2BFVL

Monoclonal antibody fragment fv4155 from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
DIELTQSPPSLPVSLGDQVSISCRSSQSLVSNNRRNYLHWYLQKPGQSPKLVIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVAAEDLGLYFCSQSSHVPLTFGSGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords FV4155
publication title Antibody fragment Fv4155 bound to two closely related steroid hormones: the structural basis of fine specificity.
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1997-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bfvL00
1YEHH 4K07A 3DO7B 1DBJL 3GSQB 4JRXB 4K3DH 2BVOA 3OB0H 1AGEA 1FNSH 1IKFL 1R3KB 5BO1H 2NTFB 1ZT4A 3OSKA 5B3NA 2R8SH 4DVBA 4OB5H 1L7TL 1GSMA 3EGSB 1QO3A 2B1AL 2XWJB 4I1NB 4PJAE 3LCYA 3MGAA 5FM8A 3ULUD 5F9WC 1V3JA 1NFDE 3C5JA 2V2XB 3ZDZF 5ALBH 1FFNB 1WBYA 4PJXE 2EDXA 2WNGA 4LQ1A 1Q94B 4IDJL 5TDNB 3ORJA 2DQTH 3VH8A 2X40A 1TQCC 3SKNB 3WFDH 4PIRF 4K9EL 2HJKB 4FNLL 4Y16D 1FZMB 2B5IC 4XPBH 4G8EA 2BMKB 4M8VA 4XHQA 3BN3B 2EDJA 3BQUC 3BVNB 4HZAA 1IM3A 2PYEE 1QYGH 1A7RL 4FQIL 4HKXA 1S7WB 4HJ0D 3PGFL 1OAYH 5IJKC 2VR4A 1B4JL 5CGTA 2WWKO 5J1SC 4ZXBC 1NGPH 3VXSA 3VD3A 3TBWA 2V2WA 3QQ4A 5HGDB 5FYKL 2XQYK 2A6DA 5BRZE 5C9JB 3B5TA 3QUYA 4BJLA 4CMHB 4JPVL 4MDJB 2E9BA 4LEXL 5TE7L 1YNLH 4I3SH 3LKOA 5FA3B 2XN9B 4TN9A 1IQDA 2HT3D 2MCG1 3SE9H 1T03L 5KJRH 2DBJA 4NJ9L 3SDXA 5MEPA 5EU3A 1RUPL 4ZAKA 4POYA 4JFDE 4XH2B 1FN4B 4WU5B 4LRNL 2W9EH 4NKDA 4KQ4H 4MNQD 2B39A 3R8QA 5DEZA 2XKUA 3QXAB 4XMPL 4K3EL 4C56D 5MP6L 2YN5A 4I2XB 1N64L 2XPGB 2VABA 2W07A 4I3RH 1FBIH 4OZIF 2QSQA 1T0PB 1D7FA 5I8OL 3SJVA 1G0XA 1MRFL 5DJDA 3WHXA 1DEEB 5CLTA 3VA2C 2E7CA 4JRXE 1YJDC 2RHEA 4J2XA 4FQXC 1C08B 5E8NA 3JV6B 3U4BH 3R0NA 4MQSB 5IR1B 3IAGC 1SJVA 2IQAA 1JF5A 3Q3GB 3DX7B 3HMWL 4X6BB 5J1TC 3GZKA 1MFCL 1JPTH 1A6UL 1IAOA 5T5FL 4O2EA 2QKIB 2V9TA 5JPNA 1TQBB 2EYRB 2HRPH 4RIRA 4KTEH 3Q1SH 3CUPA 3QFJD 3H9HB 3DUUB 3HTLX 1RURL 3VXRA 3MFFB 3S88L 3JWDL 5I6XB 1F4XH 3MROA 3VRIB 2OI9C 5DVNA 2FJFB 4M7LH 5I1KL 2RQ8A 1DJSA 3BPNB 4JFXB 1HILA 2CK0L 4M7LT 1KGCD 1WICA 4K7PY 5IFHH 2CLRA 1DANU 4JFQA 3RTQC 1JNNH 2OLDA 4GW5A 1U9KA 2OX5A 3CLFH 3QPQC 4OFKA 3SKUD 4L9LA 4J4PA 1GYAA 1LEIB 3BIKA 1A2YB 5IUSA 1DQDH 3ULUL 5DQ9B 5GGUB 1OP3K 2Z8WC 3JSSA 4LFHD 1RUMH 3SDDC 5FECB 3PDOB 4X6FB 3UZEA 4D0BB 5INDA 2IANA 5B3JE 3QULB 2AJVH 1JF1A 2B0SH 4GMTL 1NAKL 1JPFB 1FZJB 5JPMA 3ULVF 2AI0L 3JWOL 5C0BD 2V5MA 1FO0H 5DZNA 3QA3A 2NX5B 4M1DH 4OGYH 1W72H 3VD4A 1S9WB 3MRNB 1N59B 1OCWL 4HPOL 4KY1L 1ZXQA 2XN9E 2Q1EA 2C26A 4H1LA 3UAJD 5CSBA 2GT9A 4OM1H 2DB8A 4KQ3L 3D18A 5IMLB 1PSKH 4YHZH 43CAA 4WFED 5FGRA 1JHKH 1NBQA 4AENA 4FMFA 4PYGA 5F7EH 5CMAB 3EO0B 3CZFB 1NANI 4KV5E 5MHSE 1GJIA 1WTGT 2CQVA 1IEAA 1RUKH 3AMLA 4WV1B 2P8MA 4I2XE 4EKXA 4DEPC 4X7TB 1RJLA 1UZ8A 4WWKD 2F19L 5EC1A 1RJCA 4KKNA 4N8CH 4NRXB 4JM2A 4BQ6A 1MREL 4HUWA 1EPFA 3C60D 2P8PB 4QXUH 4HUXA 1IKNC 1MRDH 4MA3B 4BSWB 1Z0MA 4HIHB 2X4UA 3CSGA 5K9OB 4O9HH 4BKLA 2YEZB 4O2FA 3LD8B 3NFPB 4IDLA 1U58B 2CKNA 4NN6C 2ICWB 1A7QL 3EYFB 4NNPL 1S3KL 1BD2A 2BERA 4LCIL 4QY8A 35C8L 4XAKE 3H9SD 2ORBH 4KK6D 3VI4F 2IFFL 3X3FH 3IJSB 1NFDA 1D5IH 4M62H 4DW2H 4PJXA 5CILL 1AD0A 4ODVL 1DN0B 2NZ9C 1MWAA 4XPHH 5E8EB 1NFKA 4ALAL 1T89C 3H7BB 3MUZ1 1E4KC 5BZWB 2YPLB 5ACLA 4G9FB 1YEGH 3QG7H 2C4FU 4JPIB 1MAJA 2AJZB 5FCUL 5IOPB 2N7AA 1NFIB 3BYYA 5TE6L 1IC4H 3LDBC 4R7NA 1T7WA 2R1XA 2HFTA 2PO6D 4YGVB 1BLNA 3IDJA 4U6VL 1HQ4B 2YS4A 3RWCB 3U4EA 2CR3A 1JWMA 4EZMA 1CG9B 1IAIL 1JYWA 2OTWA 5BQ7B 1J5OH 3BD5A 4QHUA 1TVBA 4ELKB 3MRCA 3N06B 2X05A 5GQBA 4NQDA 1A7BA 3VFSA 3GMQB 3LQZB 5I9QB 5CHNB 4BUHA 4BFBD 3HPLA 4A6YA 2AEWA 5FDWB 2OL3B 3BUYA 4U1IB 5BRZA 4JO1L 4RMTA 5DMGD 5HGBB 4GG8A 2NX5E 2X44D 4O4YL 4NIKB 1LO3L 4M6MH 4QEGA 1KTRL 1A6VH 2HTLD 1FRGH 3KG5A 3ZDYF 2ZUSA 3TEUA 4LRIA 3IU4L 1MELA 3U7YL 4JFDA 5HDOA 1KCUH 1WFOA 5IQ7L 4MSWA 3DMMC 4M7JL 4GXVH 1UYWH 3HC4H 2IH3A 1Q9OB 3SDAB 1AHWA 4YAQA 3V7MA 5F7KC 1PDKA 3TYGL 3H6JA 1NGYB 5FKAA 1JHTA 4KRPB 1A1MB 5DO2D 2XRAL 5T3XH 1NMCC 5C2UB 2SEBA 4Q9CA 4OGXL 2DLHA 3BMVA 1XAUA 1CL7L 3EYSL 3DO7A 3FZUD 4XVSH 4G6MH 3EFDH 4KK8D 2L0DA 4KXZI 3ZKNC 1RHFA 2BVQB 5DFVC 2NTFA 3NGBC 4PB9L 3GJFK 1P69B 3VWJC 2XWJA 2ZJSH 3RUGB 3MREA 2YZ8A 2FBJH 3Q0HA 3KJ6H 3JTTB 3CH1A 3T4AA 3GHBL 3GSWB 5DDHB 1Q94A 5CEYB 5TDNA 5I2IA 5E7BA 1G9MC 3K4AA 5D70H 2YPLE 2IFGA 3WNKA 4G9FE 4JRWA 3RVTC 2VE6A 3SKNA 4OQ1A 4GT7A 4HIEB 1IGTB 2AGJH 1J87A 2HJKA 4WGVB 4Z76B 1FZMA 3KPQA 2BMKA 3R1GL 1SYSA 1E6OL 4Y5XA 1C16A 2YKLH 3DV6A 4OLXL 4NM8L 3HUJA 4JFZH 2PR4H 1A3LH 2FIRT 4KKCC 2R1YA 4S1RL 1ZTXL 5AD0A 1IAIM 3MJ9H 1ZLWH 2R2CA 2ZUQB 5I71B 3LH2H 1F45A 1KLUB 1BQUA 4F7MB 1ZHKB 2XACC 5DUML 4PJDF 5DHVA 4KHTL 1LQSR 1R0AH 3BQUD 2XZAL 3MRLB 3SKJL 3V6FB 2DQDL 2YD4A 3Q5TA 1LP9F 4LVOC 3K2UL 2NNAB 5FA4B 1HIML 2NY4C 2XN9A 3DBXA 5E2TL 5FA3A 3SGKC 3BRFA 4KMTL 1N7MH 1ETZB 4ZXBD 3BGFB 5DMIL 1YECH 4OI9A 1XR8B 4RAUB 3P11H 4M1GL 4XH2A 4HIJB 1P6AB 4MNGA 2DDQL 5F72S 5SWSB 1BMGA 3L5HA 3QXAA 3HE7C 3TBVA 3MV7B 2R0KH 1YA5A 3ARGC 4D0DA 1YYMH 4RMWA 4PJHB 3O2WH 3BWAB 1OPGL 2A9NL 3ULSA 3VGDA 3VD7A 4XNYH 1EAPB 1AO7D 3QPXL 4NYLB 2JJTA 