2BFVL

Monoclonal antibody fragment fv4155 from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
b'DIELTQSPPSLPVSLGDQVSISCRSSQSLVSNNRRNYLHWYLQKPGQSPKLVIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVAAEDLGLYFCSQSSHVPLTFGSGTKLEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FV4155
publication title Antibody fragment Fv4155 bound to two closely related steroid hormones: the structural basis of fine specificity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 24
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1997-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bfvL00
5ICXA 3LS4L 3ZMRA 2A6IA 1RJLA 4XGZB 3IDIB 2Z31C 3HZMA 3L7EB 1TQBB 4ZFOL 1BVKA 2EE9A 1MAML 5BZWB 4P5TA 3QEQE 3LD8B 3NCJH 3P0VL 1G9ML 3CK0L 2AABL 1MEXH 1A6TA 2WMPA 4CW1B 4ODVH 4HCRL 2WAHA 3GSVB 2NMSA 2WQRA 1URLA 2K3TA 3QIWA 5AYUH 1AGEA 4U6XA 3VFPA 4WO4B 5JW3L 3OKKA 5GGTL 5JXAL 1NMBL 2V17H 4HIHA 4FHBD 2DQFB 3QEQA 4TULL 1AP2A 3CFKB 4JM2D 1I7UA 2EYRB 4I2XB 3T4YB 4PB0L 4LEXL 3MV7B 4ZNEE 3FB5A 5C92A 3S5LB 5HYQA 1TQCC 3TBTA 3RWCA 1G7PA 4JVPA 4E41D 3CSGA 2OP4L 1NL0L 1KB5B 1C08A 5JW4M 2MKWA 5JIKA 2KKQA 2VISA 5MHSD 4HF5L 3G08A 3B9KC 1A9EA 4JB9H 4U3XA 3MUGA 3WJLC 4ZNEA 4P5MB 5TDPB 3BFOA 2R4SL 5DVKA 4Q0XL 2AKRA 5E1AB 1IT9L 5LCVH 3BWAA 4NZUL 4OUUA 3IXTA 5SX4I 2X70A 3N85L 5E94A 4HULB 1UB6A 4MQ7A 2ERJC 1QOKA 3MGTA 4G7VL 5CGYD 4U1IB 3BW9B 3HZVB 5GRUL 5E4EB 4EIZC 2YRLA 4Q6YA 3BEWA 3VI3F 4UILH 5AZEL 4OUOA 2FEDD 3ULUH 2WINB 4DZBA 3GBMH 3HNSH 2FLRT 5DRNA 3O6LH 2KUTA 4JFYB 1LEKA 5C09B 5I73B 1YC8A 2BOCB 4KKAD 1VFBB 5D7JC 2R2CA 1CLCA 5C7XH 4I0KA 3BT2L 4KH2A 2YD7A 2L0DA 5MEPA 4G6KL 3U4AA 3WFBL 1FO0A 2B1AL 2HTKC 3OZ9H 2Q3ZA 4HKZA 5C0GA 1RUPL 3D5OF 4NM4H 5DS8B 2KH2B 1NBZB 5HYIA 4JFZH 4YDJA 4QCIB 3PUCA 1XGYL 3CSPA 4HIIB 1FZKB 4HKBA 4U1LB 3GUTB 4M7KH 3A6CL 1CGSH 4PJFB 2VWEC 2I07B 3BQUD 4AEHL 2AK1L 4RA0C 1F42A 4U1SA 3GMNA 4E5XB 4X83A 4HUUA 1M7DA 3W9EA 3ELAT 2Y4SA 1DLFH 4E41E 2XKNB 1FVEB 1DUZB 5CD3B 1C5DA 4M62L 1N59B 3IS1X 4ZO6A 3CGTA 5AWNH 4ZS6D 4G8GD 4LKXB 3HE7C 3TT3H 5MHSE 5D7LB 2ZPKL 3MRIA 5EOCL 5C9JA 2KL6A 2QKIB 3QDME 4YXHL 3S37L 4APQC 4OV5B 3VA2C 2G75A 2MFNA 4L5FH 2V2XB 1A0QL 2B2XH 3PDGA 1HH9A 5E9DE 3OPZH 4OLXL 3UJTH 4E41A 3N1QC 1HIML 2NY5L 1GVIA 2WSKA 4ZO7A 5DC0A 1WAAE 2AJ3A 4DFHA 4AZ8A 1F4YH 3LPFA 1P84K 3PL6B 3EHBC 1A7PH 3PV6A 1CT8B 2OJEB 3B2UC 1DBKH 2CR6A 1AD9A 3FB6A 1MHHB 2CUIA 2VXQL 2MHAA 3QYCA 3QDMA 4NHCL 4LMQE 5E9DA 3VD7A 3H9ZA 5IVXF 5IB4B 1X7QB 5DUPH 1T3FA 5KOMC 4P23C 1EJOL 5DC4B 4P3DB 1UT9A 5IW1B 3VXRB 1NQBA 3CVHL 1WAAA 3V95A 1WFUA 5EUOE 1XGQA 5EO0A 2FWOB 2HH0L 3WXWL 3GMQB 2NLJB 3VGEA 5B38B 4OJFH 2VABA 2PYEB 5DR5H 3DUHA 1TITA 3MRHB 4HBQA 1CBVH 1LE9A 1A14H 2ZNXA 3ARFC 5A40E 1AGBA 4JPKL 3OR6B 2Y06H 3ARDB 4YDLB 1A6VH 1KCUH 5CD5D 3AREB 1QBML 4NKIL 4Z95L 5EUOA 3V8CA 5CKAA 2FNBA 3QEGL 1NEZA 3RWJA 3BP7A 3N9GL 3NZ8A 4H25A 3MODH 5L7XH 2NY0C 3MJ9L 3MV8D 3SN6N 4GAYA 5EBLB 4UDTA 2RGSA 1UH2A 2LQRA 3LEYL 1GIGL 3RQ3A 5IF0A 4QHUA 4RFEA 3CIQA 4QHLA 3MOBL 4K8RL 4F3FA 2P8LA 4D0CB 4Y8DC 5DUBA 2MWCA 5CBEA 1IBGH 2PW1B 4G8GE 3GSOA 4POZC 1B2WH 1QLFB 2X4RB 1MRDL 2OR9L 4JFQB 1LE5A 2VUOA 1LO0H 5DLMH 2O5YH 2DTSA 3CCHA 1FG2A 1HZHH 1U8LB 2YD6A 5JIHA 3V6ZB 4KI5F 3TZVC 4Y4FD 5IMKB 1ZSDA 3ECBB 1Z0NA 3UROR 2DM3A 4G8GA 4XI5D 5DYOA 5F6IC 2HG5A 4LSDA 1CE1H 4U1NA 1E4KC 5F9JA 5C3TA 2R8SL 4G9FD 3V7AE 4G9DA 3VFOB 4M6NL 1R3LB 4YPJA 5IMMB 2VSDA 1MFDH 3W5NA 3FO2A 5DJDB 3SKOA 1UQSB 3BH9B 7FABL 1I3RB 3IXAA 3M8OH 1W0VA 1R5IA 2BHYA 4JQIL 4PGZA 2UZIH 5KZCD 3NIGE 5IFJA 4KKBC 3E3QE 3X13B 1Q94A 5TPWL 2PTTB 1CF8L 5D6CA 4OZHF 1KIRA 1KXTB 3QWOA 2AQ1A 5IMLB 1N5YL 3REVA 1CDIA 3FJTA 4KHTH 4M6MH 5JPMA 2OL3B 3RX8A 1HINH 3VFNA 2GYSA 3NVQA 1ADQL 3RY6A 4LFHD 3HNVH 1BFOA 2DTMH 3MRKB 4X6DB 1GGBH 4TUOB 5KSVA 2R9HD 1Q72L 4PGDB 1IGTA 1DUYA 3MV8E 3L9RB 2UZYB 2UY7A 1YY9D 4RIRA 1TJHL 1LO5A 3HS0A 3LKPA 1U2CA 2QQKH 3HG1D 3G9VA 2DBLH 1KIQB 3HPLB 3VRJA 5IK3B 3DUUB 3MRQA 4P2QB 3ZT7A 5KOVC 1ITBB 4U0QB 4D9LH 3PP4H 3V4PH 3O3EA 2X4SB 4PUBL 3KXFA 4Q9QL 3P11H 1J87A 1LEIB 4JY5H 1JGUH 2HT2C 5C08D 3RTQA 3RL1B 1QFHA 3QIUD 3VWJD 4PTTB 2VXSH 4HUXB 2PO6D 3MLWL 5L88L 3CFBA 1J0HA 2DQCL 5DJXA 4FRWA 5IW3A 1YEHH 3LH2L 2GCYA 4PJDE 1GOFA 4UOW0 5JW4N 2CRZA 4IDJH 2DMBA 3LN9A 3O3DA 1UXWA 2FL5A 2VXVH 2W9EL 1JYWA 4I8DA 1PJ9A 3RVWC 1N5AA 3BSZH 3NA4A 3I2CH 1U8KA 3RWHB 3FL7A 5AZ2L 4JVUA 4QHNA 3VJ6B 1NGPH 5TH2A 1IKNC 4Y4FA 5CHNA 3CMOL 3HUJE 4OLWL 2BCKA 4JG0H 5J9PB 3UBXI 4WFFE 5ERWB 3F5WA 4PJDA 5GRJL 4F7CB 3UTPD 2AJXL 1A2YA 1SYVA 4JFFD 5CEYA 4M1DL 2C3VB 4QNPE 1JNLL 3DO7A 4C54A 3MGOA 2FJGB 3PHQA 4R7DA 1D3CA 4ZYKA 2X9WA 5ICYB 5E8NA 4TNVF 4XP5L 1AD0A 5EZOL 4JM2C 5J1TC 4O5LH 3KHOA 2ARJQ 2NW2A 4NNYA 1GZPB 4JG1L 3U4EA 4NM8L 3DXAD 4PS4H 1Y0LA 3T3ME 4EUPG 3O6FB 1FN4B 5CJ5A 2D0FA 4J3WA 5HGBB 3SGDH 1NUNB 2VL5B 2EIZB 3KJ4C 5CP7B 3S37X 3D2UD 3AUVA 2ZSVB 3SKJH 1NFIB 4P48A 2G60L 3EJYD 4U1JB 3SOBL 3PABB 4GBXD 4ZTPH 5I1EL 3L3GA 4KZDL 2BY2A 4U49A 4Y4KD 1SEQH 5C08E 4DGVL 5ACLA 1F3RB 5KVEH 1RIVL 5T1LB 1ZGLB 2NXYD 2GTZB 3IGAB 3F7YA 4TNWK 3MLRL 3FO1B 5HGHB 2EH7H 4PJCB 5CGYC 5LGHL 2H6PB 