2HVJA

Crystal structure of kcsa-fab-tba complex in low k+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
218
Chain Sequence
VQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords antibody Fab heavy chain
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 39
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2006-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hvjA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hvjA02
2CIKA 3DSFH 3EOAA 1HH6B 3A6CH 3TZVA 1NEZB 1KJ2B 2A6JA 1MLBA 1YMMD 3O3AA 3UEZA 5HHNB 5F9WC 5DO2C 3RVTC 2J6EH 2PO6D 4RGMB 2E6QA 2FX9L 5CJOL 5DJ2B 5J1AA 4AENA 1HQ4B 4HWBL 4NWUL 2R56H 4ZS7L 4PB9H 4F9LA 2VO5A 2WQ8A 3DV6B 3QNYB 3SCMA 1MWAB 3MXVL 4UU9A 1RZGB 4QXTA 3SDCD 3GI8H 2I9LB 4HJGA 3OKMA 1SYVB 4KK9C 2BNRB 3C6LC 4P2QE 1VFAA 1ZLUH 1S9KC 1UXWB 2BHZA 4M48H 5IHBA 3TJHC 1R0AL 1UQSA 3DUSB 3BXNB 3PABA 4TTDC 2Q3ZA 5CGTA 2YZ8A 3TESA 5IB4B 5KN5B 2PUQT 3L1OL 4TUJB 5GIRA 2CMRL 4ZFFB 3SKOB 5FYLD 1F8TL 2E8YA 5FM5M 5JLZA 1NSNL 3ISWA 3WJLC 4M1DL 2QQKL 3QNXB 5KVEL 3AXLB 4JFHD 5TE6L 3VDAA 1NUDA 4ZUSA 4FXLA 4RIRB 5C2BH 2DQGL 2KKQA 3STLA 4OGZA 2UY7A 2HJLB 3TGXA 4YJZL 2GYSA 5E24E 1JPST 4P2RE 2RB8A 3K81A 3LAFA 3T0VA 1EGJA 2CK2A 1XAUA 5T3ZE 2QADD 3SPVB 4YHYB 4XBGB 1UM4H 2IALA 5MENB 3TP4A 3D85A 4HUXB 4JE4B 1R3JA 3ARED 4JQXC 4Y4FD 5C0BD 2J8UA 1KCUH 3T4YB 3GEWB 5B8CB 3LPGA 1CI5A 4PRIA 1PX3A 5BRZB 3NVQA 5CLWA 5L2KA 2PW2B 2D4DA 1ZLWK 2C5DC 3MACH 3G5ZA 3JWOH 3MRFA 1MI5E 3VG9C 2Y06H 3DTXA 4IRSD 3VFTA 5E8PB 5GS1A 1YY8A 1MFBL 3IDXL 3W39A 4ZFOA 4OCSH 4G6FB 3L3OB 4BQCA 5DQ9B 5IM7B 4R4FH 5H94A 4OZGE 1OM3H 2XPGB 2CDGB 4ISVA 2XN9E 2XA8L 1X4XA 2AV7B 4N1HB 2XKNB 4G3YH 5DLML 3WE6B 5LCVL 2GI7A 1XGUB 4K7PH 3HE6B 4HUVB 3QIWB 5JA9A 2IAMB 4YXHH 1ZAGA 3OG6B 2WBJA 4KY1L 4Q97A 4HWZA 2R1YB 4R90H 4LASH 5C0AA 5IBLD 2OK0H 1HKFA 4HGMA 3GHBL 1XF3B 3ILPA 5I17B 5F1KC 2BDNH 3HG1B 3MLVL 3UPCA 2WSKA 2DI9A 4MCYB 3T77A 1KGCE 1QFWI 3E6FB 1EXUA 1Z5LB 4PJFF 1DBAH 4FQXD 3H9SD 1LK2B 4DGYL 4PJ8B 3MLSH 4HK3N 4G7VH 2ESVB 2FO1A 2AEQL 4HXBH 4PIRF 3MNVB 3PQYA 5BVPL 4FQQB 2DF3A 2FGWH 4HF5H 3UXFA 4R6UA 4PUBH 3N85L 1KTDA 4B0MM 5ABDE 1FC1A 1MCSA 5D2LA 5E8OA 2Y36L 5IEKA 1QBLH 4PY8J 4JZNB 1QSFE 3OMZA 1C5CH 3O2DA 5DUBA 5JIKA 3S5LA 4AH2A 1HSBB 5LGJB 4KJYB 4PRHE 5E56A 3P4OA 4JANB 1OP3K 3V6FB 2BERA 1FYHB 1LWRA 3DHMA 1U8KA 1MOEA 4XPGL 3GMLA 3SGKA 3L3JB 1NCDL 4JPIA 3BH8A 4EOWL 1MCHA 2OJZL 4XH2B 1O7VA 4LBEB 3FQTB 4GKZB 2YC1A 1JNNL 2C4XA 4QF1B 3FO9A 2C7UB 3QCVL 4PGCA 5FA4A 1IC5L 3IDUA 4J1UB 4NWUH 1HDMA 3TN0D 4OF6A 5IIEA 1BFOB 2AV1B 5D4QA 2WP3T 3W9EA 5J4MA 2XQBH 3MLRH 4MXQD 2FNBA 2I26N 2VXSH 4Y5XC 1S9YA 2I24N 5INDA 4MYWB 1OTUC 3MRDA 5ELIA 1Z6JT 3FO2B 1Q94B 3K7UA 4I3GA 4M1CD 5D6DA 3LQAL 5FHBH 5K9OA 2EYSA 4X4ZA 4P9MH 2V5TA 1H3TA 4WV1C 4ELMB 4GAGL 3BGFC 3EYFB 4G9FA 5BVJA 4MB3A 5E6ID 3B8YA 1YMME 4M1DH 4GBXD 5HYIA 6FABH 3GSNB 3L95A 4HZAA 3DBXA 1FGVH 3JVGC 3MODL 4ETQA 1IAOB 2MTPA 2A6IB 2WW8A 5DRWB 3PDOA 4NM8L 3ZDYE 1WZLA 4LPVA 1KLGA 1FLRL 4JKWA 1TETH 5ETUB 2W9DH 2BJML 3PIQB 2EDJA 4YO0B 2BY1A 4EKXA 4FQ2L 5KVGL 5E5MA 1I75A 2IQAB 3BPNB 1UWXH 1YEEH 4P9HC 4PJAA 1K2DA 5F6HI 1BD2D 2ARJQ 5ILTH 3VU2A 2XKUA 4X6BB 5FYLE 1B0RA 2XICA 3QNZA 2WM0A 4IM8A 1R3KA 4WW1B 1K5NA 4OD1H 4DWHA 2K7PA 4JFHE 2WUBH 4NKIH 2VAAB 2BVOA 5F3BA 3RAJL 4R4BB 1JRHI 3O41B 3MRLB 1IGFL 5FGCE 1K6QL 1T20B 4Y4KC 5D7KD 1IQDB 4I3SH 5DC0A 3HUJB 4GW4B 4HIIA 3T0BA 4OZHF 3O6ML 4DFIA 4ORGB 2R0KH 1WC7A 2EIZB 4HK0B 4CJ1A 3ARWA 2J8UF 1MRCL 4WWKC 5C0BE 1GJIA 3GGWA 5IQ7L 4P5MA 3LKPA 3MRKB 2C1OB 3HHRB 3F5WB 4GKSB 1KG0A 2VQTA 4ZQKB 3T08A 3T3ME 4X4XB 3VW3H 4PB0H 3KWWA 4PJXA 1FL5A 3NPSC 5C08B 3FOLA 2AEQH 5SV3A 3VI4E 1SJHB 4LCUB 1DLHB 1G0YR 4KTEL 5GGTH 5BVPH 4P4RB 3FMGL 5K9KA 5JXAL 5HVFB 1B6UA 4ONGH 2Q7YA 4X6DA 1H5BB 2LAGB 4NFDA 1TQCB 5DD0H 1HK6A 1A9BA 4OT1L 1R5VB 1UJTA 3C5ZC 2DIBA 2AS5M 2ZUTA 4OM1L 3Q1SH 2BVQA 1P1ZB 4MVBD 3BIKA 1FGNL 1CFSA 4YHNB 4IDJL 2JK5A 4L3AA 2X89D 3ABZA 4OZ4B 4PRBB 2O61B 3IS0X 4EDWH 4TNVK 1WWWX 3H9SE 4BELD 2CIIA 3VXQB 2HMID 1UJ3B 4FFWC 5EO9A 4FA8A 1IEBB 1NANH 3QCVH 3V6ZA 2G9HA 4I3RH 5GGSB 4HDIA 5E6YA 3UBXI 3JTSB 3O6FC 3PGDB 4NZRL 1IAIL 2C3XA 4KKBD 1JTOA 3JWDL 5D2LF 3O8XB 5SWZA 3WNPA 1CN4A 1ND0A 1UACH 5DD5L 5TH2B 1BQHB 1P2CA 1RD6A 3HI5L 1TJIH 4JM2A 2ZUSA 2W91A 2DQUH 4LF3A 2FZ3B 4N5EC 5E4EB 3V0VB 4RGOH 2YPVL 5CGYC 5JQHC 4F7EB 4S1QL 4DGIL 1FQ9C 4LEXL 3RDTA 4MZ2A 3BT2L 2NW3B 1ZVSB 4QRRA 3CVHB 4BH7B 3CZFA 1YQVH 3RGVA 4HJ0C 1RJZA 3OQ3B 3MLYH 3BYYA 5L7XL 1QR1A 3DETC 3SCMC 4PRDA 1V3LA 4PYGA 4FXKB 4KDWA 4PLJD 2FSEB 4NN7C 1BLNA 1A6AA 1U95A 3ZE2F 1KF9B 5A2KH 2KZ1B 3QG7H 4MNQD 2H2SD 1CGSH 5DD6A 3G08A 4QXUH 3QEQB 1MPAL 4A2MA 3PNWA 5TJWK 3RIAF 3QCUL 1YEDB 5KVGH 4DN4L 3OJVC 2HLFD 3MV8B 5D1XD 4EN3B 2XACC 1G7LB 4H26A 1JZ7A 5A2FA 1OAKH 4OQTH 2H3NB 3VXMD 3WN5A 3SDAD 4OZFG 2Q76A 1K4DB 2V2XB 4Y19D 4PBXA 4NJ9H 4MQ7A 3LPFA 1T22B 1KEGH 5EU5B 4YQXL 4ZNEE 1IGTB 3HNVL 4OI8A 3RPIA 4X9BA 1MCQA 1P5UA 5DJCA 4YEFA 4L8CA 1T1ZA 1VKXA 1MCOL 5FUCC 1IGYB 4JJ5A 2CR3A 3WIFB 4LIQH 1A9EA 5SWSA 1RZ8B 1FBIL 1W0WA 4GT7A 3VFGL 2MSPA 4LHUG 1CXIA 3O6MH 