1OP9A

Complex of human lysozyme with camelid vhh hl6 antibody fragment
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
121
Chain Sequence
QVQLQESGGGSVQAGGSLRLSCSASGYTYISGWFRQAPGKEREGVAAIRSSDGTTYYADSVKGRFTISQDNAKNTVYLQMNSLKPEDTAMYYCAATEVAGWPLDIGIYDYWGQGTEVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HL6 camel VHH fragment
publication title A camelid antibody fragment inhibits the formation of amyloid fibrils by human lysozyme
pubmed doi rcsb
source organism Camelus dromedarius
total genus 32
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2003-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1op9A00
2EIZB 3P4NA 5CUSL 3W2DL 5C1MB 4G9DB 2Z4QA 2DQIH 5H8DA 3MRIA 4WFGE 5DHVB 3OWEA 2G75B 1HHKB 1J1PL 3FB6B 2MHAA 3V0VB 1YMMD 4KJWC 4HUVA 1MCWM 1P7QD 3UTZB 3PGDB 4ALAH 2ZJSL 1A6TB 5T3XL 2XI9A 3DURA 4N0YL 3MRFA 3QJFB 5CSZB 1RUKH 5ALBH 1TFHA 1IM9D 1YNKH 4TUOB 1FNSL 5DFVD 4LSTL 5FB8A 1P84J 4JRYE 3FL7A 4O2CA 2ED8A 5ILTL 1U8LB 1K85A 1GGIH 3NTCH 1WEJL 3CUPB 1C08B 5H94A 4X4ME 2OTPA 3CMOH 5F96L 3GKWH 5IBUB 1Z5LA 4XNXL 3HZVA 3DVGA 4X80L 1N26A 3WUWB 3WIHH 4I8DA 2YD7A 3EYFA 1KFAL 1T1WA 5B4MD 2DQJH 3S36L 2BRRL 1J88A 3GO1H 3VGGA 4ZSOB 2Q76B 1FGVL 3AROA 4OCNC 4H1LB 4MMXC 2R2HB 3KPRB 1BOYA 4HKZA 4PGBA 3H3BC 3GMQA 3VGHA 2EEAA 2YD2A 1UH2A 3OAUH 4JCLA 2Z8SA 3MUY1 2ADJA 2I9TB 3D48R 5T1LA 1KLGB 4MA3B 4RNRB 4NNYB 1T21A 4RMUA 1NAML 2GTWB 4MQXD 1ADQH 5TPWL 3QH3B 4IIQB 5IJVB 4XNUL 5K9KA 1HINL 1X5HA 4MWFB 1TVBA 5A2KH 2IPUG 4PJXA 3MBXL 2HTLD 1CBVH 4R2GD 1AGEB 1NMAH 1HNGA 1Z3GH 3DSNA 4HKXB 4L5FH 4X6BB 5E8NB 4QRTA 3VRJA 1IGCH 1A14L 1MCFA 4JJ5B 3HG1B 4ZD3H 3OJDB 4YDVB 3QIUD 2ZSWB 3U1SL 3ARYA 2R2CA 2Y72A 1QSEA 3N85L 4G8FA 5E7FA 2F19L 4TSAL 3PE9A 4Y5XA 4DCQA 2DDQH 2B4CL 4UT9L 2AV7B 4BFIA 3EOBA 5FGSA 1RHFA 1YC7A 4PJBA 4P3DB 4LQ1A 3QDME 3BH9A 4NQEB 3LCYA 4YO0B 1EV2E 3O2WL 4S1RL 3ILPB 5KSBF 2LV4A 3BMWA 3TNMB 3SPVB 3HFMH 2D9CA 1H15A 4NOBA 4I48B 4NBZB 1YMHB 1L7IH 1EHXA 1GZQA 4EN3D 3RKDD 4MNGA 2R2BB 4I0KA 1NFIB 3SE3C 2NLJA 2OTUB 1UWEH 5DJYA 4V2BA 2NY3D 5E94A 2V2XB 1NCTA 5J6HB 3DXAB 4NCC1 3RTQD 3W5MA 4PRIB 1MRDL 2C3XA 3QXDA 5L7XH 2NY2B 4ZMAT 2GJ6E 3M8OL 5D1ZC 1KCVL 3RGVC 1YEIH 3MV8D 1J8HE 2DJSA 1KN2L 1LDSA 4ZUTB 2F5AL 3QIBD 5HHVH 5F7EH 3UCRA 3AY4A 5F6IB 1CDIA 4G42A 2EZ0D 3ZHKA 2ZOKB 1IGTB 2HT3C 3K80A 2V2TB 4KVCH 1EX0A 4WO4D 3GMRA 4OLVH 1SVCP 5CEXB 4ZQKA 1AGDB 5HGDB 5DWUH 4P2OA 2RFXB 3NFPA 2NTFB 3NCMA 5JLZA 2P5EB 3B2VL 2CRYA 2HJFB 4ZUWB 3DUHA 3KPSA 1PJ9A 4QWWD 3ZE1E 1WTLA 2VDOH 3N06B 3P30H 4Z95H 4JM4H 1P6FA 2NNAB 1NCDH 3B6SA 3HS0A 1E28B 1FZOB 3ARGA 5C0IA 1LO5A 2QHRL 5FYLD 2XICA 5IKCB 4NDMA 5HHNA 4NZDA 3STZA 1G7MA 3T0XA 4K2UH 1JNNH 3P0VL 4XPGL 1WFOA 5DRNA 3V4PL 5C0NC 1DEEB 3EAKA 4M6OH 1WAAF 3L5WA 3MA7A 4KROB 3D6GA 1ITCA 2WINB 1KN4L 4GT7A 2LAGB 3WDJA 1R0AH 2CKBA 4Z7QE 1WJ3A 3BKMH 3IJYA 4IOIB 1WVZA 2EDRA 3CIQA 2BSRA 3MLVH 3OKNA 2COQA 4OSUH 2VDPL 4FQQB 5L9DH 1MFDH 3ZTJH 2AEIT 3MGTA 4P4KB 1TZGL 4L3EB 3ARVA 3CLFL 2PW1A 1AIFA 2V2XA 3DRQB 3ZHDA 1U8JB 3ECBB 3QEUA 2DKMA 3PP3K 3ZE0E 5TF1L 3L9RA 1B88A 2Z35A 3QEQE 3TA3D 1DDHA 3NPZB 3O0RL 5JOPE 1IL1A 5I1EL 3F6LA 3FOLB 1K3IA 1FL5B 3QXUA 1RFDL 3O3BA 5GGVY 5E9DD 3ZYIA 4G6AC 1QBLL 3HPJB 5DJDA 3V5KB 1YEHH 2LTQB 3PWJB 1IAMA 3T2PA 1DSFH 5KTEH 4HK3J 3DO7B 2DIBA 5E6YA 2P44B 1CD0A 1FV1A 2IMNA 2G5BB 4YFLI 2CDEB 3FONA 3PL6B 1YEJH 4KTDL 1FRGH 4G9FA 1PSKL 4Y1AD 5J12C 3UTTD 3W9DB 5MEQA 2H32H 4OLWL 5HD8C 4OV5B 4ZO9A 3LV3A 2DYPB 5EPMB 5KVDL 4OF6A 4YDKL 3HLAA 3VFPB 4AIOA 2X6MA 2CGRL 5E6IB 2WM0A 4WGVB 3AAZB 1NEUA 2I07B 1RJZA 3BPLB 2EKSB 1FO0A 4H0IA 3PDOA 2FEDC 5H35B 2O5YH 2R23A 3LKNA 3OXSA 1INDH 1T2QL 5EUKB 3B4NA 3WNLA 3I75B 4P3CL 3DGCR 3FB5B 5D7SL 2JELL 4WUUE 3WL9A 4F2MB 1IFHL 5ICZA 4GG6A 4HJ0C 2X4OB 3QNYB 4K7PY 3U9UB 3LS5H 2NY4B 3OJVC 1CK0L 2X4UB 4X9IA 4LBEA 1J9CT 4Y4KD 1AGBA 2A9NL 2XOTA 1HQ4A 1QFUH 4Q2ZA 2HG5B 3LSOB 4L9LB 2CK2A 4WFHD 1HSAA 4WWKB 4PJ7E 5ETUA 4MZ2A 1N2RB 2H32B 5I30H 4MJ5A 2Y25A 5IT2L 1X7QA 3UEZA 3GMPA 1XGPA 2E27L 3N1GC 4ZAKD 1BFTA 2FJFA 2AJXL 4JRXA 1RZGA 2XQBH 2BNQD 2WBJA 1HYSC 4MXVE 1IEBA 2XXMB 4LMQI 1J0KA 1DJSA 3SDYL 3BHBA 4HWBH 1XGQA 2DQHL 5C7XH 3CSYB 4XXDA 3AS1A 4JHAH 1JZ4A 4P2RA 4R8WL 3QFJB 1GPOL 3FRPG 2ICWB 3C09C 5DA4A 3ARPA 1NGZB 1IC5L 1ND0B 3VWJB 4NN7B 5FHAH 4PJ5A 5JXED 1KB5L 3B9DA 4HBCL 4H8WC 4LKXA 2YD9A 3QUZC 1IMHC 2GIYA 3BWUC 4Z7OE 3V6FB 4F7EB 4GQ9H 5EOCJ 4J6RL 1NDMA 2GCYB 5I8OL 1UZ8A 5T33L 3GHEL 5IIEB 1T1XB 3K8LA 4WV1B 2K7PA 1A7RL 1SJHB 4OB5H 3DARA 4F3FA 1EERB 4L8SB 3U0PA 3MACL 3G5XA 4CW1A 5DRZB 3T0AA 4ZOCA 3MJ7B 4PP2B 1LO0H 4KUCD 5C6PB 1BLNA 4OD3L 4DW2H 1P4IL 2GHWB 2PYED 1A6ZA 1CDGA 4JN2B 2YEZB 5GGUA 4QGTA 1OTSC 3SJVD 1LMKA 3KLDA 4N0CC 3KR3L 4JFYB 2A0LC 5F7FA 4TULL 2LABA 5H2BB 3VXMB 1NGXB 2OLDA 5DMGD 4PJGE 1IAIH 3GJFK 1KC5L 5I1KH 2HFTA 5EOQH 1UKQA 1RPQA 4GKOA 4QTHB 1YEFH 1YNLL 4MS8D 5DEFA 3SDDC 2L4OA 3CPLB 1X6LA 1LEKB 5CINH 5BZDB 3S3PA 5HVHC 4LVNB 1G0YR 3B9KA 4U7KA 1VGKA 4M7JL 4KI5E 