P23C 1RUPL 5F1NB 4ONGH 2HT3C 3X14A 1PEWA 1YA5A 2YD9A 4J23A 1JTOA 3SKOA 4Y2DD 5CSZB 3MO1B 4MAUL 1A4JA 2X4UA 5F9DC 4RFEA 2IH3B 3QFJA 4PRNB 3IDGA 3PQYD 3CVHH 5HHME 1YEDB 3IRPX 4LKXA 3WIFA 3UTPD 5F93C 3KPOB 2Z8RA 3K8LA 3F5WB 4JZJB 3RX7A 4L4TA 2VXSH 1A6WH 5DD6A 1Y0LA 1BPVA 3F7YB 5EFIA 3K2UH 3T0XA 4M1DL 5I2IB 1YPZA 5BVJA 2R9HD 1ZSDB 4BM7A 1ZVSB 4MLIA 2VZUA 4NHCL 3V9FA 3VXSB 3WLBB 4Y1AB 1ODAA 2F74B 4DN3L 3I02B 4WWKA 1GPOL 2VXVL 1UZ6E 2ZOLB 1ZLWH 3VH8B 2HVJB 5LG1A 2GT9B 4AIOA 5I1KL 2L0DA 1HKLL 1EGJH 1U8QA 2OZ4A 2X9YA 2FHFA 5FKAB 5C0AB 5CCKH 3IJYA 2Q8AL 1NBZA 3C2AL 5FHBL 1A1NB 3EGSB 3QHZH 1KCRH 4CGTA 2X4TA 1UJ3C 3FQTA 4PLJC 4OZ4A 1FQ9C 1SJHB 4X0KB 1I85A 2EE2A 5J4MA 5JPMA 2DQDL 2P5EE 1ACZA 3MCLH 1GOFA 3C6SB 4PJFB 5FOBA 1Z3GL 1BF8A 1PKQA 1SY6H 4UDTB 4XPGL 1E28A 1KCUH 5D2LE 4D0DA 3RWHA 1FHGA 4GQ9L 4M7LH 4Y4HD 1ZT7B 5E2TH 2R29L 5E70A 3OJDB 2OK0L 3TH2T 4PJ8A 2I9TA 2G5BB 4OGYH 4XWOD 2YRZA 4AH2B 3L95A 1RZFH 4NQCB 1ADQH 3HC0A 1VACA 3NFPB 4MYWB 4UB0L 4L8CA 2EICA 4GRMA 3Q2CA 1DQDL 3AB0B 1WFTA 4MAYB 1H5BB 2VLJA 1DUZB 2HFFB 3BSZL 4YGVB 3Q6GL 4CVWA 4D9QD 1F97A 2X9XA 3FTGA 3PF2A 3RA7H 3AVEA 3U7WL 1T22B 5EO0A 3E3QE 2P46B 5I15H 3NABH 4L8SB 3O9WB 5IESL 1UQSA 3ZHKA 3RHWF 1K4CB 3RTQD 4DOHE 1XIWA 1NGXA 3CFIC 4S10A 2D7OA 3RGVC 3WYRA 2EEDA 3U9UB 1SYVA 3NZ8B 5JUEL 3TNMA 3FL7A 5MI0C 2AABL 3DX6B 4L4VD 1A7RL 4GBXD 5JR1H 5BCAA 3VFRB 2OL3A 4K7PL 4HUWA 3E3QC 5KSAA 2HLFC 2MQCA 4YDIH 4FQIL 5HYJD 1IL1A 5BOZG 1KT2A 4E0RB 5J7CC 2JELH 2HVKA 2JJWA 1U8MA 1FNEA 2F5BL 3PDDA 3PWPD 5GIRB 1IC1A 4RAUA 2HJKA 1VGEH 2H32H 2J8HA 1X9QA 1HQ4A 1RVFL 3ARQA 5IBTL 5ACMA 4UNTA 3I6KB 3TBWB 2HG5B 2E9WA 4I4WB 3H7LA 1Y6MR 4OLVH 4Y89A 4TNVF 1RJYA 2OJEB 4ZMAT 4IRZH 2AQ3A 2MCPH 3PJSA 4YUEH 3ZE1F 3CH8A 1WWWX 4HXBL 2NY7L 2E8YA 1IT9L 4CN6A 3GNMH 5D1QA 1MPAH 3CXDL 1TVHB 3B9AA 3L5JA 2J8OA 1QACA 1IILE 5KVFL 3BAEL 4FQXA 4ZXBC 4S1SH 1FPTL 3O81A 5C2UB 5EU7E 3ZKQD 4ZFGL 1FNSH 1WEJH 2NYYC 3VE0B 5AG9A 1RUQH 2WLZA 3HI5H 3MNZA 4I0PA 4RDQG 5J13B 3TWCH 3Q6FB 3KAAA 3LB6D 1CLOH 2MQ0A 2YA2A 2W9DH 3HKFA 2BDNH 4LQFH 5CHNA 3D39A 3IRZA 4JQIL 1W0WB 3BE1H 4MA3A 5HYQA 3DI2B 4XRCA 5DEFB 4ZS6D 2D7PA 4LASL 1AXTL 5EU7C 3VI3E 2CGRL 4ZFZA 3X12B 1T4KA 4YEEA 4HJGB 1S5HA 1L4IA 4RAVB 1R5VB 4CU6A 1OPGH 4XCCH 3TP4A 3LN4B 1O0VA 3TO4D 1I8IB 1CLZL 4Q6YA 3I9GL 4CKVX 3CLFL 1NUGA 4CN1A 1S9VB 1GYAA 5DJDB 4NQSB 4ONHA 2IADB 3HNVH 4ZQKA 1UA6L 1KNOA 3F6LA 5DMGC 3AY4A 4G9FB 5AAWA 1CICD 1OQOA 5DJAA 3VXRA 1CGSH 5ITBH 1JUFB 4JDZA 4KTEL 5EZIL 1M6OA 1TTGA 3MBEC 3EDJA 4ZODA 3BW9B 4Z7UA 4JM4L 2A77H 3MXVL 4NPYB 1R3JB 4I77L 2JIXD 4TUJA 4GLRI 5TGBA 3IDJB 4K7PY 3L3JA 3W2DH 3TJEL 3P4NA 4KY1L 1N5YL 2FEDD 2OJZH 3B2VL 4FQCL 2BOCA 4HF5L 2VH5L 1TQCB 3EHBC 3FO9A 5HPMB 1L6XA 3ZTNL 2QEJA 4HMEA 4Y16C 1NCUA 4WFEE 2ADGB 3JWDC 1NDMA 3KPNB 3ULUF 5FA4A 4LF3A 3ZHLA 4QRSB 5I71C 3CFJB 1P4BH 2EYSB 4XI5D 1CL7L 4FMFA 2A83B 5IG7B 4XMKL 1FSKC 1QSEE 4PJ7F 4P2RE 3HE7D 2WWKT 5DR5L 4OZIE 3QEHB 4PG2C 1F4XL 2OZ4L 2Y9RT 2YUVA 3QZWG 1XF4B 2G60L 4GXUN 3WN5B 4LSQL 1MWAB 3F12A 3O6KL 3G5YA 3JWOL 5FO8A 4M9PA 1BQHG 3DV4B 5E24E 3GSNH 4BQBA 1HHHB 1QKZL 1QOKA 1WSST 3LSOA 4RQQA 3MRNA 1E4KA 1FL6B 1YDPA 2OM5A 1ZGLB 4N5UA 1CK0H 3DMMA 2R2CA 3MLTA 1KEMH 5MEPA 4HHAB 3G5XB 5HDQL 4JHWL 1CGWA 3SGJC 4U6VH 1U8KB 4P46B 3S3PA 1S5IH 3FO2B 2WQ8A 4MA7L 4J6RL 3LKQB 4QCIA 3C09C 2V5SA 4U6TA 3IXTB 2RBLA 3U1SH 3DNKA 4UOW1 2X41A 4NFDA 4U0QB 1S78D 1OWRM 3K1DA 4RMSA 1FO0H 3G6JE 1EX0A 1FNFA 2GTZA 4ZUTA 4FQHB 5F70A 4YAQB 2JLLA 4XP1L 5DF0A 3CFKB 2WBJA 1RZGB 2ID5A 5C0ND 5KS9F 4JPWL 3RWFB 2YZ8A 4BQ6A 1MAMH 3L3GB 4ZFFA 3ZTJG 3M17A 5FYLL 2J6EL 1AHWC 1ZLVH 4HZAA 4KKNA 2DQGL 4CDGC 4QXWA 3QIWA 3PWVA 2R2HB 3SPVA 3QQ4B 2ATPA 3MGOA 4O4YL 2ADFH 2IFFL 5I1JL 1SEBB 4ISVA 4GJTB 5CIPH 1EEZB 4G8GE 5CILL 4CDHA 3P9LB 5JW4N 1X7QB 5IQ7H 1LP9B 3ULUH 1JJUA 2EDOA 2VLLB 3PHQA 2FIKA 1MNUL 4CNIB 4EXPX 5HHOA 4LLMB 4OD3L 1I3GL 2WIMA 3JVGC 3RWDA 4MDIB 2NTFA 2DLGA 4JDTH 4YPGA 3FCTB 2ICWJ 3HZKA 4E5XB 3QI9D 3BXNB 4NQEB 3UTSB 1EMTL 5JXED 2X4PA 4U33A 1IM9B 5D2NE 4LCIL 4OCLC 2VDPL 3O8XA 3F7PC 4NRYA 4RX4A 5JOEA 3P73B 4PJIA 4R4ND 4Y1AD 5BZDB 1K6QH 3P9MB 3RFZC 4P5TC 2DLIA 3BIAX 3H3KA 1PGRB 3HC4L 4MD4B 5IP4A 3I2CL 2AEPL 1T04B 4YDVB 3VFNA 2EE3A 4R8WH 5C0AD 5E5MA 1YEFH 3LPGA 1J0KA 4LLVB 3RDTC 2WINA 4NQXA 5DUBA 3SCMD 4ELMB 1PEZA 1FZJA 3CUPB 5D2NC 5BQ7A 2J88H 2YPLB 2GK0B 4WTXA 5E8EB 4HK3J 1KUMA 3PL6C 4LAQL 3MRQB 1ORSA 3OG4B 3QXVA 4QXGH 2ATKB 4LLYB 1Y18B 2ED9A 4OI9A 1Q1JH 2FJHA 5B3JF 4HGWA 4X6FA 3TYGL 2BY1A 4L9LA 1U8JB 3FOMB 1MVUA 4NN7B 1MCHA 5C2BL 1PAMA 2X40A 3VFPA 3X14B 4JM2C 3S98A 3KR3L 4PJXE 3QJHB 4R2GC 3ARDC 1CGYA 2WBWB 4NQCD 2D3VA 1A4JB 2F9BT 2NXYB 4RFEB 3QFJB 4MGXA 3IDGB 1LO3L 1KPUA 2QR0A 1M71B 3RL1A 5L6YH 4LKXB 3WIFB 5DJYA 5C0CD 3O6LL 2MSPA 1BJ1H 1IGIL 2YN3A 4N9OB 3LOWA 1T83C 4HS8L 4F9LA 4L4TB 3TT3L 4LSRH 1J86A 1OTTD 5DD6B 1Y0LB 2C4FU 5FCUH 5EFIB 4OI8A 4K3DH 3P0GB 4Y4FA 1YPZB 2F53A 5LCVL 4H20H 3BPNC 5I0ZA 2RCSL 3HUJA 3RIFK 2UV3A 