2BFVL

Monoclonal antibody fragment fv4155 from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
DIELTQSPPSLPVSLGDQVSISCRSSQSLVSNNRRNYLHWYLQKPGQSPKLVIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVAAEDLGLYFCSQSSHVPLTFGSGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FV4155
publication title Antibody fragment Fv4155 bound to two closely related steroid hormones: the structural basis of fine specificity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 24
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1997-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bfvL00
3V6FA 3SQBA 1L9MA 1BX2A 1PD6A 3VG0H 1BD2A 3S8WA 1R3IH 3UJTL 2VDML 4QEGA 2FYYB 2KBGA 3MRKB 3KXFA 4HUVA 1E4KA 3DYMA 1I8IB 4ZPVA 4EIZC 2QADD 4RISL 1B6DA 5J13C 4MA1C 5EA0H 1KF9B 4KQ4H 4PUBH 4NM8H 4YXLL 3NZ8A 1QYGH 1T5WA 4P48A 1E4WH 1GGIH 5IB4B 1PY4A 2P5EA 1CGTA 4Z7UB 1CFQA 1QLRA 2AEQH 2DL2A 4R8WL 5DRNA 3TJHD 4I3RL 5I75C 3G6JF 4MX7B 1XT5A 1CLYH 1F4AA 2NZ9D 4LHUA 4GBXA 4KDTC 1F8TH 2HG5A 1SEQL 2FJFA 5ISZD 1MCLA 4P2RD 3W5MA 1RMFH 1R5VA 2BVPA 1UH4A 2HJKA 3GSRA 4TRPL 4XP6H 3SDAD 2NPLX 2OCFD 3U79A 1XH3B 1A7QL 2B39A 4Q6IB 1UWXH 1FZMA 2FZ3A 2YD8A 3L7EB 1HSBB 3OAYK 1NCAL 3BD4A 4LAQH 3HB3C 4JLRB 4YBQD 4WNQB 1AXTL 1J05B 1QSFA 3NGBB 3D48R 5KOMC 4BH8A 1KLGA 2Z8VC 4AEEA 3B9EA 4XNUH 3C8KA 1N64L 2Y7QA 1DVFC 1G7LB 5JW4N 3H0TB 4N8CL 4XAWH 2J6EH 4RA0C 4AM0B 4PIRF 4Z77B 5TDPB 1MJ8L 1N8ZB 1FFNB 2MPAH 2V2TA 1JI1A 1PZ5B 3ETBF 3MV7E 4QXGH 1XF4A 2VRAA 1MFBH 3D2UD 3CVIH 1Z2KA 4IOFC 3T08A 1ZXQA 1YMHA 3PWVA 2XWTA 1KJ2L 1NC4B 5E95B 2OP4L 2VLRB 1WZ1L 2CDEB 3I3EA 1BEYH 3IJYB 4KGLA 2N7AA 1SYSA 5C9JB 4QOKE 4G5ZL 5E2TH 4G6JH 3LN4A 3CXDL 2CQVA 5F7KC 3HNVL 2R4RL 1D6VL 1JHLL 4PLOB 4GJTB 4JPVH 1PKOA 2CKBL 1HQRB 4ZPTB 4UQ3A 4M7LH 1D5XA 4JKLA 1E6JL 4LSPL 3NAAL 4YDIL 5A40E 3MRMB 5SX5K 3DI2B 5CGMA 1PEWA 2BSRA 1QFWL 3ULUC 4HEPG 3MLRL 4Y5YB 3VFGH 4G6AC 4HCRL 5F6IB 2O5XH 5I8EA 1S9WA 4Z7NE 5JIPA 1RUPL 1XZ0B 4MWFA 1A6PA 3MLWL 3D6GA 4H20L 4ZFGL 4QGYA 4N9GA 1YC7A 2J8HA 5DTFA 4X8JB 1Q9OA 4ZQKA 1YUHB 3WO4B 3T0EE 1D9KD 2LFGA 1EO5A 2R1WA 1I8KA 2MFNA 4OBRA 1CLZL 3TF7C 1GOFA 4UAOB 5F71A 4P5KA 5B38A 4UNUA 3WFZA 5F8RC 5DEFA 1YNKH 1U92B 3GM0A 5IMKA 5CEXB 3MBXH 4V2BA 1CBVL 1BQHG 2J12B 1QLFA 5TPWL 2APXA 5ITFB 1YA5A 1KCSH 5J12B 1P53A 2WUCH 4OF6A 3A67H 4LLWB 3SO3C 5IQ9B 5L8KB 5J06A 3UYPA 3O4LD 5FUZH 3GFUA 4LNRB 3MNVA 3IDJA 5KTEL 4HKBB 1LP9B 5HTSA 5CGTA 4Z76B 1FPTH 3QUXB 4X7FC 2CIKA 5DQJB 3TBVB 4PJ9B 3WKNA 2X4RA 4U0QB 3LEYL 4G9FE 4X6CA 2HA1A 5LBSL 1SJXA 3QDMD 2ZUYA 4KKLD 2HH0H 43CAB 2GSGA 4JB9L 4HIEB 1CVRA 4NZUH 4S10A 4P9HH 5GZOC 1YNTA 3B6SA 4KDTA 2D4FA 3JBG7 5C0NC 2RHEA 2E6PA 3P4OB 1PEZA 5EOTA 4TSCH 4U1GB 4PJFF 1ORQA 2NXYC 4HMCA 4OJFH 1GOHA 5C2UB 3JWOH 5L0QC 4I18B 1DEEA 3PWPD 3N85L 3W39B 3CU7A 3BIKA 1AI1L 5EDXA 1DBAL 4R4FL 4MAYB 4XWOC 4UNVA 2VXSH 4LASH 2NY0B 3MMEA 2ED7A 1F11B 5IEHB 4KKAC 3PHQB 3NTCL 8CGTA 3ULVH 3LQZA 3MRCA 1TNNA 1DVFA 4NKOB 3UROR 4C57C 1CU4L 2F15A 2GT9B 4NFCA 4X6FA 1DR9A 4L4VA 2HFTA 3D5OF 5FO8B 1GGCL 5D7IA 5IOPA 4EOWH 5T1KB 2P5WB 4PJXA 1CK0L 4UIKH 4KK6C 5D9SB 1NJ9A 5IK3A 1RVFL 1HH6A 1XR9A 4NM4L 1IQWL 3QQNA 5FYLH 1D5MB 2R39A 5JUEL 1ZT1A 4FQPA 3ARDB 3B2UD 3QPQD 4JVWA 4L8SB 2HT2D 1X7QB 1CFTB 1U8KB 3V6ZA 3O3BB 1F02I 3VD9A 1VKXB 2M26A 5HDBE 1CLOL 3TH4T 3LRSA 3ZKND 1CDHA 4YHPA 1SY6A 3OAZH 5LAXA 3MOAH 2E27L 1E4JA 2XKSA 3HG1E 4N5ED 4URTB 4Z95H 2G75A 1JE6A 3MR9B 1IL1A 3PWUB 1QVOA 1C5BH 3G04B 2H45A 1LO3H 1KEGH 5SWZE 1DL7H 3IT8D 1A4JA 4H1LA 5KSBE 3STBA 4AT6B 4JQXA 2F53B 5K59E 2EDQA 2VDPL 2XWJA 4POZC 1S3KL 1H3UA 4FFZL 4PJ8B 3FQTB 3WFDH 2IMMA 4G42B 4UOW0 1ZLSH 2E8YA 4UV4H 4X9BA 4WW1A 1ZA3A 2Y06L 4Y4HD 5CEZL 1S7VB 4KC3B 4L9LC 1AC6A 1KOAA 3WXWL 1BFVL 5ESQA 1Y0LA 4UB0L 5F7MC 3FZUD 1RIUH 2R2BB 3EYQD 4JFFD 4KZDH 4GW5B 4XCNA 3F62A 3SE4C 4ZTPL 4OFKA 3O4OB 3W0WD 3OKOB 1L0YA 2X1QA 4M93C 1JYNA 1NCCL 3VWJC 2FCBA 1BOGB 2HKHL 3PWJB 4D9LL 4G6ML 2AV1B 3JV4B 4N68A 5T3ZD 1TETL 5LGKA 2VLJE 4YC2C 3BZEB 4KRLB 5GSVA 3KPSB 2ED8A 3VXSA 1OPGL 1G9MC 5T1LD 1C16B 4R4NC 2AEPL 5IROA 5IKCB 3N1FC 5GGSB 4NQCB 4WIQA 3UTTE 4F9LA 4M1DH 3HNSL 4FQJL 2I25N 2HTLD 3QNZB 4JZJC 2NXZD 2ZSWB 4OSUH 1FDLH 4IDLA 1Q94B 3IRPX 2O5ZL 3ET9F 4M6AA 3RJQB 1GAFH 3GSUB 1R5WB 4MNQA 3ZKMD 1TPXC 4IDJL 4NQSA 12E8H 4KUCF 4YDJB 1S7QA 1QFHA 2A1WL 1UADC 1EJOL 3DROB 4PRBA 1INQA 2JIXA 4MHHI 1KJ2A 2AGJH 5JZ7D 5LWYH 4XT1C 4KRNA 4X6DB 3T65B 3TYGL 1MCBA 4HWZA 4WVRA 3UTZA 5ICXA 3S97C 5E8NA 1PBYA 1Q1JH 4M8QA 5ID1A 4GMTL 1NFIA 3QULB 1YEIL 4M7ZB 3IKCA 4FXKA 1S9YA 4MSWA 4YHNA 3K0WA 2YUZA 1ZA6A 3RKDD 4PY7A 5DJAA 3BUYA 2C3VB 2CRYA 3W82A 1FL6A 4JHWL 3DURA 1KIUA 4NNXB 4U3HA 2IAMD 4WY7L 4HCRA 5ACZB 3I6KA 5IW3A 4RMSA 3LKPB 5ADPH 1EA9C 3LV3A 4P5TA 4XPBL 5CP7A 4K71B 1RU9L 1AP2B 4MA7L 3WLWD 4KY1L 3IETB 1Q0YL 2C7UA 3QNXB 2YD1A 3MLUH 5GS1B 4ODVL 1SQ2N 4R3SA 4XNYH 4KRMB 1OTSC 4RBPK 1WIOA 1BECA 1MNUH 5E24E 4JPWH 5IVZB 1CG9A 4HJ0D 1OARL 5HI4C 3STLA 3MV7D 1JF6A 2YRLA 4DVBA 2XRAH 1M05B 4GXVL 4M5ZL 1U91A 4NZRH 4U1SA 3RU8H 1LO5A 1RUKH 5HGHA 3QO0B 2YPLA 5FYJL 2DYPB 2OZ4L 1P5VA 2MKWA 5IB2B 5KSVB 1A22B 3V4PL 