2FJFB

Structure of the g6 fab, a phage derived vegf binding fab
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
223
structure length
218
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTISDYWIHWVRQAPGKGLEWVAGITPAGGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARFVFFLPYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light Chain of a VEGF binding Antibody
publication title Structure-function studies of two synthetic anti-vascular endothelial growth factor Fabs and comparison with the Avastin Fab.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 218
sequence length 223
chains with identical sequence D, F, H, I, K, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2006-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fjfB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fjfB01
4KK6C 4DJMA 3WFBL 4K8RL 2D31B 4HIXH 4GFTB 2CKBA 1S7UA 1FYTE 2IH3A 2W65A 2HJKA 1CN4A 3AMLA 5CLTA 3I6GB 1ZHKA 1K4CA 1QSEB 1QNZH 4TRPH 5DJ6B 4QRRA 3IRPX 1OAUH 5DRZA 5C6TL 1KTLA 4PLKD 5I2IA 4G42B 3MV7E 4XH2A 2ARJB 3BUTA 1UA6L 4AEEA 4P46A 3S3PA 3QFJB 4X6BA 3I6LD 4YHZL 3U4BL 3B8YA 3RWJA 4FTVD 2VNCA 4BQ9A 5MENE 2VISB 3MCLH 1QHPA 4MJID 5IGXL 5DA4A 2H9GA 4HUKB 1CR9L 1NGXB 1G9NL 4ZFGL 4OLWH 3MRBA 3OKDB 3DO3A 3G5ZB 3W2DL 3RIFK 4GG6E 5INDA 2NY0B 1E4KA 1X5IA 3ZKNC 5HVWA 4HKZA 5DI8B 4GG8B 1AI1L 3T3ME 4XWGL 3B4NA 1UH2A 2BNRA 4L3ED 4QYOA 3DV6A 3FB8A 1NLBH 1P4BL 2AEQL 3ARGA 2RGSA 3PJSB 5HHQA 4LBEA 2ZSWA 3KHQA 1IAOA 5F7LB 1D5IH 4XT1C 3L5IA 4LSRH 4LSSL 4L5FL 4DEPB 4KHXH 1FFRA 3PWUA 4LDOB 3UYPA 5CP7B 5JNYA 3WJLA 5I18H 4HWBL 3ELAT 4ISVA 1K8DA 3GKWL 2CKBB 1CICA 2EYTA 1T1ZA 3EJZD 1S7UB 2IH3B 2W65B 2HJKB 1QRNA 2Y6SC 4OF5A 3SGEI 3QNXA 3ZDYE 1K4CB 4JFFA 5E2VL 5F96H 1H5BA 1I1RA 4JKLA 4KJPD 4HS8L 4QRRB 5DRZB 1T7ZA 4K9EH 5F1IA 1KTLB 2OR8A 5I2IB 4GBXC 5TFSH 5FV1L 4XH2B 4FZ8L 4P46B 4FQIL 5AAWA 3ULSA 4X6BB 3KPPA 1XEDA 3RWJB 5I75C 4Z7VE 1TTUA 1P4LA 1J1OL 4NZTH 4LPWA 1I4FA 4YWGH 4LAQH 4EZMA 2H9GB 1XCTA 1IVLA 4R4NC 4AH2A 1MCPL 5D70H 1TFHA 1AXIB 3TN0A 3OJ2C 3U7WL 4LSQL 3MRBB 4KWUA 1UT9A 4HC1A 1FQ9C 4NUGL 5INDB 2PR4L 2LFGA 3RWCA 3V8CA 2F5AH 4HKZB 4OLZL 1RVFL 4LGPB 5I30H 1RZJC 3DECA 4M8VA 4OT1H 5I1LA 3CMGA 1G84A 2BNRB 3QG7L 2FNBA 1IAKA 2NZ9D 1HILA 4QYOB 3DV6B 3QQ9D 3FB8B 1X4ZA 3ARGB 2WLZA 5HHQB 2VQUA 2OP4H 5LCVH 4LBEB 2ZSWB 3K7UA 1IAOB 1BREA 3QEQE 4HK3N 1A3LL 3U2SA 3PWUB 1DEDA 1NFDE 3T09A 5JNYB 1K85A 3GHBH 1KOAA 3O41A 3TT3H 2GSGA 4ISVB 3WN5C 4JPWH 2QEJA 4IM8A 1K8DB 4DQOL 2EYTB 1CICB 3WE6A 3P2TA 1T1ZB 3NGBC 2OR7A 2N7BA 4P2QE 1JZ2A 1QRNB 3CVIH 4B53A 3U83A 3QNXB 3HE6C 3LZFH 4JFFB 5BV7B 2AEPL 4MXQD 1H5BB 3V0WL 4M62L 2CXKA 2V9RA 1A0QH 3KS0J 3PV7A 5F1IB 4LVOB 4KUZH 4K2UH 4ZS6C 4HQQL 1AXTH 2P49B 5HI3D 3ULSB 5IB3A 3KPPB 1KCLA 1YJDH 3QHZH 5JW4Q 5D2LE 5CLWA 35C8L 2WWMC 4BYHA 1P4LB 5KANG 3BZEA 1I4FB 1KULA 2EE9A 3OGOE 4MD5A 1XCTB 3LS5L 1NEZG 4AH2B 1C12A 3JWOL 3TN0B 4GKZA 4ZO6A 4LCWA 5JPMB 5AG8A 1T0MA 3DGCR 1Q9KA 2YD9A 2AJYL 3RWCB 5GGRA 1JRHI 3HE7C 4ONOA 2FX8L 2F8VA 5D1XC 5KVFL 4H8WH 4LK4A 3VI4E 1I1AD 4L9DA 3RGVD 5IROA 5I1LB 3NVQA 2NTSP 2CMRL 3Q1SL 1IAKB 1HILB 3HI5L 2X4RA 2X6MA 3X3GL 4HWEL 2IBZX 1JGUL 3E1F1 5C6WH 1VACA 1FZOA 4GJTB 1C16A 4OSUH 2PW2A 2UUDH 3MGOA 3U2SB 3V6FA 4F58L 5D1ZA 2IPTH 3ARTA 4QTHA 3O41B 3SY0A 1DQMH 2C9AA 2GSGB 3L7FA 1NBQA 3WLWD 2CK0H 4Y16A 4YBLC 3WE6B 2WK2A 3QDJE 4XWOC 2VWEE 4ODTH 2SEBA 3K1DA 5TH2A 3TNNA 4PG2C 4HIIA 4P99A 3BQUA 1FFOA 1AGCA 2DQCL 3NZHH 2OI9B 4I0PA 4N1EA 5J8OA 3TIEA 2MKWA 1OARH 3T65A 5IB3B 3QUMH 4PPTA 2XA3A 1M7IA 1KNOA 3STZA 2BOBA 3ZZ1A 1SBSL 4MLSA 4JLRA 4MD5B 2P4AB 3C2AL 4R2GD 2VL4A 1C12B 4GKZB 2WQRA 3MBED 4LCWB 1TJGH 4HEME 5IK3A 1R3KA 1T0MB 1Q9KB 4KVCL 1A7OH 1KFAH 3P9WB 4JO4H 2XG5A 2BNQA 5GGRB 4O58H 1NH6A 4GXUN 3WEXA 3OQ3B 2JJTA 1SBBA 3WNKA 4HH8A 2X4RB 5JDJA 3C6LC 6CGTA 5E1AA 2YK1L 4GRWF 4NM4L 5E99H 1VACB 1YEKH 1FZOB 1C16B 4L9LC 2M26A 2PW2B 2NCMA 2P42B 3MGOB 3QIUA 3V6FB 3LKQA 4X4XA 3DIFA 5D1ZB 4DN3L 4QTHB 2NY5L 3SY0B 1VSCA 1NBYA 3GBMH 3L7FB 2FJGA 3MRPA 4Y16B 1P6FA 1QQDA 4OGAD 4HJJL 5E70A 4X4YA 2SEBB 3TO4A 5TH2B 2CLZB 4Y0GA 3TNNB 2YN3A 4HIIB 5KS9F 3BQUB 1FFOB 1AGCB 1M05A 2FRGP 1S7RA 3I3DA 5IMMA 1NEUA 4FQ2L 4QGYA 4I0PB 2NY4C 5FM4A 3TIEB 1CGXA 3E3QC 3T65B 2PXYA 4DGYL 4XPFL 3O2WL 1M7IB 1KNOB 3STZB 2QADB 2BOBB 3QJFA 4P9HH 1OQXA 4JLRB 3BP7B 5FOJA 5FO9A 5IKCA 1SY6L 3INUL 2VABB 2XYCA 3HN3A 4KRNA 4JG1H 3R8QA 2EC9T 2XZAL 1Q1JL 4KJQC 2IADA 1LEGA 5IK3B 4D9QD 1LE9A 1DVFD 1R3KB 3MV8D 1M71A 4XAKD 4K23L 2BNQB 2Z31A 2VITA 1ERNA 1MFNA 1G9MC 3UMTA 3TJHD 2HFGH 3WEXB 4PJ9A 1EFXD 1IM3A 4MX7A 5DJAA 4GSDH 4NN7C 4TQEL 5C1MB 2ITDA 4CBPA 5DFWH 5E1AB 1X3DA 4IJ3C 1OM3L 2F5BH 4ELMA 1HQ4A 4Q6IA 4ZFOL 1NC4D 5CAYB 1YEGL 1GHFH 1Y18A 2XFXA 3NIDF 1A7PH 3MOQA 3QIUB 4X6DA 5T5FH 3LKQB 4X4XB 3DIFB 1K8IA 1IC7L 1S78D 3G6JA 5DD0L 3BKCL 2YKLL 4OCWH 3H3PL 3CFDA 1NBYB 3PABA 4AEIL 5CP7A 1OAXL 1ZEAH 2FJGB 3MRPB 1QQDB 3PWPD 3GO1H 3JVGA 3SDDD 4X4YB 1J7VR 3TO4B 5JLZA 2A74A 4S1DC 2DWEA 3NTCH 1AC6A 3TWCH 1N4XH 1WITA 1M05B 4J3SA 4U1JA 1I85A 5KVEL 1S7RB 5IMMB 5HYJA 1BVLA 1AP2A 1AFVH 5BQ7B 3QYCA 2PXYB 1X5FA 4I0CC 4ZAKA 