2FJFB

Structure of the g6 fab, a phage derived vegf binding fab
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
223
structure length
218
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTISDYWIHWVRQAPGKGLEWVAGITPAGGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARFVFFLPYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light Chain of a VEGF binding Antibody
publication title Structure-function studies of two synthetic anti-vascular endothelial growth factor Fabs and comparison with the Avastin Fab.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 218
sequence length 223
chains with identical sequence D, F, H, I, K, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2006-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fjfB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fjfB01
4HIEB 3VRLF 3PWLB 1CE1L 4WW2A 1U8HA 1MCSA 4JFOA 2EXWC 5F7MC 5AZ2H 4I9WD 3FO1A 4R26L 2ZPKH 1MCBA 3GSXB 3RTQC 3BUYB 5M95B 4LKXA 3QCVH 1E0OB 2VDQH 5ELIA 4LCIH 3MQIA 5D1ZA 4DOHE 1CICA 4IMKA 3U0TA 4M03A 4OCYH 1Q9KA 5FYJH 3GSNB 4CN6A 3AREA 3EDKA 3KPRD 2VLKA 4OIBA 4XZUA 3U79A 3BIKA 5DJZB 2GY7B 1ZLWH 2FCBA 4HIXL 5A16B 1LILA 1I7UA 1UYWL 1A4JB 4PGCA 2YRLA 4R6UA 4R4BA 2XXMB 4EUPG 2J3SA 5HGAA 4DN3H 1OAXH 1YEKL 3RWCB 4MA3B 4CADB 1OY3B 4E5XA 3VCLB 5EIIB 3GSQA 5J6GA 1ZS8A 5HYJE 4P23A 1FJ1A 1JPTL 1A14H 3QG6A 3ULUF 2Q3AA 3K4ZA 4RISL 2NY5H 1NSNL 3D9AH 1C5DA 3BMVA 5ID0B 2AK4B 4ZPTA 4I77L 5ANMA 1Z6JT 4X9HA 4N1CA 2YOCA 4MZ2A 1IM9D 3A6CL 4RMUA 1BZQK 3SDDD 3CMOL 4FG6C 1CGXA 1I7TA 2ICWI 3QQ4B 4OT1H 3FOLB 3U0WL 3OMZA 5TF1H 1A6ZA 3PWJB 4G8IB 3ORJA 4MXWH 3MYJA 4KRPC 1OWWA 3MODL 1VGKB 3B3IB 2WINB 3AS0A 5T1MB 5IEKB 1T80A 2LTQC 1MFBH 3WDJA 2QSVA 2F74A 4MD0A 4WVRA 1R3HB 3BWAB 1LO2H 3O6FC 4U1MB 3IFOB 4KI5C 1J1XL 4RX4D 4XRCA 2HFGL 1PX3A 2Q86A 4GT7A 4QEGA 1K3IA 3E6HA 3AB0B 5JIHA 2GJJA 1P6FA 4RMWA 4Q7DA 1DBKL 3VGAC 4OLXL 4BZ1L 3MV9A 5AAMA 3MTRA 4OAWA 1MI5E 4BSJA 4XPGL 2NY0D 3CH8A 4WFEE 4TOYH 2VH5H 2XTJE 4TULH 3BOVA 4QGYA 4ZO9A 4FQXC 3C5ZC 2A6KB 1YYMH 3WMSA 4FRWA 1RK0A 5AZ2L 3RJQB 4I48A 2E7LA 2A6JA 4GG6E 4Z18A 5CJ5A 3QCVL 4KROB 4Y19D 2HRPH 4C55A 1G7LB 4LCIL 4X0KA 5DUPH 4BKLB 1ZHKA 1G7PA 3VD7A 2X4PB 1NBZB 4Z7OF 3HS0A 2QQKH 2NZIA 1MQ8A 3DMMC 4XP1H 3MGTA 1S9YA 3SJVE 4OCMC 1F4YH 1G0DA 4KK8D 1NH6A 1OAXL 1IGIH 3GSRB 3TNNA 1MFCH 2BZDA 3RX8A 4XNZC 1YN6A 1OT2A 3JV6B 3WLBB 3E8UH 3G6AB 1QSEB 4X5XA 2DYPD 3O8XD 3KS0H 2ADIB 1A14L 4B41A 4JLRA 4HX1A 1NL0L 2NY5L 1OGTB 4BFIB 2DQCL 3D9AL 4LVHC 15C8L 5GRZA 3IB4A 4O2CA 2Y5TB 3DXAE 1IKNC 1YEJH 3H3BC 4BZYA 3UX9B 1U2CA 3C60A 5MHSD 2RCSH 1Q72L 3MRJB 1JHLH 4HIJA 3SEPA 1U8OB 2AVGA 4R3SA 2YSSB 4MXWL 5GJTH 4X6FB 4AENA 4EI6B 1TNNA 4JFFB 2OL3B 3W11C 2YK1H 1J8HD 3TV3H 3FKUS 3KYMB 3OWEA 2ZSWA 4HFWB 3L3DA 5I75C 2H8PA 2R2BA 3NACL 1P7QA 4JO2H 4PJDF 4LGRB 5AEAA 1LO2L 2DD8L 5LAXA 4MNQD 2C1OB 2R15A 5E99L 1KSRA 1RUKH 3QCTH 5T1KD 3MNVB 2YWZA 1IAII 4OZIF 3BSZH 4WENB 3VWJA 4NQVB 2Z0BA 2E7MA 2B5IB 3IDMA 3JUZA 4U3CA 1IGTB 3QUKB 2W07A 3RX5A 4D9QE 1KB9K 2LVEA 2FO1A 5BVPL 1HHIA 1PW3A 2FEDD 2VUYA 1ZWIA 3KVQA 3B8YA 4XXCC 1EGJA 1JV5A 4TOYL 4KVNH 5FO9B 2VH5L 4KGJA 4CN1A 3KLHC 5CZVH 3S3SA 4LCUA 3BZEB 1NDGA 3T2QA 1KIPB 4Q58C 2XN9E 3UDWC 4OB5H 4NQEA 5DRXB 5ESQA 5I1IL 4PJAF 1UQSB 1PG7W 4KRLB 3OKOA 2HRPL 3GMRA 5DUPL 2GJ6D 2HLFD 5L2KB 3S4SA 2R1XB 4KK5C 2EC8A 1CFTB 4U1KB 4YXLH 4B53A 2JJSC 5BS0A 2OXGA 2APBA 2PXYA 2PW2A 2QQKL 2CIIB 1I8IA 5AYQA 1CFQB 3LKSA 3W9EA 4IOFD 1IGIL 4TVSa 2XZCL 2GTWB 4KV5F 4YZFF 4QRTA 1MFCL 3WIFA 3HCVB 3OKKB 1KC5H 3U30C 1EX0A 1P1ZA 3VFNB 5FO8A 1OOAA 5CGMA 2EKJA 3TCXA 1WLHA 4R4NC 1L4IA 3ETBF 1MVUB 3ULUC 4Z0XB 3RIAK 3T2PA 2NY4D 1TZIB 2GKIA 4ODXA 3REVB 1G9MH 1YEJL 4L3AA 1KPVB 3PE9A 5KBNC 2A6IA 4Y4KB 3FQXA 4ZSOE 2RCSL 3BP4B 5T3ZH 4R0LC 4P48A 4L9LC 2YPLB 5CSBA 1Z5LB 2AGJL 1JHLL 2JCCE 5I1GH 5EIVA 2ATPA 4CGTA 1JMXA 5C0ND 3SKNB 1SJHB 1UXWA 1G7IB 3MRIB 3TV3L 4NNXB 2IAMC 5FGBA 1C16A 5LQBL 4MX7B 1BD2E 1PLGH 2HP4A 4XNXL 3CDFA 5C8JB 1CD0A 4PJ9D 1F4WL 4AH2A 1T7WA 3QUZC 4QHUA 3LKNA 2MCG1 3ZTNH 5BV7B 1JNHB 1YY8A 4M5ZH 1N59A 1RUKL 1IM3A 1WGOA 3A0OA 1A9BA 3BSZL 4OF3A 5IK3A 1SY6H 4HJJH 1S7SA 3EOBB 3WN5B 2FYYA 3BVNA 1D5MB 2IFGA 3HUJF 3V6OE 1A1OA 1A3RL 1B0RB 1DN2A 5TE7H 3KNBB 3VWKD 1JYNA 3U6RB 1P5UA 4YDLC 2XI9A 3DUUA 3IXAB 5CZVL 5MEOA 5JTWA 1U91A 4KJPC 2XG4A 4KH2A 2B2XH 1A6TA 4LLMB 2O26U 3NA9L 4OB5L 5FFLA 3RPIA 1GSMA 3FB8B 4BQBA 1DJSA 4YHKH 4JZOA 2CIKB 4ODTL 3RHWK 1FZJA 1OD7A 2SEBA 4LP5A 4YFLF 3QDGA 3IETA 3IRZA 1GJIA 4CVUA 3HB3C 4YXLL 3SE9H 4M9OA 2WIIB 4XVUD 3QR2A 5ESVB 3AVEA 2G5BB 4HCRL 5EU6E 1JYWA 4GRLC 4H25B 1I8MA 4O51B 3O4OC 2PETA 1TNMA 4H1LA 4G8GA 1S9KC 2FO4B 3QDMA 1KC5L 1X6LA 3BD5A 3UC0H 5E7BA 5I66B 5B8CA 4QHKI 2A83A 5I9QB 1X5XA 2XWJB 4V1DB 3IDXH 3CNKA 4LOUD 4RGNB 4APQC 4PLNC 1G9ML 4Z7UF 3QEQB 2NXYB 1P4LB 2DQJH 3HE7D 2GY5A 3D2UD 3KWWA 3L1OH 4JDZB 5I8KL 1ACZA 3AMKA 3GBML 4P5TB 3VI4E 4K71B 5I1GL 4X8JB 3QJFB 5IV2A 3P73A 5HGDB 1ZSDB 5DD1L 5F7YC 1Q0YH 2VJXA 2UV3A 2BNUA 1IGYB 1PLGL 4PV8B 2R1YB 3EO0B 3SE3A 2P4AB 3TVMC 4F7TB 2WWMD 3ZTNL 4WUKH 5DD6A 3O6FA 4AM0B 5K93A 9CGTA 3FOMB 4M5ZL 3RUGF 1E27A 