5LCVL 3ALWA 5FYJH 4U1KA 1NCBL 4TN9A 1CE6B 1I8LC 2YD5A 2EYTB 2CIIA 4NN6C 3X12B 4KRPC 2OZ4L 1EJOH 1FLTX 4TUJA 1E6OH 5TDNA 5LVEA 3H9SA 3FZUD 2GEEA 3GB7B 5KZCD 4MA1C 5F9OL 5D7LB 2BOBA 4O2FA 1D6VL 3UTSD 1TLKA 2IQ9L 1WCBB 4N8VG 4OIAA 5TFSL 5AD0A 1Q9OA 3I02B 1HHJB 3WFEL 1FZMB 5I8CA 4UTAL 5SWSA 4JFXB 4YQXH 3V52L 1UA6L 4WV1A 1KOAA 4P9HC 2EKJA 3VG9B 2D3VA 3M1BA 4I0PB 2Z9TA 1EIBA 4DZBA 4JZNB 1QR4A 3G6DL 3D5OF 1MREL 3LKQA 3IAGC 2W65A 1KPVA 2KBGA 1N8ZA 3QIWB 1RZFH 4G80A 4NZTH 5IBTH 2F8VA 4RGND 4C4KT 3S35X 2VLRA 5ESVB 3VWKA 1HYRC 5E5MA 3L3IA 5C0BD 5BOPA 1S9XB 1A64A 2J6EA 3QUXB 4OZ4A 1TVHB 2HKHH 1EEYA 3UTQA 1UXWB 4XXCA 2B5IC 1T89A 2C3WA 4GW4A 5DZLA 1HSBA 2AK4E 1EGJA 3WXVL 3OSKA 5E8OA 3VFRA 3G5ZB 1IAKA 2B0SH 2MQ3A 4FQPA 5F7LB 2ATPB 2VDKH 2VC2L 2NR6C 4X6DB 2BSSB 1MRCL 2ZG3A 3LB6D 4JFDD 1AFVH 1BAFL 1RIUL 1N5YH 1OSPL 5D7KE 3QUYA 4CKVX 1OF2B 3FQUB 4KFZC 4LQFH 1MWAA 3HPLB 4Q7DA 5DI8B 4PR5A 4UU9B 1IZKA 3MUJA 2H9GA 5C0GB 2HRPH 2Y6SD 3OR6B 1IC4L 2R69H 2ICEB 5I1DA 4UOW0 2AP2A 2CIKB 4UINL 4NWTH 1KT2A 3DUUB 1HHGB 2ZCHH 3OF6D 1DQDL 1UENA 4DVBB 4WFGD 2X10A 4ZTPH 4PLJD 4M8VA 2IQAB 4G8GE 2J4WH 4JPVH 4Y5YB 1F4YL 3C08H 2BNRD 4NZJA 1RUQH 2FB4H 4I13B 4UV4H 5DD6B 5EUOA 4KY1L 1IM3A 2APXA 4QRPA 4U1LB 4BUGA 3CVIL 4Z0BH 1Z9MA 5IW6B 1TQCC 4Z0XA 1AE6H 3KGRA 8FABB 4L4TB 4Y4FD 1A1NB 3BW9A 4XP6H 5JHLL 5GS0D 2VQ1B 3OGOE 5GGRY 3S5LG 2JLLA 3ZDXE 3LKPB 1J0JA 1TIUA 1NBYB 1S78C 2E9WA 2BSED 2HFEA 1NCAL 3BZFB 3O3UN 3TCLB 1QR1A 3GMMB 2F74A 4NFBA 3B3IA 1RZ8B 2F53D 3P9LB 1S5IH 3MRMA 4QO1A 1FYTE 3P11L 3W11C 4YGVA 3U36B 2GTZA 3L95A 3JV0A 2DQUH 4NC1C 2LVCA 2B39A 5HJ3B 3O4OC 2A6JB 2V17L 1U41A 3SHSA 4AG4L 3ARFB 1NMCB 1XGUA 1KPUB 1T0MA 1KLFA 2HJKA 3VXRE 5FUZH 2WWMC 1IGYB 4MLSA 4K3DL 5DD1H 3NAAH 2H1PL 3OR7B 2WLYA 3P73B 4L3CB 4DVRL 4P5KA 2X7LA 3QCVL 3GBLA 1P5VA 5CWSB 3VD9A 4HWNA 4QOKB 4LLUA 1AR1D 3PDGA 3VH8G 1BPVA 5E2VL 5EU3B 3O4LB 2IPKB 2VRAA 4R4ND 3O6FC 4M1CC 5D5ME 4R6UA 3SDXF 5KS9A 2UWEB 5C0FA 2VIRA 2ZG2A 3KLAA 1IAOA 1NEZA 4OGXL 4Y16D 3UZEA 3T3PE 2AV1A 1Q0XH 3B83A 1HEZB 2Y36H 4M8QB 1CFBA 2VZTA 5JW5A 3A6BL 4BJLA 1BZ9B 2VH5L 5FHBH 4JDTH 5GSRA 1T22B 1VEPA 1ZHKB 4GG8A 4UILL 1RURL 1JPSL 5J06A 3LHPH 1INQB 4NYLB 1KIRB 3HE6D 2ZUWA 2XWTA 5MP6H 5ISZA 3LQMA 3RUGB 2FO1A 1KJVA 5DMIL 5FA3A 1ZHLB 1KCLA 1WF5A 4PRHA 3QDMD 4HHAA 2IH3A 1P9MA 5HYJD 1KTLB 4Y19E 3TWCL 4X99A 2BVOA 3TPKA 3LKSB 1IGFL 4OT1L 4YBQD 3RRQA 3U0TB 4B7IA 3ZDYE 4GMTH 1ACYH 2FO4A 5IB3B 4R4BA 3UBXA 3FB8B 5HJ3A 4OM0L 4FP8L 4BELD 4Z76A 1S7WB 1JPTH 2F58L 2LU7A 3MRPB 5TQ2L 2QQKL 5F1OB 3RGHA 1S7XB 2A77H 4TVPE 1PY9A 1LQSR 3MV7E 4XVJL 5BS0D 3SKUD 1CTOA 1BVLA 1P7KB 5FECB 3X14B 1K5NB 1N7MH 1U6AL 4D0BB 3LPWA 4NO5A 1MVUB 2GJ6D 2X4SA 3NIFF 1J8HD 2Z93B 1I7ZA 5DEGB 3IU4H 4HUMB 2VXUL 1S7VB 3CD4A 5IESH 3BGMA 1NMBH 3WUWG 4WHTB 4AEHH 2V9QA 4U2YA 2QSQA 2K1MA 4G6JH 4LPCA 5CJBA 3HCVA 1JGUH 4DKAA 3U6RB 2DQDL 3H7LA 4H1LG 4WU7A 1JN6A 1DVFB 4PJ8C 5D9SB 4LNVA 2R0LH 2E8YA 2EDFA 3HNVL 1ZLWK 4M1DH 1XMWA 1WZ1H 1Q9LA 4UIMB 3H9ZA 5FXCH 2XWJA 4Q9QH 4X7TA 2NY5L 3DV4B 3QUMH 4IRJC 4WI6A 2ZSVB 4PTTA 3R1GH 4XMPL 3V7AG 4Z18A 4XNZC 3Q6FA 3VFWA 3W0WE 2BC4B 2DTMH 3AXLB 5C3TA 1JPGA 4CUCA 3LH2H 1J8KA 3SCMC 1MFNA 1W0VB 2P49B 3RY6A 1CD1A 2CDFA 3LS4H 4OCYL 1FC1A 1FLRL 1MRFH 5BO1H 1HKLH 5GSVA 3UJIL 1QVOA 4JB9L 3FAWA 5IMMA 4FG6C 4EUPH 4LSQH 5JMRA 4AMKL 5L88L 5DQ9B 3P4OA 4WCYH 1U2HA 4X83A 3OKDA 2NZIA 4GBXA 4NRXB 5FM5O 1RJYA 3ZZ1A 1G7HB 4S1QL 1CQKA 1EFXB 4O02L 3QEQD 3D85B 3PHSA 4F15B 1FGNH 3VDAA 5LBSH 2NXZD 1JIBA 5ADOL 5JOPD 1RJLA 2AXJA 1YC8A 3Q1SH 1FDLL 5GS3A 3EYOA 3H6JA 4Z8FL 2JF1A 4HFWB 4GUPA 3HC0B 3JV4A 1K9TA 3QPXH 3RWDB 3QUMB 4C57C 2YC1B 1NCWL 3LRHA 2ICWI 5GZOC 1FH5H 1I8KB 1Z2KA 1VPOH 5E95B 2IANB 2YUXA 3GJEB 3GGWB 3FQTA 3MOBL 4J4PC 2ZNXA 3CFBA 3F12B 3L3OB 3MA9H 4MAYA 5DJ8A 4Y5VA 5CP3H 2EXWC 1AHWC 2QADD 4OZHE 1BJ1J 5DD0L 1D7FA 2IPTL 1A7QL 5DVOA 1ZGLM 2CLVB 5F7MC 2EH8L 4WEMB 4JKWA 2B2XH 3S4SA 4JFFA 4NPYA 3O3AB 5DTFB 4EUPB 3PWPE 3K1KC 2CLZA 3PQYA 2FIKB 2FX9L 4YAQB 5CSBA 2UY6A 5IBLD 1OCWL 4JLRA 2J2ZA 3OG4B 2JCCA 4BQ8A 4E41A 1SJEB 4YBHA 1CLYL 5E1AA 1BD2E 5I15L 1JNLH 4PGCB 3WV0A 1J0ZA 4X0KB 5E00A 5IV2A 4G6KL 1GC1C 1A6WH 4MNQE 1JHTB 1I8MA 4WUUD 3QNXA 4P59L 4C58B 2XTJD 1L0YA 1P53A 3OJ2C 4ONFL 4WI5A 3MUHL 5DHYB 2BP3A 4ELMA 1B4JH 1R5IA 4JN1H 4IMLA 1X5AA 4KUCF 4NQVA 4HDIB 3QR2A 5F7WC 1OTTC 2HVJA 3IFNH 1I85C 4HPYL 3O6LH 4LNRB 3DROA 1U3HC 2AJVH 1M7DB 1JZ3A 5A3ID 3KJ6H 2X4RB 2V7NB 3DRTA 4OTXL 2VZSA 3BE1H 1PQZA 5DXWA 2E9BA 5AYUH 3CVHA 3RL1A 3BGAA 5EN2B 3HC0A 4L29A 2ZG1A 4TRPL 5GS2H 3L3HB 4LAQH 4E5XA 1SBSL 2EYSB 1A7OL 1NC4A 2GY7B 4LLVA 3N0PB 5IVOA 5GGQH 4I3SH 4LIQE 4S11A 3W39A 3H3PH 4OUUB 1R5VA 5F9WC 1I9JL 4KJPD 1QSFA 5ID0B 1Q38A 1F11A 3GSRA 3NFSL 4X6FB 3VI4F 1G7QB 1S7QA 4HV8B 3E6HB 3TO4B 4X4ZA 3T0WA 4CMMA 2GAZB 3BEVB 3HR5A 3NCYS 3U0WL 1T7VA 1IGMH 2N1KA 2X40A 1QLEH 4UT7L 1MLBB 3SBWC 4OBSA 4C54A 1U92A 1CXLA 4KKCC 5F1SA 5AWNL 2FH8A 1G7JA 4HXBL 1FNEB 1IAII 3TBVA 3LEYL 4NO3B 1LEGA 5IVXF 