3WKMH 3WO4C 3QIBC 5C07D 3QNZB 1QSFB 4LK4A 1KIPA 4NQSB 1C5BL 2GY5A 2AJ3B 2JJSC 3JV6A 3AY4C 1BX2A 4RGOH 3WJJC 2CK2A 3K8KA 2WWKT 5GGQL 3MRMB 5J9PB 3UTTD 3Q3GA 3DX7A 1VEPA 4N9GB 2D7QA 1JVKA 1J0KA 2EC9U 5E95B 1LK2B 1R5VB 2I27N 3RUGE 3UYRL 5H37H 5I1EL 2HFEB 1I8LA 2WBJB 4HKBA 5BVPH 3H9HA 3V0WH 3MFFA 4OLZH 4M8QB 1QFUL 1R3JA 3UTZA 2VL4A 2IQ9L 3EBAA 5IROA 2MQ3A 4JFFB 3BPLC 2O5YL 3GRWH 3ARQA 5CBAB 1YNKL 2AXJA 4JFXA 4F2MA 5FYLL 5D4QA 5A16B 3ARPA 4KAQL 4E5XA 5GISH 1INQA 1L6ZA 3FQXB 5F1OB 1A2YA 2ZCHL 3QB7C 5DQ9A 1JPSH 1MFBH 2VZSA 2QLVB 3PDOA 1FSKB 1MLCB 3MLUH 2YRPA 4D0BA 3L3HA 3WUZA 4OZHF 1JPST 3QULA 3UO1H 3RTQD 5TGBA 1WZ1L 1JPFA 1FZJA 3QPQD 3PNWB 4KGLA 5SWQB 5FHBL 4OD1L 1CGVA 2BZDA 3MRNA 1N59A 2YPVL 2BVPB 3SDDD 3DXAD 2E9IA 4OD2B 5ADOL 1ZHNB 3QYCA 4G8GB 3FN0L 1U6AH 5IMLA 5C0CD 2OXGA 3VGHA 2F53B 3VFWA 2AEPL 5DGQA 1MFEL 2AJUL 4XVTL 1F4WH 4YDVA 4GG6B 5CMAA 3EO0A 1IFHL 4HQQH 2VN4A 1GGYA 1NDMA 9CGTA 4M7ZB 5GRVL 4WV1A 3MV7E 4PJHE 1BJ8A 2VXVL 2VDLL 5J0BA 5JDSB 2VL5A 3VXNA 3QWRA 2VXUL 1QSFE 4MA3A 4BSWA 1CLYH 1FO0B 4HIHA 3BP6B 5K9OA 4LCCC 1P7KB 3STLB 3RU8L 1T04B 1KXQE 3L5WB 3EYFA 3NCCB 5BMFL 1SJHA 4RDQF 3GSOA 1FLTX 3VG9B 1OAQH 2Z91A 5AZEL 3MUJA 1MHPL 3WS6C 5LJYH 3IJSA 4GAJH 4YK4B 4H0GA 4YDLB 4LPWA 5EOQH 1DN0A 5E8EA 1EO8L 3HI5L 5AYUH 2B2XH 3H7BA 1I1YA 1JGEB 5BZWA 2YPLA 2R9HC 3TBTB 4JFFE 2BSSA 4G9FA 5SX4I 2VLRD 1RZFH 2AJZA 5ANME 5IOPA 3T0DA 5JHDD 1F5WA 5EU6B 1U3ZA 1D6EB 3RX8A 1CF8L 1HQ4A 4OCYL 2NZ9D 4Z7VB 1Z3GH 3GI8H 5ESVA 2X1OA 3W9DA 4GJTB 1YJDL 4G80B 3V4UH 4YQXL 4ELKA 1F6LL 5KSAB 3QAZB 2AJXL 5JIIA 1INEH 2A73B 1RSFA 3LQZA 3DVGB 5CHNA 4RWYH 3H8NA 3M8OL 5E4EB 2OL3A 3O6KH 1DQJA 5CCKH 4U1IA 1KB5B 4KVNH 5HGBA 2IF7A 4OLYH 5LWYL 4L8SC 3EOAB 1FH5L 1ZANH 5D7JB 5DQJB 3O8XA 4ZUSB 4G8GE 2JB6B 1LEKA 2ESVE 5DSCB 2DF3A 3CCHA 2F53E 3IU3B 3VFGL 4XZUA 4PGDB 4GG6E 5B39B 3F58H 1QKZL 3M1BB 2JLLA 4RGNB 1G6RL 4PS4H 1BVZA 1NGYA 5CJQH 4K55A 3U9UB 3SGJC 3NA4A 4C57C 2D4FA 1V7NL 1FORL 1QG3A 5B39G 4HLZH 5J3HC 4LSSH 2YUWA 1B2WL 1FYTB 3G9AB 1MCPL 4HWUA 1CGYA 3DMMD 5D71L 4IRZL 4WW2A 4ZUUA 4J12A 1T20B 4KPHH 3RBSA 5DJ2B 2K9UA 1CT8A 2R29L 2DQFB 4TQEL 3KYMB 1GAFH 2R23B 4TULL 1PYWB 4WW1B 3MLWH 2YPKB 4D9QE 1CTNA 4HUNB 5HGAB 5L2KD 4IRSB 2I9LB 3JTTA 5CJXA 1WJ3A 1OQOA 5DDHA 2EKSB 5JHLL 2ARJB 3QQ3B 5DA0B 3ZKND 2X42A 5IW6A 1KJ3H 4NFCA 5CEYA 5DFVD 3WSQL 3VFNB 4HDIA 3FT3A 4D2NA 4MCZB 5D5MF 4WFGD 2NY6B 3VWJD 3TA3B 2X4TB 3HMXA 3E3QC 4HIEA 3IXTA 2VAAB 4Z76A 5EU6E 5C0AD 1F3DJ 1M6OB 1Q9WB 5BVJB 3SBWA 4X5WA 4Z7VE 5DD3H 3EYOB 1G84A 2BXZA 4M9PA 3O45B 1RU9L 1QSEA 4NN7B 3VMOA 5L2JB 1NC4B 4DGVH 1MCNA 3FQWB 1IAII 4O02L 3RVTD 4FFYL 1OGTB 3EDDA 5J4MA 1CXLA 5EUOB 1E0OB 2W92A 1WWAX 4F3FB 3SE4A 1NAMB 4F7MA 1WWWX 3NCEB 5JW3L 5F1IB 5I75C 4L9LC 3MRLA 3V6FA 3TT1H 4LARH 5CGMA 1ZVHA 2FX8H 4EVNB 3UDWA 4KKCD 2NNAA 5FA4A 3UTQB 3QRGH 3VXMB 4WI7A 5KVGH 2XI9A 1OAZH 2E3VA 1JZ8A 5HI5C 4JPWL 3FO0L 4JM4L 2VQ1A 3X11B 4U1HB 1G9NH 1XR8A 4RAUA 3OJMB 4ZD3H 2FSEB 3MRHA 3E6HB 3QH3A 4ZQKB 2WLZA 4QTIH 5TFSH 1PKQB 3G5XB 4RGNE 5J7CC 2VLMD 2NY4D 4OQTH 4X4YA 2IAMA 3KPNB 1FNGB 3X17A 4E41D 2CDGB 3P9MB 4Y19E 4NYLA 4Y4HA 4UV4H 4Y89A 1AC0A 3VGAB 3QNZA 1FYTE 1NSNL 1QSFA 1CL7I 4NQSA 3W2DL 4YHLL 1RFDL 2AJ3A 1FHGA 1F58H 4X5XB 4BZ1H 3HE7D 5CGYC 2FJGB 5IVXB 4OSUH 3ARGD 2W38A 5J9PA 4MA1B 5TDOB 2X4QB 1HHIA 2OYPA 2J8UB 3SPVA 1MH5B 3QIBD 4TRPL 1DBBL 3ARFB 4KZEL 2DM4A 3OKMB 1A4KA 1ACYL 3MR9A 2JB5H 4FS0A 4NKOB 5I1AA 2WUBH 4RMSA 1MCWM 1Y6NR 5IB4B 3G6DL 4U1KA 1U3YA 3WO3B 4P23B 3V5DB 1QFHA 1LE9B 1RVFL 1QSVA 5TE4L 1G7QB 5ANMA 3UYPA 5HHXL 3H3PH 3ZTJH 5CBAA 3QDGD 3U0TA 3KPPA 5MEOB 1A7NL 5A16A 2CR6A 5IHLB 1D5ZA 3W5MA 3TV3L 4P2YA 2XWTB 2BVYA 1G0DA 3MACH 3RZCB 1OOAA 1P9MC 2LV4A 2RGSA 4Y4FB 3DRTB 4OCMC 3MPCA 5KW9H 3QXDB 1XGPB 4NWTL 3ARDA 2LTQB 4GKSB 2Y06H 1VFMA 4RBPK 1MLCA 5EUOE 2DQUH 1SHMA 2R4RH 2LABA 3OKOA 4Q9BA 2UWEF 3QIUB 3BW9A 4M9OA 2AK1H 5EO1B 5SWQA 4RFNB 3F62A 4DAGL 3NIFF 1MCOL 3IJYA 5I1IL 5IMOA 1S5HA 5KVDL 4LCWB 3OKDA 1ZMYA 3CK0L 4OD2A 5GGTH 3VXME 4GRWE 2CGRH 4NZRL 2YD9A 4WCYL 3C2AH 4X80L 2ESVA 3MLRH 2F53A 2J1KA 1RZ7H 4AIOA 1M71A 2NMSA 1QRNA 3S35H 3QXUA 1PKQE 1G9EA 3RA7H 1RUQH 5I1HH 4WNQA 1N8ZA 2ZG1A 4AEIH 4QRSB 3HC0B 3IDXH 5F8QC 4KUCF 4ONHA 2FR4B 1U91B 5JDSA 3ZO0A 4I0KA 1DBKH 2GSIB 2MWCA 5FYJE 1CFQA 1FVDB 3BP6A 4BH8B 5C92A 1AHWC 1SBSL 5IVXE 3T77B 1E27B 3UTSB 1IL1A 1RZKC 4D0CA 1T04A 3G6JA 1FNFA 3IFLL 5LBSH 4JFOA 1CIUA 3ZKXB 2ITDB 1JZ6A 3S5LB 1HH9B 4UIMB 5E00B 4LF3B 3LS5L 3ZSTA 4FHBD 1TENA 5IMKB 3G08A 2FIKA 3KPSA 2NY1D 5IFJB 5DFTA 4WUKL 1JGEA 3S5LG 2EDWA 5HGHB 3NCYS 5CSZB 3TBTA 3ESUF 2HFGH 4WHYH 4YWGL 1U3HA 4MA7L 4OLUL 4JDTH 4YHKH 5EU6A 3EFFB 1D6EA 4AH2B 1ZHLB 4JY4B 4Z7VA 3VW3H 4XCCL 4Y1AD 3OHXB 3TVMA 4M1CC 3TPUB 2R9HD 4JO3L 4MJ4A 3QUMH 4U3XA 1OP3H 1S7SB 1QLRB 2NLJA 5IHUL 4TSCL 1FYHB 3QEUB 1C12B 3QUZB 1SEQL 3MA7B 3DVGA 2R56H 4FQLL 1JNJA 1BIIB 1CGXA 1AKJD 1QRKA 4U6XB 1R24B 5KVEL 1A6ZA 4KDTA 4NT6B 3OR6B 5FF6A 1JCKA 4OLVL 4LCWE 5DQJA 3V9FA 4NC0B 2UUDK 4ZUSA 5IG7A 3BKYL 2NW2B 3FFCD 3SDXF 4LMQE 4FOMA 1IGMH 3P30L 2FL5B 5FOJA 8FABA 1UWGL 4C59B 3IU3A 4F7TA 1WLHA 1LILA 