1LDSA 2VB5A 1UKTA 4F33B 2BSRB 1SY6L 2DJSA 4MNGA 3QPQD 2P8PB 1A1MB 5HDBE 1YZZA 3BN3B 3Q6FB 43C9B 3C87A 5GPRA 3F7YB 5ICYB 4MHHG 3ZKXB 1EMTH 5EU5B 1DQJA 2XQYG 1KPRA 1U3YA 2XXCB 5TE7L 4PJ7B 2OR8A 3TA3C 4ZAKC 4X7TA 5DUBA 4P59L 3ZT6A 2HTLC 4NUGH 4PD4J 4Y4HD 4GRMB 3RP1A 5HGHB 2AS5M 2B2XL 5BO1H 5ADPH 2Z91B 1PYWA 4DQOH 5IVXB 1H15B 4YHKL 5ABDE 2I27N 1B88A 3D39B 3CDCA 2Y7QA 2V17H 3HG1E 2CR6A 3SE9L 4C56D 4JRYA 4XP4H 3B5TA 3BISA 4NM8H 4D0BB 5ICZB 5A2KH 5SWZA 3AROA 4Y4FC 4AIXA 4YO0A 3P9LB 3NGBB 1X5AA 3INUL 1GGTA 1ZLUK 3UC0L 1KOAA 1LEKA 1VFUA 2R0ZH 3D87B 4HUWA 1XH3A 4FQ1H 2W0KA 3DJ9A 1XR9B 1FNFA 2FX8H 5DHXB 1Q9OA 3OPZH 1G7QB 4ZUTA 1FGNH 4UNVA 1FYTD 1GZPB 3KYNB 3L6FB 4WI5A 2RHEA 1Z9SA 3UZVB 1GVIA 3ZKSD 4HV8B 4KXZI 4LSDA 3FQNB 5EWIH 1LNUA 2ZOLA 4MD4B 1RJLB 3O9WD 3HPJB 1Q0YL 1CTOA 4E0RB 3MRGB 2YD6A 4X7EC 3C8DA 1G6VK 1BZ9A 1PKQA 3FRPG 1MCQA 5CSGA 3TN0B 1DQLH 1XFPA 1KIRB 2NY1C 2Z92B 4IHOA 4WWKA 2LU4A 4X6DF 4AY0A 1BOGA 5DQJB 3SOBH 5D2NE 4WUKL 3VRIB 2R56H 3HZVA 4G3YH 5L6YH 1WZLA 1NGXB 4RIRB 3WFHA 1K8DB 4ENED 2WZPD 5AUMB 1VERA 1V7MH 3ILPB 3UROR 3JV5A 5AZEL 1RZIB 5FUZH 3FMGH 3DI2B 1NJ9A 1I3GL 3SDDC 1R24B 3SHSA 1TJIL 3BW9B 4R97C 4U1JB 1EMTL 4P2RD 1HNGA 3MA7A 3NFPA 4WFFD 1DQTA 4OV6F 4XXCA 3UTQB 1CD8A 5H94B 4GH7B 1WZKA 3FTGB 4NUGL 5MERB 3TO2B 3RDTA 1AGDA 1C5CH 1JWSB 5BO1L 3UDWA 1KJVB 2VL4A 3MBEB 3U46B 4LEXH 4QRSB 1PQZA 2IADB 4WTXA 2V17L 1N8ZA 4YDJB 2AXJA 2QKIB 2ATKB 1UZ6F 3NN8B 1ADQA 4XP4L 4NM8L 1AR1D 2ENSA 2V2WB 2OCFD 4IRJD 4S1QH 3UTSB 3N1FC 4XCCH 5EBWA 3BP7B 4G8FA 3REWB 4PJBA 2E6JA 4X7DC 3VXMA 2FJHB 3VRJB 4LGSB 3WNNA 2UZIH 4DGVL 4HS6A 5TFSH 2NY0C 4PJHB 3C08L 2VLRA 4LLVA 4PG2C 3T0EB 1T04B 5JA8B 2R0ZL 1Y18A 5T33H 1X4ZA 1EFXB 2VE6B 1I75A 1OM3H 2FX8L 3HR6A 1GYAA 5LCVL 1RZJH 2BOBB 4P3CH 3OPZL 3HKFA 2LAAA 3GKZA 3QUYB 4N8CL 2X7LA 4EZMA 3JV0A 1OGAB 4NO2A 3S6CA 5EWIL 3EYFB 4PR5B 1TDQA 2VIRB 1RI8A 3MRHA 2BNRD 3PGDB 3QDAA 4PRAA 4PTUA 2APTA 3LD8B 4FP8H 5TH2A 1YEDB 4X4YA 1F42A 5KSUB 4QRPB 2DLEA 4G5ZL 5BOPA 4KK8C 3HHRB 4RAUB 4KI1A 3RKPA 2JELH 1HQRA 4I5BA 2JKXA 2X4UA 2ED7A 5DDHB 4UT7H 2EDYA 4WV1A 1I1FA 2VWEE 3ARBB 3P77A 4M9PA 1DQLL 5A2LH 2YN3A 3O8XC 3SOBL 2AJXL 4LSTH 4Z95H 4G3YL 2OTWA 3IXTB 3SDCD 4Y1AA 1D5BA 1KLFA 3IFLL 3QDJA 3OAZK 3BEVB 3AFLA 1J1PL 4ZOEA 1ZLVH 4BK5A 5FUZL 3FMGL 3BKYH 5IB4A 2XTLA 4LDOB 3CCHB 4L8SB 3LAFA 1EAJA 2E9BA 1GOHA 4JJ5B 3S5LG 4XH2A 3V95A 1MQKL 5FA3B 3WUWB 3HTLX 4K3EH 1WUNT 3SQBA 4RSVA 1CLOL 1QSED 4OKDA 4UUJB 2D7TH 3MV7B 5D6CA 1HNFA 4P49A 4LNRB 3MRCA 1YYLH 1TETH 3SGEH 1HHJB 4NQDB 4M6NH 1T7VA 3IAPA 4Z7QF 3TPUA 4LEXL 5SX5K 1S7VB 4X9IA 4KZEH 5DQDH 3GKWL 4LL9A 3ZKMD 2ZUYA 5E2WH 3WSQH 4OGZA 4S1QL 4XCCL 3WS6C 4MNHB 5T3XE 4MJIA 5C0CA 5IB2A 1UKQA 4KPHH 4GRLA 2DLFH 1CDJA 2W38A 4JFFD 2UZIL 5EBGA 3CFJA 3PNWA 5FCUH 1MUJB 5TFSL 5KSBB 3NBNA 2YXMA 2RAMA 2FEDC 4Y5VC 5IOPB 5JW5A 5K59E 3FN3A 2IF7A 1F58H 1UM4H 5T33L 2CK0H 1ADQH 1OM3L 3F6LA 1RZJL 2C3WA 5E00A 4P3CL 3NPZB 5CBAA 5FUOH 2UY7A 2V7HB 2H3NA 3FO0L 4YHZH 3QWRD 2OXHA 5E8NB 2HLFC 5C0GA 1RZKL 2DBLL 2F53E 3ZTJG 5F88B 5TDOA 3W9DA 2AV7B 1S9WB 5T1LB 1R3LB 1ZANL 1X7QA 1KCRH 4PV9B 1LGVA 1MH5B 4B5EA 4U1NA 4FP8L 4K3JL 5JDSB 4QRRB 1P7KA 4UV4L 3F7VB 4LAJH 2CD0A 5JIIA 1MCOL 4IOFC 2JELL 1QBLH 1DL7L 2V2TA 4UT7L 1KPUA 3KAAA 4LPXA 2DQHH 5J0BA 3B9KB 1XGYH 4Z95L 2DN7A 4DZBB 5FHAL 4MXVE 4CVWA 3MCKB 2NY4C 5LGJB 2BX5A 1QSFB 5GGVY 4PJEF 4OZIA 1JF1A 4XHJD 3SDAB 1QRNA 4NRZB 3RGVA 1DBBH 3BKYL 4OGXH 4NBXB 1DLHB 4RFOL 4N5UA 5BZWA 5EIQA 3HMXL 3KXFB 3OXSB 3EHBD 4OF6A 5C0NC 4PD4K 5KSBE 3MLUH 2G9HB 1A64A 4K3EL 5IMKA 2A9MH 5E94B 3TA3A 3MX0A 3H7LA 4ZAKA 3PABB 3VXSE 4S1DD 2D7TL 5D7IB 5FECA 4YC2B 1JGUH 2EDOA 2I5YH 1YYLL 4PJ9C 3GNMH 1NBYB 4M6NL 4X5WB 4PJAA 1PEZA 2CLZB 5D2LA 3NPSC 3DBXA 1AGEB 3DRTB 4KZEL 5DQDL 5EDXA 4Y4KD 4W6WB 1ZK9A 5DI8B 1AD0A 2EE9A 5E2WL 3BPLC 1I3RB 2HJFA 4L3CA 4E42B 1JL8A 1VSCA 2HFTA 1S5HA 2BNQB 3KPSB 4NPYB 4YDIH 3TBYB 1WITA 1T5WB 3N9GH 4KPHL 1I8KA 2DLFL 1DBJH 2XV6B 4NNYB 2FNBA 5ERWB 4XPTH 3K2MC 1H3VA 2KKQA 3K46A 5FCUL 2GUOA 1MRFH 2DQEH 4OF0A 4DUWA 2VZOA 3VWKC 4HLZG 2H41A 1IC1A 2CXKA 3M17A 1F58L 1UM4L 1P4BH 2CK0L 1P7HL 1MLBA 2CJUL 2BHZA 2GCYA 3BPCB 3JWDL 1NFIB 5EO0A 3OR7B 5FUOL 1BJ8A 4YHZL 4X9BA 2GITB 3OV6A 4Z7VB 2DLGA 1NEZB 4YXHL 1G1CA 1G7JB 4KTYA 4LLDB 3T8XA 3BH9A 5J9PA 2A6DA 5MEND 1RJCA 1C08B 1E28B 4RMQA 1KCRL 1QR1A 4PB0H 4XVUC 1TCMA 1R5IB 2V2XA 4XCEA 4GW5A 3VH8G 3WXVH 4M7ZC 2HT4D 3S96B 5GQBA 2EDWA 3MCLH 3C5SB 5TE6H 1NKRA 1FPTH 1QBLL 1FL5A 3CC5B 3HI5H 5I74B 2DQHL 5JHLL 1JWUA 1S7WB 5IMMB 1XGYL 1OWRM 4KHXH 4J2XA 2NR6C 1WWCA 4OV5B 5IW1B 4OZHB 4E41A 4LOUC 2ZP0T 3VFMB 2CDFB 3JWNC 2VN7A 1CXHA 3VDCA 5IQ7H 4WU5A 4PJGB 4OGXL 3HE7C 3KPSE 1HEZA 4GAYA 1IM9A 5JHDA 2OZ4L 5DMKA 3I6KA 2C7UA 1K5NB 3MMEA 2P7TB 2IC2A 1OD9A 1DQQA 4WGWB 4ZNEA 4QO1A 2F58H 3FRUB 3MLUL 5L0QC 4UDUB 4HS8H 1CXIA 2A9ML 1HOCA 5IT2L 3DVIA 2VQ1B 3M8OH 4OTXH 3CFKB 3AU1A 3FT3A 5FKAB 1MPAL 5ITFB 4PY7B 4V1DD 2I5YL 3BE1H 4G7VH 3MO1B 2AKRB 3G6JA 5J13B 5SWSE 3OR6B 1H5BB 1JWMB 1BLNB 5E8OA 2MNUA 2WWMC 3HRZB 4IDLA 3QEQD 1UM6H 3QRGH 4M62H 2AV1A 2GW5A 2FECL 2NY7H 4LASH 5CHNA 3B9DA 5E8PA 4Y5XB 3QPQC 1HDMB 5DA4A 