2FJFB

Structure of the g6 fab, a phage derived vegf binding fab
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
223
structure length
218
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTISDYWIHWVRQAPGKGLEWVAGITPAGGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARFVFFLPYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Light Chain of a VEGF binding Antibody
publication title Structure-function studies of two synthetic anti-vascular endothelial growth factor Fabs and comparison with the Avastin Fab.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 218
sequence length 223
chains with identical sequence D, F, H, I, K, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2006-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fjfB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fjfB01
3SGKC 4FQIL 4V1DB 2J5LB 3IFLH 4FQ2L 1G6RL 1RZJC 3RX5A 4YDIL 3UBXI 4Q2ZA 4PJDA 3VGAB 4CVZA 5KVFL 4AIZB 5DRNA 2OR7A 2CKNA 4PB0H 5D2NB 2EICA 1HHHA 1IC4H 3OQ3B 4XCYA 5TF1L 3PWJB 3ZL4L 2V5RA 4J1UA 5LGHL 5C7XL 4O02H 3QDME 4G6AD 1FZKA 3SDDA 1P4BH 1SJHB 2VUOA 3FZUD 4J4PA 4PJAE 4NP4L 4L9DA 4X5XB 3W11C 1K8IB 4GKZA 2XZQL 3GMQB 3V6ZB 5FDYA 2Z8RA 1WC7B 4EN3C 3FQUA 2ADJB 1VFUA 3ZO0A 2NY1C 5E7BA 4C59B 4YFDB 4GAGL 3FT2A 3IJSA 4AMKH 5C08D 4LCCA 4GRMB 2E6JA 3LKNA 2B39A 5DA0B 3LCYA 5SWSD 1YNKH 4R0LA 5HHNB 5DQDH 1CFSA 1Z9LA 4GG6B 3LN5A 4X4XA 5DHVH 3G9VA 2XQBH 3RZCC 1JNLH 3GM8A 1D6VL 5J3HC 4BQ9A 5EZJB 5T3XL 2VLKE 3LB6C 1V7MH 4PJFF 1C08A 3QIBD 4HIIA 2EYSA 3UTQB 5CFHA 2ADGA 1JV5B 4FP8L 4X4MA 1QR1B 1OW0C 1WBYB 5E9DD 1N4XL 3AS1A 3U7WL 2Y1VA 1BD2A 1T0NA 4OT1L 1K6QH 4RAHA 3EJYC 2FEDC 4UILH 5DYOB 3VFWB 4Z78B 3S9DB 1L7IH 2B2XH 4P5TA 1JNJA 2GJZA 5JIIA 1TVHA 1IEBA 2DQHL 5I1DB 2VLJA 3EDDA 4BZ2L 3WKMH 5B39G 1G7LA 3P2TA 4WI3A 4GBXA 3QIWA 3V5DA 5I1HL 1F4AA 1U3HA 5TE7L 4NZRH 1DN2A 1JHTA 4DAGL 5IBUB 5T1DL 4FG6C 1U8IA 3O41A 1IKNA 2XZZA 2PR4H 4ODUA 3S34L 4M1DH 4OTXH 2Q7YA 4NRXB 1RMFL 2EH8L 5AG9A 4BH8A 1C5CH 2VXVH 1EFXD 3TA3D 3IFLL 1AHWA 4IMKC 3KDMA 1RURL 2VB5A 4UNTA 1WWBX 1BQUA 4NKIL 4MXWH 3GJEB 4PB0L 4WU5B 1J10A 1T3FA 4WGWB 5L2KB 1CICB 1IC4L 1UWEL 1ZLVH 4ODBD 5JW4Q 2GHWB 5IJKA 1NGXB 4NM4H 1E4KC 3CGTA 4KUCD 4LOUC 1HCVA 4PIRF 3HZMA 2H2SD 2EEAA 4KJYB 4NSKB 1FZOB 3VXMA 4FQJH 4O02L 5GGVY 5FHAH 4YHPB 2BRQA 3QJHA 2AEPH 3GSWB 4Y1AB 1P69B 1YEEH 3W39A 3EYVA 3QFJD 2VAAB 4KTYA 4HGMA 3BVNB 4KV5F 4AMKL 3F5WA 3MGOA 3TBTB 3DRTB 1YNKL 3TIEB 4PV8B 1FVEB 3HB3C 3C5ZD 5DVLA 1GGYA 3TVMC 2J4WH 5I71B 2WAHA 3V7AE 4F15C 1JNLL 1EA9C 1FFNA 1V7ML 3O3EA 2DMCA 1MCWM 2J8UF 5JLZA 3H0TB 1XIWD 5C8JA 3SDAA 2O61B 2EE2A 3VGFA 3CVHA 3WLWD 1JZ3A 1K6QL 4Z77B 1A6ZB 1L7IL 2WP3O 1CL7H 2V6HA 2DM3A 1QLEH 4PRPE 4WI2A 1MHEA 3BP5B 5C1MB 3SCMD 5IVOA 3L3JB 3OPZH 4KROB 1KPVA 1I1FA 2OXGA 3WIFA 1I3GH 4ZAKC 5FOJA 4GRWB 4MZ2A 3DSNA 3BUYA 1QSEB 1MCPL 3OXRB 4RGMB 3RU8L 5DT1H 4ZXBC 5CBAB 4U1MA 4LSUH 5E6YA 4AG4H 2PYED 3I75A 2FO4B 2PW1B 2PR4L 1CFNA 4U2ZA 4M1GH 2DYPB 5LQBH 1HHGA 5DHVA 1NEZB 3CDGA 1C5CL 1KGCE 3GEWB 2VXVL 1R24A 4M4RA 5MEPB 3ALWA 3D5OF 1N7ML 1N6VA 2DQJH 4P3DA 1CFTB 4UTBL 1PG7X 4L9LC 4LSTH 3GJFH 4MXWL 1ZA3A 4P3CL 4P23B 4QY8A 4LPYA 5FYKD 4LF3B 3GIVA 2BSTA 1KTDB 4EVNB 3SGKA 3I2CH 4YDJA 1X7QA 1X4ZA 4NM4L 5JHDE 2OCFD 2HLAB 3LRGA 1BP3B 1MFEH 1MFBH 4RMWA 1S5IL 4RNRB 4FQJL 3QXDB 5C6TH 5FHAL 3WXVH 3QUMH 1OAQH 3L7FB 5GGRA 3KPSA 3T4AA 1BOGA 4PJAA 3HNVL 2AEPL 2ICWB 2V17H 1EBAA 4L8CA 2UV3A 1UFUA 3NPZB 5FKAA 4LCIH 3DVIA 3U4EB 4QRPD 1S7RA 4CGTA 5J8OA 4UI2A 1TCRB 1X6NA 3RVXD 3HZVB 5D7LE 4MJ6B 4NCDA 5FM8A 1JF1A 1FVDB 4X6DF 1K2DB 2HWZH 1ZOXA 3STZA 1F00I 5D1ZB 2J4WL 1ZGLB 4EN3A 5FA3B 1U3JA 3W0WE 3PL6D 3VFSA 2VLKA 1I7ZB 3O3DA 3MLZH 4R4BA 1UJ3A 2NW3B 4H1LB 2GIYA 4M6NH 1NFDE 4DOHB 4E42B 1FYTB 5IEHA 4PRID 3UZEA 2XN9A 3KPMA 3CPLA 1QBLH 2FJGA 3MGTB 1OTSC 2GTZB 3TN0D 3ZYOA 4F57H 4OD2B 1LNUB 2WWMD 3RZCA 5ETUA 2GJ6B 4PJFB 5HGBB 5C6WH 2Z91B 2JKXA 1RV6X 5C0RH 5DI8A 2CDFA 3OPZL 4L3CA 2ZNXA 4KUZH 2VKWA 1N59B 4JO3H 1NUGA 3N85H 4ENEC 1NFIB 1S3KH 5IB5B 2IMNA 3KPNA 5DT1L 3B9DA 1Q9KA 4LSUL 3FQTA 2WSKA 4AG4L 2DAVA 3VRIB 4JFHE 4M1GL 1J12A 9CGTA 4AK1A 2QLVB 5LQBL 4UIMA 2RBLA 5CSZA 2ZCHL 5E56A 2DQJL 3EAKA 1AO7B 4QKXB 4LSTL 3LN4A 3AAZA 3O3BA 5MP6H 3ZSTA 2W92A 5KSAC 1CQYA 1G0DA 4L8DA 4PP1C 2ZOKA 3IYLW 1WZLA 3CU7A 3I2CL 4BQ6A 2QR0A 4OZIF 2HJFA 1MFBL 1MFEL 4IMKA 3D0LB 5KAQG 4ZYKB 3HE6B 1S5HA 5C6TL 3WXVL 3QUML 4KGJA 4XCNA 4YK4C 3AM8C 3BJLA 1I8KA 4ZDHA 1K5NB 3MRRB 3T0AA 1S9YB 2IAND 2V17L 2RCSH 3MRKA 5JORA 2A6DA 2QSCH 1NBYA 1LGVA 4LCIL 5HYJB 3CFKA 4MQXC 3ZDYF 2DI8A 4YXHH 5FUOH 4GAYB 3K1KC 2YSSB 3QG6B 3RVTC 2X2YA 32C2B 4X7CC 1QRNA 4OD3H 4U1JA 4F9PC 2Q20A 3X3FH 5C0AE 2YRPA 5EC1B 2HWZL 1HWHB 3WNLA 4NFBA 2BDNH 1W8OA 5D96C 5BCAA 4CMMA 1U8KB 3QRFM 3ARDD 3LSOB 1R5VB 3NA9H 3DVFA 4OFYA 3DIFA 3GJFA 4JKWA 3OKOB 4K8RC 3N50A 4KJQD 3T4YA 1KT2B 3QQ4B 2FH6A 5J12B 4MXVE 3IU3B 3O4OC 5GZND 3TVMA 2KZ1B 4Q6IC 4MLIA 3ARGD 1QBLL 1ZK9A 3HAEB 4LBEB 5DURB 4F57L 3L95A 2VN7A 1KIRA 5E8NA 5ISZD 5I1AA 4R9HA 3KYOA 1DQJB 5CD5C 5C0RL 1I7RB 5BS0B 3GSXB 5IROC 4K23H 4QHLA 2DJUA 3LEXA 4KUZL 5CSGA 3RGVD 2YPKB 5DEGA 3FFCA 