3T0DA 3WJLC 4D9RE 3PNWA 4W81A 5D71H 1YPZE 5GGSY 1HCVA 2BJML 3Q6GH 5GRJL 3U30C 2ZNWA 3WE6A 3GBMH 4LCCB 2EDYA 5BQ7A 1IEAB 4GAJH 4OGYH 3PGCB 5EA0H 1TTGA 2ITCA 1TJGL 5BVPL 1JBJA 3GDBA 3UPRA 5DFVC 3IT8D 3O81A 4M9PA 4U1JA 5CMAA 1KNOB 4NQXA 4NUJA 4ZFFA 4HUUA 3NCEB 2R8SL 5IF0A 3T65A 3U46B 1YZZA 4GLRH 2ZUQC 2NY6C 2VERN 1BMGA 2UZXB 2MQ0A 3C9NB 3ZTJG 3T0EE 2ICES 1R3JA 5IP4A 4OZIE 5KVGL 4JFHE 4HX1A 1GOGA 5FF6B 2BRQA 2A1WL 4NO0D 5F1IB 1J18A 1IGIH 2VZOA 2MKLC 1NGQL 2CKBL 4JY6B 3SE3A 3ULVE 4PJAF 5F9DC 3QHFL 2V7HA 3KLHD 4RX4A 1MHEA 1I7TA 2R1WB 2VXSL 4M48L 3RWIB 2CLRA 3G9AB 5C0DB 5H37H 3X13B 4KXZH 1K4CB 1HH9B 3H3KA 3OKKB 4MLIA 4YDJB 1LO2H 1A4JB 3QJHB 4G6MH 1INEL 3DVNB 3DVFA 1LDPH 1T2JA 3H42H 3NH7H 5D1ZA 3DHMA 4O4YL 4OZGA 3RGVA 3QI9D 4BSVA 3SN6N 2YMXL 1NJ9B 3BJLA 4ZDHB 1F90L 4MQXC 2C5DC 3UYRH 3S34H 2FEEI 4FQ1H 1T2XA 3MCKA 1JGVL 4TSBH 4X6CB 5I16A 1A4KB 1MHHB 3NACH 1AI1H 5IB2A 1DUYA 4MCYB 4OKVA 4AEIL 4YHNA 4A6YA 4F9LA 4R2GC 5C07B 1QD0A 4GAYB 5I74B 3CC5A 5T3ZE 1K8DB 1F4WL 4MX7A 3L1OL 2Q6WA 2XZZA 1BGXH 1ZWIB 4FABL 5I1LA 3BP6B 3QIUC 1U95B 4AENB 4J8RB 4P2OD 3G04B 4JQXC 5DUMH 5CIPB 2VYRE 4YPGA 1JZ2A 1Y6MR 3KPSD 5EC1A 3T4AB 2F8XC 5LGKA 3FO9B 4UOJA 3IJHB 1FO0L 3ZTNH 1RIHL 4MJIB 3S7GA 4LLWA 2FBJH 1FFOA 1PLGL 2AK4D 1JFQL 4PRAA 3FO1B 5GJSH 1S7RA 2AGJL 4KUZH 1BQLH 3I6LE 1RZIA 1NSNH 3IF1A 4PUBH 2PNDA 4KPHL 4LDLB 1AO7B 3DI3B 3MO1A 3ARDA 5DS8A 1QFWM 3L3KA 1XIWB 4EN3C 3RKDC 4S1DD 1NFDE 2ZCLH 3V79C 4FFZL 1IKNA 1JHLL 4GRWB 5D7KD 4AEFA 1XF2B 2XN9A 2IAMA 1BBJA 2NY3C 3AB0C 1QBAA 2FJGA 3DV6A 3QUKA 1S5HB 1V7ML 1DQQA 4TQEH 1ZSDB 1QRNA 4FZEH 3RTQC 3QXWA 4K94C 2BK8A 3ESVF 2YHGA 4JFZL 5I73B 4KWUA 2Z91A 4AIZB 4HGWB 5JIPA 5ESQB 4I5BB 2LU4A 3Q3GA 4PJCE 1JNHB 4KK9D 1JGLL 5EOTA 1T1ZA 1OQOA 1BOGA 3BRFA 4L9DA 4RFOH 1IGJA 4G8GD 4JO2L 5DJXA 1DE4A 1XGYH 4PJIE 1RZJL 1YQVH 3OKMA 4WO4C 1OM3L 4X8XA 5MHSE 4APQC 5DK0B 2ADGA 5ACMA 3RWGB 4Y0GA 2NY0D 6FABH 4PJHE 2F54A 4LAJH 3ARTA 5D96B 3TVMB 4QWWC 2KDGA 3C09B 5HYSB 1CZ8H 2W9LA 2V2WB 3CX2A 1R6VA 1A0QH 3MXWL 2WMPA 2MPAH 3BKYH 4QRRA 4NNXB 4N8CH 5IHZB 3TNNB 2D0HA 1MF2L 4R3SA 2J7LA 1AXSA 4ZUSA 4X7EC 1YN7B 3GMLA 1JHKH 4LU5H 2B4CC 1UB5A 4L1DA 1RK0A 3C8KB 1PKOA 3ETBF 3CX5K 3OJMB 1QSZA 4QXTB 1MCOH 1DQTA 1FYTD 5A1AA 4JFQA 2BX5A 1HWGB 4MXWH 3MRCB 3OKEB 4Z7VB 4KTYA 3GRWH 1FNGB 5EU4A 3IRZA 2D0GA 1C5BH 3QSKB 5C09A 2IALA 1OAYL 4MDIB 3CLEL 3MXVH 2ED7A 3U7YL 4Z7UF 2F5BH 2QJDA 1WZKA 2QQLL 5C08A 2L7JA 4OD2A 1M05A 2Y4SA 5ANME 2BY3A 3HZYB 1AKJB 3F58L 4Z6AT 1T5WB 1JYVA 3KPLB 3ZT5A 2VUOA 1MCHA 4XP1L 5AZEL 5I76B 1B0RA 5LQBH 5HHQA 1M71A 3O11A 3WN5C 3LIZL 1LO4H 5EOCH 4YHML 5HVHB 3W5NA 4LLMA 2R56H 3HE7D 5ACZB 3WO4C 2A6DA 1MCRA 4U1HB 5CGYD 5D2LA 5F89A 2X4QA 3E3QC 3L3GA 1WK0A 4V1DA 5K93A 4PGDB 2JJSC 4NN6B 3JTTA 3IDJA 2WBJD 4LRIC 1SQ2N 3SKJH 5L2KA 1N5AA 3IB4A 4PJFE 5CEZL 2NZ9D 2EDNA 2Y1VA 2NW2B 4UOW1 3F7QA 2MCPH 3QUZA 3G6JE 4XPBH 3VFUA 3VXUB 5HGAA 4M6NH 1WTGT 3NZ8A 5I66A 2O61B 1DL7H 1RZ7L 1JTPA 3P4MB 4QTIH 1AGFA 3I2CH 3BPCA 2ICCA 3QXAB 4M5YH 4M61B 2ARWA 4NQCB 1LP9E 4RISH 5TDPB 2NX5E 4PTUB 3VJ6B 2I24N 3F7VA 5EFIA 4EXPX 4JANB 4OLXL 2WNGA 1UM4L 1YEDB 3KYMB 1EHLL 2H2SD 5DJ6B 3EOAA 2IADA 4XNMA 4XPHH 4K7PL 4U6HA 4B0MM 1WWWX 1O7VA 4R0LB 5HY9A 3CH8A 4PYGA 1FG2B 1WIUA 1RUAL 2P8PB 3ARED 1QYGH 2B5IB 3VXPB 4YDIH 5SX5H 2PXYC 1T3FA 1IQWH 3MV9A 1JRHH 1BF2A 1NLDH 2J6EL 4XPAL 3SDDA 4ZAKC 4LGRB 2HT4D 3VGEA 1I8IB 5IFHL 1FFNB 1EGJL 2DTSA 2DWDB 3TIDA 5E08L 3P77A 4XVTL 3IVKB 2PTVA 3CDGA 3GSXB 1RSFA 5CHNB 3LQZB 1A22B 3U4BL 2O26U 3FN0L 3BQUB 4MD0A 5IFAH 5J1SC 4HIJB 4LHQB 4PJDA 2JIXD 3ZT6A 1CLCA 1MQKL 3MJ9A 1PEWA 4KJQD 1MWAL 2CR3A 4MAUH 5CILH 5JW4R 3HC4L 2C1OB 1JGDA 5CEZD 4TUKH 3PHOB 4LVOC 3W0WD 5JXEC 1Y6NR 1LNUB 4OI8A 3R06B 1SVZA 4TYUA 1E4JA 3GIZL 3BP5B 3PWNA 4KC3B 2VZ1A 3NZHH 4FNLH 1WBZB 2OYPA 3NIDE 1AGCB 1QA9A 1VEOA 1N6QH 5I8EB 5DUBA 4WFEE 2CXKA 1D5IL 1XCQB 4N0FA 5T5NF 4O00A 4P5TD 3RWCA 4XCFL 1FE8L 4NHUA 1EO8H 1FC2D 3K3QA 1TQCB 5FK9A 1KPRB 4LMQE 4KAQL 3S35H 1PVHA 2HTKD 1QEWB 2GFBA 3KHOA 3MNWA 2YRPA 2UV3A 4EEEA 1TJIL 5I19H 3GI9L 4QY8B 5BJTB 5JPMA 1G0XA 4NQDE 2VLKB 2VLJB 3FB7A 5IMOB 2KH2B 5FOBA 2YKLL 5FA4B 4Z7NE 2H3NA 5KSBB 4JR9L 2D7OA 5DMGC 5HYQB 1F00I 1P69B 1BBDL 3ROLA 2VXQL 4MS8C 2PR4L 4N9GB 1T5XA 3WS6C 3V5DA 3B9VA 4ZXBB 5MENA 3O4OB 1OGAA 5IMKA 1Q1JL 4WJ5A 1CIUA 3SEPA 3TBYA 5JHDA 1TQBB 5JXAH 5AYQA 1H5BA 3GSQB 4D3CH 1P4BH 4BH7A 1WWCA 4U6YA 4PREA 1UWGL 1AP2B 1JMZA 4H88H 4M6MH 3BZ4A 3PWPD 4XX1E 5HDQH 1KCKA 3KDMB 3KPNA 4GO6B 1HQRA 2XXCB 5D7IA 3O6FB 3QEHA 1MI5A 1JPST 5D1XB 4LSVL 43CAA 5JNYB 3F5WB 3VFOB 3UDWC 4X8JB 4HD9A 1N3NA 3QA3B 4CVWA 4MNQD 2CR6A 1I1YA 3UX9B 1SEQH 1CR9H 3N1PC 4FQXD 4KMQA 5IR1A 5C6WH 3MOAH 3PGFH 1SY6H 2VITB 5D2NE 5ERWB 4W6XB 4LVEA 1U91B 5HVWA 4N5ED 2YPLA 4EKXA 4J3TA 3NPSC 4PJXF 3GI8H 1VACA 5CJXC 1HIML 3LRGA 4OZFH 3TO2A 1ORSB 3SDAD 3TV3L 2ITDB 5ADPL 3K2UH 4OCLC 1YEKH 3BWAB 4QXGH 1MCLA 4RGNC 4ZUUA 2BDNH 2HFFB 3KPOB 4NJ9H 3VGBA 4W4OC 1BQSA 1CT8A 3QEGH 4I18C 