3BOVA 4PGDA 4OFVA 1AGCB 4NQCD 1X5JA 4MVBD 5B39A 5ALCL 1OWRM 1I7RB 2BVUA 3M1BA 1NBVH 4CMHC 3IB4A 2XZQH 4P9HH 1ZLVK 3EDKA 5AWNH 2QSCL 4YIQB 3WFBL 4NO0B 1CDBA 3PP4L 4X8JA 4Q58C 4Y19A 4HFWB 5CEZD 4OT1H 1HSAB 4IS6B 2J8HA 4LRNH 2ICCA 4YR6B 1YQ2A 5CJBA 1T20A 1WBZB 5DJ2A 1GPOH 4XNXL 4K3EH 3NN8B 3UTSE 1V3LA 1PYWA 3GKWH 2IADA 1YPZA 5J3HD 1LO0L 5HYJA 2JJTC 3TN0B 2I9LA 2VLKB 4YZFE 4KI5E 5HVGB 1KC5H 1XIWA 2DD8L 2DTSA 2DMCA 1AXTH 1B9ZA 1OT1A 2VDPL 2ARJA 3S9DB 3QQ3A 1NEZB 3D3VD 3GJEB 2QHRL 3HI6L 1A14L 5T1KD 3VDBA 1U8LB 3FB7B 4PRHB 4I18B 2MKLC 2LU7A 4UQ2A 1U92B 3TA3A 2E8YA 2X4TA 3F7YB 3PABB 2DQHL 4OBRA 4P4KB 4ZFOL 3OL2A 1M6OA 2XZCH 5ICXA 5GJTH 1FL3B 2FGWL 3EYOA 3O45A 5I6XC 3W11D 1WFTA 4MLIA 4TVPE 4YHML 2RCSL 2GITA 3CDGB 1YY8B 5EUOA 1U8HB 2ZOLB 3KYNB 1JHLL 3B9AA 3BPNC 3W39A 1NAMA 3E6FA 1C5DB 1OARL 5F1IA 3C08H 3D85D 3O6ML 1OM3H 2R0ZL 4Z8FH 5JMRA 4M93B 4O2CB 1FPTL 3DTXB 5EU4A 4N0YH 3VXMA 3I9GL 5CD5C 1CD1A 4JVUA 3X11A 4U1HA 5IESL 1J1XL 3E6HA 4TUJB 4ZQKA 1NC2B 3O3DA 3RFZC 2FX9H 4UV7H 4O58L 1KTDB 1M7IB 4LPUA 5TDPB 2ADIB 3FB6A 1Q8MA 5E7FA 4XMKH 5I1CL 1PEZA 2A38A 4OZ4B 1FNGA 2GSGA 1UKSA 4FXGB 5HI5D 3T1FB 4JM2F 5HYIA 3U82B 3HNTH 2CDGA 1KJMB 2Z31B 3DVFA 1KNOA 1K3IA 2AQ2A 2DJSA 2OZ4L 1HHJB 3CAFA 4PV9B 4WI2A 3T2OA 2CJUL 1ADQA 4WV1C 4CJ0A 5IB1B 5TDOA 2X4QA 4UOJA 2NY0B 4OCXL 3T0EA 3GJFH 4X83A 1MH5A 1NFDF 3PF2A 4PJXF 2VLKE 4ZUWA 3N9GH 2UYLA 4I0PC 3DETC 5CGYD 3MXWL 4H0HB 5IB4A 4PTUA 3LD8C 4W6YB 5CEZL 4V1DB 5E6IB 3NABL 1CDIA 2PKDA 3CX2A 4P23A 3V5DA 3O9WB 3IXAA 4PRHE 4FQJL 4XP9L 2BNQA 4LCIH 35C8H 4I3GA 4M4PA 5I0ZA 4NJAH 5IIEB 2VDKH 3T0WA 1RZJH 3ZDXE 3OKYA 1WBXA 4PRNB 3E8UH 1QBML 4LCUB 4QRPA 4U7KA 1KTKE 1NBZB 3MXVH 3QXDA 1T0NA 2VZ3A 2A77L 2GUOA 2OJZH 4WY7L 1ZA6B 1BHGA 5EO1A 5A3IC 4TPRH 4S2SB 4LSVL 3V95A 5GGVY 3U7WH 2O5XL 1F3JA 4PJ8A 1N26A 2D03H 3GMNA 3WMSA 4NWUH 3ZKQD 4NSKA 2PW2B 3EJYD 4XBEL 3WN5B 1F2QA 4KRMB 5I9QC 1I85A 2Z9TA 1VGEH 4MAUL 4N90E 4JDVB 2EC8A 3TH4T 1R3LB 5TPWL 2L4OA 4QXTB 5D1ZA 2HYMA 4JEGB 5I15H 3VRLE 4HK0B 3VXPB 1R5IA 2PYED 1LO3H 4AL8L 5DD0H 1WZMA 4HD9A 1UXSA 1U93B 4RMRA 1RY7B 2VZ1A 4NFDA 4HWBA 3KDMB 1XCTA 2XT1B 3JWNC 1ZGLA 3ZE0E 3WE6A 1S7TB 4PRPD 1KEMH 4IMLA 3SQOL 3X14B 1EH9A 3F7VA 4P48A 1GHFH 1FVDA 1RHHB 4LHQB 4BH8A 2W91A 3SDAC 2MFNA 3CVHA 3T77A 1E27A 3UTSA 3CFCL 2YD3A 4RRPG 4KRPC 2DIJA 2XQYG 2XRAH 1NMBL 5IFAH 2YA0A 1RIHH 1JPGB 3S5LA 4JFDD 1HH9A 4QYOB 3UPAA 4UIMA 5E00A 4LF3A 3EYSH 5FDYA 2XTJB 5IMKA 4OKDA 5BXFA 5E70A 3BZDA 4IJ3B 2VXSH 3PWPA 4MNHB 1U8PA 1BWWA 2G75B 2P46B 4V1DE 5KZCD 2QQNL 4Z6AT 3O2DA 3AB0B 2ILLA 2EH8H 2R2EA 5JOEA 1BGXL 3OJVC 5F1NA 5C7XH 3C09C 4K3JH 2RR3A 4YDIL 4Z7QE 2EDYA 1T2JA 3EFFA 4AH2A 4JRXD 3GO1H 4HKZB 1P4BL 4NO5A 1ZHLA 3GHBH 2J7LA 3HUJF 1YEJH 4JY5L 4Z0XB 2NZIA 3TPUA 2W0FA 1A22B 3SN6N 4UDUB 1S9KC 4W4NA 1QLRA 1J0JA 4L3EA 4PJBA 2AK4B 3QXWA 5B3JF 4XB8A 3KPMA 3ULVH 4HEPG 3QUZA 3S36H 4KVCL 2F5BH 4FXKB 3LRHA 4P2QB 3CVIH 1BIIA 4EDWH 3LVEA 3LS4L 4B41A 2EDBA 3JV4B 1R24A 5CUSL 4M1CD 4JZOA 1RZIA 1V5JA 3SKMA 1JF6A 4IIQB 5GJSH 3OR6A 1EBPA 4U31A 3MRBA 3WD5H 4HXBL 4NDMB 2ADFL 1OAUH 4UOW0 2FL5A 5I71C 4PLJC 1AGCA 5HTSA 1J8HB 1A3RL 1HNFA 5DLML 1SJXA 4U1LB 1CLOH 4WUUD 1MCSA 3D1MC 4DTGL 3MZGB 1G1CA 4LQFH 1FV1B 4G6JH 1CVRA 4YIQA 1QFOA 4HAGA 4XC3L 3BGFC 4ZDHB 5K9JH 3LMJL 4HFWA 4GOSA 1FLRL 1QBBA 2DL2A 4M43H 2VRAA 2FRGP 2KPNA 1H0DB 3EHBC 4YR6A 3BPCB 3SOBH 4PJIA 4YBLB 1WBZA 4P3CL 3QNYA 1VGKB 3ZHLA 3GIZH 4POZC 2EDEA 2HG5B 3NN8A 5JOFB 2LAGB 3MTRA 4Y4KB 1RULL 1HYRC 1NGWA 1OPGH 2A9NH 4UINL 4F57L 4M5ZL 4JZJA 4QOKA 2VLKA 1YQVL 2XTJE 2Y7QB 3EOYG 1AFVH 1J05B 1JGUH 2XZZA 5MHSD 5HHOB 2D4DA 2P47B 5D96B 2FEEL 2X9XA 2AXGB 3GJEA 3MLVL 2OTUB 1F6FB 2QR0A 5CD3B 3FB7A 2J6EL 4QRUB 3MV8B 4PRHA 4X6DB 5B8CB 2UV3A 5DWUL 1T2XA 3F7YA 3PABA 3EO9H 5DD1L 2OK0L 1MIMH 3O4LB 2WBJC 4PV8B 1U2HA 1V7ML 1PY4A 1FL3A 4JQVA 4ZTPL 4B0MM 2VLJA 4JN1H 4MD0B 2JELL 3CDGA 3OB8A 4XAKD 2AK4E 1YY8A 4YDKL 1U8HA 2ZOLA 3RHWK 3PWNB 5LCVL 1RZKL 2HA1A 4KAQH 2DLFL 4P2QE 1QR1B 3INUH 1HXYA 1F8TL 4MJ5B 3BIAX 3DTXA 1DSFH 1FSKC 2BDNL 3RL1B 4J1UA 1MHCB 2AJYL 1YEKL 3QFDB 1I9JL 1WZ1H 1D5XA 1UH4A 5HHQB 4UQ3A 1NC2A 1J8HE 4XI5C 4PRIB 2VDML 3PWUB 4DQOL 12E8L 1M7IA 5TDPA 4CKVX 3HE6A 2ADIA 4GUPB 1BVLB 4L4TA 4LLWA 1DBMH 4OZ4A 4CBPA 2FD6L 4K2UL 4FXGA 5C9KA 3T1FA 3DPBA 5CD5D 2AABL 2XWBB 5FM5M 2Z31A 1ZVYA 4KH2A 1RD6A 2HFFA 5BV7H 1B3JA 2VXQL 1HHJA 5F7LB 1JRHL 1ED3B 2NX5D 4EQ3A 1D5MB 1A9BA 3JV0A 4XX1E 1IILE 4X9IA 4PD4K 1VPOH 5GGRY 4JANB 1KTLB 5T33H 1U8OB 2VDLH 5D6CA 1IEHA 1J1OL 3J7HA 2N4IA 1ES0B 4XP6L 1F6AB 5HHOE 4OF0A 2I5YH 4V1DA 5E6IA 2EDFA 5EA0L 2Z8RA 4M6NL 3O9WA 1PQZB 3MV8E 4X6DE 1DQMH 3QBTB 4ZS7L 5TQ2L 4NGHL 3BT2H 3VG9C 5IIEA 4F7PA 1MHPH 3VG0L 1HNGA 3O4LE 4I0PD 4YK4C 3DETD 4G6FB 4YDLC 5IBLC 1HHGB 3VXTB 2DBLH 3TH2T 3L3KA 3HI5H 5F6HI 2J12B 1OAKL 5ILTL 1EO7A 1NBZA 2NY5C 5T3ZD 3BZEA 4JQIL 1IC5L 1T1WA 3IDMB 3I02A 3UC0H 5I19L 3P2TA 1QNZL 1ZA3B 5FYKU 1ZA6A 5EFIB 4AY0A 1HWHB 1JGDB 5IV2A 4OCYH 1JMZA 5LGJA 1TJHL 5HD8C 3TH3T 5JUEH 1NGXB 3CFEB 4HBCL 5SV4A 1I1FB 2H32A 3B6SB 4HCRL 4PG2C 3V5KB 1YJDH 3PXHA 1K5NA 4OGAC 2D9QB 3QAZC 5KSAC 