4EDXA 4JO3L 3N85L 3KS0H 2JB6A 4N8VA 3OR7A 4XH2A 2X4NB 4LVHC 4U33A 4PFEA 2X41A 5IW1B 1IGFH 3RKPA 3DVGA 3RNQB 4X4ZA 3VFMB 4Z7UE 5HI4D 1ADQA 3GMPA 4JN2A 1ZHNA 1QSVA 3ULSB 3P4LA 1I9EA 4K3EH 5IIEB 3RL2B 1IKFH 4FQXD 5MP6L 1FFPA 3VFRB 5A1AA 4LNRB 1KPUA 4Z7QF 3IDGA 1A1MB 1Q72H 4X8JB 4L4VE 3KPPB 3DGGA 3H2WA 4YHIB 4D0BB 4OLWH 3EYQC 2NXYD 5EU5A 4L9LA 3ZE0E 4KVCH 1JMXA 3FN3A 5IB4A 1B88A 4K8RH 1YNTB 3V52H 5I1EH 3HHRB 2RCSL 3OHXB 2W65B 4OM1L 3VFTA 2QSCL 3LD8C 2YD1A 4NT6A 1CDBA 3WFDH 4L5FH 6FABH 1X5IA 5D7LA 4YXHL 3WS6A 4X9IA 1JF5A 5FUOL 2WINB 2LE9A 3BMVA 3MJ8A 4LCUA 1U8HA 2IH3A 3UZQA 3RZWA 4OD3L 3ZTJG 4F37K 5SV4A 1X5FA 3X3FL 1B6UA 1JVKA 1UACH 3W0WA 2Y36H 3FT4B 2BDNL 2X4QB 4K71C 3D3VA 5D7IE 1PJ9A 1YEJL 3NA9L 4WW2C 3SN6N 5BRZE 4HUVA 3SE8H 4XNYL 1UWXK 3FB6A 1TVBA 5A2IH 2BVOA 2OJZH 3F7RA 1KG0B 1IAIM 4F33B 4ZQKB 5KBNC 2Q3ZA 3LKPA 4UV7H 1WITA 5DC4B 4WI5A 3HMWH 4MX7B 4QXWA 3V7MA 1CZ8L 1J1OH 3ZKSD 5J0BA 3U36B 1QSFD 5CZXD 4MS8C 5H35B 4K23L 4XNMB 1O7SA 4HW6A 3UEZA 5IMKA 2JIXD 3Q6FB 2JCCE 1FL6B 1I1AA 3LV3A 2F58L 4QHNB 1AR1C 5HVHC 3KXFD 4PJHF 4R2GB 5DK0A 4NC0B 1Y6KR 1MLCB 1UZ8B 4PJXA 1F4XH 1IGFL 4YR6A 2PO6B 2WM0A 3DI3B 1UWGL 3K2MC 1IEHA 4F9LC 1Q9OA 4N1CA 4WUUD 1AGCB 5E03A 5FYLD 4I2XB 5E94B 4JFFB 2RFXB 5IEKA 1BZ7B 4LCWE 5BOZG 1T80A 3TIDA 1IKFL 1G6VK 1JWUB 1YECH 2YPLB 3FRPA 2NNAA 1WBZA 4P2QD 3T1FB 2A73A 4N0FB 1Q72L 3Q0HA 5KAQF 4NQSA 1BPVA 2W60B 4JRYD 1G1YA 4NHUB 4PBVC 3HE7C 5EOTA 4KVCL 4JN1L 4HKJB 3TBYB 2GSGB 4K8RL 4HS3B 4WJ5B 1OVZA 4OKDA 4OZIB 4QHKI 2AV1A 3SDCC 4Q9CA 1NCUA 1BVKA 1MCOH 4IOFC 2DL9A 3ARRA 4WWKB 4ZSOE 3SDXF 4MNGB 4YFLF 3SGJC 5KS9F 3WFDL 4OV5A 4L5FL 2D0FA 6FABL 4S1SH 3ARXA 1ZT4A 1Z5LB 2BNUB 5C0AA 2NY0B 3QUXB 3AM8A 2A9MH 1NCTA 3ELAT 5ACLA 5DTFB 3QCTH 1UACL 4FTVE 3E2HC 4N9GA 4OCRH 4R96A 3WFEL 3CX5K 1A1OB 4HZAA 1DQMH 4EUPH 3SE8L 3PF2A 5D5ME 3BOVA 4F9PA 4U3XA 5C0IA 4JCMA 4KZDH 5ESVA 2OJZL 4F7TB 5IW6A 4PJ5A 1FP5A 2DBLH 3EYOA 3QDJB 5HHXH 1JZ2A 1VADA 3HMWL 3ULVC 5E08H 2OL3H 4NIKB 1J1OL 1T20A 2FYYA 3KG5A 1LK2B 1WIPA 2QL1A 2MTPA 4LPWA 3MUZ1 4ZO7A 4NN7C 1TQCC 1FNHA 1IGMH 5DRWA 2DWEB 4Q6IA 4Y5VB 1OL0A 1GZQB 4XZUB 3V79C 2BC4A 4OAWA 4JRXB 3BZ4B 4KMLB 3C08H 4RISH 1FNGA 3ULVE 2ARJB 1AGDA 1XF4B 4ETQA 4DN4H 2A83A 5J13B 5IROA 3RNKB 1F4XL 3M17A 1XCQA 4FQQB 1A0QH 3X13A 3ETBF 1EHNA 4NRZB 4PTUB 5EC2A 1A6TB 4W6XB 1G7PB 3W9EB 5E8EA 5SWZA 4WCYH 5BZWA 1DQTA 1YECL 3BQUD 3NFSH 5JPNA 4TVPE 3L3KB 5IT2L 4YQXH 1V3JA 1N0LA 4IJ3C 3ILQD 3IKKA 2E27H 2K7PA 1PLGH 3N06B 4PLOB 3U6RA 4CVXA 3MRCB 4GJTB 4M3JA 1HQ4B 2PTTB 4ZMAT 4J3UA 3L3OB 1NGWA 2YWZA 5DS8A 5C0BB 3NOIA 5MI0B 3O6MH 3BKYH 4LARH 3MA7B 1HHKB 3WDIA 2A6JB 4GT7A 2FR4B 5DHYB 1I3RB 4E41B 3O4LA 4S1SL 2R23A 1VSCA 3VRLF 4OD1L 3GSNA 2E9JA 4LSSH 5JOFB 2A9ML 3F7YA 2BNRD 4GRLC 2APWA 3VGDA 2QKIB 3QCTL 3HC3H 4OCRL 2X4RA 5DJ6A 5F1OB 4XXDB 5KN5B 4P49A 5IFHH 1DQML 4XC3H 3NAAH 4FXKB 1HQRB 3P4MA 3C9NA 2IEPA 4OZ4A 5IV2B 3HC4H 4D0CB 4KZDL 4OZHE 1CXLA 3VG9B 4PGBB 1HH9B 2F74A 2X1OA 5JW5B 2B0SH 4AM0A 2DBLL 4S2SB 4WW2A 5E08L 3GUTA 3IETB 5IG7B 5C08B 3IDJB 2OL3L 3QFDB 3FQRB 1MRDH 1B4JL 3DX8B 3ARZA 4HH9B 2FL5B 1B3JA 4QRRD 1W0WB 4DEPB 1QP1A 4POUB 1IGML 1PG7L 1YYMH 1R5IB 4FFVC 3RWEA 3MRPB 3MRNA 4UAOB 1S7TB 1VEMA 1T1WA 3S4SB 1PW3A 1TJGH 3BKJH 3G5YA 5DJ2B 1IQDB 2HTKD 5E2VH 3MJ6A 3C08L 4RISL 2F54D 4KKLD 4JM2A 4DN4L 3IDMB 4WHYH 1EAJA 2P44B 1AH1A 5CHNA 3PHQA 4PJHB 2VDQH 3SKMA 5AEAA 3D18B 4EUPA 5DDHB 4GS7B 1ZLWK 4ZUVA 5L2JA 3GGWA 4KK5D 4RX4A 3EFFA 4JB9L 1J1XH 3WV0A 4YDKH 2GK0B 2F8OA 4XCFH 1W0VA 4WCYL 4KJPC 3NFSL 1J0ZA 2NTFB 4YQXL 3TCLB 3KPTA 4YAQB 4D9QD 4F9LA 2F53E 2AJZB 2OL3A 2E27L 1PLGL 4LPCA 2XACC 4JHZA 2DJSA 4GW4A 2GJJA 5DJDB 3CIQA 1FE8H 5HY9B 1BM3H 3KLAA 1IGJB 5B38B 5C0EB 3EGSB 4HUUB 3TA3B 3B5HA 4S0SD 3O6ML 3C2AH 4JZOA 2DKSA 3ORJA 4KXZI 4LARL 1MH5A 2EXYC 1M05B 3QXUA 3H9SB 4L3AA 3HE7A 4QYOB 4PRAB 3ZMRA 1EO5A 3N0PB 2VDNH 3MV9D 4LSSL 5L7XH 4LLDA 3B9KB 3NFPA 4FTVA 4H25B 3SDCA 3QXAA 5C0CD 3PXJA 3SDXB 5KS9B 1BQHB 3HC3L 3NBNA 3EJZD 1UKSA 1S8DB 3HC0A 3SGJA 1JYNA 4MXQD 3G5VA 5TH2B 3LKSA 5D5MA 5IFHL 4NQEE 3NAAL 1JGEB 2YPVH 1BX2A 4PRHE 4DVRH 3BW9B 4JFXB 2AEWA 3NCYS 1PD6A 3QFJB 1BMGA 2B0SL 4ODWB 1KJ2A 4NN5B 3SGDI 2DQIH 3AMLA 2ZJSH 1NMCC 1H0DB 1MWAH 3JWOH 1T04B 5A3IC 1AXSB 4YNYA 4PLKD 2J12B 3RDTB 1YYML 2Q76B 2NW2B 4G8EB 1UB6B 4E5XB 2X9YA 1G7MA 3PWPA 2YA1A 4NNYA 3HTLX 3C2SA 2VLJD 4XTRD 4MAYC 4JDZA 5E2VL 3KWWA 4GBXD 3QIWD 4MQ7A 1U3HD 1IE5A 4M93B 1I8IB 1FL5A 3IRPX 3WE6A 3QDGD 4W6WB 1CR9H 5FXCH 3R8BB 3H3BC 2VDQL 3VRJA 3VXUA 2NX5E 2IPUK 2KDGA 3DXAA 2DMBA 4HLZG 4M61B 3KLHC 1J1XL 4PJ7F 5ID0A 4YDKL 2MQ3A 4XCFL 1FAKT 2OMNA 4PJGE 4P2RA 4MA3B 4P4RA 2CK0L 4PJBE 3MFGB 4BQ8A 2CXGA 3I3DA 3LH2L 2BSRA 4RGOL 1JCKA 3IFOA 1WIUA 2XA8H 4QXTA 4LKXA 2A0LC 2ID5A 1D9KC 1FE8L 2D7QA 3O6KH 1BM3L 1JNHA 3QHZH 5I66B 3KJ4B 3SO3B 1IZKA 4U6YB 1DQQB 4MA1B 2R8SH 2ZOLA 4JFDB 3C2AL 4RMVA 3CC5A 3WFHA 1A9BB 3G6JE 3IDYB 5I17A 3P77A 1NC4B 1CQKA 4YBHA 1KIUA 5HDBF 2EKSB 4MMZC 1KN2H 2X5PA 3BESR 3RVUC 5IKCA 2CXKA 4IRJD 5E00A 2VDOL 5IVZA 4E9LA 1ACZA 4G8IB 3REWB 4RA3A 4CMHC 4P5MA 2YPVL 1FCCA 3F12A 1T5WB 2O5XH 4G8GE 3V5HA 1ZTXL 3BWAA 4A6YB 3C60C 