3QJFB 4IS6A 5CILH 2QHLA 4MA7H 4FNLH 4M48H 5FO9B 5IKCB 2HN7A 4WJ5A 5J3HD 4WWKD 3SDCA 4YLQT 2IADB 1LEGB 4LIQL 1L9NA 2FWOA 4OD1H 1LE9B 4PRIE 1M71B 2DF3A 2Z4QA 1OL0A 3B8SA 4HPYL 1EXUA 2Z31B 1H3PH 1B0WA 3T1FA 2VITB 5KOMC 1RUPH 1TCRA 4PJ9B 3GNML 1IM3B 1UADC 4ZXBC 1CVSC 4GRLC 4MX7B 1MOEA 4N0RA 5DJAB 4UT6L 4Q9QL 2ITDB 2HLFD 4NP4L 2AQ3A 4ELMB 1HQ4B 4H1LG 1T1WA 5DJCA 4Q6IB 1MF2H 3G5YA 5EOTA 4KRMB 1YQVH 1I9JH 1Y18B 2XFXB 4JO1H 1S9WA 1FO0L 4X6DB 1IFHH 1SJXA 4J3VA 3G6JB 1K8IB 2YUVA 1CK0H 5AG9A 2IAMC 3CFDB 3AUVA 3PABB 5DRXA 4U2YA 5BRZD 5DFVD 1A2YA 3VXSE 5JLZB 4ZOCA 4WO4D 2A74B 1N59A 1JE6A 1LDPL 2DWEB 4QXWA 5DEFA 3DSFH 5E7FA 5FYJE 4IMKC 3VXUE 4MXWL 4U1JB 4WENB 4Y5VA 5HYJB 5DT1L 4DZ8A 4P2YA 1BVLB 4B41A 1UXWA 1AP2B 1H3UA 3AGVA 1NGWA 1ZKAA 1T03L 5J6GA 4PRPA 1HWGB 4ZAKB 4IS6B 5E9DD 4JRYD 5ERWA 4WJ5B 3IXTA 4HMDA 5C0AA 3SDCB 3O3UN 5AZEH 4AENA 1I3VA 4CW1A 3DI2B 1F4XL 2FWOB 4OIBA 3FONA 3VH8A 1WBZA 5C0CE 3DHMA 2Z4QB 2OR9L 5C92A 5I8KL 1KCVL 1EXUB 2NYYD 3FKUS 4DK3A 5F7KC 3T1FB 3V7AG 4FFYH 5DQDL 4OF6A 3VXPA 1TCRB 4G6KH 4HIHA 3PXJA 5FYKU 4JY5H 1EO5A 5FKAA 1CGUA 1A6AA 2Z35A 4WEBL 4HULB 2YHGA 1LO0H 4TVPH 2IMMA 5TDOA 2FLBT 3U36A 3RI5K 2DMKA 5E0QA 1T1WB 3OKLA 2DI7A 5DJCB 2PN5A 3G5YB 5EOTB 4NJAL 4YPJA 2HT3D 3O6FC 3LQAL 1FVEA 1S9WB 3QCUL 4KJWC 3SE9H 1ZANL 3T4AA 3MRKA 4LNVA 3ME0A 3TA3A 3LQZA 3P0VH 3WO3B 2AI0H 5DRXB 2CRMA 3GI8H 4JKMA 1PY4A 1IBGH 1A2YB 2X1PA 1MAML 5D2NE 2B4CC 2NY7L 5DK0A 5L8JB 1N59B 3MC0A 4GKOA 3SDXE 3QCTH 5DEFB 1P84J 2GI7A 5EO1A 2UY6A 3QQ3A 4OF8A 4Y5VB 1CFVH 3ARDA 4DZ8B 3S88H 1UXWB 4RGNB 5DJDA 3M45A 1NGWB 3O6MH 4DN4H 5J6GB 5DFTA 3SGKA 3OKYA 2X4TA 1G7MA 4HUNB 2W0LA 2QSCH 4K71B 4H26A 4M6NH 1A7RH 5ERWB 3AVEA 1EGJA 3IXTB 4O2FA 5C0AB 3OG4B 1AC0A 3NA4A 4J3OC 4AENB 4CW1B 1HN1A 5DJ2A 1HZHH 1I1CA 3MYJA 2XWTA 3NA9L 3VG0H 3UYRH 1QZ1A 3VH8B 3RWGA 1RAMA 4AMKH 1WBZB 5HDQH 3WUWA 3B5TA 1SM3L 5GRYA 1WC7A 4M93C 2WANA 2LTQB 3VXPB 3REWA 4WV1C 1QR4A 1IAIL 4HIHB 1Z3GL 5HD8D 3AAZA 4QWWC 4P48A 5FKAB 1A6AB 2Z35B 1BEYH 1CD9B 4M3KB 2VL5A 4OZFA 4NKIL 5TDOB 2X1WL 3RTQD 3U36B 3IDMA 4G5ZH 2RBLA 3OKLB 4M6OH 3RIAK 3S37H 2Y4SA 1ZVHA 3GHEH 5KOVC 4NQCD 3FFCD 5DMKA 4V2CB 1FDLL 3S34H 1FVEB 4K8RC 1EO8H 3T4AB 3MRKB 2DB8A 1F6LL 1IGYA 2Q3ZA 3LQZB 3TA3B 4UTBH 1NANH 3CMOH 2W0KA 3QDAA 1S9YA 5EPMA 5I19L 5JO5A 4M7LL 3I50L 7FABH 2QBWA 2IF7A 1AQDA 4X9HA 1QR1A 1I3RA 5DK0B 1QD0A 4HJ0C 4OM1L 3U46A 5EO1B 5C0DA 1QFUH 3QQ3B 5H37G 3ARDB 4NKDA 1MFDH 1TZGL 5GGQL 4WTZG 3CU1A 1IKNA 1QFOA 3MO1A 4OZGF 3BKMH 3H9ZA 4LPXA 5AYUL 5DJDB 3BPNC 3UBXG 3KG5A 3GSXB 3BAEL 3ARSA 3VFUA 1ES0A 5I76A 1T2QH 4KAQH 1G7MB 1Q94A 4HD9A 1SMAA 1U3ZA 4H26B 4KK5C 4KY1L 4YDLC 5IESL 1S7TA 2ICEA 1JGVL 2JLLA 4P5KA 3MJ9H 5LBSL 4MNQD 1KYOJ 4O2FB 2O61A 4P2RD 5DJ2B 3QBTB 3MYJB 4LHUG 2XWTB 5C08E 2RCSH 3RWGB 4ALAH 1D5MA 1QFHA 4TVPE 4YFLF 2FIKA 1KTKE 2JJVA 3BN3B 5CIPH 3OJDA 1WC7B 3P4NA 3REWB 3AAZB 3EUUA 4OZFB 2VL5B 1RIVH 2P5WA 5CZXD 3IDMB 4K7FA 3SE3A 5BS0D 4K3HA 4RMRA 3B9KC 4OQTA 1HHHA 2EC9U 3PG2A 3QP3A 5DMKB 1FLRH 5IFAL 5ENWA 5I1HH 3OAZK 4XVJH 5TQ0H 1IGYB 2X1XR 4XP6H 3KPSD 1B88A 4HHAA 4LSVH 5CEYA 1URLA 1CXIA 3QDGA 3QUZD 4Y4HC 4G6JL 2WBJD 2X5PA 1S9YB 5EPMB 5JO5B 1MFAL 1Z6JT 2ZPKH 1AQDB 1JYWA 1QR1B 1I3RB 3D3VD 1NAKH 4Q9RL 5MHSE 3U46B 5DWUH 1R24A 3EYOA 5C0DB 1ACZA 4W6YB 2RJMA 1VPOH 4KRPC 4WFGD 4PJ7E 3CDYA 4MDJA 1D9KD 4NKDB 1LO4L 3MO1B 3M17A 4ELKA 4JG0H 1OP5H 2B1AH 5ADOL 4B5EA 3VFUB 4M1GH 1ES0B 5I76B 1Q94B 3WIHA 3PP3K 2DAVA 1BJ8A 2YUXA 4YR6A 1BF2A 1S7TB 3BO8A 4EI6A 2ICEB 1VFAA 3BPOB 4P5KB 4RMVA 5H35A 5JPNA 4XPBH 2KQNA 2O61B 3LKOA 4NNYA 3MJ8A 1CTNA 3UTQA 1D5MB 1JL8A 2C4XA 4EUPG 3W5NA 1KLUA 3OJDB 4RZCA 3P4NB 3ZTJG 3BN9D 3NFSL 2P5ED 4OQ1A 2VR9A 2VLRA 1NSNH 3WFZA 1EAPA 4L4TA 5F72S 2AGJL 4GAGL 3STLA 3EKCA 1OPGL 4U0RC 1X5HA 2P5WB 3BE1H 4K7FB 1CXHA 1U42A 3GMOA 4M1CD 2OZ4A 1CLYH 1JNNL 5EC2A 1HHHB 4OQTH 1N0LA 1F3JA 4UQ2A 1TZIA 5ENWB 1IGFH 5AUMA 4GQPH 2X09A 5JR1H 4W6XB 5F6HJ 5FUCC 3G9AB 3WFCH 4HHAB 5CEYB 2NLJA 2XTJD 3QDGB 4PLKC 5FYLD 5CZVH 4J3TA 2DQDH 4LKCA 4MA1C 5AZ2L 5JZ7D 5JORA 3LMJL 1BZ7A 3BUYA 4V1DA 2LAAA 3EZ8A 1R24B 3EYOB 1N5YH 1ONQA 2J4WL 2VLJA 4MDJB 5EZIH 1NMCC 1RJZA 4OD3L 2YPLD 2FHCA 1V3MA 3M17B 4ELKB 3MRNA 3O4OC 4MXVE 3QPXH 1ULVA 1JNLH 3V5KA 2J88H 5EC1A 4YR6B 1CLZH 1NCWL 1XGUA 3BO8B 3JWOC 3CIQA 4EI6B 1VFAB 3VU2A 3ULUD 4Y4KD 4YHOL 4ZD3L 5H35B 5JPNB 3BT2H 4C55A 3JTTA 3LKOB 4R9HA 5AAMA 4NNYB 5EU6D 1ZT4A 3MJ8B 5DD1H 3UTQB 3TFKD 1F4WL 2DD8L 2VXVL 2O5XH 2XZQH 3HI1A 4KI5F 1KLUB 2CSPA 4RZCB 2VAAA 4UT7H 1J0ZA 4UBDD 2VLRB 4ELMF 1EAPB 1KJ2L 4L4TB 3QB7C 2MCG1 4LRNL 1UM5H 1HHIB 4L8SC 3STLB 4X6DF 5ICXA 3GMOB 3BSZH 4HLZG 3RY5A 3EJZC 5EC2B 4TYUA 5E8DH 4NCC2 1F3JB 4MQSB 4UQ2B 4MQXD 1TZIB 5AUMB 3O4LD 4WFEE 1GC1C 4I13B 3BVNA 2NLJB 4FZEH 4NWTL 4KQ4L 2AQ1A 3O2VL 2ZCHH 3AS0A 3MLUH 4LKCB 5JORB 3BDYH 1L6XA 1T4KA 1B2WL 1BZ7B 4R90L 3BUYB 3MV7D 4V1DB 3V4PL 1FPTL 1W8OA 3DV4A 3NH7H 4JPVL 5HHMB 5TE6L 3S96A 3QO0A 2MNUA 1ONQB 2VLJB 5DC4B 5EN2A 5MEND 1RJZB 4NDMA 4RQQA 1M6OB 3MRNB 5D8JH 3DX6A 2DLFL 4AZ8A 1FGNL 3V5KB 3RUGA 5EC1B 2X1QA 1XGUB 1ZTXL 3LN5A 4PJHA 4Y89A 1PGRB 3BIAX 3QNZA 1CQYA 3JTTB 5SV3A 3HRPA 2NZ9C 