3KR3L 3DIFB 3WN5A 5ESQB 3QWOB 5KAQF 1VFBB 1IT9L 5I74B 1RAMA 1NCWL 4RFEA 5A3ID 4JDVA 1R3LA 4LPCA 3SHSA 2ZG2A 2Y36L 4J3WA 3MLYL 4PRIE 5LWYH 4ZUVB 4IMKA 4KDTC 3WKNA 3WFCH 2GAZA 2AJSH 5D7JC 4MAYB 2CDEB 4LIQL 2UZIH 3C87A 3MRQB 3BP5A 1KCKA 2AKRA 3KDMA 4QTHB 4R97C 4D9RD 1FE8L 1S7TA 4WW2F 2XXMB 4RRPA 5I0DA 4HFUH 1S5IL 5DD6A 1HK6A 2FX7H 4HS8L 1EJOH 1QKZH 1UWEL 5ACZB 1G7HB 2FEDC 5EIIB 3OKLB 2HN7A 3DYPA 5F3BB 1KXVC 3TO4A 1JNLL 1V7NH 3FT4B 1FORH 1I7UB 3O41B 1JPGA 1UB5B 3KLDA 5F7WC 2XKNB 3HAEB 5DYOB 4OZIB 1A0QL 3SDAD 2NY7L 2HTKC 1F2XK 2F5AH 2G75A 1BOGA 3PHQB 2WW8A 4KRPD 3I84A 2GJJA 2GHWB 2IPTL 5I1GH 1N5YH 1H15B 3CSYB 3HAEG 1TJIH 4EI5B 3S8WA 4IRSC 1H9VA 1T7XA 3OR7B 1CDJA 4HKJB 4Z0XA 5B38B 4L3CB 2VDNL 3CLEH 2GFBB 5TQ0L 2R0LH 2KZWA 1FNEA 4JGUA 2F54B 3AGVA 5IF0A 2NY6C 2AK4A 1I7TB 3H42H 4RBPH 4EN3D 3U30B 5B38G 4QHNB 4FXKA 3RY6C 2P5WD 4S1QL 1X4YA 4P2QA 2CUHA 5H2BA 3MJ7B 3HPJB 2FJHB 2APWA 3A6CL 2BXYA 2A1WH 1LDSA 1BQLL 4NN7C 3CC5A 1QHOA 4JHWL 1T0MB 2R15A 2F8XC 2CUMA 1TCRB 4OFPA 2A74B 1MOEA 4LSUH 1VACB 3NPZB 4FQQB 4L8DB 5DUBA 5T3ZL 1QTYT 3NTCH 1KPRA 3DLQR 3ETBF 3MRDB 2FECL 1N4XL 4L8BB 4Z7NE 1FV1A 1VSCA 1DQLH 5DJ0A 5IWLA 3IFPA 2LAAA 4JPWH 1MAMH 2XYCA 4PLJD 4XMLL 1MLBB 3QEHA 3CMOH 5JXEA 3DVIA 5ID0B 2K1MA 1Y6MR 1KB9K 2D7TL 1P53A 1I8MB 1B0RA 6CGTA 2MCPL 3AVEA 4DKEL 2DWEB 2CKBL 1GGBH 3CFJB 3U2SA 2HG5A 2DMKA 1ZE3C 2CLVB 3FN9A 3HNVL 3DUHA 4P46B 4RZCB 1ZT1B 1X7QA 3D48R 3D39B 4ODBD 4YUEL 3TBYB 3EHBD 5DJ8B 3VGAC 4FQ2L 3T0XA 1OTSD 2AQ3A 1J05A 4OZIE 1HEZB 5SWSD 5FB8A 2NTSP 1TLKA 5ISZB 4POZD 3WLBB 1IGJB 3MV7D 3GSNH 4Q74A 3FJTA 4MA1C 3SQBA 5CD3A 5B8CA 4NUGH 4NM4L 3IFNL 1OAXH 5GRJH 5E99H 3ARFC 3QNXB 3DOSA 4PBVC 2EEBA 3MYJB 4HV8B 1XF2A 4L1HA 4PP2A 2AXFB 3DI2B 3AREC 2HH0H 4WTXA 4P23C 3V5HB 1DVFB 4G43B 2F54E 4ZFGL 1DUYB 4JGJA 1YN6B 15C8H 5KOVC 4P2RA 5D7IB 1NANH 1KN2L 4U6HB 2WBJD 3MV9D 3WIIH 3STZA 1HKFA 1QR1A 3MBEA 3RZCC 3KYAA 4CNIB 1IQWH 4Y4FC 3LOWA 4JFFD 4MJ5A 2A0LC 1WCQA 2GJ6D 2IG2H 2LTQC 3DV4B 1E4WH 3FO9B 2UUDH 4OI7A 2Q86B 4PGEA 5DMJB 1UH2A 1SY6L 3C5ZD 3IAQA 3QIUC 3QFDA 4JKKA 1FGVH 4QHLB 4RFNC 4X7SL 2V9RA 4DAGH 4PRIA 4M00A 3ZT7A 3CXDH 5IEHB 3P3YA 2MMXA 1P4IL 1GZQB 4GSDH 1KLFA 3C6LB 5C08A 1ZLVH 3ULVE 2XWBA 4UDTB 3TZVD 1XZ0B 3P0YL 4PRDB 4GS7B 1G9MH 1FGNH 2P5EB 3IETB 4D9LL 1ED3A 3WHE0 5DUPH 3TWCH 5I1LB 1DLFH 1YEHL 4YPGB 2UZYB 1RIVH 3G6JF 4JANA 3KHQA 3RNQB 3MSPA 4ETQB 4K3DL 4I9WE 3GBLA 4G8GD 4NPYB 1U8OA 3SO3B 2FGZA 4PRBB 3D39E 2ZPKH 1FNSL 2ZNWA 1AR2A 5BO1L 3EZ8A 4NZUL 4OB5L 5T1LB 4K7PH 3SDCA 4QKXB 4FQPA 4M3KB 4MXQC 5C0JB 2Q20A 4LLQB 5ALBL 5IMMB 1PQZA 3Q5OA 4HC1H 5IB3B 2DS4A 3IFLH 3B5GA 3ZKXC 2D7PA 4N1HB 5BV7B 3QP3A 3RKDC 2DQTL 1Z2KA 4Z7VF 3GMPB 4MQ7B 2WSKA 3C8HA 3P4MB 4KI5C 3U46B 5ICZA 3WFDL 5A2FA 3RWDA 1HHGA 3RIFF 5DMYA 3PJSB 4F37K 4XPBL 3VI4E 2IGFH 3IDMA 4G9DA 5D7SH 1J1PH 5E1AB 3K2MC 4DFIA 1A1NA 4D9QD 1QYGL 4KZDH 1YEIH 5CP3H 5D7IE 5EFIA 3EYUH 3G04A 1JGDA 1OAYL 5JW4M 3V8CA 2FNBA 2IH1A 4RSVA 1NGPL 4BZ2H 4BQ8A 5IVOA 3CFEA 3TF7C 5HVWA 1I1FA 3B6SA 3OJ2C 4NQTA 2CD0A 3V5KA 3HCVA 2ADGB 2V7HA 4BSJA 2EDNA 4YNYB 2JIXD 3QUZC 2H2SC 5ESQA 3QWOA 1YNLL 1P4LB 2W0LA 4Z9KB 1CFNB 4LSTL 3SE9L 5HD8D 2OBGA 1M7XA 5KJRL 4U49A 4ZUVA 4LDEB 1EUUA 2W9EL 4OGAD 4KQ4L 5FGBA 5KSAD 1CGSL 2IJ0C 3L3DB 4MAYA 3C8DA 5MI0B 3BKYH 3LRSB 1BVKB 4K94H 5IM7A 4PJ7B 3KWWB 4I13B 3PV7A 4QTHA 1I1AB 5IK3B 4EXPX 2ZZUT 3NH7H 4I3RL 2P5EE 1FBIL 1K3ZA 2P24B 3EO1B 1JRHI 3ZDYE 5ACZA 1G7HA 3F5WA 5D7JD 3OKLA 2DYPA 5F3BA 2YRLA 5I1JH 1YPZF 2ZUTA 4KJWC 5GS0C 2BHYA 3DX6A 3LPGA 4HH9A 3U4BL 4L5FH 5FHAH 3WDIA 3PP4H 5F7YC 1T5WA 3X13A 4HMCA 1UH3A 4RISH 4LVHB 1NJ9B 1JPTL 4JLRB 3N1GC 2XKNA 3HAEA 1X5HA 3MV11 2VDRH 5DYOA 4FFZH 2AVGA 1B6UA 3EOBA 4PJFE 2X1XR 4J3OC 2HRPL 3Q6FB 4KTEL 4EIGB 4IHOB 3Q1SL 4LKXA 2DWDB 1H15A 3CSYA 1F4XL 3ROOA 4X7DC 4EI5A 1H3WM 4G3YH 4F9PC 4OF3A 2CRMA 3TN0C 1FYTD 2P4AB 2W9DH 5KS9A 3QI9B 5KBNC 1S8DA 2HTKD 3MUGB 1WSST 1EZVX 4YEFA 5IFHL 2WQ8A 2QHRH 1JNNL 1A14H 4HXAH 3CLFL 1NCAH 5EUOF 1K2DB 1QLFB 2F54A 4I18C 3LQMA 4P5TA 4WI4A 1DQDL 2A6IB 3LKSA 4M02A 4IRSD 4QHNA 4RMVA 4HBQA 4P4KC 1BFOB 3RBGA 5HHPA 4R4FH 5I76B 1JTOA 2YA1A 5DMKB 3HPJA 3U36A 1TETL 1KJ2H 1XT5A 2AJVL 2B0SL 2XY2A 4JFYB 4YHMH 1AGFA 2NY6D 4GRWF 1T0MA 4JFED 1FO0L 4FMKA 4M1DL 1EEYA 1AIFB 4OGYL 1RI8A 1W72L 4JFHD 4KGJA 2DMBA 1TCRA 4F7CA 1VACA 4N1CA 4OM1L 1IM9B 5DRWB 4WFHE 3WHE1 1PSKL 4YHZL 1U8KB 1BJ1J 3BWUC 1JHKL 5C0IB 3MRDA 3EW3B 1NC4D 5F7EL 1UJTA 3PQYD 1FQ9C 1YEFH 4HS6B 2HVJA 1XH3B 3W82A 4PJ7E 1MLBA 5I8EB 4K3GA 1DL7L 4W4OC 1XF4B 1EGJA 1K4DA 5GGSA 3AXLB 4N8CL 1I8MA 2V17L 3CX5J 3WXVH 4B53A 2FZ3B 4U6YB 3MLTA 2CDFA 4QXUL 2J4WH 5EU7E 1FG9C 4I5BB 3IVKB 2GTZA 1MRDL 1QVOB 4CVZA 3VXMD 1HN1A 3FO2B 4O9HL 1R3IL 1IGFH 1GIGH 2VMFA 3D39A 4NOBA 1UVQB 1FC1A 4R0LA 2XA3A 4UT9H 3WNPA 5JLZB 2ORBL 1URLA 2ERJB 4KMLB 5IKCB 3GB7B 3X3FL 2XY1A 4LP4A 2M26A 1D5IL 1Q0XH 4M62L 3HG1B 4X9FA 5CIPA 3DUSB 2IMNA 1LNUB 1KB5L 4XPHL 2NY0C 4POUB 4RMQA 3C6SA 5DT1H 4L8CB 3PGDA 1G9NC 5DHYB 1YEGL 1A5FH 3QG7L 1KBGH 2YSSA 3MRIA 5HHVH 4HV8A 2AXFA 3VJ6A 4PD4J 1NCBH 2W65B 5CEZH 3MRRA 3TJEH 3E2HB 1K9TA 1MQKL 5IBUG 