1CF8H 1RZIA 5K9KB 1UGNA 4OZHA 3MZGB 2H26B 5DWUH 4GRLA 2Y5TA 3R0NA 3RUGF 4DVRL 3HUJA 1MCEA 2A2QT 2E8ZA 3HZYA 4XMLH 1DN0A 3MV7B 5GRVK 2FJFB 2DQIL 5D7IF 5E70A 2ZJSL 3MODH 3UYPA 5FM4A 2M26A 4JM4H 4IRSD 1MWAL 3JWOL 4NJ9H 4WFGD 4AL8H 1PZ5A 3MUGB 1GGCH 4YBQC 1YMME 4ORGB 1OP3K 3GSVB 4R7DB 4MJ4A 5BVPL 4RMQA 1ZA6A 3UDWC 1F3DJ 3KPRD 4PRIB 3TN0B 1R5WA 1CR9L 5GS1B 4JZJB 2QQNH 1A1NA 1FJ1A 5E6IA 4YHZH 5DA4A 4HK0A 5F93C 5E8PB 1FZMB 1ZLUK 4NO3A 3JWDC 1HE7A 5EN2B 1KTLB 3U9UA 3BHBB 3WS3B 2LAGB 4WEMB 3FCTB 3U0PA 1FN4A 3CFCH 2AJVH 3FONB 4JFQA 1MWAA 2XA8L 2NY2D 5J11B 5BV7C 2O5YH 4F58H 3O6KL 3EHBC 1CN4A 3QHZL 3SPVA 5IQ9A 1CGSH 1I9JL 4NKMB 4FMFA 3I6LE 2VC2H 3BD3A 1G7JA 3L9RA 4PG9B 3QDMD 2R8SL 1ITCA 1CTNA 1UT9A 5IOPA 3PUCA 3KPSD 3F58H 4LEOA 4F8QA 4DVBA 1MCSA 3IXTA 3L3IB 4MD4A 2FLBT 4L29B 4YLQT 1KN2L 3QWOA 3DURB 3FB5A 1H3WM 1JUFA 1BVZA 4HKBA 5IB3B 4O5LH 2APTA 3LS4H 3TO4B 4KMQA 1UXSB 4CW1B 4NQEA 3P9LB 1QSZA 4XAKE 4PRHA 3W11D 2HFEB 2O5XL 5KSVB 3OG4B 1CF8L 2EECA 1G7IA 4EN3D 5JA9A 5DWUL 1L0XA 1MJJB 4R26H 2NY6C 2VLKD 3LVEA 2ZP0T 3QZWA 4XGZB 3B83A 3MROA 4XMLL 2OQJB 5TDPB 4HMEA 4U1NB 3U7YL 1Q94B 3MODL 5F71A 4IIQB 4JM4L 1XF2B 4APQD 1W8NA 3TP4A 2XN9D 4NJ9L 4AL8L 3GK8H 3MNZA 1GGCL 1E4WH 2BY2A 3BD5A 1NDGB 5T5NG 2NY5C 4Z7VA 5KOMC 2R0LH 4X6FB 1AXTH 3EDEA 4J2XA 1RULL 3EBAA 4RIRA 3PP3H 5DD3L 3GDBA 5BV7H 3ARGB 1T1YA 1KXTB 3IAPA 3FN0L 1HXYB 3V4PH 3GKWL 2NX5A 2QQNL 4GXUM 1YC7A 3I84A 1OGAB 1K8DA 3QH3B 1J0JA 1KIPB 3EYSH 4HPOL 4LDOB 5EZLB 1CIUA 4FFZH 4YHZL 3CLFL 1JZ8A 3ZKMC 5MENB 4YHYC 4PJGA 2P46B 4CKVX 5A2FA 1FNEB 4PJBA 4TUJA 1CG9B 5HDLA 5IMOA 4Z7OE 4L4TA 1DE4A 4FG6D 3TPUB 3CFCL 1A4JA 2AJVL 2IALB 4Y16C 1EDQA 4CU6A 2ERJB 4PJIE 1HXMB 2O5YL 4F58L 3GHBL 1IAII 1CGSL 2FEEI 3OAZH 4P48A 3QP3A 3UTSA 2VC2L 3GMRA 5EO0A 5FO7A 1BJMA 4MHHG 1DTUA 2OI9B 1MFCH 3QEUA 1RVFH 3D2UD 3G6JA 3MRIB 4UU9A 3STLA 3F58L 3EZ8A 3LY6A 3EUUA 1D9KA 1DBAH 3RWDB 1PQZA 3HCVB 3PJSA 4S10A 2Y9RT 1F6LL 2DWDB 1UQSA 3B5TA 1RZFH 1OAXL 2H3NB 5F9WB 2YOCA 4O5LL 2W9DH 4NKOA 3AREB 2R4RL 4KZEH 4M1CC 5HYIA 4PJ8C 1QRND 4XNXH 5ID1B 3O81A 4NZJA 4XNQB 3CSPA 4G8GA 4Y4KC 2QADC 2VDRH 4UOW1 5C0DB 2OTUA 4ZO8A 2LTQB 4R26L 4LLMB 4OFYD 5KSBB 4L1HA 1I7TA 3PP4H 4JRWA 5GS2D 2YUVA 1OD7A 1T03H 4G9FE 3C09C 3TZVC 4GQPH 4L4JA 1Q9WA 4K7PX 4X98A 3HB3D 3MJ9H 1ZVHA 2X05A 2B5IC 2EIZB 4K3JH 1XEDA 3HG1E 3TVMD 3TNMB 3PDOB 3RUGB 1YMMA 3GK8L 1E4WL 2R1WB 1X44A 4GKNB 1NC2D 3BGMA 1WFOA 3VWKC 4LHJB 4PRPD 1R0AH 2PCPB 2DQFA 2R0LL 4WUKH 4LVEA 2C3GA 3BH8B 3GBMH 5K9QG 2VSDA 1AXTL 4KY1H 3UJIL 5HHQB 4H0HB 3DV6A 2Q6WB 1IT9L 1J11A 4YHNB 3A6OA 1QUNA 4KKCC 4ELME 5FOBB 5JW3H 1T0PB 4YHKH 4IEFB 2AJSH 4H0IA 3V4PL 4CU7A 5E1HB 2GTWB 4G42A 3VFOA 5IM7B 3CSBA 4LP4A 1N0XH 3EYSL 2ZUXA 3O2WH 4FFZL 1KGCD 2BFVH 2JLLA 3IJYA 3UDWA 3VXSB 1G9NC 4ZAKD 1D5ZA 1NANI 2JIXB 4KK6C 5EUKA 2YS4A 3K74B 5HYSA 3FOLA 2IBZY 4ZXBD 4OLXH 3L3GA 1DANT 4ZUTB 2WIMA 4ONGH 1OGTB 1P6AB 2GKIA 1EEUA 3PGDA 4P5KB 5CUSH 3B6SB 5DJCA 2YKLH 4X6EB 3V0VB 4NYLB 5LBSH 3MCKB 1MHCB 3S37H 5JHDD 3ABZA 3L3HA 5FUZH 2L4OA 3SJVA 4Q58C 4JO2H 1I9RH 4PJDF 1RVFL 2ZUSA 5MEQB 1H8OA 2I27N 1JZ4A 1VDGA 4OM0H 1DBAL 3CFJA 1SQ2N 4YDLC 1AKJA 1S9XA 1C12A 3BPLB 5ACZA 3L7EA 3LN9A 1RZFL 5D7LD 2HAZA 3LHPH 5FCUH 2W9DL 1MUJA 1Z6JT 2P8LA 4QT5B 4XNXL 5FA4B 2CQVA 1KCUH 2AP2A 5KVDH 2AV7A 2BCKA 2HN7B 4U1KA 2IG2H 3W0WD 5D1XD 2VDRL 3C6LB 3E1F1 1DUZA 1N2RB 1INQB 3IJHB 3ZKQD 3TYFB 2OTWB 4HH8A 1HDMB 4Y5XB 3PP4L 2BXYA 4HMCA 3X12B 2Z31A 3MJ9L 3B43A 1AY1H 4K3JL 1YEHL 3PQYB 4I48A 4YDVA 2P8MB 3O9WB 5T5NF 3EO1A 2VZOA 3VXQB 1MJ7H 4ZPVB 3ZE1F 2X7LA 3BI9X 3U2SA 4WUKL 1SYSA 3GBML 1RK1A 4LPUA 3MTRA 4KY1L 1FO0B 1Q0YH 1U3YA 4K7FB 2VIRA 5D1QC 3T0WA 3MXVL 1LE9A 3NIGF 1S7UB 5JW3L 4YHKL 2EYRB 1M7DB 4Y4FD 2AJSL 3M1BB 5DJZB 1UCTA 3IAGC 2C5DC 4KDWA 4JFHD 3QUYB 2QQQA 4JPKH 1N0XL 3O2WL 2BFVL 3FB7A 3SE3A 4MJIA 1WLHA 4ENED 1FG2A 1U95B 2B4CH 4KI5C 3MZTA 4OLXL 4EZMA 4JY5H 1ZHLB 2ZWLT 5HHOE 3MJ9A 4PJIA 5CUSL 1LQSR 5IHBA 1JK8B 1T2JA 5JPMA 4KHXH 1X9QA 3CXHJ 3LRSB 3QDAA 1ROWA 5LBSL 3I02A 3VJ6B 2LVEA 3LQAC 3S37L 4WHDA 2CRYA 5I1LB 5FUZL 3WFBH 3QQNA 4H26A 4KI5E 5F3HA 5L9DL 4JO2L 4AQOA 1I9RL 3SE9L 4Y16A 4JFOA 3BP4A 5KSAD 3VE0A 3QB7C 4C58B 4OM0L 4PP1D 3BQUB 1HOCA 3OX8B 1DBMH 4R3SA 2YUXA 1GRWA 3QO1B 4O2FA 5IWLC 4UT6H 3CFDB 5F6IC 3FO1A 3BAEL 3LHPL 5FCUL 1G9MH 2RQ8A 4ZS7H 5ALBH 5DJ0A 4LRIC 5I1KH 4XHQA 1OTUC 2PYFA 5C0AD 1KCUL 3MRGB 2DTML 5I76B 5JZ7C 3Q1SH 2C7UA 3HN3A 5HHVH 2IG2L 4QO1A 5IFJA 4ZTOL 4TN9A 5I0DA 3WMSA 1HSBB 2NXZC 4ZUUA 1T4KA 1ZHKB 2AXFA 4LSPH 2X4PB 3RVTD 2AEIT 1AP2B 4NM8L 3ILPB 4PJ8A 5JNYB 3HG1A 4J23A 5JA8B 1ORSA 4Y4KA 1AY1L 4JFEA 1NPUA 4ZFOB 3AFLA 2VITB 3MNWB 4GXVH 5EBMB 4PJ5D 3MRQA 3IDXH 5I1JH 4JJ5B 4ODVH 3VFVA 4KI1A 4LDLB 4KGLA 4WO4A 1MJ7L 2ED7A 4I1NB 3TZVA 1M71A 3DROA 3PV6B 5DRZB 2YWYA 3A6BL 1Q0YL 4QRTA 4RMRA 5GRJH 1BJ8A 1KLGA 2HLFC 2R0WH 4ELKB 1CGXA 1TQBC 3LQAH 4PGDB 3VDCA 3VWKA 5FB8B 3VFUA 5J56B 2KUTA 1OCWH 4HC1H 3J7HA 4BFGA 3E6FB 5A2LH 4MWFB 4KJWC 2D31A 4QRRB 4U31A 1BQLH 8FABB 5BZDB 1E4JA 1V7NH 2IAMC 3MLYH 5TPWH 2B4CL 3NCJL 2DF3A 4JY5L 3ZT7A 4N8VG 1XFPA 4MA7H 4RCAA 2A6KA 2F54B 4KHXL 4XI5D 4FMKA 5DSCA 1CE6A 