2FJFB

Structure of the g6 fab, a phage derived vegf binding fab
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
223
structure length
218
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTISDYWIHWVRQAPGKGLEWVAGITPAGGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARFVFFLPYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function studies of two synthetic anti-vascular endothelial growth factor Fabs and comparison with the Avastin Fab.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Light Chain of a VEGF binding Antibody
total genus 46
structure length 218
sequence length 223
chains with identical sequence D, F, H, I, K, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2006-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fjfB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fjfB01
3Q6GH 2QR0B 3HAEA 4XTRC 5D8JH 4L3ED 2F8OA 4DZ8A 3L7EA 4EI5D 4LPCA 4G9DB 4NCDA 4L29B 1OWWA 1A9EB 3EO0B 1L7TL 2P47B 1LQSR 2APXA 3TBYA 3JWDC 3R0MA 3ULVC 3O81A 1OP3H 5FYKD 4OF5A 4UDUA 1P6FA 1XGPB 2XN9E 3HC4L 4Y1AE 4NQDA 3LKOA 4JFDA 4Y4HD 5ITFA 4I5BA 2UV3A 5HY9B 4QXUH 1GHFL 5BMFL 1NBZA 1QNZL 3HAEB 1EK3A 4QHLA 2BVPB 3HI6H 3IVKA 4XTRD 4PJIF 1HSBB 5FHBH 1MJ8L 5TE6L 1QLEL 4KKLD 3S3SA 4LLVA 4N5ED 2W92A 4UT6L 5TE6H 3WDHA 4UOW0 4U1MA 4Y4KD 2I5YH 4M61A 1IM9D 3QG7H 2DQDL 3LN4A 3IDIA 1IQWH 1HXYA 3B9KD 3HE6B 1WBXB 4JKPH 1K4CB 4NZTL 3NTCH 1NEZG 4LCWD 5C9JB 3FFCA 5BRZE 3SEPA 1OVZA 4FZEL 3WL9B 1NFDF 4FMFA 2UUDH 4CMHB 1IT9H 3VXSD 3RA7H 4QCIA 1MJUL 5HYJE 3B3IB 3GMNB 5HI4C 4TRPH 3U2SA 2OK0H 4MA1C 1YN7A 1E4KA 3NPZB 5D1QB 4JFDD 4HG4J 3HMXL 1MCWM 1SMAA 2FEEL 3DX7B 4EXPX 1U8JA 4Z95H 2VKWA 4K8RD 3O9WC 5KW9H 3N1GC 4QXWA 5HHOA 8FABB 1MWAL 2P8PA 3TA3A 4X6FA 4CJ1A 4AIZA 4APQC 5J9PA 4X7EC 4HCRL 1YYLH 3RIAK 1MLBA 1HI6B 5EC2B 3VGAC 5CGMA 3VFTB 2HLFC 4K2UH 5IB1A 4ZTOH 2QBWA 1V3LA 3DLQR 5C0GA 2JCCA 4QXGH 4JHAL 5TE4L 4B7LA 1T20B 3GNML 1MCNA 4GQ9L 4WHYH 3O3AB 3JWOC 4HIHA 3KAAA 4V2BA 4YAQB 1QSFA 2DKSA 5C0DB 1T5WA 3KGRA 1SY6H 1EERB 4WV1A 4PGZA 4WUUD 2ZOKA 3ORJA 4FOMA 2A9MH 4ZS6C 4ELMB 2V5SA 2VITB 1A7NL 1YN7B 2ZUTA 5IB1B 2EEAA 3LKNA 4DKEH 1QEWA 4PTTA 5JORA 3PHQA 4K7FA 3QCTL 5BQ7B 1ZANH 4MJ6B 4PJEE 2ZP0T 2FSEA 2VXSL 8FABA 3QJFB 4I0PC 5D6DA 4YBLB 4PS4L 3X3GL 3C2AH 4P59L 1ZSDB 3KYKH 3BE1L 3U82B 3H9HB 3Q6FA 1S9XB 4LCWE 4LVOB 5GS3A 3BP7B 1FDLL 3MOBH 4H5SA 4LNRA 3O4OC 3MX0A 3SKJH 2GK2A 3I6LE 1FL5A 1U95A 4Q9CA 4O2CA 1W72A 2F58L 4LLAA 2JJSA 1FYHB 4FXGA 3RTQB 2CUIA 3VH8G 4OQTA 3VRJA 4OFVA 3SCMB 3VDAA 2EKSB 1QFWH 4YPGA 4JY4A 5IROA 2J8HA 4S0SD 1U6AH 1F3RB 4N0YL 2D9CA 3OKLB 5DJCB 3ARFB 2XTJC 4F9LC 1MAJA 2IBZX 3ARUA 1HIMH 3UO1L 1T2XA 3OB0K 3V95A 1YY8A 3K8MA 1WSST 3RTQD 2CLZA 5EOQH 4Q7DA 4PYHA 4Y1AA 1T03H 3L3KA 1I4FA 3RY6A 1OARL 2ZCLL 4DGYH 1JF6A 3BO8B 4J3VA 5GGQH 2AKRA 2A1WL 4XP6L 5JW3H 1YEHH 2DD8H 1MJJB 5E8OB 3B9KB 3ARPA 4P5KA 3NCBB 1T0MA 4KKAC 3C6SB 2WW8A 5D70L 1L9NA 4E5XA 4OZFA 1I1FA 1EO5A 3GSUA 2HVKA 4GAGH 3PDDA 4JB9H 1RPQA 4QCIB 4YDVB 3RZCC 2DMCA 3RTQC 4Y5XC 5AZEL 2EXYD 1S7UA 1IC7L 2DIJA 4LNVA 1U8QB 4UNVA 1M7DB 3VMNA 2P8LA 1NANI 3SQOH 3QNYA 4XWOC 3MLRH 1Z0MA 1T4KB 3AUVA 4KK8D 1IARB 3VW3H 3VXPB 1BBDH 1UWGH 3WEXB 4JJHA 1G7MB 3KPMA 4JRYE 1IQDA 4FTVE 4NQCA 1Z2KA 4NQED 4Z7VB 1OY3B 2O26U 3MLTB 1MEXL 4FQCL 3FO9B 4LF3B 1JWMB 3JUYA 3O8XD 5H37G 3HFML 3P30L 2B1HH 3KPTA 1DQJA 3WS3B 4NNPL 5EU6A 4C56D 4MA3B 5KSUB 2VITA 1WLHA 3C9NB 4P2OA 5ESVA 4F7MA 1N7ML 4GQPH 5T1LB 2BOBA 3QAZB 3GSNL 3OKNB 5E08H 3RBSA 1T7XA 3LEYH 4JFPB 5DQ9A 1UM4L 3L6FB 5EC1A 1PYWA 4AT6B 4P5MA 5DD1L 5J13B 3QWOB 1IZJA 1ZAGA 5DVOA 3MLWH 3BHBB 3T2PA 5B39B 4ZFGL 1OAXL 3LV3B 4ONGL 3V0WH 4Z76B 2RHEA 5DJAB 4G7YL 3VFPB 4X98A 3KPSB 4I8DA 1OCWL 3HLAA 3M1BA 1IILE 2V6HA 1WF5A 5ADOH 4X8JA 2Y1VA 3G08B 3DRQB 4G6FD 4QRRB 4JVWA 3RI5K 1RMFL 1NSNL 4XMLH 3VWJC 4EI6B 1MCQA 2HKHL 3U79A 3ILQD 3QHTC 4HJ0C 1T03L 3STLA 1DUZB 1U42A 1EEZA 4U6HA 4HMCA 1G6RB 1FYTB 4YUEH 5H94B 5TPWL 4R2GB 5FGSA 5JHLH 4X83A 1KCSH 4UAOB 5DXWA 1IM9B 4XPTH 5IKCB 2IAMA 4PTUA 2IANB 4U1NA 4PRHD 4YK4C 1UQSA 1WWCA 3PWLA 3WNNA 1AXSA 4Z95L 3V8OA 4G8GA 4HS3B 1AC6A 1CLOL 1AR1D 3QUZD 1P84K 4GBXC 3RVVC 2DLFH 1CE1H 2P44B 3LEVL 1AO7B 2A6DB 4RA0C 4JDTH 5CMAA 3ARRA 5EUOF 1A9BA 3C09B 3WFBH 5GJSL 5HGDA 4MXWL 4K7PY 3D85B 3TIEA 5ALBL 1Q9LA 5E7FA 3MMEB 3DXAB 3CXHK 5E8EA 3UZVB 1FO0B 3QIUB 1HWGB 1NDGB 4PRIB 4MD5A 2P5EB 4FMKA 4D9QD 1ZS8B 5D2NC 1BJ8A 1L9MA 2EXWD 4YHML 2VLME 4IRJA 3M1BB 2CDGA 4UT9H 2BVOA 5FYJE 5E2VH 3SDDD 3ZTJG 5BJTB 1MCFA 4POUB 2ORBL 4WCYL 4RFNB 1W2KT 3IFLL 4GBXD 3LS4H 4C56E 3MLXL 1YMHA 3W5NA 3VWJB 5L2JB 4IJ3B 5EB9A 3O3BA 2ICWI 4ZFFA 1A1OA 4XC1L 5TDPB 2VLLA 3SDCB 1OPGH 3QIUA 4NQDB 3Q5OA 2HRPL 3BKJL 1CFBA 4UTAH 3MFFB 1EEQA 1SM3L 3EDDA 4KTEH 2ARJQ 1KEMH 3DYPA 4PJFB 2OR8A 5IQ7H 3DURB 4FQIL 4L3EE 4PJFF 2YZ8A 5FO8B 4JEGB 5IK3B 2I25N 3P4OB 3BDXA 3VXSA 4CVXB 1CDBA 5SX4H 1A1MB 4JLRA 3MPCA 5CIPB 4GKZB 5C09D 1IC5H 3MZTA 4B41A 5HI3D 2ZUXA 1I1AC 2FWOB 5E5UB 1D6EB 4WHCA 2FBOJ 1UXWA 2DQGH 4UBDC 1SVZA 4KUZH 1YJDH 2R0LL 1Q0XH 2NY6D 5D9SA 2X7LB 4LDLB 4JRYD 5I74C 3PWUB 5DQJA 4HFUL 3BP6A 4UIMA 4R0LA 5L2KA 2W65B 1DDHA 5T3XE 