4FQCH 3QQ9C 1KYOK 1WCBA 3RWFA 2A9NL 3O6MH 3I50H 1I7TB 3QRFM 1OAZL 3BPNB 4GO6B 4QRTB 2UVFA 3BSZH 4QHKJ 4HG4K 1X4XA 4HWEL 4YFLI 2F5AH 4KV5F 5D1ZD 4HUMB 2CUHA 4PBVC 5E4IA 1FNHA 3CH1B 4OTXH 3T0VA 2CGRL 4CBPA 1I9JL 3VMPA 1QSZA 3DRTA 1YN7B 2EIBA 3QEGH 4YDLB 5HYQA 2GY7B 2D7TL 1TZIB 3ZZ1A 1IEBA 2F54E 2PCPA 5EOCL 3ZE1F 2ARJQ 1T4KB 3CVHL 5ILTL 3SE4A 2I9LA 3QPXH 3BRGC 4KK9D 4NO3B 1CE6A 1F2QA 1QO3B 3VWJA 4GUPB 2P8MB 5FUCE 4MXQC 3SCMD 3O9WC 1T6WA 4CNIB 4QOKB 1ZTXL 4OAWA 4K07A 5LXGH 2I07B 3WHE1 3Q6FB 1KXQE 3L3OB 4CVUA 4QCIA 5GGVH 1EEZB 3FN0L 4YHMH 4AEIH 2IPKB 1FIGL 4G7VH 1RZ8A 1WEJL 4U33A 4BFGA 3CC5B 3GKZA 1NUGA 2R56L 3BW9A 3KR3L 1MCOL 1JNNL 1SEBB 4U3XA 1J88A 2VZVA 1MFEH 5LG1A 1FN4B 1YPZF 3VA6A 3QEQA 3O8XB 5BMFH 1BQHA 1K8DA 1QA9B 1UKTA 4LPUA 5KW9H 2CIIB 3HE7D 4GG8B 2NY3B 4LSSL 3EJYC 1BIIA 1FHGA 1P4IH 5CLWA 3PDGA 4JRYA 3O3DB 4ISVB 1MH5B 1KN2L 4J8RB 4OZFG 5HGBB 4MZ3A 1XCTB 2FLRT 1KFAL 4PTUB 2YN3A 5SWQA 5ID0A 1KLFA 4S1DD 1U0QA 5E8PB 4C83B 3T0EB 4ELME 5F3BB 3OKMA 2YXFA 1EBAA 5DC9B 4N90D 2R0KH 4IRJD 4HWBH 1KYOJ 3O6KL 4H26B 3C60D 5DGQA 4NCDA 2VXTL 1NL0L 5IBTH 1MAKA 2ZUWA 4HG4J 2QSTA 3RQ3A 2OXHA 1ZHNB 4BZ2L 4GW1B 5JDSB 1T22A 2YD4A 1KSRA 5C6PB 3B9KB 4S1QL 1K9TA 1WTLA 5HHQB 2VDRL 4LARL 4JY5L 4MDIA 3QRGL 2ADIA 1RUAH 1RY7B 4U0RB 5DRXB 4B7IA 3HC3H 1R5IA 2FX9L 1XGUB 2NW2B 3GZKA 4G9FB 4YHZH 5I1DA 4X5XA 5KSAC 1A1NA 1H3GA 1PYWB 3HZMB 5J1SC 4DKFH 3OKNA 3H9SE 3RA7H 3V6BR 5BJTB 1W8NA 1ONQB 4YE4L 3RWEA 1EHAA 1T1WB 3ES6B 1MELA 4OCRH 1BVKB 3BI9X 3PP4L 1U36A 3O3UN 3QP3A 2V2XA 1F90H 4MYWB 4NN6C 2I9TB 2PKDA 1TQBC 4MA8H 4F7CA 1MJJB 1MREH 4FFWD 1ITBB 2CLRB 3G6DL 2VC2L 4LSQH 1CD1B 2C1OB 1JZ7A 1CXFA 3VFOB 4BQBA 4UQ2B 4NQDB 5L2JA 4H8WL 5ANME 4M7KL 5J9PB 1ZHBB 3GMRA 4ZNCD 3FN9A 3O81A 4OCLC 3MV8A 4N0CC 4LFHD 3NCBB 2FRGP 4WEMB 4I0PC 5CJOH 4MD4A 1P4LA 4PLKD 1WWWX 1T03H 3HR5B 2FGWL 1KT2B 4YZFF 5E8EA 4KUZH 1AGCB 1MUJA 1QBLH 3VXMA 4FFYH 1U8QB 2VR5A 3FCTB 3O6FC 3GMOB 4CGTA 4WU7A 4DEPC 3S3JA 5AZEL 4Z5RB 4ZXBA 1N5AB 3BZFB 1H8SA 4NOFA 3O9WA 1MF2H 1HE7A 4I9WD 1ZGLM 4BSWA 1MI5E 1QQDB 1S7XA 2EC9U 2VQUA 3FQUA 5EU6A 2X4SB 2FR4B 3G6JA 5C86A 1OAXH 5B21A 4NQED 3W2DH 3HRPA 3U1SL 2NTSP 3OXSA 4JFPB 4EN3C 3KPOB 1DSFH 5F7DB 3LSOA 3CFEA 2OSLB 2CH8A 5CWSB 2ARJB 1XGTB 3BKYL 1SHMA 3WMSA 1B90A 1BREA 2VLJD 4XPGH 3HG1B 2VZOA 1L6ZA 3MBEC 5IF0A 4I77H 3BKMH 4XB8A 4XXDB 2D7OA 3R06A 1S7UA 5DC0A 3BGFC 2FEDD 2PUQT 3EOBA 3LCYA 2HJLA 5DD6B 5SWZB 3LHPH 5EFIB 5KSBB 1QBMH 4PJAE 2DWDA 1FSKC 1ODAA 4CDGC 5JOPD 1A0QH 4F37K 5MENA 5F21B 1YECH 3D39D 4OCNC 3QHZL 3RTQD 2QQQA 2AJZA 5DJ6A 4M6MH 2QQLL 4QHLA 3L5HA 2CUMA 3HS0A 3I02B 3WLBA 2R8SL 1T2QH 1T5XA 4GXUM 5EUOF 1MJUH 1NEZG 3NZHL 1I8MB 4GLRH 4WJ5A 3WE6B 5IFAH 3VXUE 1EO8L 2WWMC 1EPFA 3DX9B 5E8DL 3ZTJH 3OV6A 2OZ4A 2UWEB 4PV9B 4ODUB 5L2KA 1KTLB 4IRZH 1T0NA 4TNVF 4P2YA 3OMZA 3NH7L 2VABB 5D1XB 1FE8L 5MERA 5I0ZA 3X3FH 2B1HL 5I1JH 3E3QC 4H8WC 2G2RA 1JZ6A 1PG7X 1S8DB 5I76A 4U2YA 2R0WH 1T7WA 2A73B 3N0PB 3PL6D 1EX0A 3WUWG 5I75B 3IFPA 4NQXA 3UTTB 4U2ZA 1LDPL 3DIFB 4WTWA 2J5LB 4HKXA 3QEHA 1N7MH 3ZSSA 2AI0H 5KSAA 4JM2F 1M7XA 1XAUA 1MCRA 3AXLA 2BNQE 4Y4KB 4LSTH 1IAOB 4N8PA 3U46A 1I85C 2Z8RA 2IGFL 2R1YB 5I73B 4Z7VF 3WDIA 3CVHA 4PG2C 3QUYD 3M07A 1OL0A 2CDGB 3L3HB 1C12A 4MA3A 5IVXF 5E1HB 1OCWH 1S9VA 4DQOL 4E0RA 1JMXA 3QIWD 2X89A 2C9AA 4Z18A 3TBTA 1E0OB 2EIEA 3W9EB 1FYTE 3DSFL 5JNYB 4WI4A 5DS8A 4I48A 1QEWA 1EBPA 1D5ZB 3RI5F 32C2A 4MHHG 4NQUA 3V8CA 3J7HA 5L6YL 5BVPH 1M7DB 3LDBB 3DTXB 4P23C 3F58L 1UJ3A 3KPQA 4KRPC 1PFCA 5JOFA 1EHNA 2PYED 5M94B 4TVPD 2VTFA 1RZKL 1UACH 3TLRA 4DFIA 3GUTB 1IC5L 3O6FA 5E9DD 4F7PA 5A2IH 3MREB 1IC4L 1C5CL 4R96B 5IBUG 2XA8L 5JO5B 2E7CA 1FNSL 2DD8H 1UXSA 2EC9T 5ETUA 2NY4B 4RAUA 4Z7QF 3DWTA 2YKLL 5BRZA 4XB7A 4EN3A 3VWKD 1KG0B 5F1OB 1MCPH 2BERA 3MXWL 3U4EA 1CXKA 3MYJB 4PJFA 4PREA 1A6AA 3GMMB 1DDHA 3CMOL 1CDYA 4FQ2L 4MD5B 4TQEH 2ICWB 3MBEA 1QR1B 4O2FA 4PRPD 4ETQA 5CJ5A 4F7MB 2WWKT 4NUGL 4YQXL 4Y5VC 3R4DA 3SPVB 3SQOL 4RIRB 4NJAL 1J1OH 1LEGB 5GGVY 5C07E 3SKJH 4YUEH 1Q9WA 3P9MB 1FNAA 1FGNH 3LQAH 3KLAB 2H6PB 1QRKA 2DKMA 2V9RA 5E08L 3OWEA 4OLVL 2AXFA 4IMLB 5C0JB 1OGAE 5J6GA 3O45B 5F1SA 4AQ1B 1DQQA 2F54B 3RNKA 3HPLA 1L4IA 4EBQH 4HT1H 5MEQB 4OFYD 2KH2B 1WWAX 1FRGH 2WINA 1I75A 3FO9B 3WFHB 1AC0A 1A47A 1FFRA 4XCYB 2Q7YB 1EVUA 2PO6C 4R0LA 1Z9MA 4YDVA 1WZLA 3VDCA 4BSVA 3BDYH 4HW6A 1MHCA 1MCDA 2FSEB 2DJUA 2MHAA 3FRPG 1OHQA 2XWBA 3OAYH 1ZV5A 3BEWA 1BM3H 3IAGC 4QWWD 1MCEA 3KDMB 4OZFA 5CD5C 1AD9B 3B3IB 3ECBB 3MJ9L 1EEUA 2JJVA 3HE6B 3OJDB 1IQDB 4YXKL 5IMLB 2ICES 2CRIA 4O2EB 1F6FB 2DLGA 2N56A 3DV6B 1I85A 2HJFB 1RZKC 4HH8A 1DQLL 2IWGA 4PG2A 4Y4FD 1Q72L 4I2XA 4XVTL 5HHPB 2IBBA 1CZ8L 2I5YH 5IHUL 1CFVL 5D7SH 1FZKA 3GBNL 2WP3T 3UTSE 4HGWA 2HWZH 1ZHKB 5IHLB 3VFTA 5I30L 3MROA 3ARFC 4WFEE 3QXAB 3CLFH 5DEZA 4NO5B 1XF3B 3ZMRA 2ADGB 4LLMA 5C08D 4ALAH 2A38A 1KB5B 2X4QB 3CZFB 2JJSC 3QFJE 2DQDL 1JZ8A 4WFGD 1RK0B 2YBRB 2J88L 4NGHH 3TBWB 2ITCB 5GRJH 3QHFL 4YGVA 1K5NA 5F70A 4FQQA 4F7EA 4GQ9L 4L4JA 4YHIB 1QRNE 1S5IL 2Z31C 1LD9B 4HX1B 5I18H 5SX5H 3BKJL 4UI2A 1OAYH 4L29B 3DVNB 3GSNL 4ZSOA 1XIWC 5GGTH 4S2SA 1I1FA 