2BMKB 4RWYH 3RX7A 1CBVH 1P7KA 4P2OC 1KCSL 2G2RB 3WFBL 5T1MB 5E1AA 2WP3T 3MV8E 5C07E 1J9CT 2EH7L 1S7WB 4Z7WA 3O8XC 1DBML 1F8TH 4PP2B 1HKLL 4Y2DC 1SJEB 5TE6H 2ATPA 4Q2ZB 4PJDB 4CVZB 4UT6L 5B8CC 3EYQD 1CXKA 5DRNB 1G9ML 4ZS7L 1HHHB 5ALBL 5C9JB 4XCYB 2DLEA 1S9VA 3U0TA 1VFAA 4IHOA 3OTTA 4J1UB 4OIBA 3Q1SL 1ODAA 4MD5A 5HHVL 3T04D 5LGKA 1FV1A 4UDUA 4HBCH 5BRZD 4NQCE 1JHLL 3QUZA 2CJUL 3ES6A 1RUAH 4JREC 1FZKB 1LO4H 1XGRA 1UG9A 3SDDB 2R0ZH 5T1KD 2MWCA 4M8QA 2V2WA 4MQTB 1OT1A 4GKZB 3BIAX 4X7SH 5F7DA 2AK1H 4PYGA 3FQUB 3RJQB 4GXVL 5DK2A 3IDXL 3CDFA 5I1JL 4PJ9A 2DLGA 5C09E 4ODVL 3CD4A 3IJSB 4LCCB 5DFTA 3LKNB 2PTUA 4U1SA 3BP7A 4R0LB 1DBKL 4NCC2 4XCCH 1CFSB 1BQSA 5CLWA 1G6RB 2HT2C 4X4XB 3RTQC 2C9AA 2P7TA 2R0WL 4QHKJ 3BE1H 1I1RA 3LQAL 4G6AC 1I85A 1C08B 4HIIB 2EYSB 5GRWA 5IK3A 3VXRB 2ADGB 3QPXH 2P43B 4MS8D 1OCWL 2CLRA 4MNQA 5HDOA 5ITFA 1I3UA 4ZFZA 4HKXA 1II4E 1I9IH 1BD2B 1T0NB 5D1QA 1RIHH 35C8H 1AQKH 4P5TB 3MLYL 5TPWL 3FQNA 1T5XA 4HIJA 1TVHB 3MQIA 5TQ0L 5EBLA 2X4TA 1KNOA 1XMWA 1G7LB 1WCBA 1FNSH 4FS0A 4MA7L 4GBXB 3IAQA 2EXWC 3QIWB 3V5DB 4ZUWA 2HTLC 5JTWA 4UNVA 4RWYL 4C54A 1JPTH 5GGTH 1B2WL 1S7XA 1JHTB 1K4CA 3KS0J 1U8IB 3O41B 4JLRA 5FIEA 1WWCA 4ODUB 4LPVA 1A02N 2Q7YB 4Z7OF 4RMSA 5BJTA 4BH8B 1I8MA 1NCCH 4EEEA 4I5BA 4MCYB 1AHWB 2IGFH 1F8TL 4LK4A 5TE6L 4Z5RA 2HVJB 4Z76A 4U6HA 4XBGA 4HC1A 3HE7D 2Q3AA 3VI4F 4MB5A 4O58L 4DCQA 3MV11 3A0OA 4LIQL 1T3FB 3QNZB 1DBBH 5FEBA 3ULUC 1EEYB 4FTVD 5GJSH 3SDCD 2AJ3B 3O11A 3HZMB 1EUUA 3VXMB 4HBCL 3W5NA 5IWLA 2UVFA 4U05A 1RUAL 1RJYA 1LO4L 2R0ZL 3QJHB 2BHUA 4XMPH 5GGSY 5A40E 4LRIA 4PR5A 3NN8A 4PJCA 5HXMA 5D72H 1QACA 4X7SL 4HFWB 3ULUE 3W39B 4YHMH 1OP5H 2C4XA 3EYVB 5F7FA 1IL1A 1NMBH 1FPTH 3VD3A 1M7IB 3V6BR 3F5WB 3TYGH 1DVFC 2SEBA 1DP0A 5ESAA 5J7CC 4XCCL 4YZFE 3D0VA 1T7ZA 3ZKXB 2CRMA 3T2OA 3U4AA 2NPLX 5DEFB 4HWEH 4AENA 5DC0A 4IDJH 3ULVD 3VWJA 4RRPG 3O3EB 5IHUH 5D4QA 5JLZB 4XBPA 4NQDA 5C8JB 4U1GB 3TBSB 3SDAB 1IAOA 4I0CC 2BVYA 3NIDF 1T1XA 5I73B 5TE4L 1MRCH 1I9IL 3T3PE 4Z8FH 4ZD3H 2JJUA 1KJMA 1RIHL 35C8L 1AQKL 4QHUA 1CGYA 1JPGA 2VISA 2CIKA 4KTDH 1J7VR 1MHEB 2CO7B 4F3FA 1FNSL 1KPVB 4TVPD 1E6OH 1I1FB 3WIFB 2XG4A 1RSFA 4P2RD 3BUYB 1DL7H 3IDIA 5FM5M 5CIPH 2VR4A 1JPTL 3CFEB 1KB9J 1RJZA 4IMLA 5GGTL 2IAMA 2BVPA 1J8HE 4U1MB 2H32H 1BVLA 3I75B 1KPRA 4M43H 2R1XA 4U1HA 5J89A 4WWID 4OBRA 1MVUA 4P9HH 1A7QH 1HHGB 2ICES 1YPZE 4YPGA 2V5MA 5DHVB 4U0RB 1R24B 1NCCL 4HIEA 5B4MC 1FH5L 4DZ8B 4K94H 4YC2C 2IGFL 3OKLA 2KKQA 4P2OA 3WO4B 5I8EA 4K7PL 1CDHA 4P3DB 1P7QD 2JJSC 3CCHA 3RWCA 1PSKL 2Y06H 1ZA3B 4QY8B 1DBBL 3GIVB 3D39B 3DTXB 2H6PA 5I2IA 3JUZA 1X7QB 2MMXA 3O8XA 5GJSL 1YQVH 2BNQE 1E6JH 3UX9B 3BZEA 1ND0A 4Y2DA 4NQCA 5JDSA 1I1CA 5GGRB 3KPSB 3T4AB 1BOGB 1U8NA 2AXGA 1KCLA 4JR9H 4XMPL 4KPHH 4OFDA 5D72L 1U8JB 4GRLD 3REVB 5FKAB 4YHML 1U0QA 1NMBL 1Y6NR 1FPTL 5EOCH 4ZFFA 1JF1B 4D8PA 2GSIA 1KB5A 3SOBH 3L5XL 1R3LB 1TETH 2ESVE 1B0RA 1ZGLM 3QA3A 3BN9D 3STZB 1TZHA 1VESA 2R2EA 5KVEH 3QJFA 1QBMH 4FQLH 2P5WB 2NY1B 3VFSB 5MHSE 4HWEL 4F2MA 3O3DB 4IDJL 1ZLUH 2ZSWA 4R4BB 5E8DH 1IGCH 1UJ3B 4QNPE 5IHUL 4LVNC 5F7WC 3TM6A 4OGYH 5IEHB 3GMMA 2XN9B 3MREB 3KPMB 3CPLB 3FT3A 3V8CA 4J12A 3RTQA 4Z8FL 3RZCB 5ETUB 1YEGL 1FNFA 5I9QC 3RVWD 4KTDL 1CDCA 5DI8B 3ARFB 2Z35A 4L3CB 2OSLA 1JI1A 1E6OL 4PJXF 4WEUD 4QRSA 1R3KA 5LKNA 4M8VA 1DL7L 2F53D 3PL6C 4KKNA 4K3DH 4XMKL 5EO1A 1U92A 3KPNB 2DM2A 1Q9KB 3R8QA 1IC1A 3FQTB 2VH5H 2B1HH 2YN5A 5SWSA 4EUPG 5T5FH 4AYFA 2W0FA 4P9HL 1A7QL 1P9MC 3V0WH 4UIMB 1B90A 4KJPD 1JZ6A 5CSZB 1T83C 3RBGA 5EO9A 2WWMC 2FHFA 3QO0B 4K94L 4U6XA 1XGYL 4XPHH 3OL2A 3LN4B 3AAZB 3QIBA 2VZSA 4CN4A 1IGTA 4WEBL 4KRPC 1BIHA 5E9DA 5GGSA 2Q86B 4HBQA 4L8DB 2D0HA 5HD8C 5CS7A 2ZOKB 1YEDA 1S9KC 4L3EE 5FYKH 2QR0B 2L0DA 4LLWB 5GRVL 1VFBA 1YQVL 5EU6A 1S5HB 3BIKA 3LEYH 4NQED 5I18H 4LFHG 3MRJA 3RAJH 4V1DE 2YUWA 4XCNB 3RL1A 4MZ3A 4PRHD 3DSFH 2XYCA 1I8KB 4JR9L 4ZDHB 5TF0A 4OZGF 4KPHL 3MRKB 2YD8A 3CH1A 5JORB 3P9WB 1CD1A 2N56A 5DZOA 2H32A 3CFKB 4O2EA 3F6IA 3KHOA 4XVTH 5J6HA 5C0FA 4I0PD 5D2NE 4RGNB 2BY1A 3KLDA 5EOCL 2ENYA 2XRAH 4U1IA 1K85A 3SOBL 4JANA 1QRNB 4U1JB 1TETL 4HG4J 1EFXA 2IQ9H 5KVEL 4CMMB 1QBML 4FQLL 3DIFB 5J57B 3GJFB 3V6OC 4PPTA 5E8DL 3HR5B 4JAMB 5IFAL 3T4YB 4WI6A 5A3ID 1H3GA 3HI5L 3P4OA 4OGYL 3T8XA 3EOAA 4F7CB 2AVGA 2OXHA 3L95B 2NX5D 3QPQC 4CVUA 2YD5A 1KIRB 3QUMB 5DHXB 5E8NB 5I1AB 1F2XK 3KYOB 3EIFA 3GBNH 4MAYD 1DSFH 1H3XA 2W0PA 4GG6E 4MJ5B 4OFKA 3V6OE 4DZBA 5ELIA 5IHZB 1OWRM 1JBJA 1K9TA 3CMOH 4QHLB 3VI3F 3LEXB 4LSRL 3QI9C 2EDTA 3O6FD 5DEGB 3FFCB 1RIUH 1KELL 3ARDC 2X4UA 1CFVH 4G9DA 4K3DL 4AEHL 2JB6B 1ZLVK 4N8VB 1IGYA 3OR7B 4XH2B 4BSVA 5F7EH 3MLRH 3PG2A 1QYGH 2B1HL 1NJ9A 5T33H 3KLHD 1RHHA 5CAYB 3K7UA 4JPVH 3C5ZA 2KPNA 3V0WL 2BVEA 5J9PA 1RPQA 1BOYA 2G5BA 5TFSL 2L7UA 2JJVA 4JN2B 1ZHNB 5HDQH 2HP4A 4C55A 3D69A 1JGUH 4M6MH 1S7SA 2VKXA 4XPHL 4GKOA 1P53A 1RU9H 4DUXA 1FFPB 2A0LD 1D9KD 1XIWA 4HLJA 1KPUB 4XVJH 3IDGB 1E27A 2PKDA 3O45A 3RWHA 3G5ZB 4IM8A 5FYKL 4I9WE 3KYNB 3DGGB 5KG9A 3FKUS 2YC1B 4GMSH 3R06A 1CICC 3DYOA 5EU5B 4GAFB 4L9LB 3LEYL 5I18L 2VABA 4XNZC 3SCMA 2DMKA 3RAJL 3ROOA 4G8GD 5IB4B 1XGTA 3DSFL 5B21A 1WZMA 3BPCA 4JE4B 