3QQ3B 1UXSB 3T4AA 4IRZH 1RU9L 5C08A 3KNBA 2GSIB 3QIUA 3KPRB 4H20H 1NC4B 3NIFF 2HLAB 1DFBL 2FEDC 3IJYB 4PJ5E 4ODTL 4UIMB 3CFJB 2DKUA 2DLIA 1MHPL 2YEZB 4LCWD 2Q6WB 3HC0B 4QHKJ 2A1WH 4RX4A 3KYAA 4KKAC 2FO4B 4HFUH 4JFFE 3DVIA 3PWPD 3QI9B 1A6WL 1UZ8B 4OZIA 4L3CA 1OW0A 4AT6A 3CZJA 2ICEA 4ODSL 4G8IA 4JRXD 1RZ7H 1JHTA 3O9WD 4MZ3A 3THMH 2EECA 4I18A 2JB5L 4PJ5A 2XZCH 3KYNA 3PP3H 1VFUA 5GGQH 2VQ1B 1KBGL 5FM5M 3RNKB 3DMMB 3OG4B 4KJQD 2H26A 5MEOA 1AXIB 3H8NA 3D69B 3QP3A 4YX2L 1KLFA 2Y7QB 5GJTH 3BQUC 3AS0A 4G43A 2W9DL 2E27H 4P9ML 3DXAE 1A9BA 1T5WA 1F3JA 2ADIB 2R15A 1P7QA 2RB8A 4PGJA 3D39B 5EU7E 1A4KA 3LDBB 5TF1L 3L7FA 1QKZL 1ZVYA 4PGBB 4KRPD 2F19L 4X7TA 2F74A 4ZS6C 3ULVH 3K4AA 1NAKH 5I30L 1T0NB 2FATH 4YGAB 2H45A 1UJTA 4Z7OE 1RVFH 3D85D 5AG9A 5JORB 5I1CH 2XZQL 1NCAH 3DXAA 5GGVY 4MNGA 3RPIB 4OZFB 4NQXA 4RWHA 4ZODA 4NRZA 2X41A 2R0ZL 5GPRA 4NZTL 1JHLH 4JN2A 4WHYH 1TVBB 4DZ8A 4EI5D 3FFCE 3FCTA 1VB9A 3G5YA 2MCPH 1MFEH 4GBXA 4NNXB 2R1XB 3PGFH 3SY0A 3OL2A 1B4RA 2CLRB 2AV1A 4H1LH 3QCTH 5FA3B 1BIIA 3MNZB 5I8KL 4M5ZL 5F7EL 1BEYH 3BD4A 5E7BA 1XIWB 1Q9KB 1CXEA 5C0EA 4Z0XA 4ZXBB 3FFCA 1PZ5A 5CZVH 4XVJH 4LCWE 5C0BD 1A1MA 4IOSD 1D7FA 2APTA 3E3QC 4BK4A 3TVMB 4DUVA 3MLSL 1S9XB 4H8WH 4OCRH 8FABA 35C8L 3T1FA 5HTSA 2BVQA 4EDXB 1GPOL 4YHLH 1I8MB 3W0WB 1D5ZA 3CFCH 3F65A 4EDWL 2YUVA 5BRZE 4YHMH 4DQOH 4LLQB 1ZVSA 5CD5C 1FGNH 1F3DJ 1I4FB 2XOTA 4LCWA 1QA9B 3J8F7 5HDLA 1AQKH 2IG2L 3EYOA 4F9LA 4JPVL 1P4LA 1HEZB 4OFYA 2YKLH 4RGMC 5DQJA 3B5HA 1N2RA 4Q9CA 2MKLC 1DBML 2APFA 5JHDE 5K59F 5MP6H 3O4OB 3O9WA 1BFVH 2GY7B 3GRWL 4WW2C 5E2TL 5BRZA 2CXKA 3FOLB 4NO5B 5CS7A 2Y23A 2E9WA 2X89D 1FGVL 2PXYA 5HD8D 2Z8VC 3QUYA 5ADOH 2J6EA 2WW8A 3DRQB 4L1HA 3PE9A 3LQZB 5INDB 2HJKA 5A3ID 3MLXH 3T0AA 1G1CA 3T0EB 4UQ2B 5JHDA 2W59A 4NKMA 2E9BA 3TC9A 1A6UH 3MOAL 5C0FB 2DKSA 4NQED 1KJMB 4Y4FC 4TVPD 2O5ZH 4DEPC 4DOHB 1A7NL 4OCYH 5TQ0L 2GUOA 4XI5C 2EIBA 3L5WA 5CEZE 5BXFB 4LVNC 1MFCH 4NKOB 5JQHC 3AU1B 4J12A 1XGUB 5JW5A 4PJGE 4FQCH 5GIRB 3VXOA 5C9KA 4G8FB 1BZ9B 2V9RA 1OQOA 4GMTH 2VDMH 3LIZH 1PBYA 2KPNA 1FAKT 5C0BE 4HX1A 5I19L 2I9LA 3FB8A 4Y19D 1EX0A 1F8TH 1AE6L 4X7SL 2LVEA 4XNQB 3VXSD 1JUFB 2A9NH 4RFOH 1UZ6E 3V0WL 3HI5H 5CIPH 3ARWA 3D25A 3KAAA 4J6RL 4PJGA 4ODHH 1UM4L 1OHQA 5JPNA 4L8SC 4AEEA 1B0GA 1EIBA 5C0BA 3ZE1E 1KCVL 4FFYH 3ISWA 1HNFA 1VACB 2JLLA 2R1WA 1BOYA 4ZOAA 5C70A 2R9HC 3G6DH 1MELA 3MLYH 1PDKA 3GMRA 1YY9C 1V7NH 3P30H 1QPXA 1HILA 1T5XA 1OM3L 1K5NA 3HN3A 3T2QA 5DJYB 5B39A 1M71B 2EC9U 2HJLA 4MA1C 3KJ6H 2VDKL 2FB4L 3UEZA 4I0PD 3S88H 1HDMA 2R23A 1BF8A 2Z8RA 4L4TD 3QRGH 3X11A 3PP3K 2VOTA 3CFIC 5KW9H 3RL2A 1AI1L 2CDGA 5DHVH 3GK8L 3C60D 3QAZB 5K93A 3C87A 4G42B 2CIIA 3FN9A 1FIEA 3BHBB 3QIUC 1H5BB 1LK3L 3VWJC 3MRCB 4O02L 3OJDA 4DTGL 3EOAA 2PO6C 3O3UN 4X8JB 1S7XB 3WBDA 3MUY1 4IBLT 2FYYA 4CAGA 2EEAA 4UINH 3H3BC 1FH5H 5GGRA 3QCVH 4N8VB 1QO3A 4HT1H 4PTUB 5I8OL 3C6LD 4EBQH 1C5BL 1WLHA 4XXDA 1LVEA 2BVOB 1J5OH 3GMLB 3CSYA 3VG0L 2R4RL 2DL9A 5HGDB 1VERA 4Y19E 1MREL 5KANI 1JPSH 4F9PC 5EIIA 1S9VB 3WIHA 3VXSE 5EBMA 2R39A 1MJ7H 4G6MH 4LSPH 5B8CB 5HJ3B 4OGYL 1RZJL 1E6OL 2B4CL 3SE3A 2FX9L 4KDTA 2WIMA 4LCYB 1MJ8L 5BV7H 4MD0A 1IGFL 4PBXA 3CH1A 1RIHL 3G5ZA 3MXVL 1G9NC 2DJSA 3VXQA 3DBXA 5BO1H 4HUVA 1MCKA 5FYLE 2IH3B 3I9GH 1WT5A 1UCBL 2AXGA 1U8PB 3F6IA 4MA3A 1KPUB 2H9GB 4JY4B 4ZFGH 5I8CB 1QSVA 3BJLA 2J12B 3VI4F 4DVBB 3ARBB 3CPLA 1HHGB 5GS0L 1JGLL 1ZLVH 4HIXL 4ELME 1KLUB 3DJ9A 5DK0B 2R2EA 3LKNA 4MMXC 4QYOA 1YQVL 1HSBA 2XTJC 4JO1L 3P0YH 2XN9A 4NC1C 3MCLH 3BPLB 4F2MA 1IGYA 1BQHG 3HMWL 5ESAA 2NTFA 1J8HD 4LVHB 2YS4A 5IVXB 3EJYC 3H42H 3ZKXC 1WITA 2W0LA 4GBXC 4PRDA 3L3JB 5IQ7H 3O6KL 1P4IH 4Y4KC 4OCLC 1MQKL 4ELMA 1OSZB 3A6BH 4PG2A 5EORH 2FHCA 3NCCB 1JWMB 4LARL 2NXYC 2O93L 1J88A 3HRPA 3LKSB 4RGNE 3MRDB 5C8JB 3GSNA 3DWTA 1XH3A 4DKDC 2PTVA 2BXZA 3U6RA 1NGZA 4G6JH 3NPZB 3S96B 4PRID 5H2BA 4PJEF 1JF5A 4M5YL 2CGRH 4OCXL 4OAWB 4WIQA 5EZLB 3C5ZA 3OKOB 2VC2L 3VU2A 5C6TL 3PQYB 4NO0D 4J3TA 4J3XA 2AK4B 3KYOA 4CUCA 3X14A 1HHKB 2OYPA 1PG7X 4LCUB 3DPBA 3ULUD 3C6LA 1JWUB 3KPOA 2PYFA 3BKCH 5EFIB 1TETH 1S8DB 3TBSB 5IROC 1IGIL 1GH7A 3FO9A 5I76B 3O9WC 4RFNB 2DDQH 2FX8H 4OBSA 3EAKA 3H7LA 2AV7A 2BJML 3IDNA 2GTWB 1OGAB 5D7IB 4K7FB 4KJQC 4PJIB 3V5KB 4UAOC 1MWAA 5HHPA 1U42A 4V2CB 1RZGB 2Q86B 2G9HA 5DURB 4CN4A 3ZYZA 5TQ2H 1LWRA 2A73B 1ZS8B 4IIQA 1SJEB 1I3UA 3MRLA 2EO1A 4QXWA 4KRPC 4Q2ZB 1L0QA 4GUPB 1J8HE 5LBSL 1SJVA 3ZTJH 1KPRB 4TRPH 5E8OB 3Q5TA 4DN3H 4ELKA 1MVUA 3SCMD 1BBDL 4HK3N 3WJJC 3U0TA 1B3JA 4ZDHA 1IM3A 5J3HD 3MQIA 1R0AH 3K80A 2ADJB 1FNEB 3C2AH 3WL9B 4OZHB 2P47B 4EI5C 2AI0H 2D03L 1N4XH 1J8HA 4Y0GA 4GAGL 5KS9F 4ONHA 3VFTA 1W72H 5E6YA 3WNMA 4PRIE 1TJIL 1KG0A 1GGIL 4UMGA 1D9KB 1LEGB 1I8LA 1IARB 4OFKA 4QT5A 2EC8A 1ROWA 4CN6A 4TTDD 4JDTH 5GJSL 4FMKA 3QHZL 4X6CB 5E2VH 3DHJA 2DIBA 3WHXA 4WDIB 4L9LA 3ULUE 1AKJB 2X09A 4PRIA 2I25N 2W0FA 1VCAA 2DWDB 3ARPA 1P69B 3DLQR 3IDYB 4WWKA 1ZA6B 2BHUA 2WP3T 2P8MA 5D96C 3HB3D 5IIEB 4TUJA 5D6DC 4XH2B 3I6GB 4ETQB 4KTEH 2I26N 3IETA 4KDVA 4CMMA 4AEIL 4Z0BH 1CD8A 1XGRA 2Z35B 5IEKB 3KPNA 1G0XA 5HHVL 5IT2L 2X10A 1M6OB 1JTOA 1RJYB 5DVMA 