4JY5L 2ATKA 4XHJD 4RMTA 5KN5B 2YBRA 3ZYZA 3IDIB 1A21A 4JQVC 5ALCH 2QQQA 5HDBE 3MRDA 2AJZB 5DVNA 4PJBF 1YNTA 43C9B 4AIXA 1OWWA 1V05A 5DD3H 4OQTA 5DC9B 3LB6C 3MZTA 5E2JA 3GSQA 5EO1A 2FZ3A 3CFCL 3TT3L 1EJ6A 2AJYH 3ZSTA 2DIAA 5F7YC 4P57A 1EAJA 1F4XH 2DBJA 5MEPA 5EZIL 5B3JE 2Y6SC 4GLRI 2O93L 4U3XA 5IEHA 2X5PA 2PYFB 5GRVK 1WT5C 1DQML 2IPUK 1WC7B 5BV7L 3VW3L 5KAQG 1FPTL 4OZFB 3F5WA 4JM2A 3T0VA 5EC2B 4KHXL 4ZSOE 3MLUL 3VD7A 2W0FB 4PLJC 3T1FB 2ADIA 1MHCA 3JVGC 3KPRE 3EFDH 5D1QD 3A0OA 1SEBB 3UZQA 4H20H 1D5MA 2D03L 1FL6A 1EHNA 1XR9A 2HFGH 3GMNA 2XYCA 4OF3A 4AZ8A 4UB0H 4YE4H 4HFUL 2MNUA 4KXZI 4L8BA 4Z5RB 1JP5A 3BAEH 3EKCA 3V7AE 1EEUA 1N4XL 1IBGL 1X4XA 3MC0A 4Y4FC 3IXAA 3HRPA 2GUOB 3JV6B 2V5TA 1P1ZB 4XNZB 1WAAA 3OKLA 4EUPG 5E2WL 3FO0L 3SCMB 1G9ML 1XAUA 4WTWA 3T0ED 3U9PH 5ISZD 5F7HA 2H6PA 3KYNB 2R1XB 4JFHD 3C6LD 3PXHA 1S9WB 3SOBH 2VZVA 1S7TA 5EBMA 1CLZH 4OCXL 3TH3T 1EBAA 3D69B 2LE9A 5LXGH 3DOSA 3TN0D 2HJLA 4KKBD 3BH8A 1GAFH 1CL7I 4HT1L 5IVNA 3WFHB 2A83A 3VFSA 3WUZA 1KCRL 1ZK9A 2EDQA 3AU1B 4PS4L 1A9EA 1ETZB 3AM8A 3BN3B 1FAKT 1GH7A 1KEML 4OCMC 4I77L 3RL2B 2P8LA 4WHYH 1GXEA 3CCHA 1A6VL 1GC1H 5ICXA 4XP9L 3QFDA 4LSSL 2VJXA 2PKDA 1FVDA 1BIHA 1J1OL 5CCKL 4NQEE 1BJMA 3ES6B 4PJ9A 3N1FC 1MNUL 1OW0A 3GHBL 4P2CG 4OFIA 1AR1C 2Q7YB 1NAKH 3D9AH 4LFHG 4R4NC 4HJGA 4I2XA 3DMMA 5J9PB 1BVKA 2GJJA 4HF5L 4Y16C 4HPOL 3QDGA 2CXGA 5FYKL 2KKQA 3LN4B 1ZXQA 4TNVK 4IEFB 3CNKA 1FBIH 5T3ZD 4XCNB 4PJ8A 1FFQA 1WSST 4MJ4A 1T4KA 3OKOA 3DXAE 4DN3L 2DQEL 1Q9WB 4PRIE 4XPTL 4ZTOH 3KS0J 1KJ3L 3HE6C 4K07A 5IROC 2WIIB 4PRDA 4C56B 4IRJA 4HS8H 4JHWH 3B9EA 5GPRA 4YIQB 1KACB 1NCNA 3GK8H 3DX9B 3T1WA 5GGTA 2EECA 5TGBB 2D4DA 3CFJA 2YK1L 1QQDA 1SYVA 1ZAGA 2ZUUA 3HI5H 1A6AA 3BRDA 3EZ8A 1I3GL 4FQCL 3I6LD 4BZ2H 2OR9L 3LEVH 4YBQC 3BXNB 4IDJH 4DUWA 5JMOC 4JZJC 4OCRL 2I60H 5DJAB 5I6XC 4PV8A 5J11B 4NKIH 1A7NH 4PLKD 3O6KL 4XNYL 3QQ9D 4NJAH 3VRIB 1GZPA 2YS4A 2JB6B 3HC3L 5JUEH 3WIFA 1KIUA 1BJ1H 2X4TB 4RZCA 1LVEA 1MH5A 2NYYD 4J3UA 4Q0XL 3SDCA 4XRCA 1U8QB 3ULSA 4FRWA 4IRSA 5CGTA 4LSRH 2EYRB 4I0CC 1M7IA 4GG6F 3QDJB 1U8IA 5EU7E 3TJHC 3NFNB 1ES0A 1A9BB 4F7MB 1IQDA 1XF5A 5D5MF 3DI2B 5DJ2A 5E2UH 3C5JA 1AQKL 3CVHL 1EEZB 4ZPTB 5EIIA 2OBGA 4YX2L 1AXTL 3VGFA 1IVLA 1F5WA 5T5FL 4OQ1A 4XP4L 3SE4A 12E8H 5GRUL 1AHWA 5IUSA 4P46A 1UACL 2R1YA 5DD5H 5HGHA 4L3EE 5J57B 1UJ3C 5FYKD 3IFPA 3HMWH 3VD3A 3WFBH 2XV6B 5KSAD 4JKPH 1C12B 5T1DH 5I17A 3MQIA 3BGFC 1T66D 4OM1L 2D7MA 2VTFA 2ZUVA 3BZEA 1U93A 3FO2A 3L7EB 3OL2A 1EO7A 1JUFB 4YHPA 4X6EA 4HEPG 3K4ZA 1X5XA 3OXRB 2PO6D 3O2DA 5EU5A 2DWEA 3MRLB 3U30B 5C0CA 3V2AR 1YMMB 5E99H 4AK1A 3ZDYF 1PW3A 3TT1L 3TBTB 3C5ZB 1IM9B 2DM2A 4OF5A 5HVFB 32C2A 5LGJA 1UZ6E 4M1GH 1ZLVK 2ESVB 5J4MA 1D9KB 1O5DT 2W9EH 3O41A 1QPXA 5DT1H 4NUGL 1X5KA 2C7UB 3DX6A 1U3HA 1FL3B 2XKNB 4CDHA 4G8EB 1YN6A 2ZUQB 1S9VA 2I27N 2NY6B 5CUSH 3W2DH 4UDTA 4QHNB 2NXZC 4QGYA 2YUZA 3FFDB 3MRJB 2V5RA 5JO5B 4K8RH 2Y23A 1J1PH 1A1MB 4NZUL 4DUXA 2BERA 5BVJB 4BA8A 4P5MA 3LEXB 4ZOAA 5KJRL 2YPVL 2XRAL 1C1EL 5T3XH 4HG4K 1G1YA 3V9FA 4QRSB 5H37G 4N0YH 3RDTD 3P0YL 5HHOA 3HAEH 1X9QA 3MGOA 2AJSL 1GHFL 4LSTH 4DOHB 2P43B 3TIEA 5IQ7L 5FIEA 4KK8D 4XI5D 2DS4A 4JPWH 4U1GB 5ICYA 4KMTL 4R7NB 1NC2A 5ILTH 1PG7L 1WEJH 4LKCA 3KYAA 4X4YB 2H8PA 4IDLA 5E4EC 5SWQA 1C5DA 5F96H 4XNXH 4X80H 1DUZB 3BOVA 3DWTA 2EE2A 1D5ZA 1KFAH 4YC2C 1HE7A 4U7MA 3S36H 2BRRH 5IGXL 5IBLC 2H26B 4HQQH 4D0CB 2R4RH 2YPKB 3I3DA 4EZMA 4QF1A 1QO3B 2NX5D 4Y2DB 4NSKB 3FCTB 2D0FA 3QHTC 5CJ8A 3D3VB 1P7QA 4MA7L 3REWA 1QLRA 4P48A 3VGAB 4A6YL 1IM9A 3QFJE 1JZ8A 1U8PA 4FXKB 4NC0B 2EO1A 4QT5A 1NGYB 3C6SA 2XTJC 3U82B 1K2DB 4IOSD 4NHCL 2BMKB 4ONGL 1NAMH 3KLSA 5F3BA 5TPWH 2P48B 5EWIL 5DJZB 3W9EA 3HAEB 4ODXA 4R96A 5SWZB 4L1HA 2B7DT 4XNUH 4QYOA 5J8OA 5HYSG 1F97A 4Y4HD 1Q72L 1HINH 3QCUL 5EU6A 2AERT 2ED9A 5EO0A 1DQLH 4MCZB 5FO9B 2R0WL 2EIDA 1NKRA 2I9LB 3MBXH 5A3IC 1UEYA 2Y06H 5T1KB 5ESAA 3DIFA 2G5RA 2R2EA 4F80A 1CFNB 1A14H 2IMMA 3BDBA 3VCLA 5C9JB 2DF3A 1I9RL 1KIQA 3U1SH 3VE0B 4EN3B 2XA8L 3SKOA 5KBNC 3N85H 5L6YL 1T6VN 2F19H 4IJ3C 4TSAH 1VA9A 5IB4A 1ZVYA 2EE9A 2R29L 3AB0B 3C8HA 5IB5A 4KJPC 4UQ2B 3MRQA 4WUKL 4GRLD 4UT9H 4DZ8B 3LN5B 4TVPH 5ACLA 3EOTL 2KUTA 4CDGC 1QRKA 4UAOB 2OL3A 1ZGLP 1J1XL 1FORH 1FP5A 2Q86B 1AD9B 2JK5A 3VXME 1C7SA 3O2WH 4LEOA 5BZWA 4YZFF 1WUNT 4S1RH 1S7SB 4WW1A 3MV8B 3SDXB 1QUNA 4F9PC 1HOCB 4WW2A 1JF1A 1NAMB 2VXTH 3EFFA 1MCIA 3IDNA 2CMRL 1EHAA 1ZVSB 2K3TA 2BOCB 5INCB 1H0DB 4WO4B 3TGXA 2HT2D 4APQB 3GSVA 2N4IA 4WFED 1G7IA 2KQMA 3CX5J 1E4KC 3QIUA 4JQIL 4RGOL 4RMVA 4HIEA 2A6IA 5CP7A 4X5WA 3O3DB 1W8NA 2DLGA 3IETB 4IMKA 4JQXA 3VXSB 5I1CL 1TTUA 1G7PA 3M8OH 3ESUF 1KCVH 4POUB 4RMQA 3E8UL 5D7LE 5FO8B 2F5AH 1OP3K 2MFNA 4CRPA 4MZ3A 5EUOF 3OGCB 3VFNA 1VKXB 2AJ3A 3EO1B 4LARL 4UNVA 3MV7B 1TENA 3MJGX 3O8XD 4JAMA 2VDLH 3HRZA 3B2VH 3VFVB 3QCTL 1OQXA 4R7DA 3FMGL 3D0VA 4Q97A 5GS1A 3KLHC 4FTVB 3V6ZB 2QHRH 4H5SA 4WIQA 3C5SA 3ARDD 3OHXB 3RTQA 3P0VH 3V4PH 4XPGH 4UNTA 3CFEB 2C3VA 4G7YH 4OIIL 