5HI4C 4WHYG 3U82B 3VFTB 3RVUD 4LNVA 5HPOA 3IRZA 1MI5E 4EBQH 1KFAH 4XVTL 5CJXC 1DFBL 5D7LB 5L2KE 4LLAA 3HPJA 3UPRA 4ALAL 1EVUA 2XRAL 2PXYD 3MJ8B 4LCUB 4G43A 1U8HB 3C8KA 2IH3B 1YQ2A 3C60D 5GISH 1YMMD 4D0DA 3DRQA 2IQ9L 3D3VB 3AS3A 3CXHK 2XTLA 3PWUA 4GQ9H 2DQCL 1AI1H 5I71C 4J3TA 2ZG2A 1G9EA 3A6CH 4Y1AE 3MRLA 4V2BA 4UUJA 3FB6B 3LKRA 1TVBB 1FC2D 4YBQD 1FCGA 1U41A 3LKPB 2QHLA 1LEGA 1TTFA 1D5MA 1FFOA 1MVFA 2DBJA 4CBPA 2R2BA 1DSFL 4KK8D 1YZZA 4NUJA 1T0MA 3I3EA 3CMOL 5ADOH 5KZCD 5JIHA 4JM2F 5IMKB 1RIUL 4XP1H 1I1AB 3LV3B 1S9WA 1CFVL 4QRPA 2JF1A 5HGGS 5DK0B 4KROC 1X5KA 3NA4A 4GXUN 2MQCA 5F7EL 3MLRL 3H42H 1QYGL 3HPLA 2VDML 1P4LA 3O2VH 5T33L 4PJXB 4JPVL 1JZ7A 3I6LD 2HFFA 5EZIL 2HJKA 1Q9OB 4BA8A 3MSPA 4Q9RH 1GIGH 3P0VL 3PL6A 2BHZA 2BSSB 2W1NA 4NZUH 1JGUL 1C1EH 5IEKB 4BQBA 4LSVH 4M6ML 1RJLA 3OGCA 4FXLA 2IFFH 4LHUA 1RU9L 2HRPH 4GRWE 3GI8H 1QSEE 4M7KH 3EHBD 4BK4A 1P9MA 5FECA 2NNAB 1WBZB 2YRZA 2A73B 2XNAA 5IJVA 1QFOA 2V5YA 1UZ6F 4GMSL 4DUWA 4X4YA 4P23C 3IDNA 4OLYH 4OQTH 1T6VN 1OSZB 4XAKD 5DFVC 1KCKA 1Y0LA 4PJEA 2EDOA 3BH9B 1MSPA 1LP9A 2AV1B 43C9A 3G6AA 1BVKB 2UZIH 4GSDH 2E6PA 4OV5B 4HF5H 4EBQL 1KFAL 1MHHA 2X70A 4J3SA 1ZT4B 3IS0X 1N6UA 4OZGB 2FIKA 4OF3A 4YK4B 3WNNA 2YHGA 4PY8J 3BXNA 4LQ1A 4R96B 2NY6D 3OAYH 4P2CG 2EDDA 4NFDA 1SJHA 5IVXA 1N5AA 2W0KA 4EQ2A 1AI1L 1X3DA 1K8IA 4YHOH 1SEBA 3K80A 5C0IB 5ESVB 5T3ZE 4C4KO 5IW6B 4NO0D 3B2VH 4PJ5B 3KAAA 1RI8A 3MJ7B 5I0ZA 4NOFA 4LSQH 1VADB 2VLRB 4F7EA 3BPOB 1QFPA 5INDB 4GG6A 3LDBC 1T20B 2FYYB 1CD8A 3O6LL 4WFFE 1BFOA 4C56E 3V0AC 2LAAA 1FVCA 2IANA 4MJID 2VWEC 5DRWB 4Q6IB 4XP1L 1KCRH 2XZAL 2EDEA 2YEZA 3UTQA 5DUPL 4DOHE 3H42L 1FYTE 4I3RH 4ETQB 3FO9A 3O2VL 3VFWA 2A83B 3KLSA 3ZKMD 5H94A 3QI9A 1XCQB 3S3PA 4PJFE 3MNVA 1R6VA 4OUUA 5J1TC 4NKDA 1WQVT 3X13B 4OKVB 3ARDA 4Q9RL 1GIGL 4NDMA 3IB4A 1F4YH 5EC2B 1C1EL 2ZUVA 1ZVSA 5FYLH 2FZ3A 4N1EA 2I25N 4Y16D 1NCNA 4LSVL 4LVHB 3T0EB 5HHMB 3F7PC 2IFFL 2HRPL 5E8EB 5SWZB 3GI8L 5BZWB 5JPNB 1LEIA 5C92A 4JHWH 3U6RB 4CVXB 5DRXA 5ISZA 4ZG1A 1UEYA 4OLYL 4OQTL 3MRHA 4MSWA 4NBZB 5KJRH 3RGVA 3FMGL 2IPKA 1NGWB 1EZVX 3HE6C 5DS8B 4BH7A 1AO7E 1MI5A 2UZIL 3K2UL 4GSDL 1VACB 4G9FD 4HF5L 1CICA 4CU8A 3O4LB 5AYUH 5GRYA 1Z9MA 2R23B 2BRRH 4OQ1A 3HG1D 2WANA 3TH4T 1KXQE 2QADD 2ZZUT 4RFNB 4NN6B 4I3SH 3EOTH 3T65A 2X4RB 3LD8B 5DJ6B 4QXGH 1AIFA 3RFZC 2M2DA 5CJXA 2L7JA 3GSWA 3TZVD 3C9NB 4Y1AA 4AY0A 4YHOL 3UPAA 1U93B 3OKDB 1YDPA 4OZ4B 1AD9A 4TNVF 5HYJE 1X5GA 3B8SA 2VAAA 2EDRA 3N1FC 2F74B 4HIXH 3B2VL 3T3MF 2XG5A 4AM0B 4P46C 4RA0C 5J12C 2OM5A 4GLRI 1JPSH 4WW2B 3VWKD 4HWBH 4HXAH 1U8QB 4M6OH 5C0GA 2DICA 5IP4A 2UWEF 4Y4HB 1LWRA 2V9TA 2BSED 4KV5E 4QNPF 2W07A 4KKCD 2FSEA 3OKKA 4JQXC 3OB0H 3MRNB 2VLLA 1KCRL 4NPYA 5H37H 3TO2A 3PIQA 1T1WB 3G5YB 4HKZA 5DZNA 2BP3A 1ETZA 3FFDA 1DLFH 5DD0H 4JM2B 1P84J 5HI3D 4Y5YB 3LAFA 2VJXA 4KK6D 5CHNB 4RDQG 3PHQB 2J8UE 1B4RA 3QWRD 3SKMB 2E8YA 5DJAA 4EUPB 1MCHA 5BS0E 4ZUVB 1F4YL 5L2JB 1YMHA 2FECI 5FYLL 5HYSG 2Z4QA 2FBJL 1HILA 1U8LA 1W0VB 1YYLL 2Y72A 3DETC 5D6CA 1CCZA 1T21A 2FO4A 2GYSA 4GMTH 1OHQA 5ABDE 2OL3B 4JHWL 2HTKC 4HK3J 2BERA 1GAFL 4GW4B 1KV3A 1QSFA 1QBAA 4KKLC 3KLAB 5MEPA 3ESVF 1JRHL 5JMRA 5DMIH 1KOAA 5BW7A 5KJRL 4MNHA 1CFTA 4S1RH 1A3QA 3QG7H 3KXFA 4X6CA 1MH5B 4P23A 3BRFA 3PWVA 1KTDA 3HE7B 4DTGH 1LMKA 5EBWA 2BRRL 4N0CC 3NCCB 2UYLA 4LLDB 1AC6A 3NFPB 3SDCB 3QXAB 4I3SL 3QXDA 4ODTH 1NEZG 3P40A 4YH6A 1XCTA 1LO0H 3HC0B 3NCYP 3PWLA 3G5VB 3LKSB 1KB9K 1AFVH 4KRNA 1OQXA 1NKOA 4WY7L 3WNKA 4ISVA 4JDVA 2ZCLH 4LRNH 5ANMA 3L6FA 4M48L 2LV4A 4P2QA 2AJYH 3MYZA 4HIXL 4L1DA 3E6HA 4KQ4H 1JPSL 2QBWA 4HWBL 3MLWH 4HXAL 4M6OL 5ALCH 4MCZB 1ACYH 4C56A 5I8KL 1HKFA 4H0GA 1CDJA 4WDIB 4HWZA 4WI8A 3EJZC 4HEME 3PWPB 3BZDA 4X6DE 3RA7H 5JOPE 4UDTA 5HHOD 3DYMA 2ICWI 4JDZB 4MJ2A 4EQ3A 4B7LA 1FYTA 3ZT6A 3KWWB 4R4ND 4OGAC 2C26A 1MCJA 1T2QL 1DLFL 4JO1H 2Z92A 2YA2A 5DD0L 4HEPG 2EIBA 4MQ7B 3ARSA 4JY4A 4R2GC 4NN7B 1FL5B 1O7VA 5FGBC 3WE6B 1TQCB 5GS0C 5HYQA 5TGBA 5F1SA 4KI5D 3VRJB 2QJDA 3VXUB 3DXAB 5EUOA 1WV7T 5ID0B 1N59A 7FABH 3VW3H 1F3DH 3HNSL 1U8PA 1MCKA 3DMMD 5ERWA 4P2RB 5FGSA 3OWEA 4LGRB 4HWBA 2Z8WC 5LAXA 3VRIA 3TJEH 4LAQH 3IFOB 3G9AB 1PYWA 4QXTB 2Z0BA 1Q8MA 4LKXB 5FCSH 3RWJA 3IU4L 5FYJE 1JNHB 3NMEA 5DMIL 1UJTA 1UKTA 4I2XE 1J0KA 1GPOH 4JFFE 4IJ3B 4NWUH 5I74C 4TQEH 4S1RL 2ZOLB 2MSPA 3QG7L 1I7UB 3L5WA 4FRWA 3CC5B 3MBED 3WFHB 4WV1A 1CK0L 2YPLE 3V2AR 4YHLH 3S36H 5I17B 2QSVA 4DTGL 3P77B 1OTUD 2DQEH 1G84A 4G7YH 1LE5A 2E7HA 4YGVA 4WWKC 5JZ7D 1ZSDA 2BJML 3D0LA 1CWVA 3QQ3A 3HE6A 5IKCB 2B8OT 1FGNH 4ODTL 3ZYJA 5IVZB 1Y18B 2NXZD 1LO0L 3D9AH 5FUCE 4Z18A 3QUXC 1U9KA 1HYSD 4OZIE 4P5MB 3F12B 3V5HB 3BWAB 1MNUH 2RB8A 1HZHH 1S78D 2ZCLL 2MPAL 1RIVH 2O26U 4MNGE 2Y5TB 4J3WA 4W6YB 2AJYL 4LIQE 2GY7B 3HUJB 1DEEA 1NCWH 4OZFA 4KQ4L 3HZYB 1DN0B 3MLWL 1JYWA 4JPIA 1Z9SA 4LASH 5ALCL 1ACYL 3LSOA 1Q1JH 3ZDYE 2HLFD 2GITA 4IRJC 4HDIA 3OKOA 4M62H 4P46A 3RA7L 3CLEH 3IU3A 4LGSB 4FFYH 4UOW0 43CAA 1ZA6B 4PGEA 1AGEA 4Y5VC 2EIEA 4JO1L 3GB7B 4KJWD 1BECA 4RDQF 5DUML 4KH2A 1D5IH 3QDJE 3WXWH 4QTHA 2BNRA 2J8UA 4JQXA 2IAMD 5BS0A 1A1NB 4UT7H 3MV8D 2XV6B 1FJ1B 5H8DA 4UOJA 5DMYA 2YPKA 4JY6A 4GG8B 5E6IB 