1O5DT 3PWPE 4GFTB 2VXQH 4FXKA 1DBJL 1G7MA 4TNVF 5EU3B 5GGRB 1MRFL 3O4LA 2DQEL 5DD5H 3MPCA 4HMCA 5MEPB 3PIQA 2H26A 4PG2A 3IS1X 5J11B 5IKCA 4Y4HC 3T3PE 3VFTB 2BVPB 1NAMB 1NFKA 1D5IH 5E2JA 4ODVL 4OZHE 1QPXA 2NTFA 3MJ7A 3VD5A 2X4QB 1RUPL 4Z7UA 4I2XE 4TUOB 4XP9H 1A21A 3DNKA 1UWXK 1ZHLB 3MOBH 4HBQA 3GI9H 4JN2B 1JGDA 2IPTH 1ZTXH 1N0XH 3RZCC 1AKJA 3BPOC 2QTEA 3D6GA 3MRDA 3NIFF 4WW1A 1PY4A 5D72L 4NP4H 3ZE1E 3T4AB 5DJXB 3CUPB 3Q5TA 2B8OT 4CDHA 1XIWB 5TE6L 1FPTL 3RU8L 1HI6B 4FXLA 4L5FH 2P24A 1KT2A 5ITBH 2DYPA 4JM4H 3MREA 1K6QH 3T1WA 1PVHA 3RUGA 5HHOB 3L7EB 4BH8A 3D39D 5DJ8A 5DRNA 4WHTA 3T3MF 2XACC 2UYLB 4GSDH 2AXGA 4PRHE 5JUEL 1B4RA 3O3BB 1LE9A 1FZKA 3FFCE 4DVRH 5C0BD 2EEAA 3IDNB 4MQ7B 5FM5M 3H0TA 3KLDA 4IRSD 2JIXB 2F58L 3DTXB 3RNKA 2F54A 1OTTD 4HS8L 3O9WC 5LVEA 3FFDA 4G80B 3BZDA 4XT1C 5D6DC 3HPLB 1J8HA 4C57C 4O58H 3UTTE 1ZOXA 3E3QC 4OTXL 2PYED 4LLAA 4G7VL 5EC1A 4HUNB 2ITCA 5IB3B 4NQSA 2DMKA 4MNQA 1UM6L 3QRGL 4M62L 3U2SB 5T1KA 3CFCH 2NY7L 4JCLA 4LASL 4PGBB 3KPTA 3LKPA 1YPZE 3QO0B 1J8KA 2JLLA 2YUZA 3KYKH 4QTIH 4M6OH 2FJGA 1G9NH 4L3EB 5F9WB 1BZ7B 2IBZY 35C8H 4K3GA 3T2OA 5GGSY 43CAB 4PG9A 1IGMH 3WLWD 1SJVA 4OLZH 4K7FB 4YNYB 4QNPF 4RNRB 1VGEH 4LCWD 4Y5VA 5KOMC 2R1WB 2UZXB 4I4WB 1CK0H 4XCYB 4M48H 3CVHB 5FYLE 5DTFB 3QI9A 5KOVC 4W70A 4ACPA 3VXTB 2KQMA 4D9RD 3GJFK 3VXOB 4GG8B 3ARQA 3BEWB 1A6VH 2XKNB 3QXWA 4XP9L 4K9EC 3MOBL 4JG0H 3GI9L 2IPTL 2VZVA 4YUEH 1ZTXL 1ONQA 1N0XL 1Z3GL 3E6FA 1FLRL 2HJKB 1AR1C 4LVNB 1D5XA 1F3JA 4FQQA 4NP4L 3V5HA 1KLGA 4M7JH 2F15A 3JV4B 4NN7C 5CJ8A 5GSRA 1FG2A 4L9DA 3WYRA 5EUOE 3LKOB 1CZ8H 4KVCL 2J2ZA 2VDPL 5DC4B 3GRWH 3RKDD 3PQYB 2QADD 4QXUH 3PHQB 4L5FL 4FHBD 4X6DA 5EO9B 3TCLB 5ITBL 2GK0B 3MBED 1K6QL 4LBEB 1NFDF 4NZUL 2YD9A 3STLB 2EIEA 1RJZA 4YWGH 3QXDA 3AB0C 2R2HA 4Y2DD 1A6WL 4LPWA 1R0AL 1RHFA 4F57L 4L3EE 3UTSD 4NFCA 3ULVD 1RURH 4X9FA 2I07B 4QOKE 4DVRL 5IESH 4WUUA 2X4NA 1BX2A 4JAMA 3BP6A 3MOAH 3AY4A 3G9VA 1QLFA 1ES0A 4FS0A 4BSWA 2A9NH 2HVJB 3T0ED 5JIPA 5JQHC 4HIHA 1EFXD 2ZNXA 4QCIB 4JZJB 1Q9WA 3GI8L 3K8MA 4WHDA 3DPBA 3UPCA 5CCKH 3SDCC 1I7RA 4KROC 2FHFA 4KKLD 1TFHA 4YHMH 1OGAD 1WIOA 2AK1L 3KR3L 3NFSH 3KPMB 4WFHD 2WM0A 4HWBA 3KYKL 4QTIL 4M6OL 2EYRA 4Q6YA 1G9NL 1FFRA 5FA4B 1H3PH 1HCVA 1MIEH 3A67H 1MREH 1TCRB 3ARFA 3F8UB 3RI5K 2DWDA 1IGML 4IMLA 2EZ0D 4GW4B 4OZFA 4P4RA 3BXNA 1RZKC 2VDRH 5F9OH 1VGEL 3ARBD 5LKNA 4PRNA 3VWKA 2ARJB 1CK0L 1W0YT 4M48L 4HJGB 1BJ1J 4ZFGH 3BJLA 2BFVL 4PRIB 1FFPB 4EIGB 4F7MA 5HHXH 2BY1A 5FYJE 4HIIA 3AS3A 1D5ZA 2VOTA 5FDYA 1A6VL 1ETZA 2HWZH 3GMMB 5IJVA 4JG0L 4AG4L 3OKDA 2NNAA 4M93C 1IL1A 4YUEL 4YPJA 3ARGA 3ZKMC 1BFOB 4YIQB 3JXAA 3GSVA 2QSCL 4GQPH 1P9MA 4M7JL 2A2QT 1ED3A 2HTKC 3Q2CA 3SGEI 2CK2A 1CZ8L 1ZLSH 1A6PA 4N0RA 3MV7D 3GRWL 4QXUL 2MTPA 1T5XA 5EC2B 3HZMB 4LGPB 5LGKA 2AABH 2VSCA 1EH9A 3NCCB 2EDLA 4NT6A 5F7KC 4QT5A 1Z0NA 3HI1A 3VFWA 1EERB 1IVLA 2CO7B 3MRFA 2VLJE 3RWGB 3PV7A 3RWDA 5CS7A 3CLFH 2B5IC 5C71A 1M7IB 1OQOA 3UYOD 1JK8B 1FL6A 4EIZC 3MOAL 2VLLA 5BW7C 1N6QL 2C1PB 2RQ8A 5MEQB 4NCC2 5F70A 2IPUG 1JNLH 1B0WA 4PJ7F 1HHKB 3X17A 3DHMA 4KKAD 4NKOA 1RAMA 4MAYB 5FOJA 3BT2L 2RGSA 3QAZC 3U0PA 3TYGL 4MMZC 1R3IL 3WFDH 1QACA 3MLSL 1YMMB 4MJ2A 5IVXF 2X44D 5E6IB 4XGZA 3VFOA 4OFPA 4UQ2A 4XVTL 3LRHA 3S36L 3V5KB 4WI3A 4ZQKB 3NFSL 2PYFA 4K8RL 1RFDH 1J87A 4U2YA 4XHJC 2YA1A 2F5AL 4N9GB 3CX5K 3WL9A 5IHUH 4OGYH 3ARSA 1H3PL 4QRRD 5K9KB 1MIEL 3A67L 1MREL 4L4JA 4WO4A 3EHBC 1IC7L 2VDRL 2DIJA 3QFDB 4WHYG 1Y0LA 1T1YA 4PGEA 1K85A 3L5IA 1I85C 2ITDB 4S1DC 3B9KD 4JO1H 3UP1A 4GMTH 4HWBH 4ZFGL 4L29B 3D5OF 1H3XA 3QZWA 5I30H 2B4CC 2DLHA 5HHXL 3U9PH 3EYOB 3CDGB 4L8DA 3D25B 2APFA 5CEZH 2J6EH 5L88L 5DVKA 2JTDA 4ZUWA 4GLRI 3SDAD 4DJMA 1T4KB 4DK3A 2ZUQB 1QLEH 4OZFH 4TSAH 1NC4A 4Y4KC 3VDAA 4F9PA 3PL6B 1T1ZB 2ADFH 4JFPB 5JXEC 2N1KA 1FFNB 3EOTH 3MLXH 3RZCA 3DGGB 5C08D 2OQJA 3SDXF 3KXFD 4P9HL 1KN4H 3MRLA 1BIIA 5EB9A 3STBA 2J8HA 2P5EB 4U1SB 3WHE1 3UPRA 5DK0A 1ORQB 1W0WA 3TIDB 1TIUA 1ZLUH 3JVGA 1FVEA 3LV3A 2VLKE 2XIDA 1A7OH 3VXRD 3SGDH 3FCTA 1YMME 5IBUG 5KVDL 3OXRB 2FECI 3LDBB 5IG7B 3SY0B 5I2IA 1BVKA 3TYFB 2BP3A 3NZHH 5HYJA 2AABL 4HKBB 1NCNA 4IS6B 3FT4A 4TNWK 3CFBB 1XF4B 1X5LA 5EPMB 3CLFL 5INCA 5IGXL 5B39G 5SX4H 1RPQA 2O5XH 3WN5C 2BVQA 5ANME 1CXEA 4LARH 3P4MB 3ZTJH 2HT4C 3R0NA 4XXDA 1JNLL 3CPLB 5F21B 5IQ9A 5D6DA 5H35A 4KGLA 1FAIH 4HIEA 3RBGA 3PWLA 3HAEB 3OAYK 5BQ7A 3G5VB 4LRIC 1CG9B 5D7KD 2VKXA 5EUKB 4D0DB 2BVOA 1YEHH 1LEGB 1FP5A 4YPGB 2BERA 4WI4A 4ZS6D 3EJZD 3GSXA 3TJHD 3BUYA 5DUMH 3J8F7 2IH1B 5I73B 1RFDL 1LO3H 3OZ9H 1XF2B 1J88A 1YDPA 2X2YA 5DA0B 1OVZA 3PWUB 5D1XB 2D3VA 1BF8A 1F4AA 5EOTB 5IHUL 3ULVF 5DJZA 5HHPA 4X7CC 5A16A 1A4JA 1KJ2B 4JR9L 2PO6B 1MCLA 1FZOA 1MI5A 4FNLL 4NZRH 1AQKH 3RWCA 2ID5A 4MA3A 4PJHF 4CADA 3MV9E 3I50H 4P57B 4U3XA 3VCLA 5EIIA 4JO1L 4GMTL 4HWBL 1PX4A 1QA9B 5I9QC 1UXSB 4MQTB 5I30L 4H5SB 4CMMB 3U9PL 4PJCB 1INQB 3FO9B 5CEZL 2J6EL 2IWGA 2XT1B 5ID0A 1AQDB 2AK4A 4Y2OA 3WIHA 1JZ5A 2NXYC 1QLEL 4OFYD 4TSAL 1BWWA 3MV8B 2ADFL 2HLAB 3H3KA 1EHLL 3QQ4A 2R0WH 4U7MA 4K71C 5J57B 1KN4L 2R0LH 3D48R 4UOW0 4JB9L 3FQWB 3PWJA 4G8IA 4DEPB 3SJVA 1TQBC 4J4PD 3MLTB 3HE6B 4OCSL 1AI1H 