5L88H 1G7PA 1I9JL 3R06A 3NCYS 5I66A 5DGQA 3WDIA 4LRIC 2WP3T 2X9WA 1A5FL 2X1XR 1KGCD 3JV6B 5LXGH 1U8QB 5D7LA 4OLZL 3Q48A 3E0GA 5EDXA 3IJYB 3LQZA 1NBZB 4MXQD 2VB5A 4B41A 3OAUH 2X4TB 4RWYL 1MJJA 1DQML 2YK1L 3N50A 3SE9H 4OZ4B 1IGFH 2CKBA 4PRID 1FFQA 1G7LA 3LMJL 3RWIA 1IEBA 1NDGB 5JPMB 2YC1A 3ILPB 1V3MA 1J9CT 3NACH 1I3RA 5FOBB 2F54A 1H3PL 1PKQB 4OZGF 5CSBA 5IFJA 3UZEA 1E28B 2LAGB 4FQJL 2NY1C 4D0DB 5FYKH 3RWHB 3VXPA 2DQHL 4LHQB 3OTTA 3FN9A 2FHCA 3GM8A 1ZS8A 4W4NA 5MENA 4PJ8B 2I9TB 1J1XH 2B5IC 3S37L 1MRDH 4X7FC 4HSQA 3L95B 5ALBL 4ZTPH 4XCNA 3RWJA 5F1OB 3HC0B 3VXOB 1VACB 4L8CB 1FVDA 1CU4L 4GRMB 1G7MA 4OTXL 4Z7QF 3QCVL 2F8VA 3MOQA 1U3ZA 2VLJB 3DETD 2NY3C 3MUZ1 2H45A 3FTGB 4KRNA 4PBVC 1NCCL 4W70A 1J05A 5GHWL 4IEFB 1PLGH 4ZDHA 3CH1A 3VGDA 1DVFA 2I26N 1WTLA 1QYGL 1UQSB 3NCJH 1EO8H 1XIWB 1KCVL 1NGXB 2BP3A 1KN2H 1SYVB 2DJUA 4UDUB 1OM3L 3G5VA 3TNMB 2UY6A 3DVFA 3P3YA 3RQ3A 3KG5A 3SJVE 3CFCH 4PLKD 2OL3B 4HUWB 5DWUL 5KSAB 1A14L 3NFSH 4HUXA 1EPFA 5GZOC 4OSUL 5CEZL 1IL1B 1KT2B 2ARJQ 5CJBA 3QQ9C 2ZSWA 2HVKB 4X8JA 4UIKL 1U8MB 2N7BA 1FNEB 2EDBA 1JPFA 5B22A 4RAUB 3MLXL 2HJKB 6FABL 4E41A 1J8HE 4V2BA 4G9FD 2YS4A 1UXSA 1K5NA 1CTNA 1AI1L 1GGUA 3QEQE 4KWUA 1B9ZA 3NGBB 1FBIL 4G8FA 3FN0H 3MYZA 4QRPE 1RJYB 2R23A 4GG6F 2EKSA 3C6LC 2EIZA 5L9DL 1MFDH 3PJSB 2VLRE 3LS4L 5EIIA 4MXVF 3KYMA 2J4WH 5D1QB 1AR1C 3EJZC 4NWUH 3EYSL 1Q9KA 2Y07L 2F8XC 3ZE2E 2WW8A 3DVGA 1FZKA 4FQXB 1FORH 2XG5A 1U95A 1YQVH 4IHOA 3UJIH 3LIZH 1VESA 4YXKL 3AMKA 3HR5A 1TETL 4XP5H 2AERT 4LP5A 4BZ2H 3MNZB 2DD8H 3MV8E 4I0PB 2Y06H 1OTSC 1D5XA 2XTJB 3RI5F 3GZKA 4RGNB 4YXLL 4OZHE 4KVNL 5CHNB 1DSFL 1KV3A 3D39B 5D70L 4MA3B 2E7LA 5HYQB 4XRCB 5D8JL 4M48L 1RURL 1UWGH 1AE6L 1E4WH 3ARFA 2VTFA 4ZFZB 3U4BL 1T4KB 1S5HB 1UEMA 1UT9A 1TMCB 4GRWE 5EIVA 3KJ6H 5ETUA 4WTZA 3LEYH 1FJ1A 2JCCA 4RBPK 5C92A 4HD9A 4H88L 1J5OH 4ONHB 1V3KA 4OUOA 5GRZA 4ZQKB 1KNOB 3LEVL 4XVUD 5DJAB 4PJGB 3VXRB 3ZDYF 5KANI 3WFBH 4MCZA 4JDZB 3BPOC 1M6OB 1MF2L 1VDGA 1V8HA 4Z7UB 3VW3H 1QBLH 4TUJB 2BNRA 5TGBB 5CZXD 1YEEH 3L3JB 3C5ZC 1P7HL 2D7MA 4CAGA 1OGTA 5JW3L 5MP6H 1D9KC 1RSFA 5D7SL 4FQLH 2BOCB 1JE6A 5FGRA 4JRYE 3FO9B 3MLWL 5F9OH 5CZKA 3D5OF 3INUH 3P9WB 5FA4B 1MIEH 4LF3B 1TZGL 3KXFE 3FOLA 3EFDH 5IMLA 4BSJA 3VGAB 3U36A 5KTEH 4X6BA 2R39A 1P6FA 4IMKC 1RQ5A 1TENA 5EPMA 5FGCB 5IVZA 3T3MF 3VRLE 4X6CF 4AY0A 2RB8A 3QUXA 3F12B 3MA9L 2VZVA 3G5YB 5FO8B 5ALCH 5L0QC 3VD3A 1BIIB 2VR9A 3MV01 2D0FA 5E7BA 4I9WE 3T09A 2CKBL 3LSOB 1QUNA 4RQQB 4P4KC 4HLJA 1CLYH 4HQQH 5HI3C 4ZOEA 3MRNB 4MLSA 1YNLH 3DMMB 3MLTB 5T33H 1LK3H 5MEPB 1MRFL 3EOBA 4NQED 3UTSD 3EZJB 3NPSB 4M61A 1HDMA 1IM9D 4P4RA 2Z8SA 3GBNL 3SBWA 1QR1A 1VCAA 5BRZB 5TE7H 1DQQA 4L9DA 4QCIB 4JHAH 1YZZA 1JHKH 4LFHG 1INEH 1ZANL 4H0IA 1QFWL 3V8OA 2I25N 5C3LD 3K0WA 4NGHH 5E2WH 1N8ZA 4PY8J 1NAML 2GTZB 4P0DA 4ZUTB 1MFEL 2NY0B 2GSGA 3HC3H 4QTHA 2DTML 3TLRA 5C0BA 2WBJB 1DBJH 2CD0A 2YPLD 4M4RA 5HI4D 1IKFH 4MNGE 1BM3L 3KYKH 1YEGL 2AQ2A 2VZ1A 4X80L 2W59A 4H8WC 2APVA 2DM7A 3DGGA 4ZFFB 3M17B 1BFVL 3OQ3B 3QIWB 3PWVB 4OAWA 1F2XK 2ATPB 3MGOB 4LHUA 1J0IA 3PHSA 3UYPA 4ISVB 5I6XC 2VDNH 2EDEA 4MJ4A 1OAUH 5ICYB 4I0KA 2NXYD 3QFJD 4PJ9C 3TVMA 3EFFA 4HT1L 3ALPA 3PHQB 2FIKB 5F44A 1FNGA 3Q5YA 1YYLH 3QIUC 2VC2H 1BFSA 5HHOB 3ULVF 3O2VL 1KB5A 4JG1L 1ITBB 3RWDB 2YKLH 2NTFB 3ARVA 4L4TD 5I8KL 3IS1X 5HY9A 3UPCA 4KHXL 4YPGB 4Z7OE 1NLBL 1MEXL 2IGFH 3HZKB 1GGTA 3UJTL 3PV6B 4ONFL 1VFAA 1WUNT 2X4PB 3KLSA 4TQEL 4W4OA 4P59L 4HBQA 5L8LB 3V4PH 1CLCA 3O8XB 4ODVH 4NRYB 3EW3B 4PY7A 4PJIB 5SWZB 3UTOA 5CUSL 1UWEH 4WWKD 4NM4L 2X44D 4IRJC 1QLEL 5ISZD 2ESVA 5GS1A 1WZ1H 1D3CA 3ZKMD 1LVEA 1OLZA 3C08H 4LHJB 5F7DA 5E5MB 1KBGL 1BQSA 2WINB 4NQXB 5DUBB 3G6DH 1FZJB 5BQ7B 4R7DA 4IRSD 1HKFA 2EKJA 3PQYE 1I9RL 3OZ9H 3IFNL 3UTPE 4XP4L 3TPKA 2K7PA 1ORSB 3MGTA 4WY7H 1EXUA 1JGLH 1L7IL 2FJHB 5EUOF 4YX2H 4HGWB 1W0YT 2N7AA 4OLYL 4X6FB 5DC4B 4L9LB 2PO6A 1MVUB 2FECI 4M5ZL 4POZD 4KUCD 2VLKD 3QZWB 4V1DA 1UVQA 4EUPH 4PJ8D 1ZT4A 3VFPB 2J8UA 4Y2DC 1A7NL 2HWZH 4HIXH 4O2CB 4OFDA 5FUZH 3TA3A 3RVXD 3C5JA 3K46A 1NGYB 1TNNA 3MRFA 1KXTB 4J3OC 4OIIH 1S9XA 2XXMB 1KPUB 2QR0B 3RL1B 3T04D 5DJYB 1WBXA 3GHEL 3NAAL 4OCSH 5BXFA 5CD3A 2DOCA 4KZDL 1L0YA 4JZNA 5F6IC 3WEXA 2AJ3A 4BKLA 5DA4A 1F2QA 3NIDF 2VDLL 1QBMH 2R9HC 2X1PA 1DBAL 3L5XL 4Y4FB 5E94A 2XN9D 4AMKL 1KTRL 4HFWA 1KG0A 3SDDC 1I8LA 2VLMD 2F53B 3WFEH 4JB9H 1BJMA 1T66D 4I1NB 3TBTA 4EOWL 3HUJB 3ULVH 1G7PB 3R06B 1JTTA 5I66B 4IJ3C 1LHZA 4MJ5A 4PYGA 1YJDH 2YBRA 5J89A 1IM3A 4F7CA 3BYYA 5D7LB 1QPPA 3LQZB 4GQPH 2ZNWA 4B50A 1NBYA 1NGQH 3BN9D 5IV2A 1MJJB 3V6FA 3MRDA 4QHMA 3S96B 2CKBB 3QXAA 4M5YH 1G7LB 3BWUC 2YSSA 3CDGA 4TSAL 5DD5H 2YC1B 3TZVC 4YJZL 1I3RB 4QF1B 4D9QE 5GJSL 4JKKA 2F54B 5IFJB 3GI9H 5EBMA 1CIUA 2LTQC 2IFGA 3GI8L 4QGTA 1P9MC 4GH7B 4N0YL 3VXPB 5IROC 2HT2D 5IR1A 2DAVA 2PF6A 2BRRL 4XWOC 1KCSL 4WHYH 1ZS8B 5IB4A 5MENB 5B3NA 3FQXA 5E4EC 1JHLH 2EC9T 2CK0H 5TQ0L 3KGRA 4LCWD 3ZDXF 1TNMA 4XCNB 4JFXA 1UCTA 5D1QD 3RVUD 2WWKO 3RWJB 1FVDB 