3TYFB 3NCYP 3V5HA 3O9WC 3LAFA 4G43A 1YN6A 2DM2A 3QCTH 5BS0B 2Q6WB 1Z0NA 1J5OL 2HT2C 1K6QH 3ARFD 5D7IA 4G42B 4O00A 3VXUD 3BXNB 4NN5B 5F44A 3ARED 1A1OB 3DURB 6FABH 1FFRA 1TZHB 2R39A 4ZS6D 1MHHB 3EYQD 3GSNB 4NKQB 4P23D 5F97E 2X4RB 4NQVB 3BDBA 2A77H 3VRJB 4M6ML 2Q86A 4LSRH 1A6VL 1FRGL 1OGAB 3X12B 2ICWI 1YMMA 4QHLA 3WIHL 3RZCD 4CU7A 4Y4FD 3WV0A 4GKNB 5DHXB 4OFDA 5E94B 4HMEA 1GZQA 4GXVL 2FECI 5ELIA 1UYWL 3HC4L 4MXVF 4OCSH 1EIBA 4PRDA 3WN5C 3I50H 3QIUD 3KYKH 3U1SH 1FJ1B 5T3XL 4Z5RB 3R06B 4RMUA 4ODSH 4H8WH 3MRFB 5HHNB 4QGTA 4YPGA 4NRYA 2G2RB 4LCWD 1BP3B 4G6ML 3RNQA 4NNXA 1U95A 4ETQA 3ZHDA 4NPYA 2P45B 1OT2A 4CDGC 2DIBA 1I8KB 4PRBA 4PLNC 1KLGA 4XNMB 5JZ7C 1DCLA 3OAUH 1WWBX 4KI5F 4MQXC 4V2BA 3OAZK 5T1LA 1XGRB 4LNVA 4JN2A 3DHMA 5A2LH 5DJ6A 4CAGA 1EFXD 2ZJSL 2IWGA 1PW3A 4PJFA 5HDQH 2FBJL 3KJ6L 1BAFH 4LLQA 1AR1C 5IMMA 2COQA 3T8XB 3LKNA 2ZSVB 4R96B 1T3FB 3RDTB 3RIFK 4HK3J 5HPMB 5D70L 2HMIC 4LSQH 3U46A 4CN6A 2XTJC 5D7LD 4HWEH 4NCC1 1MCDA 2AGJL 1BWMA 4MXQD 1PFCA 3UTSD 4FZ8H 1W2KT 4PJBF 2EE3A 3AB0C 1BJ1H 4NNYA 1AI1H 1TTFA 2YKLL 4ZNCD 2GJZA 1QA9A 4JFZL 2PR4L 4R3SA 3RKDD 1EAJA 1A6AB 1A3LL 4KI5D 4H1LH 4OCNC 5D5MB 3MJ9L 3L95A 3C9NA 3LH2L 5IB2A 3PWJA 3RVUC 1C5CH 1R0AL 4PLKD 2C3HA 4AQ1B 2UZXB 5EIQA 3UCRA 3WFHA 4AEHH 1OGAE 5C09B 2C1OB 1N7ML 3KYOB 5CP7A 5GS1A 2F8OA 4NBXB 1YECL 4H20H 3P11L 4IIQC 4TVPD 4S10A 2DLGA 3QUZD 1BVKA 2H2SD 3QQNA 1FZKA 1IGCH 4PJ7A 3KWWA 1T7VA 2R0KL 4N0UE 1YYML 4PJIF 1YDPB 3O2WL 2P8LB 3MCKB 4OKVB 3HN3A 3Q5YA 4XNYL 3WKML 1MUJA 4GQ9H 1C1EH 1HCVA 1FL5B 1EZVY 2ZG3A 1W0VB 4GKZA 1N2RB 2P44B 1MWAH 3O11B 1V8HA 3QHFH 2VAJA 3G5VA 4RGOL 5ID1B 2WP3O 5EBWA 1U41A 3OJDB 4ONOA 1NJ9A 4JLRA 4P3WA 1SEBB 4JHAH 4GMSL 1CICA 1QUNA 2BNUB 5LGKA 4YX2H 1M4KA 3ARBA 3DX8B 5BVPL 3V0WL 4XNQA 4KJWD 3VFOB 2AV7A 1RULH 4Y4KC 4NO0D 4OLZL 3BO8B 5AYQA 3K74B 3OXSB 3GMRB 1KB9J 3ISWA 1WCBB 1RZGA 5DJZB 3GRWL 4JREB 1FDLL 4ZTOH 3MUGA 5D96C 3T2NH 5SWZB 3BZFA 3BH9B 4A6YH 5I8KH 3MLXH 5EZOH 1CYGA 5GISL 1K2DA 1GC1H 5F7NC 1P6FA 5DFWH 4PJ9B 3J8F7 3TN0D 1EBAA 3LRGA 1JPSL 1MFBL 1PLGH 1U36A 5D5ME 1B0GA 1U8QB 3MLUL 4MJIB 3BJ91 3UO1L 3MMEB 1NKOA 2YUXA 3DROA 4JZNB 4ONGH 1I3VA 1U8IB 4PRHD 2X89D 4YDKH 4HJGA 3SCMD 4LHUA 3FMGH 4P4KD 2BHZA 4JHZA 4NHUB 3VRLF 4ODXB 5C09E 1U6AL 2EXYC 1FG2A 1KF9B 2VISB 3RWFB 4Q9QH 2E27H 1U8KA 4C4KT 3V4PH 3VFVB 2ITCB 3ES6A 4N9OB 1F4WL 3KLAB 2UWEB 1DQQB 4HQQL 1Y6KR 4HS6A 2C7UB 1XH3A 3ZE0F 4KJYB 1DDHA 5C3LD 1N5AB 5F7FA 4TVSa 2RJMA 5I8EA 1JN6B 5HGGS 2AJYH 4AG4H 1XF4A 3AXLA 4U1SA 4H26A 2YK1H 4XC1H 4APQB 3HS0A 2ZCKH 5GGSY 1Y18B 12E8H 1XGTB 4GQPH 3H0TA 1QVOA 2XFXB 3KXFA 4YO0B 2VZTA 1G7PA 1NLBH 2LFGA 4DKFH 3K3QA 2MNUA 3RY5A 4BFGA 3OG6B 4MGXA 4TVPL 4N90D 2WM0A 4JG0H 2GCYA 1EEZB 5ITFA 4QF1B 1AQKH 5A2IH 1DQTA 1OAQL 1BQSA 1YUHB 5IKCA 3WNLA 3GB7A 3UTPE 2WUCH 3GI9L 3BN9C 4GAJL 5MENB 1A7PH 5EOQL 1LNUA 3GMLA 2BVOB 5AYUL 1FNHA 2B2XL 3RPKA 1J1OH 1ORSB 5IJVA 2DKSA 5DHYA 4UI2A 1RZFL 4PJEA 2KL6A 4JO2H 1QO3B 3D9AH 2YR3A 3BDYH 3MJ8B 5DURB 4QXGL 3I2CH 5SWZE 5CSGA 3C5JB 4XCEB 3D25B 1GVIA 4M6NH 5DHVH 1Z3GL 3QDJD 2YMXH 3GI8L 2VR9A 3ZSSA 2Q6WA 4R7DA 2BSED 3BZ4A 4ZMAT 3BXNA 2YD1A 4OF6A 1INEL 1CWVA 1XF5B 4MJIE 1A1OA 2V2TB 2WZPD 4J3XA 1MHHA 4RWYL 1OAKH 4G8EB 2DQJH 5EO0B 3A67H 5CCKL 3PIQB 1WK0A 4ZNEE 3QRFM 4KVNL 5DD5H 5JW4R 2B4CH 5I19H 4B7IA 3QZWB 4WI5A 3VRJA 2HT2D 5GIRA 4NCDA 1ZANL 4HKXB 1ACZA 2GIYA 4FFWD 1I9EA 1AGDB 1UA6H 3PWLA 1MNUH 3NA9H 4JJ5B 4R26L 3QZWG 5JR1H 3QQ4B 4GKNA 4HBCH 2X4PB 4P9MH 5E94A 3S37H 2UWEE 4HLJA 5C0GA 3ZT6A 4DUWA 3F58L 1FFOA 2ZWLT 5EU5A 4PS4L 3NIFE 1RZJC 4N0UA 5CJQL 4I8DA 2BJMH 5FO9A 5I74C 1NCWH 1Z9LA 1OB1A 5EO9A 3O2VH 3JTSA 4Z5RA 2VWEC 4Y5YA 3SGDH 3H3KA 1UT9A 3MC0A 3JBG7 3MRFA 4LSSL 1TNNA 5EU3B 5HHNA 3UXFA 5CJ8A 4JVWA 1PX4A 2G2RA 2P48B 4NKDB 3Q48A 4KC3B 3MOBH 4G7VH 1DUZB 3T08A 4KPHL 4YH6A 4UT7H 5BOPA 1GAFL 2A6JB 1H3VA 2VABB 4LLVB 1S5IH 3MLWL 3LSOB 4ZUTA 3SJVB 2A83B 5DJDB 5MENE 1E28B 3MUHL 3SDYH 3T8XA 4ZO7A 4L29A 2ZSVA 5E8NB 4R96A 1CDCA 4YDJB 3TC9A 2YD6A 1KJ3L 5JZ7D 1CZ8H 3GKZA 2J88H 4MQXD 5HPMA 1P7QB 2IQAB 4F15B 4CVWA 1AXSA 3LB6C 5KSVA 1MCLA 1IBGH 2VZUA 2VSCA 1I75A 4F7EB 3VWKA 5KN5B 5JPNB 4OIBA 3VCLB 1AR1D 2PYFA 4RIRB 4MJ6B 5EOCL 5DD3L 3RGVC 2NY3B 1WT5A 3ZKMC 1XR9A 1LO5B 3MROB 4EI5C 2HMID 3WDHA 4DGVL 1JUFA 2XTJD 1KCRH 4IOIA 3KHOA 1AJ7H 1HILB 4HUVA 2CLRB 5IVZB 4JFQB 1MJJA 2VDNH 3L1OH 1EHXA 1UZ6F 2C4XA 4LLAA 4LARL 3LKPB 2FX8L 4ORZC 1LEGB 1OD7A 3QDMA 1U42A 5CEXB 2FATH 3QRGL 5KVGL 3UX9B 2DJUA 1OAZL 2C1OA 5C09A 4LLYA 5INDB 4OQTA 3KGRA 4IOFD 2BY3A 4RX4D 2DM3A 1G9NL 3RVUD 1JF1B 5JPMB 4ZSOA 4ZD3L 4QTIL 1WQVT 4R4BB 5TFSL 1CDHA 3E1F1 3QA3B 4DVRH 5ABDE 4R2GB 2D2OA 4XNUH 1TZIA 5T1MB 2I07B 1YDPA 2GT9B 3MCKA 2FO4B 3D18B 43CAB 1ZSDB 5D2LB 4JB9H 4OLEA 4UV4L 3RWJB 1NDGB 1FVCA 4AENB 1N4XH 3CIQA 3NBNA 2AW2A 1N2RA 3ULVC 1UQSA 1F58L 3O11A 4BZ1L 1IEAB 5ID1A 4OSUL 2P8MB 3FRPG 1RJLB 3OJDA 4NKMB 5KSBE 1J8HD 3O81A 3HHRB 3SJVE 1N6UA 4HUWB 1YC8A 2BNUA 2JB5L 3DX8A 2WUBL 2X4UB 1RMFH 1NGZB 4P46C 3VFOA 4BKLB 4C56B 1BFTA 1G7JA 3FB5A 4MMZC 4TTDC 4JKWA 4YHPA 3OXSA 5JQ6H 2Q7YA 4Z78A 5C6PB 1BD2B 4UT6H 4Y8DC 3F7QA 