4ZFOB 2X4SB 5IEKA 1BVLB 1S9VB 4OLYH 2VRAA 4EI5B 3K2UH 2HFEB 3NZHL 1R3HA 3BWAA 4OSUH 4U1MA 2AEWA 4JKLA 5IVNA 3IFOA 3ECBB 5T3ZE 2VDKH 5KANG 5JOFA 2OX5A 1XEDA 1I8LC 1EK3A 2VXSH 2QQNL 2NZ9D 4R8WH 3UBXB 4U7KA 2N7BA 2YBRA 5GIRA 5I8CA 2O93L 4XX1G 4WDIA 3ZL4L 2EEBA 3BWUC 3I6GA 3ZKXC 4GRWB 1MF2H 5BRZB 5JNYB 3TWCL 1UFUA 3UJIH 5C0AB 3BH8B 2G60H 1FAIL 1PSKL 4N1HB 2R4SL 5GGTL 3ZZ1A 1QYGH 2KH2B 4R2GD 4OCWH 4ZTPL 1DEDA 2A1WH 5TDNA 4EKXA 5DUML 5DVMA 5EOCJ 3EUUA 4RRPA 2HKHH 1G7LA 2I24N 4BKLA 3OAZH 4JVUA 1I9RL 1LO3L 2OSLA 5HYSB 5F9JB 3OZ9L 4PYGA 1TZGH 5GGUB 2X4PA 1NBZA 1CTNA 1PG7H 2OLDA 3C5JB 4J1UB 1W72B 3WNPA 2W1NA 1DUYB 1GAFH 3HNTH 4Q6IC 1JTTA 1Q94B 3DROB 4IRSC 1MCPL 3GSRA 3I9GH 1OTTC 2EO1A 4NZRL 1AQKL 4O5LL 4OUUB 5F6HI 3NGBC 2E9IA 3ALWA 3JV6A 3I50L 3G6AA 1QSEA 4LHUA 5DC9B 4RGOH 2ADIA 2X70A 1NCDL 3OAUH 4RFNB 1OGTA 5SX5H 4BFIA 2XN9A 1F3DH 5KN5B 2Y5TA 5EA0L 5GS3A 2OMBA 1WFNA 3GMOB 3NIDF 4XWGH 2X1WL 4R96B 3SKMA 4PJXE 4NQEE 3MRJA 4QXWA 2R0LL 1WSST 4I1NB 2JIXD 2YSSA 5KVEH 1SYSA 1FYHB 4X6FA 4EI6A 5JIKA 2JJWA 4JFFA 2OL3A 1YMHB 4ORZC 1S7UB 3MNWB 5BS0E 5AWNH 3WLWC 3QHFL 3KYMA 3WIHH 2Y9RT 1A6UH 1NLBH 4K9EH 4GJTB 4HFWA 4CN4A 3WFZA 4OLYL 5GRWA 3TN0C 3K2UL 4GUPB 4OSUL 2PW1B 1FSKB 5J12C 5FUCC 2VDKL 4LHJB 1EHXA 5KANI 2C1OA 3MYZA 1DE4B 1E6OH 4P3DA 3I3BA 5HHVH 2VXSL 2ZUWA 4MQXD 1Q38A 3IDGB 2KBGA 4R8WL 1MLCB 4JO4L 4NQVA 5GRJL 3GBNH 7CGTA 1JNJA 5GGVH 1AHWA 2JJTA 3QSKB 1IGTA 3QUKA 1FL3A 3RTQB 25C8L 4XVJH 1T83C 2X4OB 4U1HB 1KACB 1N7MH 1U93B 3UJIL 5I8OH 3QNYB 1RMFL 1CDCA 2OK0H 2G60L 2PN5A 5FO9A 4Z6AT 3K1KC 4Q9CA 5D7IF 1UEMA 3RKDC 2QADC 4MCZB 1BD2A 5IFJA 1QYGL 3BZEA 4OCWL 1KIPA 2HG5B 2NX5B 2A1WL 2P5WB 4JPVH 3MBEC 3ARRA 5DRXA 2FATH 1UQSA 4MXQD 4OZGB 2IPKB 5L2KA 2R1XA 4LLQB 4JFZL 4Y2DC 3FQRB 3WEXB 1T89C 4U1KA 1PG7L 3KJ6H 2CRYA 4U6HA 2NYYD 4KHTH 3TO4D 5J6HB 3ULVC 2CIIA 2W9EH 1GAFL 3HNTL 5TE4L 3V4PH 1CLZH 1CFQA 4KMTL 3I9GL 2GTWA 3WFBH 3HCVA 3OKKA 3PQYD 1N6UA 3VFNA 1CI5A 4GKNB 5E0QA 3T0EC 4RGOL 1C5BH 2AEQH 1MVUA 1U95B 4F15C 1FO0L 4Z0XA 5GGRY 2R9HD 1TZIA 4Z78A 4KKLC 4W68A 3SO3C 4Z7VF 1KPVA 3W0WB 4XWGL 4Y4KA 1HSBB 4OJFH 3V6ZB 3BP4A 1L9MA 4JANB 5JXEA 3DRQB 4LMQI 2YPLA 2Y1VA 1Z5LA 1HH6B 1F97A 2ICWB 2LFGA 1LQSR 1D6VH 3KLAA 2JF1A 3SKNA 1SJHA 3RWFB 3QDGE 2CQVA 1G7IA 4W6XB 1T21A 4Z9KB 3MRIA 4NNXA 5AWNL 1CL7H 4LF3A 4YK4B 5CZKA 3VGAB 4TTGA 1A6UL 1NLBL 5B4MD 4MYWB 4MX7A 4TRPH 4I0PA 3ARBC 4WFGE 4Z0BH 3MRBB 3TH4T 5E5RB 1JNHA 1U8KB 3R06B 4OZGE 2Y07H 3QXAA 5HHVL 3ZE2E 4LSQH 5I16B 2COQA 1ZT7B 1TZHB 2E9JA 5I19H 4PJGF 4OLEA 4PJFB 3GBNL 5GGVL 1XGRA 4AQOA 2Y4SA 3DVGB 4L8SC 3EOBA 3WN5A 3O2VH 4D9QD 4XVJL 4OLUL 5DJ6B 4RBPK 1N7ML 1D5MA 1FRGL 4UIKH 3LEYH 1B0RA 2OK0L 4XTRD 3KNBA 3U6RA 1I9IH 3GFUA 3L3KB 3HC0B 5C9JB 5CZXD 3IXAA 4KKNA 2ESVB 4A2MA 4PRID 5D96C 3DO7B 1U8IB 5DJDA 4M02A 2FEEL 4ORGB 4J7RA 5IROC 4LLMA 4JPVL 1NGPH 4G9FB 1BECA 2QJDA 3FB8A 5E5MB 3PV6B 1QBBA 4R7NB 2CIKA 3VGDA 5JA9A 1RHHA 3B2VH 5IHLB 1UM5L 3RVXD 3LB6D 4KI5E 2BHYA 2WIIA 3U83A 4X5LA 5ESVA 2W9EL 1CCZA 3V4PL 1CLZL 4LVHB 1UWGH 2G5BA 2QLVB 4J3XA 4H25A 3OB0K 4Q9BA 1NEZG 3H6JA 1QNZH 1NCCH 3A6BH 3RVVD 3WFBL 4EUPB 2FO4A 4XAWH 2XYCA 5DMJB 2X4TB 4UOW1 2MJWA 4FQJH 3HNVL 4P9HC 4P5KB 4RMRA 4KKAC 5GRYA 1K2DB 5ALCH 1KJ3L 4DKFH 4XI5D 2XWJA 2FGWH 1MEXH 2CLVB 1M4KA 2IFFH 3T65A 3K4DA 2AJYH 1DBAL 1P4LA 5E2TL 2B1HH 2CH8A 2CLRB 4OJFL 3MCG1 4JDZA 3C8KA 4P5TA 2GSIB 4OQTH 1BAFL 2BVEA 1D6VL 5E9DE 3BQUB 1KLUB 1HINH 1NBVH 3QJFA 1C7TA 3BKJH 1ZSDA 3QUXA 1VFOA 4OD1H 3X11A 4YDKH 4DGYH 4MAYD 4TRPL 3DETD 5I1EH 1IGYA 4PV8A 2R1YA 3EO0A 4Z0BL 3UCRA 3QQNA 5SWZE 1GC1C 4F7TA 3GK8H 3B9KC 3VFSA 4EQ3A 1QRKA 4NRXA 1X9QA 3P4OB 3TPKA 4AM0A 1WFTA 1CVSC 3FOMA 2Y07L 3OSKA 1QOKA 5I1HH 4L4TB 3L3IB 1CXLA 1UWXH 4LSQL 5DD0L 1LO4H 3O45B 2DBJA 4F33A 4RZCB 2XZQH 3SDAC 1J5OH 1MJJB 3S37H 5I19L 3BD4A 2BSRA 4HEPG 1MJ8L 5JOPE 1BEYH 2P8PA 1KEGL 1A1MA 3QDHA 3Q6FA 1OPGL 3O2VL 3F7YA 5ICYA 3MXVH 2DMCA 1E4KC 3SBWC 4K3DL 4UIKL 5BV7H 5FCSH 3KDMA 1SVCP 4PJ7A 1I9IL 2X1QA 3S88H 2X9WA 1KCLA 4LLWB 4UDTB 4YC2C 1QLRB 1RZFL 1FE8H 1AO7B 4GRMA 1GGIL 4LSUH 5HGHA 1NGPL 2YN5A 5DO2D 4EEEA 1N4XH 2Z91A 5IVXA 3O2DL 1A7BA 1WCBB 4WJ5B 4QGTA 1H15A 3V6FB 1GGUA 1ND0B 1WK0A 5K9QG 1KFAH 2Z35B 3ZDYE 1CR9H 2DF3A 4JPIB 4MGXA 3VXPB 4ZFFB 5L8KB 1T20A 4D0BA 2IMMA 5TF0A 3O6LH 1UWGL 1OB1B 5ICZA 5F7UA 5T5FH 1QNZL 1NCCL 2RB8A 3A6BL 4OZ4B 1XCTA 3KG5A 2XNAB 4CU7A 4HULB 2MKLC 4WI2A 5J3HD 3P9LA 4XAWL 1B6DA 2CKBA 4FQJL 4NZTH 1MWAB 2DDQL 3QWOB 5ALCL 4DKFL 4POZD 3D3VE 3MRMB 1MEXL 4Y8DC 1XR9A 5IVZA 4L4TE 2K7QA 3N1MC 3VRLE 2QEJA 5HHNB 5SX4I 1G7QA 4ZS6C 3TJHC 2OR7A 3EJZC 1GZPA 3KYNA 3L6FA 3KPNB 2B1HL 4ZOAA 4ETQB 3FQNA 4KMQA 4XBGB 4OQTL 5HY9B 4MD4A 1HINL 3ESVF 1RJLA 3BKJL 5D7LB 4M6AA 1MHCA 2B7DT 1V3KA 1SYVA 5BZDB 2E27H 3MRGA 4YDKL 4U3HA 5I1EL 2DQTH 1KELL 3ARDB 3AM8A 3PDDA 1AO7E 2H32A 2YR3A 5DD3H 1KTLB 3TN0A 1VADB 3GK8L 1KIRA 4R4FL 1IKFH 2Z92A 3VXME 5KVGH 3VRIA 5DQJA 3GJFH 2CSPA 1WFUA 2J8UB 3C9NB 3MLRL 1AY1L 5I1HL 1YNLH 2NXZB 4JY5H 4B0MM 1K8DA 3O81A 5ACZB 1S7XB 3S37L 3U4BH 3ILPA 3RL2B 3KPQB 4OF5A 1BEYL 1RZIA 5DRWA 3ULUE 1XGPB 3QEGH 4JFEB 5F3HB 3CMGA 3L7FB 1R24A 3MXVL 1IEAB 