1JPGB 3JWOH 1MJJA 1DVFB 2A6DB 4N0UB 1JVKA 4GKSB 1BIHA 4NBYB 1EMTH 3EO1A 4HJJL 1YJDH 1J1PL 1KCRL 4NSKA 3SKMA 1A21A 3WDHA 5TE6H 5HD8C 3VXTB 4UV4L 4MJ5B 1H15A 3A67L 1XGTA 5A3IC 3GHBL 5FOBA 1I7RA 5BJTA 3LQAL 3CXHJ 5HI3D 3L3HA 3DURA 3P9MB 1YEFL 4XPFL 5H94A 3ROOA 2EH8L 4R97C 4OD2B 4JKPL 3QNXB 2ED9A 4HKJB 2CO7B 2ZUWA 1DQTA 3QUKB 1CICD 1V3JA 5F1SA 3RX7A 3HNTH 3OB0H 1S7SA 5DZNA 1V5JA 3D0VA 2O61B 2FEEI 4XCNA 1W8NA 3V6FA 2HFEB 3DX6A 3WEXB 3SCMA 1T4KB 2YWZA 3OAUL 5FB8A 1E6JL 2XFXA 4WI4A 3KDMB 1Z6JT 2ZCKH 3TCLA 3MRPA 5MEQA 4YGVB 1ZANL 3T08A 3ARGB 1VFAB 1FL3A 3FRUB 3I75B 2JELL 3TIEA 3QA3A 4YWGH 2D31B 4IRSA 4NIKB 4BKLA 3IKKA 1NUDA 4N1CA 3ZDZF 2NPLX 2FLBT 1A64A 3ORJA 4I77L 4KHXL 3RIFF 4J3SA 3ZE0E 5C0AD 3ZT5A 3PXJA 5IJKA 2WWKO 1MCBA 4JDVA 1KB9K 3HC3L 3K1KC 4JLRB 5ISZB 1YMMD 1ZLUK 1BQLL 5CMAB 4TSAL 3VW3L 4CVWA 4MXWL 4GQPH 4X9IA 1AHWB 1M7XA 3BX7C 4W4OC 2EKJA 4ZD3L 2DI7A 3JV6A 1DN2A 2GJ6B 3Q6FA 4XCYA 1FAIH 4I0PC 1QLRA 1MCLA 1YEEL 1FE8L 1YN7A 4NRYA 3EYFA 4P4RA 5LGJA 3HLAA 2GAZB 1XF3A 4JPWL 2IH1B 2D9CA 5KTEH 3C60C 3KPQA 2ICWA 1TPXC 2FGZA 3GKWL 3NPSC 2ORBH 2ED7A 4NFBA 5DD1L 2V7NA 3QNZB 1P2CB 2WBJB 5F3HA 4HWBH 4PGCA 5FHAL 2QBWA 3FQTB 1JK8A 1I9RH 2N7AA 2QQLL 1UWGH 3VXPB 3MA7B 2BFVL 4F33A 1KEMH 4XRCA 3KPPB 1ORSA 2MNUA 1OP3H 5CWSB 3FAWA 2P5WB 4XBEH 4WNQA 4Y16D 5J1AA 5T5FH 1U2HA 2BMKA 1K8IB 5I1IL 5DI8B 3U36B 5DFTA 3LKQB 5IVOA 3R06A 1NGXA 1FL5B 1ZT7A 3DSFL 3QFJD 2AAVA 3ZDXE 1PSKH 2EYTB 3SBWA 1V7MH 4JO3L 2Y1VA 4E0RA 4LNVA 4GW4B 4XPTH 5F9WB 4XCCH 2ESVB 4ZFFA 1DQML 3O6ML 2YD4A 3EJJX 4XNYH 5C0AE 3GGWA 3L3DA 4KK5D 4D8PB 3D0LA 1AFVH 4IIQC 1S7VB 4GG8A 1AO7D 2AJSH 4LDEB 4TNVK 5CSZA 1YMME 3GSXA 2ILLA 1FV1A 1KJ2B 1RULH 3IB4A 5SWZD 1FYTE 5DDHA 1IAKA 5FV1L 1X5FA 4E9LA 1U8MB 3E6HA 5EU4B 1XCTA 2UWEA 2R0WL 1HH6A 1Z5LA 3JSSA 3P4OA 5CZXD 5C0AA 5LVEA 4WV1B 1SBSL 2F8VA 3GNML 1UB5B 1WZLA 5E6ID 1BM3L 4R90H 1P5VA 1MCFA 4YDVB 3VE0A 2XA3A 1FYTA 4F7MB 4F57H 1RK0B 4I3SL 2ZCLL 4HMDA 3LS4H 1DSFH 3BYTA 4PBWD 5IVZA 5JQ6L 1KGCE 2F54D 3TFKD 3BEVB 4MQXD 2QLVB 4MD4A 4RQQA 3BIKB 4ODUB 2Q8AL 3P0VH 1G9MH 2E7LA 2AABH 5IOPA 2R2BB 4U6HA 1B88A 1KEGL 4MAYA 5J57B 4HCRH 3HAEA 3HCVB 3SO3B 4Y2DD 3VGFA 3MRGA 2J8UA 4MSWA 1TIUA 5KSUA 5JXAH 1NMBH 1E4WL 1G0DA 3EGSA 4XX1G 1G6RB 1C5CL 3T8XB 3WFCL 2R69L 3RWGA 4G6FD 3O8XD 1OL0A 4LEXH 3ULUC 4GKNB 2AS5M 3B9EA 1CU4L 2BNRD 4FXKB 1U9KA 3QFJE 5K9QI 1BJMA 3KGRA 3OB0K 3RDTD 1BD2E 2YPLB 4N0YL 1EFXB 2OP4H 3ZKND 1NL0H 1G7LB 1GZQB 5D7KD 3IF1A 1OAXL 1AO7E 3IU3B 1KTDA 4HF5H 3T65A 1PLGH 1XGPB 1U3JA 1M05A 5DK2B 4D0DB 3QFJA 5FDWB 3G6JE 4FS0A 4QHMB 4JHBA 4Q0XH 1BD2A 1IT9H 1Q0YH 4NZUH 3QEHA 3B8YA 4ZUTB 3VGBA 3MNWA 2BSTB 4G7VH 4UT9L 2EE3A 5CEZL 3UPRA 5K33A 4UT7L 4MB4A 1SVZA 3E6FB 3HFML 3QIBB 5GRVK 3REWB 4R7NB 4EKXA 5T33L 5DMIL 5E99L 1DBJL 2GK0B 3G6JA 3QUXB 5AZEH 3SCMC 3VDCA 4MX7A 4K07A 2F54E 1KFAL 2IPKA 3ULVD 4ZFZB 1T7WA 5J3HC 3WLBB 3RY5A 4P2RA 4LGPB 4PLJC 1FC2D 1LD9B 4IMKA 3E1F1 4JY6A 4FQHB 4S2SB 1MUJB 4PP2A 4G6KH 4K7PL 2VZOA 4L4VD 4LMQI 5JUEL 1FBIH 4PRBB 3CC5B 3WFBH 3WS6A 3TNMB 1UJ3A 3OKDA 1HQ4A 1RUPH 3CX2A 6FABH 4FXGA 4JPIA 2CJUL 1NGQH 5DD3H 4Z77A 1IGJA 3A6CH 3BPOC 1X44A 3AS2A 3JV4B 4TTDC 5DJ8B 4RRPG 1T1ZA 4AEHH 2AK1H 2Z4QA 6CGTA 2YPKB 4M4RA 5ENWB 2BNRE 4LKCB 1RSFA 4FQXB 5FV2A 5EU6E 3V4UL 3VFUA 1P9MA 1MHEA 5EBWB 1LGVA 2YD1A 4LU5L 1J86A 4DWHA 1X5KA 3HB3C 2BDNL 1N26A 1P4BL 3GHEL 4ZUUA 1NCTA 1BQSA 1UVQB 3GFUA 1OP3K 4WJ5A 1E28A 2ZPKH 4XCFL 5EOCH 2YSSB 4O4YL 3AS3A 2AEPL 4UT6L 4PJ9D 4JQVC 3EFFA 4P59L 3S37H 4YXHH 5F8RC 2QSQA 2BNRA 5GRYA 2BSRA 2E8ZA 1A0QH 5EU6A 3GBNL 3RDTA 3S36L 4S0SD 3BDBA 1YUHB 1HIMH 2YPVL 4HPYL 4YHOL 3RGHA 3N1PC 2CLZA 4A2MA 3QCUL 5D72L 1QRND 1AXSB 4HS3B 4DJMA 5I2IB 4QKXB 3BKML 4NDMA 4Z8FH 2UZXB 1HXMB 2VXQH 2E5EA 3QDHA 1WK0A 4NHCH 3O4LB 4IS6A 1J12A 1U8OA 2YN5A 2X5PA 3RJDA 2EDLA 4L8CA 3ULVE 1EJOH 4S1QL 4QF1A 2DKMA 5F1OB 1T20B 5EO1B 1SBBA 5I75C 1HHHA 3WXWH 1CICC 2VE6B 1DL7L 4XP9L 3S3SA 3TWCH 3P73A 4PIRF 4Y5YA 3OR7A 1I3GL 4L4VE 2BRRH 4QRRB 5HY9A 5HBBA 3IYLW 4NKIH 3SBWC 4XZUA 1Q0XL 3ULSA 4A6YL 1TVDA 3QEGH 1U91B 5E7FA 2JIXD 4TVSa 2C3XA 4L8BB 3MJ9H 2H32B 2HAZA 1QHPA 1F4XL 4PYGA 4MNQE 3MTRA 3WIFB 4L4VA 3LEYH 2C4FU 4LCCB 1GIGH 1RZ8B 3LMJL 3ZSSA 2IBGA 4RNRA 3MOBH 3WUWG 1FNFA 5KAQG 2XWTA 3GSRA 4I5BA 4X99A 4TSBL 3INUL 4QXTA 4MVBD 4Q6IB 3MRNA 1JN6B 5K9KA 4RGOL 1YEIH 2DQIH 1MRDH 2OS7A 4MHHG 3NZHL 1H3PL 3NABH 3BKJL 4MNQA 5DUML 1BBJA 4Y8AA 1ZLSH 1I7ZB 3VFSA 5FO7A 2VDLL 3SEPA 3PWUB 1P1ZA 1U93B 2QHRH 2ITCA 1P53A 4NRXB 1Z9LA 4GRMB 3HI1B 4KKCD 4YQXH 5IVNA 3V0VA 1QRNE 1WAAF 4Q74A 4QXGH 5IR1B 1JCKA 4PJEB 4PRPD 1MY5A 1WWBX 1O5DT 4LBEA 3GI8L 4RCAA 1CXLA 3D3VB 5GSRA 1T0PB 2FSEA 5EIVA 3RPKA 7FABH 3RHWF 1KLGA 5BQ7B 4JZJB 4JQIH 1T2QL 1LO2H 3DV6A 3BGFB 1I8KA 1NCBH 2OZ4A 2CUMA 2DQDL 1QRNA 1CIDA 5TPWH 5EUOF 4YHZH 1CF8H 5HHOE 2JK5B 3FHAA 4LCIL 3FB7B 5F6HJ 1MWAL 4FNLL 4ZQKA 5KSAB 3FT3A 3QULA 1N5YH 4R3SA 4JFHD 3ESVF 4BELD 5FK9B 4KTDL 1NMAH 1Q8MA 2BZDA 1PEZA 3RKPA 4PR5B 4L3EE 3QR2A 2G2RB 3D6GA 1ADQH 2F53B 1C7SA 1XR8B 5HHOA 4M93B 3SGJA 1Q72H 1SEBB 4Y16C 3CFEA 4Z7VE 3IAGC 5JHLL 3QWQB 4PV9B 1U8IB 5CLWA 3UJJH 