4L4VE 3STZA 1U3HD 1C5BH 1G7MB 4I2XE 4C54A 3H42H 4FQXD 4HJJL 2XKUA 4P2YA 1JPSH 3VFOA 3P30L 1J05B 3HZVA 5HYJE 4ZDHB 3CH1B 1WITA 4LGPB 1CF8L 4HC1A 1DVFB 1U41A 5DO2D 4I0PD 3PWPE 1E6OL 4FZEL 4GAJL 3ZLQC 3CPLB 3DJ9A 3D39D 3MLYH 2DIAA 2VL5B 2JJTA 3G5VB 5FCSH 4GBXC 3MA7A 1CXHA 3OG6B 3UC0L 3BKML 4NC2B 5DRWA 3WJLA 1IMHC 3IDUA 4HUXB 1G1CA 4YHYB 4BZ1L 4JPVH 2ZSWB 3WKNA 1D5BA 4X8JB 1JPFB 3EJJX 2VDOH 5AG8A 5TF0A 1KIQA 4XB7A 4E41B 3T3PE 3J8F7 1UXSB 4X7TA 3VXRD 4J3WA 1K5NB 3CXHJ 4DGYL 4K9EL 3S36H 1IGML 2KUTA 5CJQL 4F57L 1SVCP 4ZS7H 4G8FB 1TQBC 2R23B 1TDQA 2EIZB 5J0BA 2XICA 3QXTA 4MSWA 5DHVH 1J10A 3BDBA 5E03A 4KK9D 5EIIB 2P8PA 3KYMB 2ICES 1F4WH 1EAPA 1KB5L 5AWNL 5INCA 2A6JA 4X6DA 4W6WB 3BMVA 1Q9KB 2ENYA 4UAOB 2ZPKH 4EI5A 3DVGB 4XNQA 1FZKB 3Q5TA 5D7IF 1U95B 4XNUH 1X5YA 4IHOB 4Y7MA 3WIIH 3KYOB 5T1DH 1V5JA 2OSLB 3I6GA 4XNXL 3HR5B 1FAKT 1EJ6A 5TF1L 4D94A 2D9CA 3LB6C 1OT1A 1D5XB 4U1IA 5ESVA 5C0DA 3LD8B 2E9IA 1PBYA 2AEIT 5HYSG 1MLBA 3V4VL 4KMLB 2O93L 1WLHA 3BQUA 1SM3L 5BVPH 3BP6B 4MQSB 3U0TA 3ARFB 2DYPD 3TN0B 1V7MH 2B8OT 4V2CB 3OXSA 5I17A 3TO4C 3VCLA 5ETUB 4CJ1A 4EQ3A 1FJ1B 2JCCB 1JGEB 3IETA 3S97C 4MS8D 1CICC 4S1RL 1F5WA 4PJHA 2NZ9D 1ZHBA 4NZTH 2B0SL 1MI5D 4N0UE 1FRGH 2DJSA 4MCZB 1FYTD 4U7KA 5E8NA 4U6YA 3P0VH 3LKNA 4AQ1B 4G9DA 2BNRB 1Q0YL 2ZUQC 4NUJA 3U0PA 5B21A 5CKAA 2NY0D 4XVSL 4Y5XC 2FEDC 1I8KA 4FFYL 1OGTB 3QXWA 3QO0A 3QPXH 4JN1L 4R4BA 1QSFA 2VKXA 3T0WA 3G9AB 4GKOA 4LLAA 5GGVH 4PJFF 2EYRA 1RUML 1NAKH 1HXYA 4XI5C 3WHXB 5GS0H 1URLA 3QIWD 3FOLB 3QHFL 1G9ML 4M6MH 3GIZL 3HE7C 1A7QL 2QSQA 5IMLB 2Z4QA 3OAZK 2QTEA 15C8L 1F6LL 3U36B 4X6BB 2H26A 4MB5A 1CDCA 5EPMB 1DE4A 2ZCHH 5IVZB 1HZHH 1CDGA 1A7PH 1JRHL 3QUXB 1INQA 4UU9A 2YPVH 2BSED 1I1AD 4YDLB 4XXCA 4BQCA 1ZT1A 4GS7C 2BZDA 1M1SA 5HHOD 3WNNA 2QBWA 3MYJA 3WFDL 2WP3O 3W0WA 4WCYL 5GS2D 1B3JA 3QB7C 1F4HA 1QFPA 2DRUA 3EOBB 4D9RD 1IAKA 4M61B 1HDMB 4P4RB 1KJ3L 2EH7H 1LEGA 2UWEF 1QR1B 4RX4D 4K8RH 1DQQB 5FYJD 3HG1A 1V3JA 3DUUA 3V5KA 2DDQL 3BUTA 1S78C 4Z95L 4LCCC 35C8L 1GZQA 1QSEA 5IVOA 5CINH 3RU8H 1N8ZB 5DFTA 1CVRA 4JY6B 1G6RA 3THMH 5CLTA 4TVPH 5I1EH 1TVBA 5C0NC 5C0BB 1RAMA 1HCVA 3GUTA 4HKJA 4KFZC 2O26U 5JPNA 3ABZA 3DGGB 2HH0L 4S1QL 4UZGA 3QWRA 2Z92A 1AQKL 1PSKH 4OCYH 1UM4H 4U6XA 3GEWB 4KUZL 4OAWB 4LHUB 3FMGL 4GKZA 4XPHL 1UCBL 4ZOAA 2YMXH 2X4OA 2X1QA 3VDAA 3VXSE 4Y1AE 1U36A 3MRKA 3TVMB 3FRUB 3EFFB 3MLSL 5CJ8A 3BDYH 4OD2A 1I1YA 1FNGB 2IQ9H 3MROA 4JZJC 3G6JA 1A64A 4NC1E 4ZD3L 1KB5B 2DL9A 3T4YA 1K3IA 5C0AE 5HY9B 4R26L 5EH1A 4Z7WE 3WNPA 4D9LL 5JXEC 3BGMA 4JO1L 4CVZA 1Y6KR 2EEBA 4Y4FD 3AUVA 1PVHA 1VFAB 5AYQA 2F53D 5H8DA 5FGSA 1SEQH 4UV7L 4M02A 1I7TB 2COQA 4R4NC 4U31A 1XF1A 4PY7B 1YY8A 1EO5A 3CSPA 1PG7W 2DBJA 2FH6A 1HH9A 4MD0A 1A6PA 2AQ1A 2A9MH 3LS5L 2ESVB 4NC1C 4F9PC 5GS1B 3VGBA 4A2LA 1KC5L 5JOPD 2YHGA 4UILL 1H8OA 5D7LD 1EBPA 2W9LA 4HV8A 5F7DB 5JNYA 3VWKA 2IPTL 2DQIH 2HKHH 1JNNL 2R0KL 4XNYH 4NQCE 4OB5H 2NPLX 1C5DA 3ES6A 4R7DB 2IPUK 4FQPA 4K3JL 2LU3A 3RY6C 4EDXA 4PJCA 5C0CE 2HMIC 2EZ0D 4EBQH 1PG7H 3MGTB 1DJSA 1EXUB 2F54D 3OPZH 3SE3C 3S35L 3B8YA 2QQQA 3ZYIA 4JREB 1JNLH 4PRDA 4WI6A 3A6CL 2PO6B 2WANA 2CDEA 3QWQB 5I1AA 4V1DB 5MEND 1UVQB 2RAMA 1ZT4B 5DRNA 3V5DA 3TA3B 3B2UC 3C5JB 1LO0H 3MMEA 3MRFB 3B9EA 4B5EA 3AB0C 1VSCA 3FAXA 1RHFA 1GAFL 1H5BC 1S9XB 4MAYC 2YWYA 2ZKHL 1P6AB 1QO3A 1WBXB 1OARL 1KGCE 3DECA 2AJYH 5IK3A 3IU3A 5D72H 2GEEA 5BXFB 3CZFA 1OTTC 2NX5A 4L8SC 3ECBA 5CD3B 3O9WC 2AJXH 4JZNB 4P2CG 5HDOA 3WEXB 2V17H 2AJ3B 4P2QD 4BKLB 1DVFD 4KDTC 5E9DA 1OCWL 6CGTA 1MFBH 4UTBH 1T2QH 2DQEH 4HFWB 1KG0B 2ADJA 3ARXA 5E94B 2XKSA 3BO8A 5AAMA 3ZSSA 4PRIE 5T5NG 3TBTB 3QDHA 2HT4D 5DJ8A 2OLDA 4JJHA 4LIQL 5L8KB 4I3SH 1F4YL 2DLTA 4RRPG 4MJ5B 4MHHI 4HJ0D 3V4UL 5K9QI 4M62H 5DVLA 2YBRB 3W9DA 1JYNA 1YQ2A 4CRPA 3D48R 3N9GL 4J8RA 1IM3B 1EZVX 4G7YH 3G6AA 4F7CB 3WDJA 4MXQC 4WU5A 3MXWL 2PTTA 4PJXA 5KSBF 2V6HA 4U49A 1MQKH 4ZUWA 5IV2B 1J1PL 4J4PA 3V6FB 1LDPH 3MRDB 5LJYH 4E41D 3MUY1 4QHMB 1K4DA 1RUPH 3QXAB 1IAII 3CDGB 2YSSB 3T0VA 5A2KH 5IMMA 4FQ1L 5EC2A 4WUUA 5CJ5A 5GZND 5EBMB 2I5YL 4QT5B 4G6ML 3LH2L 5IJVA 4MAUH 3E1F1 2WMPA 4JO4L 5KVMC 2ZUWA 1G9NL 5IR1B 3JWDL 5JXAH 1TJGL 5FUOL 4FOMA 5IB4B 3H0TA 3FQXB 1DEDA 4JFXB 2Q87A 1AD9A 3W5MA 4X83A 3B5TA 3STZB 3DETC 4M1DH 1IZKA 3NMEA 2OBGA 5DFVD 4DW2L 4P57A 3VFOB 4YZFF 5DHXB 1CFVL 1YUHA 3HZVB 4Y19A 1QBAA 4NHCH 4XNZB 3S5LA 4LSTH 3IFLL 2BFVL 2FX8H 1GPOH 2XY2A 3HRZA 5D7JD 4CL7A 2VXVH 5J13C 4MNQA 3F65A 2EC8A 1FG9C 2YA0A 5I1KH 1HKLH 5DD3L 4G9FE 4OLUL 4PD4J 1C1EL 3UJJH 2Q8AH 3C2AH 1NCBL 3E8UL 1VFMA 2UZIL 1JGUL 3G9VA 4J3SA 5DRWB 1Q9OA 2X6MA 5D1ZA 4X9GA 4QWWD 3WD5L 3KYNA 4K3HA 5D7KD 1U42A 1Z3GH 5D6DC 4JQXC 4XPGH 1D5BB 3GMQA 4NHUA 3VXMA 4GQ9H 1KIQB 2MJWA 4ODTL 1U2HA 1F3DH 4GXUM 1YC7A 4X7TB 2OK0H 3X3GL 4YHPA 2DQJL 1X5GA 3OB0H 1WWAX 4WHDA 4UB0H 1NMCB 5M7QA 1FLRL 1DQDH 3NH7L 2GJZA 4WW1A 3BYTA 4KJWC 4MSWB 3MJ9A 2BNRD 5EBLA 5I30L 2P8PB 3U7WH 1EAPB 2XOTA 5INCB 1S9WA 2A6JB 1WQVT 4NDMA 5TJWK 4X6DB 2I9LA 