4ZOEA 1VGEL 1IQDB 4NQCB 4YLQT 4Z7VA 4OIIL 2F19H 2Z31A 2VR9A 2E8YA 3SDCD 1N59B 2HWZL 5C70A 1KF9B 4GKNB 2VDKL 3P40A 3PWNA 1Y6KR 1OT2A 5AUMB 3U4AA 4XPBH 1KG0A 2YPLE 3D9AL 4RIRB 5HHXL 5DEGB 4YX2L 3GMMB 5JQ6H 4KKLC 5C09E 1H3WM 1SJHB 5FA4B 1QO3A 3EYQD 3QDMA 4CAGA 4Y19B 1RUKH 1U41A 1IAOB 4NGHL 1T6VN 3HLAB 5EBWB 5BVPH 1ZT1B 2FX8L 1MFCL 5AD0A 4JANB 4XWOD 1FZOB 5A3IC 1CFSA 3OAYH 1DANU 4OCLC 5ELIA 4L4JA 3CUPA 2HJKA 3ESVF 2DBLH 3WN5A 1CFNB 1FIEA 3CFIC 1NAKH 1FSKC 1RZKH 1XIWA 3O6LH 3BPNB 5TQ2L 4NJAL 5CP3A 4TPRL 4EI5B 5DJ6A 3KPSE 2WNGA 3HNTH 3HUJB 5CBEA 5ADPH 2QV2A 2XWJA 3IDNB 4ODUB 1XT5A 5I76A 3IJHB 5DDHA 4N8VA 5IMOA 4NO3B 4ISVA 5EOTB 3UEZA 3LN5B 3DMMC 4XP1H 1RZFH 3OKKB 2EDJA 1AIFA 3ULUE 2PYEB 2LV4A 4YHLH 2PETA 5IB3B 3P0VL 1HILB 4WWID 3LHPH 1LE9A 2HG5A 4H1LG 1MCCA 3SGDH 3TJEH 1CCZA 4XNQB 1N8ZB 4GW1B 1IMHC 3FT2A 5DT1H 4R4FL 3OMZA 1U3HB 1ZTXL 3LSOA 4N68A 2MQ3A 1FNSL 4H0GA 3SKOA 1NPUA 2X41A 1RUAL 1TJHL 1HH9A 3C8KB 3LIZH 4JG1H 4O2EB 4Q9QH 2GKIA 4EI6A 3BPOC 4OFPA 2X4SB 5F21B 2X89D 2DI8A 3T0WA 1C5DB 4OF7A 4XVTL 5DQDH 5IG7A 4Z7UA 3RX7A 4PGBB 2P5WE 4M6ML 3MRIA 4KXZI 3ME0A 4ELMA 1R3JA 3S34L 1CICC 5D7LE 4FQIH 1CLYL 1RUPL 2AK4B 4JPWL 4PYGA 4WNQB 1KTLB 4GMSH 3QXAA 2A6KB 1DTUA 4XAKD 1A1NB 1PD6A 4AENA 3EAKA 1I1YA 3DURA 4XBGA 2VMFA 1FG9C 4JPIA 1KJMA 2BNQE 5T3ZL 1NDGA 1TZGH 1T0NA 4YZFE 1YC7A 3IDJB 4YDIL 5F89A 1ORQA 3TNMB 1AFVH 3D1MC 2Y6SC 1FFPA 3AS0A 4GKSB 4X7FC 4M7JH 5IWLC 4S2SB 2Q76B 4XNUH 3LSOB 3EO9H 1A6TB 2XKUA 3P73B 2FECL 4PJFE 4QWWD 2W0LA 2J8UB 3PUCA 2BXYA 2AEPL 3CMGA 4JKKA 4QRPB 2EDKA 2Z8WC 3WE6A 3WFHA 5INDA 1HHJB 3CCHB 3G5YB 4WI9A 2VB5A 2RQ8A 4OFIA 2R2BA 5IP4A 4R7NA 2H2PC 5I17B 5DEZA 5FYLH 2YD9A 1CICB 4YBHA 3KS0H 1NGQL 2P8PB 3TA3B 4GO6B 5IHBA 3MJ7A 2Z4QB 2GITA 4UOJA 3KJ6H 4ZPTB 2W59A 5EOCL 3ROLA 2JCCF 3DMMA 2ADIB 1T3FB 2OZ4L 1RZ7L 1NEUA 1R24B 4TOYH 5EU4A 2EXWC 4KK9C 4XPGH 5EOCH 3AS3A 1HINL 4J6RL 5HDLA 5D1ZD 3CLEH 1ZANL 3MV9D 1Q9KB 4IMLA 5D93C 4DKEL 5TH2B 1CR9H 1KJ2H 3LS5H 5J0BA 3CK0L 5I1EH 4PJCF 4WWKD 1W0WA 1VADB 4JM2B 4JO4L 3WXVH 1B4JL 5EC2A 1CDYA 2NY7L 4NUJA 4RBPH 4JHBA 4NZUH 1BHGA 2FHCA 1F13A 4NWTH 3QH3B 5BZDA 2GYSA 4PJEF 4L5FH 4G43A 1KCVH 4ONHB 4ALAH 3NVQA 4ELKA 3SKJL 5I9QB 2VRAA 3HMWH 1HHKB 5JUEH 1WCQA 2PW2B 4QO1A 43CAB 3ZE1E 4EXKA 1IC4H 1N4XL 1XCTB 2H32H 2MQCA 2R1WA 5CFHA 2EE6A 1RFDH 1TJHH 3EDJA 5EBLB 4HG4K 2V2TA 1OF2A 1FVCB 4Y4FC 5E2TH 2X09A 3G5XA 4O2EA 3CDGB 2BNUA 4PLOB 2EYRB 1T1XA 2VC2H 1NQBA 1HOCA 1ROWA 4XNZB 4CBPA 5DMGC 3LD8C 2BX5A 4HW6A 2OYPA 3IGAA 3OR7A 4KRLB 5D2LE 3CFEB 3S34H 3U4BH 2MCPH 4NQTA 4NNYA 3RWIB 5HD8D 3VRJB 4G80A 4ZSOE 1RZJC 3F58H 1HE7A 1AQKH 1CZ8L 1K2DB 2WUBH 3ALXA 5CZXC 3MJ8A 2HP4A 1MRCH 2D03H 2X1PA 4ZO6A 1G7PB 1CK0L 3BZFA 1FLTX 3QUKB 2CK0H 2IC2A 2XZZA 4NO3A 1Q1JL 1EAPB 4J6RH 3NAAL 4HKXA 4X0KB 1JWUA 3CZJA 2X70A 3EOAA 43C9B 4P23B 4PRBB 4YR6B 1QSED 4C55A 2F8XC 3QZWB 3AFLA 3ARVA 1WIPA 3AREA 3BXNB 5ILTL 4Z9KB 3QNXB 1OAZL 2YPVL 2OJEB 3QCUH 5EULV 4I2XE 3RL2A 1JZ6A 5E8OA 4LPTA 5FYLD 3VFSA 1N0XH 2Q76A 3MGTB 1FZKB 4Z0XA 3UTPE 3S5LA 4YFEA 2D7MA 4KJPD 2FL5A 3QQ3B 2J6EA 1JF5A 4L8BA 3VRLF 1QBLH 2E7HA 4Z7UB 3T3PE 3TVMC 4M5YH 1J0JA 3VG0H 3GBLA 4I3SL 4MS8C 4XVSH 5IBTL 4DVBB 3FB6B 2YS4A 2I9LA 4AK1A 4MJ5B 4H20H 5GJTL 2DQJL 2VERN 4YIQB 4ZUUB 5I17A 3FT4A 3SDYH 4JFOA 4H5SB 2Q8BL 2AK4A 2VXQL 3FZUD 5T1KD 4GS7C 3VFVB 2BSED 2F54D 1MFNA 4HBCH 4QHMB 4YHYB 2QADD 4GXVL 5D2LA 3L3JA 3FQXB 3UTTA 3GBML 5E4EB 2C3GA 4OM0H 3VD4A 1P7QA 5KVDL 4K9EH 4K7PL 5C0JB 5HYQB 1MIML 1PZ5A 4DTGL 2ZSVB 1XZ0B 5SWZA 3SE4C 4ZXBA 2I9TA 5D1XC 1I1RA 5DFVD 4NJ9L 1AD0A 2H2SD 4O9HH 3I6GB 3JWOL 3BGMA 3S5LG 1F11A 4WTZG 4LSRL 1LK2B 3JV6B 4OZFG 5L9DH 1IC5L 1JYNA 4H26A 1MH5A 1ZLWK 3A6OA 3QR2A 1BJMA 1DN2A 2EIBA 3VFGH 5D1QA 3UTTB 2R9HC 3NABL 4J4PD 3ZE1F 1XCQB 5C2BH 4HZLA 2P43B 2EO9A 2E6QA 4MCZA 4YFLF 1T21B 3NACL 4IOIB 3KLHD 1EUUA 4OCRH 4OZIE 1KGCE 2PXYC 3B9AA 5K9JL 2FZ3A 1J1OL 3O8XC 2EC8A 2CRZA 5TDOB 3WS3A 5GGRB 1I9RL 4F37F 1AHWC 2RCSL 1J12A 3MOAL 2WINA 5JXAH 4GG6A 5D2LF 5CINH 2OXHA 3O3EB 1YEFL 2Z31D 2NY5H 1D5ZB 4CNIB 5HVHB 4YFDB 5ERWA 5A16A 3QRGH 4WI2A 5F9AC 1HQ4A 2V9TA 5JIHA 4CVUA 1I8MA 4UB0H 2VXVL 1I7RA 2HFFB 3HE6A 2UZIL 4XCFH 2XRAH 1UKSA 2NTFB 3MRHB 4HX1A 3T0EA 5J89A 4TNVK 4GJTB 5DWUH 2Y5TB 2VDMH 4JFZH 3WJLC 4M00A 1CVSC 2NLJA 4JM4H 1BLNB 1CXKA 4B5EA 4YE4H 4JFZL 5EBWA 2EYSA 3GBNH 4FQXD 5DJ0B 5D7JA 3MBED 3RJDA 4V2CB 2IWGA 1OAYH 2X4PB 1A6UH 2AK4D 3LKSB 5CJXC 3EGSA 5I1KH 3V79C 3GMMA 5E56A 4PJ7F 3MXWH 1CD8A 1G7PA 4DGVL 5JO5B 1BZ9A 3U7WL 2IFGA 3BI9X 5I1GH 2AJXL 3QZWA 4OB5H 3HPJA 4Y2DA 4OCYH 2IBGA 1PEWA 1FFNA 4N9GA 5H37H 5C92A 3OJDA 2V5RA 2JJTC 4N8VB 4APQD 1RULL 1MF2H 2CKBH 5E2UH 2LVCA 1UH3A 1A0QL 4U4BA 4HFWB 3V4PL 4WFED 1X5JA 4U7MA 2VQ1A 2Y5EA 1GOGA 3O45B 1EHNA 4CN4A 3ROOB 4L8SB 5BW7A 2IQAB 4XPFL 3JWOH 2K9UA 2OLDA 1B9ZA 5FYJU 2EE2A 1HWHB 1R5VB 1FL3B 4RX4D 3AXLB 4XPAH 4YHNB 1BAFH 3TP4A 3ILPA 4I3RL 3KPLA 1UACH 4I2XA 5CZVH 1MVUA 2P8MA 3T3MF 2ATKB 3ZKMD 2BY3A 3SCMD 2NR6D 2VTFA 2MQ0A 2WLZA 1U3ZA 3MODH 4WI7A 4U2YA 3FHQA 3I84A 4GRWE 2VQTA 4OLVH 3ZT5A 4KRPD 1NBVH 5EOQL 2CXKA 4NBYB 2V2XB 3TZVB 5F7FA 1CD1B 1D9KC 5L8LB 4YHNA 3PDOA 