3ZLQC 3RIAK 5BZDB 3V5KA 5H37H 1I1AD 1I1YA 4YXKH 3W81A 1QLEL 2MMXA 3CFKB 3H9HB 1HE7A 4PJIB 5GS1C 1CD1A 1U91B 5DUPH 5EBMB 1BD2E 3S9DB 3CU7A 1FNFA 3BEVB 1DVFD 2Z35B 3ARGB 3RU8H 4HLZG 1IGCH 1A7OL 2V2WA 2VXUH 4UQ2B 5H2BA 4RA3A 1TJGL 2F5AH 1BQUA 2X4NA 2KH2B 3MNWB 1KFAH 4CAGA 5KW9H 1OQOA 2VDPH 3W0WA 2ORBH 5D7KE 4ZSOA 2DJ4A 1CGTA 3BP7B 2EH8H 1GZPB 3QXUA 2WBJC 3KG5A 3PV6B 3MV7B 2VLLA 1WZ1L 1X4YA 3VA6A 3AC0A 1NMAL 2Z4QA 4R0LA 1SM3L 3MLUL 4YX2L 2ZOKA 4WFHD 3HZMB 1T7XA 5EC1A 4IDJH 4CVZB 3FO1A 1P7KB 2R4RL 3A67H 1HHHA 4KI5D 1AD0B 3SBWA 5HI3C 3TT3H 4K2UH 5FYJL 5GGVY 4H0GA 2FECL 1JF6A 2C1PB 1I7UA 1PVHA 2HT3C 1CXEA 1S3KL 4C58B 2VDKL 1P69B 4L3CB 1Z9OA 1QVOA 3X3GH 4X6DF 1T21A 2VDRL 2NY3C 5ALCL 5DWUL 4EI5C 2XWBB 3MRBB 4MZ3A 5F9AC 3R1GH 4JZJA 4NQCB 5CD3B 4YDKH 4L8DB 5F1IA 1CICD 1AO7B 3MRCB 1F58H 4W6YB 4AM0A 5HSFA 4OD3H 4Y16A 4ETYA 3BPLB 3SE9H 5IV2B 3RFZC 4M4RA 4P3DA 4ZUUB 4R8WH 4G42B 3DO7B 1LP9B 1FCCA 4JFPB 2F9BT 4NHCL 1VACB 4H1LG 1RAMA 3O3DA 2DQCL 1AGBB 3MJGX 1F3DH 3GIVB 1JWMA 1C5DB 3FOMA 5E8DH 1KNOA 4KRPD 4JFZL 1ZVHA 5F7EH 1ZSDA 5KSAA 5D6DC 4RMVA 5CZXD 4JM2F 4LSQH 1HHKB 4RRPA 1A6WL 2H41A 4L4VB 1EEYB 3BRFA 5E9DA 1I7TA 5LBSL 4CJ0A 4U1HA 3QIUD 4OLZH 1NEZG 3MV11 1BF2A 1OAYH 2WP3O 3QISA 1XGTB 1CE1L 4MNHA 4Z0BL 4G8IB 4EUPH 2OTUA 1CR9L 1X3DA 4HW6A 3VXOB 4NWTH 3L9RA 4JFED 2VZ3A 4WJ5B 2DM2A 5FKAA 5CLTA 1JGUL 4FQCH 2EDDA 4PS4L 1MCNA 1UCTA 2ZP0T 3D0VA 2V2TB 2B5IB 1H3GA 2A73B 1YUHB 5JPNA 4P2OA 5I19L 5FOJA 3T1FB 1QRNB 4MNQE 2A6DA 6CGTA 1GCFA 1JI1A 3W82A 4LOUD 4WFGD 1CFTB 3O2WH 1ZKAA 3UTSD 3VFWA 2APXA 4Y4FC 1KENH 1IM9A 3QDMB 1CDJA 2ITCA 5DJ8A 1X5FA 2VE6B 2PYFA 1G7MA 1J5OH 4R96A 5F7YC 5IMOB 3RVWC 3QUMA 5FKPB 1JK8A 4UZGA 4HMCA 3FQWB 4Y19E 5DA0B 2F54D 4G6MH 1QOKA 4LLUB 3L5WB 1N0XL 5I1KL 5EIQA 4G8GB 3FB6B 3ZYIA 2H45A 4OKVA 5C7XH 4XNUH 4B41A 4PJEE 2Y5TB 3IYLW 5DR5H 2E7MA 1FAKT 1HILB 1EMTL 3QWOB 4XXDA 2WAHA 3TBWB 2VXTL 1OW0C 4LLQA 5BS0B 4HUMB 2ARJA 2BOCA 4WVRA 3C8KA 3OKDA 4K3JL 4AL8H 3SDDA 4JN1L 4D3CL 5D72L 4ENEC 4WY7L 4GSDL 3AVEA 2UZXB 1WGOA 2DICA 3BVNB 2IGFH 3RRQA 2W60B 2NYYD 4JY5L 2R0ZH 3U36A 4X5XA 2HFFA 5IUSA 3KPRB 5HHMD 3V5DA 1ZHBA 2AVGA 4R7NB 1E27A 4E41A 2EEAA 3WO4C 3ZT6A 1CS6A 3D25B 3KYOA 3T2QA 2PF6A 4PLKD 5FYJH 1UFUA 1DL7L 2FJGA 3VGDA 2GK0B 3OB0H 4CRPA 1N26A 1I8KA 2P5ED 3UZQA 1RY7B 1T1YB 4M5ZL 1KEML 4P59H 3GSRB 4NO0B 3VXNA 2VDRH 5CKAA 5FM5O 1MJUH 2CSPA 1RUPL 3KPMB 3MRRB 2PCPB 3QJHA 1ZK9A 1NMBH 5IT2H 2EE2A 4Q6IB 2A1WH 3BUTA 3GSQB 1X7QB 3U9PL 2VQ1B 2H6PA 5IHZA 4JPVH 1T3FA 4WFHE 1ETZB 5F6HJ 1TNMA 3EFDH 1F90H 4U6VL 3G6JE 4WIQA 3HFML 4KI5E 2ADFH 1JHTA 2A74B 2HVKB 4POUB 4FN0A 5T3ZL 1NL0H 3FRPG 3C5JA 2W38A 2XA3A 4H88H 5MI0B 3C2AL 3WD5L 1ZWIB 4WI7A 1AGFB 4MXQC 5EU6D 4RAHA 4P9HH 3GJFK 5ICZA 4KKLC 4MA7H 1P4BL 2BHYA 4M1CC 5E5UB 5CJXC 3TF7C 3HCVB 4ZTPL 1S5IH 3PDGA 4JPKH 3C08L 1YEJL 2Z92A 1P7QB 3V8CA 3VFSA 5KS9E 4PJBF 3NTCH 1KLUA 3FFCB 4JCMA 3NCFB 4GBXC 1HHJB 1U3HB 5C0GA 5CILH 1MSPA 3LH2H 1D6EB 4TSBL 1C12A 2HG5A 1L7IH 1ZXQA 1AI1H 1NGQH 3WMSA 5EB9A 1FCGA 3ZZ1A 4OGYH 5LXGH 4P23D 4M7ZB 3UZEA 2Z91B 1FFPA 1YZZA 3I6KB 5ID0B 5EBGA 2VWEE 2NY0B 1DBML 4Q9QL 4NKDB 5GISH 5CEYB 4JDVB 2VLJD 1HI6B 3LKOA 4D9LH 3DX6B 4IRZH 4Z0XA 3VD7A 3WO3B 1S7TB 4KV5F 3KYKL 3MV9D 1LO4L 3CDCA 3FAWA 5L2JA 2HT4C 2GJ6B 4HAGA 1SEQL 3EKCA 1FYTA 1IAKB 5EWIH 5C0DB 4OFYD 5CD5C 3PWPA 2VAJA 4CKVX 4XP4L 3RJQB 5I1DA 1BZ9B 4JFEE 4P0DA 2OSLB 3SKJL 1BM3L 2Q20A 3QJFB 3AGVA 4N8VB 5HDQH 3ES6A 3LRSA 3P40A 4K94C 3BE1H 2EKSB 2AJZB 1B4RA 4HCRL 2DBJA 5ESQB 5L88H 1XFPA 3G5YA 1MUJA 1SBBA 3VXUE 5IF0A 2IANA 3UTTA 5E1HB 5DD1L 5IGXH 1G7PB 2DBLH 2AI0H 1NBVL 1KIUA 4DGVL 3PWVA 5J7CC 4WFGE 5F3HA 5F1NA 3KPSA 3G6AA 3UTSE 3RZCD 3ECBA 3MMEA 1GL4B 2Y7QB 4K3JH 5JHDD 2I9TA 4Z7QE 1ZT1B 3CC5B 1NAKL 3QFJA 2P46B 1TIUA 5DRXB 3E2HB 2DKMA 1NLDH 3RX7A 1G7JB 5T5FL 1MIMH 5JORB 4IIQA 2F54E 5CFHA 1OAUL 4UOW0 4ODWA 2MWCA 3DXAA 5ISZB 5A2JH 1X5HA 1PDKA 1MCPL 4D8PA 5IESH 2YS4A 1CLYH 2YUZA 3OPZL 3HZKA 1W0VB 2AK4A 4NJAH 2ZCHH 5LJYH 1KEMH 1CG9A 1SHMA 3DECA 1V7ML 1ZE3C 4GRLD 3WV0A 2XNAB 1JTTA 4LQ1A 4YHKH 4HLJA 3S3SA 4APQA 2E7BA 2ZJSH 1BP3B 4XAWH 4QTIL 3HN3A 4NC1C 4YDLC 4MVBC 2D7MA 3MBXH 3UJIL 3QEUA 4FHBD 1WITA 1ED3A 1FG2B 5B22A 1CT8A 3SBWC 1U8HA 3CNKA 5E2JA 3D3VB 2BNQA 1BZQK 3WUWA 2WANA 5HHME 3U0TB 1L4IA 4OIBA 1LEKB 5CJQH 3CZJA 2HMIC 3TVMB 5TFSH 4NZTL 2IQ9H 3MROB 2X41A 3NCYP 3CLFH 1FNGA 2J12B 2P5EE 4PJGE 1C1EH 4KKBC 4S1SH 4WUUB 4LHUD 5IFAH 4XMLL 1J8HB 4JZJC 3TBTA 1OARL 4IHOA 4M93B 4PGDB 1LD9B 4GW5B 5FYLL 2WMPA 5FCUL 1P4BH 2CO6B 1JHKL 1YDPA 4PJ5B 5ACMA 5DQJB 4P46B 3GMRB 3PGFL 4OTXL 3ET9F 5FDWA 4L4TB 4HBQA 1C08B 1CTNA 4GG6F 4XI5D 4NN6B 1CGYA 1G7QA 4NRXB 5ESVA 3C08H 1ZANL 2AJVL 4R7DA 5E8EA 4Q2ZB 1AY1L 1EGJH 4LSRL 1CTOA 5C0JB 1QPPA 5GZNC 3D48R 3QH3A 5E1AA 1U8NB 1VEMA 1N2RA 1NCUA 2W65A 2OX5A 1BQSA 4XWGH 4B50A 2A9ML 2UWEB 2EH7H 1ORQA 2AKRB 3QO0B 1KSRA 2GTWA 1M7IA 2UZIH 3DGGB 5EU6E 3NA4A 3VH8B 3FB8B 4OGXL 2NY1C 3IVKB 1F4HA 1U3JA 4W6XB 5D1XC 1Z3GL 3BGMB 4JDTL 4PJ7A 1NGXB 5FYKH 3ARFA 1FVCA 3SDAC 3E6HA 2X4PA 1ZA6A 4L1HA 1FZOA 3NCJL 5D1QD 3IFPA 1DFBL 5KSVA 