4GRLD 2CJUL 1DE4B 4WU5A 1SY6H 3TN0B 5I1EL 1IEAB 1SBSH 1CL7H 1BBDH 3VI4F 3E8UH 5JW4Q 4NJ9L 1I7ZB 1EUTA 2R9HC 3CFJA 5EORL 3O6LL 3OL2A 3ULUH 2EYTB 4PP2B 3RHWF 1JNLL 3HPJA 3U9PH 4CU8A 1AGFA 5BS0A 2OI9B 1V3LA 4U6XB 4EDWH 2XOTA 3H9SB 5C92A 1NMAH 2CO6B 3UJTH 2DI7A 3ARBC 3HTLX 4J3WA 2HN7A 1NFKA 4AZ8A 4TVSa 4RFEB 2OR9H 2PXYD 1MI5D 5HDQL 5C2BL 1AFVL 3QNYB 3C5JB 4YXLH 4QTHB 4RA3A 4Y5VA 3BPLB 4XP1H 3BYTA 1HINH 1TZHB 3NFSL 4L9LB 2I60L 4R8WH 1NCDL 4I3RH 1TJHL 1RURL 3HI1B 5TQ0L 5HYSB 4WV1C 3TPKA 5ANMB 4U1LA 4DAGL 3QDGD 2Z4QA 4I0KA 2XT1B 1OAKL 3HFML 3QWRD 4TNWF 1YJDL 4XBEL 5C0GA 3FOLA 1F4XL 4X7CC 1LE5B 1JYWA 2FL5A 3W5NA 5I2IB 4NC1C 2WWKO 4PJBE 2P42B 3VGAC 3HZYA 5ERWB 4YC2B 5HHOE 5TH2B 3QWOB 1Z9SA 2FX7H 3GMPA 5DT1L 5EC2B 3IFOA 4P49A 4Y5XB 3VGGA 4YJZL 1FZJA 4HS8L 4JZJB 5GPRA 5DK2B 2PO6A 3D18B 4GT7A 1FAIH 4AIOA 3X17A 2BXYA 3IU4L 4DTGL 2FO4A 1B0GA 5EH1A 1T0MA 2CRZA 3ARGB 1MJ8H 1RZGB 1ZS8A 3GSOB 4DUVA 1CFNA 1U6AL 3QA3B 5JW5A 3OKEB 4GAFB 4L5FL 1KCUL 3DV4B 3ULVD 3WS6A 1VFBB 5IHZB 3V7MA 3C5ZC 3M45A 2ZG2A 3LKSB 4XCEB 4G6KL 1YQ2A 4ZD3L 4NQTA 1AGEB 1X5AA 3NCYS 5IM7B 2EH7L 4QRRE 1F97A 5T5FH 3SGDH 3P9LB 3H7BB 1NEZA 3VGFA 4DCQB 5C0CA 3FO1B 1HXYB 4YXHH 3HNVH 5F3HA 1Z5LB 2R4RH 4XHJD 2X41A 3LH2L 1FFOA 5HGDA 4KK5D 4PJAB 3GKWL 1ZKAA 4RWYH 5T33L 4RQQB 3U0TB 2F19H 2BNQD 3OKDB 4YPJA 4TSAH 3SY0B 4RMVA 1KB5H 1DBML 1R3KB 3MLRH 3QXDA 3WUWA 5GGUA 2JJSA 4HCRH 2L7JA 4CADA 3QO1B 1RUPH 4HKJA 2DQHL 5C09D 4HV8B 4OZHB 2B2XH 4M3JA 1AQDA 3VXUB 2F74A 5E5MA 5IB3A 4ZFGH 3G5VA 1FYTD 2Z31A 1U8MB 4HXAL 3IXTB 4OCXL 35C8H 3BHBA 3DXAA 2EEBA 3OKLA 4YNYB 4WUUD 4M02A 4X9GA 2O26U 5DMKA 1VPOH 1U2HA 3X3GL 3DGCR 1GC1L 1XIWA 3QUZA 4P2QE 1FG2A 5K9JH 4KJQC 1KNOA 1IT9H 1QNZL 3BP4A 2D7PA 3V9FA 3D85A 3WNKA 5DI8B 2IJ0C 3GM8A 4F8QA 1I1AB 2VIRA 3NACL 4C56E 1G7JB 4FTVB 1OOAA 3OKKB 4FHBD 3CDYA 5E6ID 3B5HA 1YPZA 3D1MC 1NGXA 2B5IC 4P4KA 3QXUA 4NC0B 3ARBA 1QD0A 1OT1A 1DQML 4U1MB 1BPVA 3EDKA 2OTUB 3KYOB 2X1PA 2VLKA 3V6OE 1HYSC 4QRPD 3MRNA 1OY3B 3B9DA 5C0EA 3VFMA 4JN2B 2OLDA 1D7FA 5FM5M 1XF1A 4JO1L 3QG7H 1M7IB 1FVCA 4HXBL 5I74C 1LO2L 3L3GA 4BQ9A 3FTGA 4PYHA 4WV1A 2GK0B 4WEBL 3MRDA 3C6LD 5D1QC 4OZIE 1CDGA 3VW3H 4OD1L 2NY6C 5EZOH 2EDFA 2VE6B 1WBXB 5BVJA 3MJ9A 4JJHA 1WAAF 4NCC2 5DYOA 5JHDE 1T89C 1CN4A 4BFIA 1DQDL 4UINL 1MCCA 3ZKQD 3TO4B 4NSKA 2NY1B 5H37G 3T3PF 1DBAH 1G9MH 3DX7A 4X6BA 1K4CB 3FB7A 4JFXB 4RGND 3VMNA 2W0LA 2K9UA 1A7NL 1KUMA 2XZQH 3DO7A 1DLHB 4OD3L 3NTCH 1G6RB 3H3KA 4PGDA 1WWCA 3IDXL 4TNVK 2F5BH 1F45A 3TO2B 1CU4H 3N9GH 4QXUL 3JWDL 4H0GA 4LLUA 4U1JB 3FONB 4JM2C 1P7QA 4J4PC 2GCYA 3PXJA 4KDWA 3ROLA 2ESVE 2MKLC 1Y6KR 2AK1L 1NBYA 5FDWA 4PJ5A 3LZFH 3C5ZA 4N1EA 1WC7A 4C4KO 2GSIB 1ADQL 3L1OL 3PHOB 2QQNL 4NM4H 2I26N 3PGDB 5JUEH 2EIZA 1UM6L 4GFTB 3PNWB 2V2WA 1FV1A 5D70L 3D9AL 2W07A 3GSNA 1NBZA 1GC1C 3FFCD 5E2JA 1PSKH 3PDOA 1LEIB 2Z8WC 2R2CA 5EUKA 4GKNA 4PGZA 2PW1B 1D6EB 5C07B 2Y9RT 3TJEL 3U7WL 3PV6B 2E27H 3OR7A 1OP9A 4ZUWB 1QSFE 4RBPH 3EIFA 3BPOB 1Y6NR 3R0NA 5DFVC 3HAEB 2LVCA 4MJIA 3ZHKA 2EKSB 2ITDA 1OGTA 1OGAB 3ROOA 2CDFA 2DM3A 3H3PL 4G6FB 1JK8A 4LLYB 3HUJF 1CICC 3UYRL 4M7JL 4HDIB 2CPCA 3C5SB 2Z35A 2YD2A 4JO3L 2VDPH 5E8OB 1OSZA 5L8JB 1JPTL 3EYVB 2P47B 2PTVA 5F7UA 3L3DB 1YEFL 4AMKH 1N59B 1FNEB 3FB6B 4J3XA 3UZQA 1A6WL 1QLEH 3QFJD 1OLZA 3REVA 1BFSA 2DQTL 1XFPA 1UWGH 3QSKB 2YPVH 3MZTA 5A2FA 4FQXB 4APQD 1MRCL 5H94B 3P30H 2WBJA 4Y1AD 3ARTA 1QRND 4XP9L 3S37X 4XPTH 3RGVD 4JGUA 1BF8A 1HHGA 1KIRB 1NCCH 2HT3D 1T66C 2DQGL 2ZNWA 3WNPA 5SX4H 2ID5A 2BSSB 2NY2D 5MI0C 5J1TC 4G6MH 5EU7C 5FHAL 2Q7NA 4K2UH 1OPGH 3BFOA 1KJ3L 3PE9A 2AEPH 3LOWA 1RIHL 4XZUA 3S6CA 5L8LB 2AEIT 3MPCA 5DDHB 5EIQA 4OB5L 1VFMA 4U1HB 2Y36H 1TVBB 4XH2A 3C6SB 4S1SL 3UTSB 1UA6H 1ZLUH 1X5XA 3IJHB 5DRZB 5IW1A 4D0CB 4PRHD 1RZIA 3JWDC 4U1IB 1N2RB 1KIPB 2HFGH 4KXZH 5DD0L 1ITCA 4XBGB 5EUOA 2R2EB 5HYEA 2VL4A 2F8VA 4L9DA 5DHYA 4LGRB 3W11C 2FH8A 4E41E 1RJYB 4U6HB 5E5RB 1IGFH 2FATH 5HI5D 1ZSDA 5DR5H 1T89A 3AS3A 5TE6H 1WVZA 3TVMC 1ZWIA 4ODWB 3FT4B 4X0KA 4N0FB 1QRNB 2QSQA 1KCRL 5C6TH 2VXQL 3P73B 5A2LH 1H3TA 1TFHA 4DGIL 1JZ4A 1KPUB 5E2VL 3WKML 3RDTA 2XN9A 5CIPA 1KPRA 1G6RH 1WZKA 1M6OA 2V7HA 1CE1L 1IKFL 2O5YL 2XZZA 3G9AB 4N0YL 1EHLH 3MLYL 1JWSA 2EO1A 4OZGE 3QWQB 3EOAA 3UBXB 5JW3H 1BWWA 4JM2A 5HHOD 4HAGA 4J4PA 5FM8A 4BJLA 3V79C 4JHWH 1R24B 1JV5B 4JZOB 4NO2A 5GSRA 4WY7H 4Z7VA 1NMBL 4LKCA 3L3JB 1A3QA 2AK4D 5HHNA 5IVXA 1PX3A 4LFHG 2QR0B 1Q0YH 5IQ7H 4K3DL 4KI5D 3R8BB 2BXZA 3D3VA 5FYKE 3ZE2E 4O02L 5F44A 2KL6A 3L7FA 2EH8H 3CX2A 5C1MB 2NX5E 1A14L 2XY1A 1KLUB 4HJJH 2YC1A 4ZO9A 3GIVA 2C3WA 2ZNXA 4ODXA 3OB0K 5AG9A 3K8LA 1HCFX 3FQRB 2OZ4H 2AXGB 2ZUUA 3MRPA 3V4PH 4NN7B 4EUPB 5J11B 5F7LB 3WN5A 5EO0A 4BQCA 2VDOL 1OAZH 3NABL 4PJBB 4L8CA 3HHRB 3DGGA 1NKOA 1SJHB 1BIHA 2BRQA 2IC2A 4AEFA 4GKSA 2QBWA 1CICA 2QSCL 5F9WB 3BZ4B 2W9LA 2YOCA 5DHVA 3DBXA 4L8DB 1VGKB 4MXVE 4PJXE 4BZ1H 5F1NB 3WFCH 2A6KA 2CGRH 3WDHA 2WM0A 2Y5EA 3FFDA 1BZ9B 2WUBL 4JFDB 3C8DA 1T6VN 5FA3A 1RQ5A 3K2UH 1JN6B 1P5UA 4OKDA 1VADB 5BO1L 2ICEA 4OCSL 5ILTH 5JA8B 3MRIB 3SKOB 2M1KA 4G43B 3PQYA 4LBEB 1NGPL 3KPLB 2VDQL 3CFIC 5F7FA 5KZCD 3U9UA 