1YPZB 1FSKC 3BPNC 4QWWD 4XB7A 4QRUA 3QDJB 4HMEA 1DDHB 3M07A 1EGJA 4L3EA 4FTVD 4OF8A 4YHKL 3QXDB 4U6YA 4LNRB 3QZWG 4YDIL 2A77L 3VA6A 1INDL 3VXMB 4KC3B 4P3WA 5GS1A 1G7HB 2JIXA 1J7VR 4KK5C 2DQTL 5FM4A 4PUBH 3E8UH 4Z7VA 4WFHD 4Q9QH 4M7JH 3D1MC 3IDMA 3OWEA 3I85A 2NX5B 3H9SD 2A9ML 1ACYH 3WFHA 1T21A 4KFZC 2ZUUA 5ECJE 2OTPA 2VLKD 4JANA 3DROB 4P46B 1U8NB 5C71A 1K4DA 1ZMYA 5JA9A 3LH2H 3AY4A 5CZXC 5CIPA 4KI5D 5CJXC 5JXEA 5HI4D 4PRPE 2W9EH 1TDQA 2LVCA 4JFPB 1DN0B 5E6IC 1TFHA 3JUZA 2BC4A 2I9TA 3KYKL 5FM8A 5EN2A 2IAMD 1U3HD 1YEDB 4TOYL 1OD9A 5AZ2H 4JCMA 1L9MA 3WS6C 3CMOH 4ODXA 2CKBB 3Q1SL 5MI0C 2HFGL 5ALBL 5HGAB 3TFKC 3NIGF 3O2DH 3P9LB 3U0WL 5GRJH 4MQXC 1MIML 5EC1B 1XMWA 3BZ4A 2ZUQB 4PRPA 1FVDB 4UI2A 2AJXH 2DM2A 3MR9B 1C12B 1ZWIB 4NO2B 4M1DH 4JFHE 5FYJU 1FIGH 2OMBA 5EZIL 1HWHB 2M1KA 4AIZA 3PWLA 3CFDA 2QHLA 5I74C 5F89B 4OKVA 1XF4B 4JDZB 5BZDB 4JKKA 4Y2DC 3OF6D 3FRPA 5ACZB 4N8CH 4MJ2A 1X5YA 3NFPA 3LN4B 1BWWA 3OKLB 5BVJA 4XP5H 3O2VH 1EDQA 2YMXH 4ZOBA 5EZOH 4NCC2 3LPGA 4C56B 4JRYA 3O8XC 3GMOA 4JG1H 5ETUA 5EG6C 3JWDL 2XY1A 4WW2F 1XIWC 1VFOA 4MYWB 4FTVE 3RDTC 1JF1B 5FKAB 4LLVB 2XNAA 4OQTL 3P77B 2VDNL 3ZKNC 4OF3A 1RD6A 3S36X 3R1GL 1MI5B 3MRBA 2G60H 4WFHE 5INCB 5J89A 4H0GA 3OKMA 3KHQA 5I1EH 4JHWL 5DEFA 1LO3H 1DTUA 5T1KB 3RAJL 2K1MA 4AG4L 4DGVH 5L9DL 3QQ4B 2Z31B 1DBAL 4FTVA 4A6YB 2QR0A 3MLRH 3DTXB 3T3PE 1N6QH 2SEBA 4AMKH 2VLLB 2X4UB 3IFOA 2OTUA 3BP4A 4QOKB 3FQNA 4PJDF 4FZ8H 1KTKE 3MBED 1CR9L 4PJXE 4ZO8A 5FGCB 3SDAD 3ZL4L 3KPMB 4RISL 1AGDB 1DFBH 1XZ0B 4KMTL 4ODTH 5I15L 2EE6A 3ULVC 2X1OA 3HUJF 1WFTA 4PLKD 1IILE 4FQ2L 3T2NL 2A38A 3BMVA 1G7QB 5TFSH 1TQCB 3EO0A 3VD5A 5IEHA 4OBRA 3KYMA 1A6WH 4PJXA 1M7IA 1U3HA 4PJ8D 1RV6X 4FA8A 1K2DA 1NGWA 5EWIH 4QNPF 3MGAA 4O2EB 1VENA 1A3LH 1MLBA 2LU3A 3B9KB 5M7QA 5E2WH 4HXBL 2P8PA 5DJCA 4YFDB 2WIIB 5KSBE 1IAIL 4H26B 2ZOKB 3CUPA 4NKQB 5C0DA 1LP9E 2W9DH 2W65A 1CTNA 1F2QA 4P9MH 2FO1A 3PHOA 2ERJB 4Q9RL 4PY7B 5TF1H 1NCCH 1IM9D 3T3MF 1FL6B 1BOGA 1KIPB 1S7RA 1S78D 4HHAB 2F58H 4H8WC 3RZCD 1ETZB 5KSBA 1CXFA 3VDAA 3O45B 5I30H 5T3ZL 1KT2A 5E2UH 2JJUA 1LNUA 1CFQB 2DL2A 4HG4J 4PJ9C 2XZQH 1S7TB 4UIKL 2Q87A 5EULV 3WUZA 5FHBL 4FFWD 2R0ZH 1KJ3L 1A4JA 1UWEL 5CBAB 5D7JB 1ZHLB 2A74B 5MERA 3FAXA 3WFEL 3OB8A 3EDDA 4BSWB 3U0PB 1NCDH 4MB5A 4OLVH 5F8QC 4HWZA 4BUGA 5C0RH 3O3AA 5SWSA 1WBYA 1NC2A 1YN6B 2EDOA 1OAQL 3WNNA 5I8KH 4JKWA 4B7IA 1B6DA 5F7NC 4U1HB 1BAFL 4C57C 3OKNB 2R2HB 1T1XA 4NQDA 4CNIA 3K2MC 3AFLA 3UX9B 5JOFA 1JL8A 2KQNA 1ZHBA 4KQ3L 3SGJC 1FZMB 35C8H 3N1GC 5FA4B 4DKEL 3V52H 1GPOH 1WFNA 2VN7A 4YC2C 2OQJA 4I3GA 1YY8A 2BVPA 5JLZB 4KZEL 3MO1A 1M4KA 3GIVA 3HE7B 4EVNB 3HHRB 1IEHA 1HQRB 5DD6B 4GS7C 4O9HL 4CBPA 3IRPX 2OXHA 4APQB 4LL9A 1F2XK 4JPVH 3Q3GA 2ZWLT 4WGWB 3GJFB 4KI1A 1XAUA 4PJ8A 1I7TA 5C0CD 1H3TA 2E9JA 3GRWH 1QLEL 4U1GC 1ED3A 1CE6B 3RWIB 2VN4A 5JOPD 3OG6B 1W72A 3VXUB 1FGVH 4LLMA 5F72S 2XQBL 3RIFK 4MVBC 3MRJA 1JBJA 3AY4C 2ZJSL 2BOBA 2V5TA 1DZBA 3EO9H 4P23B 4Z7OF 4KGJA 5HHNB 5HDBE 4N9GB 4PJBB 4KJYB 3BO8B 1ZT1B 4XC1L 1IM9A 3KPSB 1U92B 5C09D 2ITDB 1KN4L 2XPGA 1A7NH 1YECH 4HS6B 5GZND 1Y18A 3MZGB 3IT8D 4ZPVA 3RZCA 3JWNC 4KKCC 2V9TA 3ARFB 5AD0A 5JIPA 4CDHA 1WZKA 3EYUH 3SQBA 4OM0H 2O26U 3RVUC 4HPOL 4XGZA 2PTUA 5LAXB 3L7EA 3ETBF 4WU7B 1MCRA 3FQRB 1A7BA 4R4NC 4U31A 2NY0B 3U7AA 1IQDB 4KK6D 3WO3B 1UACL 2NY3D 4NZDA 4PD4J 5F7FA 1DLHB 1GGTA 3I02B 1QACA 5I8EB 1U6AH 4CW1A 3GSVA 4DCQB 3U46B 2YWYA 4WO4A 2X05A 1OSPL 4J6RH 4TQEL 3NCFB 3EYVB 5F1IB 4MCZB 3BPCA 1UM4H 4OGAD 2L4OA 4IOIB 3CFKA 1N0XL 3FTGB 5FO8B 1X4ZA 3H0TA 4GAJL 4JGUA 2EYRA 2GT9B 1KCVH 3T4YA 2E7MA 3EJZD 4DFIA 2O5XL 1FRGL 4JM4L 3JZ7A 3S5LA 5FYKL 3MSPA 5FO9B 3TZVB 2X9XA 5ICXB 1OM3H 1FQ9C 4QWWC 1LK2A 1KB5A 2AERT 3HZMB 5L2JA 5F6IB 5JOPE 3BWUC 1CDHA 2VLJD 3VGDA 2VDKH 2FB4H 2OTWB 5C07D 4OF0A 4Z18A 2JJTC 2W60A 1KN2L 2CRIA 1FO0H 4OT1L 5BV7C 4OCNC 1AGEB 1AXTL 4UTAL 2CK0H 3GJFK 4P3CH 4O02H 4DTGH 5C09E 5D1XD 3WIIL 3DSNA 4U1IA 4HWEL 2M8XA 3HZVA 3W9DB 1I7UB 2Z93B 1XF5B 5DJ0B 2C1PB 1JYXA 2XKSA 4KI5C 5HI4C 3FB5B 5HYQB 5I1LA 4R26H 4LPYA 4AQ1B 3QXVA 3VH8G 3FO0H 1J1XH 1CDUA 3GKZA 2IAMC 1U3HC 2BNQB 1WTGT 4PJGF 1C08B 5KJRL 5C09A 2ADFL 1ZLWH 1QD0A 2HWZL 2YHGA 2BOCA 3UXFA 3VG0H 4BA8A 2VISB 3GMMB 3G08B 4NN5C 4OLEA 2HKFL 3DIFA 1E6OH 5DS8A 3VGHA 5CCKL 1NBZA 2FX9H 3BWAB 1UZ6F 4QCIA 1C16B 2YK1L 3IXTB 4HIIA 1FZKA 1MJ8H 4U1LA 1IGFH 1MCIA 4PJFA 2W9LA 1FFPB 2VR5A 5SV3A 3ZE1F 5LG1A 4OCWL 1E27B 4C59B 1JIBA 1UCBH 4IRJD 4E5XA 2ZZUT 3IFNL 3BJ91 4JQXC 4M9OA 1T0MB 1HHJB 1X4YA 3CXDL 5GS0H 1JGLH 1CD1B 1OAZL 4HIXH 1N59A 5DRNB 3LEVL 4LKXA 2F5AH 1YQVH 2FZ3A 2VLJE 2EIDA 4JO1H 5D7LA 2VXUH 2DQEL 2GKIA 3HMWH 4J2XA 1INEL 1JV5A 2GJJA 1VADB 3UYOD 4MD5B 5J12C 1JNNL 2X7LB 1YNLL 3O6KH 5GS2H 5C0GB 1J8KA 3MLTB 4KVNL 4YDJB 4EQ2A 3L5IA 4WTZA 3PL6A 2VLJA 4LARH 3C08H 4S0TD 4HKBB 1JPTH 1CT8A 2AW2A 2OJEA 5EU5B 1WSST 5K9JH 3I50L 1EAJA 2PYEE 2XA8L 4GH7B 3G6AB 5I16A 1L0XA 2WK2A 4N5ED 2VLRD 4MA8L 1HHIA 3GMNB 4HUUB 5IB4A 2ATKB 1M7DB 1X7QA 1X5IA 3MBEC 4M5YH 4P3DA 4OCXH 3SDAC 2D7QA 1C5DB 3MNVA 2FWOA 3D18A 5D1XA 2GJZB 2D2OA 4JM2B 3GMQA 2NLJA 1U8QA 2D0HA 4LRIC 5B38A 2PYEA 1KC5L 