4ZPTB 4Y89A 4K23H 3P3YA 4MWFB 4JHWL 4KRNA 5F9WB 4LGRB 5DHYA 1RJYA 2YPKB 1OP9A 4P2OC 1WCBB 5EBLB 4KFZC 2VXQL 3VCLA 5DJYB 1M05B 5E00B 3C9NB 3EJZC 3JZ7A 3MJ9A 4WO4D 4OAWB 3P9LB 1DE4B 3RY6A 2DTML 1J0JA 4Z7NE 1A14L 3TO4D 3TBVA 2J3SA 1KCVL 3C6LB 3V79C 4MNGB 5I1HL 4PJHE 2VLJE 3NCCB 4NQXB 1WFTA 4OFKA 3SKUD 4IJ3C 1NAKH 4JRXD 4AEEA 2H1PL 5INCA 4HG4J 1R3LB 3LIZH 2EXWD 1GYAA 4Q6YA 4R4ND 1RK0A 3LEXB 4MB4A 3CK0L 1T0PB 3QWQB 4MX7A 4OD2A 5BJTA 1JZ5A 3LKSB 3SY0A 5GJSL 1HSAB 1RHHA 4O58L 3RWFB 4OFIA 5IB3A 5IR1B 4D0DA 4WHCA 1EFXB 2JIXB 3EAKA 3O4LD 1H9VA 3IF1A 2HRLA 3DWTA 1BFTA 4JFQB 5ITFA 2APVA 3T2NH 2CUMA 3RZWA 4F3FB 4JO1H 2LU3A 3LPWA 3BOVA 1JWSA 4AEIL 1FJ1A 4BM7A 3V6OE 4NQVA 1FDLL 4MDIA 5JHDE 1JPFB 1KN4L 4V1DA 3TCLB 4X7SL 4EXPX 4YWGH 1GOFA 1KT2B 3BDBA 1S7SB 5DEGA 3BH9B 5EO1B 5IQ9A 3WFZA 1FZMB 3B2VH 3QZWB 4ONHB 1U6AL 4DZ8A 3VG9B 3SGDH 4HS6B 3D0LA 2IEPA 1BFVL 1N5AA 4I2XB 4RFNC 4Z5RB 3BQUA 5J11C 2HJKB 4WU5B 4PRNB 3I75B 4Z9KB 4O02H 4EUPB 4FQIH 1UZ6E 4JAMA 2RHEA 4U6YB 1W8OA 3MRJA 5IVNA 1JGDA 5FECA 5EUOB 3JXAA 2NZIA 1JZ6A 4LNRB 2D2OA 1GPOH 2ADGB 3P4NA 1EHXA 1OT1A 2AABL 4LSTL 5IHUH 4GXUN 3BEWB 5SX4I 2Y4SA 3NOIA 4JO4H 5GS0C 4U6TA 4MHHG 4PJDA 5E2UH 4KTYA 5J6GB 4K7FA 4RCAA 4OF3A 1D5IL 3LKRA 2CGRL 3CCHB 3TFKD 5EN2A 5IB2A 1PSKL 1CFVH 4O2CB 3FQNA 3G5VA 5MEND 2VWEC 4D2NA 5HYEA 1CU4L 1VB9A 2FHBA 1II4E 1A64A 5EU7C 3NIDF 1JYWA 2F53B 3QXAA 5BRZD 1CWVA 2X4TB 3EYOB 3WHE0 1RIHL 2AJXH 1EAPB 2IPTH 3KYNB 4DQOL 1R3IL 4S1DC 5A3ID 1UB6B 1YMHA 4G6FD 1YNLH 4NQSB 4U6XA 3TYFB 5K9JH 1J0KA 3GJEA 3OTTA 1D9KA 1N6QH 4MAYA 2HFTA 1ZGLA 3PHSA 2VDQL 4NNYA 4PTUB 1PBYA 3UTQB 5CBAA 3EFFA 4JFXA 5DRNB 4GMSH 2F58H 3L3HA 1S7XA 3BO8A 2YRLA 3NGBC 3HE6D 2IAMD 3TNNA 1Q1JL 2VXQH 3CFEA 2DM7A 2J4WH 1PG7W 1MY5A 1XF1A 5D1ZA 1LO5B 1NBYB 1MAMH 2CLRB 5DVNA 2XZCL 4LOUC 3V8OA 1HHGA 3GSVA 4LKXA 3DV4B 4Y5XB 4HS3B 1A6ZA 2XTJC 3WXVL 1SBSH 3JV6B 4PJ7F 1QR4A 3OJDA 1ZGLM 3NAAL 2PTTA 4FZEL 3RY4A 2ESVD 5HYFA 2A83B 3DYOA 3TPUA 5IVXA 1EBAA 2ITDB 4UUJB 3MBEA 2ZNXA 3GBLA 4WV1B 5I0ZA 3BGFB 3U6RA 5AZ2H 1OPGL 5BV7C 1IKFH 3SE3A 1VCAA 4NNPL 5C3LD 4DK6A 3RX5A 4L1DA 4YLQT 3U1SL 3BN9C 5L8JB 2NX5B 1OGTA 3KJ4C 5JTWA 3VXSB 4FQHB 3S88H 1A6TB 3F58H 4PD4K 4LQFL 1N3NA 4NBYB 4NO5B 3VFVA 4FFZH 3AM8A 4X4MA 1I9IL 3RWCA 1AE6H 5DSCB 4NO2A 1EO8L 1FPTL 4IIQC 3VGEA 2NYYC 4JRXE 3S6CA 1AGEB 1I7ZA 5JMOC 4RAVB 1UYWH 1N64H 4PV8B 5ENWB 1ONQA 3T0DA 3UROR 3GSWB 2R2BA 4HFUH 4XBPB 4M43H 3NACL 3VFUA 2VLRA 5ID1B 3O4LE 2GW5A 4P4KA 3UTPD 4Y4KB 4K3EL 3V0WH 5HHOB 3LQZB 2BFVL 1JIBA 4FQLL 2AXFA 1MVUB 2C26A 5F7WC 2ICWB 4KZDL 3ULUD 1HNFA 2CRMA 3F12B 3GBMH 5FCSH 5HGDB 3U4BL 1A0QL 5JA8B 4WWKB 2NXZC 1B2WH 1NAMA 2YKLH 4L9DA 1XIWD 1J9CT 2W9EH 4G5ZL 3VWJA 3L7FA 4QT5B 5F7MC 1I8LC 3OAZK 1S8DB 1YYML 4I77H 1N7ML 5KOMC 4WDIB 3MFFB 5D7JC 4OZGF 3NPSB 2ICEB 3P4MB 5GRUL 1ZT4B 5ERWB 1ZHNB 4L5FL 5T1MA 3PXHA 5SV4A 1NCBL 4U1MA 3RIFF 1KPUA 3PWJA 3GRWL 4WTXA 3BSZH 3TLRA 4E42A 1CD0A 4RWHA 3W5NA 3QDJA 5T1KB 1KACB 1KCSL 1JF1A 2VERN 3U7YH 1ZEAL 3RBSA 3C5ZB 4M00A 4QLRA 3VWKD 3I02A 4U0QB 2HKHH 4RWYH 1HIML 4D0BA 5BW7A 1X6LA 3EJYD 4PJDF 4K94H 1VADA 4HBCL 1MCRA 4TOYH 4H25A 1D6VH 1RUQH 2YBRA 4AMKL 2AXGB 2RCSL 4IMKC 2B2XH 1VFBA 5DQDL 3ESUF 2G75A 1KJ3H 1QSEB 4KDVA 4P23C 1AXTL 3KR3L 4LKCA 1OAZH 4QHLA 5MENE 5JUEH 1Z0NA 3QWRD 3O6FB 3RIFK 4AG4L 5CCKH 3KJ6H 2Y9RT 3FB5A 5BRZE 3DGCR 1WAAE 4KJQD 2FR4A 1TPXC 1FV1A 4PGEB 4F7MB 1EX0A 3VXRB 2CQVA 4XHJC 5F21B 1IE5A 2CIKB 1CZ8H 4S1RL 3LKQB 1I1CA 5EIIA 1MLBB 4NGHH 5C08D 5M95B 2D9CA 2ED7A 2LU4A 4OFDA 3D9AH 3SDXA 4N9GB 2B0SH 1VPOH 3L3DA 5D9SB 4AENB 5J1AB 5I76A 3BRDA 1V7NH 3FRPA 1FL3B 5B39G 5TQ2H 3TYGH 1CGVA 2EC9T 3RY6C 3ZL4H 4XP9L 4ZAKD 3SCMB 1WT5C 1GGBL 4AEHH 4QXTB 5FXCH 1BAFH 4HJGB 4NN7B 3OKMB 3UP1A 2NQCA 5JOPD 1VFAB 3LEVH 4ONFL 3QI9A 2YD2A 4WUKL 5SX5H 2JB6A 4NKMB 3PABB 3QHFL 3V6OC 3M8OH 3RZCC 3GNMH 4FMFA 4XPTL 2A9NL 4ZFZA 1VFOA 3UYRL 1U36A 3SJVA 1T0NA 12E8H 3EYVB 2HFEA 4X9FA 2PXYD 4LGSB 3V4UH 5F7UA 5JLZB 4Q9RH 2ESVE 3ULVC 5HYSA 3KLHD 5FDYA 3O0RH 4RISH 1B0GB 2DYPA 2ICWJ 1OWWA 1UCBL 1IC1A 3ORJA 4GRMA 4A2LA 2EZ0C 3MLXH 4ZNEA 3BD5A 3O8XD 5B4MD 3STLB 3UC0H 3QQ3B 4C59B 3HZYA 3IFLH 4W70A 5HY9B 4OLYH 4OV6F 2XN9B 3ZDYF 1DLFL 3IXAA 1UXSA 3BHBA 2VZVA 3NZHH 1BBJA 4K3EH 1RIUL 3QULA 3GIZL 4JVWA 1BECA 2YD5A 4AQOA 3D85B 5GXBB 3KDMB 4H5SB 5FOBA 2XY2A 3VGGA 2X40A 5L2KB 4XNXL 3G5ZB 1DQLL 3MRFB 5AYQA 5HHPB 3QFDA 4JLRA 5LVEA 5GS1B 4M6NL 1FFOA 1F42A 3W39B 5IB1A 3QEGH 1JNLH 5KVDH 5H94B 4KHTL 3QEQD 4JZOA 2R9HD 3IJHA 2C3WA 3B5TA 3R0MA 5IMMA 3TO2A 1QO3A 5FO7B 1QFUH 3HZVB 1U0QA 1LO0L 5GQBA 4YR6B 2P42B 1NUFA 2HJFB 2EICA 3UTPE 3QPQC 1X5IA 2UUDH 3PF2A 1NGPL 2X4RA 2WBJB 2VLMD 3D69A 1MAKA 2BSED 5EOCJ 2LQRA 3BESR 5C0AB 3STZB 5FGBA 4EBQL 3ULUE 3WJJA 1I8MA 4H0IA 4HV8A 1X4ZA 4LDLB 3OB8A 4JVUA 3RWIA 4XI5C 3HNSH 5JO5A 3WYRA 3EZJB 4GO6B 3T77B 3D5OF 3U9UB 3MUZ1 3LCYA 3T3MF 1LO3L 4JFYB 5KVMC 3JTTB 5GJTL 1NDMB 3QHZL 3PQYB 3WIIH 4IMLB 1MFDL 3MUHL 2DN7A 1A5FL 3VI4F 1CFNA 2CDFA 3KR3H 2OTWA 3CPLA 4O2EA 3N1GC 5CGMA 3IETA 3RWDB 3OF6D 5IEKB 3QUMH 3ZTNH 4AY0A 3SDYL 5DUBB 2V9QA 1A02N 1FZKA 4AH2B 