5E95B 4HK0B 7FABL 3MFFB 3VW3L 1SY6H 3FN9A 2FIRT 2XKSA 1F58H 4U1LA 2VNCA 4JRXE 4HG4K 4P2OD 1EHXA 3U9UB 5I8OH 4ZNEA 2X40A 1BWMA 3U0PB 3TJEL 2DQTH 4G6FD 4LAQL 5T1LD 4JFQB 1MWAB 5GHWH 5JDJA 4JG0L 1QFWM 4U6VH 1T7WA 3M45A 1VB9A 2F19H 2WMPA 3SPVB 5IQ9B 4PBXA 2J88L 5LGJA 4HJGA 4GRWF 1GPOL 3L9RB 4GKSA 4NWUL 4Y2DD 4NQCD 5CILH 4TQEL 3VFRA 5IOPB 1EV2E 2G60H 3D85D 4YHLL 1LO3H 4LEOB 4M9OA 5E2TH 3S36L 5C2BH 1J86A 4X8JA 5HJ3A 5MI0C 4DVBB 4G7YL 3IXTB 2LQRA 4EI5B 1VCAA 4MD4B 2CUIA 1NAMH 3VD5A 3QWOB 5C09D 3FB5B 1JUFB 1U36A 1FGNL 2BVQA 4HKBB 3EO0A 3D9AL 4POZD 5FYJU 4Z7QE 2KZWA 4HWUA 4HCRH 1YNTA 1XR9A 5J6GA 1YC8A 3F7QA 2W65A 5C0BE 4EXKA 4JEGB 4TVSa 4WI9A 1G7IB 2AK4A 2FB4H 3TF7C 4E41E 3QZWB 1NCWL 3MROB 3LRHA 5DUBA 3VG9C 2IBGA 2R9HC 3GMOB 3WN5A 4K7PY 4LASL 5ICXA 3FT4A 2E6QA 5AZEH 3WIIH 5BO1L 1Q1JL 2HT2D 4FXGA 3UTPE 3C5JA 3RTQD 3CVHH 4CUCA 1D5XA 3MNZB 4P4KC 3NGBB 4M62L 2GUOA 4X6DA 4Z7VB 5LVEA 4FABH 5D93C 3CLEL 3OKEA 4FFYL 5F9OH 3BYTA 1KG0A 4RIRB 4UAOC 3MV9A 5F88A 3S96A 2GCYA 1D5IL 2OX5A 4LLVA 3WXWL 3E8UH 1T1YB 5C0CA 4QHMA 3W9DA 3PABA 1JI2A 3BPNB 4TNVK 3TT3H 1U42A 1K8DB 4UT7L 4XNMA 1N6QH 3LQZA 5CEXA 1YY9C 1I8LA 3Q6FA 4APQC 3RQ3A 3H3KA 2EXWD 2HTLD 5B39A 2F9BT 4GS7C 1SY6L 4PJGB 3RY6C 5DO2D 1TZGH 3JWNC 5FGBA 1F58L 2EDHA 5KVGL 4TUJB 4MB4A 5IMOB 1A7RH 1DE4B 4L4TB 1YN7A 5JQHC 2DQTL 1A4JB 5KSUA 4PG2C 4HS6A 1MCLA 4U6VL 1CDYA 4W4OC 3LIZH 1NGPL 3QIUB 1A4KA 2F19L 4PJHE 1L6ZA 1UVQB 4JFFA 2FX9H 3DX6B 3UTSB 4J8RA 1BZ7A 5EO0B 3VGGA 4AEIH 1FDLH 5FO7B 4M02A 5CILL 4TSAH 5EU6D 1RZJH 1KULA 4Q6YA 1UB5A 1WUNT 2KQNA 3QEUB 1IAMA 2G60L 4K2UH 4UU9B 1NUNB 3T1FA 3STLB 5C2BL 1D9KB 3F8UB 1B0GA 2FWOA 1HN1A 5IB2A 3ULUD 1PQZB 4KDVA 4X7TA 3MRBA 3QDGA 3ZDXF 3PJSB 1Q9LA 5IMLA 3CZJA 1FLTX 3I9GH 2J8HA 2EYTB 2FNBA 4OCMC 5LCVH 4NKOB 2W9EH 4HXBH 1KBGH 3B9KC 4I0KA 4XVUD 3QNYA 4EKXA 4IS6B 1SY6A 2EZ0C 4U3HA 4OGZA 4OSUH 2DQUH 4WWKA 1FSKB 4ZUSB 1ZVYA 2FB4L 2OR9H 3H9SE 4F80A 4F37F 2C3VA 3QUXA 1DVFD 2VRAA 3NABH 4X98B 3T0DA 1SVCP 1R3HA 5I15H 5AZEL 3H9HA 3SDXE 3QXVA 5KS9E 3WIIL 4OB5H 3CVHL 5GSVA 1QPXA 4HAFA 3BGMB 3QULA 5DVKA 5D9SA 2DQFB 4FABL 4KHTH 1P4BL 4F7TA 5F9OL 1XGPA 4O4YH 3DV6B 2E9IA 1NAMA 3WCYA 3QFJE 2HG5A 5A2KH 4X0KA 1JTPA 3E8UL 1J8HD 4IRJA 3MUJA 5DJXA 4HCRA 3TT3L 4G42B 1MLBA 4XWOC 3TNNA 3VFOB 1PZUB 3JV5A 4MB3A 1N6QL 2AAVA 1HHIA 3ESUF 2UZYB 1FQ9C 3IJYB 5DQDL 1L9NA 3IVKA 2BOBA 1D5ZB 5KZCB 1JTTA 1I1YA 5EUKB 2XQBL 2NZ9C 1TZGL 3SKNA 1MCDA 5HYSB 3FOLB 4R90H 2I24N 3JTSA 5EORH 2ICEA 3L3GB 1A7RL 2UY7A 3PGDB 3RNKA 3NH7H 3F65A 5GGVH 5DJCB 4RMUA 4IRSA 5E99H 2PW2A 2DIAA 2BNQD 4NRZA 1BZ9A 5B4MD 4FFWD 1NQBA 4UILL 4AEIL 4YE4H 2B2XL 3QEQE 3SJVB 1G7PA 2ZUWA 1RZJL 2LVCA 3TV3H 3KJ4C 3DI2B 4QWWC 3WKML 3L3KA 4K2UL 1CVSC 3L1OH 3GZKA 5E2JA 5BV7B 1VGEH 3CFJB 1X4XA 3KPRA 3MO1A 1GC1C 1AKJB 4NZRL 3IDYC 5I1IH 1C12B 3I9GL 5ACZB 3L7EB 2PTTA 3NFNA 4NQXB 4OF8A 2KBGA 1MUJB 5JXEC 2W9EL 3C5SA 4HXBL 2ESVD 4M1DL 4OTXL 2P8LB 1KBGL 5A16A 2AV7B 2BCKB 4U1KB 4JFDE 3QXWA 5MHSD 1DUZB 1ZS8A 1TZIA 5DHYA 2V7HA 4E41A 4ETYA 2OR9L 4WW1B 1LO5B 1A9EA 3G5XB 5GS2H 2FHCA 3VMOA 3NABL 2Z31B 2EEBA 5I15L 1RZGA 2Q7NA 1OARH 4I48B 4XXDA 4YDVB 4KMTH 4HULB 4OB5L 3QDMA 4FQHA 2BZDA 4U6TA 4PRDA 3VRLE 5IBLD 1ZGLP 4Z7NE 4ONOA 4XPBH 2X7LB 3U2SB 4D0CA 1SYSB 4KHTL 1RK1B 4B41A 4PGBA 2D3VA 2B1AH 1HH9A 4O4YL 3SGEI 5DC9B 1RUQH 5D1XC 1YEEL 4S2SA 5C70A 3FQWA 1IZJA 4P4KA 3MV7E 1KJVB 3FQRA 5B22A 3RP1A 3CU1A 4N5ED 4M5ZH 1CFBA 1Q38A 1BFVH 5SX4I 1P6FA 5FV2A 4BSJA 3TBVB 3O2DA 3FB7B 3NZHH 5AWNH 4MJIB 1DDHA 2X1QA 1ADQH 2YD2A 4P2YA 2CRZA 4R90L 1GC1H 5EORL 1CIDA 4JFPA 4LHUD 1PGRB 3NH7L 5JQ6H 4PJIB 5GGUB 4OBSA 5JPMB 2XXCB 3QCVH 2CIIB 4APQA 1MREH 1WF5A 3I02B 4L3ED 3RI5F 5E99L 5TJWK 2NY4D 3RY6A 3TEUA 3MUHL 2IBBA 1CD9B 2IPUG 4F7MA 2DN7A 1UYWH 4YE4L 4LL9A 5J11C 4H26B 2DD8H 1CL7L 4Y4FC 2Z9TA 5F3HB 1HH6A 2R2HB 4V1DD 1LD9B 1QLEL 3TV3L 4Y16B 2MJWA 4JFOB 3S4SG 4LSDA 3SDYH 4CN1A 4KRPD 3BP4B 4QXUH 2XZCH 3TCLA 1OW0A 3IFPB 4W4OA 3L1OL 5HD8D 1VGEL 1I3GL 1HOCB 1MCRA 4DW2H 3T2QA 1KEGH 4NC1C 4O2FB 5I1IL 2XPGA 3KJ6H 1RK0A 2LU4A 3DX9A 5F1NA 3FO1B 5I16B 1IGJA 5DJ0B 2PYFB 1VEOA 4PJCF 1KENH 5INCB 2C7UB 3CFIC 5IFJB 5KANG 1P84K 2Y25A 3PP3K 3NVQA 2BY3A 4NC1E 4ZUUB 1EPFA 2AXFB 3RBSA 2JE8A 3B9KA 4PJ8B 1AGBA 3CNKA 1ORSB 3SDXA 4DJMA 4Y4KB 4JFEB 3I6GA 4TSCH 1KLUA 1OARL 1S7VB 4KMTL 4OI7A 2F5BH 3MRQB 5B38G 4IOIA 3VFVB 3D48R 1JGEA 4IIQC 4WO4B 4DKEH 2VERN 2Q8BH 2DRUA 5EOCJ 1OAQL 3D2UA 4XPBL 1MY5A 2JK5A 1M71B 5HPMB 3IKCA 3DROB 1GHFH 2B1AL 3BW9A 12E8H 4JFXA 2R1YA 4QRTB 1GL4B 5AD0A 1E4KA 1KLGB 3U79A 3QPQD 3NCFB 3OAZK 1MF2H 2AEQH 3QHTC 1BQHG 3VFUB 1AXSA 4M5ZL 4X9FA 4ACPA 3FO2A 5DMKA 1BFVL 5HGAA 4G8EA 3H7BA 4YFLI 2D31B 3QI9D 3CJJA 2X1XR 4NO5A 3NZHL 5AWNL 1R3IH 1QLFA 5FO8A 1ADQL 1GC1L 1HHJA 3BSZH 3MLZL 1A47A 3WO3B 5EIIA 4DUVA 4M6NL 2A6KB 4XC1H 2R15A 5DSCB 1CE6B 4I9WD 2C1PA 1P7KB 3QEQA 1OGAE 1XGUB 4M61A 1NC2A 2DD8L 2H2PC 4PRBA 1AJ7H 5EDXA 5E1AB 4PRPA 5MENE 3SDYL 2XZCL 4MD0A 1FBIH 2IC2A 3D1MC 5H2BB 5E5UB 2OI9C 4Z7WB 1XF5A 2HT3D 4B50A 3MYJA 1A5FH 4DW2L 1MI5D 1KEGL 1S3KL 4PJ7E 2ATPB 3E3QE 5L2KD 1CICD 3KJ6L 5E8OB 1TENA 2IH1A 1HNGA 3VXNA 2HRLA 1P4IH 1S9VB 