3H3PL 3NCFB 4DGYH 1CK0L 2ARJQ 4UILL 5SWZA 4C58B 1NFDB 4JVPA 3LN5A 4PJXB 2OL3H 3LIZH 1AD0B 4Y4KD 1MWAB 3UJIH 1GZPA 4ODWA 3UJTH 1H5BB 2XG5A 1E6JH 3IFNH 4XPGH 3L6FA 5KW9L 2EE6A 1HZHH 4IRJD 2Y9RT 1QBLH 2FLBT 5EPMA 2N56A 1JE6A 1LO2H 1VB9A 2Y06L 4EQ2A 5KTEH 1I9IH 4F58H 3VFMA 2DQUL 5HHOD 4YXKH 2AQ1A 3NZHH 4R7NB 2R1XB 2AK1L 1U8IA 2VXTH 1IGYA 3M17A 4ZNEA 3MV8D 1DVFC 4PREB 3U4EB 5F71A 1JWMB 4Y2DC 2OTWB 3QUXC 2OR9H 1F90H 1W8OA 3HZYB 3O4LD 5GGTL 3I75A 4NQDB 2CGRL 3BE1H 4MZ3A 1CS6A 4WRLA 3C2AL 4MA8H 1ZS8A 4WJ5B 2VISA 3MLRL 3RWFA 1K4CB 1RZ7L 2Z8SA 5L88H 3HPLB 2DL9A 3CU7A 4A6YB 3S35L 3KLAA 3BUYB 4YHOH 1DQQA 4GG8B 2C7UA 1N5AA 3RA7L 1RUQL 5I1HL 1JN6A 4AEIL 2H6PA 3ZE1F 2EXYD 3IDXL 2BNRD 3LPFA 3VGBA 5M95B 3CFDA 3OTTA 3MA9L 3O4OC 5D2LE 1DBKL 3P73A 4LFHG 4AMKH 5F9JA 4OCWH 2XA8L 2XFXA 4MSWB 4MD4A 2IH3B 3C6LC 5IW3A 3GSUA 1KT2B 4GS7C 3S35X 5FKAB 1A7OH 1JHTB 1ZLUK 5HHMB 5LBSL 4GW4A 1OHQA 1S7XB 2CMRH 4X5LA 5DTFB 3HMXH 5CAYB 1FNLA 2SEBB 3MGOA 5MENA 4MNQE 3BX7C 2PN5A 2Y07L 4C56E 3SO3C 1M7DA 1WITA 3MRKA 3FHQA 4WWKB 4OIIH 1ORSA 4NZUH 2HFGL 1BD2E 25C8H 3MJ8A 1SVZA 3MREB 3QUMA 3TT3H 4JDTL 4YHKL 3BN9D 2R69H 3CH1B 3T4AB 3B43A 3D25A 4XCEA 5JW5A 3VW3L 1H3XA 2PUQT 1RZ8B 3BGAA 5I2IB 4G5ZH 5C70A 3QUML 5BV7C 3B9KD 1FZOB 2MQ0A 1MEXH 1ERNA 2VE6B 1CD9B 3S34H 1EEQA 1XF5A 1WZKA 4QT5B 2V2TA 5TJWK 3KPQB 2R56L 4URTB 3B3IA 1SYSB 1ZEAH 1A6WH 1BFVH 5EO0A 3SKOB 3PIQA 3QSKB 5DK3A 2E9WA 4Y5XB 1C16B 1E4XH 4XCNA 3DV6B 4F9LC 3ARVA 3HUJB 3QZWA 4HUKB 4HGMA 3B4NA 4UU9B 4ZOEA 1AGDA 2R1YB 4ZODA 5AD0B 5ICYA 4NQDE 2RB8A 4AZ8A 4OFYA 1PG7W 3BIBX 1IGML 2YD8A 1KGCE 4JJ5A 4V2CB 4P2OA 2PO6B 4Z7NF 4PTTA 1F02I 4OZGA 2X4PA 4KKLC 4UTBH 5DHVB 4P57A 2CRZA 1NBVL 4Y0GA 3CXHK 2XZQL 4P9HL 1MI5D 3DBXB 2GTWB 5AWNL 5IHZA 4LSTH 1S7QB 1ZK9A 4N0RA 4OT1L 1NQBA 4NP4H 2FYYB 1NCCL 4MNGB 4WI8A 4WO4C 3OAYK 2GK0B 1DUZA 1CGSH 1GL4B 2VLLA 5MI0C 1GPOL 5DK0B 1L6XA 2O61A 3TBVB 1I1AC 1UM6H 4HMDA 4NC1E 3UZQA 4D0DB 5BW7A 1M05A 2A6JA 2V7NA 5HHME 5KSBA 4LLVA 3GKWL 3ULSB 3ZMRA 3O3EA 1TMCB 4WFEE 3LSOA 3QEGH 2A83A 3G5YA 5EU7C 1OSZA 1E28A 1KC5L 2DQIH 1KIPB 3L3OA 1AXTL 3TFKC 4YDJA 1BX2B 1WV7T 4JAMA 2D3VA 4M7KL 2DLIA 1P7QA 3MNVB 1BFSA 5KS9F 1JV5B 1YYLH 4PR5A 4LVHC 4N8VG 3U7AA 2YHGA 2OTPA 4YFLI 4JRYA 3RL2A 4F7EA 5KN5A 1LO4H 1UGNA 5GGVH 3VCLA 3AUVA 4MJ6A 2XZCL 4HKBB 1FIEA 5GJTL 5K9QI 3A0OA 1LO5A 1YMHA 4GBXD 1R3JB 3UTZB 2ZSWA 1ONQB 3DYOA 4JCLA 3ZKSD 3VDAA 3QI9C 2DI8A 4DOHB 2VKWA 4F2MB 5IVZA 5JOPD 3EIFA 3BISA 3RGVD 4E5XB 3ZKMD 1INQB 3BPOB 3C08L 4MX7B 1OM3L 1MY7A 3LKPA 4EI5D 3HUJE 4JKMA 4Z8FL 3T3PE 1LEGA 5CEXA 4N0YL 3LKQA 5IGXH 5KG9A 2X7LB 2VYRE 1EVUA 1VEMA 3L3HB 1ZGLP 4Q6IA 1TETH 2X70A 4MWFA 4HHAB 5TGBB 3NVQA 4ZPTB 3N1MC 3NFNA 4DK3A 4R4BA 2FX9L 2ATKA 4RCAA 4UV7L 4JQXC 4KU1A 4XMKL 4HGWB 1IARB 5T1MA 4BZYA 2I07A 2FO4A 1X5KA 3HNTL 2YC1A 3DHJA 4P5KB 1VADA 1ZSDA 4X9BA 5D2LA 1OL0A 3VFWB 3FRPA 3OPZH 1EXUA 1BBDH 3RIAF 1NDGA 3RWJA 5L6YH 4MNGE 4YDVB 3Q6GH 3ZZ1A 2QQKH 4OUOA 4Q2ZB 1NDMB 3VXOA 2NY5H 1EK3A 1DL7H 5FM5O 4NKMA 3VD9A 3GDBA 3OAZH 4H5SA 1VKXB 2VL5B 4NO3A 2V17H 3VXNB 3N9GL 4MNQA 3ULVD 1BBJA 1NGZA 1ZV5A 1R3IH 4C56A 3IDIA 4LPXA 4PGZA 5I1DB 4KK5C 3KPRD 2ZCLH 1IEBA 1M1SA 1SJHB 3IKKA 2W1NA 4XP1H 1MCJA 5BZDA 3GSOB 3WUWA 4NJAL 2VDKL 4G6KH 2ERJC 2Z91B 5C07B 1RZJL 2Z92B 1I3UA 3VFPB 5I17B 4I9WD 4P46D 3E8UL 4Z7OE 1KB5H 4GRMA 4TTDD 1OQXA 1BQHG 3D39D 5FYLE 1H5BA 5D7IF 1I1YB 3R4DA 1HI6B 3MXVL 1EHLH 2Y4SA 4PY8J 2BSSB 3T04D 1KIRA 2OJZL 2B7DT 4DOHE 5ISZD 2X1QA 3QFJA 1MQKH 3E2HC 4TPRL 3L5XH 3U7WL 4PREA 3N1FC 5ESVB 3OX8B 3W9DB 4G6AC 2EDQA 3BKMH 3MO1B 1UM4H 2D03L 4ZOAA 3S97C 5HYFA 2E7LA 1Y0LA 2BK8A 1KEGH 1H8OA 3HZYA 3QO1B 4HWZB 2HRLA 3MNWA 4NWUL 4NN5C 2LE9A 3THMH 4D3CH 3QEQD 3CFIC 4WJ5A 4XNZB 32C2A 4H25A 1K4CA 1X4ZA 5J89A 2QQLH 1VGEL 5IVNA 4YC2B 4P99A 3P0VH 1DVFD 1DQJB 4OLWH 1YNTB 5I15L 1MFDH 4Y2DD 4HJJH 1EMTH 3QUXD 1HKLH 3O3UN 5DD0L 1FVEA 1JJUA 2W59A 3O8XB 1P7HL 3WIHH 4WEUD 1LEKB 1PEWA 1OP5K 3CCHB 1IZJA 1MVFA 5DF0A 1KEML 4XZUB 3IAPA 1ZLSH 1GHFL 5HXMA 5JDJA 4PGBA 3FONB 1KT2A 1MHEA 3RPIA 4IOSD 5KAQG 1J88A 4PJFF 5IFAL 1UJ3C 3G5ZA 1S7XA 1RIHL 5DTFA 5JO5A 5JIPA 3IF1B 5J6HA 4FQHB 1MJ8H 1YEDA 3IT8D 2Y5EA 4QWWC 3T1WA 4WW2B 4ZUUB 5EB9A 3C6LD 2VXSL 4NOFA 1P1ZB 1CT8B 1MF2H 3MLSH 4WWKA 2P5ED 4H88H 5E9DD 2EH8L 4NQED 3EYVB 5E8PB 5E8DH 4RNRB 5C7XL 1KCSH 1J0HA 4K3JL 3C60A 3FOLB 5C07E 4DJMA 1S9VA 1NAMH 3GO1L 4UNTA 3K80A 3H2WA 1YEJL 5IW6B 1H3PH 2VITA 1RZ8A 1CXIA 2KDGA 2MTPA 4UAOB 3RDTC 2CLZA 3FT3B 4HDIB 5A1AA 1FZOA 5T1LD 3H9SA 3ULVL 3GFUA 2I25N 3NZ8A 4GRWH 4TUOA 3S36L 3IXTB 2F5BL 4QT5A 5D1XC 4IM8A 5EOTB 1OY3B 3CVIL 4EDWL 3SKOA 4X5WB 2DKMA 1VERA 1QSEB 5GJSL 1R3HA 4RAVB 2XICA 4UU9A 5F3HA 5HBBA 1KG0A 3WD5L 1OAUL 1GGCH 1RPQA 2PO6A 3N85H 5GPRA 1QD0A 5DGRA 2PCPA 5FYJH 1F11A 3VXQA 1HHKB 3S36X 5D2NA 4PJ7F 4U1NA 2DRUA 1WVZA 5E1HB 1CLOL 5J6GB 3LN4B 5HVHB 1ADQH 4LQFL 2VQTA 4G6JL 3GGWA 4NRZB 2GTWA 4TYUA 5INCA 1S7QA 4LNRB 3HB3C 3FQNA 5K9JL 1EERB 2VQ1B 4RFOH 1KPUB 3SE3A 4M43L 2FYYA 3JZ7A 3MRHB 4NC2B 3QH3B 4BYHA 3SOBL 4ODHH 2GK0A 1A3QA 2Q76B 5DK0A 1BZ7A 1KENH 3GIZL 3DXAE 4TSAL 4X4YB 2IAMB 3V52H 