1ZT4B 4F7EA 5M7QA 2Y5TA 5HVHC 4KHTH 3VXMD 4ODSL 1DBAL 3HI1B 2GJ6A 4M5ZH 3TIDA 3IFNL 2F58L 1LK3H 5I1GH 1NCBL 2YXFA 4I3RH 2FECI 2VAAB 1PVHA 5GIRA 1AE6L 1A1OA 1GZPA 3J8F7 4ZSOE 1A6VL 4GBXA 5GRUH 2YRZA 3LQMA 3PP4L 5D5MA 5ICXB 1A7NL 2CDGA 1QG3A 4LLVB 3MCG1 4DKDC 4P2OA 4LSPH 3WIIL 2EH7H 4AG4H 5FYLL 5A2LH 2NY5C 2Y36L 5GS3A 4MXQC 3BVNB 1CDHA 3NIFF 2DWDA 4JJ5A 5IMLA 5HHNA 1T4KB 1IL1A 4G3YH 1ZLUH 4XPGL 1H9VA 3DV4B 3U0WH 3QO0B 1MRDL 1XIWD 4TNWK 2PKDA 4UAOC 5FGRA 3QEHA 3VG9C 4D0BA 3HHRB 4NJ9H 3ULVH 1DP0A 2GAZA 4XC1H 2VN4A 4NDMB 5K59F 4XHJD 1BMGA 4PFEA 4RQQB 1VGKA 5L2JA 3ULUL 1FGVH 2RQ8A 2XRAL 3RUGB 3QA3A 3R0NA 4I77H 3CCHA 3F62A 5IWLC 4FS0A 4X83A 3LN5B 4PJHB 2AERT 2ED7A 1I1AC 2C3WA 4WUKL 3QNZB 2J8UA 3RGVC 5DMGD 1JYXA 2B8OT 3WN5A 4F7EB 1BD2A 1S5HA 2Y5TB 1MCEA 5I74C 2VDQL 1IGIH 3RAJH 3FN0H 2GJ6B 4OFPA 4OCXL 3TIDB 3F7VA 3LPWA 3HE6A 4O2EA 5GIRB 4I18A 1A1OB 1GZPB 4MMXC 4G8EA 3I85A 3QEQD 4GBXB 2Y07L 1ZMYA 2ZWLT 3BWUC 4JHZA 5L2KE 3OF6D 4OLVL 4XNXH 5FYKH 2CDGB 3WLWC 3DVNA 5I75B 4LSTH 1RUAL 1NCAH 1HQRA 2F53E 2VZVA 2G60L 1UYWL 1L0YA 4PYHA 4N5ED 4HPOL 4P2QD 2AK4E 4ZYKA 1A3RH 5F7YC 4Z78A 5CINH 3QDMA 1ZAGA 4U1GC 3V4VL 3QCVH 2DWDB 4JJ5B 4CGTA 5IMLB 1L7TH 4HDIA 1L9MA 1JPTL 4FOMA 1GGBH 5HHNB 5JOEA 4FP8H 1IL1B 1F8TH 4N0UA 1F11A 3VGDA 3HE7A 5D1XA 4HCRA 1OWWA 1MFBL 4WY7H 3QEHB 1RZJH 3F7QA 3BEVA 4D0BB 2GAZB 5ISZA 4R2GC 2WUBL 1HE7A 1BJ1J 3MBEC 1VGKB 4M4RA 4XCYB 5I1IL 3GRWA 2DM2A 1E4WL 3QA3B 1EHLH 2BVTA 3CCHB 4OGZA 1IILE 2IGFH 3W0WE 2D03H 3V4UH 5I15L 3ZKMC 2D7OA 2D7PA 4NT6A 2J8UB 1GJIA 4H20H 4PREA 1LK2A 3WN5B 1UGNA 1BD2B 1S5HB 1MEXL 3NGBB 1JYVA 4M9PA 4PGBA 2DI9A 2VLME 3PGCA 3F7VB 3EJYC 4NHUA 3U7YL 1CXKA 3EYUH 4HWNA 3HE6B 1VADA 4PG2A 4O2EB 2JJWA 1U8QA 4I18B 1A14H 3NACL 1DLFH 2UWEA 4G8EB 4U1KA 1CFTA 3RJDA 1KB5H 5EOQL 25C8H 1FBIL 3K2MC 4F33A 1NCUA 1WEJL 1KIRA 3E2HC 3DVNB 4NWUH 4U1HA 2AJSH 1HQRB 4DVBA 1OD7A 2EEBA 3U30C 1MHPL 3BD4A 3QPQC 4ZYKB 4Z78B 1J8HA 3QDMB 5JW4R 1P7HL 1J18A 5F70A 4R26H 4HDIB 1XGTA 3ULVE 2X2YA 2B1HH 1NBVL 5C0IA 4N0UB 1F11B 1T2JA 1I9RL 2BVUA 3HE7B 5D1XB 4U2ZA 2WQ8A 3RU8H 4P23C 1JZ7A 2OX5A 1OAZH 5ISZB 4M43L 3TNMA 3ARUA 3CDGA 4EIZC 1PQZA 3C6LA 1JPSL 5L0QC 3WFHA 1J12A 4JJHA 1BBDL 5F9OL 1DVFC 5JXEC 3IVKA 5F9AC 3AS3A 4NQSA 1A6TA 3I02A 2EDQA 3MCKA 4L9LA 3EFDH 4QHUA 1E27A 2I26N 3H42H 4LEOA 5EULV 4NT6B 3UJIH 2E7HA 3TJHC 5KS9E 1G0YR 4HK3J 4U1LA 2WV3A 3ARGD 4HIXL 4R4FH 4PREB 1LK2B 3DGGA 2ZCKH 4YBLB 5FOBA 5C07E 1OWRM 4PGBB 1U8JA 4J6RL 4WTXA 3PGCB 1UVQA 4NHUB 1AY1H 2HAZA 1VADB 4AQOA 1U8QB 2UWEB 4C56E 4OAWA 1QNZL 1F4AA 1JIBA 1OAUL 4U1KB 5BJTA 1S78C 1OSPH 2R39A 4F33B 3MACH 1PG7W 1Y6MR 1KIRB 5J13C 1M7DA 4PD4K 3T0EE 4U1HB 3SDDC 4RGMC 1DQJA 4DVBB 4QHLA 5GGUA 5AYQA 3MCLL 5HTSA 2YD3A 4OLWL 1XGTB 3EW3B 4JCLA 5BVJA 5C0IB 1NJ9A 1HCFX 3ARRA 4KGJA 3WFEH 2AVGA 1G6VK 4K3DL 3TN0D 4CMHC 2VLKB 5C3LD 1CD0A 1CDGA 3HNTH 5DZNA 2ZCLH 5JXAH 1QFPA 3NIDE 3TNMB 3CDGB 4JKPH 3TV3H 1RZ8A 5D7LE 5J3HC 4KZEH 1PQZB 3C6LB 1UXSA 4WWKC 3WFHB 3IXAA 1U8PA 3IVKB 5GHWH 1GOHA 4NBYB 4NQSB 4ODXA 1A6TB 1IT9H 3I02B 3MCKB 5C0RL 5CKAA 4L9LB 1GCFA 1D5IL 4NO0B 5E2WH 4QHUB 4LSRL 3KPTA 4LEOB 5B38G 4U1LB 1BBJA 5I18L 3ZT7A 3DGGB 3QFJE 1P9MC 5FOBB 3NOIA 5CKGA 1RJYA 1E6JH 2HLFC 4X4ME 3Q48A 1U8JB 5EB9A 1UVQB 2AABH 1WIOA 5DMIH 5F96L 4OAWB 4HFUH 2PYFA 5JQHC 1J05A 4K9EL 5BJTB 1BOYA 1L0XA 1ZGLP 1CDYA 2NY4B 3GMLA 4XMLH 4CU6A 2UY7A 1MJUH 4ZQKA 5F1KC 1L7IH 1M7DB 5DFVC 2IBBA 1DQJB 4DFHA 4QHLB 4WO4C 4XPHH 2XQBH 5EUKA 5GGUB 1RIHL 4YWGL 4LAQL 3SJVE 5D70L 3WYRA 1U36A 8CGTA 1BQHA 3BOVA 4JM2F 3EJJX 5BVJB 1CI5A 2FB4H 4CN1A 1NJ9B 3O2DH 4NIKB 1BGXH 2F5AL 5H94A 5I30L 4PRAA 3GM0A 4OT1L 2CGRH 4ZXBA 4GRLA 4R97C 5DUMH 1RZ8B 4NN7B 1UXSB 4XNZC 1BVKB 3UTPE 3IXAB 1U8PB 4IJ3B 1V8HA 2OP4L 3H7BA 5LCVL 4ODXB 4PRID 1INDH 4G6FB 4QRRE 1PBYA 5EFIA 5KW9H 5E4IA 3FFDA 2IAMA 1HXYA 3GHBL 1BBJB 3TT3L 4JPWL 3BJLA 1RJYB 3CFBA 5DD3H 1OAQH 2C4FT 4N68A 2DKUA 4JFDE 4IMKA 2HT3C 4KTDH 3FQNA 1H3XA 2PYFB 3QWQB 1A0QL 1J05B 4KV5F 5F7UA 4KUZL 4K2UL 3GMLB 2J8HA 1AXTL 2R69H 2MKLC 4ZQKB 3CX2A 3S35L 3S8WA 2FR4A 4Z9KB 2OCFD 1YJDL 3QHZL 5T3ZL 2CIIA 3WNPA 2B0SL 4X9IA 4RDQF 2NXYD 3CC5A 3BWAA 3VXSD 2R2CA 5EUKB 4BFEA 4P59H 5MERA 3HAEG 4OZHA 4XTRD 1G6RA 4BZ1L 1QBLH 9CGTA 2IQ9H 3T0WA 1BQHB 2FHBA 1A1MA 1OCWL 1MCLA 3H9SE 1MCCA 5CFHA 1FC1A 3VGBA 3OTTA 3N1PC 2IQAA 3HNVH 5H94B 4ODHH 4H8WL 3KPMA 4PRAB 2R29H 3FT4A 4ZXBB 4GRLB 5GPRA 3RUGF 2CXGA 3FQXB 3GKZA 2MFNA 3AXLB 3OR6A 2HJLA 1YPZA 3JV4A 4PJHF 3H7BB 4E5XA 3D39A 3O6FA 4OSUL 1MLBB 5EFIB 3DMMD 4U6XA 4JB9H 3FFDB 2IPTL 2YD7A 2IAMB 1HXYB 3OB0H 5DJ0A 2HH0H 5HD8C 2APTA 5JDSB 4QF1A 3RBSA 2CK0L 3CFBB 1IC1A 3ARZA 4ODTL 1A47A 3ILQD 3PGFH 4J8RA 4PJGF 43C9A 3QZWG 3FQNB 4MSWA 1QLEH 4Y2OA 2YSSA 4Z76A 3NZHL 3DWTA 5K9OA 1DBBH 1BF8A 3MV11 1OARL 2FR4B 3QUML 3F7YA 2CIIB 3CC5B 3BWAB 4HV8A 3HMWH 5MERB 4OZHB 4UV4H 4X6CE 2VXUH 1G6RB 1AGDA 5D1QD 5D7IF 5F6IC 3SQOL 1FL5A 3IS0X 3SKNA 1TJGL 1A1MB 5T3XH 2AAVA 5ELIA 3STBA 3CLFL 1A7OL 4MHHI 1KFAL 5J4MA 1QSZA 4JO4L 5T1KD 2IQAB 1I3GH 3BYTA 4O58L 3KPMB 4P0DA 4WV1A 3FT4B 4NCDA 1NMBH 1DZBA 2XN9E 3DRQA 2D9QB 3MXVH 4LLMA 5C0JA 3OR6B 2HJLB 2Z31D 1YPZB 