3V6OE 2A6KB 1KTKE 4K3JL 4M7LL 3QI9C 2IAMD 4UV7L 1MFEL 4I3RL 5LAXA 4HXAL 2XWBB 3EGSB 4HAGA 3QIBA 2EIEA 2Z31B 1EVUA 1OAXH 1FZJA 1GL4B 5E9DB 9CGTA 2OM5A 3EHBD 1UXSA 1DBMH 4X6DE 4H25B 4TNVF 1A6PA 4PY7A 4NKDB 3CLFH 4HIIA 4UIKL 2WUBL 2UZIL 5IVZB 4ALAL 2HLFC 3UTTB 4Y1AB 5C0RH 3QO0A 3GJFH 5ALBL 3AY4C 1MY5A 4LGPB 3WHXB 4EIGB 4EI6B 1YNKL 5I9QC 5K59F 3O0RH 5DJ0B 4MMZC 3IFOB 5I1EH 4P2OC 2FECL 1FHGA 3I6KA 4AY0A 3T4YB 3G5VB 1RFDH 5DEZA 4YDLB 2F54D 3NTCL 2ENYA 5FDWB 1QBLH 2MSPA 5ENWB 5KS9E 4ZS6D 4ODVL 1AQDA 4JGMA 4K9EC 5CJQH 2W0LA 3EUUA 4MHHI 1CWVA 1WFTA 3RWJA 4KTDH 4OZIF 4BSJA 1PSKH 4MDJB 4OLWH 4L8DA 4ODUA 3VG0L 1FVEA 3D0LB 1LE9A 1H3TA 5KVDH 3QQ3A 4DQOL 3SGDH 2ZCKL 4YDKH 2GJZB 1TCRB 2G9HB 1MCBA 2CGRH 1V3JA 2A9ML 4ZNCD 2NMSA 1NKOA 4S1DC 4XH2A 5C0JB 3BDYL 4L4TE 4U6XB 5B3NA 3PJSA 4NT6A 3FFCA 4S2SB 5F88B 2P24B 3WNKA 1XT5A 3RZCB 3TA3A 1K4DA 4NOFA 1WGOA 3MLPA 4M62L 3GJFB 2PXYB 3NIGE 3BP7B 5E8PA 3VFMA 4Z7WB 4NNPL 1T0NB 4LK4A 3RWFB 4ZAKB 4O58L 5D7SH 3WN5A 5F7UA 2QLVB 2JELH 4KK9C 1ZGLA 3MTRA 2BVTA 1IFHH 1I1AA 3KPRD 1KF9B 3DBXA 1NMAL 1CK0H 2L0DA 4L5FL 4RAVB 4L4VB 3FQXB 4PV9B 4AH2B 2JJSA 3B43A 4LRIA 4OLZL 2A9NH 3O3EA 2Y5TA 5DK2B 4F7CB 5BXFB 4ZD3L 1VFBA 1D5XA 5K9OB 1B0GB 4OCWL 4XBGA 1RHHB 3ALPA 2BHZA 5BRZB 3GIVB 4DAGL 5IT2H 3I50L 2IG2L 5DMKA 4BKLB 1DN0A 2E27H 1BFSA 2X1WL 4QOKE 4RRPG 2DQFA 4LCYA 5KSUB 2AJXH 4LHUB 5L2KD 3MJ9L 3O4LE 2HWZL 5EZLB 4PJEA 3T77B 1IKFL 2UWEE 4J1UB 4AQOA 3HI1A 1W0WB 3P9MA 3BIKB 2D2OA 3D2UB 4HUWB 3SDYH 1CDBA 5I1AA 1T7WA 4KJYA 2DQHH 4X4XA 4XVSL 1F6AA 2XNAB 1KIPA 4ZFZA 4WENB 4NBXB 4R8WH 3QO1A 3MRKB 3KPPB 3HG1D 5C8JA 3RPKA 1KTDB 3BVNB 4R4FL 1FZKA 1NGWB 4P9HL 1GPOH 4K23L 3WSQL 3HA0A 3PUCA 1UWEL 1YY8B 4Y4KA 4PG9A 3RUGE 2Y07L 3G08B 2PYEB 5TDOB 5F6HJ 2P24A 3SJVB 5DDHA 4ZFOA 1U8KA 1ZOXA 5C9KA 5DRWA 4J6RH 4XCEB 3K0WA 3L3DA 1PKQB 5I8OH 1LEIB 1OD9A 5T33H 3GHEH 1QNZH 3S3SA 4F33A 1YUHA 1A7RH 3IS0X 5FCSH 4XZUA 2BNQA 5HHVL 1RK1A 4P2QB 5F7EL 1JWSA 3HMXA 2HLAB 3ARBB 4XBPA 4KVCL 1ZT1A 3U79A 2P1YA 1CS6A 5F9JA 3WKNA 4XGZB 5L8LB 5DWUL 1H8SA 1ZTXL 1OSZB 3BEWB 3QQ4B 2XG5A 3DTXB 3DXAD 4K7PX 1RZJC 1W8OA 2EDTA 2WBJC 1D6EB 1WITA 2OP4L 4PRID 2NY2D 3KR3H 3M45A 3ORJA 2FL5A 3FJTA 1LD9B 1P7HL 4TULH 4Z95L 4K71C 4NKOA 5KZCB 4U0QB 2NZ9C 1XR8A 1KC5H 1KLUA 3UTSB 2E7LA 4GW5B 1YNLH 4X7FC 3V5HB 3K1DA 4X7DC 5IVXB 2FYYA 3LD8B 1Q94B 3L6FB 2QR0A 1KJ2A 2J12B 5JORA 2PETA 4PGZA 3TBSA 3IKCA 4M7JH 3NGBC 3S37H 2WP3O 1NCBH 3MLWL 4OZFG 1R0AL 4QHUB 2P5ED 3VFTB 3IDGB 2IBGA 1NBZA 1PY4A 2BNUB 5D6CA 3MRGB 1W72A 2JJVA 2H2SC 5JPNA 5F9OH 4LCUB 1D6VH 3MFFA 1EXUA 2IQ9H 2J8UB 2DQTL 3LQAC 3KXFB 1HILA 5TFSH 4EDXB 4RAUA 3ZKMD 3QULB 4XCCH 3AREC 4KROD 5FKPA 3T0BA 1A2YA 4I18B 4UQ3B 3V52H 1Y18B 4ELMF 1UA6H 2BHUA 2DM3A 5E70A 3TP4A 1A1OB 4Z78B 3LKOB 3WS6A 1AD0A 2RR3A 3QWOB 3G6DH 5EBWA 2HT4C 1YECL 1MREH 3UC0L 2YWZA 1YEHL 1HN1A 4JY4A 5HI3D 3E2HC 1R3KA 1YEJL 4XTRD 5FYKU 4OQTL 5E7BA 4JFEA 1S8DA 2YXMA 4WTZG 3FAXA 2XACC 5IEKA 5C0AB 4MHHG 2W9DL 3NMEA 4FXGA 4KJQC 1IE5A 3AMKA 4D8PB 2FHCA 3WXVH 4K3EL 4LDEB 3G6JF 4K7FB 4F58L 1KB5A 1JCKA 1S7UA 2VC2H 1EPFA 3UDWA 1MIEL 1WLHA 5FKAA 1J0HA 1MRCH 1JWUA 5HGBA 3MMEB 1INDL 4UUJA 2GSGB 1LP9F 1K8IA 2IANE 1RIUH 3PL6D 1OSPH 3DGGB 1TZIA 2ILLA 5F3HB 5C0EB 1AY1L 4K3GA 3TC9A 5J1AB 2XFXA 4P5TC 4CJ1A 5E6ID 3QG6B 2FDBP 4LF3A 1IC4H 4MB4A 4PD4K 4KU1A 1MELA 4RFNB 2R4SH 4Y4FB 2P47B 3DUSA 4M93B 2I26N 4UINH 4N0UA 1QFUL 5E8DL 4YFLF 4ZPVB 5C0BA 3TYGH 4JDVB 4OGZA 4N1EA 5AZ2L 1MFAL 5TQ0L 4W4OA 4HK0B 1SYSB 3MODL 5IQ9A 2ZUTA 3MCLL 2MCG1 2F53B 3MLSL 2C1PA 4KY1H 4WHYG 1II4E 2FGWL 4PJAA 4ACPA 1TVDA 4Q58C 3CVIH 3RWHA 3OBAA 1OTUD 4JFDA 1T89C 2P5WB 5C7XL 5JHLH 2VISB 2V5SA 3DX7B 2QV2A 1PAMA 4WWKD 5CBAA 3HUJF 1ZT7A 2OZ4A 3G5YA 2DI8A 3MNZA 2VR9A 3IXTA 1XZ0B 1U8OA 1NCAH 3MJ6A 4FQIL 2E3VA 4N90E 1BX2A 2HKFH 1JPFB 3OF6A 4EVNB 3RVUD 4MSWA 4GQ9L 1DP0A 5CZVL 1MUJA 2V17H 3BP4A 4GSDH 4AG4H 4OZGF 4DTGH 4L8CA 3IJSB 2BNRA 4KGJA 3HZMB 4BK4A 3QFJD 4OB5L 4FQXC 1A5FL 4DN4L 3M17A 2EXYD 4JM2D 4OLUL 4K3DH 2R0KH 5KVEL 4U3HA 1CLOL 1ZHNB 1CDYA 4DVRH 4JRYA 3QCVH 2D7PA 4N5EC 3VWJD 5JOFA 1CG9B 3KYOB 4DW2L 3MREB 5E2VH 5IFJA 1X5LA 3CXHK 4U1IB 4EQ3A 5B39B 3SDAC 3VI3E 5B38A 5IOPA 4JDVA 4X4MA 3AVEA 4WNQA 2E7MA 3WYRA 4OGXH 1M6OB 5ELIA 1MJJA 5A16A 4ZO6A 1YDPB 3A67H 5HYJB 1LE5B 1N0XL 2WBKA 5HHPB 1JV5A 5GGTL 4Z7NF 2FD6L 3WEXA 2VH5H 4XHJC 3QPQD 2IEPA 1J05A 5I1KL 2BCKB 1RURH 5CINL 1YEEH 4U05A 4LCWB 1CXEA 3CGTA 5HI5D 5FYJL 4DWHA 4Z7UB 5DMIH 4WTXA 5IB1A 1D3CA 2CRIA 3KS0H 1ZA6B 1LK2B 2FJHA 4G43A 1CFTA 3TWCH 1PZ5B 5J3HD 2CK0L 3WNMA 1CICB 1IGFH 4KI1A 1OB1A 4I3GA 2LU3A 2AAVA 2NW3B 3V6BR 4QHMA 2PCPA 1CFQA 4LSPL 4FQHA 2VO5A 1DLHA 5B8CB 1I3RB 4X5XA 4GKNA 4Y16A 2X05A 4OM0H 4FP8H 2AVGA 4PJ9D 1B0WA 4W68A 5MI0B 4M03A 1XGRB 2X4PB 5TQ2H 2QQKH 3TLRA 4RIRB 3RVXD 3WS3B 1UJ3B 2R15A 3NN8A 4XVJH 5CLWA 1X4YA 3FTGA 1U6AH 3HE6A 1TZHB 5IROA 3TFKD 3BGFB 4HULB 4D2NA 5D7LD 4Q6IC 3U2SB 5DR5L 3D39B 1I7RA 3KNBB 4PRBA 2OJZL 2VXUH 1MAKA 3QDMA 2R0ZH 3FRUA 