2HLFC 4WFHD 4OTXH 3DSFH 1L0QA 4Y4HB 4OCRH 2VQUA 4WO4D 3MRGA 2BSRA 4N8VA 2P43B 1AFVL 1JGUL 3KPTA 1IC7H 4M03A 1I1AD 3B2UC 3MNVA 2KH2B 1EDQA 2I24N 3VE0A 3GEWB 1JV5A 1R5WB 1HHIB 1PD6A 3SPVB 4GMSH 3EO9L 2BOBA 1PX3A 5LAXA 1FNAA 1MIML 3D0LB 1A4KB 3G6AA 3MR9B 3TFKD 1LE5B 1BEYH 4FQXD 5I1AB 2APXA 4YFEA 3OKNA 4K94C 4U1KB 3BKJH 4LVEA 1H3UA 1ONQA 3B9VA 5F9AC 5F89B 4JN1L 3TP4A 1KULA 2OM5A 1BECA 5ANMB 1NCTA 3D0VB 3S96B 1CFBA 3MODH 1FDLH 4YHIA 3FT2A 2EYSB 3U0TB 3KPPB 5T1DH 2Y1VA 4M5YH 5ACMA 1D5ZB 3O3AA 3PV6A 3INUL 4MX7A 3BJLA 4PJ9C 1QSEE 3VWJB 3W0WB 3ARDB 2D0FA 3QI9D 2X7LA 1DSFL 4HWBH 3OKOB 5IBTL 3UBXI 3BW9B 4HHAA 5E2WH 2AEQL 4ZPTA 5AAMA 1MFAH 3IJYB 5IMOB 4NKIH 3CVHH 1S5HB 3P4OA 3CDCA 3RWHB 3GSRA 3OKDB 1DBML 4HGWA 4ZO6A 1NMAL 3ILQC 2DAVA 3REVA 2R2HB 2Q3ZA 1I3RB 2YWZA 4P5KA 2ESVB 1UC6A 2CXKA 5EOCJ 5BV7L 2AEIT 1XGYH 1M71B 3CJJA 4PJCA 3TIEA 1QRNB 3RX5A 1MY5A 3MJGX 4LSPH 4Q2ZA 3WDJA 5IJKA 1VPOL 1G7LB 3JXAA 3O2DH 4WNQB 1N8ZB 4ZXBA 1KSRA 1IM9D 5T33L 2BHUA 1I3GH 4ONHB 5D93B 1VKXA 4N5UA 4YFLF 4APQC 1HH6A 5DJXA 5CLWA 4ZO8A 2JK5A 3PP3H 1CFQB 2DKUA 4P49A 2HVKB 2I5YL 5I1DA 1OW0C 1IL1B 4D0CB 4TVPH 4PJEF 2WINB 3G6JB 1DQML 4ERSH 1BQHA 1JIBA 4JFOB 3BT2L 5C0EB 5C07A 2HWZH 3DO3A 2Z92A 3GI9H 1BIHA 3VFPA 5I17A 3G08B 4UBDC 1AD9A 5FUZL 1CD8A 2FIKB 3KPSB 3NIDF 2DBLL 4XRCB 4KK5D 3ARGB 1AXIB 3UTTA 3BD3A 1HI6A 4B7LA 3GHEH 5LXGH 3UC0L 4OV6F 3AU1A 1U3HB 2OR8A 3CU1A 4XXCA 4QXGH 2QJDA 1GRWA 1RJYA 3HG1D 4AEEA 5FGSA 4G8IB 5JUEL 3OX8A 1OTUC 3TVMB 3QHZH 3MO1A 5GZNC 1TTUA 5C6TH 3W0WE 3QO1A 4HWZA 2NLJB 3TO2A 3QDGB 3AM8A 1QOKA 5GS0H 4A2MA 4I0CC 4HT1H 1LD9A 2D0GA 1YNTA 4G6AD 4ESKA 1A6ZB 5BS0D 1CGWA 5GRZA 2X4NA 3TJHC 3WIFA 3WFCL 5FUOL 2AJSL 2EIDA 4QNPF 5FF6B 4KKBC 3B8SA 4GAFB 4U7SA 5IG7B 2UZIL 2ADJA 1G6RA 1LMKA 4CDHA 8FABB 3RTQA 4R26H 4HF5H 2V9QA 4F7TB 1QRNE 1QFWM 4HFUL 2E7HA 2FX7L 3TESA 1EJOL 3QUYC 2ED7A 1A6TA 3FONA 3U0PB 3SDDA 3DXAA 4R4NC 4Q7DA 1OGAD 4OF8A 1DR9A 3AC0A 4OZFB 4EUPB 5E56A 1O5DT 5D6DA 4X8JB 4Y19B 3IF1A 4ZAKC 4FQHA 4ELMA 3V6ZA 4OZFG 4EUPG 3CXHJ 2WIIB 4ZFZA 2F5AL 4UIKH 1P1ZA 3HC3H 5HPOA 4N0CC 5JMOC 4K8RH 5EZJA 5I1GL 1N5YL 4N68A 5B4MC 3EYVA 5E8PA 3G6JE 3LY6A 1TJIL 4RNRA 2IADB 1YPZB 2OJEB 4W6WB 3FOLA 5HYJB 4QWWD 1ZOXA 1MVUB 3DVNB 1XIWB 1P2CA 2MJWA 4NHCH 3KPSE 4CU8A 4LASH 3PGCA 1WFNA 4ZFOB 3KPLA 4OM0H 3CLEL 5C0RH 3BYTA 4YXLH 2R0LL 4F15C 1MCQA 4UQ2B 3JWDC 3EZJB 3H42L 4NFBA 2C3VB 4H8WC 1IKNA 5EBMB 4LCCB 5EOTA 5DEFA 5EOCH 5ICXB 2NY1B 2L7JA 4J6RH 5GRYA 4FN0A 2NY3C 2ZKHH 3RDTD 5J12B 4P5MB 2A1WL 3HRPA 3IYLW 1U8MB 2VLRA 2ZUUA 4Y88A 4RAVA 3RKPA 2GITB 3QDGE 4LSUL 3W39B 5D1XD 4KUZH 4Y1AB 3NTCL 5BJTB 1YN7B 1T89A 1VEOA 3ARZA 3E6FB 3L3JA 4Z7UA 1HHKA 4JKLA 1E4KA 2JE8A 4J4PC 3NCMA 2VDQH 4GXUM 2J2ZA 5J6GA 3LN4A 5EU4B 2WMPA 4NRZA 2EE9A 1J7VR 1DQLL 3D87B 3D2UD 4GRWB 2G60H 4LLUB 4XBGA 4LNRA 4P0DA 1MAML 1CD1B 3OZ9H 4F33B 1MJUL 1MCIA 2F15A 5C2BH 3CMOL 3IDYB 1KPUA 4ZOCA 5LQBL 1Q72H 3O3DB 4Z95H 4Z7WB 4TNWF 4I4WA 2Q76A 4R2GC 2P49B 1GGBL 3FB6B 3HFMH 5J13B 2FH8A 2K3TA 3OF6D 1CXKA 2GSGB 1ZLUH 2G5BB 2Y72A 3HB3D 5IEKB 4K23H 1KNOB 4FP8H 1I4FB 4LL9A 5GGRB 5FK9A 5FO7A 3GSNL 2HLFD 2X41A 1R5WA 4NUGL 4EXKA 3T0EB 1OAXL 3BAEH 1YPZE 5GRJL 3MGTA 1IAMA 1GGUA 4JM2C 4YFDB 1T1YA 5E99L 5EUKB 1D3CA 5HYJE 3QWQB 3DMMA 2V5RA 5KVFL 1K8DA 3D0LA 1SMOA 4ZUWB 1I1CA 2UYLB 1LE5A 2CIIA 1U2CA 4N0FB 4PTUB 3B2UD 1WFUA 4E0RB 2HH0L 2H32H 5F89A 5C0DA 3IXAB 3B83A 4QGYA 15C8L 2BNQB 3D0VA 3S96A 3NAAH 5E4IA 2EYSA 5D7KD 3UTPD 5FO8B 1CK0H 4UILH 1WBXB 4FABH 2CRIA 3ARUA 4XPTH 3WIIL 4LVNB 4UTAH 3SY0B 3D3VB 4QRPB 1IQWL 5DEGB 2H3NB 5CINH 3I3EA 3VWJA 5EC2B 1HOCA 1T0NB 3W0WA 2IG2L 1D5BB 4LGPB 1E4WL 2EEDA 2GUOB 5SWZD 5C0AA 5LKNA 2MQCA 1FGVL 2YA2A 4Y1AE 5K93A 5HYQA 2IALB 2HKHH 2APFA 4XVJH 3NACH 5DA4A 4PJ9D 1F3JB 4PJ8B 3CXDL 1MJ7H 5FV1L 1AQDA 4AIXA 3GMNB 3RWHA 1X4XA 4GSDL 2DLTA 3GNMH 4NSKB 4MJID 1VCAA 2R2HA 3FHAA 4RWHA 4WU7A 1I3RA 3EDFA 1NCDH 5C8JB 1G9ML 1FGNL 4XT1C 4PYHA 2KQMA 3AAZA 5D1ZB 3OAYH 5DUPL 1GC1C 3TWCL 4Z7WE 1R5IB 1DLFL 4EDXA 5DVOA 1RIVL 1G7LA 1B6DA 4RGMC 3ILQD 3K7UA 1UXSB 4NZJA 4LRIC 4RA0C 4XCFH 5CWSA 1DLHA 2ZPKL 1IZKA 2FO1A 3MA9H 1XCTB 1HCFX 1ZGLB 3WE6B 2D7OA 1CDYA 4IMLB 3LEVH 3U6RA 2XA8H 4K7PL 3F7VB 1LK3H 4XXDB 1MFNA 2HVKA 3SGKA 4HSQA 3CVHB 4LBEA 4NC1C 3IDGB 4LU5H 4X99A 4E41A 4HC1L 4DK6A 2WINA 4GLRH 5L8KB 3T0EE 4APQD 5C0EA 1F97A 2EIZA 1N6VA 2CIKA 3T09A 2CUIA 5BXFB 2Y07H 3HE7A 5HJ3B 3W9EB 4XRCA 4FFVC 3PWPB 1U8PB 4MMXC 3ARGA 2VSDA 3BHBA 3OXRB 2IGFL 2R2EB 5D7SL 1J1PL 2FDBP 2QL1A 1MAKA 4QO1A 3RY4A 5F1NB 2BNQE 5TF1H 4KUCD 5FYJU 4KZDL 1AY1H 1YEIL 2QHLA 3EYUL 5ERWB 4UBDD 4NO5B 5IP4A 3I6GA 3AY4A 2ED8A 5F93C 5A2JH 4G8IA 1VFAB 3D3VE 4BZ2L 4WGWB 4XPAH 2NQCA 1B0WA 4QRPE 2VIRA 1I8IB 1XGQB 2W0FB 3EUUA 4L3EB 4PJBB 4X4MA 3QDGA 1ZVSA 3KPMB 4LKCA 5C6WH 5E0QA 4OZGF 3OKKB 3H9ZA 4Q97A 1UFUA 3ZYOA 1EVTC 4YPJA 4NZTL 1OTUD 4Y5XC 5JQHC 2EXWC 4JZOB 1RZIB 3SKMB 5GZND 3IDNA 3MLPA 4MHHI 2A9MH 1ORQB 3E3QE 5I30H 4WI6A 4OI8A 3MRBB 1J10A 4K94L 5IHBA 1W0WA 2XV6B 4L9DA 4GAYA 5DZOA 3NH7L 1PZ5B 1A64A 1RJZA 3L3GB 5F1KC 5F9DC 3STBA 3VU2A 3IRZA 3TJHD 3U0PA 4KKBD 1VFUA 2VERN 