3JV4B 4OFIA 1TNMA 1IGJA 5E99L 4WI8A 3QEGH 2J8UF 1YEKL 4E5XB 3D39B 3O6FB 4G8IA 2Q7YA 2BZDA 4BJLA 1CGYA 1GGYA 2HT2D 5FHAL 5DJ0B 3GBML 4X5LA 4J2XA 4QF1B 1L4IA 4OZGE 4ZOEA 4PIRF 2ZNWA 1U8KA 1OGAA 5CZXC 1G7HA 1CFQA 3EGSA 43C9B 2HMIC 1WV7T 4PTUA 4FQXC 5EOCH 4MSWB 2YSSB 2P7TA 4Z76B 2BHZA 5C0BD 3JV5A 5F44A 4EXPX 5K9OB 1QP1A 3VFOA 1RPQA 2VZTA 3QUZC 2R1XA 4K3EH 2WBJC 3BRDA 3F7YB 2CRZA 3X3FH 4P9HL 1WTGT 4HV8B 4HUMB 2YA0A 5DEGA 1AGDB 3LHPH 3IJHA 5F6HI 4JG1L 1AGEA 4QY8A 1CS6A 3SKNB 4DW2H 5FDWA 1HHGA 1ZLWK 4NC1E 5E5MA 5E2TH 1KTRL 4QCIA 4ZO7A 4E42A 3DROA 3SDCD 4M93B 1GXEA 5CS7A 4WV1B 1R3IL 2HFGL 3HZKA 4KI1A 1G7LA 3DRQB 1WFTA 4LLMB 4PGZA 4JPIA 5C0JB 4QXUH 4Y1AD 1HKLH 4NZJA 2M1KA 1MIEH 4D2NA 2XA8H 1IGJB 3B9KA 1XGYH 4BH8A 1GHFL 3WUZA 4G8IB 4NHCH 2Q7YB 4TVPD 1A7PL 4PJIA 5T5FL 3BN9C 4JZOA 3PE9A 1EJOL 4OCWL 5EUOA 3KDMA 5I9QC 1LE5A 4Y4HA 1MELA 1JF5A 3X12A 1ZEAL 3UZVB 1U8KB 2BVYA 3GO1L 1OGAB 1RJCA 4XXDA 2CQVA 2R2BA 3NPSC 1CFQB 3X13A 3EGSB 4PTUB 3NTCL 5GS0H 1N4XL 2YD1A 5GRVK 3BGAA 3VGGA 3WDHA 2P7TB 3MLSL 1CL7L 3VFOB 3BPNB 2NXZB 1X4XA 3MTRA 2XTJC 4ODWA 3M8OH 4MQ7A 1AFVL 2EO9A 2R1XB 4NZDA 2WZPD 3UXFA 2BNQE 2EDJA 5T3XE 5JZ7C 3T3PF 2NNAA 1UACH 4NQDD 4QRPA 5CILL 3P73A 4MA7L 5DSCA 4YDLB 4FNLL 1RZFL 4HMCA 4M48L 5DEGB 2Y7QA 1F02I 3IJHB 3DXAE 1LILA 4QY8B 5JHDD 2ZUYA 4PRPD 3G9VA 3KYAA 4RX4D 4OD1L 5FDWB 1HHGB 4X8XA 3BP6A 2C5DC 4YBQD 5E5MB 4LP5A 1QVOA 2CDFA 3WMSA 4LQFH 4QCIB 4XGZA 5C0AD 4E42B 3DROB 4NSKA 1H3PL 1TQBC 1RUPL 5EBWA 3HZKB 2JF1A 5K9QI 3MV9A 1G7LB 4Y4KC 2A9MH 4HT1H 4JPIB 5I1JH 1BZ9A 2W0PA 3TFKC 3B9KB 1MF2L 4H1LH 4P3DA 1CGSH 4BH8B 4JO1L 4PJIB 1IFHL 2BY2A 4D9LH 4JZOB 1CK0L 4UBDC 5EUOB 3RL1A 1ZT1A 3KDMB 1LE5B 4Y4HB 3X12B 2BCKA 3CXHJ 4XXDB 2BSTA 4HLJA 2R2BB 1EEQA 3X13B 3QFDA 4FTVA 4MJ4A 3DSFL 2EDLA 3A6CH 3CSPA 2V2WA 4KRPB 5KAQG 4MJIA 3KLHD 2GSIA 1TVHA 3EHBD 2VE6A 4Z7WA 2ARJQ 2AV1A 4JFXA 5DTFA 4ODWB 4MQ7B 1N2RA 3UX9B 2W9LA 5KSUA 1UWGH 2HFTA 4H25A 2NNAB 3ARDD 4QRPB 2HA1A 3P73B 5DSCB 2BSSA 5BOPA 4KI5E 1UZ6F 2H1PH 2Y7QB 4AL8H 2C4FU 5AZEL 1ODAA 4PJ5A 4L3EA 5TF0A 3VJ6A 2EE6A 1G1CA 4KDVA 3BP6B 4MZ2A 3QH3A 1QVOB 2CDFB 4GQ9L 3QUKA 3ARPA 4XGZB 4BH7A 4NSKB 5JHLH 4FFYL 5FFLA 1D6EA 5EBWB 3ROOA 4G6KL 3FOMA 3MV9B 2VDKH 2UZIH 3TZVC 4JY5L 5MEPA 3OAYK 1LO0L 4L8SA 4TVPL 4BQ8A 4U0RB 4OLXL 1UCBH 2JJSC 1BZ9B 1D7FA 3KLAA 4P3DB 2E27H 1WCQA 5HYJE 2RAMA 4NUJA 3SE9L 3ARWA 3DNKA 1IE5A 3RL1B 1ZT1B 1F13A 3P0VL 2BCKB 2AI0L 2DQIL 5DD5H 5ALBH 3RFZC 4MA1B 1IBGL 4XCCH 2BSTB 1T7YA 3O45A 3W9DA 2AJZA 3EYFA 1UM6H 4OBRA 5FEBA 3QCTL 3QFDB 3MBXH 4FTVB 5SX5K 5JW3H 3LEVH 4HS6A 2V2WB 1J1PL 3NBNA 3ARBD 4MJIB 1CFVL 2GSIB 1TVHB 2VE6B 4Z7WB 3S88L 2AV1B 4JFXB 5D7SH 1WSST 5DTFB 5GZNC 3O4OB 1N2RB 1JRHH 5IHUH 1Z5LA 1UC6A 4DN4L 5KSUB 1RZKH 2GK0A 4H25B 1BAFH 4KUCF 4ORGA 2BSSB 2QSCL 4IOIA 4XC3H 1JGLL 1A7RL 3HR6A 1XIWC 1QKZL 3UJJH 1FFQA 4Z95L 4KTYA 4PJ5B 1HZHL 4L3EB 3VJ6B 1TITA 3VG0L 4K3JL 4LHUA 3UYRL 4XHJC 3QH3B 4AMKL 5HDQL 1MCNA 3PF2A 2V5SA 3QUKB 3SE8L 2NY2D 4X5XA 2D7QA 4BH7B 1F2XK 4JFHE 1RIUH 1D6EB 2H3NA 3SKUD 4P4KD 5F7FA 5IQ7H 3FOMB 5MEPB 1YEHH 3OSKA 3HC3H 3EO0A 1BEYL 4XPAH 4L8SB 2ORBH 4NBXB 5DMGC 3TBYA 3NIFE 3S37L 4FHBD 4J12A 3KLAB 5GGVH 3GHEL 3WIFA 5JW4N 3S34L 4NUJB 5DJXA 1EO8L 1YUHA 1GC1H 2OJZH 3K4ZA 4UTBL 3EYSH 1Z0MA 3CMOL 3KPLA 1WTLA 7FABL 3O45B 1PYWA 3W9DB 5K59E 2AJZB 3EYFB 3N85H 4PJAB 3FL7A 1DBJH 3D9AH 1QFUL 4HS6B 1X7QA 1CCZA 4N5EC 1P5UA 1MFDL 5H37H 1MCWM 1NANI 5JTWA 1INEH 3BKML 3ROLA 3MMEA 4Y8DC 5EWIH 3B9EA 1SMOA 1Z5LB 2GK0B 2GCYA 3ALXA 1T2QL 3G04A 1SY6A 1XF1A 2H6PA 4KAQL 4ORGB 1T22A 4IOIB 5IWLA 5KSBA 4R6UA 3OKMA 3QT2A 3RDTC 3OJMB 1I1AA 1VEPA 3MJ9L 3GJEA 3RGVA 3CNKA 2HG5A 2ADGA 1QHOA 3QUYD 1GL4B 5HVHB 4LHUB 2E9BA 1EHAA 1BWMA 4FQJH 4ALAL 2FGWH 1ZGLM 1GAFH 1UH3A 4X5XB 1HWHB 2H3NB 2AJXH 4NCC1 2VZ1A 4R4BA 3EO0B 1PKQA 3H9HA 3TBYB 4ZFOA 1RIVL 5HI4D 3VI3E 2RR3A 5CSZA 2BHYA 3LEXA 3MLWH 2DQGH 3WIFB 1FLRL 2M2DA 5I1HL 4XVJL 5DJXB 5TQ0L 4HG4J 4NO3A 1YUHB 1RHHA 3BH9A 4XP6L 2FX9H 3PHOA 4LSVL 4HX1A 3KPLB 2K7PA 1UJ3C 2ZPKL 5LGHH 1PYWB 2FD6H 2CLRA 3B5HA 2CRYA 4K9EC 5DWUL 3CAFA 1X7QB 2X41A 4UAOB 2PYEE 1OP3H 5E8EA 3BZ4A 1VPOL 3VG9B 3PDGA 1BHGA 2EKSA 5E56A 2AEWA 1F6AA 3PQYE 3ROLB 3RY4A 1RI8A 3MMEB 1QLFA 3MBEA 4KKNA 4JG0L 5TE4H 2B1AL 3HKFA 4M1GL 2VLJD 2GCYB 1ACYH 2H6PB 1X5LA 1KN4H 1YMMD 1T22B 4MNHA 5KSBB 5GRJH 3OKMB 1AO7E 1I1AB 4XP4H 1WISA 3GJEB 3RGVB 4ETQA 2HG5B 2ADGB 3H3KA 4MNGA 1PW3A 5I74B 2FBJH 2J5LC 3GM8A 3SQBA 2B2XH 2APFA 4EUPH 4G8GE 4D0DA 3ZTJH 2JJUA 1T7XA 4R4BB 1PKQB 3VE0A 3H9HB 4ZFOB 1WLHA 3L3DA 3RQ3A 1FO0A 5CSZB 1CLYL 2IPUK 4J3UA 4OQTL 4N8PA 4Z7UA 1IGFL 3CUPA 4NO3B 5JR1L 5I16A 4G6AD 1NGYA 1RHHB 3BH9B 4U1GB 3WFCL 4KROD 4GAJH 1T0PB 3WFDH 1OAYH 3PHOB 4HX1B 1B0GA 1BX2A 5CZVL 4Q2ZA 4ERSH 2DQDL 1J5OH 3V6ZA 3U9UA 2CO6B 2MQCA 1FAKT 2CLRB 2DM7A 2GT9A 2ICES 3UZQA 1BLNA 4P23A 1N5YL 4OM0H 2DQHH 5E8EB 3BZ4B 5EZIL 2EDTA 3H2WA 2EKSB 2H26A 2V17H 3QIWD 1F6AB 1NDMB 4R2GB 5A2KH 4BK5A 3BKYH 1YJDC 1QLFB 3MBEB 1RUMH 4CL7A 5JXEA 1DVFA 3QPXL 1JNLL 2FL5A 3ULVD 4MNHB 1CLZL 1R5IA 5FGCB 2C3VA 3TN0C 1VERA 1EEYA 5TGBA 3CGTA 4DZBA 3BT2L 4ETQB 15C8H 5A2JH 5L6YH 2P5WE 4MNGB 