3HZKB 1IM9A 1PQZA 4NBZB 4DZBA 3GRWH 4QRRB 3SDDD 2XFXA 2H41A 3BP6B 3TEUA 5IIEB 3IU3B 4C56D 3IDGA 3FN0H 1TNMA 1FL3B 1DN0A 3FL7A 1FIGH 3ALXA 3UX9B 1YEHL 3QUMH 1MCWM 2R56H 4JRXD 2YA0A 3FRUB 3VA2C 3BIAX 2YN5A 4KJYA 4HS3B 4Z0XA 3L3KB 2IBZX 5J3HC 4KZEL 1NCBH 3I6LD 3MFFA 4F80A 1EFXD 1U8PA 1OD7A 3UTPD 1YEDA 1IBGH 5TDNB 1YMMA 2DTMH 2NR6C 2CXGA 1U42A 4TNWK 1ADQA 3TVMA 1DQTA 1NPUA 1I9IL 3QI9A 2YA2A 5HD8C 2HFFA 1KN2H 2KPNA 2VO5A 3TBYB 1GJIA 4D8PB 3RZCB 4QRUA 5BQ7B 1W72L 4MB3A 5GHWH 4OM0L 2BSTA 2H9GB 3G5ZA 1ETZA 2UZXB 4KKCD 1A02N 2JB5L 4P2QB 4GAYB 3OF6D 5JHDD 1QSED 1HZHH 1RUML 3VXSE 3DRQA 4R6UA 3LMJH 3E6HA 5MEOA 4Z7UF 1GPOL 2NY5H 5HYIA 4LPCA 3REWA 5D7JC 1DLFL 3GI9H 2MCPH 5BV7C 1X5IA 5C3LD 1JNJA 5DA4A 3OXRB 5I9QB 4JFEB 1BD2D 2OK0L 4NRYB 3HMXH 5DD3H 1G7MA 1IGJA 2ZKHL 3KXFD 2V5TA 1FC1A 1N6VA 1MHHB 3MJ7A 1GZQB 3JSSA 5B22A 3UP1A 1U8LA 1FQ9C 3N1QC 3MV9E 3HI6L 1IM3A 4LLQA 2FX9H 4MCZB 4M6NH 1KACB 1KIQA 2P5ED 1K4DA 2NNAA 4ZFZA 5CS7A 5DJ0B 1E4XL 4JG0L 4FA8A 2XKNA 3C09C 4YE4H 4LHUD 4GBXD 3VXNB 4OZIB 1HQ4B 3T4YB 3PP4H 1UCBH 3JTSA 5KBNC 4KROC 3WD5H 3DUSB 2DKSA 1S78D 4ZAKC 3TZVC 4HLZG 5GGRB 3MLZL 3TT3L 2HRPL 3TCXA 5ALBL 3EO9L 3KJ4C 1A7RH 2VC2H 3PWLB 4C54A 4AIZB 3BAEH 2HTKD 3B8YA 4EI6B 1IAKB 1NGYA 4GRWB 1I8LC 3EJZD 4H8WH 1VHPA 1NC2B 1A9BA 4JY6B 5DJ2A 4M7KH 3NA9H 2MQ3A 3ARQA 2NTFA 1QSFD 3X13B 1L7TH 3T0BA 2OQJA 1MCKA 4X7TB 1PKQA 1ZT7A 3OJVC 4YWGH 1ZEAL 4LRIA 3QXTA 4GMSL 1O7SA 2ESVB 3NZ8B 5ABDE 5JPMA 1R3LA 3FO0L 4W70A 4K7PH 1FVDA 5BW7C 25C8L 3OGCA 4UDTB 5AZEH 2EXYC 1S5HB 4PRAA 4X98B 1HHIA 4D0BB 2ADFL 2GKIA 5L88L 1A6TA 4LEXL 3SDYL 3ARFB 4HHAB 4L8BB 4DVRL 4HK3N 4K7PX 3NOIA 1R5VB 4CDHA 3QDJA 4IOSD 5IUSA 3F7YA 2VXUL 4AYFA 3MNZB 4P9MH 1UZ6F 4LCCB 2D9QB 3TYFB 2EYRB 2HLFD 1LK3H 4HIIA 3CSYA 1AE6L 4K8RD 5CUSH 1NGZA 3TH2T 3F7RA 1L7IL 2FD6L 4LF3B 1I9RH 2Q6WA 4CVWA 5E56A 2Z92A 1DP0A 1WGOA 1I1YB 4R97C 2CUIA 3IGAB 4Y16D 4JFYA 4R90H 1LP9F 1MFAH 3CFCH 5E0QA 5CP3A 1HILA 3PWVB 4X7DC 5JA9A 3T3ME 3T1FB 3QJFA 4A6YB 2PTTA 1DCLA 4HIJB 4PPTA 4ELKB 2B0SH 5BOPA 2IADB 3NZHH 5DJ8A 1NGWA 2IFGA 1JUFB 4ZS6D 1EHXA 1I3VA 1H3XA 8FABA 2X7LA 5D7JA 3PDDA 4J1UB 2EDHA 1R3IL 3O3EA 5DUPH 3M1BB 1A1OB 4IJ3C 3L6FA 2H3NB 1JPST 4B41A 2YUXA 4NNYB 2OTWA 1UJTA 2WIIB 3DHJA 3MRHB 2BNRE 3WNLA 1I7UB 4KQ4L 1BMGA 1QYGL 3IFNH 3CD4A 1E4WL 1GGIL 1QACA 3FB5B 3V0AC 1WBZA 2AEQL 2PR4H 1U3HC 2RB8A 4HIXL 1CLYL 1FORL 4NHUA 3JV5A 4JRYE 4MVBC 1F8TL 4X80H 1RMFL 1G7HA 4X4MA 5FYKD 4XP6L 4E41B 2IANE 1QFUH 3KPRA 4I0CC 1MAJA 1HXMA 2VMFA 4KHTH 2X4PA 4ZAKA 3TZVA 5F7HA 5DO2C 4UOJA 2HFEA 5F9JB 3HZVA 4UMGA 4LAQL 1FVEA 3ZT7A 1RHHB 3QG6B 1QLFB 1BFOB 4GRWH 4AENB 1NDMA 1I8LA 5B8CC 3HB3D 2RAMA 3NFNB 3MV11 4XNUL 4PGCA 4PG9B 4RGMB 3L3IB 3CFDA 3MLXH 1XGPB 5AYUH 2J6EL 4Y19A 4LPYA 3JVGC 2HRLA 3VH8G 3W81A 1DVFD 2BVYA 4OZGB 5HDOA 4QXGL 4K3EH 4L4VD 5E2WL 1R0AH 2VKXA 1MFBL 2X4RB 1IGCL 1RZKH 3F5WA 2VSCA 2FJGA 4NQVA 2CRMA 5BW7A 3V0VA 1MOEA 3H9HB 2M8XA 1BEYL 3P3YA 3FO2B 4IOFD 5I16A 4RFNC 2GAZB 1ED3A 5CHNB 1LE9B 1YNTB 1ORSA 3RFZC 1U58A 1C5CH 4FXGA 5E2TL 3FOMA 4G6JL 3CLEL 4L4TE 1ZMYA 1W72A 3GHBL 3QEUA 1CDCA 2ZSVB 2NX5B 2Y5TA 3QXVA 3NPZB 5C0BE 4JPVL 1J0HA 4YPGA 1DEEB 1GCFA 4V1DA 4NZTH 1WAAA 4IRSC 3ZE0E 3QAZB 3VFGL 2O5XL 1H8NA 2OS7A 5MHSE 4CJ1A 4NWTH 3G5YA 1H5BA 2W1NA 3LKRA 4YQXH 3IDIB 4KMLB 4L3EE 3MRRA 4A2MA 1JBJA 5T1MB 1JMZA 2QKIB 1RZFH 3U6RB 3PGCA 3C2AH 3I9GH 3NN8A 4GS7C 3BWAA 4OBSA 4PJXB 1BGXH 2I27N 2Z93A 3MZGB 3NVQA 5CBAA 3TC9A 3MBXL 4A6YH 3FT2A 1HKFA 5EU3B 4UNTA 5HBBA 1UH3A 2B5IB 5EU6E 3LD8C 3X11B 1KCSL 2WUCL 3VJ6B 3A67L 2W60B 1WFOA 1BHGA 1U8HA 3FQWA 5JW4R 3LRSB 5FUZL 5C0DB 4I3GA 1AH1A 1HDMB 1YDPA 1AGDB 5IVNA 3MLSH 3TESA 5IW6B 3VXSD 2ATPA 3QIBA 5H2BA 2H8PA 5CZXC 5D1QB 3TT1H 3AREC 5DA0B 1HCVA 5B39B 1A9EB 2KDGA 2VDKL 4H1LB 1UVQA 2X5PA 4ENEC 4DOHE 2DWEA 1BJ1J 1U3HA 3Q1SH 3D25A 4OLUH 2UYLB 5MENE 2P7TB 1I4FB 4LCWB 4P9HL 3DMMA 3GMQA 3BOVA 5HVWA 3LPFA 1UWEL 4MNQD 5EZIL 1UCTA 5GZOD 4JJ5A 4TSCL 1DQLH 4X9IA 3HUJA 4OJFL 5C0ND 2EO9A 2KQNA 4XPFL 4RZCA 2VR4A 3JWOL 4XVTH 5TE7H 3EYSH 4GLRI 4QXWA 1J8HE 1CZ8H 2JIXD 4BFEA 1F4HA 2NXYD 4JPIB 5FYJE 3T2PA 4LASL 1TZGH 4I13B 4OI9A 4XWOD 5F97E 2P24A 5B8CA 5D96B 5FV2A 3H7LA 4HZLA 4X4YA 1OAQH 2J88H 5GSVB 4KKAD 2R2HA 4OCMC 4P4RA 3VD5A 3JVGA 3BVNA 2QQKH 3QHFH 5A3IC 4IHOA 4FXLA 4HBQA 4EOWL 4OV6F 4Z9KB 4XGZB 5FECB 2VDNH 3BKJH 3I75B 4FG6D 4UIKL 4M4PA 2D3VA 1YN6B 4QHNA 3GSNH 5FO7B 4P5MA 1XF2A 4P5TD 3L5WB 4JFOA 1K8IA 1SJEB 5FYLL 1KEML 2XTJC 4MDJA 4KK6D 3WEXB 2A6JA 4R4BA 2CJUH 4KTDH 3TCLA 3QQ4B 4EI5C 3MV9B 5K9OB 4NJ9H 2R1XA 4CVXA 5I1IH 3O6LH 3X14B 5EU4A 4AG4L 4XWGL 3RAJH 5K9KB 3MOAL 4Z95L 2OJEB 2OR7A 4R7NA 2GJ6E 2VZTA 5F1IB 1C5BL 3BQUC 2YPLD 5EBMA 4IRSA 4K7PY 4JCLA 4JO4H 3TIDB 2O93L 2BVUA 1KEGL 5HDQH 2VAAA 4LVNB 5EN2A 3CPLA 4UBDC 1K3ZA 1KJMB 1DL7L 2VUYA 1FZOA 4UTAL 4MSWB 2CKBB 3UEZA 5IT2H 1SVCP 1G9EA 4FQ1L 1CDBA 4IS6B 3PWNA 5AUMA 3EO1A 3WFDL 5ESAA 3DURB 1ZE3C 1ZLSL 4P2OB 4UV4L 1NAMB 3ZSTA 1C08B 4J3UA 1YQVH 3T4AA 3FQXB 4KKNA 2IMNA 3MRFB 1F4XH 3SGEI 2CR3A 4QY8B 5EWIH 4TOYH 4KZDL 5CCKH 5M95B 5I8CA 3RWIB 3ARWA 3F7PC 4CU7A 1J8KA 1FNGA 4NCC1 5DT1H 