2X4QA 4EI5B 4OI9A 4ZUTA 5GSVA 1R3HA 5IMLA 3RWGB 4I48B 4YC2C 5TE7H 4LARH 1J11A 4OCLC 3ARGD 3O4OC 1QBAA 4X4YA 2CDEA 1T2XA 4MAYC 3DMMD 4RMQA 1IC7H 1ZVYA 4LLVB 5E70A 3U7WL 1AXSA 4WI3A 1T2QL 3BH8B 3MRGB 2FX8L 3BGAA 2DQTL 1S9WB 5B21A 1DBBL 4G7YH 2YC1B 1YMMB 2R4SH 3FQUB 2MCG1 5D5ME 5DVOA 1I85C 1J86A 1BBDH 1NGZA 2MHAB 5FA4B 3HUJE 5DI8A 3MV7D 2BXZA 4JFFA 2PW1A 1OAXH 2BX5A 2ENSA 4XBEL 4X7TB 1J0IA 5CEZH 2VL5A 1MIEH 2IWGA 2VDML 1SEBA 3LD8C 32C2A 3TO4C 5INDB 4NSKA 3MRDB 4NUJA 1AKJA 3HC4L 5K9OB 5EZOL 3RHWF 1QKZH 4XGZA 1CBVL 5AYUH 4NNXA 4HXAH 1OF2A 4G9FB 5BVJB 4ESKA 2WNGA 5C08E 5CJBA 1EV2E 4R4NC 3SDXF 2DB8A 5F96H 2R0WH 2FLRT 5DFVC 5EU4B 1T5XB 3NIFF 3O2VH 3L95B 3MREA 1RULH 3ETBF 2Z8RA 5EUKA 3HAEA 4ETQB 3HPLB 5MERA 3T0ED 3W5MA 4NQDD 4Z7VA 1FFNA 3NH7L 1KN2L 3PXJA 4NQCD 4X7EC 5FGCB 5D2NA 5E08H 2YPLA 3IGAA 5I1CL 4X6FA 1LO2H 4GQ9H 4NZUL 4I5BA 2VXVH 2CLZA 5JOPE 1AO7D 2KQMA 1IFHL 2A38A 5E5MB 1FRGH 3EDJA 4OCWL 3QYCA 3H42L 2EDFA 4M5YH 5GS0H 4PJAB 2WIIA 4Y4FB 1BVZA 5C0BB 3RHWK 4GAFB 4P3CL 2XWTA 2VABB 2P24B 4KGJA 1EJOL 3MLTA 1BEYH 1JV5A 3FN0L 4B7IA 5E2VH 3U2SB 1G6RH 4YDIL 1IQWL 2F8OA 1S7UA 4EZMA 1U92A 1YEGL 1MHPL 2BVOB 3LHPL 5F3BB 3GB7A 3O45A 5CHNB 1WFUA 3QUXA 1U8MA 4F33A 5IW6A 1BZ7B 2O5YL 4L4VD 3JV4B 5GGUA 2D7NA 1OAQL 4ZUVB 2RBLA 2GFBA 5DEFA 3Q48A 3VG0L 4BQBA 4OCYL 1QFPA 3BKJL 1A6UH 3V7MA 1ADQL 4G6KH 4CW1A 1XGYL 3ZO0A 3TBSA 2ZKHH 3LKPB 4P5MB 2BCKB 4YHMH 3DI2B 2YRZA 4JPWL 3VWJC 4JFDA 4RDQF 4GUPA 1KG0B 3GK8H 3TJEH 3MJ7A 3SE8H 1CL7L 5BQ7A 4X5WB 4JM4H 3WEXA 2ATKA 4HUNB 8FABA 1NGWB 1SY6L 1DVFA 1UM5H 2GTZA 4PJXB 3T04D 5C07D 3F7RA 1QRND 4NYLA 3LS4H 4LCIL 1QQDA 3FOLB 1BIIB 3BIBX 3QEQE 1U58B 5T3XH 3WO4B 4JY6A 4X98B 4M1GH 4F37K 2R23A 3OBAA 2YOCA 2DOCA 3QDMD 2Q7YB 4X6DB 1OTSC 5GS3A 2NTFB 4RFOH 5K59F 1A9BB 3VFRA 2R1WA 2BOBB 4UILL 3DVIA 4NKQB 2VLME 4DVRH 1A3RL 2AXHA 2WBWB 3MYJA 4ZUWA 1CFSB 4RX4D 1BPVA 2JK5B 5BV7H 4G9DA 2EDNA 3ARDA 2VSDA 2EXYD 4U2YA 1CF8L 1SYSB 1NCAH 1IAII 1W72L 3PP4H 4NQEA 2Q7NA 3CJJA 3Q5YA 3G6JA 1TJHH 2OXGA 4N0YH 2CIIB 1O5DT 4LNVA 4ZMAT 1IMHC 5EO9B 3FO0L 2J88H 3FHQA 3V6ZB 4TQEL 1NCWH 5BS0D 2FJFA 2D0FA 1QFWM 1I3GL 3IU4L 4LCWA 5I16A 2CKBA 5SWZB 1ND0B 2GJJA 3TA3A 2B7DT 1RFDH 3FQXB 5F89A 3P30L 3C8DA 4PJIE 1ZTXL 4JRYD 1CLZL 4UINL 5C71A 1T7VA 4CVXA 4R26L 4AEFA 3EOBB 2HN7A 3L7EA 2R1XA 3NZ8B 5EZJA 3AROA 1CDYA 2ILLA 4W68A 1CICA 1OHQA 4QRRB 2P8PB 4PGZA 2FJHA 4M6ML 1W0YT 1DQML 1QR1B 1GGUA 2NY5L 4LSSH 4J8RA 4C4KT 4GBXB 4UTBL 3QXWA 4NO0D 3Q3GA 4LMQE 2E7LA 4FP8L 1A6AB 2LABA 3MV7E 4EVNA 1Q0YH 3CFJA 3NH7H 2M2DA 1HZHL 2V5RA 5DD6B 3L3IB 3G08B 3WDIA 2W0FA 3RA7L 1ACZA 1FO0L 3PNWB 4KMTL 4ZO6A 4CL7A 1OGAB 5EC2B 2R2EB 2LV4A 1I1RA 1M7DB 1G0DA 4PP1D 4H26B 5D70L 4OCWH 3WSQL 3OL2A 4XPBL 4FQJL 3B9KD 2QR0B 3M17B 4BFEA 4N0UA 5FB8A 2KZWA 3DX8A 2Z31A 4MQ7B 1BD2B 2AEPL 2YUXA 3MNZB 3ZKNC 3C6SA 4GS7C 5ITBH 2OL3A 1V3KA 4L29B 4OUUB 4DTGL 3A6BH 1BGXH 4JFEA 3RPIB 4BQ9A 4Z7VF 5I1JH 3T0EE 5I8OH 3HMWH 4NQDE 5TE4L 3OR6A 2DWDA 4NQCE 2CR6A 3VXUA 5SWSB 1NUNB 3B2UD 1AO7E 1BJMA 2EDEA 1JZ3A 1IEAB 5TDOB 1QLFA 4HKZA 1P7QD 1PQZA 3CDGA 2HAZA 3ULUC 4NUGL 4YHIA 1U3HD 5JW3H 1VDGA 4L9LA 2VZSA 1CD1B 1A7PH 3IDYC 3TT1L 1JVKA 1FNSH 2NY2C 4P5TD 5C9JB 1LP9E 1MCCA 3WFBL 1XIWC 2W0KA 4CN1A 2HA1A 1IAMA 3GFUA 5F9JB 4LLMA 3H6JA 4OJFL 5ALBL 3SHSA 4HFWA 4DVBA 4DKDC 2QQNH 4C54A 1GGCH 4LCIH 2MPAL 4O51A 2DLIA 2NY0D 3WS3B 1KB5A 3MRQA 4ODVH 3QHTC 3W0WB 3N1PC 3QUKA 3Q6GH 5CWSA 4L4VE 5DS8B 3HC3H 3THML 4GAYB 2VH5L 4J3OC 1YEIH 4L8SA 4HWEL 4ZO7A 5FGBC 3E1F1 5I8CA 1M6OA 2Z4QB 3VD4A 1OL0A 4UIKH 1PG7X 4XC1H 2FYYB 3B9VA 4QHMB 3VWKC 5JIIA 2FECI 3SGEH 4U3HA 1CCZA 4ELKB 4YDLB 1JHLL 5J12C 3UJTH 4ODSH 3TWCH 1HHHB 3MJ9H 4HT1H 5I15H 2H26A 1S9XA 2DI7A 3U48A 2FD6H 1U9KA 5C07E 4PV9A 4XNMB 2I25N 3IJYA 4LLDA 1QRNE 4QNPF 3X11A 5I1LA 2OP4L 3NFNA 1JWUA 1MF2L 1I7UB 1MVFA 1DBJL 1H3VA 3OAYH 3VGBA 2IBZX 1T21B 2DQFA 3QDME 4C55A 1DEDA 4Y5VA 4PJGA 4Y2OA 2I60L 4RQQA 5GGQH 4KJQC 1F13A 1OP5K 3AU1A 2UVFA 4JZJB 1DJSA 3ULVH 1ZTXH 2QHRH 3BP4A 1LMKA 1CLZH 1TVDA 5F1IB 5H35B 3D39D 1H8SA 5HGBB 2GITA 5ISZD 4LSVL 3EYUH 5C6WH 3T65B 3MRMB 4FNLL 1M1SA 1HWHB 4G8GE 1UKTA 1A4KA 3UBXA 4X7CC 3TIDB 4UOW1 3QRGH 4PFEA 4UT7L 2WQRA 3G6JF 4P3DB 3OG4B 2ZPKL 3HS0A 4M6MH 4KI5F 3KPOA 3S8WA 3MRPA 1Z9SA 3WBDA 3O3DB 4XMKH 4BKLA 4NM4L 3ZE1E 4ZAKC 5BS0E 4XPFH 4Z7WA 4XNQB 4EXKA 3PWNB 1DTUA 5I1IL 1JWMB 4RAUA 3T0WA 4KH2A 2O5ZL 4OZFH 3BAEL 1RZ7L 4OB5H 1UA6L 1ZSDB 2YA0A 4MNQB 1A7BA 3I9GL 4OLVL 1YEFL 2XRAL 1B4JL 4R9HA 4WTZA 3QUYA 3IAQA 3DRTA 3BKCL 5DJZB 1I7TB 3D18B 2EDRA 2OTPA 4JRYE 4LFHG 1MWAL 4NPYA 4U1HB 1QLRA 1C5BL 1OCWL 1RU9L 2NY1B 3MR9A 3P11L 3DROA 5HD8D 5D1XB 5KSBE 2PXYC 5KJRL 3VXMB 4ODTL 3PWUB 3SDAB 1INQA 4QYOB 5KS9F 4P2CG 2AJSH 4HH9B 3F6IA 3B83A 2GKIA 5FGSA 1J8HD 5B4MC 3D0VB 5HHVL 4XC3L 1EK3A 1VGEL 1E0OB 2YMXL 4FFVC 2ZCKH 4F58L 4P2OB 3FRUA 4QCIA 4ERSH 4PJ5D 5HBBA 2J8HA 43C9A 1CLOH 3TV3H 5DC4B 5AZEH 4P46D 4MMZC 1D5MA 3VFWB 2ZG1A 5H8DA 3FT2B 3KPLA 4BUHA 3OX8A 3LKNB 3QDHA 3FB7A 4HLZH 5C09A 1IVLA 3MV01 5HXMA 1HXMA 1G7MB 2PYFB 2GSGB 2R69H 4KJWC 1R24A 4R96B 5I74C 1CGWA 1PJ9A 3V7AG 