3VD3A 5DD1L 5EZLA 4G9FD 3C2SA 2O5XL 4H8WC 2XZQL 3TVMC 3QO1A 4WI2A 3ZL4H 1OOAA 4IIQC 3GSWA 4UT7L 1OT1A 3J7HA 1UKQA 2P48B 4S1RH 2GJ6D 3VE0B 1UM5L 2GYSA 4PJIF 1ITBB 2CR6A 3E2HB 3L3DB 3MQIA 3V5DA 1FO0B 3PWPA 4M7KL 5EUOF 3SDDA 4HLZH 3MA7A 3U30B 4GBXD 4Z7UB 3CUPB 3FO1A 1TJHH 5FYKD 1NGYB 3IKCA 2DJSA 4FZEL 4JDZA 1B0GB 1BX2B 4P2OD 4C56D 4Q2ZB 2ZCHL 3MLUL 3V6ZB 3U9UB 4CVUA 2K3TA 1A6WH 2GT9B 1GH7A 5D6CA 1NBZA 5DLMH 1BLNB 4P23B 2W92A 2WLYA 1JFQH 3DX8A 2H26B 1UB5A 5HHOE 4YZFF 3EO9H 5L0QB 1PJ9A 5D8JL 1DVFB 1MCWW 3WXVL 5ESVA 2FL5B 4WI3A 4PJDA 1R5IB 2C3VB 4XZUA 1EIBA 1EEYB 4L4TE 5TGBB 4YHML 4DZBB 4JFQB 4E9LA 3VFMB 4WW2F 5C2BH 1X44A 2AW2A 1P9MA 1QFWI 5EZLB 4KHTL 1FRGH 5D7LD 4M5ZL 3VDCA 2KDGA 3FQUA 3OWEA 1LK3L 5I1GL 3MUHL 3GSWB 4I3RL 4TSAL 4Q9CA 1QSFE 3VA2C 1BD2D 3QI9D 5GRUL 2XZZA 5HHPA 3LS4H 4WWID 5J13B 5BRZA 2VQTA 3V5DB 3GMRA 3PWPB 5DGQA 3SDDB 4RGMB 4RFNC 1ORQA 3MA7B 4AG4L 4WO4A 1J0KA 3BESR 4QRTA 3FO1B 3TESA 4YO0A 3SEPA 2UUDK 2VN7A 3IKCB 4AYFA 1QPPA 2ILLA 4JFZH 4AIZA 4MA8H 4JDZB 3VWKD 3ARED 5BXFA 2R9HD 3WBDA 4KQ3H 4G3YL 3MOBH 5D6CB 1NBZB 1VGEH 3QAZC 1MCHA 3U0WL 4CMHB 5D71H 2NXYC 3CFKA 2DM3A 3DX8B 2W9EH 4KK9D 2OMBA 2X70A 4XTRC 3ULVL 1UB5B 2P43B 2VAJA 4XC1L 4BQBA 3SJVD 3ESVF 4P9HC 4Z7OE 4GXUM 3W81A 1DTUA 5ESVB 1FGVL 3FB5A 3EOBA 4I77L 1U3HA 5I0ZA 2PTTA 4PJDB 1MFEH 4XZUB 1N0XH 4M6MH 4YQXH 4YXKH 4TTDD 5IF0B 5B4MD 2HTKD 4FQ1H 4YAQA 2GITA 3T2QA 4KV5E 1IC5H 1KPRA 5EORL 3RAJL 1IGIL 3RRQA 3FQUB 3UTPD 2PNDA 2OXHA 2X4QA 2Y9RT 3DMMC 1AR1C 2CUMA 2HVKA 1F42A 1MCIA 2UVFA 4NKQB 5DK3A 5HHPB 2GTWA 4XNXL 5FYKL 1UFUA 3EDFA 5BRZB 3GMRB 1OTUD 3IAQA 4LSTL 1ORQB 1NCAL 1Q72H 4WO4B 3ILQC 4WHTA 4QRTB 5ADPH 4JVPA 4YO0B 3BXNA 3JXAA 5CINL 5E5RB 2FCBA 5DR5H 3QCVL 4JFDD 2HP4A 2R4SH 1KPUA 4AIZB 4PJAF 3KYOB 2QSQA 2A0LC 1NFIA 1GGBL 1QFWM 5BXFB 1SEQH 4FP8L 5GGTH 1ETZA 2EDRA 5GXBB 3OAUH 1F8TL 4PRHE 5LVEA 1J8HD 4GOSA 1BQUA 3CFKB 4WY7L 4G80A 3HNSH 4JO2L 1RZJL 2X70B 5D2NC 1N7MH 4R97B 4FQLH 3CVHA 4WEMB 5D1QC 5MI0C 3B9AA 3PL6D 1BFVL 3ILPA 4XNZB 3FMGH 4FXKA 4OLYH 4MS8C 4PJBA 4FFVD 3FB5B 2DLEA 1JN6A 3VXNA 2QQKH 1ZA3A 1EHLL 3EOBB 2PTTB 1A6UH 4U1IA 2R0WH 2IGFL 3EOTH 5E8OA 5FKPA 2D03L 3C6LD 4GKNA 3V4UL 3OJVC 4PJGE 1CBVL 1JGDA 2CJUH 1JWMA 5DVOA 4H20L 1EDQA 4YAQB 2GITB 3ZTNH 3LOWA 1KPRB 4D8PA 1N8ZA 3IDJA 3LVEA 4LARL 2ZOKA 3EYUL 1VENA 4NQCA 3FFCA 2DQTH 1A14L 2X4QB 1DLFL 4I2XA 5ALCH 2HVKB 4DAGH 1KB5L 2HT2C 5D7IE 4P5TD 5IJKA 25C8L 4F2MA 2GTWB 2DMCA 3AS2A 2E5EA 4KMQA 4IOSD 3N1QC 1RHFA 2E6JA 5SWSA 1TXKA 3TM6A 4XHQA 3I9GH 4WHTB 4JRXE 1Y6NR 3UC0H 3BXNB 4LF3A 1DUZA 5J9PA 3P9LA 2WMPA 4UIKH 4JZJC 1KPUB 4R26L 4YDIH 1J88A 2IC2A 1J0JA 1U8MA 1NFIB 2B1HL 2GFBA 4JEGB 1ETZB 4YHLH 5HJ3A 4RFOH 5SV4A 4LCIH 5A3ID 3GK8H 4G80B 1QPXA 1OAZL 3CFIC 1BJMA 3CVHB 1LHZA 2H32H 3CVHH 2NW2B 4P2RA 3ILPB 4FXKB 5KSBF 4PJXA 4PJBB 4PJEF 3Q3GA 3GMMA 1JN6B 3VXNB 1ZA3B 4FABL 2IANE 1TLKA 4U1IB 1ROWA 3EOAA 3EFDL 5IBLD 5E8OB 5FKPB 4GKNB 1DQQA 1UWXH 5CD3A 1JGDB 3O6KL 1JWMB 1FE8H 5JQ6H 2ZCKL 4D8PB 1CQKA 4P2CG 1G0DA 1N8ZB 3IDJB 1A22B 2ZOKB 3F58L 1G9EA 1H8OA 1AY1L 4FQXA 4MGXA 2N56A 3FFCB 3QDME 4NQCB 1KJ2A 2ICWI 1EHXA 1U8OA 4I2XB 5MEOA 3UTSE 3VFGH 1I9IL 4EEEA 1S7WA 4JKKA 1OSPL 3O3BA 3KPSA 4F2MB 3MACL 3QUZA 2EDFA 2WBJA 5SWSB 4RAHA 1HXMA 3NPZB 1U6AH 3D3VA 3S4SG 1C8PA 4DVRH 3ZE0F 4WGVB 3F7RA 3WDJA 5ISZE 5F6IB 2DTSA 5J9PB 4LF3B 1DUZB 3P9LB 3Q2CA 4OIIH 2A9NH 1U8MB 2ZSVA 2GW5A 2GFBB 5J06A 5HJ3B 3CX5K 3DSNA 3WFEL 5F1SA 1LO2H 1WICA 4JQXC 4OFVA 3HNTL 4Y4FD 2ZCLL 5JXAL 4JKPL 3TV3L 5DZLA 1X4YA 4P2RB 4KZEL 4YPGA 4Y88A 1JGEA 1X6LA 1JPFA 4PJXB 4WFHE 3Q3GB 4WGWB 3GMMB 3ZSTA 4F7PA 4UUJA 1IT9L 1MI5E 5TF1H 2EIDA 3ALPA 5E2WL 1WFOA 1GYAA 1DQQB 5DHVA 2MMXA 5CSBA 1P69B 5CD3B 1JUFA 2V7HA 4HZLA 3SKOA 4PJCF 3W5MA 1SYSA 4M7JH 2XICA 1E6JL 5F7DA 3UEZA 5IFHH 2WSKA 5BS0B 4MD0A 2KQMA 3WKNA 2AABL 4FQXB 1MVUA 2EE2A 3AU1A 1A8JH 1KJ2B 4P3WA 5DMIL 3T3PE 1U8OB 4HFUL 5MEOB 1NLDH 5E00A 1S7WB 3O3BB 3KPSB 4XMLL 5I6XC 4Y19A 3QUZB 4Z7UF 1UZ8A 2WBJB 5A43C 2DTMH 2LVCA 1L7IL 1HXMB 1UB6A 2VLKE 4M7ZC 3D3VB 3TGXA 2XQBL 3KS0H 4ZFZA 4PBWD 3HAEA 5J0BA 1AH1A 4A2LA 1TIUA 4U6TA 3SOBH 3B2UD 3KLHC 3EHBC 4YDJA 1WF5A 1XGRA 2ZSVB 3VA6A 2YPLA 4XCNA 1A02N 4UTAH 3O2DL 1XF3A 2BDNH 4S10A 4CVXA 2NX5E 5T3XD 3P4LA 1MUJA 3HMXH 4HBCH 2CGRL 4CDHA 3AS1A 4Y4KA 5ILTH 5DUML 5L88H 1JPFB 4Z0BH 4LGSB 2HRPH 2OM5A 5EU6A 4IDJH 4KRLB 2RHEA 4UUJB 4F7PB 3MA9H 4M6AA 1INDL 4GMTH 1EZVY 3U4EA 2BJMH 5DHVB 5KW9L 2I25N 1JUFB 2V7HB 4HZLB 3SKOB 5I9QB 1PEZA 1SYSB 3E3QE 3MJGX 1J1XH 1RFDH 4FQPA 2HJFA 3KJ6L 3B9DA 1QYGL 1PZUB 5F7DB 1OAQL 2ZUUA 4L8CB 3NPSB 4MD0B 2HT4D 2BC4A 1OQOA 5CBEA 1MVUB 3AU1B 1IRAY 4KTDL 3G6AA 3QZWA 4XBPA 1EPFA 5JOPE 5E00B 2HFEA 4X9FA 3O0RH 3LD8C 4HK0A 1YMHA 2XTJB 4Y19B 1UZ8B 2R69L 4HAGA 4NO5A 1MIMH 1BM3H 3D0LA 1V7MH 1UB6B 1F3RB 3I6KA 3MV7A 4P59L 4ZFZB 5LKNA 3HAEB 5IG7A 3IDNA 1QBLL 3ARBC 4C58B 3WDIA 2IQ9L 5MENA 2X05A 4YDJB 5DK2A 1XGRB 1OD9A 2EYRA 4FXLA 2YPLB 4XCNB 4CUCA 5EDXA 1XF3B 4MAYD 1CT8A 4CVXB 1ZHNA 4ODHL 1TQBB 2GIYA 3P4OA 2WINA 1MUJB 4I3SH 5BO1H 2R29L 5KANI 5AD0A 4MVBC 4GG6A 4Y4KB 3LDBC 3TZVA 2LU7A 3C08H 3HZMA 1BP3B 5ESQA 2JJSA 5EU6B 1RY7B 