3MRIB 4PLKC 3MRHA 1KPVA 2X44D 3OR6A 3GBLA 3AREA 4E41B 4EUPH 5DRXA 4PJ8C 1OWRM 3KJ4B 2XKUA 2AEWA 4LHQB 1S7QB 1EEQA 2AJ3B 3IJSB 4PREB 3SPVA 1CGUA 1UWXH 1IFHH 4HC1L 1CGVA 2IWGA 3NN8A 2VZVA 5EBLA 4O58L 2MHAB 5BMFL 4Z9KB 4YHYC 1JRHL 4ZFOA 5HHMD 1UA6L 4D0CA 4NGHH 4HGMA 5E95B 4BQ9A 3FT4B 4TPRL 1XT5A 1IC5H 5EO0B 4ELMF 3IDXL 2APWA 4P4KD 2OZ4L 3SE8L 1QLFA 2X4RA 1S78C 4JKLA 5D70L 4AH2A 1FP5A 2EDWA 3HZKA 3RZCC 1LE9B 1U8LA 4P9HL 3V6ZA 2J1KA 5GGTA 1BLNA 3AROA 4MJID 1BBDH 3B9AA 3ECBA 3K46A 5EUOB 4FFWC 1C8PA 1NEZB 3RWJB 3BP7B 5DEGA 3VFOA 4H25B 5IMMA 2VLRE 2FD6L 5DJDA 4GAGH 3H3PL 3BH9A 3JWOC 1I3RA 4UDTB 2Y6SD 4QHUB 3NGBC 1FFRA 4QHLB 4OFPA 1GGIH 4F7EB 3IDJB 2P8LB 4XCEA 4F3FB 1EGJL 4BUHA 3P40A 1YJDC 2HTLD 2X2YA 3X13A 5B21A 2PTTA 4X6DE 5ILTL 1W2KT 4HFWA 3S35L 3BISA 3BQUB 5GJSH 1TJGL 1U8JB 1I8IB 3QHZH 4FZEH 4UDUA 1CLYL 1MIEL 2WP3O 3DYOA 1FG2B 2OL3A 4RMQA 1DCLA 1R5VA 4FMFA 4NJ9L 4P2QE 2KBGA 3VRIA 1ZSDB 1IEAB 4G8GB 4HH9B 4X6DA 4TUOA 4WHTB 5IJVB 3VD9A 4U1NB 4PGDA 4XNMB 2AEQL 43CAA 2VH5L 4AEIH 1R3HB 5CSBA 3FZUD 1ZLWK 1PZUB 5IT2H 5ITFA 3SKOB 3WNPA 5HHME 3KWWB 3IXAB 2XWBA 4ZSOB 1KIQA 4WI3A 1W0VB 1AIFB 3HPLA 3N1FC 3DUUA 4P2QA 5IK3A 5KVFL 3GEWB 5L8JB 1ND0B 2XYCA 3K2UL 3X17A 4NQUA 1G9NL 1BJ8A 2X4SA 4ODWA 1N8ZB 5IHUL 4HJJH 4FQIL 4LPVA 3ZKQD 3P3YA 1LEIA 1KIRB 5D5ME 2X42A 4U1KB 4UV4H 5D1QD 2J2ZA 2V2WA 4K8RD 1FZOB 2IQ9L 3QG7L 3TYGH 4JFED 32C2B 3GHBH 4PTTA 3ZKMD 5JPMB 3LQAH 4HUXA 3QZWB 2EDFA 4WENB 1YEFH 5JIIA 4XPFH 1NH6A 3QSKB 2ICWI 5E8EA 4OD1H 2EH8H 3QUZD 4X7DC 1KULA 4JKPH 3MV9D 4P4KA 3RVVD 5BS0D 2WUBH 1BFOB 2DLGA 4X7FC 1WZ1L 3V5DA 5KSVB 5L2KD 1IGTB 5GZNC 5D5MA 4CMHC 4YO0A 3LKPB 3VJ6A 2LFGA 5E03A 2AJZB 3R0NA 4YXLL 1XR9A 25C8L 3OAUH 2H3NB 1CXHA 3RHWK 4UZGA 4DGIL 4RGMB 4PY8J 1T6WA 3SDCD 2CD0A 3JTSA 4GG6B 3MV8B 3UTTD 4DK3A 4KK6C 3BESR 4DW2H 5KBNC 4WW2B 2NY3C 2JELH 3ULUF 4LSQL 2ZP0T 1JZ6A 5I17A 4OCSL 1SM3L 4LHUD 5F70A 5ICYA 5DJXB 4KHXH 2DM4A 4OGAC 1CK0L 1WBZA 1EHNA 1UXWB 1OQXA 1H3XA 3ALWA 3EJZC 3NAAL 3SQOL 1N5AB 4M7LT 1X5JA 3IAPA 5F9OL 1NLBL 1HE7A 3CVHA 4J23A 43C9A 2XZAH 4QHNB 4LPTA 3MACH 3MMEB 1FORL 3O6FA 4P2OD 4Y4FB 5DZLA 1PY4A 4DEPB 4DGYL 1QFPA 4N9OB 2VL5A 2EIZA 4Z7UE 1A6ZB 1QBLL 4PJCE 1Q9OA 4ZD3H 1NFIA 4GMSL 4LSTL 4LVNB 4U1JA 4UOJA 4OI8A 5D2LB 4G9FB 5DTFA 1XEDA 3N1MC 5GS3A 1SYVB 3TCXA 4RMRA 5CEYB 1OAKL 5T1LA 2Y36L 3KPRE 4LF3B 3PJSA 1G7IB 3MRRA 3IGAA 1TZIB 5KZCB 3SDDD 3HUJB 4X4YA 4M43L 3FO1A 2R0KH 5HGHA 2EXYC 4PJCA 1Z3GL 4ZYKB 5TE4L 5D1XC 4OLUL 5DD1H 2ED8A 2H6PA 1UXSA 4PP1D 2H2SD 3V4VL 5ALCH 4I48B 2NW2B 4MAUL 2GSIA 5FHAH 3OSKA 1GOGA 3KPRA 3U4EB 2AQ3A 1VEPA 5BVPL 2HLAA 3MYJB 4L8SB 4UUJB 1P84J 2W91A 2BFVH 1T89C 3MRMA 3SE9H 3QUZA 2YEZA 2Q6WA 3HC0A 3CDCA 1ZHNA 4UTBL 2HN7A 1LO4L 4JVWA 1NFDE 3PV7A 2W0KA 3HG1B 3TJHD 2RHEA 1PX4A 3RA7L 1MF2L 3TJEL 4MA1B 1CFVL 1FZJA 4HD9A 3OJVC 4HLZH 3DMMA 3KS0H 5MEND 2ZUTA 5AG8A 4FFVD 3TT1H 1INQB 1G9MC 3SDCA 1PW3A 2F5BL 5JNYB 3ZE0F 3B5TA 5C08B 3QIUB 1KXQE 4IM8A 4IRJC 4QRPD 3VWJB 2ID5A 1CLOL 3TO4D 2PO6B 3NMEA 2CXGA 4M48H 1DQDL 2R0WH 1MCJA 3IJHA 4D0BB 4J3VA 3S8WA 2ICES 3SDXE 3GNMH 3QUML 5JORA 2KQMA 1BM3H 2WBKA 1VDGA 3EYQC 4OZFA 5LJYH 4AT6B 4G8IB 1KELH 3I6LE 4RDQF 4P2OA 2LV4A 4I3SH 1TVBA 3OAZK 1EEZB 2ZCLH 5JQ6H 1HOCA 1JGEB 1MFAL 4PJ7E 4QXUH 1NKOA 1N7ML 3SDXA 3GSQA 5HI5D 1TZGH 4NNXA 2Q8AH 2H1PH 2R1XA 3L3KB 4JFFB 2CLRA 3TGXA 2X1QA 5FA3A 4N5EC 4HGWA 1I9JH 1KEGH 2DQJL 1T5WB 3SGDI 5F96H 3SDDA 1Q9KA 3S35X 1A4KB 4N5UA 1NGYB 2NY1D 4GXVL 1ZT4A 3TA3D 4PJ7A 3QHFL 1E4WH 4BZYA 4TVPL 2J6EH 3CDYA 5DRWA 4ORGB 3RWFA 1YNKL 2YBRA 2JJWA 3WFCH 2R69H 4EDXA 3DHMA 1BHGA 1BREA 3DXAB 3W0WA 4NQXB 4EN3D 1F00I 1CU4H 3K0WA 4PGEA 2XTJB 1IZKA 5IFAH 2C4XA 4JN2B 5HYJD 1NAMB 4DZ8B 3ZDXF 2DJUA 3RNQB 4JO4L 1QA9A 2XWJB 3D2UB 4CVXB 1S7WB 1LDPL 1HEZA 3G5YB 2AVGA 1OAXH 4KK9D 3ZKXB 4GBXB 3FOMA 1E4XL 4Y4KB 3T0EE 2DJ4A 1GOHA 2Z8WC 4QRPE 4LVOC 3UYRH 1IJ9A 2NXYB 3FOLA 3JVGA 4NO5A 5GGUA 3VCLB 5C0EB 4DOHE 1AJ7L 4CJ1A 2Z92B 3DRQA 1A1MB 4P4KC 3W11D 4UT9H 1IZJA 1UM5L 3PGCA 1V05A 5CEZH 1YNTA 1BFSA 8FABB 3T0EA 4JFXB 3HFMH 1X9QA 2BVQB 4QRPA 1T22B 2Q76B 5C0FA 1ZV5A 1H3WM 4L8DB 5B4MD 5DMIH 1D5ZB 5T33H 4LQ1A 1T7ZA 1KJMA 5ADPL 1ZVSB 1FLRL 3SJVB 3FONA 2WLZA 3EOTH 1QSFD 3B9VA 3HE6D 4NKOA 5DQJB 5IQ9B 3PWPB 2Y5TB 1N2RB 4PYHA 4X9GA 4ONGL 4XPBL 5FUCE 1PFCA 4JRXB 3O9WB 5GIRA 4XWOD 4NUJB 4K7PH 4G8FA 2Y6SC 2FJFA 3H7BA 1KB5L 3CLFL 4JE4B 2CJUH 5FCUH 2HTLC 4UAOB 5HSFA 1O7SA 3VFRB 1JUFA 2HJKB 4OF6A 4HXAL 2AJUH 2APVA 4M7LL 4XAWL 2MCG1 2QQNL 4ZS7L 3UTZA 4LDLB 3DVNB 3V6OE 3V4UH 2EDYA 1HSAB 4S1DD 4ZAKD 5FGSA 4KRPB 4JR9H 2Z9TA 2P4AB 2BDNH 1P4BH 3GHEH 2GUOB 1VACA 4NQSB 1JGDA 3LZFL 3U4BL 1F02I 2E9IA 3D85B 2ZUXA 5AUMB 4M61B 4UT6H 2AEPH 1N64H 3FZUC 4JKMA 3S34H 2BVEA 2VZSA 4EN3A 2IQAA 3QXAA 3QH3A 3V6OA 3GBNH 1HXYB 1R5WB 4KRNA 3VXOB 3U2SB 4QLRA 4EI5B 3T0BA 5GGVL 3G6JF 1JP5A 2YPVH 4HPYH 4YHOH 2WWKT 4Y4HD 1ZOXA 4ODVL 2X1WL 1FNAA 3WIHH 3BKMH 5D1QC 3OKEA 1JRHI 4PJGB 5E24E 2XRAL 1H5BA 2V17L 3X12B 3MRCA 2J5LC 4JJ5B 3ZKMC 4P5TD 1D6EB 5C3LD 1S7XA 5JPNB 2WBWB 5C0BB 5BW7A 1GGUA 3RVVC 1QSFE 5D71L 1HI6A 5BOPA 4PTUA 2R1WB 3P9WB 3QIWD 2Z91A 