1P84J 5IMLA 1CG9A 1MJJA 3BUTA 4OCSH 2DWEB 4L29A 4IHOA 1QG3A 4N0FB 1ZHLB 5K93A 5SWZB 1F90H 4Y4FA 1JUFB 1YZZA 3MCKA 1MHCB 5T3ZH 3RHWK 2R4SL 4XMKH 4CADB 4E0RB 2Q1EA 1M71B 2NY6C 1A6VH 3O6FD 3GSOB 4OCXH 1YEEL 1URLA 3C2SA 4H26B 1CGYA 4D0CA 5IB2B 3HRZB 3WJJA 5C0NC 4S2SA 5FIEA 3MROB 3DGCR 1OW0C 3L3OA 4OI8A 2NW3B 4XPHL 1TETL 4ZS7H 2BRQA 3B83A 3T2NL 5D71H 3SGEH 1IAIM 2IH3B 3T77A 4GAYB 2EZ0D 2ILLA 3P0GB 1EO8H 5CEXA 1WIOA 3WFCH 1D5XB 5I30H 1NC2D 5DGRA 3W11C 4L4VD 1QSEB 1JV5B 4BQ9A 4ZYKA 4Y89A 5F9WC 1KXQE 1LEGB 2ZUWA 3O8XA 4LLMB 4XB7A 4JFEA 1VKXB 1CD1A 4X7TB 3O3EA 2AI0L 2SEBB 4N1CA 4WIQA 4OCYL 3TZVC 3GJFA 1BFOA 3QNZB 4TUKH 3K4AA 3IAGC 3HRPA 1XGTA 4PJ9A 1BLNA 2P49B 4WEMB 4MA3A 5AWNH 4OAWA 5KSAC 3B9EA 5EN2B 2YHGA 3QEQB 3RVXD 1TVHA 4WCYH 3QWRD 3V6OA 2CK2A 1NFKA 2PW1B 3H0TB 4J4PC 4M3KB 4RAUA 1GGIL 4RNRA 3KLAB 1U58A 3RUGE 2EH7H 4G5ZL 3U30B 5HYJA 2NY4B 2XWTB 1W0YT 4GAJH 4NYLA 4ZXBC 3DTXB 4GSDH 4OV5B 2IH3A 3NCCB 1HHGB 3MTRA 4X99B 3O6KL 4KI5D 4YXKH 3ZL4H 1YEDB 5KVEH 5GRJL 2NMSA 4LOUC 2OJZL 2NY2D 1ZGLP 4R26H 4Q6IC 5EWIL 3SDAA 4JFEB 1MCEA 2D9QB 3ILQC 4U3HA 4YNYA 5BW7C 2RCSH 5DD0H 5HHVL 1KT2A 5EU5A 5AYUL 5C07B 2NY0D 1I3GL 4FFVC 1XH3B 1NJ9B 5HHNB 2O5YL 4EVNA 3QA3A 5E9DD 5DQDL 4WWKA 2OR9H 4GRWF 5DZNA 4HBQA 3LH2L 1HYRC 1OTSC 3CFDA 3CDGA 4QEGA 3SGKC 4M1CD 4NHUA 2IGFL 3GSXB 5DEFB 3MREA 4BFEA 3D18B 1WAAA 3K74B 2QL1A 2ATKA 4PJDE 5I1AA 4LSRH 5ITBH 5ESQB 3RWGA 2CIIA 3HTLX 1UA6L 3O4LE 3INUH 5CP7B 1OAYL 1OTTD 3WUZA 1HNFA 3TPKA 1QHOA 4NQUA 2YPLA 3LVEA 4LKXA 3SDAD 3D3VE 4IDJH 4ZPVB 4JR9H 4PV9B 5CWSB 1VFUA 2BVQB 2GJ6A 1DE4A 2IALB 3RY5A 4NZRH 2HKFH 1N6QH 3KHOA 1DL7L 3J7HA 5DA0B 4L8BB 4OCRL 1HHHB 3GSNA 4G5ZH 3HG1E 3IS1X 3G5VA 4PP1C 3SDDA 4ZDHA 3NH7H 1NLBL 5KW9L 2DTMH 3BDYH 3GUTB 5DA4A 3RWCA 4BQ6A 3EYFB 4N0UE 1CICA 4HCRA 3IFPB 4PJ5B 1EV2E 3W82A 3OHXA 1YEFH 5I1KL 1FVEA 3HNSH 4X5WA 3UROR 4Z7QE 4OGAC 1QLFB 3RZCA 1QBLL 4TULH 1NCAH 1G7LA 1RIHH 1X4XA 4MD0A 2PXYA 1Z9LA 4J3OC 4EOWL 4BSWA 1F4HA 5ETUA 3VGEA 4K3JL 4JAMB 4O2FB 3O2DH 1KNOB 3S88H 4NQXB 5IVZA 1L7IL 3IAQA 5HHOE 1BOGB 4XCCH 5B3JE 1U8PA 4LARL 4OM1L 5T1MB 3MJ9L 2MWCA 2B2XL 5SX5H 4P2QA 5IIEB 4F3FB 1OAUL 5ENWA 2QSQA 5IFHL 1JZ2A 2B2XH 1AJ7L 3QEGL 5I75C 3TVMA 2W9EL 5M95B 3NIDF 3PP3K 4Q9QL 4JO4H 3WXVL 4PP2B 2B5IC 1Q38A 2PNDA 2P5ED 2D31A 4K71B 3HAEG 4I9WE 4WI5A 2ZUVA 1SMOA 1JHKL 3U0PB 2UWEF 4RQQB 5DJXB 1EEUA 4HUXA 2XTJD 2YK1H 3KYKL 3NGBC 3S4SA 3O6KH 3ZL4L 3W0WA 2Q20A 3QDGB 4GBXA 4YWGH 1C1EH 1X5LA 2VAJA 4WHDA 1EHXA 3VXRB 5CJOH 3WNMA 2VYRE 4JO2H 3VFTA 3K1KC 3PL6B 1QFPA 32C2B 1L0QA 3EYSH 4LCYA 5HVFB 4BH8B 2P5WA 1NGWA 2G60H 3ULVL 5DUBA 2VQUA 4PJ5E 1A4JB 2OL3A 3QO1A 4U0RC 1KELL 3AROA 2P7TB 2E5EA 3NH7L 4HIHB 4IOIA 1DQTA 1CDHA 5D71L 1BOYA 3GMOB 1FYTA 3UPAA 3CZFB 2OSLB 3BX7C 1OGTA 1AE6L 4TTDC 4ESKA 5C3LD 2EH8L 3KYMA 5K59F 4PJ8D 4D9RD 2AAVA 4ODXB 3U4EB 4AQ1B 1RIUL 2VIRB 4H25A 4BZYA 4ETQA 1S7RA 1G6RL 4E41A 4P2RE 4EVNB 4EBQL 2DKMA 3VFUB 2YPKA 2B4CL 4RDQG 3RX5A 5DJAA 4IBLT 3UTSD 3VFRA 1T7YA 1N5YL 2BSSA 3L5IA 3JTTA 4NN7C 5EZLB 1H5BB 1PKQA 4TTDD 4H1LB 2F15A 1O5DT 3BKCL 4WU7B 3D2UD 3X14A 3PF2A 5ECJE 2XYCA 1F6LL 3CVHL 4HC1L 3HR5B 4JFXB 3MRNB 1A4KA 3VGDA 5HGBB 4M8QB 1EO7A 1HHHA 2DOCA 2VLLB 3SDCA 1I85C 1BFVL 2JB5L 3HI5H 2MPAH 2PW2A 43CAA 3NZHL 5GSVA 4X98B 1TENA 1NBYB 3TPUB 4PRNB 2HLAB 3QULA 4HXBL 4JRXE 3X3FH 4R26L 5EOCJ 3L3DA 2BVTA 4PRPE 3IFPA 4M7LL 4PJ5A 4IRSA 4Y16C 1MRFL 2CLVA 1T22A 5C7XH 1AD9B 5ICZA 3VXOA 4TSAL 5IBUB 1K4DB 5E24E 3F12A 1UM4H 3BWAA 4P4KA 1KJMB 3FT3B 1IGML 1ONQA 3MACH 4RFEB 5K9OB 3EHBD 4L8SA 2OBGA 4ZUSB 4MVBC 4UV7H 5EORL 4L5FL 1JHLH 4HMEA 5ICXB 3FOMA 5JHDA 4MA7H 3B9DA 1V7NH 5GSRA 5F8QC 1I75A 2YPLB 4RWHA 3CIQA 3RDTA 4X4ZA 3MJ6A 4EI5C 1NLDL 5T1LD 4O58H 2NPLX 3IJYB 4GG8B 3WHXB 5IKCA 3MXVH 3EFDH 1QFUH 2BRRH 5HHMD 4GKNA 1UJTA 1ZLSH 4D9LH 2R0ZH 5D7IE 4CVZB 4PRBA 1Y18A 4JO1L 3Q5YA 5JQ6L 1S7UB 4I9WD 1XF4A 5EIIB 1JZ3A 1U8NA 2EDNA 4IIQA 2WM0A 5L88H 3LB6C 1M7IA 2DQTL 2DIAA 4RCAA 3UTSE 3EJJX 1QLRB 4M6MH 4XBPA 2V17H 5ANME 3IKCA 2JKXA 1QLEH 2NXYB 2R9HD 2VDLH 4LEOA 4FQLH 1NCDH 4QYOA 1QACA 4P2OD 2PTUA 2ZUYA 3PWJB 4KDVA 2DI7A 2AK1L 4YGAB 2OZ4A 4X80H 1WBYB 1DQDL 5J7CC 1ZLVK 3VA2C 3BAEH 3C6LB 5IFJB 2R1YB 2ESVB 1AKJA 4LRIA 5F1IB 3H7LA 1BQHA 1PQZB 1GOHA 5HPOA 1MHHB 2IPUK 2RJMA 3MFFA 4KU1A 1KFAH 4FN0A 5EU6B 5JW4N 2WINB 1TTGA 2QQKL 4BSVA 1W0VA 5DC0A 2GFBB 2IGFH 3IB4A 4R2GD 4NRYB 1NLBH 2FEDC 3C5ZB 3CSYA 4DVRH 3Q6GL 1XF1A 5E6IB 3I02A 5CJBA 5CEYA 2FBJH 3CFCL 4X7CC 1FNGA 1GC1H 4UTAL 2VN7A 3TBTB 3G9VA 3LKPA 1ADQL 3WIHH 3GMLA 1BZ9B 5DFWH 5GIRA 5E8NB 2HFTA 3SE9L 4FQXC 2V7NA 2Y25A 3T8XB 1GGBH 3VH8B 4BFBD 3BP6B 2ORBH 4X9HA 4RAHA 3TC9A 5D6CA 3QHZL 3ARFA 3MNVB 4P2RA 4L3EB 5TH2A 1T80A 1XR9B 4JG0H 5C6TH 4UT7L 3QDME 3R8QA 7FABH 3MBXL 1J10A 3CLFL 3RU8H 3TH2T 2XWTA 1JRHI 3CLFH 1B6DA 3VGAB 2OXGA 1A0QH 1G9NL 1KACB 3V4PH 4BZ2L 4RAVB 4ODTH 4NJ9H 4Y5YA 3VGBA 3L3DB 5F72S 3EFDL 1R3HB 4J12A 2YD2A 4P9HC 5SWZE 3IDYB 4KRPB 5E6IA 1JPST 1MRCL 1REIA 5E00B 4E41B 2O93L 2MKLC 4TVSa 3RWJB 3LMJH 4JPWH 4PJGB 4XCEB 1JZ4A 1X5GA 1LK3H 2VWEC 4EDWH 5C2UB 2HMID 1GZQA 3IDJA 4OF0A 1NCBL 4O5LH 4HIXL 5DK2A 1HHGA 4X99A 3MUHL 