3QUMB 4YZFE 1AR1D 1JK8B 1HHIA 2JB5H 4IJ3B 3CSPA 1ZLSH 2OZ4A 1YN6A 4X9GA 3BIAX 3LB6D 3MJ6A 3BDYH 3SQOL 3GMOB 2VDOL 1Q72H 3QPXH 4PY7B 3QUXC 4XVJH 1C7SA 4IRJA 5EOTB 1IM3A 3HLAB 4KVCL 1IC4L 1XF5A 3MTRA 2R9HC 2O93L 4OKVB 4KROC 4GXVL 1WK0A 2I27N 2N7BA 3UDWC 3WCYA 1DEEA 1DBKL 3VFMA 3MGAA 4HIJA 4UV7L 4WI9A 5FK9A 5B3JE 4U3XA 4LLQB 2V7NA 3ZDXE 2BOCB 3C8KB 1K9TA 1V5JA 5DXWA 3MGTB 3S4SA 1FVEA 2FATH 4Z7QF 1AHWA 1F4YL 1LHZA 4LSPL 2FBJL 5DO2D 3RVTD 3U36B 2X4UB 4MA3B 5T1LD 1RZKL 3X13B 1ZHBB 2R0LL 4YHLH 1E27B 5I1AA 4KQ3L 4IS6A 5IFHL 1W2KT 3NFPA 4K8RC 1NCCH 4TPRH 4KK9D 4RFNB 3C6LD 3G5XA 1I8KB 2VISB 4XP1H 5J11B 3CLEL 4J6RH 4O5LH 4URTB 5F72S 5J56B 4FTVA 1KJVB 3RI5F 3EO1A 4TTDD 3MLZL 3WDHA 3PHQA 3JBG7 3T8XA 4XCYA 1N6UA 5CP3A 1QBMH 3GHEL 1T1XA 3F6LA 5KANI 4YDJB 3DJ9A 4GRLA 5EU3A 1OSPL 2H6PB 4MSWB 4H1LH 3RBGA 3DMMC 4Z76A 5CAYB 3V4VL 2HH0L 1FO0A 2QSCL 1E28A 4XCFL 1JYXA 3QXTA 5ADOH 5J9PA 1YYLL 5D7LA 4QGTA 1XR9B 2P8MB 4Z95L 1PX4A 1ZT7B 3EOYG 1RZIA 2BVPA 4O4YL 3I3DA 3UJJL 3CH1A 2D7TL 1MFCL 2JCCA 1P9MA 1KOAA 1IT9H 1O7SA 3RWEA 1XR8B 1MNUL 1G6RB 1P84K 2O5XL 3I2CL 4NCC2 5AD0B 1QRKA 4PJGF 2OI9C 3G04A 3DX7B 3S5LG 3LN4B 4OZIA 1HINL 1XGPA 2CLVA 5CIPH 5GS2H 2ATPA 1GC1L 3DIFA 3OSKA 4PRPD 3DRQB 3D39E 3DVFA 4NHUB 4ZOEA 4F57H 1BX2A 5ISZE 2E6JA 2Z92B 1RURH 4EI6B 1WJ3A 4LCYB 4Y2DA 4D9RD 3P0VH 2DS4A 3MCKA 4RMWA 5ICYA 2NLJA 4J3XA 1TVBB 3X17A 3ZHKA 1VSCA 2MOVA 1T89A 3EOTL 4NRZA 3T0EC 4Z7WF 5BO1H 4KTDL 4X9IA 4CUCA 3VDBA 4W81A 3NGBB 3ULUL 3L3GA 1GHFL 1INEH 5C70A 4KKNA 4C57C 4NP4H 3BKML 4J2XA 5C0ND 1UWGL 3GSNL 3LKOB 4JEGB 1Y18B 4ODUA 3RUGA 4C4KO 2RR3A 5A16A 3O3UN 3WFDL 4JKPH 5L2JB 2Z31C 1IBGH 2R29L 1MREL 2XTJB 5TDPA 5EPMB 3MGOA 1N5YL 1Z0MA 1YPZB 2Q3AA 1J1PH 3IKKA 2XXMB 4FZ8L 2WBKA 1GH7A 2F54B 1BFSA 1RUKH 3SQOH 3QDAA 5EA0L 4IOIA 5BV7B 4I4WB 4CDHA 1DZBA 1J8HE 5IBTH 5IVOA 1NFIA 1MUJB 3G5YB 3VE0A 3PP3H 5JW5A 1FH5H 2IANB 1CYGA 1LE5A 4ZNCD 5HDBE 4O2FB 4PJ5E 3SQBA 3LMJL 3WHE1 5F3HB 3KJ4B 5F1NB 4XP6L 4Z7NF 4LIQE 3ECBB 4LPCA 1N4XL 4OFVA 1F4XL 5IW1A 3CU1A 3VFOA 1NBZA 4G6AC 1IL1B 4XAKD 4U1NA 1XZ0B 4IIQB 4ODHL 4K71C 3H0TA 4ODWB 4HKJA 3DXAB 2UWEE 5DK0B 3QAZC 5HHMB 5I8EB 1A1OA 5KOVC 1DQJB 2XOTA 1CIUA 2BVEA 2DJSA 3HI1A 4E5XA 7FABL 4M6OH 4Z7OF 2AK4B 1XMWA 4UDUA 3ZDZE 5C0FB 4WTWA 1U8QA 2MKWA 4L8SC 2ZSVA 1CG9B 1OTUD 3BI9X 3AS1A 4HSQA 4LVOC 2HP4A 3U82B 4V2BA 3EJJX 4PTTA 3I50H 3TH2T 4KUZH 4UNTA 5JR1H 1HH6A 1A7RH 3HNTL 1KJ2A 4QY8A 3BD4A 4TRPL 1AJ7H 5F9OL 4JO3H 5IWLA 1CT8B 4ZXBD 4PLOB 1QYGL 1T1WB 4M7JL 4K7PX 2QSCH 2BNQB 2NXZB 1UVQA 3IJSA 1MLCB 1T83A 1JUFB 1Q9LB 2NX5D 3QCTL 1MWAA 1GIGL 8CGTA 1RZGA 5FO9A 1BJ1H 1NFDE 4DAGL 3H3PH 1HCFX 3F7VA 5EO0A 1JGEB 1SYVA 2BNRA 5E4IA 4Y5VC 1F2QA 4HC1A 1P7HL 4KRMB 3L5XL 5D7JB 4ZS6C 5DK2B 2DIAA 3RWJA 3WFEH 1OSZA 1PGRB 3U79A 2O5XH 2WWMC 5IB4A 5DTFA 3TBTB 3CFCL 4IHOB 3U0PA 2XWJA 1G6VK 4TUJA 5DURB 5EU6B 4GOSA 4ZFFA 3RNKB 3HMXH 2ARWA 1CFBA 4LSUH 4TYUA 3T3PE 2FEDD 2G5BB 4GRWH 1QA9A 4OM0L 5C6TH 5ESVB 4KK5D 3AXLA 3SKMA 4JGUA 4PJCE 1UM6H 3VMNA 4R7DB 5E8EB 2JJWA 3MOAL 4ODXA 1I7RA 5DEZA 4CN4A 3WIHA 5JIPA 3MFGB 4RIRA 3OKEB 3H3BC 3NCEB 5D96C 3IRPX 4NN5C 5IROA 1N2RB 4Y4KD 4JQIH 4ALAH 3X3FL 2JCCF 4NBXB 4IOSD 1NC4A 1ORQB 1ZS8B 3VRJA 1INDH 4OLWL 4P23B 4XBGA 4LLWA 3ULUH 3QUYC 2IH1A 3RTQD 5L9DL 2CKNA 5B8CA 4OZIF 4Z7UA 3C5SA 4K55A 4WWKD 3VGAC 4NCDA 4S2SA 3GBNH 1WAAA 5FEBA 5GRWA 2PW2A 1RUML 2Z93A 4PP1C 3FTGA 2X4SB 1TPXB 4PJHB 4NRYB 5DUML 3WFDH 3B9KC 2JE8A 3UTOA 3S98A 3MV9B 4KKAD 1DN0A 1BQLH 2E9WA 3A6OA 3L3OA 1N5YH 5DQ9A 5IM7A 1RZFL 1UEMA 4D9RE 5KSVB 3ARYA 1RVFH 5I18H 1AFVH 4H20H 2CDGA 2QQLL 2OR8A 3BZDA 4M62L 5EA0H 4ZO8A 3VCLB 2GJZB 5T1KD 3WE6A 4YIQA 4KVNL 2BXYA 3QIWA 4HUVA 1W72B 2HTKD 4Y1AD 2ZG2A 3C5ZD 4FOMA 1E4XH 2R1YA 1WBZB 3B2UC 4XVSL 4NO3B 4Y4HD 4DCQA 4C56D 3RUGF 3EO9L 5CINH 2X1QA 3SOBL 3K74B 4XP6H 1N0LA 2BMKB 3FHAA 5I17A 3CXDL 1OQXA 2B4CL 2DLHA 4UT6L 3HG1A 1AP2A 4MCYA 3RZCB 3E6FA 1JBJA 1UKQA 5BZWA 3UO1L 1XF2A 4P5TC 4KK8C 1LK2A 2XZQL 4PJ8A 2GK2A 1QSED 5LQBL 1RK0B 3EYSH 4FFWD 3MOBH 1HH9A 4OD2B 1FIGH 4FQQA 5BJTB 1MEXL 4M7KH 2P49B 3GMNB 4FQ1L 1ZV5A 5HPMA 3I6GB 3O6FD 4HKXB 1IGIL 5IB3B 5HHXL 3WFHB 4LAQH 1DQDL 3IF1B 5HVGB 4JZNA 1TFHA 3CVIL 3VXRD 5HGHA 1K4CB 1NKRA 1G9NL 4HHAB 5LGJA 1NJ9A 2UVEA 4N5ED 4LFHD 3TZVD 5CGYD 3DSFL 4JANA 2MQ3A 2E6PA 3A6CL 4MDIB 4HIHA 2BSTB 2ADIB 2VC2H 5EZLB 3ROLA 4OZFB 4XH2A 4LBEA 1A1MA 2J6EL 2M8XA 1ACYH 4OF5A 2OR9H 4XAKE 4TVSa 4HJ0D 1E4KC 4AIZB 4KXZI 2C7UA 1ZHLA 3DETD 3SCMD 4O9HH 4DZ8B 4PB9L 1WZKA 1N5AB 1SJEB 4OLUH 3O3EB 5C0CA 5JQ6H 3GI8L 4QXGH 5E7FA 1BFOA 4OV5A 5TDNA 3OR7B 4LRNH 4M48L 3B3IB 2IH3B 4NDMB 2E27H 2OJEB 1Q94A 2YD7A 4WI5A 1LE9B 1ZHKA 4MD4A 1JGDB 4LHUB 3ME0A 5FYKU 1P6AB 4DN3H 3RWHB 4OLXH 3R8QA 5CSGA 4ELMA 5F7DA 1KPRA 4B7LA 2V7HA 3IFNL 3OHXB 2E8ZA 4PD4J 5DRZB 2IG2H 3GSNA 3GM0A 5C2BL 3PG2A 1EHAA 3C8HA 3K8MA 3I6LD 1IAOA 2Q86B 1P9MC 2NX5E 1D5BA 3LKRB 4XRCA 5DRWA 1K8DB 2X6MA 2XIDA 1GOGA 3VXSE 1NLBH 5ETUA 3CDFA 2Q8BH 3D85D 3BJLA 4X8JB 4YO0A 1UM4L 3STBA 1CFQA 1P4LA 4PRID 3QXAB 1KCUL 5L2KD 2H9GB 2VLKA 1CDUA 4W4NA 3N06B 5LAXA 4HEPG 5MEQA 3MACL 