5KSBF 5I1JL 4OZFA 1RV6X 4MDIA 4EUPA 4L5FL 5FHAL 2WLYA 1UKTA 3VXSD 4MXVE 1MSPA 1UACH 3FRUA 4RISL 1NCCH 1SYVB 2DTMH 4PJIB 2VDRL 1S7VA 2B4CC 3QUYD 4FFZL 3VMPA 2WIIA 3O6LH 2JTDA 3QNYB 4R4ND 1SQ2N 1JK8B 1F4AA 3AS0A 1NGWB 1TVHB 2MHAA 4RQQA 2OJEA 4G3YL 3GMMB 4PRPB 4ZAKD 4JZJB 3LKRA 4QOKB 1A4JA 2W0PA 2W9DL 3H7LA 1MVUA 3DVNA 2VTFA 3MCLH 4EOWH 2C3WA 3PWPE 4M3JA 4ZFOA 4N0CD 5D72H 4M7KH 1MPAH 2BC4B 2QR0B 3BSZH 1BJMA 4HXAL 5B4MD 1NCAL 3I6LD 3CSBA 3ULUF 1PJ9A 4YBQC 3SJVD 2C3VA 4QHKJ 4U1GB 5EBMA 1TQBC 4LCCA 5E2VH 1I8LC 1MCEA 4R4FL 1KJ2L 5H94B 2J5LB 3LEYH 4P5MA 3RZWA 3OGOE 1P7QD 2VLJB 1NCNA 1U8MA 4HIXH 5IROC 3SGEH 4OV5B 4L3EE 4PJBE 1D9KB 4EI6A 4KHXH 3DECA 3GM8A 4HX1B 4JPKH 1UM5H 4Y1AA 5BJTA 1D6VH 1KJVA 1YN7A 2NY3D 3VXRD 1NH6A 3BPOC 1FIGH 3ELAT 1HXYB 1JI1A 4NUJB 2ICEA 1CLZL 5AEAA 1YEFL 4LLUA 2H9GA 5DRNB 5D2LF 4TNWK 2YOCA 4AM0A 4F33A 4J1UB 1P5UA 1OP5H 1AKJA 1JTPA 1D5XB 3EOTH 3WJLA 4M6OH 4J4PD 4UQ3B 5D8JH 3WXVL 4Z7WA 2OR7A 2OZ4A 4MD5B 5L7XH 2Z93A 2J4WL 3HE6B 1UXWA 4L4TB 4IEFB 4LLWB 3RVWC 3FFCA 3MYZA 1IGFL 1GIGL 2G5BA 3FTGA 2IAND 5IEKA 4MQTB 2HFFB 3RJDA 3WLWC 3GBNH 1I4FA 3PHOB 4MB5A 3ALPA 4NQCA 3WNMA 4UT9L 4L8SA 2I9TB 1JGVH 4PJIE 1A9BB 5GGRA 4R2GD 4WUUB 5L0QB 3TIDA 5F7DB 1Q0XL 1ITCA 4P4RB 2PTTB 2D7NA 5DT1L 5D6CB 4HUUA 4PRPE 2VDOH 5EUKA 4QOKE 1A5FL 1KBGL 5HHVL 1NBYB 1JZ7A 1MQ8A 4N0FA 1NCBL 4E0RA 3TJEL 3SGJA 5DI8B 3RVVC 3K0WA 4JM2D 3QCTL 5DS8A 5FO8A 4F7PB 1K6QL 3LV3B 4AQOA 1KACB 1N0XH 1SJEB 2GI7A 5C3TA 2ED9A 3SY0A 4DKAA 1J12A 3PL6B 3D3VA 6FABL 4KK9C 3L3KB 4HZLA 2PW1A 3VDCA 5T1KA 5DEGA 2H3NA 2VLJE 3BZEB 1T21A 1T1WB 2A6KA 5EC2A 5TH2A 3ROLA 3I02B 1BD2D 4AYFA 1D5BA 3RGHA 3QCVH 4LSRL 2PTUA 4XXCC 5ENWA 1UADC 3K8MA 5IV2B 4FXLA 1YEEH 2IALA 2R0WH 2F74B 5LGJB 1JP5A 1TZGH 2H32B 2W60B 1K5NB 5AUMB 1ZT7A 1PAMA 4OCSL 3AM8C 5DJCB 5C8JA 4XNZC 3I50L 3KYKL 3U1SL 1KXTB 2Q3AA 4RFEB 4YC2C 3VGGA 5HDBF 3T3ME 1CDUA 2ENSA 3D85A 3HAEH 5FEBA 4ZYKB 5I16B 4ODSL 4H8WL 5I73B 3QJHB 2GAZB 3KVQA 4WHTB 3FO1A 4L4TE 3WS3B 4NQDD 3O8XC 1EV2E 1F4YH 3OAUL 1AH1A 3BP5B 2AKRB 1T7ZA 2WAHA 2VO5A 2D31B 3FAXA 5BRZD 5DD6B 1S78C 4XXDA 3L7EA 5HDQL 4WUUE 3S3SA 1BAFL 5FFLA 1T80A 3O3BA 4QCIA 7FABH 2HN7B 3IDGA 2Y25A 3IKCA 2MSPA 3TO4B 2HJLA 3CGTA 2UVEA 1N3NA 5D6DC 1XEDA 1V3MA 2EEAA 5MERB 3ALWA 4XCYA 1BPVA 1JTTA 3O0RH 5KOMC 1SM3H 4LSQL 1HDMA 4Q9RH 1T1ZA 5A40E 4WW2C 3BESR 4HWEL 3EKCA 5HJ3A 3W9EA 1I9RH 3OXRA 1BOGB 4FZ8L 1AP2B 3S3PA 4JFPA 5HHMD 4JKPH 3DI3B 1AI1L 1X5IA 3FL7A 3EJZC 4U1MA 3S6CA 1CE6B 3KNBA 1QLEH 4N8PA 4FZEL 4ORGB 2HJFA 5ERWA 5F96H 5CJXC 1JWUA 5IB5B 4OIAA 2XKSA 2X2YA 4FFVD 1VFAA 5K59F 1CE1L 3MNZB 3CZJA 3T3PF 3OBAA 4UAOC 2WANA 1I8IA 4ODUA 1XGQA 4P3DA 4U1JA 1C5CL 1FNEB 4OUUB 2X1PA 5IF0B 4YXHH 1WF5A 3IGAA 3IDUA 5E8OB 3BRGC 3MOAH 3TPKA 1INDH 2VH5H 3OKKA 4I0PB 3H9YA 3BH8A 4AEHL 5H2BB 1WIPA 3SBWC 1EGJH 2R1WA 1KN4H 2F58H 3DNKA 1BF8A 1CU4H 4H20L 2EDDA 2G5RA 3CC5B 1CI5A 4E42A 1ORQA 4PJAA 3T0BA 4M48H 1IGCL 4EIZC 5ADPH 1IAKB 2ZUQC 5DUBB 3SE4C 1PZ5A 3RNKA 4LIQE 1P9MA 3L3GA 4TSBH 1X5GA 1KPRB 1T6VN 4KMQA 2O5ZH 3FQRA 2EXWD 3U0WH 4GQ9L 1RK1B 1KUMA 3FOMA 1C1EL 1PG7H 1PGRB 3UDWC 5HVHC 5CIPH 3PWVB 4MXWH 3N1PC 3U79A 4L4VB 1MWAL 5DJ0B 2CKBB 3IFPB 3QHFL 2FHBA 1OWWA 3QEHB 5LVEA 1SYVA 2MOVA 1B0RB 4JHAL 2B8OT 2DM7A 2PYEA 5FOBB 4JY6A 4YX2L 3U2SB 2XN9D 4TSAH 1JK8A 2IAMC 1PVHA 4X7EC 2ATPA 1TVHA 1X7QB 3CFKB 3NFSH 1IRAY 1CN4A 3GMMA 4PRPA 4Y4HC 2J6EA 3WL9B 4Z7OF 1MRCH 2VC2H 3ZLQC 3QUKA 4ZTOL 3K46A 5FB8B 3T2NL 4FQCH 1UWXK 4NO2B 5HVFB 1Z5LB 4A6YL 1EO5A 3MLXL 1K8IB 5I8KL 2BC4A 1JFQH 3F6LA 5EZOL 1GC1L 1FFPB 2YZ1A 4DZBB 4LLDB 1PLGL 3QXTA 1XF2B 4KTYA 4XGZB 4PP2B 2BY2A 1I7ZA 4YHNA 3QXVA 5H94A 3L3IA 4ONGL 3GSXB 4MYWB 4OV5A 4YBQD 1D9KA 2IC2A 1CGTA 4P2RB 1JMXA 3FMGL 3GSQA 4JRXA 4HX1A 1DBAH 2R4SH 1KCLA 1HHHB 1F42A 1MCWW 2QQQA 3STZB 4ENEC 5FYLD 3MBEB 2IEPA 4Q9QL 1R3KA 2E27L 5HY9B 5KVMC 3V4PL 5T3ZE 4NUJA 4YLQT 3EGSA 3C09B 1NL0H 3ARDC 4EN3B 4ODTH 1UZ6E 1QACA 5DRNA 4EEEA 4PGEB 2XXCB 2P5WB 4PJCF 2V2XA 5F6IB 1FFNA 5F8RC 5IBTH 4NQUA 5CKGA 4AG4L 2AEQH 2X4SB 2YK1L 4XC1L 1QR4A 4XP5H 2ZCKL 4MD5A 4R6UA 4PGJA 1HE7A 1MCCA 3WCYA 1NLBL 1NMAH 4L4VE 5C08B 1H3GA 4DKFL 1QFWH 4JG0L 3DX9B 3PHOA 4X8XA 5EH1A 1L0XA 2GQHA 3RRQA 1AQKL 1TJGH 2I9TA 3BVNA 1B90A 2FHCA 2B1HH 4WUUA 1BM3H 2WUCL 1S7WA 1JZ3A 2D9CA 4M7ZC 5GRUH 5F7DA 1A7PL 3RVWD 3HI1B 4P4RA 2PTTA 2Z4QB 5D93C 5HGDA 4D9RE 3WLWD 4MCYB 2B20A 5C9JA 4BFEA 1GOGA 4XPFH 3I85A 1NBYA 4JO2L 5EZLB 3D9AL 4MDJA 3BDYL 1VDGA 3SDCB 5CZKA 3I2CL 2CO6B 4WFFE 3PE9A 1WC7B 1MIEH 4JR9H 3M07A 4JO4L 2AS5M 2Z0BA 4KI1A 5DI8A 2YMXL 3IRPX 1LDPH 4WHDA 3F7PC 1FN4A 5EORH 4WU5A 4XP4L 4KTDH 3LV3A 3QWRD 1SJEA 5ESAB 5ICZB 4AK1A 4MB3A 5FUZH 4UNUA 3PL6A 4M6AA 3RWDB 4X6CB 4I2XA 2P7TB 5EZIH 2XPGA 2DQJL 3WNOA 5GRXG 4BK4A 3A67L 3RVVD 4G9DB 5DK2B 4XWGH 5DD5L 1CQKA 3TNNB 2B4CL 3QDHA 3OKEB 1L9MA 1U3HC 3AS2A 5EIVA 1UB6B 1A1NB 4HCRA 4X6EB 4UOW1 1DEEA 4P2RE 1AE6H 3ZE2E 1ROWA 2XNAB 3G04B 4PB0H 1UA6L 1MNUL 1C08A 3NA9L 3O6FB 2F74A 1QEWB 2IH1B 4KK9D 5IR1A 2GYSA 3HR5B 3HZVB 5JR1L 3TVMC 2YPLD 4X6BA 2W60A 4P9ML 3S37L 4G9FD 3HCVB 3VI3E 2V7HB 3V2AR 5AUMA 2QKIA 5DJCA