4Z77B 3SPVA 1WFTA 3QXWA 1EEYB 1QYGL 4P9HL 2NY1D 5L0QC 4HFUH 2DAVA 1DL7H 1QSFB 1GIGL 5ICYA 1YMMD 3DRTA 2AV7A 4G6JH 1LO5B 2D4FA 1P1ZB 3BRDA 5ACMA 2Y9RT 1MHCA 1RY7B 4JM2F 1JGVH 2PYEA 1WZMA 4FXGB 5KANG 4F9LA 2K1MA 4JHAH 1QRNA 4R96A 5HPMB 4GW5B 4O51A 1S9YA 2QKIA 1G6RH 2ATPB 4HS6B 4R97B 5MHSE 3MA9L 2KZWA 1EMTL 2OS7A 3CDFA 4ZUWA 5MEOB 2GCYA 3SDYL 1T2JA 2FX8H 3QCVH 1EBPA 5I1JH 3KYOA 4MJIA 2I26N 5BVPL 1QLFA 2VDPH 5C0RH 4PRAA 4GW1A 1AC0A 1GVIA 5F1OB 3DVGB 3PL6D 4J3SA 3QIBA 1BECA 3IFOB 2YD7A 4XNZC 4X80L 1J8HA 4LSSH 3DWTA 1IL1B 4ZDHB 1KTDA 4XVUC 5MENA 3BPLC 1I8KB 5C9JA 5ALCH 2H45A 1FNLA 4JHWL 2ZG3A 3SKOB 1MHEA 4NRXA 4OJFL 3ARBA 2E8ZA 4YGVB 4NUGH 4FFYH 2MSPA 2AJZA 4U31A 5I8OH 1XAUA 3S36H 2G75B 3S5LB 4OV6F 5L9DL 4YZFF 1U3YA 4PY7B 2Z9TA 4TNWK 4KTEL 4LRIC 3O2DL 1UCBH 4P23D 3I3BA 1TVBA 2F53D 5BV7C 4RMTA 5C0CE 1FRGH 3AAZB 1YPZA 4N5EC 1Y6NR 4HWZA 2VLKE 3FKUS 3UTPD 1ADQH 3BO8A 3BUYB 4MX7A 3NOIA 3WLBA 1CFTA 1GIGH 4P2QE 1IAIH 1BD2B 4ZAKB 4JN1H 4LOUD 2R1WB 2X1XR 3NA4A 4QXTB 5IHLB 1E4KC 1G7LB 3GIZH 1F3JA 1MFDH 2HT3C 2BFVH 3E2HC 5J3HC 1FP5A 4JFDE 3MLYH 5KN5A 2XTLA 3X17A 3WLWD 1A9EA 3EO0A 3PIQB 4PP2A 3OAZK 5GHWH 3MUJA 4LFHD 1SM3H 3LKRB 2EIZB 2UYLB 4MNQB 3TVMB 2A9NH 3S7GA 4MAUH 3DSFL 5AAMA 2I07B 4KMLB 2W60A 1QFUL 5IIEA 4I5BB 4ODTL 2JLLA 3WFZA 1GPOL 4W4NA 4LCCC 4KGLA 5E4IA 3VXMD 1INDH 3FQNB 2MFNA 3HE6D 3CGTA 3D2UA 3E8UL 5I15H 1OGAA 1ZV5A 35C8H 1SBSL 4HXAH 5DMIH 1PKOA 1F4AA 3HS0B 3GSQA 1VEMA 5T3XL 1YEHL 1S7WB 1KJ2A 4XH2A 3ZKND 2I27N 4MXQD 5FM8A 4OGZA 1EZVY 4U6VL 4AQOA 4DJMA 3VFRB 2WQRA 4NO5B 4WUUE 4Z0BL 3VRIB 4PJCB 3OKEA 1C7SA 4D9RE 2FIKA 1WZ1H 4X9IA 2FB4L 3HE7D 1MLCB 3E2HB 3QFJD 4PREA 5DK2B 3UTTD 4ZOBA 2VLKA 3KPNB 4NIKB 1WFNA 2Q7YA 1BD2E 2DQEH 5KANI 5TE7L 2NXYD 4NUJB 5I73B 2H6PB 5F7LB 4CDGC 5JZ7D 4RGNE 4P9MH 2GQHA 1QFWL 2CJUH 3JV0A 2D3VA 3IFNH 5TPWH 1CGXA 1HHKA 2FWOA 1AGFA 1JWSA 5HHPA 2V17L 2H32A 3UJJH 3AB0B 2JCCE 4PJIB 3MLVL 4NT6B 3EOBA 4G8EA 3QWQB 3QWOA 1A6AA 1YA5A 2J3SA 3KJ6L 2VABA 1CL7L 3S88L 4L3CA 2AP2A 5F44A 4NZDA 1FZMB 3MRKA 5AWNL 3OX8B 4U1HB 1EGJL 2YBRA 3PV6B 1D6VH 4XX1E 1X4ZA 4HJJH 3DXAA 5E8EB 4S1QH 1MIMH 1DUZA 1QZ1A 2RB8A 3UXFA 2P5EA 4UAOC 3LRSB 3HNSL 2J8UF 3X3FL 1ZMYA 3CVIL 4MQXC 1BM3L 4F7TB 4AM0A 5GXBB 4O9HL 4NQXA 1JN6A 1SYVA 1CDJA 2OJEA 2LU3A 4DN4H 4LGSB 3DO7B 4MJ4A 5EBMA 5MEQA 5B3JF 1I1AB 4WY7H 3P4MA 2D7OA 4YXKL 4G80B 5DK0A 3ARGD 5JPNB 3SE4A 3G04A 3TBSB 4NKDA 3W9DA 2A6IA 4Y16D 4NRZA 4JFED 4NOFA 5E8DH 5D7LD 5CZKA 3MROA 1U92B 1JJUA 1MI5E 1RAMA 4F58L 4HLZG 1NGZB 4YR6A 3WIFA 1TFHA 2CRIA 4LCUA 2X4RA 1AHWB 2BNRB 5GS1C 1KYOK 1CFVL 2EDXA 5IB5B 5JPMA 3MGTA 5DJ6B 5HVHC 5I71B 5E1HB 2XNAA 1VEPA 5I1CL 3DX8B 1QR1A 1R5WB 5BRZB 2CKBB 5CINL 4FG6C 2BCKA 2GW5A 5KZCD 4AM0B 4DUWA 3JSSA 3NFSL 4F33A 3ETBF 1UKTA 3P0YH 1YPZE 3REWB 3WO3B 3RWFA 1W72L 2J5LC 1P7KA 3I6KB 1FGVH 1IAMA 2B0SH 2QHRH 3AY4A 3BN9D 4KPHL 3VGFA 1PEZA 1K8IB 4QY8B 1JYXA 2G2RB 4RGNB 4RWYL 2OP4H 3W5MA 5DUMH 4P3CH 5L8JB 2JJSC 5EFIB 3IRPX 4Z6AT 5DMIL 2ED7A 2DM2A 4ENED 1KIPB 4NDMA 4R90H 3L1OL 1TNNA 3TN0D 5CCKL 5JW4R 5D5MA 3SKMA 1IGJB 1A6UL 3S36X 4QGYA 5JO5A 3I85A 1NGPL 2X9WA 3C5ZC 1WZ1L 1T0MB 4FXLA 1NCUA 1D9KB 1SY6L 4A2LA 5ILTH 4QGTA 4KI5C 2BK8A 3KYNA 4FQ1H 4GW4A 3NIFE 4MS8D 1WK0A 4XI5D 4JRWA 5I2IB 1ZT7A 5IQ9B 1Z3GH 4UT9L 5F7DA 4LFHG 2A74B 4QOKE 3X13A 2W38A 4ZUTA 4M1CC 4PR5B 4NUGL 1P53A 4K2UL 3GDBA 3V2AR 2BNQB 2VXSH 5DMJB 2ZNWA 1T89A 5H35A 2F58H 4IRJD 1JNLH 1IGYA 3MV8E 1DVFD 2DQJH 5BXFB 1CL7H 1BVZA 4D94A 3BPOB 1VFOA 4L8DB 4GRWB 4CNIA 4V1DE 1CFSB 3MV7E 4PJHA 4ZFOL 1WIUA 3Q2CA 3O3DB 2BSRA 4AEIH 1ZHKB 3HG1B 5T1DH 5DEFA 3K46A 3AM8A 2A6JB 4KKAD 4IRZH 5IFHH 2AERT 3MRKB 2HWZH 4KZEL 4LQFL 1U8MB 1J0ZA 4FZEH 4OFYD 2Q6WB 2R2BB 5FUOH 2JJWA 4YX2H 2BSTB 3OKMB 3TFKD 3UYRL 4WY7L 2AK4E 3E6HB 3QIWD 4CMMB 1PGRB 5FO9A 3O2VH 2EDTA 1MSPA 1T1ZB 4PJ9D 4HPOH 1KCVL 4DUVA 1MCBA 1MOEA 3QQ4A 4MVBD 3ZHLA 2JK5A 1RU9H 2NY3B 3U0TB 3QI9C 2HYMA 5E94A 4ZODA 2DRUA 1G9NC 4F8QA 5IVOA 1QFWI 4PG2C 1MUJA 1CN4A 3P9WB 4L9LA 3ZE0E 3MLYL 3GBNL 4NRZB 4ZAKD 4K9EC 3CPLA 4QHNA 3OJVC 4QHMA 3OJ2C 2NY5C 1I1YB 5I8EA 4BFIB 1X5YA 5CEXB 4Z7WA 3KPRE 3N85L 4PRIA 4FZ8L 1QRNE 3P9MB 5H94A 4LCUB 3ET9F 3HNTL 4OUUB 3RPKA 4OD2B 4O2CB 3JWNC 1LO2H 5DJZB 3AREC 1EGJH 3VWJD 1GYAA 4PJ7A 5IG7B 4LLDB 4UU9A 1U8HA 5IB4B 4EBQH 5KSAB 1NCCH 1KC5H 3JWDH 4N8CH 3P0VH 5L2JA 2CDEB 1NCCL 1NH6A 4DGYL 4OLZH 2OCFD 4NQSA 3WFEL 1LNUB 1LP9A 3UJIL 1C12A 5JXEC 3BISA 2X4NB 1J9CT 4ZS6D 5FUOL 1P2CA 1U8OB 3VXTB 2JJVA 3D25B 1JCKA 4MD5B 3TN0A 5I8OL 3BT2L 1K85A 3NN8A 4QRQA 4DEPC 4LLQB 2HT4D 5HHQB 4LVOC 4QRUA 4OZIB 5FB8B 4KK5C 5EZJB 1LD9B 5IFAH 2M1KA 3ECBB 4XP9L 1BZ7A 5EWIH 3BRGC 3GGWB 2Z92B 3UZEA 4DCQB 4M5YL 5IQ7L 5E2WH 4OGYH 4OIAA 5LG1A 4MYWB 2NYYC 1VEOA 5J4MA 3ZKXB 2WK2A 3MRBB 1JPGA 3FO0H 1NUGA 1M71A 2F5BL 1PG7W 3W9EB 1FFOB 2VDRL 3FO0L 3Q5TA 5IB4A 5IVXF 3ISWA 1X4YA 5KSBF 5IVXB 3IVKB 1YMMB 4LEOB 4XCNB 4YFLI 1IE5A 5TFSL 3FHAA 3F7QA 4Y8DC 1MIEL 4HUXB 4JRYB 1QQDB 1U8QA 5IJVA 2W9DL 3LN4B 1MCOH 4UILL 3DYMA 1B0RA 5JDSA 1CF8L 4YC2B 2XI9A 3FQWA 4MSWB 3EW3B 4K07A 1I9IH 1OP5K 1QSVA 4U1MB 3V7AE 3W9EA 4OLXL 1RUAH 4JG1L 5DD5L 1LHZA 3PWPD 2A83A 