3JWOL 2OBGA 4GMTH 3MRNB 4X6BA 3CXHJ 2Y06L 5D7IB 4Y2DC 43CAA 4U6XB 2DL9A 4YC2B 5FYKD 4LEOB 4OCSL 4F8QA 4WW1A 3T2PA 3O4OB 4R4FL 1EHLH 4MAYB 1T89C 1RZFH 2FGZA 4J3VA 35C8H 1KCRH 1OM3L 4R4BA 5CBAB 3O41A 3MRLA 2FO4A 4QHUA 3L3HB 1T20A 3BO8B 1IQDA 4G3YL 1YQ2A 4RMSA 1JGVH 2RQ8A 3HUJA 3CFEB 1F11A 2D31B 4GW4A 2WBJD 4K7PL 1HN1A 4KVNH 4YXHL 4ORGA 5C0AD 2EIZA 1A4JA 5DHXB 5AWNH 4R90L 3CSBA 4LASL 4RRPG 1HHGB 2OK0L 3GSVB 4LKXB 5BCAA 2D03H 1WAAF 3LD8B 2LVCA 4B5EA 2BDNL 2AJUL 3TO4B 3F5WA 3BPOC 3OJDB 4LAJH 4GKSA 2VQUA 4JG0H 4PJFE 4ZQKA 4TTGA 1DBAL 2ICCA 4JRWA 1X5YA 3V2AR 1AR1C 5IVXB 2CXGA 3MLSL 4G7VL 3PQYD 5TGBA 2AQ2A 4K8RH 3U6RB 3LB6C 4HXBL 5C08A 4HWNA 1F3RB 3LSOB 1SJHA 3ALWA 4LCUA 2FGWL 4MXWL 1I8IA 5MEOA 2ID5A 3S35H 4PUBL 4H1LB 1ZGLP 3U46B 2HT3D 2X10A 1QFWH 3V5HA 5DGRA 1QBLL 5HHXH 1C5CL 1R5VA 4Y1AE 4DUVA 4J4PA 1P1ZA 4JY4A 1PZ5B 4P57B 4OCRH 4C56E 4YHNA 3K2UH 1N3NB 3VFVB 1PFCA 1DUZB 3S3JA 1UB5A 3RWCB 5ANMB 5IMKA 2HFGH 5HHQB 1FLTX 1RIVH 1I7ZB 1JZ4A 3VXQA 1QSEE 3O6LH 5HVHC 2CKBH 4NCC1 2MFNA 5CIPB 5GGSA 1CXLA 3JTSA 3PGDA 4BQ6A 3MLWH 2R2BB 3LN9A 1RUAH 2XQBL 3MLRL 2CH8A 1VENA 2VXSL 2VLRB 4M3JA 2APFA 3W9DB 1BQHA 2BSRA 3VXRE 4J23A 3MSPA 1MHHB 4XB8A 5FHBL 3IDJA 5E2TH 5IBUG 4F7EA 1C8PA 5KAQF 2AXFB 4G9FD 4P9ML 3K8LA 2DLFL 4F9PA 1NUGA 5JXEA 3PL6A 2NW3A 3CVHA 4BH7A 3IFNH 2VKXA 2YK1H 6FABL 4KQ4H 1L0YA 4FXKA 3VWJB 1FGVL 3L7FB 4F2MB 2RAMA 2DM4A 2IF7A 2F8XC 2LU7A 2WINA 1YN7B 3QB7C 2FWOB 1TETL 3LRGA 5DYOA 2W9DL 2DQEH 2WLYA 5T1MB 2FRGP 4MQSB 3RJDA 2W0LA 4OZHA 1KPUB 4E42B 2VDNH 5T1DH 1FE8H 3MV8A 3QDJB 5CUSH 4EN3A 1YEEL 4PLNC 1J0YA 4J3TA 5ILTL 4ELMF 3DUHA 3RVWD 3V7AE 2OL3H 4N0CD 1K4DA 2I07A 3I02B 1T22A 3AFLA 4BK5A 2GSIB 2FHCA 4OD1L 4D0BB 1IGTA 2WUBL 4NKIL 1G9MC 3UX9B 1U8LA 5EULV 5EORH 5I6XC 4H25B 5CZVH 3RKDC 4TSAH 4AZ8A 3I3BA 4F7CA 4WEBH 1TVHB 3I6LE 4XNYH 1QP1A 1KIQA 4NIKB 4WEMB 2G75B 3BZFB 4I3SL 4JHAH 1EO5A 4LKCB 5FUCE 1T0MB 1RZ8A 3DVNB 2R0KL 2WUCH 1L9MA 2J8UE 2DKSA 2ZUWA 3FL7A 3PE9A 4PRIE 3FB5B 4F80A 5L2KE 3IAGC 5C0NC 2FR4B 3IDNA 2I5YH 1P4IH 1YNTA 3CFKA 4ENED 4RMTA 1MELA 2YWYA 1U91A 2ZUQC 2AJUH 5DGQA 4POZC 3ZE0E 2BRRH 3VW3L 4PB0L 2MNUA 5FGRA 2Z35A 5EIIB 3WS6C 5IP4A 4X80H 5F7KC 5FYKE 2FIRT 5C8JA 1ZA3A 1CGUA 3SDXB 5GGTL 3GI9H 3QQNA 3AB0C 4F7PB 3CX5J 4MXWH 4ONGL 3D2UA 4AIOA 3FCTB 3RP1A 5TQ0H 4WNQB 3HUJF 3BP7A 1GZPA 2J6EA 4G6JH 3PV6A 1YNKH 3SKNA 1V8HA 5DD0L 4XVTH 1PKQB 2FBOJ 2JELH 2P5WA 2IJ0C 4KAQH 4JJHA 5C0AE 3Q1SL 2N1KA 5EIVA 3WNOA 3HC0A 1YY9C 4CVZA 4ZFZB 1P7KA 1T0NB 4EDWL 1UADC 4IBLT 1NEUA 3NABL 1AD0A 2J8OA 4Q0XH 3PQYE 1ZLVK 2APWA 4EDXB 4I3RL 2C1PA 1MCWW 5SWZD 4GRWB 1SVCP 5D2LE 4GS7B 2LFGA 5FHAH 1UACL 4TN9A 4JM2D 2EO1A 1E4JA 4YHZH 2A77H 5J6HB 1TJIL 3A0OA 3IXAB 4M7LH 1UXSB 2DQUL 4LLYA 3MRBA 4RGOL 5CD3A 4KKLD 1BBJB 4NC2B 1GXEA 4QRRD 2XZZA 3MRCA 2OMBA 5DMIH 2DLFH 3RGVD 4IEFB 1YQVL 4NZJA 4ZXBC 5IV2A 2DRUA 3MLYL 1T2JA 3MUY1 4G42A 3IDYB 1CIDA 2NY2B 3VD3A 4DZBA 1SQ2N 3OKKB 4L8BA 1KBGH 5IB1B 1VACA 4BFIA 4OSUH 1XIWB 3RQ3A 3LS5H 1G1CA 5DMGD 4JZOB 3QG7L 3IJHB 1CGSL 1C5DA 2YA2A 5F8QC 4QXUL 3LEYH 3OGCA 1OGAD 3MA9H 4M4PA 1QO3B 3CMOH 1B9ZA 1X5XA 1T03H 3SGJC 1S7WB 1F6FB 5I2IB 5EBWB 1AQKH 2QSVA 2ZNWA 2GUOB 1OAKL 4OQTL 2X4RB 2AGJH 1DQTA 3D69B 2HT4D 4G9FE 3O9WA 5IFJB 1F2XK 4MAUH 1I8MB 4NJ9L 4HV8B 2FEDC 1F6AA 4G8IA 5DZOA 1KEGL 5CD5D 4A6YH 4KK5C 3QIBA 2VITA 3WUWG 4TSCH 1CLCA 4WJ5A 3VWKB 2ADJB 5J12B 1WBXA 1ODAA 2YUVA 1M7XA 2V2TA 5C92A 5IW3A 5D5MB 5SWSD 4N1EA 1QRNA 5DJ0A 4G80A 4LIQL 4PPTA 2CDFB 4Z77A 3PDDA 4QGYA 4X8XA 1F3JA 3IDMB 4RFEA 3RTQC 4PJAE 2FB4H 3VMPA 2OZ4H 3ZKXC 1FZKB 4YXKL 4F7TB 2VKWA 3C60C 4ZUTB 1R3HB 5GSVB 5LKNA 1U3ZA 3QUZA 5DUPL 4U6HB 5EG6C 4TNVF 3PJSB 4ZPVA 3L5WA 4KKAC 1AXSB 2YD4A 1BJ1J 3RU8L 1IGCL 4R2GC 5GZOC 2VXUL 4G8GA 5DC9B 2F5AL 4LHQB 3W0WD 2QHLA 1KFAL 4N1CA 1NGZB 2DJUA 5KW9L 4XCCH 2VDPL 4MA1C 1HILA 2ORBL 3P2TA 3QWOA 2BY3A 2Z8VC 2EH8L 3NCBB 4LPYA 1BREA 5BS0A 3P77A 5DHVA 4ZAKB 3OJMB 2HTKC 3W2DH 3ZYOA 4HWBA 4XMPH 2XXCB 4YDVB 4Y4HC 2VR5A 2OS7A 1AKJB 2D4FA 4IOFC 4NUJB 4PJIF 1U2CA 3BVNA 4QRUB 2W60A 3A67L 5EZIH 1MHEB 1FZJA 4XGZB 2BC4B 4PJXE 3QO1B 3KPRA 1CXFA 1OF2B 4FABH 4R7NA 3NABH 3TT3L 4K2UL 4QHNA 4K9EC 2PXYB 3TPKA 1Y6NR 4XVUD 4X6DE 3X3GL 2AERT 5EUKB 2BHUA 4U1LB 5FUZH 3GSRA 1FFNB 4HUUA 3KPMA 3P73A 3ZTJG 4J4PC 2PCPA 2YPLB 4HUKB 4I5BB 3R1GL 4DW2H 4Z8FH 1IGMH 1X7QA 1BOGA 3TZVC 4YDKL 4Y16D 4EJ1C 1F58L 2FL5B 2ZG3A 3QDGB 4OD3L 1ETZA 5GRJH 2WIIB 2CRYA 2YD8A 3SE9L 1C16A 1JGLH 2A74A 4R8WL 1IZJA 5I74B 4F9LC 25C8H 1J05A 1EIBA 1JMZA 5IJVA 3FAXA 5GZND 4MLIA 2BSSB 1S7UB 2V5YA 5FO8A 5SWZE 1QACA 3TM6A 5KSAD 5E8DL 5A2IH 3QUXB 2DQDL 1ZWIA 1RMFH 1AGFA 5F7EL 3S37H 3FZUD 5TPWH 1A3QA 2RFXB 3P0YH 4KROB 4HPYH 4LSQL 5E9DD 3HE7A 2R8SH 1JZ2A 2NY1D 1RHFA 2GFBB 1MFNA 1I9RH 4F9PC 1AQDB 1CL7I 2W1NA 4OLZL 3HCVA 3PL6C 4YBQC 2AP2A 1OAYL 4CW1B 3BJ91 2GCYA 4QRRE 1QEWA 1ZLUK 3KPQB 1T80A 3FFCA 4NWTL 4JFDB 1HHJA 4GUPB 4ZYKA 2FX7H 4DKEH 1D6EA 1FVDB 4FQCL 4L3EA 1J1OH 2IPUG 4NKOA 4P2OD 3E8UH 1CDGA 4OIIH 4NYLB 4XTRC 1QQDB 5C0RH 3EJZD 2BNUB 3I6KA 5ID0A 3JSSA 1MFAH 4JY6B 1K8IB 5MP6H 1OGAE 3FN3A 1IM9D 3O2WL 