4M43L 4F58L 5IESH 4HWZA 1TQCC 4EI5B 3TESA 4XNQB 2CLVA 4O5LL 1CFNA 5I1CL 1FNLA 5HHVL 3DROA 3BH8A 3I6GB 5JUEH 1HNGA 3DX9A 3ARSA 2ICWI 5FHAL 5C1MB 1SQ2N 4U1IB 5ESVB 5C0DB 4K7PH 1JPTH 1DTUA 3F7QA 3WN5C 5FF6A 1MLBB 3W39A 3P4MA 3O3DA 3BHBA 3L3KA 3RWCA 3QUXD 3BQUB 1KCLA 1IGTA 2F5BH 2R0LH 3U0TB 1HIML 3GMLA 4GW5A 5J3HD 3JV5A 3CNKA 1RVFH 3OXSB 5I17B 1FGVL 5ITFA 5IBTH 2P8LA 3VCLB 1NKOA 5CWSA 3MJ7A 1HQRB 3IF1A 3V6OE 2UZYB 3LV3A 3IETB 4NO5A 5HVHB 2IF7A 4PJHB 5FV1L 4P46C 1ZHBB 1UACH 1KXVC 5JW4M 1WBZA 4I18A 5KAQF 4BQ8A 2NY7H 1IT9H 2B7DT 2H41A 3TNNA 5E8NB 1HI6A 3CXDH 4U6YB 5HDBF 4WI2A 1IC7L 3LKNB 5KVFH 1G0YR 3BAEH 4JFPA 3DX7A 1MELA 2APXA 4PRHA 3ZT6A 3MQIA 4M6NL 2W0FA 4G9DB 4TVSa 1FPTH 3V6OC 1EBAA 4YBLB 4NUJB 1MCEA 3U0PB 4ZFGH 4HPOL 3QDJA 1I8KB 1R24A 5E56A 5C0BD 3MRPA 3QO0B 3BRDA 4PJEA 1LP9E 2Z9TA 1CIDA 4R4BB 2E9JA 2BY2A 4G6KH 2QSTA 4Y88A 1OP3H 3L1OH 2EYRB 4HIIA 4JQIH 1HXYB 4BFIB 3EBAA 4CW1A 4LASH 3KPTA 2AK4A 2Z4QB 1AXTH 2CGRH 4LHUD 4NQEE 3UTSE 4XPTL 2H26B 1RZJL 2B2XL 4QRQA 1CLZH 1INQB 3I9GH 2FHBA 3CLFH 4JR9H 1TCRB 1UA6H 1ZT1B 4EEEA 1CGXA 5B39A 4AEIL 3MYJB 3CD4A 5EIQA 1G84A 3W0WB 4ELME 5EZIH 4KDVA 3BT2L 4JM4H 1FNAA 2CKNA 2YPLE 1JYWA 1IAKB 1BJ8A 3MXVH 2WUCH 1LEGB 4I77H 3M07A 3OXRA 4HDIA 5EB9A 3HG1B 2CMRL 3FONA 2H2PD 3DUUB 2NY2B 3TJEH 3V5KB 1E4XH 4KY1H 1XR8A 1N5YH 4WHTA 2ESVD 1GZQB 1QSEB 3B2VH 4FQCH 3UYRL 4AIXA 4HF5H 2VH5H 1FFOA 1NC2A 3O2WL 1G6RB 2C1PA 4BFGA 3ZTNH 4UBDD 3WLWD 1BHGA 5EO1A 3DWTA 2Q3ZA 3U82B 5EOCJ 1KULA 1RZ7L 1TVBB 3ZZ1A 4LOUD 1XT5A 5CEYA 1CGVA 4FN0A 5HI4C 3QFJE 4LLDB 5JHDA 4XMKH 1SBSL 4HKJB 1T7ZA 1I1CA 5DR5H 5FM5O 4GW4A 5JPNB 1P69B 1WIOA 1F4XH 3DBXA 4Y2OA 2Z92B 2G60H 4L4TE 5JQ6H 3JWOH 1ZA3A 4U6XB 4NN7C 4ODXA 2PO6D 4OCMC 1RMFL 1QKZH 1YPZE 3ZDZE 4GKZB 4LPTA 4LCUA 4V1DD 4TUKL 4KHTL 3PWUA 2X4OB 3TA3D 3R0NA 3WMSA 2NXYC 1C12A 3MRKB 1AQDA 4H1LG 4MWFA 1LK2A 1CDJA 1RUAL 5ISZE 4G8IA 4OD2B 5HDQH 4KTYA 1I1YB 4JHWH 3MROB 3G6JB 5KJRL 2DLFL 4XC3L 1CYGA 4NNXA 3T4YB 4MA7H 4J6RH 2XA8H 2APTA 1GIGL 5DI8A 3BGMB 3MX0A 4CVZB 5H2BA 3UBXG 3N85L 2ITDA 4A6YA 1OSZA 1X6NA 2ZNXA 5IFHL 4MDJA 3L5HA 4IM8A 1YY8B 1PKQE 4NBYB 1HH9B 4XP1H 4MD0B 5J11B 2B1HL 5DRXA 1P5UA 1CTOA 3ZKMC 3AGVA 3L5IA 4JPWH 1MJUL 3CVIH 1J0JA 3HMWL 2VITA 3WNOA 2VLKE 3JWOC 4HV8B 5JNYB 3VWKB 4N1HB 5FYLH 3BX7C 2J6EH 3F6IA 4HLZH 2DQGH 5IHUL 5IHZA 4MQ7A 3S34H 1RJZA 1C5DB 1I85C 3ES6B 2AS5M 4FS0A 2LU7A 2AJZA 5EC1A 4O4YH 4EDXB 2IFFH 3MCG1 5I1JH 4PJCB 1VB9A 2J7LA 4PJGF 3RVWC 2PCPA 3SGDH 1MCKA 2RIKA 4CMMB 5CILH 4W6XB 5A2IH 4Z7UF 4POZC 4LSPL 2GAZA 1XCQB 1IGJA 2CDEB 4PJ8C 2XN9E 1MNUH 1R5IA 2VLME 5I1AB 1T0NA 4WHYG 3TPUA 4OD3H 2WWMC 1I3GH 5DRNB 3V5DB 2RR3A 3HE6D 3MMEB 5TQ2L 3SDAD 3EUUA 2VISA 3QPQD 1BEYL 1TJIL 1EMTH 2IBZX 3DXAA 5IK3B 3IU3B 1YN6B 2VDPH 3L3OA 3DX8A 3CZFB 2YRPA 2NX5B 3ECBB 3OKMA 4PTUA 2YEZA 5DMJB 5E9DB 3HC4H 1XIWC 4WWID 4OF7A 1T66C 2ADJB 3I2CH 1JPST 3BO8B 2AEPH 1D5IL 3OAYK 3BFOA 4MX7A 2XYCA 5DJ8B 1Q9WA 4M8QA 3WIHA 5KSAC 3W9DB 5E8PA 4NZJA 1OP5K 4J8RB 3G6AB 2CR3A 4LAQH 1OGAA 5HJ3B 5HVFB 2R0ZH 3RNQA 2HRPL 3D25A 5CP7A 4WU5B 3W11C 3BN9C 4PJXB 2PTTB 4LCWE 4ZUWB 1KJ2A 4WIQA 4CVXA 3GSQA 3UDWA 1K4DB 5D5MF 3SE4A 1NUFA 3EO9H 4J7RA 5C2BH 5EC2B 4JGJA 4WUUB 4BUHA 3IJHA 4OLEA 4M7KL 2DS4A 3NGBC 2HT2C 5IJVB 5J57B 1ZGLP 3ILQC 4RAHA 4HKZA 1LO3H 5ESQA 1K3ZA 2XTJE 4OGAD 3O6LH 3KJ4B 3RY4A 2YUXA 1IGIH 3H0TB 1N59A 2GHWB 5D1QC 2X1WL 3D39E 3OSKA 3TT3H 4YHNA 5E8OA 3AFLA 2VSCA 4FQXC 4EI5D 4FNLL 1KPVA 4Y4HA 1X6LA 2N4IA 3KS0J 5LCVH 2AP2A 4P57B 2XQBL 1YUHB 3KPRA 4Y19B 2RCSH 1YMHA 3S5LB 3HAEA 4CU8A 2EIBA 3HRZB 4I0PC 1E27A 4E42A 3LVEA 2FJGA 4MNQB 2XTJC 1GCFA 1A3QA 1F11A 4PJAF 1A5FH 4RGNC 2VJXA 1FIGL 1NEZA 2ZUVA 4OLZH 3VXRE 4N68A 1U8PA 2AJUL 1EUTA 4OF5A 4RWYH 5D9SA 4EKXA 1DQMH 2YK1H 4OZFA 4WDIB 1Q9OB 5D1ZB 3RTQA 2JB6A 2ZG2A 5E2VL 1RIVL 4PJDF 2C3VA 5CBAA 1SJEA 4WW2A 1YYML 1H3PH 4FQJH 3GMQB 4RGOL 4NHUB 3VXMB 4L4VA 2WIIA 2DQHH 3AY4C 3NCBB 2E9BA 3TYFA 3VG0H 3K8MA 4YHPB 4WEBL 3S37H 4XZUA 5HYJA 3P11L 4JVUA 4OLWL 3BPCA 5ALBH 2VDQL 4ERSL 1OLLA 1UGNA 2Y72A 2JK5A 4DWHA 3PWPA 1CU4H 4HWBA 1T0PB 2ORBL 2GJZB 4U1JA 4WW1B 3N0PB 4KK9C 4KJQC 3OKNA 1IGCL 2VR5A 3FT4B 1PZ5A 5EBLB 3RKDD 5FGCE 1NCCH 5GHWH 1NC4D 5E6IC 4MNHB 1S9WB 4NDMB 1EH9A 2I9LB 5F3BA 1QYGH 4HWZB 5CGMA 4KZEL 4HMCA 4KAQL 1QSFD 3PABA 4OUUA 2CLVB 2A6IA 4U1GB 3SQOL 4ACPA 1CFNB 2X4QA 2FYYA 1RK1A 1A7OL 2E27L 3DOSA 3UXFA 4YLQT 3HMXA 3DROB 3BH8B 1K85A 4K94L 4AEEA 3GJFH 1OM3H 1U93B 3DX9B 5IB5A 3VGAC 2FIRT 4TTDC 4ZSOA 4YQXH 2HTKD 1EFXD 5DWUH 1FV1A 1IC4H 1A14H 5FF6B 3W39B 3P4MB 4R0LA 4Y8DC 5E99L 3O3DB 5CEZH 3BHBB 1MI5E 3L3KB 3RWCB 3GSRA 2CLZA 5ADOH 4UIKH 3N06B 1IGTB 3GB7A 3K4AA 4M7JL 1RJLA 4YO0A 3MLUL 3GMLB 5C09A 6FABH 1R5WA 4GW5B 1E4KC 3QJFA 2R2BA 2V5YA 5ITFB 4LMQI 4D2NA 2CRMA 3DMMC 2P8LB 3F58L 4OFYA 3W0WD 5CWSB 3MJ7B 3IF1B 1AI1H 3NCEB 5B38A 1DDHA 3LV3B 5FM4A 5JHLL 4NO3A 3NPSC 4OKDA 4NO5B 1FBIH 2IAND 4K23L 2X4NA 1WIUA 2X1OA 5L9DH 3DRTA 4Q6IB 5GGUA 5CEZE 3LS4H 2XG4A 