3BW9A 4P2QB 4U1JA 4V2CB 1MRCL 1T83A 5C0RH 1L6XA 4KU1A 1WWBX 5BV7L 2PO6D 2VAJA 4PJ5E 4KTEH 3O3AB 3PUCA 4J4PC 4HQQH 3UTQA 4UNTA 3S88L 3TFKD 3D85B 3EBAA 2KDGA 5I18L 2Z93B 2W0PA 3FTGA 5MERA 1FE8L 3Q6GH 1JWSA 5J13C 1KJVA 1N4XL 3DGCR 3MBEA 3TH2T 2LVCA 3U46A 1XZ0A 5J1AB 4DVBA 3DX7B 3PXJA 2IADA 4HWUA 1KFAL 3U1SH 1KCUH 4C83B 3MV8D 3MRNB 3HG1D 4FQIH 4YDJA 1NCAH 2QKIA 3THMH 1MHPH 2ATKA 1T89A 2NZ9C 3NN8A 1CR9L 4Y5XC 3S34H 4PRDB 5GRUH 4Y1AE 1QFPA 2V2WA 4ELMF 4FZEH 3BP7A 4GO6B 4NWUL 3HA0A 5T5FL 3REWA 3QEHB 2FJHA 3VRJA 3QDJE 1PZ5B 4DUVA 1WC7B 2XA8L 4H20H 4HFUH 3HE6D 4ONHB 1HIMH 5FYKE 4DFHA 4NZTL 1FNEB 4EI5D 2ADGB 3T0EA 1T04A 1UGNA 1RY7B 4H0GA 3CZFA 4A6YL 2VE6A 1EFXA 4OFDA 5C07E 1ZHNB 4R2GC 3WFEL 1HHHB 3RIFK 4HUVB 1NGWB 1XGQB 3VI3F 5C2UB 3QUYA 1MHHB 3EFDL 3WIIL 3N50A 1HILB 3FHAA 3EYVB 5IR1B 4PR5A 4S0TD 2CKBH 2VIRA 2Y36H 1OL0A 2FX7H 5BRZD 1WV7T 5F7FA 1YEDA 3IDJB 2A74B 4AEHL 4QRPA 5C0AD 4M1DH 4AL8H 2HN7B 1XIWC 4Z7OE 2E27L 4XVSH 1M6OB 5C0DB 3QH3B 5DDHA 3ARBA 4L4VD 1IKFL 5GRVL 2CRMA 1ZVSB 4NOFA 3IXTA 1FC2D 1YQ2A 2PTTB 1YNLL 2HT2D 4JY5L 5H2BA 4UZGA 4N90E 3T04D 2CDEA 3U4BL 2EDDA 2AJVH 5I76B 3BEVA 1DR9A 3P40A 4W4NA 2H32H 1ZXQA 4ONGL 4NQCB 1VESA 4RAVB 5C0RL 4JJ5A 4CDGC 1R5VB 1MIMH 4KTEL 5IEHB 5FA3A 3WUWA 3MSPA 4HQQL 4XC3H 4YAQB 5DJ2B 3MLVH 4UUJA 3TF7C 1FH5H 2JB6B 3MV7A 4LNRA 2IQAB 4BYHA 3LQZB 3Q6GL 1G0YR 1JFQH 2JE8A 1J05A 1HHJA 1RVFH 4NQDA 4Y4FB 3F7PC 3WE6B 4FQHB 1S7VA 2WQ8A 4PJDE 5HD8D 1NQBA 3CVIL 5ESAB 2VQUA 3SDYH 2DKSA 5GRUL 1KEMH 4OFVA 1S7QB 5IF0B 1VKXB 3CSBA 4FZEL 4MNHA 1MOEA 4JDVB 4OZIE 4QRUB 1LO0L 4G6FB 4H20L 4HFUL 1MUJA 4JZNB 5KSBA 4P4KB 4OBSA 3DO3A 3QISA 3HLAB 3VXSA 3KPRB 1PGRB 5HYQB 2VXTH 2OI9C 4Q9QH 1PDKA 2OBGA 4BFEA 1INDH 3ULVH 1X6NA 1S78D 3TM6A 1DEEB 2V7HA 3LOWA 4MXQC 3LEXB 1ZT1A 3DX9B 3F62A 5E8NA 5J06A 4NZJA 4YJZL 1T1WA 2ZUTA 1UB6B 5C09D 5KSAD 5GSVB 5F88A 1NCWH 3IFPB 2CKBL 2Y36L 2AV7A 4PJAE 3DECA 2UZYB 1R3LA 5T1LA 2EDQA 4L8CB 4PV9A 1MH5A 5DQ9B 2NYYC 3TO4C 5JDSA 3F7VA 3S36X 2P47B 4LAQH 4M1DL 5HGGS 4AL8L 3MR9B 2A77H 2ZKHH 2OTPA 2FEEI 2GTZB 4XVSL 5CEXB 3L5WB 2AEIT 3SDDB 2IGFL 5EU7E 3B9KA 4HKJB 1WCQA 2NX5D 2P5WD 2KL6A 1PBYA 1Z9OA 3BN9D 4DZBA 3HUJB 4KV5E 3MCKA 4YZFE 5D70H 1DBMH 1OSZB 3DSNA 5CBEA 2VABB 1L7IL 2C3VB 4O2EB 5LGJA 1Q0XH 2C3HA 1QSFA 3SDAA 2AJVL 4P46D 5HHMB 4NRZA 4ERSL 3IU3B 4I9WE 1DLHA 1H8SA 3QIBB 2W0FB 3T1FB 1BVZA 3KXFA 1F2XK 3SBWA 2J4WH 3TBTB 4CW1A 4LNVA 2UWEB 4JM2A 3OXSA 1CD1B 2JK5B 1DZBA 2G9HA 3RA7H 1ZVYA 5E94A 1B2WH 4GW1B 3PABA 3MLVL 3QFJB 5D7IA 1FH5L 5B4MC 2YUVA 4N0FB 1JFQL 1UA6H 4Z7WB 1U8JA 2BCKB 1RVFL 1NBYA 4AMKH 2R69L 4X5WA 4ZYKB 1JZ3A 2CLZA 3LPFA 1U8QA 4YGAB 1AGEA 5IMOB 4KAQH 2NY0B 3DARA 3W0WD 3X14B 5E4EB 4JE4B 5DI8A 1A4KB 3SDYL 5K33A 1BQHG 4E42A 1R5WB 1CL7I 3KPSA 1NAKH 5T3XD 2BNQA 3CSYB 3TBYA 1BFSA 1T5WA 2V9QA 4S0SD 3D18B 3O41B 4NNYA 4WIQA 5EN2B 1G7HB 5TDPB 3WJLA 5LWYH 5IIEB 1LP9B 1ZA6B 2B0SH 3OAYH 3V5DB 4XTRC 4NCDA 5H37G 5I1AB 3ZDZF 3DI3B 2EDRA 4ZNEE 5CZXC 4J23A 3HUJE 2HAZA 1IZJA 3NCYS 2P1YA 4PJCF 2GSGA 1VCAA 3OR7A 1EEUA 3UO1H 4TUKH 1NEZA 3CK0L 4AIOA 1G7JA 4LLDA 1NCWL 4M6ML 3RVXC 3O8XB 1E28A 2F9BT 3LB6C 2PTVA 3WV0A 5FYJU 3NCJL 3S96A 4LAQL 5HSFA 2A77L 4NFDA 2HFFB 3C5SA 2XQBL 2M8XA 3CC5A 3KYAA 3RVVC 4JKKA 1J12A 1WBYB 3PWVB 4GKZB 2F8VA 4DK6A 4CJ0A 1S7WA 1I1AD 4XI5C 1MFAH 5D5MB 5D70L 3GUTB 1JPGA 1XMWA 1NMBH 1DBML 5IW1A 4OZHA 3VFMA 2CDFA 5T3XL 4PIRF 4ETYA 3AXLB 3ZLQC 2BY2A 3V0VB 4PJGA 4OFYA 3C6LD 4N0UE 4XNUH 3L5JA 4B7LA 5ICXB 4Z7UE 1K5NA 5JOEA 2LU7A 2J4WL 4Y19E 4GRWF 3OBAA 4DW2L 5E1HB 4UDUA 3MLYL 1F00I 4OM1H 1B2WL 1AXTH 3EYQD 1A3LH 1J7VR 4HH9B 2DQIH 3VGHA 2VQ1A 4MAYC 3CFKA 3DETC 3QQ3B 5FKAA 1I7UB 5ITFA 2KZWA 3OKNB 4UU9B 4PY7A 1UA6L 4R4BB 3LH2H 3OR6A 1H5BA 1J1OH 1BLNA 2VR5A 3HRZA 4QTHB 4KAQL 1VDGA 2YD8A 5CD3B 3QNZB 3ROLA 3K74B 4AIZB 2NY3B 2W91A 4NDMA 3EDEA 3RUGE 1HDMA 5D1QA 4EN3B 5I71B 5GS1A 1S3KH 2G2RB 5EU3A 4PPTA 5GGRA 3O6MH 4PFEA 3V6OC 5LWYL 5MHSE 2HMID 2B0SL 1QO3A 5MEPA 3PDGA 1FFOA 1N5AB 4QHKJ 3W39A 3MJGX 1OP5K 1KXQE 3VFTA 2BVPA 1NAMA 3L5XH 2VDLH 4PRBB 5DO2C 1J8HE 2X4QA 4TUKL 4TUOA 3G04B 2ZUQC 5FKPB 4LIQE 1A1NB 5A40E 3AC0A 3PL6C 4MD0B 3VFUA 4WCYL 1J18A 1YPZA 1NC2D 4XRCB 1YUHA 5HXMA 4MNQE 3AGVA 4QLRA 2NY4B 3D1MC 4OI8A 3T4AA 5DJXA 3UBXG 3CUPA 4C58B 1RIVH 1XIWA 3BI9X 3L3JB 3BD3A 1F8TL 4UIMA 5J3HC 5E1AB 1HI6A 5JPNB 2BMKB 2DQDL 2VDNH 4POZC 1MFAL 5A2IH 4NN6B 1NMBL 3V52H 3S8WA 3SCMD 2DQUH 5KS9B 5HHOA 1DQDL 3L7EA 1WEJL 3LRSB 5BMFH 3BFOA 1YNTA 2UYLA 3CIQA 4CL7A 3P9WB 4PJ9B 2A6JB 3O3BA 2EYTB 2B1AH 3QG7H 4UT9L 4XBEL 4MQ7A 1ZHKB 2GJ6E 3DTXA 5HYSG 4K2UL 3X13A 4OM1L 4G80A 1AXTL 3HPLA 4GXVL 5HDOA 1ACYH 1CGUA 2DQIL 1H3WM 4H8WH 5IJKC 4HUKB 1S9YB 1NCTA 5SWSD 3LH2L 3TH3T 1J1OL 4ALAH 2AQ3A 1IGCH 3BKCH 5CILL 1L0QA 2VZUA 3U2SA 4OZGF 1DANU 2XZZA 3MRPB 1VA9A 5I73C 4X6DE 1IAOB 3P9MB 4PGBA 5DK2B 2R2EB 4HX1B 4L3EA 3CDYA 3H42H 2YKLH 5D7LD 4ZUUB 4QOKA 1S3KL 6FABH 3LQAC 4X4ZA 2RR3A 43CAA 3O6ML 3C60B 2PO6C 3GIVB 4YNYA 1OAUL 3ARDD 4NJ9H 4RNRA 3TFKC 1G1YA 4D3CL 4HIJB 4WUUE 3V2AR 2R1WA 4R3SB 2D0GA 4XCYA 4ZO7A 5DTFA 4POUB 5FXCH 3ARUA 3L5XL 4AENB 3UYRL 2VDLL 3VXTA 2QL1A 3VXOA 2FBOJ 4GG8A 