3QXDB 4Q58C 4NKDA 3KXFA 4LK4A 4ODBD 4JDVA 1HI6A 1KENL 4YHOH 3DX6A 4BSJA 5GGTA 1S7TA 4PJ9A 1DANT 5GGRB 2R1WB 1J5OL 2GJ6A 3OXRB 5JW4Q 2NR6D 4UOJA 4ZUWB 3O11B 4LRIA 1E6JH 4G6ML 4MJIA 5IB5B 4YXLH 5J1SC 1S7RA 1BZ9A 1OB1A 3DMMB 4QHKI 4NQEB 3CFBB 5C7XL 4XNUL 5E8NB 1OT2A 1TDQA 2EKSA 1UC6A 2AJZA 5DR5L 1FN4A 3AY4A 4PRAA 4GKOA 5TF0A 3B9DA 2FJFB 5SWSE 1XGQA 2DLGA 2YD3A 4LCWB 2CPCA 2CKBB 3GJFA 3SDDD 5CBEB 2Z8SA 2UYLA 4AL8L 3DARA 5CEZD 3GO1H 2Y7QA 4J12A 4MJ2A 2NY4C 4RGNC 4G8EB 2OI9B 2D9QB 3CC5A 1ERNA 2IGFL 2R0ZL 1U42A 2LVEA 3OKNA 2HN7B 3L7EB 1JPGB 5EZJB 4FFYH 4E41D 1PKOA 5IHLB 2DWEB 1TQBC 1T5WB 4CVWA 2EYRB 3W0WE 4J8RB 4ZSOE 1W0VA 4Z78A 3KS0J 5DVKA 1FORH 4P59L 4X6EB 1UG9A 4EVNB 3OV6A 1MJUL 1KJ2H 3WXWL 2Y07H 3T0EB 3L6FB 4NQDB 1JFQH 1NMBL 5IT2L 2XNAA 4OF7A 2A1WL 4U1SA 5KVFH 3C87A 1B6DA 3BPCA 2YA1A 1A6VH 1XCTB 3FN9A 4NC1E 4YPGB 3SGKC 4JPVL 1FG2A 2J7LA 1FFQA 3TIEB 3WKMH 4MA8H 3MZTA 2Q1EA 2AK1L 4QOKA 1AXIB 2H32H 3EFDL 1F90L 2NY7H 4OBSA 3D3VA 4HWUA 5F7FA 1U41A 3OKYA 5GS0D 5CP7B 2ADFL 1PEWA 4N0UB 3DX8B 4PJBA 2Z31B 5D93C 4HC1H 1NL0L 5SWQA 3INUH 3C6SB 1KLFA 3TVMA 2OL3B 3MROA 3MUGB 1MCDA 4H88L 2JJSA 3EGSB 4DOHB 2DQHH 4G8FB 4WUUA 4UT9H 4Y8DC 2DQDH 3MC0A 4P9HL 1J8HA 4S0TD 4CMMA 3OR6B 3D87B 2DQIH 4Y5YA 4YPJA 1HQRB 4PGDA 1LD9A 4MA7L 4M6AA 3KLSA 5DQJA 4S1DD 1QLFB 1S5IL 3GMRA 4HKZB 4KC3B 4JPKL 1PQZB 3CDGB 4W4OA 3WIHH 2FH8A 2IBZY 4L4TA 1C08A 4YHIB 1G9MH 2P8LA 3NTCL 3ARBA 5CS7A 1EZVX 4I0KA 5CILL 3LH2L 2CJUH 1MJJB 3OAUH 4Q2ZA 4XCNA 1L7IL 4BA8A 5C0JA 1AI1L 1NGQL 1MJ8H 1U8NA 4LLMB 3EIFA 4OGYL 5LXGL 3QBTB 5I1GH 4K71B 5C07B 2AKRA 2FH6A 2CRIA 3MRQB 1JL8A 3DUUA 3QAZB 3QO0A 5GSRA 3UTZB 1L6ZA 5GISL 3S34L 5T3XD 2RIKA 3OZ9H 4Q9BA 3VH8A 3FB8A 4D9LL 4YK4C 4IRZL 5E9DE 3IVKA 1TENA 4L8SB 3O9WC 2XTJD 1FYTD 3ZDXF 1NGXA 1HKLH 4X83A 4LVOB 5EWIL 4OIAA 3DYPA 3VXME 2Y25A 4N0CC 5DD3H 4M03A 3QIBC 2X70B 4YFLI 5CJ8A 3KGRA 1UWXK 1JPSH 1KC5H 1V3JA 5HDQL 3ILQC 2H26B 5KG9B 2YPKA 5EBLA 1WCBA 3BE1L 5E03A 5L88L 5DJYA 1N8ZB 2IAND 3UTTD 1M05A 3VMOA 1TZGH 3C9NA 3X11B 4LCCA 3NFNB 1JWUB 2ZSWB 3P9LA 4OAWA 5IGXL 2DBLL 1DE4A 3BN9D 4KPHH 2AI0L 2Y6SC 3KPSD 1M71A 3P9MA 2DQFB 5HYQA 1LDPH 3KPPA 3C6LA 4Y5VB 2A0LD 4MNGA 3WLBB 1HOCB 3QFJD 3QUZC 4KK6C 4NQXA 4HZLB 1CDIA 4JFOA 1T7WA 3NA9H 1WCQA 2J5LC 1NLDL 5KBNC 1MIML 3G6DH 3DXAD 4JRYB 2GITB 3DSNA 1GRWA 3LEXA 4N8CH 1HEZA 5KSBB 5HYJB 1A4KB 1U93B 3UBXB 3LKSA 1S9VA 1SJXA 2AK4D 5IESL 1CLYL 3KPOB 5GGVH 5IVZB 5IR1A 1EFXA 1Q9OB 2EEDA 2JIXA 4JN2A 4NJAL 2ZCHL 3WFCH 5D96B 1ZLWH 4NN5B 4PY8I 1A21A 3VXPB 2E9BA 4F3FA 4APQD 3IFOA 4LDOB 3WXWH 1OD7A 1IAIM 4YHKL 2ZJSL 4XAWL 3TNMB 4EEEA 4D94A 3NFSH 3ZYJA 2J2ZA 3MBXL 3RL2B 5CEZE 1JPFA 3M1BA 3QUYB 4JQXA 5E2WH 5F44A 3DRTB 5GGSY 3B43A 1KT2A 2BNQD 4I9WD 4HIEB 4NPYB 1S7SA 2NXZD 1QLRB 1Y0LA 3BH9A 3VGAB 4GG6A 3MR9B 5BXFA 3E3QC 1EEZA 3IT8D 4BQ8A 2AK1H 5KTEH 1TTUA 4ONHA 2DAVA 3HR5B 1GGTA 4E41E 4KZEH 1FC2D 3B9KB 5CJQL 1INQB 4I2XA 1CQYA 5LGKA 4Z5RA 1JMXA 4GLRI 1FL6A 5CSBA 5TFSL 5IKCB 2IQ9L 4PRNA 5D7JD 3MRIA 3CLFL 4EUPA 1C1EL 4HMDA 4S1SL 4A6YB 3CD4A 3CX2A 5IFAL 4X7DC 4LDEB 3U4AA 4ZD3L 5DURD 4JM2C 3T1WA 3BWAB 3FRUB 4U49A 3BP6B 5EUOA 1CQKA 1EEUA 3V52H 3LOWA 3UYPA 3RDTC 1D5MB 2ADGA 5FA3B 1NDGB 3KPLB 4Y88A 2SEBB 5F7LB 3FKUS 1U8IA 1EPFA 1HXMB 3RGVC 1R24B 1LILA 1G7IA 5HYSG 2NXYD 1EGJL 5C0EA 1KB9J 5C6PB 1UKSA 4I8DA 5J6GA 1X44A 1YN6B 3U7AA 2E5EA 4P5TB 4BZ2H 1ULVA 3CCHA 4XWGL 3MCG1 3MRHB 4I0PA 4O2CA 1IM3B 2EH7L 5DMGC 1U8JA 5B39B 3IDIA 3U4EB 4ZDHB 4U1JA 3IKCA 4HS8H 1OP3H 5JPMA 1ES0A 3HE7C 3VFMB 2F53A 2UZIL 4HIJB 5EU7E 5F88A 2X4TA 3S34H 1JI2A 5FK9B 2V7NB 4P5KB 3WN5C 5HDBF 1RK1A 5D71H 5FYKL 3KYNA 4XHJD 3BRGC 1UB6A 4LU5H 4NQSA 2XV6B 1RI8A 1GGIH 1FVEB 5K9QI 3FT4B 3AMLA 5HJ3B 4OCXH 2F15A 4RDQG 2CUHA 3F8UB 3KPNA 4ORZC 4K23L 2EECA 1PLGH 5DRNA 5FM4A 1CD9B 4IS6B 1EH9A 2YR3A 2UWEF 4XP5H 2DQJH 3NFPB 3ELAT 5F1OB 1LO5A 2W07A 3NIGE 3G5XB 5IOPA 1KTLB 2EIBA 4PJ9C 3ZDZF 1A7QH 2OLDA 1KELH 2ZOLB 4ZOCA 5T3XE 4FTVB 4H0HB 5KSUA 3EO1B 1CXHA 2CK0H 3PHQB 3UAJC 2C4FT 3T8XB 2XTJE 1T04B 3T0XA 4LRIC 5FUOH 5C0IA 2XYCA 1YPZE 4UBDC 3ULSA 2A83A 4DUXA 2WLZA 3LIZL 4TUKH 4K9EH 2EC9U 2ZCLH 2HKFH 2ITDA 3ULVD 4ZODA 4JO2H 4WV1A 5EOCH 1S7VB 4LVHC 1MRFH 2X1XR 3D39B 3LZFH 3AY4C 1WEJH 2EZ0D 4FXGA 2EDLA 5J1TC 4LPUA 3GMPA 2IANE 3UTTE 2GAZB 1A22B 3JVGA 4YE4H 1LEIA 1WISA 3CH1B 1J8KA 2EYTA 3T2NL 2ERJC 4JO1L 1RZJC 3VXSA 1G7HA 4XZUB 3HI6H 4FQHA 2HVJB 4R0LC 1A6TA 2FHFA 4V1DD 4NO5A 3QFJE 4AK1A 4UTAH 2IC2A 2GT9B 2V6HA 4YWGL 4BJLA 1XGPB 2CLVB 3IDGB 1D5XA 4U4BA 3DIFB 2H2PD 2MCPH 3B2VL 3T3PF 3LQAC 4MJ5A 3DXAE 4AYFA 2VDLH 4RAVA 4Y2DB 4PV8A 5ENWA 3GSOB 3MCKB 4XPHH 3GSWA 4OBRA 2NLJB 2AK4E 2EE3A 4XBPA 5JW4M 2QEJA 4O02L 4XVUC 4FQIL 1KIPA 3VDCA 1ROWA 5FF6A 4M61B 1VGKB 4Y4KA 3QPQD 4I18A 5HHOA 4ZD3H 3QEHA 3TBYA 3L3GB 1BVKB 1F4WH 4PG9A 1J1XH 1H3PL 1MVUA 3G9AB 3QQ4B 1GPOL 4CBPA 1DR9A 4HULB 4U7MA 3MCLH 2OQJB 4G43B 5JW4N 4ODUB 1A47A 4Y16C 2G2RA 3IU3B 2QSQA 5IHUL 1KYOK 4I9WE 2BNQE 2EDXA 1PD6A 1IILE 4JO4L 5LWYH 3MGOB 3BPOB 4GKNB 5C1MB 5E2UL 4R3SB 2DMCA 4CGTA 1S8DA 3FQRA 3JUYA 4MD0A 3H9YA 3CSGA 1YEKH 2JJSC 