3WV0A 4Q6IC 3JWOC 3KWWB 5BRZE 1QBAA 2V7NA 4G8GA 4ETYA 3VWJD 1KB9K 3BP7A 3BH8B 3GNML 1J5OH 4Z7NF 1J1PL 4KI1A 5AZ2L 1VFAA 1B3JA 3NGBC 4M1DL 4UUJA 5E7FA 1H3VA 4R4ND 3DX6A 5KVDL 4E42A 5BZDB 1FDLL 3RWFB 1T04B 3IAQA 4M1CC 4DKEH 2QADC 4L5FH 1U93B 2J6EA 4OKVB 4JZNA 1QR4A 3SDCB 1MAMH 3RX5A 4NN5B 4XP5L 3IDUA 4Z7WE 4ONHA 1JGUH 12E8L 4Y4FA 4PRIE 4OCYH 2NCMA 2EH7H 5J6HB 2KUTA 1IGYA 3QEQD 4M6OH 1Y18A 2AGJL 1H0DB 5DJDB 4MQ7B 3VCLB 3QDHA 2YEZB 2AJVL 3IKKA 5T33H 4JRYD 3LEVH 4FQLH 4X6EA 1Q1JL 3RIFF 1K6QH 4ZMAT 2I9LB 4F2MB 3BP5A 4KDVA 3S96A 2JJTA 3VD3A 1DBMH 2VLLB 5EU5B 3OKYA 3RPKA 3GSXA 3WJLC 4UV7H 3LEXA 4RDQF 4LSVH 1VESA 4TTDC 3BZDA 1IAIH 1JHTA 1A21A 4HKZB 3KVQA 2MNUA 2K7PA 3RWJA 4GOSA 1U8NA 3LIZH 4Y5YC 1XCQA 5DQ9B 5F6IC 3KYNB 3DECA 1MFDH 4OCXH 2PW2B 4HFUH 5I66A 4OGXL 3SDXE 5ADPL 3FAWA 3CCHB 1GXEA 1I7RA 4JG1H 2E9BA 1YEGH 3MLUL 1GC1H 4OM1L 4XNYL 2BNRB 3UTQA 3MJ6A 3WO4C 1MNUL 3OHXB 5IHBA 3QDAA 1NLDH 1MWAB 1BQHB 1OTSD 1WITA 4I2XE 4UAOC 1LO4L 4EI5A 1ND0B 3NACH 1AO7A 2XRAL 5CEZD 1H15B 5IMMB 3ARXA 2P8PB 4PJCE 4LEOB 1QFWM 1S7SA 1JRHL 2W0PA 5HI4D 1NEUA 4GQPH 4J3TA 1T3FA 5GIRA 3P0VH 5CBEA 3BQUA 4MCYA 1KB9J 4FQCL 4PJEB 5D7LB 2IANB 1EO7A 3I50L 5DHVH 1AIFB 3UPAA 2FYYA 3QQ9D 4XC1L 3MRKA 3RKPA 2X10A 3BSZL 4YO0B 1MQKH 4JO1H 1V3JA 1I8IA 4RMWA 3PABB 3QUXC 4LVHC 3HLAB 5DMGC 1JZ5A 4GXUN 2E7LA 2VISB 4HBCH 4I5BB 1NAMH 2C3XA 3SJVA 4XRCB 4Z7UA 3MV8D 4XCFH 2V9QA 3KLDA 2HKFH 3QEGL 3U0PB 1F13A 4MX7A 1R3HB 1V5JA 2IG2L 1CL7I 5HDBF 1DQDH 4RMUA 4LSRL 4OLYL 1W0VB 3QPXL 5TF1H 3ZTNH 4U1GC 1EGJH 3VXMD 3GI8L 4I18C 1XH3A 4Q6IA 4QRQB 5I15H 1IILE 1AHWB 5D2NE 3L7EA 5BS0E 3H2WA 1A7NH 1ZT4B 1HSBA 3AS2A 4ZXBD 4MAYC 4OD3H 3GK8H 4PJGE 3RWEB 4MXQD 3VFUB 1CYGA 2NY0C 3IDXH 4JLRA 4WNQA 3O9WD 3I3DA 2DM2A 1J05A 2V2XB 4L4TB 4MLSA 5EU6D 2ZPKH 4AEIL 5K59F 5D5MB 1AQKH 5C0BB 1G7LA 3VXQB 5FB8B 3H0TA 4AM0A 2AK1H 4Z77A 2VITB 5CSZB 5TDPA 1R6VA 1N8ZA 1FFNA 2H2SC 1PZ5A 1AXSB 4KKLC 5BMFL 2JELH 1FL5B 1A7PH 3DJ9A 5D70H 3VMOA 4XMKH 1NC4A 4MD4B 2UWEF 1P4IL 2VLRA 3K4DA 2CDEA 3IJYA 4KKBC 3ARDC 3VGBA 5DJXB 4F33B 1LILA 4L3EB 4L8SC 5C9JA 5T3XE 5FK9B 3O41B 5JIHA 3G08B 5MEND 2ZUXA 5C7XH 1BVLB 4AL8L 3AAZB 2WLZA 4LQFH 3GGWB 5BV7B 3WJLA 1HQRA 2R0KL 4ZPTA 4HWBL 4XMLH 3PJSB 4QO1A 4ZUVB 3BGMB 3MRMA 1U3ZA 1NCNA 5FKPB 3H9ZA 5IBTL 1TITA 4Y5YA 5FYJD 1S9KC 5SWSA 2LE9A 3OB0H 5H8DA 1XZ0A 3CFEB 3CDCA 5L2KD 2A0LC 3MCKB 1YEFH 4GAGL 1BJMA 4UIMB 5DD5H 1KXTB 2E9JA 4PJ8C 5F72S 3U83A 2NW3B 3LKNB 4X8JA 1RUAL 1YUHA 2X70B 4FN0A 4XPHL 5LKNA 4OGAC 3HC3L 3OJ2C 1UENA 3M17B 1MWAH 4YHZL 3EOYG 2W9DH 5BZWB 3HCVA 4DKFL 4DOHB 1U92A 5CEXA 1JVKA 1LEKB 5C70A 5KSAD 3RA7L 3K2MC 5KJRH 5HYJE 2GI7A 1QFWI 1JGVH 4WHTB 3O4OC 5ITFA 2CR6A 5FHAH 3RRQA 1KJ3H 5DJ6B 1F90L 1HH9A 4LLWA 3VXRE 5IQ9A 4YIQB 3HS0B 2AJUL 3ZE1E 4MA8L 4IOIB 4OB5H 1MREL 4QHUA 5D6CB 1N6QH 4LNRA 1J8HB 2EDDA 4LSQL 4HKBA 1LP9A 4WI5A 2X89D 4ONFH 1UM4H 4Z76A 3QUXA 1ZLVH 5DQJA 3TBVA 4PJ9A 5DD0H 1KENH 3DXAE 1JNHB 5CJOL 3UMTA 3K46A 1FO0B 43CAA 1NDGB 3ZTJG 5SV4A 4N0CD 4HIEA 1T03L 3ZKXB 3ULUF 5I76B 4G3YH 4KUZL 3BWUC 5F6HJ 1QBLL 4FFYL 5IMOB 3KHQA 3P4OA 1RUQH 3P40A 2WQ8A 5D6DC 2F58L 1PVHA 3GMNB 43C9B 4OLZL 2DJSA 4QRSB 2BY2A 2IPTH 4DGIH 2W65B 3EYQC 3O6FD 4I18A 4RDQG 3W39A 3GB7A 3DX8B 1MF2L 4MAYA 3QIUB 1OM3H 2O5YH 4HJGA 4N0YH 2BHZA 3CVHB 2WQRA 1OAXL 1KTRL 3W2DL 2OL3B 3K3QA 1F11A 3I85A 3K81A 4M7ZC 5JLZB 5C0AB 5J4MA 1DSFL 3PHQA 1YNLH 1TJGH 4K9EL 5DFTA 3WHXB 4NKOA 5BRZD 4EN3D 3TBTB 2GT9A 7FABH 4XPGL 2HTLC 4IBLT 5H35B 2NXZC 2GJ6B 5FO8A 3BKML 4TN9A 4P2RE 4K3DH 4QHKI 3S4SG 2C3HA 5T1KA 3MBED 2P5WA 4R97B 4W6WB 4O02H 5I1LA 4M9PA 3LHPL 5F88B 1I1RA 1M71B 5D9SA 1QBML 5GS1C 3TNMB 1A14H 5CP3H 3P4MB 4PLJC 1A0QL 1D5MA 3K4ZA 3ILPB 3ARDA 1MFCL 4L8SA 3UJIH 1X7QA 1CFTA 1U8KA 4M6ML 3O3BA 5D93B 2DQCL 1LMKA 3NMEA 1VKXA 1DQJB 1OSPL 1GGBH 4U6YB 3WFEH 5EULV 4CVZB 5BV7H 3QZWB 1RZJH 5AWNH 4ZFFB 4ZNEE 1A6ZB 3JTTB 2GQHA 3MLTB 5CJ8A 3MR9A 3PWUA 4L1DA 4GRMB 3G04A 2NMSA 2WWMD 4IRZL 2IALB 5SV3A 1CDIA 2D7QA 2G5RA 1EDQA 4U1KB 3RL2B 3VI3F 1BQLL 4AT6A 1B88A 5FGSA 3X3FL 1QFOA 2F53A 1U41A 4PJ8A 3FQTA 4G42A 4FQIH 5B3JE 1DFBL 4P46B 4ETQB 3SN6N 1S7VA 2HLAB 4PJHE 3WLWC 4WW2B 4JKKA 2HT4C 1N7ML 4AY0A 1MY7A 5BO1H 4OCSH 4YDLC 5ICYB 4UZGA 4LSTL 3BIBX 2VDQH 1AKJB 2R2BA 4HJ0C 4GW5A 1K2DB 4Z7WB 3EGSB 3OKOA 4PRIB 4E9LA 1U95B 3WYRA 1BOGA 1KV3A 3ISWA 2KZ1B 3PWJA 1OCWL 2X6MA 4W4NA 3RZWA 2WSKA 3AVEA 2AV1A 3JV4A 3W9DB 1NAKH 1TENA 3BZEA 3BPCB 3KPSA 4OFPA 1KTDB 1C16A 4WWKB 1HHJB 1T0PB 1DN2A 5IKCA 5GGSA 1PX4A 4NQCA 4XC3H 3KHOA 1EERB 2D03H 3QNZA 4HGMA 5CEYA 1PGRB 4K9EC 2P49B 2ZSWA 3SBWC 1Q94A 5BVPL 5GS0L 4EQ2A 1FO0H 4R0LB 4AQOA 4ERSH 5CKGA 1ES0B 4X4XA 4OI7A 3CU1A 1MLBB 2C1PB 4LU5H 3OX8B 1RHFA 3GSUA 1R5WA 1FLRH 2AW2A 1E28B 1ZANH 4KMTH 3MACL 4RFNB 2YPKB 1I9IH 4YDJA 4XNQB 4KRPD 5SX4I 3DROA 5F7EH 3KLHC 5D6DA 3V95A 3SDXB 3O4LE 1W72H 5HJ3B 2ZZUT 3S9DB 3GO1H 3DPBA 1UB5B 3K74B 4X6DA 3T65A 1PDKA 1C8PA 3U4BL 5CMAB 2CLZB 5DGRA 3KYKH 2DD8L 3T0EC 4G9DB 4F7TB 2OL3H 2X40A 3EDFA 3QULA 1IFHH 3QDME 1DLFH 1WUNT 2X9WA 4OCWL 3EOTH 4LPWA 2XIDA 4WI8A 4PJCB 4POUB 1MCPL 4HGWB 3IJSA 2R0ZL 3MROB 5BS0D 