1ZE3C 4XP9H 3BOVA 2VDOL 3VFWA 4KJPD 5D96B 1I3GH 3C9NB 4MNHB 4POUB 4HMCA 3WHE1 3I6KB 3GMLA 3MROA 3QEQD 5FGBA 1OF2B 3FFDB 2HJLB 5HGDA 1QEWB 2FH8A 4LAQL 1Q0XH 4OKDA 1HDMB 2I60L 1MHCB 1BWMA 1NDMA 1QSFA 1S9VA 1BVLA 1F90L 4WEBH 5FYLH 3VH8B 3S6CA 3SDCC 2CIKB 5HJ3A 3RL2B 2CDGB 5DURD 2AXJA 2ICCA 1F4XH 1KENL 2CIIB 4I1NB 1L9NA 4PBVC 2D9QB 3LMJH 1GAFH 1NUFA 2FIKB 2B39A 5LGKA 4TSBH 2UYLB 1IC7H 3ZTNH 3GSNH 1U8PA 2PF6A 3UDWC 3MJGX 1KPUA 2H9GA 4JY4A 1CVSC 5I8CA 3NZHH 4DVBA 3ARBA 1HHGA 2CSPA 3BKJH 4XXDB 5DUMH 4R97B 3AM8C 3HNSL 5DK0A 1T83A 3UTSD 5T1MB 3MBXL 4NQEB 4WHYG 4IHOA 4P2OC 3HPJA 4HZAA 3L3IA 5C7XL 4BQBA 4QEGA 1FNHA 5EBMB 4RZCA 1WWCA 3OZ9L 4H1LG 4NM4L 2AJVL 1KYOK 3GI8H 1OSZA 4JFZL 3ILQD 3MCG1 4MD0B 3CH1B 1L4IA 4JN1H 3SDDC 1T2QH 2P44B 2AK4E 3MRDA 3DBXB 5C8JA 4HUVB 4XMPH 2VJXA 3ULVF 3L3OB 4Y19B 4D2NA 1AQDA 5H35A 1T7XA 3VXSB 2DBJA 4YHPB 2AXGB 1RY7B 4LCIH 5J6HA 1MWAH 4FNLH 2UVEA 4PP1C 2H2SC 3WFDL 1WF5A 5EZLA 2MOVA 3LV3B 3ZE2E 3CPLB 5TGBB 4KWUA 4KTDH 2C7UA 4XP4H 4X98A 3DI2B 2R2EB 3EW3B 5T3XL 3SGKA 2AK4A 1GSMA 1KV3A 1HHKA 3O81A 5D7IE 5IHLB 4PJIE 4WGVB 5ESAB 1JWUA 2B2XL 4X6FA 1I1AD 2EEBA 1S8DA 2W07A 4NPYB 5EH1A 3TBSA 5IHZA 5I76A 5LWYL 4RAHA 1KIUA 3V0AC 3TJHC 3W39B 5DMGD 2CDFB 4G80B 5I18L 1A7PL 4PJAB 4YHKH 5IGXH 4NOBA 4I0PB 2GTWA 1OGAA 5D7IA 4K7FA 4L4TB 4PJIA 3STBA 2A77H 1INDH 4FFVC 1XFPA 1RZGA 2Q86A 3TN0D 3C60B 3K7UA 3EOBB 4NT6B 1TPXB 3UTSE 5E0QA 2A73A 1ZS8A 3TIDA 3NPSB 4NQTA 3TO4C 2NXZD 1KNOA 1JTPA 1NUGA 3JXAA 4IEFB 4Q2ZA 3M17B 4GUPA 4XP6L 5DR5L 3QDMD 4PV8A 5E8OA 3QNYB 4GRWB 1A14L 4N8VG 5E9DD 5E00A 3C6LB 3KPOB 5GS0D 4M8QB 1C1EL 2VO5A 1A6VL 1KCUL 2PYFB 5FOJA 4XVTL 1X5XA 1I1YB 4WUKL 3DECA 2OL3L 1FYHB 3KYKH 4QTHA 3UTSA 3FO9B 3VMPA 4TOYH 1WEJL 3TNNB 2ADJA 1FNEA 5ACMA 4NYLB 4L29A 2R29H 3MODL 5L7XL 2AV7B 3Q1SH 2HFGH 3TPKA 4X6CE 2FECL 1MIMH 5GS2D 3RVTD 5IB2A 1S9WA 5HHXH 1HKFA 2XICA 2LU4A 2ZG1A 4KROD 3RUGE 4OM1L 2EDNA 2B7DT 1D9KA 4J1UA 3B2VH 4X9BA 5EZIH 2XZZA 5FUCC 2GI7A 3H6JA 5F1KC 5F93C 2IPTL 3BP5B 4IIQB 3MYZA 2XTLA 4V2BA 2NY1C 2VUYA 4X6CA 1LO0L 4WDIA 5DLML 3TA3C 4W4NA 1F4HA 2ZSWB 5ISZD 1HZHL 2K7QA 3UZQA 1JYVA 1QBAA 2DWDA 3RUGA 1ZA6A 4BH8B 1DE4A 4Z7VF 4ZDHB 1IM3B 1QFUL 3JWDH 5IIEA 4GOSA 4EN3C 1VGKA 4XH2A 3I6GA 2IBBA 1MCSA 4ETQA 1CE1L 1LILA 4OQTH 3M45A 2VDNH 4UV7L 3OHXB 3NACL 5FUZL 1D5IL 1J8HB 2ARWA 4S1RL 4YUEL 5EO9A 2Z35A 4W70A 5IEKA 2BVTA 3WXVL 4ONHB 1I1AA 1RJYA 4K3GA 1MFNA 5CSGA 1KG0B 1DVFA 4AG4H 1OOAA 4YH6A 4YFLI 3O11B 1IC1A 1DBAH 2VIRB 1PEWA 3IFLL 3ROLB 3F7RA 1J11A 3QG6B 4GXUM 5F7DB 3WHXB 5DQDL 1KCSL 5EU3A 3TN0A 3W11C 1XCQB 1B6UA 1FFQA 4PRIB 2W0FB 1RK1B 1HINL 3P9MA 1W0WA 4LIQL 1CR9H 3WNLA 2P8MB 4OD2A 5A43C 4RISH 3U7WH 3FN0L 3HNVL 3QNXA 2NY7H 5B4MC 2DTML 4NO0B 1GGBL 4KMTH 3QUKA 4KV5E 5FGBC 5I15H 4CMMB 1PD6A 1EVTC 2PW2A 1OCWL 3QJFB 2G5RA 4FQ2H 5IB5B 1BJ1J 2DWEB 3T2NH 4XNXL 2HFEA 4OLYL 2QQKL 3HE6C 3WEXA 3TH4T 2DIAA 5FECB 2QEJA 3S7GA 3QBTB 5A1AA 1G1YA 1MJJB 2M2DA 3TBVB 3CSBA 5JR1L 2PKDA 4XWOC 1HK6A 3NFNB 2CUHA 3EO1B 3SKMB 2HJFB 3ZZ1A 1WCBB 4KRLB 1FCGA 5ISZE 3FQUA 2X4PB 2X4NA 1FFNB 2D31A 2VXSL 4MDIA 4JO2L 3DURB 4RA3A 5H94B 4F8TA 1YEHL 1F4WH 4IDJL 3BRFA 3KXFD 4S1DC 4ZAKC 2GFBB 1RUAH 5ISZA 3RTQD 2YUWA 3C5JB 1H3UA 5T3ZH 1NGPL 3SCMB 3KLSA 4JG0L 2NY6D 4UIKH 1AHWA 4YDKL 5E08H 1DBBH 4MWFB 1CL7L 5FHBH 2VITB 4K71C 1KJ3H 2ZUVA 3LQMA 2GJ6A 1WISA 5FKPB 2GITA 5CUSH 3T77A 2EDJA 3WFEH 2V7HB 2NY4D 3T3PF 2YZ8A 4Y4HC 4EUPA 5C0IB 4BFIB 3TIEB 3WYRA 4K55A 1VSCA 1FNLA 4LSSH 5F9AC 2QADD 5F1NB 3WFZA 4PJXF 2RCSL 4HAGA 3ARZA 3BPOB 4HK3J 4P5TC 4LPCA 1BAFH 3QNZA 2WBJA 1EA9C 4MCYA 2FGWH 2HVKB 3KLDA 4PS4L 3VXPA 4KQ3H 1R3JB 3QIWC 4DKEH 2EC9T 4WFFD 1V3KA 3K8MA 1MH5B 4K3EL 4KJPC 5ELIA 3KPPA 5CWSA 5IWLA 3D48R 3BGAA 3SKJL 4NC2B 1CCZA 4XXCA 3WN5A 1CLZL 4CADA 4O9HH 5DI8A 3U36A 1SEQL 1QLRB 4BH7A 3LKQA 5F7UA 3DX7B 4HJGB 4MJ4A 2P49B 3AVEA 1FL5A 4OIBA 4ZTOH 5KSBF 2EYTA 1D6VH 4M6AA 3AB0C 3V5HB 1LP9F 4X9HA 3KPQB 2ICWB 2ESVA 1GL4B 4RWYH 3IDGB 3KXFE 4D8PA 3SE4A 4OIAA 4YFLF 3ZTJG 3EDFA 1KJ2A 1L7TL 4QY8B 4H20L 1H0DB 4X4ME 3KLAB 1VHPA 2ZJSH 5DGQA 3UTOA 1EAPB 1U8MA 3HAEH 1J05B 4F33B 3IU4L 5L0QC 4OFVA 2VSCA 2FX7H 3DO3A 5I75B 3NIDE 1UB5A 4ZPTB 1CICB 1RZKL 4DUXA 1KN4H 1A7OH 5J1AB 4YDVA 1CFTB 2XQYK 3W5MA 3TYFA 2BMKB 2EXWD 3ARRA 4X4MA 4HDIB 1RK0A 4NZRL 3MJ8A 3THML 4NO3A 1QYGH 4LDOB 4D94A 2VRAA 4HPOH 1Z9MA 5GGQL 3ILQC 4JFOB 1U58B 1JPFA 3BEVA 1XF1A 3O0RH 4ZFFB 4ZUVA 1JPST 3TV3L 4RX4D 4MQTB 4ODUA 3Q0HA 3FQXA 3D0LB 5GJTL 3UTQB 4GG8B 2RBLA 5DJ2B 4W6XB 1UACH 3RU8H 4PB9L 3W2DH 1Q9WB 2BSSB 2DLFL 3DX8B 4PJ5D 1ZHKA 2NQCA 3UC0L 2N7BA 2RFXB 1OSPH 4TQEH 1SY6A 3E6HB 1QFWL 4R96B 3WHE0 1A1NA 1L6XA 5C0AB 2FATL 1JWSB 3RX5A 4PG9A 4GAJH 2AGJL 3T8XA 3CVIL 5I1CL 1NCAL 1ES0A 1YMMB 1DJSA 1IEBB 5C2BL 2O5XH 1FRGH 1P7QD 4GKNA 4JM4H 5FYKH 1I1AC 2N1KA 3QWRD 4TYUA 1EFXA 1PG7W 1RJZB 1JYNA 1SYSB 2BY1A 1GZQA 4NJAH 1TMCB 5CJQL 5DMGC 1S5HA 1MFEL 3BDXA 3ESUF 2OMNA 3IU3A 4MD4B 1JZ3A 4RQQB 3PGFL 1A1OA 2CKNA 3S3JA 5J6GA 1XGPA 5DK2A 4D0DA 3QDAA 1RZJC 4K23L 1JFQH 2L7JA 3TN0C 3MRFA 1OLLA 1KN2H 3BE1L 4B41A 5CZVL 1F45A 1AXTH 4ZUTA 4UTAH 5ANMB 4R0LA 5HDBF 