4WDIA 2GY7B 3HAEG 1CFVL 2ICEA 3P4MA 4YFEA 3U0WH 1ZT4A 2NW2A 1XT5A 4KHXH 3GMQB 5ERWA 3QP3A 5SX4H 1MJ7H 4Y5YC 5KSAC 1XF4A 4MJ4A 3HRZB 4MB5A 3FZUC 1H15A 4MDJB 1UWEH 4QTHB 3ZSSA 4E0RB 2VIRA 1LE5B 5EUOF 5JZ7C 2AJXL 5JOFA 3REVB 2IPTL 3VRIA 5LGHH 3C5ZA 1YNLL 1A2YA 3ARBC 5K9JL 1IKNA 4MAYD 1L9NA 2OMNA 4C83A 1N6QL 4X6CB 1FIEA 3VFOB 3TEUA 4UQ3B 5J89A 3BISA 2KDGA 4GMSL 2F58L 4YFDB 2AXGA 3H2WA 3HR6A 4HKJB 2GY5A 4QRSA 2HWZL 1GZQB 5T1LB 5D1ZD 2J4WL 5D7SH 5HVHB 3QT2A 4RZCA 1MAML 2E7CA 2F19H 2B1AH 3H7BB 1NFDB 4NBZB 4P2QA 2YD9A 4K3DH 5L8LB 1SBSL 1F45A 3MV9E 3ZYZA 4HMEA 3LKQA 2NR6C 2X4OB 5ICXB 3MBED 4TVPH 4BSWB 4MS8D 1U8OA 4HIXH 4QY8B 5AZ2L 4N9GA 1IKFL 2EDTA 4CVUA 2PTVA 4GG8A 4U1KB 1J88A 5D9SA 3OKOB 5C2UB 1UVQB 5DFVD 3IJSB 1FL3A 4LCCC 4PJCB 3O2DH 2YSSA 1HXYB 4XCEB 2H32B 5AG9A 5FO9B 3X12B 1IRAY 3F7VB 5EO0B 1MH5B 4P2RA 3OWEA 3S88L 3RWJB 3SDDC 1OSZB 3F58L 4NKMA 3ARZA 5DTFB 4FFZL 3U0PB 3JWDC 3FFDB 2HRPH 2XWJB 1AE6L 1Q9WB 3KYMA 3EYVA 1LEGA 5DJAB 3DOSA 1EA9C 2Y72A 3ZMRA 5GS2D 1QA9B 5DVMA 1B0GA 3ULVE 4QRPB 1MI5A 4M9OA 2Q6WB 1UYWL 4N8PA 4QXWA 3FONB 3QA3B 1N64L 3BUYA 3SKMB 4PRPB 2HLAA 3RL1A 2PR4H 4ODXB 1I7RB 4XNZC 4HEME 4S0SD 5E94B 5MEPB 4HFUL 1AIFB 2IFFH 1FNEA 2VLRD 3BMWA 4M43L 1A7NH 4DKFH 4P4KD 5TF1H 4RMUA 4OZGA 4UB0H 3QQ3A 3G9VA 5DFWH 5HY9A 3V4PH 3H8NA 2ZUVA 3R4DA 5I6XB 5J3HD 1AGDB 4U31A 5CSZB 3DO3A 5D8JH 2XN9A 4ZFGL 2X7LB 3V0WL 1NC4B 2Q8AH 5I30H 3VRJB 4H8WH 1GAFH 3LY6A 4LLWB 5I8KH 2IH1B 5CZKA 1H3PH 2XFXB 1J87A 3KDMA 3OB0K 4CMHC 4V1DE 4Z7UB 3C5SB 4H5SA 3GBML 4S2SB 5LG1A 5T33H 1MQKH 2Z93B 3FTGB 1NGYA 1B2WL 1J0HA 3VWJD 5J57B 2OCFD 2YKLL 5HHPA 3NMEA 1QNZL 1MHCA 2W9EL 2ZUQB 1DN0B 4BZ1H 3QQ9D 4I77L 4D0CB 2H8PB 3LQMA 2QKIB 1DDHB 3S96A 5FO7A 5EOQH 4HGWA 3HZVA 2EE9A 2VRAA 4ZTOH 3AB0B 1QG3A 3QDJD 4YR6A 5DJ6B 3BWUC 2HJFA 4YIQB 1OTSD 3BSZL 2UY6A 4CADB 1I3VA 2JF1A 3O3BB 3J7HA 3U7YL 1QSFA 3QG6A 5F7NC 4DCQB 3Q6FA 4HCRA 3STZA 1IGJB 3HPJA 2HKHL 5E6ZA 4RWYL 4PRHA 1AP2B 3B5HA 2EIEA 4X99A 4PJDE 4K94L 3U9UA 5DJDA 5BZWB 2QQQA 1XF2B 3GKWH 4TOYL 4JFYA 1D6VL 1RUQL 3JTTA 2DD8H 2VUYA 1NC2A 4I0PC 2B2XL 1NDMA 5IK3B 3S3PA 1KJ3L 1HH9B 4IMLA 4FQPA 3C09C 1XH3B 2HWZH 1OAZL 5B38G 5HPMB 4UDTA 5JUEL 3SEPA 3RWDA 5CCKL 3KJ6L 3S7GA 4YAQB 4ZOAA 1QHPA 3WNLA 3DURB 1I9JH 5HGHB 5BMFH 4EI5A 4P49A 4LMQI 1NJ9B 3RWGA 5D7IE 4I48A 1CZ8L 2HT2C 5GHWH 3RNQA 1BWMA 4LLVA 4NGHL 4HIHB 2BK8A 2J1KA 1H8NA 4WEUD 3MRGA 5I75C 3MLPA 3RKPA 3ROLB 1S9WA 3D9AL 1A1MB 2B0SL 1VPOL 4UAOC 4WFED 1YMMA 3FQUA 1FP5A 2UV3A 1JNHA 1PZUB 1ZHLB 1V7NL 2FX9H 5CJOH 5DHVH 5DJXB 4ZXBB 2MHAA 4P48A 3S36L 2PO6A 5TQ2L 3TYGL 1RZJL 3ZL4L 4HWBH 4ZS7H 5ESAB 4AEHL 4MHHI 2APTA 5IEHB 1P5VA 5A2LH 2MJWA 5C0CB 1BAFL 3MXVH 4OV5B 3QI9D 4HPOL 4X7TA 5TDNB 1T4KB 4HGKC 1YECL 3LEVL 3VGFA 3SDCA 1TCRB 1FAIL 2A0LC 3M8OL 1R0AH 2HTLD 3GNML 2LTQC 4YBHA 2AJ3A 3SJVD 1ZHKB 4MD4B 12E8L 4NQTA 3L1OH 2X1OA 1T7ZA 5IVXE 1D7FA 3KNBB 2CMRH 2DYPD 5F7DB 3V4UL 4Q9RL 5AUMA 2NY6C 1KPRB 2KUTA 1F8TH 3O0RL 2V7HB 4JCLA 4RISL 1NSNH 2QQKH 5L6YL 5KVEH 5I9QC 3ZKND 3MLXL 5C9KA 1D5ZB 1T5XA 5EU4A 5TE6H 2AJYL 1L7TL 3HPLA 3UC0L 2GHWB 2DQGH 3IFLL 4OLYL 1D5BB 4XRCB 4I0CC 4CNIA 4ZFGH 3NZHL 4APQC 3NN8A 3MA7A 1CFQB 2B20A 1P4LB 4X4ME 3WDJA 3ZKSD 2VLKB 5ANME 5F9DC 5LAXB 4Y4FA 1S5HB 5MEQB 3AREA 3RTQB 5C0BA 1U8PB 1I4FA 2VABA 3ZKXB 2P24A 3LV3A 2NY2D 1BVLA 2PYEB 2VZTA 3C60B 3UCRA 43CAB 1EVUA 3U2SA 4S10A 1QNZH 3UBXG 1MFBH 4PJFB 3IDXH 3QEGL 1JNLL 4IRSA 5KVDL 3CH8A 3SO3C 4KJPC 3CMGA 4YBLC 5CHNA 3F7YA 3PHOA 4P2YA 4R2GB 2VLRE 1R5WA 4WU7B 2FO4B 4QHUB 1BZ7A 1QFUL 2XA8H 4I18C 3JV4A 1F11B 4MA1B 5DLMH 4ZUVA 5LCVH 4FS0A 1WQVT 4MJ6B 1A4JB 2KQNA 1OW0A 4KY1H 5E95B 4WTZG 4PBWD 1HYSC 2CD0A 1KPVA 3JWNC 4Y1AB 2BCKA 1A1NB 3GHBH 3HNSL 4Y4HB 4C56B 5CMAB 3GMMA 3MLVH 1KIRB 4U1IB 4X5WA 3GUTB 2EDOA 5DMKB 1NGWA 1WFOA 2NXYC 3BN3B 3ZE0F 5M7QA 5TGBB 1WSST 4DGYH 4FQXA 3WIIL 3H9SA 1BIIA 1WBYA 4TUOA 1I8IB 5MEOB 1U58A 2X9WA 1BHGA 4X98A 2WWKT 4NT6B 3V5HB 3WL9A 1CDCA 3N85H 4QRQA 2C3VA 2CXKA 1RJLA 3QDJE 3QUML 3ZTNL 5F1SA 2NTFA 2Y36H 5I66A 5DDHA 3PGCA 3CDYA 2BOBA 3ARFC 5TE7L 4LARL 1IKNC 4JY4B 1KXTB 4JDZA 4JGMA 2LAAA 2NNAA 1IC7L 3EOAB 3GKZA 1UB5B 3TZVB 2A6JB 1U3YA 4XPGH 4LGPB 3O3AB 1NCDH 4BUGA 4EOWH 5IMKB 5I0DA 1SYSA 3KPTA 4G7YL 2OJZH 2R4SL 4OCMC 3RVUC 1BBDL 1JNNH 4JFFD 3GJFH 3S36H 1RZJH 1IC5H 3H9ZA 1OAXL 4UU9B 5CEZL 4JKLA 4HPOH 3TN0A 1MIEL 4F15C 1TXKA 1YECH 4PP2A 1AKJD 2BSRB 3FQXA 2NZ9D 2YEZA 4KWUA 1SJVA 1UQSB 2VB5A 1FAIH 3IDJB 3LQAH 1QKZL 3EOBA 3S4SG 3NZ8A 5AYUL 2YN3A 5GIRB 4HXAL 5CJXA 4GAGH 3PL6B 9CGTA 3SDXE 3AS2A 2P8PA 5F96L 5I73C 2R0WL 4EIZC 5E6IA 3NIFE 4WFEE 5L6YH 3LDBC 3O2VL 1RULL 4GBXA 4ZUSB 2AJYH 3MODH 1L7TH 2WINB 2YPLD 1PKQE 4X7FC 4HKBA 4FFVD 5E08L 3L3IA 4NM8H 1LO2L 4GQ9L 5DYOB 2VXVL 5HGAA 1FLRH 1J10A 4WHYG 2BJMH 2VYRE 1OGAA 3ARXA 5EC2A 2R2EA 3QDGD 4OZHB 1FRGL 2IALB 1M7DA 4FQ2H 1R3JB 2J8UB 4M5YL 3SJVE 5GS0L 2YD6A 3N0PB 3RY5A 4PRIB 4KJWD 2QR0A 4LPTA 3MJ8A 3M17A 4GW1A 1RPQA 3HB3D 4CDGC 2H2PC 2I07B 1BEYL 3DTXB 5E2VL 3VFTB 1BD2A 1G6RL 1YY8B 3MNZA 2VZOA 2JTDA 3BQUC 4ZFOB 3ZKMC 4GRWE 4L29A 4OUUA 3EHBC 3QUXD 1U8LB 3S97C 5F7HA