3AM8A 4I18B 3HG1D 2A9NH 3QISA 1X5IA 5I8OL 1A6VH 2NY2D 1HWGB 4JO2L 1HI6B 1OAQL 2Y07H 3O2DL 2IG2L 1DR9A 2YD6A 4JFPB 3DX7B 4PRHB 1EVUA 1CDYA 1TXKA 2FZ3A 2W0FB 2NY0C 3SN6N 4WV1A 2VSDA 1VERA 3WS6A 4YXKH 2WBJC 3QDJB 2Y1VA 5HGAA 1TETH 1R24B 3MRPB 4PJEB 1R3KA 1WTGT 1ACYL 1ZLWK 5F96L 1T1YA 3MRHA 3EIFA 2O5YL 1JGVH 4Z7VF 1JNHA 2ZWLT 2AI0L 1EGJA 3VH8G 4YXLH 5HHOE 4HIIB 4KVNH 1DSFH 3QWRD 5D70H 3REVB 3QIWC 5D8JH 1XR9A 4UT6L 4M48H 1RURH 1I8MA 4WFGE 1AE6H 4CW1B 5H94A 1EHLL 2DICA 4OD1L 2AK4B 5KG9A 1BFOA 3WIHL 3U4BH 4D9RE 4N9GA 3X13A 3GIVA 5HTSA 2H3NA 4DAGL 1TTUA 3LRSA 4N0UA 1MOEA 2LFGA 4QRQB 4PJIE 1S7XA 5FYJE 1DCLA 4QHLA 4F37K 1KJ2L 2PTVA 2AEWA 1ZWIA 5JOFA 3DV6A 4YIQA 3IFPA 3LEVH 4WJ5A 4X6EB 5B39B 4FQ2L 4N5ED 4ODUA 4DQOL 2XV6B 5B8CA 3ARGB 1IFHH 3FKUS 3UCRA 2Z93A 4QHKI 1T0MA 1S9KC 1MF2H 4MB3A 2W9EH 1TTFA 3O8XC 5TH2A 3OV6A 3OXRB 3JV4A 4HDIB 4L8DA 3VDCA 5I1HL 3FONB 2HFEA 3TCLA 1XR8B 4WHTB 5D7SH 4YDKL 4R3SA 4POUB 5I8EA 5F72S 2X4SA 4JFDD 1FFOB 1NC2B 3MLWH 1XGQA 2C1PB 4DCQA 3N1MC 4YWGL 3VWKD 5C6WH 5LVEA 3E6HA 5EO1B 4HS6A 1QFUL 4OF6A 1S7QA 3K74B 4HWUA 4WHCA 1TZGH 4WI8A 5CEYB 3ULSA 1OD9A 4J1UA 5JHDB 1QTYT 5JW4R 4LP4A 3FT3A 1H0DA 1BIHA 3P40A 4GW4B 5TDNA 3DBXB 3O3BA 1BAFL 3MRGA 3MA9H 4L9LC 1EEUA 1KLFA 1ZA3B 4ODXB 1GGYA 2AVGA 4PGJA 2CKBH 2F53E 4LCUB 4X99A 1OAKL 3PWUB 4YXHL 4A2MA 2EDHA 3HUJE 2F58L 1C12B 3NTCL 1AQDB 4MWFB 1LK2B 1J18A 1MRFH 4C59B 1TIUA 1AGCA 1NGPL 3R1GL 3QNZA 4G8IB 4GKNA 5JOPE 3GBNH 3QXUA 4P5MA 5D7LE 4NNXB 2Q76A 2NX5D 5BW7A 2K1MA 1U8IA 4KRPB 1NCNA 4Y4FC 5DI8B 1ZANH 5E9DD 2EDKA 4QHUA 4GSDL 1CDBA 1N4XL 4G6AD 1QFWH 5GJTL 1OSZB 2CRIA 3IXAA 1NAMH 2RJMA 5DMIL 4MDJB 1SJXA 4JFZL 4NM8L 1MFEH 1M7IA 1WT5C 2F54E 2DTMH 4UT7H 2XZQH 1BGXL 3X3FH 5DRXB 3QI9A 4HUMB 5GRVK 1UH3A 4R4FL 1YEGH 4X80H 2VITB 5MENE 2BOBA 2R0WL 7FABL 2R56L 3HMXL 4BH8B 5IHZB 1IQDA 1WIPA 4MQ7B 4KI1A 4PJBE 3BP7A 4NBXB 1NEUA 2AJZB 5EC1B 2EZ0C 3WNLA 3RHWK 3GMRA 3DYMA 4WUUD 1RIHL 4Z7WA 3PDGA 1J88A 3SCMA 4P2QE 5F1KC 4HT1H 2DKMA 2GAZB 1IGJB 2YA1A 1R5IB 1T0NB 1EDQA 1Z9MA 3TPUB 3ARRA 3IAQA 3S36X 4G7VL 3O2VH 3GSXA 1TCMA 4JG1H 2EO1A 2VAAA 5I8KH 1LQSR 2ITCA 3FRPG 1NLBH 1MEXH 2VISB 2XA3A 1JI1A 1H15A 3UJTH 4ONFH 4X7DC 3IJSA 2WAHA 3DXAB 4TQEH 1D6VL 4I3RL 1N2RA 4P3DB 4P59H 5BOPA 5IVNA 3L3OB 5HI5D 3DX8B 1A4KA 4Y19D 5GS3A 4XGZA 1DVFC 3OKMB 5CUSH 2SEBA 4PTUB 1E4XI 2YEZB 4NM4H 1IKNA 5A2JH 1QLEH 5GGQL 3EDFA 4MNQD 4GAGL 1SBBA 1KSRA 3GMOA 1XGYL 5C08A 4TRPL 5DURD 4E41E 2EE6A 1DQLL 4HFUL 5C0CA 4MZ3A 4MX7B 4XX1E 5T1LA 5TFSL 2VABA 1KF9B 1Q9WB 4M8QB 1KBGH 4HJ0C 4LSUL 1J8KA 1II4E 1BBDL 5GRUL 5DSCA 1QRKA 5JIPA 5E8PB 2H8PA 2DWDA 4Z76A 5IVXF 5D1ZD 4YHYC 1EJOL 1I9RH 32C2A 3IFNH 4XP4H 3RNQB 3D25B 5CP7B 1EGJL 4D3CL 1HK6A 2A6KB 1KJ2B 2QHRL 4NNPL 1ZGLM 4OLYH 4CVXB 3GSQB 1T1WA 3VXMD 4Q97A 1AHWA 3GSNA 4X9HA 4YBQD 2YUWA 4M5ZH 4QHNB 1NFDF 4YE4L 3C8DA 1A7NH 3IJHB 2Y6SD 2N56A 5IF0A 4QRUA 1G1YA 3SKJL 1EHNA 4RBPH 4HKZB 5J6GA 1MCQA 1YEJL 3P0YL 4XAWL 3CDCA 1D6EA 1A2YA 1C8PA 5INDA 3MC0A 3BZ4A 3GHEH 2XZCL 3NAAH 1KB9K 5E2JA 1N59B 2ZUSA 7CGTA 2VWEE 5E8OB 4YHNB 5SV4A 1NPUA 4UAOC 4OCNC 3S9DB 2FL5A 3W9EA 1U6AL 2VDLH 4ONOA 5F7WC 3VFTA 5DFVC 2EIEA 5DQDL 1KPVB 4Y4HB 4AMKH 4DGVL 1J87A 3MFGB 3VWJD 3RX8A 1A22B 4LARL 5ICXA 4EOWH 3V8CA 1YMHB 3HAEB 1U3YA 2HP4A 2JCCE 3D3VA 3KPSA 4E42B 2FJGB 1F11B 1P7KA 3ZE0E 5D96B 3LD8C 2EDXA 3G08A 1F90L 3GSOA 2VWEC 3MV9A 1FG2A 1NEZB 4LRNH 2E7LC 4X5XA 1I75A 1UH2A 3I50L 1BP3B 1U8PB 5EZLA 4NQTA 1NSNH 3ARFC 5D9SB 1ZLVK 3TN0C 2KDGA 4OZFB 4K3EL 4P3CL 2X05A 4QWWC 3B43A 3RTQB 2JB6B 4HCRA 4TSAH 2QQKL 2A74A 2FX9L 3QEGL 5CBAB 1BQLL 2C3VB 2BNRE 2MHAA 1SJEB 5CIPA 1QEWA 4WW2B 5E5UB 5GJSH 1F42A 4U3HA 4YDIL 1BVLA 2XTLA 5IJKC 2E7CA 3PL6A 3GI8H 3VDBA 4L4VB 2WIIB 2C3XA 4N0YH 3TYFB 4NRXA 2G75A 2R8SH 2BRRH 1KCSH 1JF5A 3BGAA 5B4MC 4TSBL 3WV0A 4PJ7A 5TQ0H 4GOSA 4XZUB 5HYJB 3BPCB 1QRND 1NL0L 3WE6A 1MJ8L 2CDGA 1T89A 5JMRA 2JK5B 3PWPB 1KELL 5J06A 2X7LA 1FGNL 4U1JB 4HJJH 5ID1A 3OKNB 4XP6L 1PZ5B 1UM6L 2NR6D 2MCPL 1WCBA 4K7FA 4LDOB 3QUYD 3QDJD 3DYPA 4Q2ZA 1CF8H 3BMWA 1R3IH 5F3BB 3HCVA 2BY3A 1E6OH 4GAJH 4OUUB 3T2PA 2C26A 2A6IB 5LWYL 2X4QB 2FYYB 5KSUA 3TCXA 1RK1B 2FD6L 5SX5H 2JJUA 4S1SL 3S88L 4KI5D 5IB5B 1CFTA 4ZUSA 5BV7L 1WEJL 4Z7NE 3UC0H 1RZ8A 2C3GA 2AK4D 4ZSOB 3H9YA 3D1MC 5GRVL 1FV1B 5HVWA 4FXLA 4XVTL 2BCKA 5IHLB 4YNYB 3QUXC 4R0LB 4BZ1H 5AD0A 3RVVD 3RUGF 2CLZB 3MRCA 2A38A 3GB7B 3BESR 1RJLB 4YDLC 4YO0B 3U4EA 4M3JA 3VI4E 5C09B 1R5WB 4KPHL 3MRMA 4RMTA 4PP1C 4KVCH 5K59E 1INDH 3QJFB 2R2BB 5KS9A 2P1YA 1NCWL 5CMAA 1C7SA 4KGJA 4DGYH 2AJVL 4K9EH 4S1DD 4J3VA 1IGMH 5CJQH 4F57H 4GRLD 5B38B 1DDHB 2C5DC 4MA8L 4WNQA 4KV5E 4NO3B 3QDMA 3BZFA 4U1SA 3OMZA 5C0BE 4UINL 1JWMB 4NNYB 4ZO9A 3SBWC 2ZG3A 2X4NB 2KL6A 3BVNA 1HHIA 1UM5L 3DRTB 2LVCA 5GGUB 4EIZC 1KB5H 3J7HA 1CGSL 1B4JL 4JPKH 3LN9A 1BVKA 2A73A 4RZCA 2FZ3B 1GC1L 1NC2D 3LRGA 1D7FA 1GXEA 2QADB 4M7ZC 4WV1B 5CP3H 4XH2A 1MVFA 1TZHA 4XNXH 1OQXA 2VZSA 2CJUL 2KZWA 5HGAB 3CLEH 4X8XA 1NCTA 3TT1L 