2CQVA 4X6CE 4OFKA 1OARL 3T0EC 2AXGA 3H8NA 5HPMA 3L5XH 3EW3B 3PIQB 4OAWA 3VXNA 4JZJA 5GHWH 5DRXA 2DQDH 2Z0BA 2A74A 1C5CL 4I0PD 3C6LC 1JGEB 4WI7A 3O2DL 2VDKL 3QG7H 4JFPA 1P9MC 3HNVH 4HWZA 3G9VA 2SEBB 4N8PA 1JWMA 4KKBC 5CD3B 3GNML 4HG4J 1V3KA 1HI6A 3PHQB 3QIWD 1Y6KR 1ODAA 1FQ9C 5GIRA 2NY5H 2VDQL 1HHIB 2X41A 5JDJA 3TZVB 5CGMA 1GGYA 4QRRE 4XMPH 5BS0A 5FYJD 4AT6A 1KJMB 3L3JA 1A8JH 4OUOA 2GJ6A 3QUXD 2NXZB 4M43L 2HRPL 3CJJA 3HAEG 4JDZA 2DLIA 1J8HA 4OCYH 2FWOA 1FLRH 2YSSA 1MCSA 2RCSL 3UJIH 1Y0LB 5IJKC 1EEQA 5DYOB 4JB9H 5EBLB 3FQNB 4TNWK 1FIEA 5CZKA 4PRPB 5L88H 1AO7E 5I1JL 4ODWA 3EO0A 3ZL4L 3KPQB 4JE4B 3CFKA 4GRWE 5FAAA 2FB4L 4O02H 3S96B 5F7DA 3VMNA 3FT3B 4RWYL 3JWOH 4XWGL 3GSUB 5ADOH 2XZQL 4P46D 2X9XA 3TBWB 3W81A 5D2LF 4YC2B 3RVVD 4XP6L 1VFUA 3SY0B 2FH6A 3GSOA 4V2CB 4OD1L 4HZLB 3O2VL 2BVPA 5F7NC 1YY9D 2APWA 5MERB 1NCWH 5F1NA 2X9YA 3QWRD 5CJOL 4DKDC 3RNKA 2OJEB 4YHKL 4ETQA 3MOBH 2ARJB 1YA5A 1OLLA 3ULUH 4POYA 1WZMA 1S5IL 3P4NB 4RFEA 5DD0H 2IPTH 5JQHC 1A7QH 4PGEA 1A6UH 2EH8H 2Z4QB 3MRIB 3EYVA 1MFBL 4OBRA 4PLKC 2MHAB 4L4TD 3RY6C 3QQ9C 3QZWA 4G6FD 4HUVB 5CBEA 3IDUA 1U8HA 4WGWB 2FX9H 3DURB 1T03L 3BPNC 3MRFB 5FUZL 1OCWH 3QEQA 1G6RA 2NYYC 1CLYH 4MD5A 3QHZH 5EORL 1JTOA 3JBG7 5I15H 5FB8B 2RBLA 4GBXC 4G6KH 4O2CB 2M26A 5LGHL 4YHZL 3KWWA 1BIIA 2B1AH 5H94B 1KCUL 2X09A 4Z7VE 1Q0XL 4B41A 1Z5LB 3HZVB 3DVGB 3ARFD 2CUHA 2WK2A 3SGJA 3EYFB 1T1WB 1F42A 4HPYH 1BQUA 5I71C 2E7CA 3VFGL 5MEOA 4OTXH 5KSAC 5L0QC 3B5HA 4HKZB 2C9AA 4PGBB 4QOKD 4MQ7A 1OLZA 5C3LD 1JYXA 4LSDA 3GMQB 2OL3L 1NC2D 2Y7QA 4X5LA 3O4LD 2ENSA 4TRPH 3CU1A 2ADJB 3U4EA 5T1LB 2QHLA 2OCFD 1SBSH 4B5EA 1A7OH 7CGTA 1T21B 4PJDF 3MLZL 1SMAA 1ZHBA 1U58A 2VDRL 2PO6C 4WUUA 2YN5A 1Z6JT 1MVFA 3CDYA 3V4UH 5K9KB 4HIHA 2C4FT 1TVBB 4WRLA 2DMKA 5TH2A 3U0WH 4PJXB 2YOCA 1PG7X 3A6OA 3EZJB 4JO3L 1PDKA 4UT7H 5DLMH 1EVTC 4QRTB 3VRJB 2D7TH 4PRNA 3T2NL 4XBEL 1U9KA 2A77L 5DQJA 5AWNH 3STLA 2CRZA 4PJ7A 3VXUE 1JL8A 3LEYH 4R90L 4JG1L 1L0XA 1AJ7L 4NZRL 3U7WL 1QSEB 1YYML 4G8FB 4YXKL 2BJMH 4WEUD 2H45A 4YHIA 3X3GL 4Y5XB 4DCQB 5GRJH 4NQCE 3JZ7A 2QSTA 4WHCA 2OS7A 4BFIB 1F3DJ 3EOBB 4PJBB 5EU6D 3N50A 4AL8L 4H26A 3OAZK 1OPGL 1RUPL 3BH9B 3EJYD 2AQ1A 1TJGH 5JDSA 4HKJA 4M7LT 1D5BA 3Q5YA 2FBOJ 1YEGL 1JGUL 4UTBL 1ZLUH 3D1MC 4KK8C 4U1NA 4XI5C 1H15B 4OF7A 2R8SH 4POZD 4OLEA 1GZQB 5FFLA 2GKIA 1W2KT 4CVUA 2FSEA 4MNGB 4AM0A 4BZ1L 2NLJB 1RUML 1KG0A 5DJYB 4Q9QL 3OQ3B 4K94L 4F9PA 5E94B 5KVGH 3TESA 4U2ZA 3R1GL 3TJEL 4CU8A 3EYUL 2A1WH 4XMLL 4MXQD 3QXDB 4CMHC 2VUYA 3AS3A 1V3MA 1NGQH 2CKBH 2W07A 1DBBH 5ID1A 1BM3L 5I1HL 5MENE 3LS4L 3C2AH 1E4XL 2GK0A 1X6NA 4M48H 5K33A 3WNPA 1DVFD 4XAKD 5D7IF 1E4KA 3V4VL 5EIVA 4G42B 1OWRM 4NP4L 4MGXA 4ZFGL 3VXQA 3QRGL 3GMOA 3GMRB 3ZKXC 4ZQKB 5CJ5A 2YMXH 3ARQA 4P2OB 5FM4A 1F90H 3NFPB 5JLZB 2UYLA 4DGIL 5IM7A 1JGVH 3PWLA 5C92A 3KPSB 4J3OC 2OQJA 4Y4HC 5FYLL 4ELKA 1MI5E 1VESA 3HS0B 3B6SB 5EBGA 3STBA 3ARGB 4PJGA 5C0IB 4LHUG 4EBQL 3I6GA 1LO5B 1ZA3A 3MLYL 4NDMB 4GS7B 5HHNB 5CS7A 2YA0A 4X9HA 3STZB 2OI9C 1G7MB 4R26L 3K74B 4O2EA 4PG2C 1F4WH 4HBQA 2XPGA 3L1OH 4NO0A 1FCCA 1PG7W 1RIVL 5DRNB 2WZPD 5JIIA 3L5WB 5A2IH 3MA7B 5JR1L 1V7NL 2YXFA 1VPOL 2ZZUT 4LLDA 3ZDZF 2CKBB 4F7TA 3IJYB 4A2MA 2BSRB 3QNZA 1Z9LA 1EFXD 3OKNB 2XTLA 3RHWK 3D85D 2X4NA 4GRLC 1T04A 5E8EA 1FO0H 1QPPA 4LASL 2VLKE 4ODSL 2VLJE 1X5YA 3QI9A 1PLGH 3MGTB 1JFQH 3WFCL 1M1SA 2PW1B 2AGJH 5DURB 5KSBE 1AIFB 2IF7A 3MUGA 4GAFB 3QEUB 4KPHH 3L9RB 2Z35B 1DDHB 4FFYL 3WLBA 1EZVY 1JNLL 3TM6A 4NC1E 1IILE 1NH6A 1IL1B 2IAND 4FFZH 1JHLH 5HHMD 4HS6A 5HPOA 4PPTA 3E6FA 2HT2C 3UJTH 3O3BB 5I2IA 4MJ6A 5JW3L 4F7PA 1V7MH 1BZ7A 4YUEL 5DJDB 5TF0A 5KANI 4JM2F 1MAJA 5SX4H 2OSLA 2HN7A 4JFZH 5I1GL 1F02I 4F9LC 2OX5A 1FV1B 3FONB 4Q6YA 4G9FB 1MCPL 5MEQB 1JGLH 1X3DA 3LV3B 1QBML 3HLAB 1VENA 4JO2H 1F6FB 2AK4A 1RZJH 2DQCL 3BE1L 4BSWA 1JTTA 4JREC 1CFSA 1RJZB 1OM3H 1FO0B 2OTWA 1QFHA 3PDOB 3O8XC 3MROA 5CKAA 4RA3A 1BEYL 4PB9L 5FGBA 2R23B 3LKNB 3OXSB 3DSFH 3HHRB 3RVTD 1VCAA 5GGQL 5DUPL 1R5WA 4KDTC 3H3PL 3MXWH 4LPYA 1EMTL 2VAAA 4HKBA 4IHOA 3WL9B 5IW1A 3ARDC 5ICZB 4GG6B 4XC1H 3ARZA 1WAAE 4DEPB 2DI7A 3EO9H 4LFHD 1QLEL 4IRZL 2APFA 1IKNC 4ZFOL 4LBEB 1AGBB 1HQ4B 2IAMC 3FFCD 3T2QA 4Q2ZB 1QG3A 1HSAB 1ZMYA 5ETUB 4G8GA 5IG7A 4MJ5B 1X7QB 3EHBC 3GMPB 1XGPB 1MEXL 3HMXL 3Q6GL 5GISL 3RIAF 1OAYH 3CLEH 2FJFB 5HDLA 3RWEA 2G2RA 3H9HA 1RZGB 4JRXB 3H7BA 2WBJB 3TO4D 1IEBB 2QQLH 1I1AD 3FQWA 1REIA 1ZKAA 1ZANH 4K71B 3BHBB 4QHLA 3PP4L 3MBEA 2XQYK 3HZKA 4BFBD 1XGQB 4W6YB 4QRQA 1FJ1A 4E0RA 2O5ZL 4XP1H 4Y88A 5AZEH 4XXDB 4P2RB 3HB3D 2AKRA 4P4RA 3LIZH 3KHQA 4YHMH 4XCYA 1GIGL 5A2JH 1ZV5A 4ZS6C 4I2XE 4ZNEE 3NGBB 3D25A 1BQHA 1KJ2L 1C7TA 4PJ5B 4QRUA 1FYTA 3AS2A 4LKXB 2Z92A 1MPAH 1S9YA 2FX7L 3N9GH 4I9WE 4JZOA 1NDMB 5GS2D 3ARRA 5CEZH 1ZT4A 2VLME 1UZ8B 2VWEC 3VXRA 4HMCA 1AH1A 2VNCA 1W72L 2XKSA 4OCSH 4XMKH 4F3FB 3U0PB 3G5XB 4CW1B 5EO9A 1RZ7H 2VL5A 1R3LA 4HH9A 3H42L 1BLNB 4NM8L 5E6ZA 1KV3A 3BD3A 2DJ4A 1A6ZB 3ZYJA 5D5MA 3QWQB 1OAZH 5GGUB 