2NXZC 2BSTA 4HS8H 1OAYH 2XXCB 3P2TA 4H8WL 4HWEH 3RWGB 1RUKL 4R7NA 4YHLL 2GK0A 3QUXA 5GS0C 4WHCA 4DQOL 3FFCD 3LPWA 3MLZL 1RUQL 2A6JB 5KVGL 1AQKL 3PNWB 4OI9A 1RFDL 3JTTB 3IF1B 2ADFH 1Y6MR 2WM0A 1LD9A 2HWZH 4Y16B 2ZCHL 4FQHA 4YIQB 4OZIE 2VXTL 4S2SA 1FSKB 3U9UB 3BPNB 4PJHE 1BFVL 1M05B 3GO1L 3RVTC 4PRBA 5HYFA 3Q48A 2OM5A 3TNMA 2CMRL 3QFJB 4KROC 4RMVA 3STLA 3QEHB 2YK1H 5ADOL 3Q5OA 4JZNA 4OFYD 1GC1L 4GW5B 1RJCA 3NTCL 3MLXL 1AO7B 1IL1A 2P5ED 3UPRB 4PJHA 1IKFH 4LLUB 4Z7NF 3RWEA 5SWZB 4OCWH 1IAOB 4LKCA 5ENWA 5K9OA 3IFNH 5BRZD 5T5NF 3CAFA 2PR4L 3LVEA 1TTGA 3QDGB 3BH8B 4XWGH 1EVUA 2PXYD 5F3BB 3QUYD 4OCYL 3CXDH 4GW1B 2C1OA 5IM7B 3UBXG 1PGRB 2OSLB 3F7VA 3PWJB 3LEVH 4CU7A 4KGLA 4UBDD 1MFCL 4DKFL 2DQEH 4R6UA 5E6IB 4XMKL 5JHDD 2BNUB 4MNGE 3CDGB 1CD0A 4PP2B 5J13C 1LDSA 5CLTA 3QWRA 2YN3A 1RUMH 1JNNH 1YNLH 3U1SL 3LIZL 4LLDA 5MI0B 2F54B 4FXGB 3BN9D 4KVNH 3UO1H 1KB9J 1F8TL 1V8HA 4HS3A 5I2IA 3I50H 4Q58C 1HXMA 4RFOL 1CN4A 4FOMA 3HI5L 3R4DA 4ODBD 4ODHL 4V1DD 4Z7WB 5I74B 3MLUH 1CXKA 1FNSL 4Y2DB 1JZ7A 4C4KO 1MHEB 1I9IH 3F7QA 2UY6A 2D3VA 1T20A 1I1FA 5JA8B 4KQ4L 3VGAC 5CEZD 5IWLC 4ZUUB 3G6DL 1A7QL 2FH6A 2VE6A 4WJ5B 4ZUWB 1KC5H 1E28B 4G6FB 3WN5C 3O8XB 1TCRA 1YDPA 2BNRB 4I4WB 3OXRB 1JMXA 3RDTB 3LY6A 5A2LH 3B3IB 4RBPH 4CL7A 5IFHH 2MMXA 2YC1A 3S88L 3RY6C 5EA0H 1R3KB 1U91A 3WSQL 2P5EE 2X6MA 3HR5B 5KW9L 3TH3T 2FECI 4L8BA 2H32A 4NDMB 4HC1H 2H41A 3ALPA 1PG7L 4PRHD 1K85A 4PRNB 4O58H 4BM7A 4LEOB 1NDGB 5BMFH 1RZ8A 1NPUA 1JRHH 5HYSG 3L1OL 4PLOB 2YXFA 4L8CB 4QF1B 4UINL 3U7YL 4E42B 4P0DA 4TPRH 1FH5L 4BFGA 3QCVL 4Q6IA 3IDXH 2OZ4H 3SE8H 2OX5A 2P5EA 4HT1L 1HHHB 1A3RL 4X5XA 4HGKC 5HXMA 3DUSB 1HCFX 3RTQC 1A47A 3BZFB 3VWKD 3LSOA 4P9HH 2BY0A 4G8EB 1TZHA 1F13A 1JHKH 1J10A 2NY6C 3HI1A 4GRMA 3RGVD 4KPHL 4R4BA 1JPSL 1YYLL 3PXHA 1WIUA 1F6LL 5IR1A 4G6ML 4UQ3B 1RQ5A 2NY4C 3QXWA 2FD6H 4V1DE 3H3PH 4L4VB 5EZJB 4XPGL 5BQ7A 3CU1A 1FG9C 5I1DB 1BQHA 4ONFL 1CYGA 2DQUL 5B22A 4KKLD 2QADC 1EGJH 2F53E 4X99B 1UGNA 3I9GL 2JK5A 5I6XC 3T0DA 5BCAA 3FB7A 3MRNB 4H1LB 1RI8A 5ILTH 4S1SH 3S35H 5KSAA 1TJGH 1J1OH 4ZFGL 1YPZE 3OQ3B 3ARYA 1CLYH 3LQAC 4V1DA 4D9QE 1MIEH 1BBJB 2V5SA 4QTIH 5EUKB 3OJ2C 5FO7B 4GFTB 5DHYB 4NJ9H 3EIFA 2G2RA 1P1ZB 2F53A 2ITCB 3ZYJA 1XR8A 1FJ1B 2WWMD 3EDJA 4LVEA 1T1YA 1EXUB 1SEBA 3NA9H 4PV9A 1U8IA 2YZ1A 3F58H 2VH5H 4PRHE 4BSJA 5IQ7L 1YPZA 2NX5E 1P4IL 4PJ9B 2J7LA 1ONQB 3GDBA 2RR3A 2XIDA 4K94H 3A6BL 2FSEB 1DDHA 1MCHA 2XN9D 3G04B 5KVFH 3QXDA 5ITBH 1ZTXH 4LNRA 5FYLD 3VXMA 3K2UH 1G7HA 4OB5H 4R0LC 1QRNB 5ID1B 1YEKH 4J7RA 5IHUH 3X3GL 3DNKA 4FQIH 1OP5H 4PRHA 2NX5A 3B43A 1T7VA 2OCFD 5IG7B 4NNPH 2IQ9H 3QG7H 4R3SB 5HDQH 4NN6C 4LSUH 2EDBA 3DROA 1U8NA 5FXCH 1FFOA 5GRXG 5F7HA 5DJZA 2RQ8A 2FJHB 1HYSD 5TF0A 5D4QA 1G84A 1MY7A 1WZ1H 3AS1A 1J0YA 4JFPA 2CPCA 4JZOA 5I1KH 1EHAA 2UUDH 3C5ZD 3VWKA 2EXWC 4H88L 4YC2B 1DR9A 2B0SL 3H3KA 2QQQA 2FBJL 4Q9BA 5DRZA 4KVCL 2MPAH 4RGND 4YXLH 1QNZH 2CKBA 25C8H 3RGVA 4GS7B 5EOTB 3P9LA 3S4SG 3FHQA 1QTYT 5GS1B 4QO1A 1FVDA 4YAQA 4Z7QE 5JMRA 4X6DF 2B8OT 4C56E 1VA9A 4LPXA 4OZ4B 1C12A 4M02A 4WVRA 1ZWIA 3MJ7B 4WUUD 1OW0C 4ETYA 4P57A 4U1GB 3Q5YA 4XBGA 5F89A 1M1SA 4LLWB 4I18C 1SM3H 4JDZA 4OCSH 4YNYB 5IUSA 3TPUB 2APXA 2VQTA 3HMXL 2MJWA 5M94B 1PQZA 4WW1B 4DN3L 1MI5E 5CIPB 4XAKD 1Q9LA 1CK0H 1EO8L 4C56A 1JE6A 1A02N 1GGCH 2BC4B 2I9TB 1MRFL 3FMGL 5EN2B 4FQLH 4LSRH 5F9OH 2XN9E 5ID0B 3C2AL 1B9ZA 5FKAA 1EUTA 1CDYA 1FORH 4DGYH 4ZUSB 2AI0L 3V8OA 3H9HB 1CS6A 4Y5XA 4H5SB 2BP3A 5SX5H 1MI5A 2P48B 4LSTH 3X3FL 5INCA 4PRPB 2ZOLB 5FYJE 4TSCL 5T1KA 4CGTA 5FGCE 4CU6A 1OAKH 2YOCA 2DYPD 3QQ4A 1UCTA 1WFOA 2Y36H 1FNGA 5D5MF 1XF2B 5DJAA 5EU7C 2MTPA 3PWLB 5D8JL 2D7NA 1JNHB 4A6YA 5E70A 1D5XA 3DTXA 3D9AH 4M43H 4GJTB 4YBLC 2J4WH 4PFEA 2DQHL 2VLLA 4M6OL 2EYSA 3F62A 5E2VL 5BVJB 1Z3GH 5IHBA 5DHVB 5TE4H 4QOKA 4W6YB 5IBUG 4OLUH 4CKVX 1CGTA 3V4VH 4KUZL 2PETA 4MAUH 2ARJB 3KPMA 5BVPH 1AGDA 2HFFB 5DSCA 5DA0B 4B50A 4I3RL 3GSWB 2XNAB 4XVSH 4WTXA 3N50A 5DJ6B 5IESL 1G7QA 4WWKD 3MRBB 4ISVB 1OT2A 2B5IC 4JAMA 1B0RB 1L7IH 4UTBH 3OKMB 4WUUE 3VD3A 5DEFB 1LO4H 2J88L 2VL4A 4OIIL 4O2EA 3RA7H 1GCFA 4FTVB 1REIA 3TJEH 1CFVH 1YEJL 1EMTL 3GI9L 4HK0A 2QR0B 1KSRA 1EPFA 3WJLA 4QRTB 4F9LC 4GO6B 4XBPB 4XAKE 2HKHL 3SKNB 2F5BH 3FQNB 3CH8A 4YK4C 4WUUA 3V9FA 3H9SB 5BV7B 5JDSB 4AM0B 3DI3B 4N0FB 1F6AA 5E5MA 2VLKB 1AGFA 1CLOH 3OX8A 1AR1D 2PXYC 5H8DA 1FL6A 3QUYC 4HHAA 3HNTL 3WNKA 4LPUA 1EEYA 1ETZA 3R0MA 4Z7UF 4XP1L 5KANG 3O45A 4PJCF 4UBDC 1R3IL 2D7OA 3QUMH 4QRQB 5IEHB 4YXKL 4J3OC 1S7TA 1RZIB 4PJXB 2IAMB 1U3HB 1DEDA 1K2DB 2VDRL 1NGWB 3BD5A 5DFWH 2VWEE 5CBAA 2A74A 4LHUG 2D4DA 1QFOA 4NN5B 1LMKA 3RWDB 3BN9C 1CG9B 2JB6B 2OXGA 3U0PA 3WO4C 1N7MH 4NUGL 2DYPA 3GIZH 3WKML 3L5XL 1YN6A 1GJIA 3DX9B 1OP5K 3F7PC 4GLRH 5DK3A 3K8LA 4U1HA 4P99A 3OKNA 2BVUA 5EDXA 3QJHA 4GXVH 5ESVA 1S7RB 1WIOA 3QHFH 4BQCA 4YPGA 4ERSL 4OSUH 2E6JA 4QGYA 2JE8A 1B90A 1KJ2L 1YNKH 4IRSD 1KT2B 1FZMA 5FA4A 4LSVH 3OGCB 1LNUB 1LP9B 2VTFA 3IDUA 3C8HA 5JLZA 5E56A 1U8HB 5SWQB 1NFDF 1MCOH 1S7UB 4AYFA 2UUDK 5DD0L 4EVNA 2VZ3A 5DD6A 4JO4H 5MERB 4PRAA 1LDPH 1D5BB 2R0LH 1IQWH 5E8PB 4J8RA 5CKGA 4DN4L 4BQ8A 2CLVB 5J12B 