3S3PA 4J12A 2ZSWB 3BEWA 1W8NA 2XKNA 4LSVH 1JI2A 2Q76A 2UUDK 2R4RH 2VXUH 5HVGB 4JFED 1IC5L 3N85H 4P2QD 2FD6H 2HJKA 4TVPD 3BHBB 5T5NF 3JV4A 1YEGH 1UZ6E 4Z5RB 1M7XA 3D85D 4TSBH 3HE6C 3D2UB 2D03H 1PG7X 1JF5A 2YPVH 4GAJH 1C8PA 3PQYA 1REIA 4EI5C 2VDNL 3TCLA 5DEFB 3V52L 5L0QB 2XWBB 3GHEH 1CFNB 3IJYB 2DQUL 2DTSA 4Z8FH 3STLA 5DS8B 4M00A 3EZ8A 3IDUA 5BMFL 4NQTA 4PRHD 1HYSD 2EE3A 3LN4B 4PJFF 1TJHL 2B1AL 3FFCD 3I6LE 1XGTB 2I07A 3GMRB 5HTSA 3BKMH 5FYLH 4YHLL 2D4FA 4WTZG 1BFVL 5DYOA 3ZT5A 4KMLB 1JHTA 1BOYA 4H8WL 2HVJA 4U6XB 1LHZA 1M1SA 4U1LB 4FFWC 1GHFH 3BIAX 1KG0B 4QCIA 1INEL 4ALAL 4D2NA 4XPFH 4JZJA 3PP3K 1IGCL 3BKCL 4RMSA 1FVDB 1X44A 4CNIB 4F3FB 2HT2C 5C7XL 3PF2A 3BPNB 5GS0H 1HN1A 3ABZA 2VZTA 5FIEA 1MCJA 4RBPH 2YKLL 4PJIB 3KPOB 4KQ4H 1TCRA 1A7RH 4JY4A 2A6IB 4GW4A 4LSSL 3ZHDA 1N6VA 3EYSH 4NJ9L 5E4IA 1WICA 5EULV 2ARJA 1ZVHA 3ULSA 3K1DA 4HJGA 4MJ6B 5J7CC 5F72S 4PRIA 3ROOB 5JMRA 2W92A 1UXWB 4PP1D 4PLJD 3BESR 2AI0H 3IRPX 1RZ7H 3JSSA 1C16B 1T03L 2R4RL 2W9DL 3MFFB 4WTWA 3O3DB 5HD8C 4QHUB 3LKNB 4YIQA 1JGVH 1YY8B 4Z7QE 2FD6L 4XPAH 1AC6A 4NQCD 1MJ7H 1AE6H 3OB0H 4NN5B 4UBDD 4NIKB 3W5NA 1P6AB 2PR4H 1YEGL 4PJEB 3TNMB 3VH8B 1FYTB 5EO1B 2MMXA 1NCBL 5HYFA 2YD3A 3SGKA 1UT9A 4TSBL 2BSSA 4M4RA 5E95B 2D03L 4ONFH 2EH8H 2YPVL 2Q8BH 4GAJL 3P4NA 4TSCH 5I0ZA 2V5MA 1SJEB 2X1OA 3HZMA 5F1OB 4X98B 1FSKC 4P3WA 4V2BA 3GHEL 1SBBA 1R3JA 1S78C 5E6ZA 3DUUB 1RIHH 5EOQL 4OCRH 3RWGA 4EXKA 5KSAC 1YJDC 1J0YA 1WAAF 4XPBH 4NO0B 1F11B 4MA8H 3LSOB 1M7IA 3BKML 1JK8A 2K7PA 2SEBB 1NANI 5FYLL 3U7YL 2C1PA 4G6FD 5MEQA 4XAKD 4IRZL 4P4KD 1QSVA 4C56E 1HHKA 1FNHA 3ZYOA 2YEZA 1U9KA 1ZT4A 4MAYA 4TYUA 5CSZB 1GHFL 4S2SB 4LLYA 1YMMA 1U3JA 1ZGLB 4P2RB 5DJ0B 4JHZA 3BN9C 4G8GB 3UZQA 4Y7MA 3BDYH 1GIGH 5E6IA 3FN0H 3QDMB 2DLIA 3V5KA 4XMKH 3ZHKA 5B8CB 5GS0L 1VFBB 2H9GB 4KDTC 3L9RB 4P46C 5MP6H 2I60H 3OKYA 3K0WA 4QXTA 4N9GA 3F12B 1A7QH 1JZ6A 4PJEE 1TTGA 2L0DA 2X05A 1FYTE 4XWOD 4K7PY 3BYTA 3QFDA 3LQMA 3F65A 5DVLA 4TPRH 4Q97A 1UENA 5CP3A 3MJ6A 2ITDA 4IRJB 2LABA 2EDBA 4L29A 3P73B 2X6MA 3WS3A 3EYOA 1T1XB 3CDGA 3MUGB 3D25A 5FYJD 4NN7B 2AI0L 1KCVL 1RZ7L 2EKSB 3E3QE 4CU6A 1T4KA 5HHMD 3M1BB 4XMLH 3FQTB 4D94A 3VXUB 2A0LC 4P9ML 4YQXH 3PL6A 3BYYA 3QIBD 1JGVL 4DZ8A 3DGGA 3LS5H 4XPAL 4K94H 4FQ2L 1BBDL 1AE6L 1OTSD 5ETUB 3M07A 2PR4L 2OYPA 4LSRH 2C4FU 2P5EA 4U1SA 1A02N 3QBTB 1ORQA 2FDBP 4MNGB 1EHAA 3TIDA 4ONFL 4YK4C 2EH8L 3QFJD 4JO3H 2R8SL 4PJ8A 3BZ4A 3L95B 4N68A 3V0WH 1UC6A 2C3XA 4TSCL 5FGSA 2BNRB 3OXRA 5IG7A 3SY0A 4P2RE 3TYFA 4WFFE 2DICA 4HKBA 1M05B 4IS6A 2J8UF 3KPPB 1S7TB 3WJJA 3CFBA 5DUBB 1RIHL 1KULA 2VLJD 4OCRL 4JQXA 5EPMA 1K4DB 3MLWH 4XBPB 4XPBL 3IJSB 1TITA 2ZPKL 3D0VB 2AK4E 3ILQD 3SDCB 3LS4H 2VDQL 2VUOA 2E6QA 1TTFA 5LGHH 1KB5B 3CPLA 4OCYL 3FO2B 5FYJL 4JGJA 3HAEA 1Z2KA 5IJKA 4PLKD 5DFVD 1CG9A 4D0DA 5EUKA 1DFBH 1I1AC 2MKWA 1LEGA 4YPGA 1N0LA 4DN3L 3BDYL 3HMWH 1IARB 3FN0L 4EJ1C 4XMKL 3HI6H 2IH1A 3EAKA 1DANT 2IANB 2AQ2A 1XF2A 1EJ6A 1XH3B 1IQWH 4O00A 5IFAH 3PWUA 3C6LC 2YZ1A 5D1XA 2RFXB 5EOTA 1A7QL 4XPHH 3BP5B 2YC1B 1RU9H 5H8DA 3H9SB 3QO1B 1KJ2A 3QIUD 4M93B 2PO6A 3S37X 2DM3A 4TPRL 2FIKB 4PBWD 3EYQC 4OT1L 4OLVH 4P57A 5TF1L 3AS2A 1B4JH 1QA9A 4CMMA 5E70A 4NO3B 1T0NA 2D7OA 1INQA 3FO9A 4PREB 1H8OA 1AQDA 2FL5B 3VFPB 3EO9H 1BZ9B 1PKQB 1K3ZA 1DSFH 2YA0A 2IH3B 1MFBL 2HLAA 5CP3H 1F6LL 2OMNA 3LS5L 4K94L 3FQWA 3BQUC 5D1ZD 3TBWB 1CICD 4LSRL 3GMPB 4WI9A 4KDVA 1TVBA 3MLTA 1FBIH 4WY7H 3ARED 3HE6A 4KKCD 2VLKD 4XNQA 1HYRC 2HMIC 4ZFOA 2X4SA 3V0WL 1BVLA 2HFEA 5J8OA 4D0CB 4LKCB 5H37H 3ECBA 3T77A 3N0PB 3OX8B 1QVOA 1AXSB 5F7EH 1MJUH 3VA6A 1QSEE 5CJQH 4LLUB 3RDTB 1OP9A 3UBXA 4LHQB 4TULL 3QAZB 1SEBB 3LMJH 1AGDB 2NY3D 3HC4H 3MLWL 1YYML 5INDB 4IOIB 2XQYK 4EN3D 4PJXA 1P2CB 1BFTA 4UQ3B 3LS4L 5HJ3A 5BRZA 5JNYA 2DL9A 2I9LB 1KYOJ 1EJOH 1CDHA 5I0DA 5LGHL 5C0AA 3BH8A 3NOIA 1NMAH 1CGVA 1H8NA 2IQ9H 3NIFE 2CUMA 1OAYH 4YEFA 4XP1L 2KQNA 4JFFE 5C0EB 1F4YL 2NMSA 2F8XC 4HS6B 3VFVB 3HMWL 4JRXB 5CP7B 2VLRB 4DCQB 3E8UL 4QY8B 5F9JA 1Y18B 1Z0MA 3HNSH 4DKAA 2XICA 5GGUA 1IQWL 5IFAL 3EKCA 2ZCHH 3HAEH 3DX8A 3C5JA 4J1UA 4XPHL 1OAQH 5DJAA 1QQDB 2N7AA 4MDIB 1RU9L 4JFYB 4UAOB 3T3ME 4HJ0D 1Q94A 3JWOC 3DROA 3T0XA 2P8MB 4J3OC 2DL2A 4OUUA 1PAMA 2C3GA 5J4MA 2PCPB 2H6PB 1F4XH 1B4JL 1RZ8A 4RWYH 1IILE 4U05A 1TVDA 5GJTL 1HWHB 4MB4A 3L3GB 1JPFB 2YK1L 4S11A 4WHCA 3KJ4B 1I1FB 3EO9L 5KN5A 3CH1A 1KJ2H 4HC1A 1DSFL 1JTOA 4JO2L 4R96A 3MBXH 1ZAGA 3ZKND 4ODBD 1NFDB 1WZMA 2I26N 1LWRA 3QCTL 5L2KE 4GXUN 1A5FH 2Y6SD 3DLQR 3PWNB 4RFEB 1YMHA 3MNWA 1FBIL 3V0AC 3ARDC 5MENB 2DIAA 4D8PB 2IEPA 2HH0H 5D71H 2LV4A 3KPLB 4GUPA 2BSTB 5I1LB 1W2KT 3RAJH 2PW1A 2LE9A 4X6CB 3MGOB 5T3ZD 5C0FB 4QNPE 4WEMB 1DE4A 3TZVB 4NKMB 1WWAX 2NXZC 3DYPA 4PBVC 12E8H 4KVNL 5F7EL 3IGAB 1AGBA 3LMJL 4PGDB 3FZUD 2WBJB 1UKSA 3HC4L 1MLCA 2DS4A 1DCLA 3LRGA 3NH7H 3RBSA 4BK4A 3RTQA 1F2QA 1JNNH 3N1GC 2UWEF 4I3SH 4XB7A 3CX2A 5F1IB 1T6VN 2X4OA 1U93A 2Z4QA 3C60D 4U1HA 3QNYA 2BJMH 3CU7A 2YPLE 1BF2A 1EGJH 4KUCD 1GGBH 2IQ9L 1OW0C 2YD1A 1OAYL 4R7DB 5C0CB 2P42B 4W4OC 4GKOA 4MCZA 4FOMA 1G6RB 4Z7WF 5E08H 2HG5A 2X89D 2NX5A 1E4XH 1GPOH 1IMHC 1P7QD 2IPKA 4OZGA 2X42A 5FM5O 5IB5B 1EEYA 