5TF1H 1R3KB 1H3UA 4H5SA 3W2DL 5JHDD 4XAKD 1Q9LA 5F7UA 1T1YB 3MRHB 1JNHB 2DKSA 2DM4A 3V4VH 1XR9B 4KK6C 1SM3H 3QEUA 1I8MB 2IEPA 5H94B 4S11A 3F7VA 1I1RA 5KG9B 1BFOB 1ND0B 4N9GB 3X13B 1PG7X 4K9EC 2WUBL 3GIVB 2H3NB 3LRSB 4N0UB 3IDYB 4LLQA 2F5AL 4LVHB 2FX7L 1S7XB 3TVMC 1UZ6F 4KK5C 5JOFB 3DV6B 1GSMA 5DK2A 3A6OA 2DTSA 3H3PL 4S1RH 1HE7A 2ESVE 4X4ZA 4YIQB 3A67L 3IFPB 2M8XA 5T3XL 3VFGH 3WNMA 4QNPE 2V2TA 3TO2A 1X5FA 1SMAA 3GSNL 4ODUB 2B0SH 5B8CB 4KKAD 4GXVL 2CRZA 4AG4L 5LKNA 2Z93B 4KRPD 2BERA 1T0MB 2APFA 4KQ3H 1ZLUH 4W4OC 5ABDE 3BD3A 4UIMA 1ETZA 4Y5VA 4LSSL 4I0CC 5A3ID 1Q0YH 3JV4B 4L8DB 3BD4A 4FABL 4XVSH 3X17A 2HFEB 3TCLB 4IDLA 4FFYH 5D2LF 1Y6NR 4F80A 5GS1C 4DEPB 4JN1H 4R3SB 5I8EB 1DP0A 2X4SB 3D0VA 1VADB 5ELIA 2A2QT 2EXWD 4V1DE 4DCQB 5LGJA 2J8UE 3E6HB 4LDLB 5E95B 4HS6B 1LEKA 1IZJA 1RUMH 4IMLA 2OYPA 1S7QB 3ULSB 4APQA 1AR2A 4J1UB 3QHFH 3GIZH 1A7QH 3BUYA 15C8H 3AU1A 1JPGA 1H0DB 1LO5A 2ENSA 4TULL 1BWMA 3KPPA 5TDNB 4B7LA 1GOHA 3ROOA 3O3BB 4JREC 3MRGB 2PO6C 3PNWA 2CUHA 4KC3B 3VMPA 5DD1L 3TA3C 4X99B 2R15A 4HCRL 5C7XL 3O11B 3WFDH 3OR7A 2AV7A 4WCYH 1S9YB 2VRAA 2Y23A 2GITA 1U8OA 4JHBA 4MJ6A 4LL9A 3U7YL 3DXAD 4GKNB 3NCFB 1KJ3H 4JVPA 4L3AA 4P5MB 3WHE1 4G80A 3SDXE 2Q76B 3ZT5A 1UB6A 4CJ0A 1U8IB 4NJ9L 3ZMRA 4OZGA 1I8LC 4QHUB 1HILA 35C8H 2VN4A 1QA9A 4ZOBA 3IXAB 3HB3D 1G9MC 5BV7B 3CDFA 5D1XA 1I3UA 3RZCA 1F13A 2LABA 3QI9B 1P2CB 1OW0A 1VHPA 1AGEA 1OGAD 2DBLL 2HH0H 1WICA 4S1QH 3VA6A 4GW1A 2BOBB 4AIZA 1IQDB 3STBA 1FE8L 3Q1SL 1YEFL 3BP7B 1RU9L 5FXCH 5ISZA 4KKCD 4KUZH 2APBA 4N8VA 4Y4KD 3FMGH 3TF7C 5D6CA 3PE9A 1J7VR 5TE4L 2XWTA 2VZOA 1UCBH 1EHXA 3GMRB 4HAGA 4HWNA 4Z7WB 4JFHE 3SCMB 1FC2D 4L3EA 1Q1JL 3MLSH 2E6JA 4M6OL 1J0HA 4IRSA 4TUOA 1F58L 5T5FL 1CD1A 3MTRA 3RIAF 2C3HA 5TPWL 5F8QC 5DT1H 1M05A 1ZEAL 3GSXB 3U30B 2IMNA 2VAAB 3AREA 3QPQC 2ZCKL 4R26H 2BY0A 2ITCB 4D9LH 1MCPL 4DZBA 1MWAL 1H15B 2XFXA 2EE9A 3IJSB 3VI3F 4F7MA 4UV7H 1N2RB 4XNZC 2VLKA 4YR6A 3KPRD 3EJYD 4XGZB 2SEBB 3GHBH 5D4QA 1A6UL 4JGMA 4NRZA 3GMOB 3LS5H 4LSRL 5C08B 5T1KA 1DUYA 4FZ8L 2XPGA 1KC5H 4PREA 43C9A 5C0CB 2JJTC 5T1LB 4GG6A 4OM0L 5E1AA 5FYJU 4OF3A 2IPTH 4KKBD 3X11B 5IGXH 3NZHL 1JNNH 2R0KH 5DZOA 4X98A 3WJLC 1EK3A 5DSCB 3DTXA 5L2KD 3QA3A 1IJ9A 4K7PX 2ZSVA 2H8PB 2DWDB 4Z76B 2XN9A 4K3JH 32C2B 2Y4SA 2XNAA 1JBJA 1HYSC 5KVDL 5LXGL 5J1AA 5K33A 4G5ZL 4XPBL 1I3VA 3S35H 1MCFA 4PG9A 1T1WB 4X6DE 3A6CH 1BBJA 4ZAKA 3GSNB 2IAMA 1IGFL 3SO5A 1X5XA 3RI5K 5ILTH 3CCHB 1CGTA 3CC5A 5IF0B 1MFCL 1NMCC 4QRUB 4JZOA 5F97E 1VFUA 4C56A 5J6GB 4OGAC 2OXGA 5AZEL 4RGMB 3V0AC 2ZKHH 1D6EB 2BVTA 5IEKA 5INDB 4PRIB 4OZIF 3BZ4B 1OARH 1MAKA 4ENEC 3DVNA 2FR4A 1FZMA 1MUJA 1BMGA 1FC1A 3B5HA 4FA8A 5CAYB 4EI5C 3QIUA 2D03H 2FL5B 4LFHD 3W9EB 3VFTB 3HPJA 1MH5A 4MA1B 1OCWH 3B83A 4U3CA 1Z0NA 2NY4B 3VMOA 5ICXB 3BKJH 3BIKA 4LIQH 4LCWA 4Z18A 2PW2A 1F4YH 3D3VB 1L7TL 3KPSB 2H9GA 2ZJSL 4JRXA 3V4UH 3S4SA 1P7KB 1KFAL 1U3HA 3MLZH 3FO0L 4L29A 3N9GH 2BRQA 4PJHE 3CFEA 3G08B 3GSOB 1F3JA 2VYRE 3MV9B 1FG2B 4X5XB 1MHEA 1W72A 3HLAA 1KPRB 3BQUC 3PV7A 1N5AA 3MXWH 5GRWA 5C70A 5EZLB 3ET9F 2E7BA 2CIIA 1J1PH 3LN5A 1CZ8L 5C09D 2ARWA 2XZZA 2BNQA 4ZPVA 4QY8A 3GRWH 1JZ6A 3BP4A 2HFGH 3G6JF 2EDNA 2A74B 4YH6A 4LLUA 4OFYD 3B9KA 4LIQE 2MHAB 4PLJD 5CIPB 1QEWB 4OIAA 3U48A 5KVGL 1BVLB 5ACLA 2I5YH 3FHAA 5HVHC 1IQWL 4JO4H 1JWUA 5DJ0A 4XPAL 5HHPA 1EA9C 1G9NH 3JWDH 4NRXB 1TJGH 2G75B 5E6YA 5FUOH 1QSFE 3QP3A 2PR4L 2EH8L 4PJ7B 3V6ZA 2GUOA 5EWIL 2ZZUT 4AZ8A 4Z77B 3NIFE 4N8CL 5TE6L 1U9KA 4NO2A 1A3LL 4LLWA 3WE6B 5EOQL 2CDGB 5GSVA 4X6CA 4NN6B 5FB8A 2X7LB 2AKRA 4YBLC 3OHXA 1U92A 4DW2H 2FRGP 3RKDC 3FN0L 5ID1B 2QADD 4OFIA 1CFVH 1UWXH 2P5ED 1WCBB 3DO3A 3TFKD 4K7FB 3IFLH 2M26A 4JHZA 4Q2ZB 2BFVH 25C8L 3HCVB 1DN0B 5KZCD 2Z8WC 4J2XA 1AO7A 5GGRA 4FQQA 4KKLD 1WWCA 3OF6D 5DUPL 5DD3H 3D18A 1C1EH 2BVQA 3W0WE 3E8UH 1KIRA 2YD7A 3UJIL 1CFTB 4ZUSB 4LVNB 1UADC 1EIBA 3K4DA 1MIML 2UZIH 1JGUH 1RZ8B 2HTKC 2VE6A 3L7FA 2DQUL 2IANE 1WAAE 2DD8L 1CE6A 3WD5H 2BCKB 5AD0B 2L4OA 2FATL 1G9NC 3HG1E 3MRCB 3OKYA 4XXCC 4LPWA 2XI9A 3U4EB 3EO0A 5C0RL 4ODTH 4QEGA 3MRMB 3T0EA 1E4WL 1U58A 4EUPA 5CMAB 2DQJH 4TPRL 4JM2F 4WNQB 2GFBA 3QDMB 3BZFB 4OM1H 4U1SB 3G5ZA 4ZO6A 2R4RL 2WNGA 1FLRH 5SV3A 3NH7H 2DYPA 2IC2A 1G7QA 1J5OL 3BVNB 1HHIB 1T6VN 2BSTB 4PB9H 5IBUB 2NY2C 2AV1A 5JZ7C 3EOAA 4JFQA 4DFHA 3SHSA 4M43H 4F58H 3CX2A 1BVKB 4DTGH 2A73B 3LDBB 1JZ2A 2WV3A 4RZCB 2B4CL 2DKUA 4O5LH 5I1CH 5HHVH 5HGBB 4PJXF 1MI5A 1TZHB 4OI7A 3A0OA 1FYTA 4IIQA 5FHAH 1Q9LB 3V0WL 2ICWA 4FQLL 2WQRA 4R90L 4UUJA 5CGTA 4ZOCA 5I1GL 1N3NA 3R4DA 1RPQA 2F19H 2AK1L 3N1GC 5F9OL 4OKVA 3DSNA 2KPNA 5HXMA 1I7RA 3F7VB 5D71L 2RGSA 4URTB 5CGYC 1FGVH 1N7ML 3S3SA 3MODL 3QT2A 3MPCA 4PR5A 5I76A 3PIQA 4XC1L 1YY9D 4JDVB 2FBJL 4KQ4H 5DK2B 1QFWM 4N5EC 4CADB 2DMKA 5F1IA 2V2TB 3TO2B 1CCZA 2AJSL 2OL3L 1WJ3A 2Y5TA 5DMGD 4DZ8A 5EZOL 3E2HB 2ZG1A 1I1AA 1Q0XL 1YNLL 3VXQA 1DLHA 5EUOA 1IC7H 4UIMB 1ETZB 4M6NH 4Y5VB 4HPYL 3NCCB 4PJCE 5HYIA 1YEKL 1OAXL 5J11C 4OCRH 4YHOL 5E5RB 