5KTEL 2HYMA 4F58L 1WBYB 3DYMA 4FP8H 3CDFA 4MS8D 2B1HL 1CE6A 4C83B 3MFFA 3RWIA 2EZ0D 4IJ3C 1NBYB 1H9VA 3UJIL 1S3KL 3VXUA 2RIKA 4EXKA 5J11C 1AJ7H 4HWBL 4WY7H 1HKLL 3TO2A 3UMTA 1UWGL 4P23A 3SDXF 3MBEB 1N6UA 3SDAB 5HHNA 3VWKC 4N9GA 4PJBA 4JFDD 4KJYA 2OQJB 1YY8B 3O2WH 1ZT1A 3SDYH 4M7ZC 3GIVB 4O00A 4R4FH 1HWGB 1SY6L 2DQGH 2V5MA 1U92A 2ITDA 1T66D 5ADPH 1FLRH 1SMAA 3S97C 4HS6A 5D9SA 1G6RL 3RGVC 5T3ZD 4FFZL 2HVJB 4EI6B 3ARFA 2LAAA 1KJVB 4PJ7F 2PCPA 1K6QL 2C4FT 4U1MA 3BGMA 2BK8A 1PSKL 1GHFH 4PJ8B 4XPBH 4OV6F 1T04A 4OQTA 4XCCL 4WU7A 2PN5A 1BF2A 3BUYB 4KY1L 5DFVD 4UNVA 2NNAB 1ZLVK 4IOFD 4XNYL 4TTGA 1KB5H 5TDOB 3VG9C 5H37H 1TVHA 5LQBH 2W0PA 1IQDA 1W72B 3CLFH 2AJSL 5FAAA 3P4MB 2HRLA 5IW6A 1RULL 1DLHA 5CP3A 4YHYB 2GQHA 1I85A 3PDOB 1K4CA 1PKQB 3C8DA 3SE3C 4WFGE 2ZG2A 4KDTC 4M7LH 4XAWH 2QQNH 3EYVA 5F1IA 1WC7B 3FTGA 3MCKA 2DMCA 1IM9B 2GT9A 4YR6B 4R90L 3RZCB 1MAKA 1WT5C 4Y5XC 3M1BA 2ZG3A 2WWMC 1A5FH 3SGEI 3TZVA 1MNUH 4EZMA 5EC2A 1PX3A 1DSFL 2A2QT 4U0RC 2Q7YB 1UEYA 1FC1A 1E4KA 3HRZA 3CJJA 5GGVH 2OTWA 1OVZA 1OTUD 2XV6B 3MA9L 1FYTD 3V2AR 4CVUA 4M9PA 3NGBB 3DARA 2IAND 4O2FA 1CFNB 3OKYA 4JFDE 2BNQE 4PG2C 2NCMA 3P0GB 2XRAH 5EPMB 3EYSH 1J9CT 1FVCB 1QSEB 3BPCB 4FG6D 4ORZC 2W38A 3FQWB 3H0TB 5T3ZE 3W9DA 1K8DB 2Z93A 1OWWA 1XF5A 5DJ0A 1YYMH 1HYSC 2C1PA 1PKOA 3JBG7 4MAYD 5D71H 4DAGL 2QSCL 3C6SB 2QSTA 4NQVA 2JTDA 3C5ZC 1KGCD 2VDOH 4JFDA 2BNQA 3S3PA 1LK2B 5L2JB 2ADGB 3GMMA 4RGNC 3NH7H 2LE9A 4LAQH 1PLGL 2I60H 1BQUA 4LRNH 3C6LC 1F90H 2P7TA 2W60B 5C0CB 1Q0YL 3ARSA 1KENH 4NP4H 1C16A 1T2XA 4K3DL 1QR1A 2YD8A 3AC0A 5L6YH 1TNMA 1FFPA 3RP1A 1RURH 1E27A 5DQ9A 1X5GA 2DAVA 1JGVH 5FCSH 1BD2D 1NSNL 1T0MA 1HHJA 1UYWL 3LN5B 4F7TB 5I1LB 4WWID 4QHKI 2UWEE 1AY1H 4NOFA 1CD1A 1SJHB 1IVLA 4RRPA 3MBXH 1EZVX 3LHPH 4UB0L 4JCLA 4FABH 5FYKD 3QPXL 4CMHB 1BPVA 1VADA 3R8QA 1IKNA 3DIFB 1FBIL 4MD5A 5IMOA 2IANE 2X7LA 3UBXB 3B6SB 2AJVH 6FABL 4AENB 3MLTA 2QJDA 4AL8L 5DD3L 1NGQL 4P2RD 3P4NA 1I9EA 2Y5EA 2AJYH 5EU5A 1AR2A 3AAZA 3G6AA 1BZ7A 2OJZH 1JZ5A 1ZVHA 2DLTA 3NCEB 2NY3B 1FPTL 4HV8B 4WRLA 5FUOL 5I66B 2GHWB 4RAVA 2ATKA 2CRMA 2IANA 3WFDH 1NLDL 2J8UE 1I8LC 1IE5A 5CEXB 3KPLA 1MAMH 3ES6A 5CZKA 2GJZA 4KU1A 5HHQB 4JM2A 2FZ3B 5T3XH 2DI8A 4Y5VA 3CK0H 1C7TA 4L9LC 4HBCL 2IBZX 5SV4A 3PIQA 1YA5A 3GB7B 4MQSB 1JV5B 4WWKC 5JW3H 2X4QB 2IPUK 5GGTH 5LWYH 4OZGE 2YD9A 1S7QA 3IJSA 4PREA 4TULH 3TLRA 1WV7T 2VLJB 1U3ZA 5I18H 4Y7MA 4Z8FL 4PB0H 5C07B 5I16B 3WMSA 4P2CG 5EU6D 5I71C 2RJMA 1HHIB 2AEIT 3C8KB 3KG5A 1OARL 1ACZA 4OZGA 3FT4A 4KMLB 1OT1A 1OB1B 3MNVB 3D18B 5D1XB 3K8KA 1AR1C 5DEZA 5FYKE 1OGTA 1U8QB 1U95A 4XB8A 2IALA 4XP6H 3TWCL 2E7CA 3WUWA 5HYSB 1KPVB 2R4SH 2BRRL 4LQFL 5GSVA 3JWDC 1C1EH 3STZB 2DRUA 3CZFB 2H2PD 4WI8A 4WU5B 2D7MA 4XVTH 3N85H 4WUKH 1KTLB 2OL3H 5DRXB 4YFEA 4P2RE 1WEJH 2VMFA 3VRLE 5DMJB 4M00A 3SPVB 5FM5O 4NFCA 5GRUH 3ME0A 3SHSA 3NN8B 3L95B 4M1GL 1N6VA 4XVUD 1I85C 1NJ9B 2NZIA 4ZFOB 4OM1H 4JHZA 4F7EA 3IDJA 4XT1C 4BJLA 1Z9SA 5IV2B 4FQJL 3F12A 3WS3A 3ZE2F 3BIAX 2IPTH 4CJ0A 4L1DA 5HVWA 1YEIL 1F58L 3BQUA 2DQIL 3BT2H 4HUKB 3C2SA 1U8JA 1I8IA 4FXLA 3NABL 2IF7A 5F44A 5D7IF 4AH2B 3HZKB 4IRJB 2B1AH 2DLEA 4H0IA 4PJIF 1ZLSL 2G5BB 5IKCA 1G7MA 4ZSOE 4IRSC 1BLNB 2QHRL 1XGYH 1QFUH 1IEAA 5D93C 4YQXL 4HH9A 4WHTA 4K9EL 5IJVA 5D2NE 4QXGL 4XNMA 5IJKC 5DEGB 1R3HA 4UV7H 4FQQA 1QUNA 3NACH 4MNQD 5FUZH 1D5IH 4S1RH 4YUEH 4L4JA 3WXVH 4BK5A 4N8PA 3KWWA 3LAFA 4ZSOA 1T1WB 1AIFA 3QB7C 3WV0A 4ZOEA 3PWVB 1LO2L 4M62H 3MLVL 1ND0A 4XCEB 1NCBL 4MS8C 2CDEB 3TH2T 2CKBL 3IVKB 2EZ0C 1N8ZA 1CDCA 4YHZL 1JNJA 5D2NA 1ITCA 5I1AA 3IFLH 3B5GA 4HFWB 4U1KA 3T0WA 2V6HA 4UDUB 2VLRB 1FZOA 5DQDH 1KCSH 2CQVA 32C2A 1NMAL 4OLXH 2F8OA 4Z76B 2IADB 3QZWA 2NY5H 5K9QG 1R5VB 4LIQH 3VRIB 3QO1A 3KLHD 4BFBD 1MCDA 3B4NA 4HEME 3FN0H 2LTQC 1T66C 4GG6E 4F15C 4KXZI 2J8OA 3MREB 1KOAA 4HKXB 43CAB 2YUZA 3UJJL 1IGCL 5IB1A 1NKRA 2PNDA 1OCWH 2XI9A 4YBQD 4X6CF 1I3VA 4OLYH 4XNXH 5HI3C 5FF6A 5ITFB 2AJZA 2XWBB 3CVHH 3PF2A 2CO6B 3RUGF 1CWVA 2H3NA 5T1DL 3C5SB 5JR1H 2HH0H 1Q1JL 5DFVC 5HHOD 4IOFC 4ODWB 3T09A 4N90D 4GG6A 3E8UL 3MV8A 4M7JL 2C9AA 1ACYL 4WW2A 1UKQA 2A6KB 4JPKH 4LVOB 2V2WB 5HHMB 4L3ED 1QBMH 3BZEB 3S4SB 1I1RA 2FR4A 4Z95H 4JO2H 5D1ZD 1T03L 1S5IL 5E8EB 2BVYA 4YZFE 3N9GH 3DRTB 4P4KB 5D2LE 4G9FE 3V5DB 3TF7C 2QTEA 1ZGLM 4OTXL 2C3HA 5D5MB 5FYJL 4YO0B 4K8RH 4MJIB 3MMEA 2IMNA 1NCWL 4HW6A 2NW3A 1XR9B 4GKZB 1A6ZA 3O2DL 4YDKH 4O2CB 1CL7H 5JXED 1R6VA 2OR9H 5D2LA 4G9FA 3B83A 1NEZG 3JTSB 3WD5L 4WCYL 1K3ZA 1OTUC 4R2GD 1FIGL 4LF3A 4MJ6A 3L5JA 5LXGL 4BSVB 1G7IA 1TZIA 5I17B 3HUJA 2NR6D 4U6TA 4N8CL 1AC0A 2RCSH 4HC1A 3GSUA 1G6VK 3O2VL 2YMXL 4FG6C 2R8SH 2X4OB 4X5WA 4M6NH 1AGCB 4XPAL 5F97E 1WBZB 1P6FA 1DQJB 4QRSA 4I48A 1NANI 4Y5VC 1JZ4A 2E7LC 4KV5F 3EFDL 4MAYC 3HG1E 3MYJA 3CVHB 1BX2B 4L8SA 4UUJA 43C9B 2XTJD 2XACC 1JI2A 4EQ3A 3LRGA 4K3EH 4NWTL 3CNKA 5IBUB 1A6PA 3DGGB 1Q9OB 1MFBL 4N90E 1MCPL 4UNUA 1G7JA 3AXLA 2BSED 4W6WB 4YHIB 1CLZH 3EOYG 4JRYD 5DTFB 4NHUB 1LO3L 3HG1A 4F37F 3PJSB 4OZFH 2K7PA 4O51B 3MRRB 3C09C 3HA0A 4X4YB 1OTTD 2Q20A 1N6QL 4Z7UB 4AMKL 3TBYB 1WBXA 2VZ1A 1INQA 1NMCC 5JNYA 4GRLD 4X0KA 4FZ8L 1TJHH