2CXKA 2C3VA 3MXVL 3AROA 5IB5B 4NNXA 4O00A 1D5IH 4HC1L 1RIVH 5ACZA 3S35H 3LKPA 1U8IB 4M9OA 3B9KC 2AQ1A 2DQIL 1AP2A 3PWPE 5C0IB 3IETA 1JGLH 5IWLC 3LQMA 5GS1A 1J1OL 4PD4K 4Q7DA 3GBLA 3A6CH 2J8UE 4U0RC 1N26A 3LQAL 3S35X 1ZAGA 1E4XH 5IVZA 5DWUH 1TQCC 1P7KB 1IE5A 1KJVB 1WCQA 5IEKB 2AS5M 2IH3B 4OLWH 3RIFK 2XN9E 1A5FL 4Y89A 3QO0A 1CT8A 3F7VB 3LVEA 2HRPH 5HGAB 4WO4B 4DGVL 2DYPA 4MAUL 4EBQL 2CK0H 2AABH 4PJIB 1KBGH 1L0XA 5IB2A 5KSVA 3R1GH 4LMQI 2FGZA 2Q87A 1YC8A 1I7TA 4QRTA 5D2NB 4LKXB 4PJDE 5EO1B 3BDYL 3AREB 2HVKB 5LCVH 2PO6D 1JPGB 4PJGB 4FABH 1BAFL 1XGRB 1Q8MA 3D3VE 4PGBB 4Q0XL 2JJWA 4PJAF 3CH1A 3ARPA 3DOSA 3PXHA 1BLNB 5KVGH 5GS0C 5HDLA 2FO1A 3ZDZF 5JQ6H 2CKNA 1YN7A 3B9AA 3FO0H 3NCCB 5CD5D 1TZIA 1KULA 4ZTOH 2A83B 3VRJB 2ADFH 1WBYB 4LEXH 2Q86B 4NO3A 5DLMH 4OZHF 1QO3A 4GUPA 1MCNA 2I5YL 2P8MA 3HMWH 5D7SL 2G5BB 5C0CD 4Y2DB 5IJKC 1R3JB 5FA4B 2E9IA 3KS0H 3ARRA 2D0HA 4CNIA 3EFFB 3CLFL 4QOKA 5JIIA 5I71B 3ZDYE 5EPMB 5CD3B 1EXUB 2I07A 1JGDB 4AH2B 4ALAL 2MMXA 3IFOB 3Q6FA 3L3OA 4NDMB 1AE6H 2IPKA 3Q5YA 4LP4A 4M48H 3SBWA 1K85A 3BD5A 1L7IH 4EEEA 3GSWB 3M8OL 1U2CA 4Z7QE 4NKIL 2JKXA 1SEBA 5DEGB 5A1AA 1MIMH 2FO4B 5GJTH 3EDJA 5I18L 1FN4A 3W0WE 4I8DA 2R0LL 4JFQB 1ZS8B 3O8XA 4IIQB 4HLZH 4F57L 2Z31D 4PD4J 1JGEB 1QA9A 4N0UE 3T8XB 5JW5B 3DXAD 1MCSA 4KMQA 2CIIA 5T3ZE 4GG8A 3PQYE 1INDH 5GGTL 1VEOA 5GS3A 3EZ8A 3O3DA 1XIWD 1MH5A 3QUZD 4ISVA 4IEFB 4J8RA 5HGBA 2XA3A 1SY6L 3LQAC 1SBSL 1BBDL 4PTUA 3RNQB 3E8UL 2H26B 2YMXH 5E8PA 3D85D 4C83A 3T0EA 3BJLA 2H32B 5F3BA 3ULUL 3TA3B 2ZUQB 4QF1B 4NC2B 5FHBH 3U9PL 5ICZB 1X5ZA 2R9HD 5TJWK 4EDWL 5TDOB 1NMAL 4H26A 5IBLC 5HYJB 4P4KD 3X12B 2FECL 3RVWC 2OR9L 2GJJA 2BX5A 3ARBD 2AV7B 2J4WH 3VXRB 3CH8A 2VLKD 3CMGA 4O5LH 1JPSL 4GW1A 5GGUB 5JDSA 5D1XC 1MCJA 5I1CH 1FFPB 4D9QD 3B9KA 1B6UA 4XP1L 4CADB 4HUWB 1HINL 1CGSL 4MNGE 2W0FB 5IWLA 4X7EC 1FH5L 1EZVX 4G8FB 4HIXH 3H8NA 1FORH 2ENSA 2J5LC 3QJHB 1XGUA 2YK1L 2NW2A 3OKLB 2P43B 4G9FA 1NFDE 1C7SA 1W0WB 2YD7A 1CGWA 1PYWA 3HZMA 4NRZB 3UZVB 4HUKB 3QUZB 4Y4KC 3MJGX 4OFIA 1U3JA 4ZG1A 5BJTA 1ONQA 5I73C 1T1WA 3ES6A 1BVKA 2FX7L 4NO0B 5JXAL 4FP8H 1HEZB 2DLEA 2LU3A 2R15A 2I9TA 3WNOA 3CSPA 1MJJA 1UH2A 2CLRA 1KN4H 3S4SA 1CD1A 1FAIL 1FAKT 2C1OA 4G8IB 3ELAT 3VFOA 3UPRB 5DZLA 4UQ2A 1CD8A 1PZUB 4NQDA 4MQTB 4U49A 4KH2A 2QADB 2BY0A 2OM5A 5J9PA 2ZCLH 4MXWH 1ZHBA 3BXNB 2VQ1A 1P7QD 2A6DB 1O0VA 1D3CA 5E2WH 3VFMB 3VU2A 1IGCH 3LDBC 2D0FA 2DBLL 3PL6C 1G84A 3HR5A 4PJ5D 3RVUC 1KT2A 1NCWH 3QCUH 5ISZB 3TFKC 1AGCA 3C5ZD 4P2RB 5I1AB 1U8QA 3FCTA 5T5FL 3GMOA 3SDAB 3I6GB 4YXHL 3TPUB 3CLEH 2CMRL 5HYSG 3GHBH 4Z5RA 1N5AA 3TIEB 4F3FB 3BZFA 4JANB 5FEBA 2YRPA 4RWYL 3OQ3B 3IDNB 3P11L 1QUNA 5T3XH 3RWGB 3VGDA 5DRWB 1QQDA 2F19L 2Y1VA 2X4SA 4LIQE 4XXCC 2FR4A 1J18A 2NY4C 4TSAL 1KB5L 4QYOB 4JFPA 1EIBA 4WDIB 3KPOA 5F7DA 2OSLA 5CWSA 3VI4E 3CK0H 2ARJA 4MJID 3VFRB 2B2XL 3HG1A 2MOVA 4HUXB 4XXDA 3RWCB 3ROLB 35C8L 4X9FA 4Y16A 1ZOXA 3LB6C 4HC1A 4MNHB 3D2UB 4ORGB 2LAGB 1WISA 5DD6A 1VPOL 5SWZA 5EFIA 4D3CH 3BH9B 2Q3AA 3QQ3B 4TPRL 4F15C 1A7OH 5K9JL 1UGNA 1IT9L 2ATKB 2WLYA 1Z9OA 1P2CB 2WBJD 4KJQD 4BH7B 1UM5H 1JL8A 4PJHB 2H32H 3I02A 1BP3B 4EJ1C 3O2DA 1I8MA 3WE6A 5HPOA 5F9OH 4N5UA 1YY8B 3DX9A 3EYOB 3OR7B 4OV5B 4OD2B 3VWKC 2UWEA 4PV9A 1T1YB 4LVHB 4WENB 4ODUA 5GRVL 1KTLA 2C26A 5FUCC 3KPMB 1HYSD 1SYVB 2ITDB 5IG7B 2QL1A 2VABA 5D1XA 3QG7L 4QNPF 1BZ7B 1CF8H 1CXHA 2VDKH 3BESR 1S8DA 2A73A 1A4KB 1GGYA 5FGBC 1FNLA 3VW3L 2EE9A 3DIFA 1D9KB 2OBGA 5EZOL 1UWEH 5EZIH 4IMKC 3HE6C 1F00I 1OTUC 4F37F 1NKRA 2NY6D 1VEPA 4N90E 3REVB 5JXEC 2UZYB 4XPFH 2Y07H 3O3AB 4Y4KA 3BO8B 4KTYA 4ZYKB 4OT1H 2R1YA 1G9ML 4NOBA 4LGPB 2N7BA 2DOCA 2CDGA 2IPUK 5J0BA 3L3HA 4H88H 1T83C 1HHGB 2R4SH 3NPSC 3O4LB 2XZQL 4KQ3H 5E00B 1QTYT 4LLVB 1I3RB 3NIGE 1J0KA 2F9BT 4H0HB 3JV6B 2F5BL 1CD9B 3RDTD 2XN9D 3W9EA 5JNYA 3VRLF 3N9GL 2HAZA 1EUUA 2Q8AH 3QDMB 4JM2D 4J4PD 1NANI 2Q76B 2BOCB 4MJ6B 1M7DA 3DTXA 1IGMH 5IW1B 3CFKB 3LZFL 1TVHB 4XNZB 1A2YB 5D72H 1KEMH 3MRQB 4JKMA 4YBLB 2XQBH 4FNLH 4PJBF 5JIKA 3D3VD 3GUTA 3KPRE 2LAAA 3QCTH 2ICWJ 5E4EB 3PWPB 4PV8B 1PSKL 5GGTA 1F6LL 3MREA 4X9HA 3VGHA 4XPAH 3TN0C 5JO5A 4AG4H 4XWGH 2J8UB 5DMIH 3JWNC 4ODSL 4XXCA 1G9NC 3MO1B 2Z91B 5DJCB 3B2VL 1T21B 1YYLH 3VFWB 1CDUA 2OI9C 3JZ7A 1KG0A 4HWUA 2D31B 3P77B 2VH5H 5CIPB 4UTAH 5DFVD 4JR9H 1M6OB 3MYJA 3GMMA 4FQ1H 4MD5A 2ICWA 1J0JA 1QR1A 4JHBA 3V4UL 5IFJB 3NIDE 4F7MA 5GRWA 1CICD 1GZPB 2PYFB 4H5SB 3UAJC 4UT6L 4AMKL 3S37L 1S9XA 3BPLC 1U8JB 4MJ4A 1QLEL 3SPVA 4PJDB 1JTPA 4DN4H 5GISL 4RIRA 1UWGL 3VFPB 2YPVL 5ALCH 3GSQB 4DFHA 4I9WE 1LEGA 3P30L 1EEQA 5E94B 3P9MA 3D3VB 4OF8A 2O61B 3KLAA 4FMFA 2H6PA 4NQEE 1ZHLB 4XPTL 5GRVK 1X9QA 1CGUA 1U8OA 4IMLA 3FMGL 2GJZB 3ZYZA 3ABZA 5C0JA 3T0WA 1VEMA 5CILH 2FEEL 3PQYD 5DQDH 3CDGA 4V1DE 1OP5K 1F6AB 2F54A 4K2UL 4WHYH 1WAAE 1JWMB 3GNMH 5MEQA 1J1PH 5AZ2H 1IM9D 2Q20A 4W6YB 1PY9A 3FO9A 4Y5XC 2Y36L 1INEH 3WFHA 4XCYA 1F4YL 5KVDH 2Q7YA 4PJ7E 1FJ1B 3T3PE 1UA6L 1AXIB 1XF5B 4P57B 4NPYB 1JJUA 3VE0B 5JOPE 3O11B 2FSEA 3IDMB 1CR9L 2HFGL 1TTGA 3D39E 3ARGC 4YBHA 4XP5H 4Y4HB 3KDMA 1AD9A 3B3IA 3ECBA 4L3CB 2GITB 1G7QB 1IGFL 5GJSL 2FATL 3HE6A 4NYLB 