1X5JA 4LLQA 5IMLB 3P2TA 4KDTA 3HNSL 1Q9LB 3FQRA 3WEXA 5J89A 3QIWB 1HYSC 1NFDE 4QYOB 2ZCHL 5B38G 3FB6B 1OAQL 5J6HA 4MD5B 4JFDB 4DKDC 3QEUB 1N26A 3STZA 2YMXH 5SV4A 1E6JH 5T3ZL 1LP9F 5MENE 2WUCH 2EXYD 1F4XL 5J1TC 4GKNA 4RWYL 4AEIH 3O11B 3N1QC 1U95A 5DURB 5SV3A 1LK2A 1HSAB 1TQBB 8FABB 2ZOKB 4CAGA 3P30H 3W0WA 1PEWA 4MWFA 1HSBA 3V6ZA 1BPVA 4JANA 5EZIH 3DRQA 3EW3B 4O02H 4ZD3H 1HH6A 5BVJB 2GAZB 4GKSB 3OKLB 3RWFA 2AEPH 3SGJC 3J7HA 5BS0D 2C4FT 4MAUH 2PXYD 4HJJL 3R4DA 1WJ3A 4HC1H 2X4RB 4NHUB 1NUNB 2HH0L 5D71L 3GSWA 1IT9H 3MRBA 1FQ9C 5IBUB 3RAJL 1SM3H 5D5MF 1U8KA 4PP1C 3R06A 3JTTB 4PLJC 5HI5D 4WW2F 5IFHH 5I16A 1ZT7A 1TZHA 4FQXA 3C5ZA 5IWLC 4PJFA 4V1DE 3QHTC 3VE0B 3DVGA 5D2LB 5B39B 4RGNE 3DBXB 1EEQA 1H3GA 3QEQE 4JJHA 1JNNL 5DJ6A 4I3SL 1QFUH 3HZKA 4UBDC 5E9DA 1U92B 3MUZ1 1AXIB 1VEPA 3ARWA 1AD0B 1XF3B 1EGJL 1GGBL 2FSEB 1J0HA 3HC0A 3MNZB 5C9JA 1I8KB 2ESVA 1FV1B 3DO7A 1U8IA 1HH9B 3DMMA 4Q6IB 1N5YH 4ORGA 5E08L 5C0BB 4IM8A 4G9FA 1E4XL 4IRSB 1GPOL 3GGWB 1VFAB 3PV6A 4PRPB 4R7NA 4I18C 4H26B 5GISH 2PYEB 1OF2B 3IDXL 1EBPA 4QHLB 1QFWM 4ZNCD 3WKMH 4WRLA 4LCYA 1DTUA 2YMXL 2VERN 2QSQA 1IKNA 2DI8A 2DQJL 3RGHA 2HVKB 4HGWB 5KAQF 1E6JL 4H1LH 3BH9B 3L1OL 3T8XB 4EUPA 4P4KC 1X3DA 3I84A 2WUCL 2X4TA 3SDXB 4P5KA 1CXKA 2IJ0C 4XCEB 4AEIL 2CUIA 1HWGB 3LHPH 32C2B 3P0YH 2CLVA 4TUJB 4BH7B 4PJ7E 1MCKA 4CU8A 4EDWH 5AYUH 4MA1B 3P30L 5D9SB 4DFIA 2R39A 4LCWB 2CLRA 4U6YB 5ILTH 5E7FA 5EZIL 4NO0D 4X8XA 5IVXE 4ZD3L 2GSIA 3IVKB 5J12B 4E41B 3BQUA 1KLUA 1UEYA 3D39E 3QDGD 3UJTH 3VXNA 4WU5B 1MCWM 4RQQB 4XWOC 4MAUL 4HGKC 3WFCH 3X12B 4LRNH 3B6SB 4U6TA 5JHDB 2Z31B 4HC1L 4WFGD 1OP5H 4PY8I 5KJRH 5J56B 1IT9L 1DQQB 1U3ZA 1SM3L 3P4OA 5GS2H 4G8GD 3D3VA 2VNCA 4JN1H 3QDMD 1HOCB 4L4TA 3IJHA 3L3IA 4HUXB 5KS9F 5K9OB 2ICES 5IFHL 4J3VA 3O45A 4X7FC 4RZCA 2PYEE 1MJJA 2QADB 3DUHA 1KYOK 5ADPL 2ZUXA 3QIBC 4DQOL 1YQVH 4XNYH 1U58B 5HVWA 1YY9D 1OQXA 1OTSC 3G5YB 5F71A 3CZJA 1E4JA 3SPVA 3BO8B 4Y2DB 4LK4A 3SDXE 2YS4A 4U0QB 1B6UA 1K8IB 2JJSA 2NY5C 4LLWA 4F8TA 3ZYJA 3TC9A 5IHZB 1AO7A 1N5YL 4FTVB 5KAQG 5F1NA 3O4LB 2FJFB 1WCBA 2D9CA 4WJ5A 2O5ZH 3V7AG 3I02B 2WNGA 3V6FA 1KGCE 1OAKH 1ND0A 4LCWE 7FABH 5E4EC 3VXUD 4RDQG 5GISL 2J88H 2OS7A 4JPIA 4FQ1L 4F15B 4URTB 4D9RE 1JPSH 1OB1A 3EDFA 3WKML 3MUY1 1FGNL 3ILQC 3NVQA 3W81A 3SO3B 5ISZB 4OZ4A 2XNAA 3TLRA 4PJ5A 4R0LA 4L9LA 1MWAA 3QWOA 4ELKB 4PLKC 3LHPL 5DFVC 3MRMA 2VISB 3P0YL 3WUZA 5EORH 4NO5B 4EDWL 4Y16B 2IAMA 2G75B 5AYUL 3KPNA 1X5KA 4ETQA 2ARJQ 4EUPH 2R56L 3QUZA 4XBGA 5HY9A 5L6YL 4P2OB 4LP4A 2ZCKH 1CDYA 1FIEA 1V7ML 3NIGF 3QIUC 2BVTA 5BZDA 4JRYD 4LRNL 4ZTOH 3UTSE 3ULVE 1LE9B 1GZQA 3WNMA 1RSFA 3ARDA 4U0RC 3RWEB 1JI1A 5SWZD 1VB9A 5C0JB 1VADA 3H0TB 4JKPH 1ULVA 2F54B 1JN6B 4Z7NF 4JN1L 2J8UA 5C07A 4PJHE 5F9AC 1UWEH 1MCWW 4WW2C 5ACZA 3T0EE 2IAND 1KXVC 3CD4A 3KPQA 5D96B 1XGPA 1C5CL 4JFEA 4UILH 5F3HA 3L7FA 3DYMA 4P2QA 3Q0HA 3H9SD 3I3DA 1OGAE 2Q8AH 5D1ZC 1SEQH 5AG8A 4JHAH 3LKPB 1MVFA 4IMKC 1U3HB 3RY6C 3SKOB 1KNOA 5SWQB 2QV2A 2VXVH 3AREC 4KKCC 3GB7B 5FDWB 1IAIH 4QRPE 4J8RB 1PD6A 4RGMC 4MDJB 1FORH 2DLTA 4XP5H 1KTDB 2O5ZL 3G6DH 5J1AA 1OAKL 3TIEA 3UTZB 3HZYB 5FB8B 7FABL 3DX7A 4ISVB 4C83A 4WWKD 4NM4H 2J88L 4ODUA 3SO5A 2NY3C 4PRDA 3KHQA 2EDFA 4WU7B 1N2RB 5LG1A 1V05A 3RVTD 4EN3C 5I71C 4PJIF 3QEHA 4APQA 2WMPA 2XKUA 4AK1A 1Z9MA 1PZ5A 2MQCA 1WC7A 4LCCB 4ONHA 2WK2A 2FH6A 1LDPH 2AJSH 2ADGA 4J3UA 5CJBA 1MFNA 3PP3H 3OGOE 2FB4H 5GSRB 3ULUH 5EORL 1HHHA 2XFXB 4HUVA 3PGCB 1NGWA 1JGLH 1XGQA 2XPGB 1MCHA 3RDTD 1MHHA 3MV7E 4UINH 3E1F1 3L5HA 3TVMA 1UCTA 4PJDA 1HILA 5IR1A 1UG9A 4NQDE 2E7BA 1CDBA 1MWAH 4LSTL 3Q5YA 1HKLH 4NC1E 2ZCKL 3IDJA 2A74A 3P0VH 4HJ0C 2HN7A 4ZTOL 1EO8H 5C6PB 1M6OA 4HUMB 1HXYB 4KRNA 5C0DA 3RRQA 4Q2ZB 2FWOB 5GZND 2X4NB 5C08B 4JKPL 3BP6B 1H3TA 2QSTA 1T6WA 3MUHL 4NN6C 4M61B 4JRXD 1RK1B 3EIFA 5TPWH 1UWEL 3EJYD 2VLRD 1X4YA 4LDLB 5C3TA 5HVFB 4CMHB 5I76A 2M26A 3VXRB 4UILL 1TETL 5FYKH 1TPXC 3VGFA 5IM7B 3ZKNC 2Q7NA 4NQCA 4RAVA 2Q8AL 3O2WH 2ICEB 3WO3B 1SEQL 1R5VA 1NBQA 3NIDE 4JPWH 5IEHA 2Y6SC 5IW6B 4JHAL 1KN2H 5CINH 1F90H 4TNVK 2R0KH 2ILLA 3TGXA 2VC2H 4YAQA 5DJ2A 3WSQL 5C0IB 2D7QA 2JB6A 4QRRE 2IQAA 2P8LB 1JHKH 3ARFB 3LQZA 1G9MC 1DQMH 4P4RB 3QA3A 4OZFB 2PNDA 4Y4FA 2WANA 3BDXA 3WE6A 4PRNB 1CGTA 4FQHA 4TVPH 1A6AB 1XT5A 1JUFB 3FZUC 5E24E 3HR5B 1ADQL 4F7MB 4Y1AD 1L7TH 1S7QA 2VDOH 5IF0A 4MQSB 3E2HB 3LVEA 3HFMH 4JDVA 1ETZB 3NA4A 1CXFA 1QSFE 3C09B 3OKDB 4QRUA 2NQCA 1AGCB 3C60C 4BZ2H 1U8PB 4JZNA 4P4KA 1PKOA 4RAHA 1LDPL 2AJSL 3TBSA 4QF1B 3KXFE 5I1CH 4K7PH 3O3EB 3HLAA 3KPRA 1JF6A 5HYQA 1AFVH 3RWIB 2FB4L 1ED3B 1RV6X 4X7SH 3ULUL 4NSKA 1BQUA 2D7NA 1EZVX 1S9XB 5EBMB 3TZVD 1JGLL 1DEEA 5D7IE 1BP3B 4UINL 3VXRE 3DX9A 2WBJD 2IG2H 3FB7B 3BRGC 1UB6A 4XCNB 5GSVA 4KC3B 4OCXH 1MWAL 2EDEA 3FB5B 1HKLL 1JE6A 1ZHBA 5DQ9A 4QT5B 3HI1B 1A2YB 4NKDB 2O5YH 3P0VL 3B5HA 1MAMH 1X5ZA 3MR9A 3RWDB 1EO8L 2GTZA 3C6SB 1DBBL 1E4XI 2MWCA 3ES6B 3RL1B 2BNQE 4MJID 3VA2C 3L5WA 5C0CD 5CEXA 2EICA 5D93C 3EO1B 3SDDA 2EXYC 2VLLB 3MC0A 2QHRH 4HKJA 1HE7A 3HUJA 5E2VH 5CLWA 5A2FA 3OGCB 4H88H 1OSZA 4PTTA 2C3VA 4N90D 5C6WH 3G5XB 2B39A 3QIWD 4GMSH 1JGUL 3IU3A 4J6RH 3GNML 4S1SH 4F80A 3A6OA 