3CMGA 1VFAB 4IHOB 5HYFA 4XI5C 2ZG1A 4ZAKA 1UA6H 3Q5OA 3MLXH 1NCBH 4QOKE 4YDLB 1FV1B 4UDUB 5IB1B 1MQKH 4ZXBA 3QUZB 3A67H 3ES6B 3NPSB 3GI9H 4YXKH 3HLAA 1XGRB 3BWUC 1UH4A 4Y1AD 2IJ0C 5JXEA 2EKSA 2KL6A 4DFHA 4M8QB 4X5LA 2V2WB 5DJ8A 3MC0A 1WZKA 5F7DB 5JHDA 1RZKC 4G8IA 4TSCL 4ZOCA 3REWA 5DK2B 2F5BL 3L3DA 4PJ9B 4X7EC 3F7VA 5HDBE 2Q8BL 2ZSVA 4Y8AA 1E28A 4U1SB 3BP7B 2H8PA 4X5WA 1SEQH 4BZYA 1GHFL 3K8KA 12E8L 4BK5A 2A74A 5KSBE 2G75A 4Z9KB 3RPKA 2P7TB 3MV7A 1E0OB 3STBA 4X99A 1MF2L 5AUMA 2DKMA 2CPCA 7CGTA 1L0YA 4K9EC 4MNQB 5ITFB 3Q3GA 3RUGE 4ZFZB 3PGCA 5MEOA 4JQVC 3S35H 2Y7QA 4Y0GA 5D1XA 2X9XA 5D1QB 3HNTH 2JJTC 1R3IL 3UP1A 3FQNB 4HIJB 4KROD 3PGFH 3BSZL 5EBLB 1KNOB 1MFAH 1J0HA 4H20H 1WCBB 1QSED 2DB8A 1NFDA 1A2YA 2BOCB 4KWUA 3PV7A 4XC1L 1VFMA 3ECBA 4ZUWB 4Y19E 2NYYC 4GW1A 5D6DC 2VOTA 1M6OA 1S7XB 1W72H 1K4CB 3Q6GH 2DYPD 4NQVA 3MUY1 5EA0H 1AJ7L 4OJFH 2CLZA 3G04A 1NFKA 3VXSE 1M7XA 2O93L 5BJTB 1LEKA 1EERB 1FBIL 1I8MB 2CR3A 1Z3GH 3BHBA 5DJYB 1ZT1A 1A5FL 5BVJA 1RZKH 3CH8A 2VZ1A 4HUKB 5K59E 3ARBB 4Z5RB 4P23D 4Z76B 4U6HB 4Y4FA 2H9GA 4JO4H 2E3VA 1NLDH 4DCQB 5F7HA 5DQJA 3RJDA 5DFVD 3SHSA 1P4IL 5ICYA 3BPLC 2Y5EA 2CH8A 4X9BA 1IAKA 3CDYA 1OY3B 3GSNH 1CLOH 1UA6L 1NUDA 4RFEA 1PDKA 3MLXL 3BO8A 1NCBL 5EH1A 1KYOJ 1BGXH 3A67L 4K3EL 3GI9L 4YXKL 1RJYB 2DI9A 5DLMH 5GXBB 4PYHA 2E7LC 3C6LC 4L29A 4NO2A 4PR5B 4PJCB 3C8HA 3LKQA 5T3ZD 1JWMA 3BKMH 3W5MA 4K9EH 5DR5H 2ZUTA 1NDMA 5F1IA 4Y5XC 3SQBA 3BDXA 4OLWL 2WK2A 1S7QB 1QFWI 3H3PH 2HFEA 5D1ZD 3EYFA 1O5DT 2SEBB 4WFFD 3O9WC 1IJ9A 2W38A 5ESAB 4C56D 5KSAA 3D0VB 1SEQL 3I6KA 3V52L 1VPOH 5JO5B 5I1EL 3BEWA 5KTEH 4XGZA 1QA9A 2OQJA 3P4NA 4KUCF 1Q94A 3BGFC 1U2CA 4IIQA 3VWJB 1FYTD 5AAMA 4DKDC 4LPTA 2NY3B 4HGWB 4XBPB 3PQYE 4NQDB 4BFIA 1IAOB 4ZFGH 3VGBA 4GAJH 1DUYA 1T1XB 3S35L 1U6AH 2Y36L 2XTJB 1KJMB 3HNTL 3QUYC 1Z0MA 4Y7MA 3PGFL 4U0QB 1JPGB 2VISB 2CIKB 4KXZH 3M8OH 1MFAL 4H20L 1QD0A 4ODXB 1SVZA 1EHLH 3TFKC 5FK9A 5CZVH 3AXLA 1MOEA 1RJZB 1KF9B 4IMLB 4UV7L 2BVPB 1D3CA 1W72L 2YZ1A 1YUHA 3Q6GL 1BVLB 1PG7W 4D94A 1KPRB 3BYYA 5EA0L 2R1XB 4U1HB 4EXPX 2YRLA 4OJFL 5MENA 4OI8A 2CKBH 1MVUB 4LKCA 1NBZA 3SE4C 3OR6B 4YPGB 5F7YC 1AO7D 4HIEB 1Z3GL 1IGIH 3TPUA 1RUMH 3WD5H 4PJ7A 3OKLB 3DX7A 1RZKL 4QCIA 5I8EB 2P24A 1NAKH 3CCHB 3RWCB 4WFEE 4WU7A 5F6HJ 1NLDL 3U46A 3SGDH 4KU1A 5I2IB 3BX7C 4Z7UA 2ARJQ 3GSUA 3GSNL 3HE6D 3O3AB 3O8XB 4QOKA 1CLOL 1ND0B 3LMJH 4Y2DB 1MCFA 1QQDB 4HUMB 1CGUA 3RI5K 1GYAA 2EDFA 3OGOE 5JDSB 3JV4A 1WAAF 2AXGB 5DLML 5CBEA 2YR3A 1ONQA 5HYJD 1QLRA 3BKML 1AD0B 4K9EL 1OB1A 5DR5L 2RHEA 4L4VA 1W72A 1GH7A 5BQ7A 4TNWK 2XWTA 2AI0H 4ZFFB 1KJ2H 3C6SB 1U2HA 3H3PL 2GSIB 4D8PB 1KB5B 1B0RB 4N90E 4ODSH 3QA3B 3GMLA 3H6JA 1TZHB 1F13A 3PWNA 1VPOL 2G9HA 2R2EB 3BGAA 4CADA 3QJFB 2NTSP 2C1OA 4HLZH 4CAGA 1MCOL 3MRDA 4F2MB 3MCLH 4P46D 2VL5A 1MIEH 1QFUH 2ZSWB 3RKDD 2XA3A 3ULVH 4KK9C 2APBA 1R3JB 1KTRL 5CJBA 5DURD 3GM0A 4Z7NF 3OKMA 3GMMB 4GAJL 5C0NC 2JJWA 5C2UB 3RTQB 5D7IA 5J1SC 3BH8A 5BS0D 4I4WB 5BRZA 3QR2A 1OF2B 3P30H 5EPMA 3FB8A 4GW5B 3AUVA 5T1KA 3M8OL 25C8H 2Z35B 5FOBA 2IADA 4LVOB 3BN9C 4Y19A 1EHLL 2ZUUA 4JQVA 4TVPH 3QAZB 1R3KB 1WCQA 4QRSB 5CP7A 3DWTA 5CJOH 5CZVL 2JJTA 1U92B 5HHXL 2IFGA 1A22B 4BYHA 5JXAH 3T0VA 1ZHBA 4OF6A 1NGZA 5SWSB 2W0FB 1BLNB 5GGQH 5CEZE 4BZ1H 3AS2A 1TTGA 1HNFA 4P3WA 1XT5A 2JCCA 4ZUTA 1N3NA 3DETD 5EO9B 2Y07H 2XQYK 1BIIB 1IGIL 1TPXC 2M8XA 1RUML 1A6WH 4U6XB 4RAVA 3RVWC 2Z8SA 1ORQA 4JDTH 1NAKL 3QIBB 4FNLH 5FM5O 1MHCA 1UH2A 2LFGA 2H45A 5E9DB 1YEDB 4PJEF 2XY2A 3DUUA 1RHFA 3S5LG 3KYMA 1A0QL 1LP9F 1VFBB 3LMJL 3FQXA 3ZZ1A 5EU6B 4LCWA 2GT9A 3BIKB 4OF0A 4W81A 3MRJB 1CVRA 4N0CD 3BP6A 5BMFH 5CIPB 4D9QE 5JR1H 3CH1B 2AK4D 4PJDE 1CD1B 3SDDC 2H32B 5EU7C 1KACB 4J4PC 5J6HB 4QT5A 5C0FB 1A6AA 5FA4A 2CKBA 2AI0L 2EO1A 5SWQB 5E5RB 1KJ2L 4Q97A 1MJUH 4TOYH 2WBWB 4U1IB 5DQ9A 2E7LA 3C6LA 2HA1A 3KNBA 4ODSL 1JPFA 1X5HA 1NCAH 1EFXB 5F9JA 3TYFA 4EIGB 4Y5XA 2HMIC 3OKNA 4ZSOA 5JOPD 3JTTA 5EU7E 3BKYL 1DZBA 1MIEL 4HT1H 1QFUL 1GOFA 3ULVL 5CD3A 2KQMA 2P8MA 2D4FA 3O9WA 5I8CA 5IMMA 5TQ2H 3P4OB 4NJAH 2FH8A 4OCNC 1T22B 2YBRA 3QUKA 1JRHI 1EAPA 4I0PC 3S37X 1KC5H 4HUXB 4OCSH 3P30L 4XC3L 4JFYB 4OGAD 4L8BA 25C8L 4FA8A 4G5ZH 4R2GD 4HZLA 1WBXB 3HC4L 5GS0D 5F89A 4TVPL 4OF7A 3BT2H 2N1KA 2GK2A 3ZE1E 3F6LA 5CJOL 3VXRE 4C4KT 1IGYB 3TPKA 4BSVB 4X4ME 3ZDZF 5HGHA 2PO6D 2R29H 3UTOA 5JXAL 4H5SA 5FYJD 1F6AA 1MRDL 3NIGE 1BD2E 4I18C 1FIGH 5GGQL 1OT2A 3C5ZB 4BZ1L 5J9PB 3T08A 1AR2A 4JFFD 4UV4H 2NZIA 4ZS6C 2J7LA 1HWGB 2Y07L 1QG3A 4TSBH 1TCMA 2DIBA 3D69B 1OM3H 1U58A 1A6WL 1TJGL 3BKJL 2YPLD 1S7SB 4JDTL 1OP5K 1PKOA 5EZOH 4FNLL 3UYRH 5GSRA 3B5GA 1XIWB 1GCFA 3ARQA 3O6FC 1EK3A 1E27B 3O45B 3RWHB 5KG9B 4ONHA 3R06B 4HX1A 4YC2B 5H37G 3E0GA 5HTSA 5B3JF 5HGDA 3MMEA 2VABB 3SCMB 2YD7A 3ROOB 1H3VA 1XGTB 1EEZA 5T3XE 4WWKD 3BPCB 3PHSA 2V2TA 3MLTB 5KVFH 1P5UA 3TJHD 5CMAA 4XB8A 4ODHH 3BZFA 2PYEB 3QUXD 3JUYA 3MRGA 3UPRB 1MJUL 4TOYL 1NGQH 4G43B 3C8KB 4G8FA 2VXUH 3DVNA 2P49B 1RQ5A 3VXME 1NCAL 5DVOA 1QO3A 4OUOA 4D0DB 1PEZA 1ZHKA 3DRQB 1FL3B 3GMNA 3PWUB 5J1AB 1KUMA 3ZHDA 1P7QA 4HT1L 3ZKXC 2OZ4A 3MRLB 3LKRB 1ZXQA 2VDNL 5TQ2L 5L7XL 4NJAL 1VA9A 1IAIH 2VR9A 4TUOA 