4B0MM 1IQDA 5DR5L 3OAUL 2DRUA 5TE6L 5IMLA 5JXEA 1YMMD 4O2EA 5D8JH 4JFFB 5F8QC 1UYWL 3S88H 3DV6A 5C6TL 1A6UH 2HJFA 3W0WB 2NLJB 1NSNH 2AJVH 4CMHB 3TVMD 3QI9D 2XXMB 2IFFH 4MB5A 3CZJA 5HHPA 4N0UB 1T83A 1AGBB 2GYSA 2YA1A 3AU1B 4LPVA 3UO1L 2OJZL 1G6RL 1JHKH 3WIFB 1ZHKA 3LAFA 3UC0L 2XQYK 5T1LB 1EHLL 3QXAA 5DVNA 4NO5A 1E6OH 1XF3A 2ADGA 1X44A 5A43C 4Z78B 5JW3L 4HFWB 1KB5A 1TCRB 3L5XH 1F2XK 2NXZB 2X4QA 4ZFOB 3CZFA 2YBRA 3IDGB 3F65A 3TBWA 2BHYA 4OGXH 4RWHA 4OZIF 4HH9B 2ITCA 4TULL 5IJVB 2IQAB 2VWEE 4YHIA 1CIUA 5IQ7L 1LD9A 4HX1A 3DVGB 4OM1H 5GQBA 1II4E 1M4KA 4L29A 2ADJB 2EH8L 3DVNA 4DUXA 4J3SA 1U8PB 1LO4H 4GRWF 4MNGB 1JRHH 4HJJL 1J0ZA 5C0FB 4UOW1 1DE4A 3TN0A 1L9NA 1IEAA 2FH6A 3D0LB 1I1AC 4ZUUB 1CFSB 4XHJC 1I7ZA 5IV2B 4KK5C 1NFDB 5GS2D 2EYTA 2V5SA 4PP2A 4U6XA 3H9SA 4XC1H 4GW4B 2E7MA 2PYEE 4RFEA 4TVPE 3MLVH 2IAMB 4XBPA 4MB4A 2G60H 3PG2A 3QNYA 3VG9B 4BZ1L 3C5JA 5E9DE 3WFCL 2BDNH 4RNRB 4QTHA 4LCUB 1ZK9A 4N1CA 1CTNA 3UBXG 4W6XB 1TZHA 2YS4A 2X4OB 4L9LA 5HYSA 4GKZB 2IG2H 3AS0A 5ANMA 3K2UL 1B4RA 2A6IB 4LSRH 3MV7B 4OLYH 5AAMA 3GI8H 1YY9C 1LE5A 3F6LA 1ZLUK 1CIDA 2JTDA 3TO4C 1BBJB 5I2IA 5JR1L 3B4NA 2NY1C 5ERWA 5TH2A 1VENA 3QWOA 3GRWL 4PRPE 3FKUS 1B0RB 5EC2A 4N0RA 3VFVA 9CGTA 1IGIL 1N3NB 2UUDH 5C3TA 1GYAA 4Y5XA 4XX1G 3T2OA 4JZJA 3S36X 5DK2A 2C3GA 4K55A 1FC2D 3D18A 3V5HB 3QDJD 3MV01 3QUML 2XACC 5D1ZB 4EUPG 5HHXL 3ARGA 3GSOA 1RZGA 4Q74A 5FCUH 5HHMD 4EKXA 3QA3A 1NCBL 3DV4A 1IBGL 5KANG 1ZGLB 2DTML 4F58L 1VFBA 5IHZA 5J3HD 4JN1H 4WHDA 3LKSA 4XCEA 3NIFF 1MVUB 4KGJA 3SO5A 2E8ZA 3IYLW 3U2SB 3T77B 1F3JB 2ILLA 1AGEA 5IM7A 2NR6D 3QCVH 3P9LA 3H7BA 4DCQA 5GHWL 3FO1A 5HD8D 2GY5A 1T7ZA 1Z5LA 4AL8H 3SCMB 4PJAA 3KPPB 1HZHL 3PIQB 3UTOA 4RQQA 3U0TA 3LMJL 3OKDA 4DGYL 1Z6JT 2NY5L 3SY0A 3GI9L 3BPOC 2MCPL 1R3KA 1YEKL 1I3GL 3MA7B 5D7JD 2ORBH 3QO1A 4XVJH 4HV8A 3HMXL 3RPIB 4OZHA 2Y6SC 4GAGH 5DD3L 3VXUA 2LU7A 5AD0B 4UT9H 5EIIB 5DUMH 3IXTA 1X3DA 2ERJB 1B0WA 4XPHH 4YNYA 1GVIA 5DJZB 2DQUH 3HE7B 4M6NL 1TQCB 4Q9RH 5HPMB 4XVUD 4FQXC 4Z0BH 4M1GL 4FZEH 5DI8A 5C08E 2FWOB 1RK1A 1I1AA 4HUUB 1G7JA 1UCBL 4FTVA 4XP4H 4WFGE 3WD5L 3OKKA 4OZGF 4KPHH 4HK0A 2AJUH 4IRJB 3KPRD 4KROD 1RULH 3QJFB 1A7RL 1XGQB 4ZAKD 2BCKB 3TZVD 3C60B 3BAEL 3MC0A 4U1MA 2OTUA 3KYOA 1V7NH 1L6XA 5EO9B 3V5KA 8FABB 3NA9L 1HOCB 4JN2A 1L7TL 4UU9B 4JY4B 1IKNC 4DZ8B 4BK5A 3HC0B 2XPGB 4Y19D 4YWGL 2GK0A 1UB6B 2Q8BH 1YEJH 2AJ3B 3MRJB 4JDVB 2VE6A 1T7XA 1WBXA 1WBZB 2F58H 4K7PL 4APQC 4L3AA 4OLZH 1XR8A 4KHXH 3TO4A 3P4NB 4PYGA 3N1GC 2AP2A 2HT3C 1K4CA 4JFXA 3BMWA 2NY2C 2DMKA 4JKPH 3DUUB 1DLHA 2X4PB 4P9ML 4XMPH 1G6RA 4K9EH 2GFBB 1EVTC 5IR1B 1KC5H 4MXVF 4J2XA 3TO2A 3BE1H 2NY5C 4U1JA 4XNMB 3FONA 4V1DD 1LK3L 1MQ8A 3QDGE 2DQFB 5CUSL 4BUGA 3SJVE 4FFVD 3P4LA 1I9RL 3EO0B 3CFDB 3QH3B 1G7PB 2DLFH 4JFHD 1NLBH 1ACZA 2GSIA 3PHOA 1JP5A 3PGDA 4WI7A 3U0WH 3PNWA 1MFCH 3GBMH 4R90L 5HI5C 2VAJA 1B2WH 1MFAL 4ESKA 3CFCL 4AK1A 2DQCH 2Z0BA 1TCMA 5C0RH 1OP3H 1OSPH 1LEIA 1TIUA 2B0SL 2FDBP 3KPNB 2PW1A 1D6EA 5C07A 1SBBA 3PV6A 3BN9C 2X2YA 4ZUWA 4D2NA 4NQEB 1Q38A 2SEBB 4O9HH 1PG7H 4WI2A 1XMWA 3KYMB 4NN7C 3HAEA 5J11C 2VZUA 2DI9A 3EFDH 5DUPL 1J7VR 2EKSA 3ULVE 3OB8A 3KNBB 2C5DC 5FAAA 1OGAA 5GRUH 1GGUA 2VLJB 1BQLH 3C2SA 5CJQH 4LLYA 3WDJA 5I6XB 4HDIA 5DSCA 1V8HA 5F9WC 3C5SA 5E8OA 3EYVA 3IFNL 3Q5TA 2A2QT 1DFBH 3L3DA 2BP3A 3QIBD 1N59A 5TF0A 1FNEA 3FB6A 4PJ7B 2PR4L 1P7HL 2ARWA 1IEHA 3G5YB 3ZDXE 4O2CB 3DLQR 4G8EB 3SE9L 4U3CA 3INUL 5FYLE 4FQXA 5DXWA 5H94A 1U3HD 3D39B 4X80L 5CSGA 3RTQB 3RY6C 4C55A 4LOUD 3DMMD 5HVGB 5FOBA 3PGCB 4MVBD 4ODHH 5B4MC 1KIRA 1QFUL 2P8LB 4KHTL 2BSSA 5DJYA 3CFBB 5C09E 3LS5H 1UEYA 5IESH 1ACYL 5IB1B 1FCCA 5JORB 1A1MB 4J3OC 1IC7H 2ZOKB 3MQIA 5DO2D 3GRWA 2AKRB 1D5BB 1G7IB 5DDHA 5SWSE 2ZCKH 4NZJA 4U1HA 4WUUE 3ZT5A 1TVBA 3C6SA 5JHLH 3EYFB 3MLXL 5I19H 5AYUL 3UTSA 5GS0H 3IJHA 5DRZA 4I0PA 4D0CA 1IKNA 1UQSB 3QUMA 5EIVA 4U1IA 1N2RA 1KIPA 3PL6B 2X4NB 5C8JB 1WIPA 4X7SL 4XBGA 2R2EA 3V4VL 4K3EL 5F9DC 3R0MA 3G6AB 1R0AL 5H2BB 2X9YA 4I3SH 3MACH 1RJYA 4U6HA 5DK3A 3STZB 2J8OA 1W0YT 2VLMD 4ODWA 3FT4A 2XICA 4N0FA 1QOKA 2EDBA 3EDDA 4K94L 3P73A 3RZCC 3QUYB 3ARUA 4QRPE 3U4BH 4H25B 2OYPA 2AJYL 1UZ8B 1J86A 4BQ6A 1KPUA 3ALPA 3QIWB 5D71H 4Q9QL 4OCWH 3H42H 3AY4C 3RUGE 4TUOB 3SDDC 4B53A 4NZTL 2R0ZH 5K9QG 2FB4L 5ACMA 3UBXA 5BOZG 3MXVH 1R24A 4IRSD 5INDA 3D0VB 4JZOA 5I9QC 4HC1H 4NWTL 4PB0H 4WTXA 3RY4A 3L3JA 2PETA 2DQIH 3HMXA 4YR6B 3QHTC 4J23A 5GGSY 2Y72A 2QR0A 2GEEA 1T7VA 3L9RB 3V6OC 2PYEB 5D2LE 3FAXA 4F15B 1S7TB 1RZFL 3C2AL 3I9GL 3VFSB 4J7RA 4RGNE 2CD0A 3MUJA 5F93C 5E9DB 1BGXL 4N8VB 4DK6A 1IZJA 2FBJH 1A3LH 4A6YL 1KLUA 1A5FH 4NBYB 3O2DH 2WBWB 4DGVH 1VB9A 4MAUH 3FQRA 1N6UA 2AXGA 3WSQL 1P69B 3VWKB 1HNFA 3K1KC 5TGBB 2ZOLB 5DZOA 4EUPA 3GEWB 5EU4B 4G8GD 4PJBA 3MLSL 1KPVB 5F89B 3MUGB 4PR5A 5GZNC 4PRPB 4LSUH 1BAFH 3BZ4A 2EC8A 3DO3A 1LGVA 4P0DA 4Q0XH 4L8DA 1VGKA 5F1NA 3TT1L 2LQRA 3FFCE 1MHEB 3PP3K 4ZOEA 1E4KC 3IS0X 3ESVF 3Q1SL 1BZ9A 4NKMB 4OLUL 4JFDA 5FUOL 4LVOB 3LS4H 1QHOA 3DYOA 3MGAA 4FQHB 1JN6A 1VADA 4AJ0A 5EZJB 3T3MF 3MRGB 5E6ZA 1NUNB 5IVOA 3MRIA 3SKOA 5TE7L 4G43A 3EYSL 4LBEA 1DANU 1Z3GH 3KPLA 4JQIL 