5FYKL 3QIBA 3T1FA 4JFDD 2MFNA 5ACLA 1HCFX 4UQ2B 1LVEA 5C86A 3TBTA 2UWEA 4RX4A 4Z7VE 4JPWL 1CD1A 1QPPA 3Q3GB 5FOBB 5CINL 1F90L 4KJYB 4QRQB 3ZDXF 1DN0B 4GW1A 2CGRH 4GS7C 2PXYC 3QFJA 4YDIL 3UEZA 3N9GL 4WI7A 4N0FA 3N1PC 5DURD 4Z7WA 1GGYA 4MB5A 1DQML 1CQKA 3JTSB 4TQEH 4XPTL 4ZYKA 5EBLB 3VMNA 5F6IC 1AP2B 5IMOA 4PGEB 5HI5C 3EGSA 4PB9H 3BPNC 3QZWB 1P4BL 1A4KA 4L8DB 1L7TL 2VDOL 4RISH 1OARH 4N0UA 1R5WA 2EDXA 1NSNH 3V4UH 3CSYA 4R2GB 3DURB 3D18A 3O41A 1QRND 3H7BB 5K9JH 5EN2A 4Y19A 3RGVD 1G7HA 1QBMH 4PJGE 1NC4B 4BZ2L 5TDPA 2Q20A 3NCEB 4JFQB 4DOHB 1LP9A 5TJWK 1ZA6A 1C1EH 3V5DA 2OQJB 5DJCB 5EZLB 5CIPB 5I1CL 4K7PL 5F7NC 4PB0L 3MRLB 2LU3A 4F2MB 4Y5YB 1AFVL 3MA9H 4OIAA 4X7SL 3WXVL 5I17B 2VLME 5HVHB 3UPRB 3MCLL 2VITB 1QHOA 4KTDH 5FGBC 3HI5L 4BELD 5ADOH 3FCTB 5IB1B 1L9NA 3DSFH 4G43A 1FN4A 3CXHJ 4OCXL 3O8XA 5HYJB 4KHXL 1KCKA 5IW3A 4O2FB 1FVCA 4H0IA 4NN5C 2O5YL 1LD9B 1MAML 5IQ7L 2HFFA 4NC0B 1DBKH 3SN6N 1BBJA 3LN5B 1WBYA 3PWVA 1I7ZB 1MY7A 3IDIA 4GKZA 2V7NA 1ZA3B 2X9YA 3RNQA 3DWTA 1CGWA 2QHRL 3FRPA 1CVRA 4KUZH 1M7DB 3GUTA 2PTUA 5E2VL 4ODWB 4PRPD 4H88L 1Q1JH 5BQ7B 3IKCB 3AXLA 5CGYD 3M8OL 1D6EB 3CFEB 4GMSL 3V0VA 2BVOB 1KIQB 4FN0A 4J6RL 3BE1L 3RFZC 4P2YA 4S1SL 2CKNA 2IPUK 4K3HA 5F8QC 1YC7A 3HN3A 5ICXA 3UYPA 4M3KB 1QUNA 5ALBH 3VJ6B 2R23A 3RZWA 3RY6A 1LE5B 1YDPB 4ENEC 4YHOH 2CGRL 3VDBA 4HH9A 1FO0B 2VYRE 5HHPB 3WS6A 3QQ3A 2VXQL 5BCAA 4PJBF 3OKNA 1CD9B 4UU9A 3PDOA 2XOTA 4TQEL 5I6XC 3GEWB 1FZOB 1MI5B 3V6BR 5DD5L 4QTHA 3IYLW 2C5DC 1IGJB 5CD3A 5B8CC 3QJHB 2NY1D 4PB9L 3QNZA 2XTJB 5EFIA 2BK8A 3SKJH 3I2CH 1TTUA 4AIZA 1NL0H 1D5IL 1OARL 2OI9B 4X99B 4E41D 3V4UL 2DQCH 3LIZH 5HHOE 15C8H 4OFKA 4EN3A 4GG6B 1MAKA 5K9JL 2F5BH 1QBML 1YY9C 2G2RA 5JHDD 2GJ6A 4MJ5A 2J5LB 4HH8A 2Z31D 3WCYA 1C1EL 1Q72H 1N5AA 2X5PA 1IEBB 4IRJC 4OLWH 3TO4B 1Z9LA 3MA9L 3SJVB 5DRZA 4PRBA 4HS3A 4KTDL 3G08B 4GBXB 3IF1B 5ADOL 4NNPH 3DVNB 3G04A 3SE3C 5FKPA 3NACH 3DSFL 1A1NA 5DVNA 4JM4L 3SE8H 2DD8H 4JHBA 2N4IA 5JOFB 2HT3D 5E99H 2J12B 1XCQA 4OGAD 1E4WH 4N5ED 1CLCA 4ESKA 5KZCB 2YBRB 3DXAB 4U1IB 5GIRB 3L3JA 4G9DA 5I1KH 5I8CB 4GSDL 3VD9A 4WDIB 1Y6MR 5E1AA 5JPNA 4QHNB 2BMKA 3I6GB 3BJ91 4FTVD 2FR4A 4KUZL 3VXQB 3O4LD 2O61B 5KG9B 5BVPH 1CT8B 1TMCB 2WV3A 4X6CF 1ZEAH 1N3NA 4X6BB 1Q1JL 3MROB 4UI2A 5KS9A 1KV3A 1CN4A 1QFOA 3LRSA 4O58L 5L2JB 4HCRA 3RQ3A 5L8LB 4PJ9A 5TDNB 5I1IH 5IBLD 2EYTA 1CDUA 5ALBL 1EEZB 2QR0A 5ISZD 2OSLB 4G6KH 4HXBH 3CFCL 2A73B 5EG6C 3B4NA 3S5LA 4YHOL 1AKJD 5KVFH 3AAZB 3IFNH 1RZJC 3T0VA 4ELMB 2NPLX 2VL5A 35C8L 2WP3T 2YRZA 5BXFB 4DUXA 4LIQH 5JDJA 2EDTA 2XZCH 4Y16D 4OLZL 4P5MB 4OF8A 3PQYE 2EO9A 4HMEA 3MRPA 4LHUB 3MRRB 5D7SH 1IAOA 5CWSB 5IHBA 3P9MA 2X70B 3SKJL 3I2CL 4HDIB 2R2EA 5DK2A 3D0LB 5DT1H 4C4KT 1DDHA 3I75A 3LIZL 2XN9B 1MHEB 1RULH 4P2OD 4NCC1 4ZUUA 2F5BL 4KK6D 4HGMA 4OIIH 3GIVA 3MUJA 3QT2A 3SKMB 4RCAA 2AGJH 5F9DC 4EDXB 3LKQB 4OLWL 1BHGA 4ZDHB 4CRPA 2F54D 5HHQB 1SYSB 1CE6B 4K8RD 4ONOA 4UTBH 2X89A 1SY6A 1FNGA 3MLZH 5LQBH 1J0IA 4NNPL 2NLJB 4X4XB 3FL7A 4XNXH 4LVEA 2W65B 2BSED 4WWKC 1F4WH 1MY5A 3G5ZB 3SE8L 3OHXB 4HKXB 1EV2E 4GAGH 4P3DB 1E4WL 3RVTC 3BHBA 4YWGL 4Z5RA 1U3HD 5I1KL 3MGAA 2GK2A 3HE7A 4ZSOB 3D2UA 1AHWB 4ELME 4MLIA 2L7JA 1RURL 1FL3B 2EYSB 1JMZA 5IESL 2JCCB 5D7JB 4LQFH 3RWJA 5DEFA 3L3OA 1ZEAL 1A3RH 1YEFH 2XWBA 5I8EB 4YGVB 1CFNA 3IJYA 3VMOA 4X6EB 2QQQA 4R90H 5DS8A 2A9NL 3WXWH 4AT6B 3RDTC 3QI9D 1BD2B 1JGEB 1JP5A 4PRIE 1YECH 4ZXBB 5IFJB 2DQFB 3LN4A 2FBJH 1WBXB 3NA9H 1T3FB 4F9LC 3VI3E 5D2LF 2VZSA 1XGTA 5CCKL 4ODTH 4YHML 4FA8A 1O7VA 5DHYA 4G6KL 4HXBL 4HKZA 1KCSH 2V5RA 2F19H 1V3MA 3MZGB 3MXWH 5KVFL 4U6HB 3IFNL 3C2SA 3U4AA 3JWDC 1XGUB 4QHMB 4U6XA 5GZNC 4U1LA 2L4OA 3DIFB 4HCRH 4LIQL 1KG0A 4UOJA 4FXGB 1YEIH 2YD5A 2MQ3A 5F9OL 1FVDA 4CNIA 2H2PD 4F3FA 2X1PA 3EJYC 3KYOB 2Q6WA 5D7SL 3T08A 3L3HB 2DIBA 5DT1L 4Y4HA 1RULL 1T22B 2XWTB 1BQHB 4PJIA 4YHIB 3KPOA 2HWZL 4Z78B 4UAOC 4JQIH 2X09A 4OIIL 5I8KH 1N64H 2DTMH 3ESUF 1F6AA 3GBMH 1VACB 3VFRB 4PP2B 4C56A 4WUUD 3ZSTA 4N0CD 2V6HA 3KLAB 4MJ6A 2DQGH 4LPCA 5F7DA 3ROOA 5EU6B 1T21B 4UTBL 5DD1H 2X41A 4HSQA 4LF3B 3CXHK 4X9GA 1U6AH 3MLZL 3KJ4C 3NCMA 1ZLSL 4I0PB 4WV1C 5I1DB 5AAWA 3MFFA 3O3DA 1MCRA 4HUUA 3K4AA 3S98A 3MJ8B 4GAGL 5CMAB 3QXAB 2DM2A 4M1CD 3ARTA 1U8NB 3MRKB 1H3UA 1IQDB 4PGJA 4PJEA 3TNMA 3VH8A 1FYTA 4ZO8A 5EO1A 5C9KA 2L7UA 2D31B 4UTAH 1MELA 1NGZB 1XGRB 4Y8AA 2OTUB 5CEZD 4ZODA 3K8KA 3LN9A 4AQ1B 3ARFD 3EOAB 3AS1A 3B8SA 1SJEA 4LQFL 1CYGA 4X98A 1YEFL 3RX7A 1ZMYA 1I4FB 4F7PB 3O9WA 4AYFA 3TZVC 4AEEA 1QEWB 4R90L 4P59H 4PBXA 4X4ME 1AIFB 3WXWL 1G9EA 4DGIH 5DJDB 1YECL 2WBJC 3WFDL 3CJJA 3G6JF 2FBJL 4NWTH 1U8LB 4NO0A 3I6LD 5FV2A 1F11A 3LSOA 5GGSB 1UZ8B 1RHHB 1NCUA 1KCSL 4IJ3B 4CJ1A 1DUZB 3ARGD 2F19L 2EIZB 4N8VB 3MXWL 4A6YB 3EFFB 2EDHA 3GSNA 2BOCB 1F3DJ 4HWZB 5CSZA 4JREB 4OGYL 1RUAH 3GJEB 4S2SA 4G42B 2P5EE 4DAGH 1ZGLA 4P2RA 4HEME 5DJ0A 1YEIL 3DOSA 4LEOB 3INUH 1EXUB 1VFBA 2BVUA 2H9GA 1GGCH 3L9RA 2NR6D 1FG9C 3QIWC 5FO7B 1MCFA 3F12A 3T65B 3QUMB 4JQIL 3DVFA 5DHVB 4NKQB 5CLTA 1N64L 1DVFB 2DTML 3C8KB 1OT1A 1UB5B 3UAJD 4DTGH 3HG1B 3GJFB 3RIAF 3MOQA 5AD0B 3EOTL 3MLXL 4OI7A 2AW2A 3FOLA 4IRJA 2DQGL 3IU4H 1JZ4A 3PG2A