4FNLL 1S3KL 4LLVB 4C56B 4DEPB 4HULB 2DQEL 3MLWL 1KENL 4C59B 5D7IA 5AYQA 4K3EL 3FT4B 1ZA3A 4R0LB 5AG8A 4J7RA 3T09A 1NGWB 2R4SH 3K0WA 4P5TC 3PGCB 3MV7A 1K5NA 2PXYD 4M7KH 3T0VA 3RWEB 3DHJA 4MNGA 4KK5D 4P4KD 2IANE 4I1NB 1D5IL 3NIGE 3O45A 1S7TA 1RUPH 1UWXK 3LPFA 2Y06L 3DIFB 4XNMB 4IRSD 1B0GB 5F7WC 2LFGA 5K59E 5JW3L 4ONHA 1TZIB 4P4RA 4D2NA 4NM8H 1I8IA 4H8WH 3VXPA 2R56H 5BZDB 5TQ2H 1FJ1A 1YYLL 1UVQB 2JB6B 2NZ9C 3EJZC 3BZEB 4OJFH 1WT5A 2DBLL 2DJ4A 3CD4A 1B4JH 4P23A 5EBGA 3D18A 4HLJA 4KDWA 2ITCB 3BP5A 5JTWA 3LKQB 5L8KB 1R3KA 3JBG7 4ORGA 3RNQA 5HDQH 4JO3L 4MAYB 2WIMA 3ZMRA 4PD4J 1KXTB 5MENB 1VACA 2XTJE 2ICWA 3D39D 4NQDD 3L7EB 1IGFL 4KJYA 2XOTA 5F9JA 4R0LC 5GGQL 1Q9WB 4DAGH 1VERA 1J86A 3IJYA 3WHXA 3IDUA 3VWJA 3N1QC 4PPTA 1AKJD 3DVGA 3T4YA 4OZ4A 1ZA6B 3MUGB 5D1XB 4H1LH 3HNVL 4LLDA 3E3QE 1MJ7H 4B0MM 3MBEA 3DARA 1MJ7L 2OQJB 3L5HA 5EU3A 4KJPC 1BAFL 4DN4L 1GXEA 4G7YH 3FFDB 4MCYB 5J13C 4JZJA 3DRQA 5HHOD 1ONQB 1OTSD 1UCBL 2NY5L 5FHBL 3UX9B 3LB6D 5A2LH 5EZIH 2HRPH 4KGJA 1A1NA 2HTKD 3UYPA 1RU9L 4IS6A 4UQ2A 1KPRB 1UZ8B 4UV4L 4ZOCA 3GJEA 5HGHA 1A7OH 1A3LL 1JF1B 1UG9A 4WGVB 2OJZH 4NOBA 3L7FA 3TT1L 1MFCH 1LEGA 1IC4L 1N4XH 2FEDD 2R8SL 4OLUH 4JM4L 1ZK9A 4JKPL 1UWXH 1R3JB 5EC1B 5CP7A 2HT2D 1UQSB 1U9KA 2IADB 3DV6A 2IG2L 2UVEA 3LMJL 5ACLA 4EKXA 5J12C 4A6YH 1C7TA 1KBGL 5D96C 3X12A 3DX9A 3JTSB 4KKCC 3HPLB 4PFEA 2XQYK 3BKYH 3MBEB 3C09C 4YHZH 4D3CL 2DL9A 3OKDA 2HFEA 3TNNA 5FF6A 2X4OB 2F19L 2FB4H 2A0LD 4ETYA 5C8JA 3FN0L 3KPSD 5IHUL 4OTXL 1P4LA 1KCSL 3QIUC 4GH7B 5HJ3A 5F89B 1ZGLM 2XFXB 5GRZA 1TQCB 4JY5H 4PJEA 2RFXB 4WW2C 4YQXH 1OCWH 1G7IB 4JR9L 3SKUD 3QQ9D 1C16A 5IW6B 1E4XI 2B4CC 3OKYA 1FGNL 4WU7A 1F4YH 2AJYL 3LZFL 1PZ5B 1G1CA 1ZTXH 2K3TA 4MXQC 1EVUA 1QHPA 4L4TA 5F6HJ 5CLWA 3KPRB 3TV3L 1UYWL 2CMRH 4LHUD 1BBJA 1N6UA 2MPAL 2VXUH 1YDPA 3TBVA 2NX5E 2DM7A 1AGEB 2CQVA 5KVDH 2YZ1A 3GO1L 1F4WH 3FFCE 3GK8H 2XA3A 2YEZB 4JQVA 4OGAD 5GGRY 1M1SA 5ID0B 2V9RA 2YPLD 5I2IA 4KTDH 1NCAL 2HJFA 2CO7B 3D3VA 2VL4A 4MQ7B 3SQBA 2D7QA 2GJ6E 4CN1A 1I8LC 1JHTB 1BPVA 3MREB 5J9PB 5IROC 2YXMA 4JFFB 1FORL 2L4OA 1VADA 2J8UE 2CKNA 2HH0H 4P2OC 4YDIH 4XP9H 4AMKH 4YHMH 5I74B 4QT5B 4R4BA 2E7MA 2J6EH 5EUOE 1FRGL 2ZCHH 1F6AA 5DVLA 5GGUA 2YRZA 1I7ZA 3ULSA 1JGUH 2Z8SA 1C5DA 2FO1A 4LEXH 3QDJD 2CIKA 4Y88A 4O4YL 1LE5B 3RWHB 1DQJB 2X6MA 2H9GB 5EOTA 2VE6A 5LWYH 3TYFB 1WBXA 4XGZB 2CH8A 3QUYB 3BPCB 2OMNA 1LDPH 4M7JL 4D9QE 1U3HD 4Y1AD 5CKAA 4XXDA 1ED3B 1RURL 1K4DA 4JO2L 4OCMC 3ARGC 3H9SB 4MZ3A 1ZT4B 1GJIA 4LBEB 1KELH 2C3WA 3UBXA 3DVNA 3F58L 3RPIB 1BX2B 3OXRB 3G5XB 4QRTA 4RWYH 3TWCL 1CXFA 1NAMB 4KY1L 3U7AA 5I76B 1CE6B 1HKFA 3TJHD 4NP4H 3QEUB 4OCSL 4PTTB 4Z7UF 5IR1A 1MWAB 3QIBC 4LIQL 4NPYA 2X4RB 3WBDA 3VFWB 1WEJL 2C26A 4W4OC 4EN3D 1YMHB 5J11B 1NL0H 5IGXL 1DLHB 4TNVF 1NL0L 2B39A 5HGAB 5K9KB 3DETD 2E9WA 5HBBA 4UTBL 3WYRA 2MHAA 5E99L 1LO4L 3UYOD 1IFHL 4JQVC 2ZPKH 1KIPA 2EKSA 1KN2L 5JMRA 1JGDB 5GSRB 3WN5C 2VSCA 2MJWA 1NUFA 5MEPB 3HUJE 4PIRF 5FOBA 3DHMA 3TJEL 1HSAB 3QG6A 1BD2A 4XP5L 5MEQB 1RIHL 2MNUA 1JMXA 2EE3A 2PUQT 2BVQA 2GJ6B 3A6CH 4KV5E 5C3TA 3TBYB 3I50L 3WDJA 1LP9E 2IFFL 1UM5L 2WBJC 3OPZH 4PP1D 3QDHA 2K7PA 2CSPA 2FO4B 3PWVA 5T3ZE 5E2TL 1G9MH 1AGCA 1YJDL 4DQOH 2JJUA 4FQCH 2VDQH 5EORH 1A2YA 1SYSB 2EDRA 3ARYA 4YPGB 1QKZH 3T0XA 5MI0C 4KJQD 4WEBH 1S8DB 3O6FA 1G9NH 5TGBB 4K23L 3MODL 1C5BH 3LRGA 3VXSB 4CVXA 1NAKL 2W0KA 4PJGF 3HMWL 4QTHB 4KRMB 4J1UA 5C7XL 3ZKXC 4OUOA 4ZO8A 1XGYL 3HE6C 3BYTA 1KLUA 1N64H 2ZKHH 4FFWD 4C54A 1UA6H 4CKVX 4ZMAT 5FO7B 5DSCA 4NZUL 4KHXH 2PR4L 4L4TE 3VD3A 4S1DC 2YUXA 1A2YB 4O5LL 4R9HA 5CEZD 2HH0L 1JNHA 2XZQH 1Q0XL 4E9LA 5DJYA 2Y36L 2YC1A 4NBXB 3RUGB 2WWMD 1YECH 3DXAD 3FAXA 4KUCD 1NSNH 2NY3D 2DMKA 3WL9A 3QEQA 5A16B 5D6CB 3QI9D 4PJ5D 5KS9F 5T3XD 4I3GA 3FAWA 1I1AD 5DLMH 1ES0B 4JQIL 4XMPL 2BSRB 2H26A 2Z91A 4PJBF 4XBGB 4TUOB 5IHZB 4FFWC 4X7DC 4GRLA 5C0BD 4Z7WE 4CJ0A 5F7MC 2FGWL 2FZ3B 3SJVB 1EIBA 5D7SH 2XN9B 3A67L 4OFDA 4JDTL 1E27B 3O4OB 4HMDA 5ADOL 2C4XA 2DLFL 3RUGF 3U0WH 2AS5M 4UOW1 1T6WA 1KG0B 2CXGA 5FDWA 1PBYA 4M43H 15C8H 3LQAL 4KV5F 5FYJH 1TQBB 4MDIB 1BGXH 5FM4A 1I3RB 3QQ4B 3BZDA 3FRPG 2QSCL 3T08A 5I15L 2BMKB 4GXVH 4QRSA 4YHLL 1DUYA 5D93B 4JFYA 5LGJB 2AQ1A 4YDKL 1AH1A 4U33A 3FTGB 3QEQD 4LU5L 4TSBH 1Q0YL 4U6YA 3HZKB 2R4RH 1ZT4A 4ODUA 5DZOA 3QNXA 2L7UA 4H20L 5GJTH 4U3XA 1QD0A 4JZNB 4JFPA 4BQCA 5I1LB 4JFFE 4L1DA 2LU4A 1DE4B 2IALA 1JUFA 3BZEA 2BERA 3BSZL 2EH7L 1N64L 2ZKHL 1GGYA 2G75A 2MMXA 3DI3B 3CUPB 4PJ8A 1YN6A 1J7VR 2PYFA 4NPYB 3Q1SH 3R1GL 2YK1L 4X6EA 4WFHE 2J4WL 2D2OA 4KK6C 2VAAA 1B0GA 3SGJA 3HRZA 5ESQA 1KTKE 1YEJH 2QKIB 3RWGB 1JZ7A 3IDNA 1C5BL 4NKOA 3THMH 1IAIL 3D39E 3BRFA 1U8IA 2BJML 4IMKA 4JPKL 1Y0LB 2VISB 3P4NB 1IGCH 3SQOL 2D7TH 1HSAA 1W0WB 4LLQA 5HHQA 3PP3H 3F7RA 3VXME 4G8GE 3VCLA 2BDNH 3MRPB 3VMPA 1CIDA 3CFKB 3F7VB 4NC1C 1DJSA 5EG6C 4WW1B 1YY9C 1JGEA 1FLRL 2EO1A 2DYPD 4F7CB 5I73C 4KQ3L 1KSRA 3SE8L 2GJ6D 4HJJL 5BJTA 4U3CA 2VLKD 3GUTA 3JUZA 4I3RH 1E0OB 3ROOA 3N9GH 1PDKA 1FG2A 1S78D 2RBLA 2MTPA 4TSCH 4ZUWB 1TCMA 3IDMB 1K8IA 4QY8A 5I1HL 1XGTB 4PJ9B 4FP8L 4AEHL 3EDKA 5KSBE 2VLJE 2X70B 4JVPA 1MCPH 3MMEA 2ED9A 1A14H 1II4E 1T7ZA 