2V9TA 4YFLI 1S7VA 3HG1E 3V6BR 2APBA 3SKMA 2NY2C 4OJFH 3U4EB 2D0HA 3VMOA 1DFBH 5GGSA 1J86A 4P4KC 1B4JL 2HH0L 2PUQT 2HJFB 3PHQA 5FECA 5SX5H 4PY8I 1SJEA 3I2CH 4N0FA 3PGFL 2BC4B 5CBEB 4K3GA 2XXCB 1CZ8H 3G6AB 3QZWB 4XBPB 5FYJU 2QR0A 2HFEB 4HK0B 1GPOH 1YMHB 1DBBL 5GS0D 2HYMA 4NO5B 3D0LB 3I6KB 3GB7A 2YPVH 3MV7B 2EEDA 3UTZA 3O81A 4UV4L 1XIWA 2NXZD 2VXUL 1Q9OA 5IG7B 3IDNB 1I1YA 5MENB 4Y2DD 2ATPA 1RZIA 2EYRB 3TT1H 4OKDA 5CGYD 4WFFD 2BRQA 3KPNA 1U92A 2AJUH 1CT8B 1I3GL 1ZHNB 3P4OB 2WINB 2J2ZA 4XNQA 2WUCH 5AD0B 4GG6B 1NMBL 3TZVB 4UQ3A 4PBVC 4HKJA 4XVSH 3HZMB 3MXVL 1PDKA 4KVNH 5C6PB 2V2TA 1FCGA 3QUYC 5ESQB 3SDYH 3P9MA 3L95A 1OP5K 1S7VB 3QEGL 3JWNC 3SKMB 4EDWH 4U7KA 5GGSB 5B3JF 2FX7H 4JFHD 2KBGA 3QEQA 1FL3A 3T1WA 2AJVH 3PHQB 3LCYA 3OHXA 4IHOA 2LAGB 5FECB 1ZK9A 1NFDA 1SJEB 3OF6A 5CWSA 2XQYG 4N0FB 1T6VN 1TZHA 2IBZY 1TTGA 3L3JA 3S7GA 3R1GH 5EOCL 4HW6A 4P2QA 5IVXA 2QR0B 2LU3A 4XX1E 2D7TH 1ADQA 2Y23A 2YD6A 3S97C 4C4KO 4K3EL 3S3JA 1T5WA 2PTUA 3GB7B 2VSCA 3L3GA 3UTZB 4XB7A 1EVUA 1YECH 3AROA 2J8OA 1XIWB 3RDTA 1Q9OB 3LHPL 5HDBE 1I1YB 3JV0A 2ATPB 1RZIB 2VZUA 2BVPA 2FEDD 1R3JA 4DW2L 3C9NA 1U91A 1XF4A 5E2TL 2AXGA 4JFEE 1U92B 2R15A 2BHUA 3CSYA 4HF5H 5CEZE 1KV3A 1FNFA 4XNQB 4L5FH 2IBGA 2DBJA 3FHAA 4HKJB 1HCVA 4QXUL 2V2TB 1HKLL 2BERA 5GS1C 1MIEL 2XA8L 3P9MB 3RBGA 3L95B 3L1OH 1DSFH 1XGYL 1DN2A 4J7RA 1IQWH 4NHCL 3ZE1F 1HNFA 2W91A 1KEGH 2AV7A 2YXMA 5E2VH 2VXTL 4DTGH 3QEQB 5CJQH 5LQBH 4OI7A 4IHOB 3OHXB 1JWUA 1NFDB 1UJ3A 3GMPA 4EIGB 2BFVH 5LGJA 4CRPA 3SE4C 5CWSB 1CG9A 1MCQA 1TZHB 3L3JB 3D85D 5J1AA 1XFPA 5GS0L 3QDJA 4ZNEA 4XBEH 4P2QB 5IVXB 5DQJA 4M1DL 4LKXA 4G6AC 5C7XH 3BDXA 4KROC 2EDYA 1ADQH 2XZCL 1MJ8H 4YH6A 1Q0YH 2EXWC 2JB6A 1T5WB 5ABDE 2O93L 4M61A 1UACL 1PD6A 3L3GB 5IVZA 5IEHA 2R2EA 4CMMA 3RDTB 2R56H 4JVWA 1WT5C 3QIWC 2BVPB 2PYED 4GS7C 1EZVX 1R3JB 1YNTA 3FT2A 3C9NB 1U91B 3X11A 3PQYD 4ORZC 1XF4B 2AXGB 4LGRB 4LQFL 3LKNA 3CSYB 4QXTA 3ULVC 5IW1A 4PJ5D 1KN2H 1MCKA 4PJXF 2RFXA 3OKKA 5EO9A 1I7UA 2A9ML 4HT1L 1BIIA 1AO7D 4RWYL 5I1JL 4DKEH 5I71C 4XVUD 3D6GA 2O26U 1WWAX 1FZJA 4YK4C 1QBBA 1J87A 4EXKA 2YUWA 2AS5M 5F93C 1CGSL 4Z8FH 3SO5A 2FYYA 2E9WA 2A2QT 4D9LL 2AV7B 4QHNA 3MNZA 4Q9BA 4G8GD 2VDNH 5J12C 1JWUB 1UJ3B 3GMPB 3S36X 2GTZA 3U48A 5LGJB 2LABA 1ZHKB 1CG9B 3RWIA 5ID0A 1AD0A 3B6SA 2JE8A 3QG6A 5J1AB 1KELH 1D5BA 1T83C 4JHAL 4Y8AA 3LRGA 1AIFA 3MLYL 4JPKH 3QDJB 3S5LG 2W9DH 5DQJB 3BZFA 4PB9H 4LKXB 5I1EH 2H8PA 1BFOA 4C54A 2L7UA 4O4YH 1G7JA 2XKUA 4P2OC 2JB6B 4LPTA 3RVWD 5JIPA 1PX4A 1UWGL 4M61B 12E8L 5FUOH 1EEUA 1IC4H 4X4ZA 5IVZB 5IEHB 2HKFH 2R2EB 5CSGA 4CMMB 2H1PL 4X80H 1DBKH 4QOKE 3ARXA 1K3IA 3O11A 1YNTB 4TULH 3FT2B 1S8DA 3WNNA 2J5LB 4ZPVA 3O8XD 3X11B 1ZLVK 3SN6N 3LKNB 3TVMA 3EO1A 4QXTB 1EK3A 1ZLUK 4IIQA 5JHLL 5IW1B 4Z0XA 5I1KH 5IHBA 2RFXB 4LHUD 4N90E 3OKKB 5EO9B 3SBWA 3O6LH 2VDKL 2UZIL 1ZE3C 1I7UB 4HWZA 1BIIB 1OTSD 1BQLH 1UCBL 1FZJB 1PAMA 2VC2H 1R5WA 4XNYH 2XKNA 2E27L 3GJFH 3K46A 3LH2H 3Q6GL 3VD4A 2VZ3A 5KZCD 1WIPA 2FYYB 1P7QD 4FMKA 4N0YH 4QHNB 3MNZB 1I7ZA 5ALBL 5DD5L 2DQCH 1OT2A 3RWDA 4CU7A 3QI9C 4QHKJ 1H3WM 2GTZB 4HGWA 4QRSA 3ZYJA 2AK1L 4G43A 3RWIB 5ID0B 1AD0B 1UM6L 3B6SB 2I5YH 3QG6B 2Z91A 3U4AA 4I18C 4POYA 1D5BB 3MBXL 1JTPA 1R3HA 1AIFB 5JW3L 3LEVL 4EQ2A 4GXVH 4XNUH 5I1CH 3BZFB 5D7SL 3QUMA 2H8PB 1BFOB 1NCNA 4YDKH 2GY5A 4NNPH 1LEIA 1G7JB 5IHUL 1JRHL 5FDYA 3VWKC 3AREC 2F8XC 1RZKL 2R9HC 1BAFL 1X6NA 2YN5A 1JVKA 4BK4A 3P0YH 4XC3L 4RWHA 4G7VH 4K94H 5F3HA 3N1FC 4KK9C 3U82B 2WIIA 3O11B 1CDUA 1S8DB 3IJSA 4ZPVB 1TPXC 5HHOD 4FQHA 3BP5A 3TVMB 1N6QH 3ULUF 3H3BC 2XIDA 2NPLX 2YWYA 4IIQB 4NM8L 4PRIA 4Z0XB 4MDIA 4ODVH 4ZMAT 1F5WA 4L3CA 4S1QL 5IQ7L 1SJHA 2D0FA 4XMKH 4HWZB 4TTDC 2NY1D 1YEHL 3HC3L 4XPAL 2ORBL 5B4MC 2HTKC 5KVGH 3I6LE 4R96A 2FJHA 4NGHH 1R5WB 4LPUA 3O3AA 2VDRH 2XKNB 5GGVL 4HJJH 2X89D 4MJIE 3LPGA 2BRRL 3ZT6A 1VDGA 1IQDA 1GC1L 2OJZL 3V52H 1I7ZB 1NKOA 2Z8VC 5ITBL 1QSFD 3EYSL 3RWDB 2FEEI 4HGWB 4U7SA 3BMWA 4QRSB 4G43B 2Z91B 2ZUXA 3C5ZD 3N85L 1OTUC 1I7TA 1R3HB 1MSPA 3D9AL 5DDHA 4WTWA 4OGYH 4JM2D 3VXSA 3T77A 3L3HA 2FHFA 1GGCH 1QBMH 3QUMB 4U3HA 1INEL 2VJXA 1RMFH 5EZJA 1LEIB 1RZGA 5HVFB 5EWIL 2J6EA 1MCSA 5TDPA 1GSMA 3BZEB 1QUNA 1MNUH 5IW3A 5K93A 2EDEA 3B5GA 4N9GA 3ZDZF 5C3TA 1DANT 5F3HB 3UTTD 1RURL 4C57C 2WIIB 3PL6C 3IJSB 4FQJL 3UBXI 4FQHB 2FGWL 3BP5B 1GAFL 2D2OA 4FFVC 3VFSA 3ZKMD 1KXTB 4PRIB 4BUHA 2UV3A 4L3CB 2AJXL 5C0CA 3MLRL 3DMMA 1SJHB 1NCCH 3EJYD 5HGDA 5B21A 4R96B 1NUNB 2FJHB 4X98A 4PJAE 3T4YA 3O3AB 3OZ9H 4RFNB 2JCCF 4M00A 1A7QH 3MLWL 5BZDA 2DQGL 5DA0B 1CF8L 1RQ5A 3IDGA 4UT9H 1GRWA 1IQDB 5GISH 2FX9L 3V6OC 3IT8D 1U2CA 4RAVA 2JKXA 4KU1A 3OG6B 4AT6A 2AXJA 4P5TC 1DEEA 5LGHL 1OB1A 2FD6L 3QPQD 3QAZB 1RUKH 2NXYB 1F00I 2ZUQC 1IARB 5DDHB 1CD1A 3BFOA 3VXSB 3T77B 4ONFH 5ANME 3L3HB 5D2NA 3IU4H 5D1QA 1A5FH 3SDXA 5EZJB 3BKJH 1RZGB 2OQJA 5FYJH 5TE4L 2DMBA 2MOVA 4P23D 5TDPB 4OCNC 4LIQH 2J6EH 3JWDC 1ZXQA 4NOFA 1ACYL 1QTYT 1KN4L 3WKMH 1FC2D 5T1KA 5GRJL 3EBAA 4N9GB 5A3IC 4NZUH 4PRHD 1TDQA 4XP4L 5JXED 4TSCH 4WUUD 5HYSG 2Y72A 2AQ2A 2FBJL 4KXZH 1LQSR 3RX5A 1QACA 4L8DA 2HFFA 1JTOA 3VFSB 1XH3A 4GW5A 5IBLC 3DMMB 4OKVA 2EO1A 2CD0A 1ED3A 