3NPSB 4ZO6A 4GBXC 5E1AB 3HZKA 1DBJL 4K94C 3IB4A 1TZGL 2RJMA 4QRRA 4S1RH 3QT2A 3BDXA 3BP6A 5IIEA 1WT5C 1QSVA 3IU3A 3T0AA 1PLGH 5DVOA 2A74A 2G9HB 1G1YA 5FF6B 4ELMB 4U1NB 1OAQL 1FL3A 3EJZC 3HI5H 4LCCC 4HIHB 5IFHH 2F53E 2QQKL 4QXTB 3M8OH 4Y1AE 4P23A 5F7YC 1ZVSB 2WMPA 4NKIH 3FRUA 3BUTA 4HS3A 2YHGA 3L3KA 2JCCE 3NCFB 5CGYC 1VGEH 3S34H 5A3ID 2HVJB 2R0LH 2VDNL 4OIBA 5DC4B 3CNKA 4F57H 5TDNA 1K3IA 4PJEF 4O4YH 4QT5B 4Z7OF 1UXWB 5B39G 2GK2A 1QKZH 1B4JL 3TBYA 4KTDL 4D8PA 2GTZB 2XTJD 4Y4FB 3RZCA 5BQ7A 4RFOH 3Q0HA 2BMKB 3GHEL 4UDUB 2H9GA 4GAJH 5I1IL 2JK5B 5DURD 4EI5D 4TTGA 3D87B 1AO7D 4P2QA 2EDXA 3WXVH 4PRHE 4K3HA 4HWNA 3TBSA 3RAJL 3AY4A 3EHBC 5C08B 4FRWA 1JFQL 1X5HA 4JO4L 1H8OA 4GG6E 3S5LB 3GJEB 3BQUD 5CZVH 5IT2L 4JFEA 1JPSH 2HLFC 4NRYA 2E7HA 4UBDD 2E3VA 3VXOB 1J9CT 1T80A 4K8RC 3THML 1CGSH 3E6FB 1FH5H 4LDOB 1MHHA 1GZQA 4TVPH 1YQVL 4JFZH 2YK1H 1DUZB 3DSNA 2VR9A 4LAJH 4MCZA 4MZ2A 3SJVD 1UKSA 5JOEA 4JREB 4KK8C 1CWVA 3DVIA 3CUPB 1P9MC 4GRLB 4TOYL 5EWIL 5KS9E 1MRDH 3SKMB 5CCKL 5DJ0A 5D5MF 1Q9KB 5DVMA 3VXNA 4OZIA 3T4YA 4EDXB 4JDZB 2E9WA 5D7KD 5JXAH 3DUSA 1VACB 2BVQB 1DBKH 4YEEA 3ZE0F 5D4QA 5GGRA 2AK4E 3AS1A 3G5XB 3PWLA 4WEUD 1J5OL 4AIZA 2XG5A 4KI5E 4HULB 4EI6A 1IAKA 2PXYB 1KELH 1MI5B 1NC2A 4OUUB 3WNMA 3VH8B 2FJHB 4RGMC 2DLTA 3X13A 4DKEL 4OZ4B 2DBLH 4X7TA 1MAML 1E4XI 5DMYA 4M1CD 3SE8H 1JGUL 3ZO0A 1H9VA 3QDGB 3V5DB 4I4WB 4OCYL 2ESVA 7CGTA 3SJVB 4LLDB 4UT7H 4OF0A 4M6OL 4UDTA 2CMRH 3WS3B 4W81A 1S5HA 4X98A 3WFBH 4D0BA 4RGOL 4AEHH 1DANT 1NC4D 3T2QA 4DK3A 2RCSH 2VLRD 1GIGH 5FYLD 3P11H 4XVSH 3LEVL 4FQLL 3TNNB 3ARFA 1K6QL 4HHAA 2BVTA 4L8BA 5EBGA 4RAVB 2YZ8A 1WT5A 4UV7L 1LNUB 4LSVL 3MNZA 1IAIL 4X4ZA 1IARB 5DK0B 4PBXA 3U36B 4LCCA 4E5XB 3TYFA 3LIZL 2EYRA 4TTDD 3QAZC 1JZ2A 3LN9A 4WRLA 1NCUA 2EXWD 1MFDL 4P99A 4HFUL 2WP3O 4LF3A 5SWSD 2JB6B 4JG1L 4K23L 1YEGL 3AMLA 4QHMA 2BFVH 2LVEA 4TPRH 1I1YA 3J8F7 2V5MA 1MLCB 4G80B 3IGAA 1NLDL 1ZLWK 2BNUB 4G7YH 1G9NH 2QSVA 2AAVA 4NRXB 3SOBL 5FIEA 5KSUB 5EBWB 3T1FA 1JF1B 4A6YA 4PRDB 3RX7A 4HEME 1NMCC 3GSVB 4HIJA 4ELKA 4OLXL 3GIZH 2AVGA 4JCMA 5EOQH 5MP6H 4EVNB 2BNQB 2IADA 4JRXE 3P0VL 2B1AH 1JUFA 1S7WB 3I6LE 4J1UA 2W92A 3UTPE 2V17H 3M1BA 1A1OA 3EDEA 4MLIA 2EDYA 5T1DH 5C09B 1J1XH 4ZDHB 2H3NA 1MQKL 4D0DB 4NNYA 3MRHA 2WIIA 1MHPL 1OP5H 1FYTB 2DQEH 2NY7H 1C5DB 1I7UA 4TUJB 4HBCL 5ENWB 1NAML 4WI6A 5SWSB 3QUXD 3G9VA 4WUUB 5DMGD 2CO7B 3UDWC 4PJ9D 3FB5A 2ICCA 4XCFL 3LPGA 4JQXC 2HKFL 1QSEE 2VSDA 3GMLB 3BJ91 1P9MA 3IF1B 4BM7A 4PGEB 5TF1L 3ZTNL 1EGJL 4E41A 5E6IB 2AERT 5I15L 5HI3D 3HCVB 4M61B 3AUVA 1BD2E 5F9JA 4KVNH 3GK8L 1RHHA 3KXFE 4HPOH 3QG6A 1X5FA 1BFOA 1OF2A 3BEVA 4MAYD 4QRPB 4AENA 3VXPB 2ZPKL 1HH9B 2D2OA 3FJTA 5D96C 2NY0D 3NFNA 4CMMB 1X6LA 1HKLH 3NBNA 1AQKL 4PG9A 4QHUB 3L3IA 2DF3A 4CRPA 1XGPA 2P5EE 4NWUH 5LJYH 1PJ9A 3RUGB 1G6VK 5IROC 1P4BH 4WCYL 2WV3A 4OZGA 4OGYH 4F9LC 3RWDB 4DKAA 3U7YH 4MQXC 2RFXB 3C6LB 3RWHB 2H2SD 2JELL 1A7PL 2GTWB 4JGMA 5T1KD 4XMKL 2P5WD 3H9HA 3FO2A 2UZIH 1EV2E 4YAQB 2GAZA 3RL1A 2AJSH 5CHNA 1LE9A 5D2LB 2EICA 5AEAA 2MQCA 4KKBD 2YR3A 3ARDD 5HY9B 1RSFA 3IDYB 5C7XL 1NGQH 4ODSH 4RGNB 1RV6X 3NFPB 2ZSVA 3P0YH 2NX5A 3B2VH 3IS1X 4LQFL 3FB8B 4XMLL 3GB7B 3MJ8B 4WW2F 4NQDE 4HJGB 4PBWD 3D69B 3WL9B 3NCJH 4GSDH 4ONGL 4LVNC 4ODTH 4ZUTB 3V4UH 3PGFH 4Z7WF 3HNTL 4UT6H 3S37H 2FIKB 3IDIA 4P3CH 5DD5L 4BKLB 1UG9A 1SM3L 2A0LD 5GISH 2R29H 4HS6B 4BQ8A 2YXMA 4P2OC 4WFHE 2F53D 2NYYC 3ARSA 2QKIA 5T1MA 5TQ2L 3MCLL 4FG6C 1N0XH 4PJ8D 3U6RA 5JQHC 1MWAL 1RJZB 4P5TC 2W9DL 4KAQL 4OGAD 5I1LB 3FT3B 5DVKA 3FFCB 4B7LA 3EYUH 4U31A 1CQYA 3MYZA 3FMGH 3F12B 5EU3A 5KJRL 4BSJA 5L7XH 1JGVL 3X11A 1WV7T 3VJ6A 2W60A 1JPFB 3UCRA 4X83A 2B4CL 1WTGT 3MGTB 5A16B 1N6QL 5KVFH 1F4YH 5C0DA 1HDMA 4LHJB 1JIBA 1AGDA 1T7YA 4PTTB 3KPSD 1E27B 5IW6A 4HAFA 4ONFL 1UM4L 3SDXF 2CK2A 1FG9C 1CR9H 1KENL 4NQCD 1T1XB 2GW5A 2N1KA 4OGZA 1S7RB 5D1QA 2A9MH 3UDWA 3QFJB 5B39A 1A9EA 5EC1B 1HIML 3SDCC 5GJSH 4NN5C 4APQB 5EBLB 2UYLA 2P7TA 1I4FA 3Q3GA 4LCWA 3OAUH 4Y1AB 4G3YL 3VFNB 4PJCF 1X4YA 1UYWH 4P3DB 1RUQL 2ZUSA 2JCCB 3RGVB 1T1ZB 3N06B 2IPTL 2YSSB 1MY5A 2NY2B 4JAMA 1EEYA 3UO1H 2OJZH 2P44B 4KVCH 3UC0H 4JPIA 1OM3L 2QJDA 4OF5A 2BY3A 2GHWB 2XTLA 3HRZB 5B3NA 2UWEE 2BC4B 2H2PC 4P59L 1YNLL 4C58B 3ARZA 1TJGL 4X6CE 1AD0B 4PRHB 7FABL 3B83A 1OWWA 2XNAB 4TULH 4X99A 4BELD 5CEYB 4XGZA 4XNXH 5FECA 4GG6B 3I75A 3TWCH 2D7NA 1YN6A 4PJIF 5FO7A 4X4XB 3L5WA 3RVVD 1MFNA 1SJEA 2UV3A 3WEXA 3UJIL 3MUHL 4U6TA 4PLJD 3QQ4A 3MV9A 5I17B 4MD0B 5K9OA 4PJGF 3WHE0 1GGBL 1VERA 3WFEL 3X14A 3HAEH 5BV7L 2R23B 1JYXA 2R69H 1RZJL 5AWNL 5K9KA 5KS9B 2OJEA 2X4UB 3OSKA 4J6RH 5JPNB 5F1IA 4CJ0A 2CLVB 5HHOB 4W68A 4L4VE 2DYPD 2B4CC 3JUZA 3MRBB 3TIDA 3MGOB 5D7IE 1KJMA 3SKNB 1SJVA 2EIDA 2CKBA 5GGQL 1LHZA 3IJSB 1HHKB 5I1GH 2AK4B 4IS6A 1T20B 1JI2A 1GGTA 3LKQB 3MRLA 1SVZA 3GDBA 3MA9H 4FQIL 1KCLA 2X4TB 4P2OA 1NAMA 1MCIA 1C08A 3IAPA 2EKJA 3LN5B 3FQXA 3MSPA 1UEMA 2P1YA 5TE4H 15C8H 1UFUA 4UILH 3MRFA 2HT4D 3ZLQC 2N4IA 1A3RH 3VGEA 4QY8A 1CXLA 5JR1H 1ZLVK 3RWIA 1AR1C 1AY1H 1EGJA 1DUYB 4NHCH 5HVHB 5EZLB 3ULUE 3A6BH 3KWWA 6CGTA 1IGIH 1AHWC 5IP4A 4M43H 1NAKL 4XHQA 1JWUB