6FABH 3FN0H 3MRQA 5IHUH 1U93A 4X6EB 4KZEH 3BGFB 3G5YA 3NZ8B 2YN5A 1Q72L 1T21A 4N0CC 3PXJA 1JHLL 3MGOA 3ZSSA 3CU1A 1RUKL 1G9EA 1R3IL 3SJVD 4WO4A 5DC9B 5MP6H 2XXMB 3DUSA 4M4RA 1A22B 2ICEA 1A1MA 1M6OA 1WQVT 4NSKA 1AQKL 3G6DH 1YNTB 4HK3J 4C83A 3KPPA 1CT8B 2ZUQC 3IDXL 4M1DL 1DCLA 1F58L 1SY6A 3LPWA 1DQLH 1QEWB 3EDEA 1GRWA 5IW3A 4YDLB 1YUHA 1RZ7H 3F7YB 4ZQKA 2YWZA 4K71C 2EDFA 4H8WL 3INUL 3TO4A 3UAJC 3DBXB 4I0PA 4WRLA 4QRPA 1T7VA 4ZFFB 3TO4C 1ZGLB 1BFOB 3I6KA 3VWKD 1JRHH 1LDPL 1S8DA 3O6FB 4KMTH 4X4YA 2OSLA 4GRLC 5I18L 5ADPL 3OKDB 1WVZA 1KIQB 3BQUC 5HDQL 4OZHA 4HK0A 3ZDXE 4WGWB 5D7JB 1G0XA 1RJLA 3BH8B 2VDML 2PW1A 5DS8B 2VL5A 4HKBA 3ZTNL 4GRMA 4R7DB 4GAYA 1A7NH 4WO4D 2QHLA 1AGBB 4PJXE 5L7XH 2C7UB 3IXTA 4NHCH 3GSRA 2ADGA 1GZPA 1FE8H 5DRXA 3DV4B 4RZCA 1KCKA 3BIKB 3RUGA 1R0AL 4H0HB 5DD3H 4X7TA 3I2CL 2ESVD 4PB0H 1OGAE 5FK9A 3IU3B 1FH5H 1V5JA 1WC7A 5GRYA 3LS4L 3TBVB 4UT7H 1AI1L 5B4MC 5C0FB 4LSPL 5GRJH 4PJAE 2H26B 2Z91B 2YD3A 4M8QA 3TBTA 4P2OB 1NMBL 1EEZB 4U6HB 3BD3A 2C7UA 4ONFH 3UTQB 3TIDB 1WT5C 4JFQB 1IRAY 1BFTA 1N26A 2AABL 2MCG1 5ID1B 4OCXL 3C5SA 3MLZH 4QHUA 3ZYOA 3SE9H 2J6EL 2XWJB 3O4LD 5EZLA 4OZHF 5BVJA 2W91A 2PYFB 4FQ2H 4RFNC 5IEKA 4W6YB 1EA9C 3KXFD 3OXSB 5D7JC 1YNLL 2GSIB 3CPLB 5JXAL 3A0OA 4OGXH 2VDNL 1MH5B 2V9QA 5CZXD 1KPRA 1UZ8A 3MV9A 2HTLD 5D7SL 3VDBA 1I1FB 1UM6L 2WP3T 3KPRD 2ZWLT 4X6CA 2IMMA 2AJVL 2ENYA 4R4ND 1SJVA 1J0IA 5GGTL 3TJHC 3QFJA 1HOCB 2H32B 3VCLB 3VG9B 4Y5YC 4N8VG 2OI9B 3RKPA 2NXYC 3TCLB 5JZ7C 4H88L 1OF2B 2I5YL 3BKML 4HS8H 3MRGB 2DYPB 2VKXA 4OTXH 1T5XB 1JGLH 5DD5H 4PJXA 3V9FA 4DOHB 2A0LC 1I9IL 3PP4L 3HC0A 3MLSL 2H1PL 3CSGA 4F7PB 2M26A 5D2NB 3BZ4A 1TZGL 4IRSB 5B38G 3T65A 5IWLA 3ILPB 3NA9L 5LAXA 3VI3F 4F2MA 4TVPD 2HLAA 3QULB 2AJ3B 1EBAA 2W1NA 5IM7A 5ICXA 5JHDB 4LCWB 4Z5RA 2YRLA 2ENSA 2FHBA 4OBSA 1X44A 2AVGA 4F8TA 1IAII 5IVXE 3P4NA 3LDBC 1A21A 3MFGB 4UINH 3ZE0F 4ELME 5CILH 5GPRA 1U2HA 2BNRA 3VFMB 2OTPA 1FBIL 2VLJA 5FUZH 5FOJA 2ZCKL 3W2DL 4GW4B 4LKXB 3GM0A 1JPFB 3VXUD 5HGAA 4BSWB 1Y18B 1HXYB 5F88B 2AGJL 3MNZA 3O0RL 3FQUA 4A6YA 4NC1E 4NO0B 3CFBB 2EDLA 5D7KD 3DVIA 1C08A 4PR5A 1GGCL 1JP5A 3QUXB 5C6PB 1CD0A 1VGKB 2DDQH 3QPQD 3V7MA 2VDPL 2ARJA 2ZSWB 4LHQB 3RWCB 4PJFA 3C6LC 2FATL 1QSFE 1QQDA 4ETQB 1MPAL 4QTIH 1PZUB 4RSVA 4RRPA 4F7EA 4XHJC 4K94C 5K33A 1T1WB 4XRCA 5D9SB 3SBWC 3U46B 2F5AH 1RJCA 2EIDA 2OTUA 3HC4H 4MMXC 1P7KB 3VWKA 3DTXA 4OLYH 4OV5A 5KOVC 3V5HB 5TJWK 2QQQA 4IRZL 3J8F7 4ZO7A 1FNEB 4MLSA 2YSSB 5MEND 1BQUA 1I3VA 2ZUUA 2X05A 3VD5A 1NC2B 2B8OT 3KG5A 25C8H 2JELH 1S5HA 4LKCA 5C0AB 5LVEA 2B1AL 4Z7QF 5LGKA 1A3RL 4N9OB 3B9VA 2J2ZA 4F37K 1YEGH 3DPBA 1BREA 4IOFC 5B21A 3BUYA 5BS0A 3X11B 1H3XA 2GT9A 2NLJB 1QSFD 2ZOKB 2F74A 4PJAB 2D7TL 2H8PA 3QDGE 1YC8A 3MLZL 4HS8L 3BKMH 1CK0H 1A7QL 5DEGA 2Y06H 2WIIA 1QSZA 2XICA 1XEDA 3E6FB 3MSPA 1ZHBB 2KQNA 1YEIL 4WI8A 1I7UA 1PAMA 3H3BC 5DTFA 1UT9A 3QI9A 4YDKH 4JQXC 4P2RB 2YR3A 4Z0BH 1U6AL 3LEXA 5E1AA 2FX9H 3QNZA 2IPTH 3N9GL 4X5XB 3OZ9H 3TBWA 3SGDI 3DOSA 4Y16A 3IDYC 5BZWA 4HGWB 1J5OL 2CLRB 3U9PH 4N8PA 4LHJB 4XWGH 1L6XA 4OI7A 5FKAA 5KG9B 3VFNA 3QUMH 5C07A 1MPAH 4QTIL 1PY4A 1KCUH 2IJ0C 5FGBA 5EO0A 3PWPE 5IEHB 5C08A 3QRFM 2OP4L 4RNRB 4BUHA 3MRCB 3TN0C 5C0EB 3VJ6B 4JKWA 2KZ1B 4FA8A 3WUWA 1CFQA 2WAHA 2AEQL 5DQ9B 3IFLH 4MJ6A 4YQXL 4GW5A 1WFOA 2IF7A 4RFOH 5D70H 5B38B 2DM4A 5FCUH 2BDNL 4KAQL 2AXGA 2J7LA 1ZLUH 5CBAA 5GZNC 3T2QA 3VFPA 5FGBC 1A6ZA 3ULUH 1MLBB 1XCTA 3E6HA 1JWUB 4OD1H 4NHCL 3VI4E 3UBXG 4XVTH 1IEAA 2JIXA 5I6XC 1KLGA 4CU7A 5JW5A 3SO3C 5HYEA 3ZHDA 4TSCL 1AJ7H 4F7CA 1JWSB 1UADC 4GKSA 4TULL 4RIRA 2EIEA 2Q6WA 4DGIH 3BXNA 1RVFL 2DWDB 4M6OH 5D7KE 3BVNA 4FS0A 5AYUH 4DGIL 1CGTA 3KPOB 2JK5B 5E5RB 1T5XA 4P59H 4EUPG 3QQ9C 3QXAB 5T5NG 4NHUB 3QQ3A 1P4BH 1NGXB 1PLGH 4LSTL 1TZHB 5M7QA 1OQOA 2GK0B 3G6AB 2N1KA 2ZCHL 2V2TB 2NCMA 3DVNB 1G0DA 4LCIL 4WW1A 3I02B 4YC2C 5CEYB 4S1DD 2NNAB 8CGTA 1CYGA 2O5XH 3GI8L 4NNPH 4HZAA 4LCCA 1R3LA 3KYAA 1T1YB 1RZKC 1FNSH 3RDTB 4ZPVA 2P8LB 1ZVYA 2DWEA 1KLFA 3KYOB 3MV11 4MJIB 1LDSA 5F7EL 3QNYB 2VLMD 5F6IC 3F6LA 5L6YH 3W39A 4LLYA 2V2XA 5CSBA 5E6YA 5ACZB 5I66A 5TDNB 2GTZA 5ANMA 5I6XB 1Q72H 3G5VB 1NFIA 2HKFL 5ITFB 1AR2A 4PJBA 5IMMA 4C57C 3CJJA 4EUPA 3ARWA 3FB7A 1IKNA 5HYSB 2LABA 4ZAKC 3GSUB 1T7WA 2AI0H 4Z7WF 1JFQL 3GSWB 3BWUC 3RZCB 5EPMB 1ACYH 1A7PH 3MV01 4XXCC 1INDL 5GGVL 1A5FL 5EIIA 2XNAB 1CVRA 1HZHL 4NRYA 2CK0L 1R24A 4HUVA 1HZHH 3LD8B 5CIPH 2KKQA 1F00I 1I4FB 4G9FA 5B3NA 5LKNA 1B90A 3WJLA 5I1GL 2DM3A 1QO3B 3QDMB 1T66D 5CAYB 5TDOA 4R3SB 2VR4A 3MLVH 2Z31C 5FHAL 4NKQB 3UPCA 4MB4A 3V8CA 4PGJA 1NC4B 3WDIA 4TVPH 2W0FA 4LHUB 3M8OL 5E6ID 1IGFH 5A2KH 1MRDH 4XNXL 1WISA 4ZYKB 1YDPB 4X4YB 1L7TH 4PGEA 5I1LA 1AHWA 3UTZA 4NKMB 2DQCL 2QADB 3NCYS 1B0RB 5KVFH 5J06A 3QFDA 1XF3A 1BBDL 1G6RA 5FECA 4JRYA 3QXTA 1YNKH 1NGPH 3MA7A 5DRXB 4JN2A 3EJYC 3S96A 4NC2B 1FFPB 3C6LD 4OGXL 3OPZL 4M1GH 4C56A 3EOTL 5DRZA 1QNZH 3AS2A 3FMGH 1J0HA 1BMGA 4GAJL 4PRHA 5DK3A 4OD1L 2ZCKH 3UBXI 2X44D 4HIEB 5EU6E 5E8NA 2A77L 4KVCL 3UTZB 1N5AA 4OI9A 3WCYA 3KLAA 2W9DH 3BD5A 1OSZA 2DQDH 1FZJA 4OQ1A 2AXJA 1XIWC 3UO1H 4YHPA 3L7FB 5CEZL 4PLKD 4APQA 1OTUD 4HGWA 3S96B 4RDQF 