5HHXH 4U7MA 1DN0A 3V79C 4WVRA 5HGDB 1MCOH 3TPUA 2KL6A 4OBSA 4X98B 1EO7A 3RZWA 5LXGL 3ZYOA 5BZDB 1YA5A 3IDGB 5IW6A 2XOTA 4JZJA 1IEAA 3WFDL 5C0BA 1OAYL 4RSVA 4RAVB 4F15C 3G6DH 5IUSA 4AT6B 1RJLA 4ERSL 3B9VA 4IBLT 1J5OL 1KB9K 1DEEB 1OB1B 5T5NF 4OI9A 5IVXF 1T03H 1PX3A 3G5XA 2EDBA 3THMH 4PJEE 2BVQA 4G6ML 2D4DA 1CD1B 3MRCA 4OM0L 2DQHL 2H2SC 3S35X 5EG6C 5D2NB 4X7SH 2V17L 5MI0B 5D1QB 4NO2A 3SDXB 1J0YA 1HNGA 3BKYL 2NZIA 3D25A 2OQJB 4ZNCD 1RUML 5E94A 4IRZH 5KN5A 1JZ6A 5DRWA 3E6HA 5T1KB 2YRPA 5I8KH 4KFZC 2KZWA 2VOTA 1JHLH 1PKQE 15C8L 1P1ZA 4Y4FC 5L6YL 5CEXA 3ARFC 1HOCA 4Y1AA 2HFFB 1VFOA 3D18A 1T21A 3ZL4L 1XH3B 3B2VH 4XP5H 2CIKA 4WU7A 4NJAH 3CU7A 2FSEA 4GW5B 4NC1C 4OKVB 2IAND 3ZE0E 3LQAH 1JBJA 5LJYH 1MY7A 1ED3B 4JGMA 1ZGLA 1ZANH 1DN0B 4CNIA 1YC8A 3KLSA 3TPUB 1FLTX 1H8SA 2VERN 1Q0XH 5D72H 1XF2A 2DQEH 1DQDH 2V5RA 4AK1A 5IW6B 5L9DH 4WI4A 1KACB 1TJHL 4U31A 1R5VA 4JZJB 1IEAB 4TNVF 5C0BB 4LVHC 3ZHKA 1INQA 3VXRE 4HMEA 1A6WL 2OL3H 3G5XB 5FGCE 2BVQB 4LIQE 3LN4A 4X8JA 2CPCA 4NQDA 3MRCB 1OW0C 2YD2A 4JQXA 1JFQL 1NQBA 2XT1B 4NO2B 1B0RA 3EO9L 3B2UC 5JHDA 3D25B 4MYWB 1KUMA 1VFMA 4PJCE 4RX4A 4PJ7A 5E94B 5KN5B 3GEWB 4JREC 4PJ8D 5DRWB 4NN5C 4UI2A 2HN7B 3E6HB 3F65A 4YGVA 4QXGH 5DJYA 3VGEA 5D4QA 4GH7B 4U4BA 2ADIA 2HKHL 5DUPH 1P1ZB 4OD2A 5C2BL 1I9EA 1U3HD 5CEXB 5GS2H 1HOCB 4Y1AB 1FRGL 2WIMA 3GSUA 4JN2A 1OLLA 5F89A 3D18B 3R4DA 4Z7UE 5F8RC 1T21B 1P4IH 2CIKB 4WU7B 1D5XA 1IZJA 2FSEB 4NQXA 3FAXA 3IDXH 1EJ6A 2OJEA 5CBAA 4CNIB 5C70A 1V3LA 5IT2H 3RP1A 5DJZA 3LS4L 1NCTA 1ZV5A 3I50H 3CFCH 4AEHH 1XF2B 4C4KT 2HT4C 3PWJA 1R5VB 2CKNA 5D7KD 1V3KA 4JFZL 4D9QE 5B8CC 4UILH 2XKSA 3MV8E 4JDVA 4MA8L 5DS8A 3OB0K 1INQB 2HVJA 3MOBL 1VGEL 4X8JB 3LN4B 4YHNA 4NQDB 5D71L 2OSLA 2W9EL 4MQTB 4ZUUA 3OR7A 2GKIA 1B0RB 1ZA6A 5LBSH 5JHDB 2E9IA 4PRPB 2NY3C 4PJ7B 2D3VA 4L4VE 4WHCA 4WNQA 3W39A 1NCDH 2OBGA 3MJ9A 5IBTL 4YGVB 5DJYB 4MAYC 5IB5A 1JZ3A 1MFEL 1N0XL 5FHBH 4M6ML 4YQXL 1J9CT 2ADIB 1BJ1H 1I3UA 3FONB 3FRPA 2NX5D 2APXA 2G9HA 4FQ1L 5E08L 2F54D 1IC5L 5CIPA 3GSUB 3MR9A 4JN2B 4OZFG 1E4XH 5F89B 2EIBA 2VUOA 3P0GB 4M5YH 1WFUA 1D5XB 4H88H 4NQXB 3MSPA 3D0VA 3QNYA 5E1HB 2OJEB 5IVOA 5CBAB 5I6XB 1MRFH 1UCTA 5JIKA 5DJZB 5F21B 4IRJD 5FCUH 1DANU 4M7ZB 1Q72L 3L5JA 4XNMA 4LLAA 5ADPL 4Q9RH 4MLIA 3PWJB 3IDYC 4MJ5A 3ARBA 1GGIL 5SWSD 5EIIA 2R4SL 4JDVB 5DS8B 3QUXC 5GRXG 1FORH 1SEQL 3DOSA 5GGTL 4BZ2L 5GS0C 2AKRA 2HVJB 3C8DA 1FNGA 4YHNB 2OSLB 3HNSL 4RNRA 4LVNB 3GDBA 4ZUUB 2V9QA 3OR7B 3DTXA 4FQLL 2NXZC 1NFKA 2VDMH 3DARA 5GGVY 1ZA6B 3C6SA 4LASH 4Y2DC 4MB3A 4OLYL 2X4TB 4FN0A 2X40A 4WNQB 2QQKL 3W39B 4U1NA 1I8LC 5CGYC 1A6UL 5CJBA 4YUEH 3MGTA 2R1WA 5IB5B 2R0WL 4HFWA 1NL0H 3EOTL 4U0QB 4MJ2A 5FM8A 4W4OC 1X5ZA 2CJUL 4P4KA 3HC0A 2I24N 2W0FA 5L7XH 2G9HB 3ZTNL 2G5RA 5BRZE 5F1NA 3WUWB 5ESAA 3BEWA 3VFRA 5CIPB 3MR9B 4K7PX 4D9RE 3MOAH 4YFDB 2I9LA 3RZCD 3NABH 5TQ2H 3MUGA 2DQTL 4QHMA 3D0VB 5ALCL 3QNYB 3VCLA 4DAGL 3LD8B 1YY9D 5EU5A 2HMID 4FQXD 5E9DE 5B3NA 5ICYA 4JRYE 3I9GL 3LMJH 5E6ZA 4XNMB 3A0OA 3UC0L 4XXCC 2A77H 4MJ5B 3ARBB 4UIKL 4RGOH 1DQLL 2J4WH 5EIIB 4WHYG 4YDIL 3AC0A 3EDJA 1ZHBA 1YEEH 4POZD 2AKRB 4YHLL 3RPKA 1FNGB 4RFOL 2EZ0D 2IFFL 4RNRB 4NOBA 1FG2A 1KPVA 4ZO8A 3DTXB 5EA0H 3LDBB 1M1SA 5K33A 3CVHL 1ZS8A 3C6SB 5B3JE 3E8UH 1MHHA 4NQEE 3QUYA 1FNSH 2FEDC 3ISWA 3MODH 1LVEA 4U1NB 3JUZA 2DD8H 2VXVH 3MGTB 3DO7A 2NY2B 2R1WB 3VFTA 4HFWB 3EDKA 5IBUG 2OXGA 4LFHG 1EV2E 3ZYZA 2EC8A 4P4KB 1FE8L 3HC0B 3UROR 1ZSDA 2W0FB 1ZHLA 4NC2B 1S7XA 5F1NB 3C60D 4YJZL 5ESAB 3BEWB 1AHWA 2FIKB 3VFRB 5J1SC 3IAGC 2I9LB 4LCCC 1SEBA 4Z7NE 3MUGB 5IJVA 1R6VA 5E2JA 3NCMA 3VFGL 3VCLB 4P57A 1OAKH 4EN3D 2CUHA 5EU5B 2EH8H 2R0LH 4NPYA 3BIKA 4A6YH 4IEFB 1H3VA 5SWZE 5ICYB 2YWZA 1YDPA 1U6AL 1PG7L 3VMNA 1KJ3H 3H6JA 5I73C 4Y19D 1JZ4A 4F7CA 4UDTA 4OIIL 1BZQK 2BNUA 2A9NL 1ZHBB 1HH6A 1E0OB 3MZGB 3GUTA 4LLWA 4QKXB 2DIAA 1LO2L 1YMMA 3U7AA 2MTPA 1FG2B 1KPVB 3ZE1E 3U79A 4W68A 1ZS8B 2RB8A 4QRQA 5T1LD 1RZKC 1MHHB 3QUYB 3QXVA 5GS1A 1N6UA 5E5UB 2YOCA 4PD4J 2JIXD 4RA3A 3DO7B 4Z77A 3VFTB 5I8OH 4I2XE 4S2SA 1K4DA 1CDCA 5C09E 4JFED 5T1DH 4KKBD 3K80A 4QEGA 1FAIL 1V7NL 1ZSDB 1ZHLB 3JUYA 1C7TA 1S7XB 4LQ1A 3W0WA 5GZOD 1IJ9A 1AHWB 4M7JL 5GRVL 3WNLA 4XVUC 3SE4A 5IFHL 4LHQB 1SEBB 5IJVB 4IOFC 4M4PA 5MP6H 1NLDL 4P57B 2CR3A 2Q7NA 1FIEA 4RDQG 5FV2A 1HSBA 2YS4A 3G6JF 4F7MA 5F88A 4NPYB 1U8LA 3BIKB 3NIGF 5F7MC 1FYTD 1JCKA 1YDPB 1YNLH 2IMNA 3IB4A 4MCYA 4XPGH 3N9GH 4MNQE 4P2RE 1MRDH 5FM5O 3SOBL 4F7CB 1WT5A 4UDTB 3QIWA 3VFNA 1DQTA 2BNUB 1HH6B 2P8LA 3DLQR 4BSWA 3GUTB 4UTAL 1U8NA 4R0LC 3RVWC 2BDNL 1FCCA 4E41E 1YMMB 1WBYA 2B20A 3HMXL 4HBCL 1UWEH 1QFWH 4IDLA 5ILTL 5L88L 4QRQB 3MRQA 5GSVA 1MY5A 1YEIL 2HRPL 4F57H 5GS1B 5BS0E 4G9FA 2MHAA 4IDJL 3DPBA 3O8XC 5FM5M 4LLYA 2FECL 3MA9L 2VDQH 4GMTL 3TZVD 1KXVC 4S2SB 4AM0A 1K4DB 2BJML 4HZAA 4NC0B 4PS4L 4LPVA 3KPSE 4KDTC 2QLVB 3GBLA 3S36H 1WQVT 1J1XL 5IMKA 5JW4M 1RFDL 3W0WB 5EZOH 1PFCA 3D3VE 1OTSC 5KS9A 2V6HA 2EDHA 3IRZA 1T83A 4HBQA 4WFGE 3TBTA 2G60H 1UYWH 5DC0A 3K8KA 2DM4A 5E24E 3O0RL 4KROB 2P47B 1HSBB 4F7MB 5F88B 5DVLA 4C56A 1U8LB 1MIML 1BM3L 1I8IA 4EQ3A 1H3TA 2Q20A 1V7ML 5ACLA 1G7PA 2Z8WC 4P5MA 4MCYB 3WJJC 