4OLXH 4P99A 2E7HA 1UM4H 3CZFA 3HE7A 1SM3L 4BK5A 1JF6A 4ZUVA 5IMLA 2BVQA 15C8L 3P4LA 4XHQA 5DEFB 3K81A 2ZPKL 1WCQA 4I1NB 1RUAH 4NCC2 1NCCL 5KOVC 3B9KB 1MAMH 1S9KC 1VGKB 4M02A 1KGCE 1CXHA 2Q3ZA 3O9WA 4E42A 2P4AB 4U1KB 2J6EH 1CD8A 4XPAH 3SE9L 2CIIB 4PD4J 4NCDA 5IFHH 4Y19A 1EGJH 3FT4A 4TUJB 5TDNB 3H9SB 4XVTH 3ZTNL 1BFVL 1XGTA 4M5ZL 2BOBB 4O2FB 5JW4Q 4YHYB 5F71A 4YGAB 1RU9H 5C07D 3FN0H 3IFLH 5AD0B 1Q9OB 2PTTA 3K8MA 5I8CB 5SWSB 3BI9X 1MQKH 1NGPL 5KSVA 1MWAH 1JVKA 1WBYA 2AEQL 4PY8J 3HC4H 5FDYA 2FX8L 2B8OT 4C56E 3RNQA 5D7JA 2BY0A 3M1BB 4DZBB 3ZE2F 2DBLL 5FYJU 3AREA 3GIZH 1G1CA 1N64L 4PYHA 3LKQB 3MLTA 4MJID 2W60A 2W65B 1KPVB 5B39G 1EAPA 1N8ZB 3T8XA 4CVXA 2ID5A 3SKNA 4G80B 1QFWL 4RQQA 4HIXH 5JZ7D 4Q9BA 2VLRB 3X3FL 3VWKB 5C6TL 1E27A 5E5MB 3L3IB 1AO7D 1KXQE 1D5IH 1R3IH 4XCFH 1FE8H 2EDBA 4OZ4B 4RFOL 1XIWD 1EEYB 3HKFA 3UTQB 5DQDH 1XGYL 4CADA 4KAQH 3FOMA 4GW4B 4AJ0A 1HSBB 5C2UB 4GRMA 4NO2A 3EDFA 5E8OB 3UMTA 3VFRB 1IAKB 3KPMA 1TJIH 3GI9H 4ONHA 4KKAD 6FABL 3KJ4B 1VGEH 1MJ8L 2JIXA 2F9BT 2NY2C 2ADFL 2YKLH 1QFPA 1A0QL 3IAPA 3QDJE 3BKYL 3PWVA 3W0WA 3QUYB 4IOFD 1MWAB 1BBDH 4JFED 1ITBB 4PR5B 2PR4H 2H9GB 4OF8A 1IRAY 2UWEF 3CXHJ 2NXYB 5GQBA 3MNVA 2G60L 2AEPL 5I1DB 5HHOE 1I9IH 1Q1JH 2HMID 1M7XA 1OY3B 1FVCA 3DNKA 1KT2B 4KTEL 4P5TA 3TVMD 3D87B 1UWGH 1N59A 5D4QA 4CNIA 4RA0C 1WBXA 4WI9A 5LKNA 1OD7A 4B53A 4ERSL 3RUGF 2JB5L 4U1SA 5EUOB 1IM3B 4QRPB 3UTPE 4LSVH 5BW7A 4JFOA 5GS0L 5I0ZA 4Z0XB 3WJJA 2CDGA 1EUUA 4KROC 3UO1L 3MX0A 3WDHA 3BW9B 4KRMB 1U8MA 1HH6A 1YMME 1L9NA 4WEBL 1LO4L 4XP5L 5AAWA 2AXFA 3IU3A 1WICA 1KYOK 1QR1B 2HFEB 3IRPX 3X17A 2F74B 2ESVE 3B3IB 5F8RC 5TE4H 5F97E 1FYHB 4OZHA 1OTSD 3IDYC 3OAYH 5ADPH 5DJCA 3RHWF 3MRMB 1LO3L 1XF3A 4XTRC 4YGVB 2GTZB 3L95B 1F58L 2UUDH 1AKJD 3PWUA 3PWPA 1U36A 2JE8A 1XGUB 4NGHH 1T0MB 2HJKB 3SKMA 1H5BC 3HNTL 2MCPL 1TPXC 4XPBL 2D7NA 1BD2A 4QTIL 5DHXB 4NIKB 1MJ7L 3LN9A 4IS6A 4P5KB 2X7LB 2DOCA 2EH7H 2LTQC 3CSBA 4MNQA 5FM5M 5J6GA 4LLUB 4DOHE 4U1MA 4RISL 4FQXA 3CFCH 3TT3H 3PL6C 1R24A 5KS9B 1RV6X 3C8DA 4WW2F 5C0FB 2VIRB 3KLAB 1IAOB 1NEZB 2AV1B 4M4PA 3DPBA 5EZIH 5E6IC 5JW5B 5GSRB 3SDAA 5SV3A 4GXVH 4GG8B 3F7PC 1DQMH 3VXUD 3VW3H 5BV7H 3OX8A 1FPTH 4S1SL 3Q5TA 4KHXH 4JRYD 3MLUH 2XWTB 1QYGL 3V0WH 5ISZB 4NQCD 2KPNA 1X44A 1KJVB 3GSNA 1JRHL 1NLDL 3MR9A 5FA3B 3REVA 3D3VE 1AR2A 1I9EA 4PRHB 4HHAB 2AI0L 4JO4L 2D03H 4GFTB 2IH3B 4KKLD 4CN6A 2RIKA 4HFUH 4NQSA 4PLOB 2GITA 2BVOB 4X99B 3KAAA 4YEFA 2H41A 5T3XE 5T5NG 1OTUC 4N0RA 2IFFL 3FN9A 1N4XH 1IBGH 3JWDH 2FO4B 4HC1H 4R4BB 5SWZE 3RU8L 5IFAL 1H3WM 4OJFH 1I1FA 3WXWH 3UBXB 3EYSL 5E2WH 3FO0H 4WWKC 1G9MH 4ZYKA 4Z76B 1YJDH 3SQOL 3BMVA 4EIZC 3PF2A 1PD6A 5KAQF 1ZLVH 4TUKL 2K7QA 3MLXL 2Y5EA 3B5GA 3BD5A 4GXUN 4YXHH 1BVLB 1FN4A 3FN3A 3UJJL 4NO5B 4JPIA 1CYGA 2VE6A 1YPZA 2HP4A 1DEDA 1JI1A 4HCRA 2X4SB 3RVUC 1DBAL 2GK2A 4HT1H 5BV7B 3U4AA 1I7ZB 2BSTA 2VSDA 4NRYA 1T83C 4FNLL 1H9VA 1KCRH 5D1QA 1G7LA 4PS4H 3CK0L 4XX1G 3BQUD 5BOZG 1KEMH 4I77H 3NABL 2P7TA 3BGMB 1A6VH 3MJ8A 2EXYC 4JM2C 5IK3A 1EO8L 1ORQA 2A73A 4Q6IA 1J1OH 2D31A 5CCKH 3EDEA 4U49A 1MNUH 3HCVB 3GHBH 3VWJC 4NN7C 1I4FA 4WU7B 1JN6B 2DLEA 1J86A 3MV8E 3SDXE 3SGKC 3EYQD 3LRSA 1S3KL 1FNAA 1Q9LB 4FFVD 4C83A 3T0EA 4HF5H 3R8BB 4HPOH 3TYFA 4KQ4L 5IHUL 1MLCA 4OZIA 2XWJB 1P4LA 4X7TB 4QNPF 5ITFA 3C6LA 2GYSA 3S3JA 4PTTB 3WIIL 3QPQC 5I18L 3VFWB 3Q6FB 1OOAA 4L8SC 1UM5L 4DK3A 1JPGB 3TN0A 4DN3H 2NTSP 1F3RB 2DQEH 4ORGA 5C2BL 1CD1B 2CDFB 1KJ3H 3VXSE 5HI5C 1GSMA 5SX4I 5GSVB 5F7KC 1QVOB 3BPNB 1FFRA 5IMMB 2VLKD 3BT2L 3P4OB 1HXMA 2YK1H 3IGAA 4Q9CA 1KEGL 4LP4A 4H88L 3OKDB 1DQJA 3FT2A 1H3XA 4GBXB 5J3HC 1I3GH 4XWOD 4D9LH 1RJYB 1G6RL 1XFPA 5IJKA 2VKWA 3AM8C 5D72H 4XPFL 4ZOBA 4ZXBD 3VRLE 1RJLB 3AFLA 4RGMC 2VLLA 4LVNC 3I3BA 4PJ9C 1Q9KA 1T0PB 1OW0C 3EYOB 1SEQL 3HC3H 3CH1A 1L9MA 4FTVE 3NCCB 4GUPB 5IBUG 3RVXC 3JV4B 3SE8L 3MOAL 3PGFL 2AABL 3L5HA 4Q0XH 1SY6L 2UVFA 4HEME 4GKSA 3DMMC 4HLJA 5JQ6H 3NIFE 2CD0A 1V8HA 4UDUA 2VAJA 3FQTB 4U33A 1ULVA 3BO8A 3CFBB 4MAYB 5DJ8B 3RX7A 4Y5VB 2BHYA 2FLRT 4FQJL 1XCTA 4FA8A 1Q0YL 4P9ML 3ZKND 4QXWA 5D1XD 5FUCE 3VI3F 4D0DA 2WWKT 1OGTA 2QKIA 5HBBA 2BDNL 5E9DE 3CVHH 3S4SB 4JFFB 4YX2H 1YYLH 4NPYB 3DECA 4WU5A 5T5FH 5GGRA 4XP4H 2CLZB 5EZOH 5GRUH 3RY5A 3PQYB 1UACH 3E3QE 4OKDA 5KW9L 2NY1C 3VG9C 4JLRB 4YH6A 4I0PC 4FOMA 2JCCB 4Y1AE 3UTTE 4E41B 3VXOA 5E1AB 4DGVL 1NFDA 2VKXA 4PJEF 5SX5K 5E00B 5IV2B 3QXVA 1I8MB 1CCZA 1VADA 4YXLL 4U3CA 3QNXB 5FCUH 2DM7A 1FFPA 2HA1A 5E03A 3CFDA 1B6UA 2DIJA 2AJYL 3KYKL 3O45A 2OR8A 5FO7A 4WI3A 3F7YA 4ELMB 1R5IB 3QUXC 4IMLB 4NQVB 1RVFL 4PJCA 1NL0H 1ZLSH 1KTRL 2HVJB 4KK6C 5CZXD 3DHJA 4A2LA 3DROB 1DTUA 2HVKA 2O5XL 3TT1H 2WQRA 1R3HA 3VMPA 3SDCC 4PJIA 1RAMA 3DRTB 2L7UA 4IRSC 3PABA 4NRZA 1PQZB 3N1QC 4CBPA 3FRPA 3RI5K 2P8MA 3CVHB 4NUGH 3RL1B 3QRFM 2EEDA 4L29B 4PJHA 5CEYA 4H0GA 4H20L 3L7FA 4E5XB 1NC4B 5KSAA 4LLVB 2CJUL 4KVNL 1BVZA 1IT9H 3R0NA 3W39B 5JW4M 3BAEL 1WWBX 3TF7C 1NBQA 1R5VB 5KG9A 4NZUH 3SE4C 1QSFB 1F11B 3GSRB 4P46C 5KJRH 