2PKDA 1MAKA 3C5SB 4QHUB 4X7SL 4WHTA 3CC5B 4XPBL 5E8PB 4Q58C 3UTOA 4LNRB 4B7IA 3OKNA 1GCFA 3LKNB 3KPQB 4PS4H 5C0BB 5J12B 3IRZA 4MNQE 4RMUA 2P42B 4K3EH 5DF0A 3S4SB 2VLRB 5EO0B 4R90L 4ODHH 3OX8A 4LDOB 4XHQA 3RAJH 5IOPA 4YXHH 1V7NL 4F15C 4GXUM 1BIIA 3DVFA 1M7XA 2WLYA 3VFOA 3QFJE 5L2KE 1I9JL 1ZVHA 1J88A 2FSEB 1HIML 4YIQA 1OAZH 2YPVH 3MRMA 3T2NH 3K80A 5IBUG 4ZS7L 4O4YH 1FO0A 2NZ9D 3L9RB 3G6JA 1RUQL 5CBAB 4YHOH 1A5FH 3QG6B 2FEEI 3RIAF 1MCRA 3WKML 4JFXA 1NMAH 4I4WB 3O0RH 5D1XD 4K94H 4HFWA 4PJ8C 1NCNA 1KN4L 4BYHA 3NIFF 2NQCA 1I85A 4DKDC 1G7HB 5TF1H 1H5BC 4Y19D 1SVCP 2GTZB 2XQYG 3JXAA 1DR9A 5CCKH 3QCVL 1FNFA 2A6IB 1WBYA 3LDBB 2IAMB 4PTUB 3O8XB 3SGEI 5GS1A 1OQXA 4HJ0D 1FAIH 4K3JH 5GISH 4UINL 4IJ3C 1TIUA 4M7LT 2IQAA 4L9LB 1I1AA 1MEXH 3RP1A 4P2QB 1X5ZA 1T04B 3ARZA 3EOAB 4WTZA 1H15A 4ZUUA 3MO1A 2Z93A 4HH9B 2NXZC 2IBBA 4XHJD 1BF2A 3G6AA 3G08A 3PJSB 2DLIA 4PLNC 3D0VA 3D2UB 3LQZB 4NJAH 4KJWD 4M03A 5T5FL 3TO4D 4OSUH 3UZQA 1PSKL 3TGXA 2H3NB 5D2LB 3UAJD 4JM2D 4X7SH 5IESL 3V52H 4ZUVB 4POZD 5D72H 3CFJA 1YEJL 5GZOC 2N4IA 3MNZB 1CXIA 3A6BL 3FO2B 2A9ML 1HEZB 5D1ZB 3FFCD 1FL3A 2IQ9H 1MRFH 3ZDZF 1NUDA 5ERWB 5E8DL 4Q9RH 1J11A 4JAMA 4O2FA 5JR1H 2C1OB 1FYTD 5ENWB 5IMMB 1VFAA 4WO4C 5DLML 2BC4A 1A1OB 3KR3L 1GSMA 5F7KC 1LMKA 4AH2A 12E8H 4WFGE 1NJ9A 1ODAA 5HHNA 2VZVA 3MBXH 1HEZA 4WFEE 4AEFA 4P4RB 2WMPA 1A8JH 3OWEA 5KN5B 4H88H 4OIIH 1MFBH 3MV8B 3ARFD 3O41A 5JA8B 5HDBF 5F7DB 4HUKB 2ADIA 4UT6H 1RHFA 1SEBB 2YPKB 3S98A 4M6OL 2NX5A 4FNLH 1GPOH 1F45A 4DN3L 1IAKB 3QUYD 3VDCA 3WO4B 1ZHNA 3FB5B 2HT3D 3QFJB 1GOFA 2DD8L 1JNJA 5DQJB 2ICES 3MR9A 5E5MB 5GRVL 4ODXA 3U4EA 4K55A 2NTSP 1KEGL 4HUMB 2BNQA 1VSCA 2R4RL 3U48A 3ZO0A 1VHPA 1CTOA 1FSKB 1NCBH 4HSQA 3RY6C 4Y4KB 4PJXB 4JLRB 4M5ZL 5JPNA 1X6LA 1EHAA 1XF5A 3PE9A 4PRPD 1J8HD 2R0WH 3FQWB 5CILL 1E27A 5FV2A 3VFUA 2NY2B 2WIIB 3WNLA 1XGUA 3NFNA 3BZ4B 1J05B 1OB1B 5E0QA 4O02L 1AY1L 5A2IH 5IVNA 1WWWX 1J18A 2Z92A 4DCQA 2QJDA 1S9YB 2FR4A 1QBML 3PWUA 1HK6A 4PJHF 5BQ7A 2P24B 5E1AB 1ND0B 2N7BA 1YJDC 4S11A 3C60C 1E6OH 3KPSA 3R4DA 4KXZH 3SDDC 1UM5H 4PRAB 2R15A 1JNLL 2WBJB 3EZJB 1AGDB 4PG2A 4TUJB 4YNYB 3QDJE 4FQLL 2BSTA 2R2CA 3E1F1 3S36L 4HQQH 1MLCA 1QR1B 2ZOLA 5C0IB 2LTQC 5GSVB 3EYUH 1NKRA 1U8MA 4NCC1 5ID1A 3IXAA 5GQBA 5IEHA 1R6VA 2QSCH 2R39A 2V7HB 1X5KA 1B4RA 3H8NA 5IV2A 4AEIL 4BFGA 1EVTC 3T0BA 3L95A 4WFGD 3V4UH 1FIGH 2XXCB 3VE0B 3O3BB 1Q9LB 2DL2A 3BN3B 3H7BB 4HH9A 3ZT7A 4KRPC 3MXVL 3VJ6A 5JOFB 4P46D 3QUKA 1GGUA 4X6CB 4XAWL 3P9MA 2MHAB 5CMAB 1BX2A 1WFUA 2R1XA 4DN3H 3SCMA 3OQ3B 3FRUA 5LCVH 1OAXH 3AREB 4PG9B 1RJYB 3GJFH 4P57B 1SEQH 3ZDZE 4YXLL 5MHSD 3QUXA 4JZJC 1RULH 1F2QA 1XR8A 4XMKL 2D4DA 1JI1A 3O9WA 4MXVE 2DQCH 1HQRB 1YECL 4GKOA 3RI5F 2DLTA 5J57B 5E2WL 3OF6A 5EA0L 4ZXBB 1OL0A 1AXTL 5C0AE 4Q6IA 1IKFH 5EA0H 2NYYD 4PG9A 3Q3GA 4L4TD 5F7NC 5FM5M 1H3PL 3VGGA 3U36A 3DROB 4N0YH 5EPMA 1OSPH 1QFOA 3NZ8A 1FNEA 3DO3A 3QDJA 1GGTA 4HPOL 1UKQA 4R97C 3CXHJ 3OZ9L 4G6FB 4QRRD 1OM3H 5HD8C 4KI1A 1LEKB 4R8WH 1IBGL 3RJQB 4AH2B 3IKCB 2DQFA 2C1PA 3IDGB 5DJDB 1WZLA 3T77B 1ORSA 1IFHH 3H6JA 1Z9MA 3HAEH 5TDNA 2E9BA 3ARBB 3TH4T 3PABA 4X6BB 4LU5H 4TSBL 2Y7QB 1MJUH 4OT1L 3RVXC 5DD6A 4MLIA 2AEWA 1KJVA 3C6LA 3VU2A 2W0FB 4LHUA 5SV4A 4M48L 1JMZA 5F8RC 5GZOD 5KVGL 1OGAD 1FV1A 4U05A 2OL3L 5I8CB 1JPTH 1G7MA 3KPMB 4I77H 5EIQA 4JZNA 1OP5H 5GGUB 4RX4A 3I75A 4PJBB 1JNNH 3X13B 4I0PB 4KRNA 3MR9B 4TTGA 3ULVE 1N59A 4LPXA 1EJ6A 3H9YA 1M05B 3VRLE 2NW2A 2GITB 5FHAH 1QKZL 1J05A 1OB1A 3QH3A 3HA0A 1KB5H 4TVPE 2R69L 1WJ3A 2VAAB 4FTVB 4Z7VE 4JY5L 5CBEB 1H0DA 1DBAL 2E7CA 1KGCD 2FJFB 5C9KA 3UJIH 5LBSH 4MB5A 4U1KA 3MV8A 3WEXA 4QXGL 3UJJL 3TM6A 3RIFF 4OZFB 3SJVA 3WNKA 2R0KH 4XP4H 3QB7C 2AXFA 2VUYA 4G42B 1FFNB 2EYSB 2YOCA 3GSVA 3ZT6A 4PJHE 5GGTA 3UTTE 2KUTA 4Z78B 1XIWB 5LXGH 4PV9A 5J1SC 1J1PL 4MDIA 4ODWA 5A2JH 4XCEA 1XGYH 5FKPB 2R8SH 1AO7D 2LAAA 4YEEA 4Q2ZA 1MAMH 3BT2H 3DIFA 2QEJA 4XNMA 5E6ZA 4BSJA 3M45A 1E4JA 2F54A 4HLZH 1RJYA 4PJBE 1MFBL 25C8L 2JELL 1JPSL 4UUJA 3KNBB 5C2BL 4U7KA 1ND0A 1NGZA 4OZGE 3QIBD 1QLRA 3DECA 3REVB 3MBEC 1U2CA 5DZLA 5T1KB 3ZSTA 2Q7YB 4LSQH 3F12B 4OGYL 3VI3E 3FTGA 3RX8A 1EFXD 5E9DA 3QDAA 4WHTB 3NTCL 4H1LA 2Y6SD 1UYWH 2CMRL 3NCFB 4HKJB 3PDGA 3BIAX 1P7QB 5K9QI 1ORQB 5EZOH 4OUUA 2BCKB 1GHFH 3GMQB 3P77B 3NCEB 3QEHB 4KK8C 3AY4C 2WQ8A 5LWYL 1AXSB 3G6JE 3MRBA 3G04B 3TBSA 4CUCA 2AJUH 5ISZD 2IPTL 5JDJA 1ZGLA 5HSFA 4L3CB 1U8HB 5ABDE 3AB0C 5D1QD 3LH2H 3KLDA 3HCVB 2XA8L 3FQRB 5HYFA 5KTEL 2CUMA 1JPTL 2FYYA 4I77L 4FZ8H 4NO0D 3D85A 2F53A 4MXVF 2YD8A 1VCAA 2LU7A 1WBZA 4PUBL 1F3DH 5JOFA 3CSYB 2XN9D 4D0CB 5IB2A 1Z9SA 3MRDA 4W4OA 4S0TD 4DKFL 3BVNB 3FQXA 4OCNC 5J8OA 4HWNA 3CVIH 4WUKL 4BK5A 1H9VA 3I50H 5DT1L 2YKLL 3OF6D 4XAKE 2ADFL 3RGVC 3BIKA 4EDXB 1RK0B 4PBXA 1DLHA 4FQXA 1JF1A 3ESUF 1A6AB 3QP3A 4FHBD 4M3JA 4RGND 1D5ZA 1VENA 5ESAB 1QVOA 4JFHD 2OTWA 1TITA 3FB6A 1GL4B 4XPAL 5E99H 1KIUA 3SDXB 3EZ8A 4AG4H 3RU8L 1Z5LA 3DX9B 1QBBA 3GMRB 1JTTA 2ZJSH 5D7IF 3CDYA 4UDTA 3B8SA 2ID5A 2P1YA 1F42A 5DJXA 1A7OL 3WLWC 5IMKA 3E3QC 1Z3GL 1FO0L 1C12B 2HVJB 2JTDA 4MCZB 3KDMA 1YNTA 2BHUA 4LLYB 2BVOB 3JVGA 4WEUD 4EEEA 3W0WD 5AUMA 3DUSB 3FZUC 2P5WB 