4IOFC 5TE7L 4M1CD 4KDWA 1JHKL 1KTKE 5F8RC 4G3YH 1BOGA 3VWKC 3D0VB 3MRBA 4PV8A 5LGJB 5E2WL 4BK5A 1LEKB 4IMLB 4GMTL 4OIBA 1NJ9A 2GIYA 2VIRA 1A3RL 1UZ8A 3EHBD 3WXVL 4APQB 3HC3L 2NY6B 3SGEH 3BUYB 1CWVA 3AU1B 1JPGB 1LO5B 1DBJL 3KPPB 4XPTH 2J5LB 3RPIA 3PDOA 1MCOL 3ROOB 3VRJA 4PJ5D 4QTIL 1RZJH 5E08H 2B2XH 1W72L 2NX5E 1FCCA 1WZKA 5AYUL 3QCUL 4ZNEE 2VDRL 3MV7D 3PNWB 4Z8FL 4KK8C 5E9DE 1DANT 5E00A 2KQNA 1PJ9A 4AEIH 4Z78A 1HSBA 2IQAA 4XX1G 3OR7B 1IAIL 2AV7B 3UYOD 1F02I 5HDLA 2VDNL 1T2JA 2GITB 2P7TA 5KN5A 1U8OB 3BT2H 4MJ6B 3VD5A 1OAUL 2OR9L 4MMXC 4UQ3A 1UYWH 2DI8A 4JQVA 1BLNA 2OTPA 3BOVA 5DHVA 4G80B 3FT2A 2CMRH 3SKOB 2Y25A 1WGOA 4ZYKA 4G6AC 1AY1L 4OZGB 2X4UB 1HILB 4PRAA 5C08D 4ODHL 5IMOA 2IGFL 3UYRH 1QA9B 5T5NF 3ZYJA 3O2WH 5T1LD 4UNVA 2XT1B 4WUUE 1MRCL 1RZ7H 5D1XB 1UWEL 5C9JA 3RZCB 1RULL 3O45A 1SYSA 2MCG1 3MZTA 1SBSH 1RZJC 5BVJB 1AGEB 1A47A 2VQTA 5FFLA 2VUYA 4GW1B 2P45B 4J4PC 4DKFL 4AIZB 4WWKB 5DYOA 2Y36L 5T3XD 5ISZB 3ZE2F 5DQJA 4N8VB 3IDIA 1RMFH 3QBTB 5D6CB 5I1LA 4TUKH 2XWTB 4KHTH 3HZMA 4Y19E 4DVRL 2HLAA 4RFOL 4HWEL 3D85A 4WTZG 3REWA 3V52L 4F8QA 1RUAH 4L3EB 3FQTB 4MNQE 3OJVC 3KJ4C 4IRSB 4TUOB 2DJ4A 1QQDA 2QHLA 4NP4H 4XMPL 3S37X 5DMYA 1CD1B 4OZHF 5KJRH 1M05B 4XC3H 3AREB 4K07A 1QNZL 4JY5L 2BHYA 4ZG1A 1PQZA 1GIGH 5FUZL 5E0QA 1V05A 4DZBB 3MOAL 1S7TA 2A0LC 3MJ6A 2XFXB 4WFHD 3VMNA 2B39A 3N85H 2NY4D 4F7MB 4FFVC 5HI5C 1I1FA 1I4FA 4GRWF 2F15A 5IFHH 2VLKB 4YR6B 4XCEA 4XHQA 4LQ1A 5DJZA 1G7HA 4FG6C 1L6ZA 1IAMA 1KN4L 3MLVL 4G8GD 3D3VD 4OQ1A 3KPSD 4PJBA 1RHHA 2B1HH 1IGYA 4NRZB 1JZ5A 1EUUA 3VXME 5T1KB 1DUYB 2XPGB 4PREB 1MJUH 4Q58C 43C9B 3HMWH 3TM6A 4GAFB 3MV9D 1UG9A 4PGDA 3IDXH 3WSQL 5JO5A 4GG6B 4DUWA 3SO3B 5E1AB 3WUWA 5EO0B 3R8BB 5IHUH 4P2QA 4X98B 3DTXB 3H2WA 5D1ZC 4F33A 3QA3B 2Z31A 2ZSVB 2E7HA 2XN9B 4KJYA 1YJDL 1OT2A 5GRYA 3GBML 5CFHA 2XNAB 5M94B 5J1AB 5D7IA 1F6AA 3PL6D 5I18L 4PG9B 1YN7A 1QLRA 1CQKA 4M6AA 3ULUD 1BBJB 4YBQC 4YHIA 4ZAKB 4WI3A 4LSPH 2YD5A 4NT6A 5F89A 3EKCA 5BO1L 1JF1A 2IAMB 2VDKL 4X4YA 2Y6SC 1H9VA 3QUKA 4M5YL 2Q8BL 1MHPL 3CC5B 4JZOB 3V7AE 3UO1L 4C56B 4EJ1C 1BEYH 2O5ZH 2P49B 4R2GD 5IEKB 1HQ4B 2MNUA 5GGRY 3DVNB 1FZMB 1H3VA 1MUJB 1T21A 3VRLF 4Z6AT 1DLFL 3WCYA 2P24A 1MH5B 1CE1L 4U1GC 1WC7A 2EDYA 1BD2A 4KMTL 5EOTA 4S0SD 4HEPG 4DJMA 3CFBA 1D5IH 1XZ0A 1ZHLA 3QIBA 3H42L 4TTGA 4MJID 3MNWA 2WBKA 4LCWB 1NUNB 4J3UA 3JZ7A 2PW2B 5IB1A 2H9GB 1ROWA 4JRXB 2FSEA 3EYOA 3S4SB 2YWZA 2IWGA 1ERNA 1U3HB 2R2EA 1MHCA 1UC6A 3CFEB 1F3JB 2HRPH 1MHEB 1W72B 3HLAB 1N5AB 4GRWH 3ZHDA 1JVKA 2CIIB 5FYJL 5D7JA 3LN5B 1PW3A 5H37G 3O6FA 1IBGL 2BNQB 4ZPVB 4QY8B 4DVBA 5HHXH 3BP4B 4PFEA 4PRHE 1A0QL 2QSCL 4LHUG 4LLUB 4C57C 3B9KB 3L7EA 4BZYA 1A1MA 4M7KH 5C07A 3NIGE 3QDJE 1JWUB 3QDMD 5HHPB 4PJEE 3ARBA 2BVOA 4Q6IC 3RBGA 1CT8A 2NY1D 4I18C 5IQ9A 3GJEA 2A1WL 4ZUVA 5JORA 4NWTL 2GUOB 3V6ZB 5LQBL 2Y5EA 3LQAC 4NO2B 2XWJA 4LLWB 5A2LH 2XACC 4KI5E 5GSVB 2FWOA 4X6CB 3LAFA 4XCYA 1CI5A 4FNLH 5FB8B 2AK4E 1GHFL 1JTPA 2AKRB 3OHXB 1U92B 2NR6C 4PRBA 1RFDL 4O9HL 5MEQA 3ARTA 4U1KA 1CG9A 3P4OA 1QBBA 2H6PA 2NY3D 2DQCL 5FUCE 2C3WA 4JFED 3R8QA 3MSPA 1KIUA 5GGRB 4FQQB 3O9WA 2D31A 2OI9B 1FIGH 4Q0XL 1XF2A 3D18B 4HUVA 3BISA 4BYHA 4KI5C 2BVQB 2EEAA 5EZJA 4WFFD 4XNUL 1KIRB 2UWEA 3QH3A 4Z7OF 2AJUH 1ORQA 1L9NA 3P4NB 1XF5A 2VE6B 3L7FB 2UYLA 3GKWL 2CLRA 1Z9OA 5E2VH 1CE6B 3KVQA 3O4OC 4B7IA 3RVVC 3VFRA 1RIVH 4ESKA 5FUCC 1NDMB 1NMBL 3IAGC 4RGOH 3EO0B 4U05A 2P44B 5FYKD 1JHTA 5IW3A 3QQ9D 1HSAA 3T0EB 1YNTA 1BX2A 3ARGC 2NNAA 4NFCA 4WEBH 1U58B 4S1DC 3P11H 4OLWH 3SQBA 1NGZA 1UKQA 4J3TA 2VDQH 4H8WH 4NOBA 2GFBB 2OR7A 4JFFA 5J56B 3DO7A 3G5ZB 2ORBH 5JHDE 2DYPB 2VZTA 4U1NA 1G7QB 2NCMA 4XAKE 3A6BL 1SJVA 1E6JH 1HHGA 1IGCH 4HX1A 3CGTA 3DRQA 4MQXC 2AV1B 3EOAB 1YDPB 2BC4A 4JFQB 1DQTA 4UT9L 2DWEA 4KZEH 4KAQH 1GGCH 2GQHA 4OV6F 1AR1D 3SQOH 4RISL 3CJJA 2GJ6A 3BKYL 1AJ7L 3ARWA 1A7OH 2E27H 4BFEA 4XWGL 1MI5B 4Q9QH 2W1NA 2VL4A 4K94H 5LGHH 1N64L 1FYTB 3QXDA 4APQD 1OP9A 2NY6D 1MHHA 5HVGB 4IIQB 2BSRA 2ICWB 4D8PA 3SGKA 2YPKA 4UUJB 5E99H 3NA9L 2W0KA 1N3NB 3QRGH 4OKVB 4M7JH 1I7RB 1NAKL 3MLUH 4OGXL 4IDJL 5GS0L 1OSPL 4HXAH 3X12A 4IS6A 4N90D 4PR5B 5I76B 3PIQB 1YNKL 4PGBA 5JHLH 1I8IA 3ZL4L 2YPVL 3SPVB 5F1IB 5I1IL 5LBSL 1AFVL 2Y5TB 4KRPC 1GGIL 4DZ8B 5I8OH 5CS7A 4JO2H 2BVPA 1XGTA 1I1AB 3VXQB 3O2DH 2IG2H 1DLHB 5EUOB 1JUFA 3VFUA 4HIJA 3P77A 4H25A 4HKXA 4K94C 3FQRA 2CQVA 1T03L 2EH7L 4M93B 1T7VA 5D1XD 1PFCA 4K8RL 2JB5L 5E2UL 3RZCD 4O00A 1ACYH 1GGBL 1BOGB 5F96H 1KYOK 2O5YH 2AI0H 3MRBB 4PV8B 1D9KD 3U4AA 1NJ9B 2V7HA 2VIRB 4TVPL 4R96A 1UZ8B 3GK8L 4UT6H 1EHLH 4OD1H 4J12A 3RAJL 4JKPL 1VEOA 5EN2A 1YC8A 1OP5H 3DXAE 3CX5K 3PDOB 1A6AA 3RPIB 3VFNB 4DAGH 3VRJB 5IW1A 4R9HA 3QO1A 4L3ED 1KJ2H 3D2UA 3ESVF 5E00B 5C6PB 4PUBH 4FQ2H 4XXDA 5DJ6A 4Z78B 1HSBB 4DQOH 2IQAB 3ARED 2YMXL 3OB0K 1XH3A 4LBEA 5KSBA 1FH5L 5HI3D 5KN5B 4C58B 4UQ3B 2NXZB 3PGDA 4AEHL 1BLNB 1W2KT 5DHVB 1OGAE 2HJFA 4BA8A 3FT2B 4JFOA 4NQVA 5I1HH 5GRJL 2PXYA 2G5RA 4ZYKB 4H1LH 1KYOJ 2VDML 