3IF1A 2BXZA 1FFOB 3SDAC 4JG1H 5KSBF 1KC5L 1IEAA 3BISA 4XPFH 1MQ8A 5DRZA 3WEXA 2R2BB 1ZAGA 2PXYC 4PTTB 4GUPA 4NUJB 1HI6A 1ZE3C 1T0MB 2ED8A 1TJIH 1D6VH 2Y23A 5JW4R 5I6XC 4PGDA 4G5ZL 4JRXD 5ICZA 3MRFA 4XP9H 3RWIA 3T0XA 1CS6A 2IWGA 3BT2L 4CJ0A 1S9WB 5FB8A 4BUHA 2VZ3A 4QRPB 3E6FA 4MQSB 5CGTA 4MWFA 1SJXA 4RAUA 3HPLB 1M4KA 2R29L 5EULV 3U7WH 6CGTA 2I9TA 4HJJH 3S88H 2A6IB 2AQ2A 5BZDA 3EFDH 5E5MA 2HFFB 3NCBB 1YEKH 2DQHH 2HJKB 4UV4L 3T1WA 2MCPH 1BEYH 1P7HL 1PKQB 1CT8A 3PL6B 4BZ2H 2VQ1B 4TSBL 5E2WH 1OM3L 3V5KA 1JHKH 2AJUH 4XNUH 3HKFA 1RJLB 4KK8C 3QNXA 5I1HH 4U0RC 4LHUB 3UYRL 2BMKA 4NHCH 1ZWIB 3FL7A 4NBYB 4Q7DA 5FECB 3BD4A 2QSTA 5IJVB 5D2LF 1JIBA 4YX2H 3KYKH 4X4YB 3DUHA 4O00A 3EDKA 3IDNB 3DO7B 1XF3A 3UBXG 4X6CF 1S7WA 2Z93A 1M1SA 3TH2T 5K59F 5C0BD 3VXOA 4KRPB 4OV6F 1Y0LB 4PJEB 4PP2A 1RURH 1SJEA 1AQDA 1LP9B 4PD4J 1EZVY 3G6AB 43C9B 3DV4A 2F53A 3GBLA 4E41D 4MDJA 4NKIH 1GZPB 1UM6H 1UWEH 5C9JA 4ODHL 1MHHB 2X70B 4DKFH 3D39E 1YEIH 2FIKB 1NGQL 5CCKH 3UTPD 2VXUL 3BXNB 2UUDH 1EMTH 1NANH 3DBXB 3EOYG 4E0RA 5IVXB 1N5AB 1FG9C 3KPSE 4QTIH 2R9HD 1SEBB 2ZPKH 3BDBA 3AVEA 5DGQA 3WLBA 4P4KD 1UJ3C 1IAIL 5GGRY 2FEEL 2OTPA 3P9MA 5C6PB 4F7EB 4JG1L 1IFHH 4XPFL 1G6RA 4LHQB 1BFOB 1EO7A 1TJIL 2AQ1A 1FVCB 1D6EA 2P5WE 5ENWA 1OTTC 2IANB 4XP9L 3ME0A 2YEZB 2MHAA 3VXRA 3ARFC 2EC9T 1V3MA 1DQDH 2ITDA 3CSYA 4I0PA 1QZ1A 1XF1A 3VU2A 3SKOB 1YY9D 2XN9E 3FO9B 5EUOF 4HJJL 3S88L 1EVTC 5H94B 3QI9B 3EFDL 5M94B 3MNVB 2NCMA 1F11B 1YEKL 4OUUB 4NKDB 2C4FU 2MCPL 1BEYL 3ARDB 4NDMB 3JWDH 1EH9A 4OIAA 4UQ2A 5E2WL 1ZVSB 1JHKL 2AJUL 2FZ3B 4XNUL 3UAJC 1MCPH 4I18A 4NHCL 1LEIB 2YK1H 4M7LT 3RU8H 2ENSA 3EOBA 3EDFA 5E4IA 5FGCE 1MEXH 4YX2L 3KYKL 5DRXB 5ISZB 3WHXA 3IGAA 4MAYA 4I13B 3OF6D 3D25A 4NUGH 4QGYA 4HV8A 3MRHB 4MCYA 4MSWB 3R1GH 1N7MH 1B0WA 1DR9A 2ORBH 3RGVB 2P5EE 1BWWA 3O6FA 2IPKB 3N9GH 4UTBH 1RAMA 1A7NH 2XOTA 2HVJA 4KFZC 4BH7B 3H9SD 3WUWA 1MI5B 2WBJC 4Z0XA 4P3CH 3X14A 1UM6L 3QNZA 1YN6A 4DKFL 3B9KD 4W4NA 3ZHKA 1EEYA 4MMXC 4XNZB 2AJ3A 1YEIL 2EZ0D 5CCKL 3G08B 3WFCH 1T89C 1S5IH 3QISA 4RGNC 1EMTL 1XZ0A 3VI4E 4X6BA 1Y6MR 3T65B 1QPPA 1AIFB 3HNVH 2KH2B 2YZ8A 4QTIL 4MHHI 2H1PH 3VCLA 4FQXB 4HFWA 1YDPB 4AH2A 1HIMH 1AD9B 2ZPKL 2NLJA 2BHYA 1FFRA 4RGNE 1M7IA 1ZKAA 5DD5H 2V5TA 1DBJH 2CLVA 2XWJA 2ADIA 4M7LH 1PX3A 1CGWA 2NXYB 1QRNE 3LS4L 5F7KC 2M1KA 2NY5H 1IFHL 4PLJC 4YO0A 5SX5H 5C0GB 3Q2CA 3F62A 3RDTD 2GAZB 4MVBC 2HVKA 5DEFA 1DCLA 3RGHA 3K4AA 2FSEB 3OKKB 4QLRA 4MDIA 1FIEA 2VLLB 4NPYB 3TO2B 3PIQB 5E2UH 1JN6A 1J5OH 1EIBA 1DQDL 5HVGB 3TBSA 4HKZB 4XWOD 3X11A 3BRGC 3BEVA 1ETZB 1QRKA 3FFDB 1KYOK 2F8VA 2PXYA 3ALXA 3BDYH 4A2LA 3DUSA 3W2DH 3C60A 1MHPH 3KYAA 2NZ9D 3QEQD 4HJ0C 4FQCH 5JHLH 4YBLC 1XGQA 3JWDL 5DJAB 1LK3H 1OWWA 1YMHB 3NIDE 5GIRA 2Z4QB 2ATKA 3FFCE 5TDNA 1HILB 1U8LB 4WTZA 1P1ZA 3CFEA 2YK1L 4EI6A 4ZTPH 5K9QI 3DJ9A 5BV7L 5D6CB 4Z0BH 1T21B 3VDAA 1VGKA 1H15A 5FKPA 3U30B 5FO9A 1MEXL 2EC9U 1J18A 1WK0A 1CYGA 4QWWD 1N5YH 1QSFB 4NUGL 2ZCHH 3RWGA 3S5LB 1JGVH 5HI3C 3R1GL 4DZ8A 5HSFA 4B0MM 4JFDD 2ORBL 5GZOC 4MNHB 3GIZH 3N9GL 5D2LB 1A7NL 4L8SC 2WIIB 5IR1A 1HEZA 2NR6C 1NC4D 3KXFB 3NIFE 4X6CB 4BSWA 4JVWA 3VMPA 3PWVB 3D39A 5JXED 3DTXA 3J8F7 5EBWB 2FCBA 2UYLB 5F8QC 1KJ3H 3WFCL 5HBBA 3WS6C 4WUUB 4HUWA 3V8OA 1MCQA 1XCTB 1RFDH 1MFCL 3PWLB 1U8JA 5GPRA 2H1PL 1QEWA 3REVA 4ISVB 4JDVB 5A2JH 2N7BA 1HIML 3JV6A 4JHBA 5ANMB 3UYOD 3L6FB 4P2QB 1I75A 2VYRE 5E4EC 3MV7D 5DD5L 2RJMA 3E6HB 1DBJL 4M7LL 5EB9A 1R3LA 4JRYB 2YD4A 4QF1B 5JOEA 2ZUQB 2CD0A 2NY5L 4KZEL 2FHBA 2ED9A 4C56B 5CWSA 2P5WA 3D3VE 1F45A 2ARWA 4R7NA 4HWZB 2VLME 5K9OA 4I3GA 5E2UL 1J5OL 4UDTB 1T03L 3LDBB 3MREA 1I1AC 2A38A 2Z92B 5MERB 1IRAY 3BDYL 4XWGH 4JY4B 3W2DL 1H5BB 3PXHA 5HYQB 1MHPL 5TGBB 1G9NH 3FOMA 3TGXA 4FQCL 1YY8A 5JHLL 3ARFA 1LK3L 4R97C 2VR5A 1R0AL 2XI9A 5EUOB 4OFIA 1D7FA 3WHE1 4BFEA 3GSQA 1U8PB 2E7BA 5ERWB 4N0RA 4ZTPL 4XCEB 5CEYA 5F72S 4NO0A 4Z0BL 2Z8VC 4MA8H 5LAXB 1JWSB 5BXFA 4PJXE 1PYWB 3MRMA 2FRGP 2PUQT 4G3YH 4R4NC 3OAYK 1EBPA 3C87A 3RWJB 1N5YL 3RIFF 5F96H 3QO0A 1JGVL 3K0WA 2EDQA 2P5EA 4HIHA 3UCRA 4JZNB 1L6XA 3GIZL 3VXTA 4OI9A 4OLZH 3LKOA 2OJEB 2DM7A 3L5WB 2VE6A 1IM9A 3ARUA 4ONGL 4WV1B 2Q86A 2CMRH 2YKLL 1LE5B 4LLWA 1RUPH 2I9LA 4YGVB 4J3VA 3T77A 3DMMC 1ZSDB 2OMBA 2I07A 1KJ3L 3QQ3B 3TO4D 3L5HA 3NACH 2WBJA 1RFDL 2NQCA 3IXAA 5I75C 2PNDA 4OM1H 3BN3B 2CR6A 3DO3A 4XB7A 3OG6B 3RY4A 1JGDA 1RZ8B 4N5UA 2P48B 1T89A 1TDQA 4C57C 3PHOA 3HRZB 1DEEB 4XRCB 3MBEC 4OZFB 4OZGE 4PY7A 5FF6A 2D03H 1XR8B 4JPIB 1CL7I 1YEJH 5KVDL 4KDTC 2XWBA 3BPOC 3RX8A 4XP6H 2GITB 3CUPA 4HDIB 3HR5A 4XNYH 4JAMA 4P46B 4TULH 4G9FA 3QWQB 1HYSC 3VA2C 43CAB 3V6FA 2P8PA 4PGEB 1AGEB 4RZCA 2R56H 1LO2H 1SYVA 1S78C 4PGCA 4PJ5E 4XWGL 4F7CA 3QUMA 2BNRB 4QTHB 1CZ8H 1OGAD 2VLRE 4AJ0A 2J8UB 1T1ZB 1G9NL 1NGYB 2CUHA 1CXFA 1KCVH 4MJ5A 3V7AG 5IHZA 1P2CA 2ILLA 1F3JA 5MEND 5DVNA 1EXUA 5F3BA 4JY6B 2F58H 5C86A 5LG1A 1VENA 2G5RA 1NSNH 2C3WA 1N8ZA 4ELMA 4U1LB 1EX0A 1KEMH 1BF2A 3BUTA 3T0EC 2EEDA 2WWKT 4ZPTB 4O2CB 3VI3E 1YNLH 2H2PD 4MA8L 1AXIB 1NKRA 2EDLA 5CLTA 3V95A 4G3YL 3TBWA 2VL4A 1UWGH 2AXHA 1KIQB 4JPKL 5F96L 3V4VH 2HKFH 3JVGC 2CDGA 5LGJB 4HJGB 4QOKD 2Y4SA 4GKSB 3FRUB