2VZ1A 4O00A 4HIEA 4F9PA 5HDBE 1NMCB 3S6CA 1T1WA 4BJLA 1HSBA 2H3NA 3D6GA 5CHNB 3OL2A 4OF8A 4EUPB 2CO6B 1BOGA 4XXCA 3DJ9A 3MYJB 5F9OH 2C4FU 4Y19A 5I71C 1DDHB 4WEBL 1JL8A 4PY8I 4Y2OA 3VG9C 4Y16B 5TFSH 1CLZH 4MA1B 3C60A 4D3CH 1XGPA 1KCRL 3ARGB 2CR3A 1K6QH 1AXIB 4PJDA 5IBLD 2I07A 5H35B 3PGCA 1MCDA 3LQMA 4CMMA 1S9KC 1XR9A 3HI1A 2XY2A 4XPHH 4GKZA 3T2OA 1RQ5A 3U2SB 4M9PA 5JIPA 2WUCL 3OR7B 4HCRH 4HKZB 2DS4A 1M7DA 4EDWL 3RZCD 3CH1A 2X1OA 5IJVB 2FX7L 4R3SA 3ELAT 2HVJA 1JRHL 4ODWB 3ARDB 4PRNA 3GRWL 1KNOA 5AAWA 2ADFH 4MQSB 2ERJB 3PL6A 3B2UC 3HUJF 3HG1A 5DDHB 3G6JF 5IMOB 2NX5B 3G6JB 1NEZA 3CFDB 3O2DA 3B6SB 1CLCA 3TLRA 1PG7H 5DUML 4NM4L 1F58H 3WFDL 1QA9A 1U91A 3WSQL 4KTYA 1JYWA 4WU5A 5GRXG 2VZTA 5FUZL 4DFHA 1UJ3A 4YHIB 2BNUB 4OIBA 4XPTL 5ISZB 1CXLA 4DK6A 4PV8B 5IF0B 5DVNA 1J0YA 4HV8A 5J1AA 2Z4QA 4NRXB 4G6ML 4WFFE 4EQ3A 4JJ5B 2APVA 2P45B 4M43L 3ULSB 4HKXB 3M17B 4P2CG 4NN6C 1SBBA 5E9DE 5EDXA 3K4ZA 4AMKL 3EKCA 4UV7L 4YPJA 4U1GC 3ZTNH 3QUMB 3FQRA 1KULA 5I0ZA 4JKLA 4OLWL 4U1IA 4BH7B 5TQ0H 3JTTB 1RZ8A 5C8JB 4BFIA 4Q9RL 1K3ZA 4HAFA 3QIWC 2EDYA 4KDTC 2NY0C 4LEXL 2DYPA 3MRGA 3LIZL 4L3AA 3FOMB 4IM8A 4U2ZA 4TQEL 4A2MA 1PX3A 3P3YA 1Z0NA 4HKJA 4OZHE 2EEDA 1FN4B 1S7RB 2IAMD 5CZVL 1HHIB 1BFVH 1XZ0A 3RNKA 4DVBA 3TCXA 4G9FD 2X7LA 2EICA 1UH2A 3PWLB 2RR3A 3MRMB 3WHE0 2O61A 5LXGL 4LCWA 4N90E 4NFDA 3EJZD 2DQIH 2DI9A 4Z76A 5B8CA 5CD5C 5DMKA 1A9BB 3OKLA 5GRUL 2NY3C 2FYYB 2B0SL 2E7BA 4MDJB 3B2VH 5C86A 4LSUL 1UWGL 5MI0B 3MLSH 3ARTA 1RHHA 4W6XB 3C8DA 1LEIB 4BELD 2YD5A 3MRNA 5FB8A 1UACL 2OTUB 1AO7E 2Y07L 3I6GA 3W0WB 4WJ5B 3ZYJA 1U8PB 5T1MA 5F70A 5C0CA 1KB9J 3W11D 4JHZA 1CF8H 5I1DB 1RZJH 1MCOL 2UWEE 3PGDA 4JZOA 3P11L 3ES6A 3Q3GB 1RIVL 2DTML 1FQ9C 1FFQA 5KSBB 5F7EH 4PJIE 4DZBB 4Y4FB 4LRNL 1HH6B 3K81A 4Y4KA 4NFBA 2X4OA 2RIKA 4OF6A 1C08B 4U49A 2H1PH 4Y5XA 5DUPL 5JXED 3LHPL 1HYSC 2A1WH 4XP6H 2GHWB 3C5ZA 4HJGB 3RWDA 4U6VH 4NBZB 3WHE1 5J1TC 3T0AA 1LO0L 4HC1A 2P48B 3WUWG 5T33L 3T8XA 3V7AG 5JOEA 3BEVB 4IRJC 1JV5A 1VFBA 3BD4A 4QNPE 2Q3ZA 4LLWA 1FZMA 5GIRB 1ZEAH 2HJLA 3KS0J 1A7BA 1EUTA 1NC4A 1NDMB 2JB5H 3B5HA 3SO3B 4Z18A 3V6OE 1VPOL 4KK6D 5D7LA 3MRLA 3EFFB 4JHWH 3TBWB 3TA3D 4DTGH 2GT9B 3B6SA 5I19H 5I75B 1P69B 1K4CA 4FFZL 1DBML 1LO3L 4JGMA 4OLUL 4QOKD 5EBLA 3WXWL 1U3HA 2FJFA 5CJQL 3GMOA 5J1AB 1MWAA 2X9XA 3G5ZA 3GB7A 3OAUL 5JHDE 2O5ZL 2IG2H 1UB6B 1KPUB 1FORH 4L4VE 1KJ3L 1EJOL 3VD7A 4JCLA 5EO9B 5IBLC 3T65B 1IGYB 1B3JA 3VRIA 1PYWB 4AT6A 2IBZY 3V5KB 4LAQL 2YN3A 4JANA 4GXUN 3BP4B 4P5TD 1JGUL 2W65A 3QUMA 4GMSL 4Z78A 1KENH 1MFEH 3MV7B 2J1KA 3BQUA 1TMCB 3LRHA 4OLEA 3QZWG 5D4QA 4LBEA 4KQ4H 3X14B 3GRWH 5I66B 5BRZD 1H3GA 3OJDB 4XCFL 4M7ZC 1U8JB 4P46C 1YEGL 2HN7B 3L5XL 4UB0L 1EAJA 3RWIA 4YBQC 1O0VA 1NBQA 4Y7MA 2FJGB 3FONA 1ADQA 1V05A 2DQIL 3STZB 3IT8D 3RWFB 3ZKMC 1YQ2A 1PG7L 1X9QA 1NUNB 2HFGL 1ZHLA 1S78C 2MOVA 2VE6B 5EO1A 3VMOA 5GS0D 2VDRH 3TPUA 1ETZB 1NCWL 1NGXA 1MELA 1KCUL 2ARJB 1HQRA 3SKNA 4IDLA 2BP3A 1WGOA 3LKOB 1FCCA 3TVMD 1FL6B 1FE8L 2CDFA 3PQYD 2Q86A 3MOQA 4ODHL 2QQNH 3IDGA 4NP4L 3T4AB 1I8LA 5KVGH 4K3DL 3UPRB 2X4NA 4P4KB 4JPIB 3VXUA 4PB9H 4YHKL 3BKYL 4Q9BA 4WV1B 5EUKA 2JIXD 1MWAH 1IEBB 4P3DA 2FNBA 3EIFA 1LO5A 4JY6B 4XZUB 4V1DA 3BDYL 1TXKA 2YC1B 4QKXB 3OG6B 5HGGS 2CDEA 1MQ8A 4FQ1L 1E4XH 1G7HA 4GRWH 1AY1H 3BGFC 4NKDB 5JW5B 1O7VA 3OR6B 4PLKC 1DBJH 3Q0HA 4ONFL 5F3BA 1QRNB 4UU9B 3O6LL 3P4MB 3HR6A 2AJZB 4Y2DC 5I8KH 3NPSB 5DHVA 4L4TB 1N6VA 2IFFH 2VXTL 1IGCL 4M7KL 1AO7A 2A6DA 3UJTL 3I3EA 3SBWA 3UTSB 3HCVA 3U1SH 3T0EE 3TV3H 2FRGP 4XCNA 2FATH 2NY1C 1TCRA 3MZGB 4Y5XB 4TN9A 3PQYA 2V2WB 5SWQA 2VC2L 3SE8H 2PO6A 1I7UB 3NGBB 1IM3A 5C07E 3D85D 4RGOH 3PWPA 4FQHA 4MD4A 2ARWA 1X7QB 5HI5D 1C16B 5IW6A 2IAMC 4AL8L 3F7YA 2PN5A 1CZ8H 2WUBL 2ZSVA 1A7RL 2OQJA 3BDBA 2IAND 1UWEL 2WSKA 3SDCC 2Z35A 1FCGA 2WUCH 3F8UB 3W0WE 4HDIA 5HHVH 4I18B 3TWCH 5F3BB 4UNUA 3OB8A 4KHXL 2WBWB 3OG4B 1OAQH 1KB5A 4XBEL 1MCKA 5IJKC 3QAZC 4F9PC 4I48B 3FN3A 1GZPB 3MA7B 1J1OH 1OWRM 5GGSB 3ALPA 4HAGA 1PY9A 3QEQE 2PF6A 3PHQB 4QXUL 1H3PH 3W2DH 4NYLB 5I1CH 4YO0A 4PJHB 5C0AA 4MNQD 4S1RH 2H41A 4JGUA 3R0NA 4OBRA 1VKXA 2ITDA 3S35L 1JPSH 1WEJH 4MQXD 3HE7A 4WW2B 4KKBC 4LPWA 3RY4A 3UCRA 4CU6A 5GS0H 1DEEB 1EHLH 2ZOLB 5GGTH 2VJXA 1OHQA 3KHQA 2ICCA 4HZLB 3WD5H 4NQVA 4J2XA 4DFIA 1RZGA 4OAWB 3HI1B 1W72H 4MA8H 2YMXL 5FA3A 4Z8FL 1G9ML 3QEUA 1KC5L 3JWDL 4BZ1H 4QHLB 1DBBL 1TJGH 3KXFB 1EPFA 4JCMA 1C5CL 4OM0L 1UZ6E 1RJZA 4NQEB 2F53B 2R29H 4Y5YB 3SKNB 2Y23A 3O2WL 3LCYA 5FCUL 1E4WH 5KS9A 1FC2D 4I0PD 1KFAL 1RZ8B 4KI5F 5HXMA 2VLRE 1B88A 1N6QL 2UYLA 3LAFA 4MNQA 3O9WD 4M93B 4WFFD 1FVEB 4GAGL 4JB9L 2D0GA 4X5WB 2EYRA 4UTBH 1EFXB 4P2YA 3B3IA 3GMNA 4MAYA 1RK1A 3U9UA 3D0LB 3B5GA 4AYFA 1U91B 1DBAH 4JRXD 4UV4H 3ECBA 4KKNA 4OD3H 4HV8B 3GSNB 3NACH 1J8HB 1G1YA 3IKKA 2VWEE 2XKNA 2F5AL 2HMIC 1BVLA 2I60H 2UY6A 1F4YL 2AJYH 3D39A 1JE6A 5KJRH 1Z5LB 5JIKA 1O7SA 3REWA 2F54B 1MFEL 5FA3B 4KZDH 5HDOA 1UB5B 4GG6E 1TPXB 2BZDA 5MEOA 3GIZL 1BQLH 1YYML 1RK0A 1R5VA 3KDMB 1ZVSB 3L5XH 1ACZA 5AD0B 4HIXH 1LNUA 1KLGB 4TNWF 2EDOA 2JJTA 1S7QA 4I13B 1RURH 1FVCA 3NFSH 4E42A 5CSZB 5HYJD 2XWBB 3QUXC 3CVHB 3P9LB 2Q86B 4YHZL 3GMRA 3DSFH