2IALA 3SGDI 2DRUA 4Y5XC 3K2UH 5GZND 1MVFA 3T0EA 1EH9A 1ZLVH 3VFNB 3QIWB 2X10A 5CCKH 4GS7B 1F3DJ 2P8LB 2X7LA 4BSWB 4O02H 3S96B 1U8NB 1JF6A 2L0DA 5EN2B 3GI9H 5EU7C 1E4WH 2P5EE 4KKCD 1WBYB 4I3SL 5BO1L 4QO1A 2Z9TA 4X5WA 3MRQB 1NC2D 3C08L 3DX6B 4GRWH 4EI5D 5DEZA 5I71B 5GSVB 4H0GA 4G9FB 2DQJH 2MHAB 1H15A 4QOKD 4YK4B 1MEXH 4LLYB 2G2RA 5D7LA 1KTDA 4OJFL 3MLVH 4AM0B 5JUEH 1DFBL 4S0SD 2VRAA 1X5KA 2IJ0C 5FYLE 5IMKB 4ODBD 5HGHA 2NY1C 3QI9A 5J12B 2COQA 4WEUD 1MCRA 1S9XA 4OF3A 3I2CL 5KS9B 1QRKA 1MPAH 4I8DA 3SGJC 1KF9B 3DVGA 1CZ8L 1TQCC 1GOFA 1KB5A 5BVPH 3R06A 3TBTB 4UINH 1MQKL 4N9OB 5D5MB 1GPOL 3A67H 4C56B 4P2OB 1I8IB 2VR4A 3AREA 3VWKA 4P5MB 3KYMA 3OKDA 4YC2C 2YPVL 1HYSC 4RA0C 5FGBC 5M95B 2IALB 4Q74A 3C5ZC 4F3FA 4PGJA 3ULUE 5FB8A 3T0EB 4JM2C 2Y5EA 4ZTOH 5DF0A 4X6EA 2X7LB 3SJVA 1RD6A 5IVNA 5E6ID 4OGXH 3RDTD 2AJUL 1IZKA 1IKFH 1HINH 3PWNA 2WUCL 4QNPF 1OP3K 4X5WB 5L2JB 4XVSL 4XCFH 4KVNL 2M8XA 2K9UA 5F9JA 1N64H 3SDYL 5KTEH 4MXVF 4ZUVA 1H15B 2AXFA 4WI6A 1MHEA 4PV8A 2ICWA 3O9WD 3UJTH 4XVTH 2G2RB 5D7LB 1KTDB 4EDWL 4R7NA 1BOGA 3KPRE 1LGVA 3O4LE 4BM7A 4J6RH 4DOHE 3TC9A 1J11A 2ID5A 2FX7L 1IAMA 5IM7A 4BKLA 2MWCA 1XCQA 2AJVL 3QI9B 5HGHB 4Q6YA 3V0AC 1S9XB 3TP4A 3UO1H 2R8SH 3QXUA 3C8KA 5KVMC 1TTFA 3R1GL 3DVGB 3NCYS 2YD4A 1KB5B 3R06B 4PV9A 3DETD 5E7BA 4LLDA 2QJDA 1NAMA 1NGPH 3K81A 4FRWA 3ZDZE 2EE3A 2D7TL 4JFDA 4GO6B 3EAKA 4U1MA 3VWKB 3AREB 3QHTC 3QDJD 5I1AA 3KYMB 5FIEA 2V7NA 3MRHA 5DZOA 1YECL 2DICA 4F3FB 4TPRL 5FB8B 2ESVE 3BGFC 4K3DH 3LRSA 5FXCH 3FN3A 4JCMA 3PL6A 1I8MA 3VXME 1TPXB 4X6EB 3SJVB 4GRWE 1M4KA 2EXYC 4HF5L 2YPKA 2F19H 2JB5H 3BEVB 3H9SA 3PWNB 5C0RH 2JCCE 1B6UA 4NQTA 3KNBA 4CVZA 5F9JB 3K4DA 3KXFE 2MPAH 4JKWA 4GKSA 3A6OA 4ZUVB 2AXFB 1G7IA 1MHEB 4PV8B 2ICWB 3L1OL 4F37K 2CKBH 1DSFL 4R7NB 1BOGB 1P5VA 4XB8A 1IQWL 2W38A 4DCQA 1KEGL 3VW3H 2VXQH 3V6OA 2APVA 5IM7B 4DTGL 4BKLB 2R0ZH 3MRMA 5CJQL 1XCQB 5LQBL 3OBAA 4C59B 4P5TA 2ZUVA 2K1MA 4V2BA 2BFVL 3CXDH 4J23A 4CDGC 1K5NA 3C8KB 4TRPL 3HLAA 5AWNH 3T0BA 1CFTB 4P49A 1CVRA 4PV9B 3D87B 3S5LA 4LLDB 4XBEL 2DS4A 1A21A 1NAMB 1RIHH 4IRSD 5C7XL 1NAMH 2YA1A 4JFDB 1ADQL 4U1MB 4MA3A 1MJ8L 1Q0YL 4HUVA 4F80A 5JPMA 5I1AB 3VGFA 2V7NB 4MWFA 3MRHB 4U33A 4OV6F 1J8HB 2Q6WA 4Y5YC 5A2IH 2DDQH 2R56L 3LRSB 2Q8BH 5CD5D 4W70A 4OLEA 4JQIH 3PL6B 3O2DA 1I8MB 1W0WA 3CLEH 4X6CA 4UMGA 4O5LH 2B5IC 1C08A 2JELH 2YPKB 5HGAA 1CE1H 1C7SA 3H9SB 1S3KH 1KN2L 2OMNA 5DYOA 3E0GA 4M03A 1D5ZA 3KNBB 1AQKH 2Q8AH 4CVZB 1NLBL 3WNMA 2C3HA 3M07A 3TVMD 4DKEL 2VZSA 4GKSB 1QSEE 1G7IB 1F4YH 5F3BA 1Z9MA 2XN9A 1E27B 1YEJH 4KHXL 5IVXE 4X7CC 4Z8FL 4DCQB 5TPWH 4ZUTA 1A3QA 2A73A 1LD9A 1W8NA 5BV7H 3MRMB 3WHE0 4EBQH 2VDNL 4P5TB 1K5NB 4G7YH 3S35H 1KELL 2ENYA 2ZUQB 3HLAB 5T3ZH 2FATH 5C71A 4OFDA 4JPKL 2B0SH 4OZGA 5KVDH 2W9DL 3S5LB 1N5AA 5TFSL 4PB9L 4BZ1H 5I1EL 5CJ5A 1YC7A 4MA3B 5KJRH 3FJTA 4O4YL 3RIFF 4XPTH 1BQHG 4DUVA 4HUVB 1IEHA 1OCWH 4UB0H 4NZTL 3JWDH 4HC1H 5FUOL 4MWFB 1IC4L 4X7DC 2HKFL 2PCPA 1NPUA 1NEZA 2Q6WB 2Z0BA 5IP4A 1C5CH 4X80L 5E6YA 5DURD 1DBKL 4Y4FA 4J3WA 1RU9H 5DVKA 1W0WB 3ARFA 4TULL 4X6CB 5J89A 5LWYH 2YBRA 4WI9A 3R8BB 1C08B 1QEWA 3RJQB 4YX2H 1GIGH 1Q9LA 4PJ8C 1JHKH 5HGAB 1H0DA 5I1KL 3L5XH 4U3CA 4M3JA 5DYOB 5GRZA 3X14A 3L3OA 2EDOA 1D5ZB 3O6LL 2ADFH 5F97E 3R0MA 1BQLL 1U3HC 2X4SA 2VC2L 5F3BB 2XN9B 4XNYL 4LRIC 4J3XA 4ZNEE 3LH2L 1TCMA 2KH2B 1DL7H 4ZUTB 4BFGA 2CLZA 4N0YL 2A73B 1LD9B 3QXTA 1FFPA 4YFEA 4F15B 1RULH 3CVIL 4YE4H 4XMPH 4QTIH 3K8LA 2YA2A 3LZFL 5FAAA 2I5YL 3X17A 2ZOLA 1OW0A 4OZGB 1Z9LA 1N5AB 4GXVL 3FQRA 4XNUL 5I1CL 2R4RH 2EDDA 3BP7A 3C5SA 1CGWA 5IB2A 4JO3H 4YDKL 4LCUA 4NNPL 2VABA 3SQOH 4FQCH 2ATKA 3N50A 4XX1G 3WV0A 1J8KA 2BNRE 1WK0A 4OV5A 3VXRD 3CLFH 3P0YL 2PCPB 1NEZB 1NUDA 5FYJD 4G7VL 3VXUD 4K94L 4PLOB 4Y4FB 4OZIA 3E6FA 3ARFB 1X5XA 3ULVF 1FFNA 2YBRB 5L8KB 3DXAA 4S1SH 1QEWB 2X9XA 1N6QL 3GFUA 1Q9LB 4JN1H 2EIEA 1M7XA 3C8HA 1H0DB 2VKWA 4ODVL 3X14B 3L3OB 3T0DA 4P9MH 1S7QA 4XMKL 1QRNE 1F90H 3D2UA 4FFZH 4APQD 2KZ1B 5FHAH 5IB1A 5KVGL 4JFFE 2X4SB 1AKJA 4NGHL 5C0NC 1WWCA 5C0CD 2VDRL 1AR1D 2PO6D 4NKMA 3OXSA 1R0AH 1FZMA 1DQML 4O9HH 5GJTH 1OSZA 5T3ZE 2XI9A 3V52L 4LVHB 1FFPB 5B8CA 4IRJC 4OI8A 5BQ7A 1KC5H 3UCRA 5CJOH 5D5MF 3B43A 3GSNA 2ZOLB 3LIZH 4OGYL 1WCBA 3FQRB 3UZEA 2A0LD 5I1DA 3ZKXC 5IJKC 2OTUA 1GGCL 3C5SB 1QBML 5IB2B 4YIQA 1N6VA 4LCUB 1RMFL 2ICCA 2ATKB 1FNAA 4JREB 1MNUL 5J11C 4NN5B 4OV5B 2DKMA 4H5SA 4W6WB 4MAYA 1P2CA 2P46B 4D3CH 3C87A 4OZIB 4MS8D 4LDEB 1R3IH 3E6FB 5HYSA 1FFNB 3DXAB 4R3SA 6FABH 4L4VD 5D7JD 1WFNA 4M8QA 2A6KA 3P30H 3RPIA 1QBAA 3L5WA 4U3XA 5IIEA 1S7QB 4U1SA 3T0XA 3D2UB 1NCCL 1EJOH 5IB1B 5ACZA 1AKJB 3TPKA 2DLIA 2YZ1A 3OZ9L 4GAYA 1MAKA 3S98A 4U6XB 1A7QL 3RZCC 4NKMB 3OXSB 1FZMB 4ENED 4UT9L 1OSZB 4J4PD 4KDWA 5GISL 4YHKH 1UWXK 1KENH 5B8CB 3QUXA 1YY9C 2DQFA 1WIUA 3MLSH 2GK2A 1CL7H 4K07A 4J8RB 2YUZA 3BPLC 4UU9A 1L6ZA 1RUKL 1YNKH 3GSNB 4LCWE 3U1SH 3DUHA 4YXHH 3GSNH 2EDNA 3F12A 1WCBB 4ONFL 1OP9A 5I1DB 1T6WA 1I8KA 1RZFH 2OTUB 3IU4L 2O5YH 1A5FL 1TETH 4YIQB 4Y2DA 1CXFA 1JP5A 1WWWX 3BKJL 5FYJL 2NY3B 1UKTA 4OB5H 2J6EL 5GGSY 3CZJA 4RRPG 4POZC 3FHQA 1I8LA 1Y0LA 4H5SB 3WKML 4MAYB 1I1FA 1FL5B 1P2CB 2EZ0C