4M7LT 4PRAB 5T1KD 4JRWA 1C16A 4YDKH 5IMOB 1JYXA 1IAOA 3T3PF 5DGRA 3T2OA 1BZQK 2HKFH 4YWGH 3KPQA 1L0XA 2K9UA 4O02L 4QOKD 1QFUH 3UMTA 4Q9RL 1F00I 5F7LB 3B8SA 3MJ8A 5C9JB 3CX5J 4OBSA 5EORL 3O45B 1SYSB 1XF3A 1H3XA 4WGVB 1CFQA 1PY9A 4GT7A 3PHOA 2OX5A 1R6VA 5DYOB 4MXWL 3UDWC 2R4SL 1ZV5A 4P9HL 3SE4C 1F3DJ 4ZAKD 1K2DA 1VFBA 1AGFA 4OZFH 3IDIB 3VFSA 2R2HA 5I1LB 2IAMD 3QR2A 2EECA 1LO2L 1OAKH 4YXHH 3SDXA 3HZMB 3KPRE 2I07A 2ED8A 2HLAB 4NJAL 4EBQL 4QHKJ 1EEZA 3JTTA 1W8OA 2O5XL 2QV2A 3D85B 3REWB 4C56D 5CLWA 1NGPH 2FGWL 3R1GH 3BN3B 1QQDB 2ZCLL 3UX9B 3RWIB 1IEBB 1FLTX 4JGUA 3SDYL 2CPCA 1D5ZA 4BSWA 5AZ2L 4OF0A 3UTTD 1FAIL 2D0GA 2VXUL 4LEXL 1PQZB 3CMGA 3QIUD 4U2ZA 1LO0L 4MDIA 4Y4HC 1S7TB 4GSDH 5HGDA 1N4XH 3FCTA 5L2KE 1I7UA 4YC2B 1A1OA 1JMXA 5GJTH 1I1FB 1I4FB 3EJYC 5DMIH 4XCEB 5IWLA 3BJ91 5DJZB 4NM8H 1G7HB 3HE6A 3W81A 3SDAA 2Z91A 5D96C 4PJBB 3CXHK 4JRXD 1RHHB 4OLXL 1J1OL 1IGYB 4XCFL 3RP1A 4HH8A 2JF1A 4R4FH 3SKNA 4TSCL 4CMHB 4PGDB 5JO5B 4RWHA 1OP3K 3WUWB 1A02N 1T1XA 7FABH 3O4LA 1T20A 2H2SD 3H9SA 5I74B 4O2EA 5FEBA 3FFDA 4W81A 4P2QB 5CSGA 5DUML 3SGEI 3RTQC 2Z31B 2BNQD 4KJYB 5E8DL 1S7UA 3V5HA 2AEQH 4WW2C 1KCKA 2GK0A 4P5KA 1AP2A 3B9KD 4IBLT 3U83A 5D7IB 1RIHH 3D9AL 1IE5A 2EDQA 1YMMA 1F6AB 1K8IA 1X44A 3O0RL 2X2YA 1YN7B 1QLRB 4LLYA 4JO3L 3OR6A 4YHIB 4NT6B 5F89B 5LGKA 5K9JH 1JF1B 3MJGX 4X4YB 1M4KA 3QUKB 5JIIA 5DVMA 4G7VH 4XHJD 3U6RA 4XMLL 4QLRA 1VEMA 3QJHA 2UUDH 4ODSL 4ZSOE 4JPIA 3BGFB 1D6VH 4I3RH 5JXAL 1M71A 4LCYA 1T21B 5IW6A 2HJLA 4S2SA 5CBEA 3NVQA 4YHKL 2P24B 5GGQH 4GAGH 4WUKL 1AO7D 1XGYH 4TRPH 4JVWA 1LMKA 1WC7B 5C09E 1BD2B 3RWGA 1DQLH 2EKSB 2PNDA 4HFUH 5EOTB 3CFBB 1ZHLB 1XZ0B 1VA9A 2VUOA 3QIBB 3GKZA 3TIDA 3U0WH 5TFSH 3MNWB 3IGAA 4JLRA 5ADPH 4YHML 2CRYA 2ERJB 3SDDD 4LSUH 4TNWF 2YOCA 5IB1B 1BBDH 4LSTL 2FSEB 3EYOB 5F88A 5GRUH 5DHYA 2FX8L 1IEAA 2R2EB 4LSVL 1MHCB 4R0LC 1EJOH 4OV5A 5EBGA 2XXCB 3JV6A 2CR6A 4D3CH 2OP4L 4PTTA 3HRPA 3UJJL 1QHOA 2QHRH 4NNPH 5D7JB 1BF2A 3AROA 3O6FB 4DVBB 3T0ED 4LU5L 4F7TA 4YE4H 3WO3B 3L7EB 1A1MB 1NDGA 3VRIA 3RVTD 3ILPA 4ZS6C 1WISA 5C07B 5A2FA 3SKJH 3TZVD 3EOTL 3HI1A 1FFPA 1YEJH 3ARBB 2BVOB 4Q7DA 3P0YH 5SX4H 4XAWH 4F7EA 1CT8B 3AM8C 3DPBA 5F7FA 5IQ9B 2XZCH 3GJEB 3DHMA 4ZUVB 5JORB 3O3AA 3MFFA 4KXZH 1ZHNA 2XWJB 4NSKA 2FWOB 2BXYA 1U6AH 5K9OA 4XCYB 2V5TA 1CDIA 2A6DA 5DQDH 3VXOA 5C6TL 1B0WA 2QADC 4DGVH 4WV1C 4YFEA 3PP3K 4QRRA 4LARH 4PRBB 3TFKC 3WS6C 2MPAH 1JWSA 5MEQB 4U1KB 5F9AC 4G8EA 3ULVD 1NGWA 1CG9B 3IYLW 3P4OB 2H6PB 1KXQE 2BHZA 4GG8A 2YZ1A 4KKLC 3FZUD 2ZUYA 5T1MA 1QPXA 3S3JA 2D31B 5IB3A 1F90H 1XF2B 4HUVB 2VO5A 3BP5A 5EZJB 3I50H 4ALAL 4NC0B 1NC4A 4Z7WF 2J6EA 2UWEB 3QH3B 1AGBA 1ORQB 4UDUA 1XF5B 4K3EH 4P3CH 2IPUG 2UYLB 5DD0L 2CLRB 3IDYC 2QQKH 3LKSA 5J9PA 2FX9H 3QEGH 4LVHC 3MREA 3E6FA 1BQLH 1JPTL 2X09A 1U8LA 4NQUA 1A6TA 3BI9X 3LKPA 1JHTB 3WXWL 4F15B 4EXKA 1HSAB 1YNTB 1DBMH 2R0LL 4WRLA 1BX2B 5C0GA 5B8CC 2NNAB 1EFXA 3F62A 5AUMA 4JE4B 4TSBH 1EHAA 4JAMA 4LVEA 5DMKA 3KLHD 1NGZB 1NL0H 3SDCA 3QHTC 1MJ8H 5DVOA 4JFFB 4F2MA 3DO7B 2GY7B 1FFRA 4PRPA 1KELH 1OL0A 4HBCL 1FGNH 4U1NB 4EDWH 3L3HA 4B53A 1P7QA 1HHGB 2V2WA 4XP6H 4HX1B 3DRQB 1UM6H 1UACL 3JUZA 1LNUA 2BC4B 2QSVA 4DEPC 2DWEB 2CXKA 2XY1A 2IANA 1WAAA 5LWYH 1C08A 2GJ6B 4G6FB 5JIKA 2BSSA 2FD6H 1F4AA 1OAYL 3S88H 1MJ7L 3M1BA 1XFPA 3PGFL 5BV7H 3QXDB 3GMPA 2PYEA 1MHHB 1X5HA 4G6JL 2BSRB 1HINL 1S7WA 5FGBA 2XKNA 4D8PB 4DGIL 4ZFOA 2ZUUA 2YPKB 4XVTH 4G6KL 3VG9B 3L1OL 2GSGB 4QTHB 1A6ZA 3T08A 3UPRA 4HC1L 4JG0L 4KPHH 3C87A 1NCWH 3ALXA 1V7NL 5C0JA 4U0RB 1YY9C 2IPKA 4IS6B 2AJVH 5EA0L 1WFOA 4PGBB 4MA8H 3DYOA 3S6CA 3SEPA 4UINH 3WKMH 2NXZD 1IVLA 1FNHA 4JR9L 1X5LA 2D7QA 1UM5H 4LPUA 5BW7C 5BS0A 3G04A 4PJGA 4FTVA 2BVPB 1XGTB 2VXQL 4PIRF 1B4JH 4X7CC 3MRRA 3VFUB 4HIJB 3P77B 2VNCA 4H25B 4HKXB 1GC1H 3FQRB 4R97B 4MZ2A 1MFAL 5BV7C 1UKTA 5F7HA 2Z35A 3K1KC 2WUCL 4PJ5E 4M1CC 2VN7A 2CJUH 3S5LG 3QI9C 4OF8A 3TT1H 2LV4A 4U1MA 1G7JA 1R3HA 3MV7E 2C1OA 1KENL 2QQLL 5E6IA 1E4XL 3BKCL 1N6VA 2I60L 1U8HA 2MQ3A 5DJ2A 3RBSA 5DEGA 2V7HB 3CK0L 5IT2L 2RHEA 4R96B 4X9FA 4H0GA 2JKXA 5FO7A 2O61A 5DLML 2NMSA 1DANU 4LPXA 5EN2B 4JFDA 1MFNA 1A6AB 2WUBH 3RPKA 3S35X 5IW1B 2F5AH 3SCMC 2NQCA 3LKRA 2FX7H 3FB7A 3D85D 3QO1B 4XPFL 5BMFL 5GGSA 2DQTH 5F6HJ 3D2UB 1R0AL 3H3PH 5C08E 5JQ6L 1P4IH 5T3XH 3A67H 4XXDB 1BIIA 5DJ6B 3U30C 4X4MA 1C5CL 2LVEA 4PGEA 4GXVH 1R3LA 4AG4H 3ZE1E 1XH3B 4LBEB 3V2AR 5KSBB 1GC1C 4FXGA 3EDDA 5FKPA 3LZFL 3PGDB 1Q72L 4LSSH 5FDWA 2HJFB 2J8UB 5D5MA 3KDMA 5HBBA 1IKNC 4OBRA 4FABH 4JFOB 4NQVB 3HNSL 2PXYB 1CFSA 1HH6A 5BRZA 2Y7QA 2XA8L 1C16B 5T3XE 5IKCA 1JK8A 3NFNA 1IAOB 4GMSL 5E6ZA 5KBNC 3BPLB 4XBEH 3AC0A 3KPQB 4I5BA 1O5DT 1YEHL 1OD7A 2LAAA 4L5FL 3EYQD 3GJFA 4ZNEA 2CSPA 3PXHA 5GS0D 5HYEA 3GJFK 3MJ8B 3V7AG 5CZVL 1T2XA 5L7XL 2E6PA 1XF3B 2Z31D 1B6UA 3WJJA 1CFQB 5SWSA 4TULH 3PHOB 4N1CA 4EVNA 1RZKL 1P53A 4WO4A 4UMGA 3CVIL 1TZIA 4OCXL 1WBYA 1UEYA 4FP8L 2VAJA 4WFHE 1K2DB 1VFBB 1AGFB 3S34L 3VFSB 1JV5A 3RWEA 1HCFX 5DD1H 5DTFA 4PJAA