2YPVH 4Z7WE 2XRAH 1C1EH 1S7QB 3RVVC 4BQCA 1T20A 4CMMB 4CMHB 3HR5B 3QISA 3P0YH 1QFOA 1YY9C 1BZQK 4X6CF 4YHLL 2APVA 2AJSH 3U9PL 1GHFH 1J5OL 4HJJL 2PO6A 1U92B 4R9HA 4MNHA 4Y5YC 5IQ7H 3JTSA 1F3DH 4L4VE 2JKXA 1G7JB 4KMTH 2OK0L 1CLZL 1U8NA 3TBVB 1LEGB 5TE6H 1QZ1A 1OL0A 3PNWB 4M3KB 5L8KB 1FIGL 2W0PA 3JUYA 5BRZE 4OV6F 4F8QA 3WE6B 4LLYA 5T1MA 5BQ7B 4M7ZC 5IGXH 5ANMA 2ITCB 1XF4A 2EO9A 3UPRB 3ROOA 2QBWA 4U1JB 4BFGA 4J3WA 5CMAB 4NQXB 2VABA 4NUJB 4XNQA 3V95A 2IH1A 4MA7H 1UVQA 4ZFFB 4HUUB 2B1HH 3EOYG 5IF0B 3FQRA 3T65B 1XH3A 4A6YH 5J89A 3RDTA 4M9OA 4O51A 2EDEA 4NHCH 2V9RA 1CD9B 4WDIA 3RPIA 5L2JA 4ONGH 3X11A 5EWIH 1R3JB 3ARFC 2DN7A 1UWXH 4HX1B 2RQ8A 2PYEE 3H0TA 4PJFA 3QCUH 2X42A 4N8VA 2E7BA 3SJVE 2D9QB 3IDMA 2R0WH 1OAUL 1KGCD 3OKYA 4MB5A 3F65A 2V7HB 3RBGA 1MHEB 1PKQE 2WWKO 3G6JA 4QLRA 1I7TB 1JJUA 2X70A 2W1NA 2BFVH 2CLRB 3LAFA 4JG0L 4I4WA 4P2QE 1I9RH 3N1MC 3MRHA 5D1ZB 2XA8H 4LSUH 1LP9A 4OZGB 3RGVB 2NX5A 4BSVB 1H8OA 5L6YH 1UB6A 1A3LL 5DSCA 1A7PL 2QSCH 4GW1A 3VI4E 2DJUA 3MCKB 3EOTH 2J88L 3KG5A 4S0TD 5I16B 4WFFE 1J1XH 5IB2B 1DUYB 4HUXA 4OKVB 4A6YB 4YHNB 3OV6A 4C56D 4EQ2A 4BH8A 4KZEH 3BESR 2Q7NA 5AUMA 3ALXA 4HGKC 1TXKA 4MD4B 3CC5B 1BFOA 4MX7B 4Y4HA 3UTSE 2Q6WB 4HWEL 5I1LB 4P23A 5IVXE 1QLFA 1P2CA 8CGTA 2CMRH 4URTB 3KVQA 2XA3A 2YWYA 4QXUL 1K6QH 1EFQA 5INDA 3OPZL 4YPGB 4F57L 4PG2A 4YHOL 1T1YA 5EC1B 4K9EL 2MWCA 2WUCH 4JQIH 4OGAD 1JK8A 3ZT7A 4RGOH 1VFAA 4LLWB 3EJYC 1FFOB 5I1CH 4PRAB 1OTTD 3RX8A 1S7RB 4X98A 1CXKA 3E8UH 1RZIB 5B4MC 5GRZA 4GRLA 3IF1B 2UVEA 1UCTA 3HUJA 3PV6A 2DL9A 2GW5A 4J3SA 2J8UE 2IBZY 2XY1A 5CIPH 3GUTA 3MO1B 3ARDB 3KXFE 4LDOB 4RGNE 5DS8B 3L3KB 4POZC 4KI5D 4HK3N 3ZKSD 3S88L 4WI8A 3S98A 3QDJD 4LARH 1UH4A 4CVZA 5IHBA 4X7SH 2XN9B 3K4DA 2IAMB 1BBJB 3IDXL 2FJGB 3LY6A 5E2TL 3DV6B 3QUKB 1DQQB 3QCTH 1QRNB 1I7UA 1G9NL 4ONOA 4MXQC 3FMGH 2VMFA 2DRUA 3MRNA 2RGSA 2Z91B 1OT2A 3E0GA 3I9GL 1SJXA 3MFGB 3Q3GB 5FV1L 1CE1L 4GAGL 5EOTB 4WW2C 1T1ZB 1BOGB 4GRWH 4LLQA 1HDMA 3GSWA 3K8KA 1IGJB 3JV5A 4OIIH 5DJXB 1DE4B 5C0AE 4W4NA 2HTLC 3S5LA 3OKMB 4K3JH 4M7LH 3BYYA 4CGTA 5J12B 4UV7H 1MFEH 2HAZA 4I3RH 4MD4A 4MA8L 2ADGB 4HXAH 1CL7H 4NQDA 3UTPD 3TPUA 4BUHA 2F54B 2AXHA 1CF8L 1C16A 3MLRH 4GOSA 4IMKC 2FRGP 3D18A 4K8RL 4QRRB 3WCYA 3O8XA 3PXJA 3FHQA 3LMJL 4UIKH 2WUBH 2UZIH 3BUYA 2OXGA 3LKRA 2BNRE 1OP5H 4R3SB 3VXTA 4Z77A 5GJTL 1AXSB 4ZUSB 3C5ZD 3UBXI 3GMLB 4Q74A 5BCAA 1UB5B 4JO1H 1RK0B 4KDTA 2ESVD 1D9KD 4LLAA 1KBGL 4YWGH 2ZOLA 1J12A 3MRRA 4JPWL 4JFQB 2FR4A 4LL9A 3VH8A 2NY6D 4QCIA 4F15C 4H8WH 2PW2A 5EU4B 4EI5A 4NKMA 2MQCA 4ODVH 1ZS8A 5C09B 4XC3L 1RMFL 4G8IA 1NDGA 4U6VL 2IALB 4YNYA 5GS1C 3MRBA 3MYJA 4ISVA 4FQ2L 5FM8A 4YR6A 3VG0H 4ZOEA 2F53E 4HQQL 5C08B 4OD2B 1M05B 2R4RL 4DQOH 2ZCKH 4XVUD 4OFVA 1PYWA 2GT9A 4KQ3L 2DLHA 4TTDD 3C60D 2A9MH 4GKZA 1B0RB 5DGRA 3O6ML 3BDYH 5HHQB 1HHHA 1ED3A 1M71B 2P5WE 3S8WA 3O11B 3QIBC 5D2NA 1L6ZA 2GSIA 4TOYL 5GGSA 1UQSA 2EZ0C 4LLMB 1F3JA 3AGVA 5DMYA 2E8ZA 2A6DB 5EZJA 4M62H 5D2LB 4P49A 1GYAA 4G5ZL 2X4QB 3L3GB 1H3PL 4NNPH 5F89B 4V1DB 4NWUL 4O58H 2XZAH 3JTTB 3IDJB 3NBNA 5L2KB 2EIZA 1N5AB 4EDWL 1GGBL 4ODBD 4G9DA 3VDCA 3F7RA 1DQLL 3MBED 4Y2DD 4J23A 5DHVA 2G75A 1MFCL 1HHKA 2Y06L 3FB6A 5HI4D 3V0VA 1UM6L 1EUTA 3D3VD 3UTZA 3QUZB 3PGDA 4OLZH 1A6TA 1OP9A 3VFUB 2YD3A 5HGAB 4K8RD 3QJFA 5CSZA 2GI7A 5CD5D 3NZ8B 4ZS7H 5I66B 4TUOA 1AGFB 1B6DA 4OCWH 1J10A 3BPCB 2VZ3A 5T3XD 4DAGH 2V5MA 4ZO8A 3I50H 2IG2H 3RVTC 3UAJD 3GKZA 5SWZD 3F7VB 5EFIB 3TEUA 1U8LA 3MJ9H 4TVPL 2HWZH 3JXAA 4FXLA 3CUPA 1C08A 1IKFH 3EOAB 3LQAL 2VQUA 1FORL 2IADB 1MCQA 5T1KD 3VXRD 4XNMB 4TTGA 5HYJE 4U6HB 4G7VL 3WUWA 4XVSH 5HY9B 4ZSOA 2Q76A 4R4FH 4P9HH 3NA9L 2VXTL 2X1XR 4JRWA 4H1LA 4K23H 2R2HA 3TA3C 3WSQH 3KPRA 1A02N 5DF0A 4NQTA 3RI5F 1T3FB 4L3AA 4LCWE 3MV9B 4ODTL 3SDDB 2Y07H 3BJ91 4YFDB 3HI6L 4Z7UE 3IAQA 5GGVL 2I9TA 3TO4C 1KLGA 3TIDB 5BS0E 3P77B 1I1AC 4MA3A 4RNRA 1WZLA 3CDGB 4NNYA 2GTWA 3RVWD 2J8HA 2IFGA 3QH3A 4IIQA 4KRPB 5IJVA 4NM4L 4MD0B 1MHPL 4PBVC 4MWFA 3ZE1F 3HB3C 4PJDB 2XKUA 4MA1B 3OMZA 1NBVH 4D9QE 1AGEA 3WDIA 4HKXA 3O9WD 3CSGA 4X6BA 5E8NA 1JGDB 4APQD 1HCFX 1ZTXH 2VDLL 4LCCC 4JJ5A 3HG1A 3OJDA 4Y19D 4YDVA 3WIHA 2OP4H 2ZSWA 4UT6L 1BP3B 4JCMA 3PWNB 3VXSD 3RJDA 3RIFK 1BF8A 4Z7QF 4KDWA 1NEZG 1QA9B 2NY7L 3D39E 2AV7A 2APBA 1KYOJ 5DUBB 2YRLA 1U2CA 1X5GA 2YA1A 4N0FB 4P3DA 4Y8AA 3RWCB 4NHUB 4NQEA 5LG1A 3RAJL 4G7YL 4TVPD 5FK9B 4YO0A 5FUOH 3MV7D 2GFBB 3ILPA 3MNWB 1YQ2A 5D7JD 3MLWH 4Y4KC 3TNMA 3SPVA 2FATL 4I48A 1YMHA 1ADQA 1DN2A 5JPMB 3ZE0F 1OAXL 4U7SA 1LHZA 3FB7B 3NCJL 2R2BA 1NFIA 2OTUA 5FOBB 1DBML 3BPOC 1L4IA 2H3NB 4FTVD 1OAQH 2PUQT 3QXTA 1HNFA 3IDYB 3K4AA 2DQTH 3CU7A 5J6HA 3DXAA 3ROLB 5C0RL 4J12A 4PRIA 1T5XB 3V5DB 5MENB 1I3VA 1ZE3C 5B22A 1OGAB 5IMKB 4WJ5B 3TBYB 5JHDB 6CGTA 3ARUA 1H5BB 3UBXG 4ZUTA 1TPXB 2YD8A 5GRVL 4KHTL 4BH7B 2Z31D 3V0AC 4JKKA 4U6YB 3MGAA 4PREB 2ZOKA 1IGTA 1YECH 3UC0H 2V2TA 3BZ4B 4PRPE 5SV4A 35C8L 5CEXA 3KPNB 1AGDA 5HGDA 5CJQL 1HQRB 1B2WL 2RFXA 4DKEL 2NTFA 5D7IB 4OFYD 2P5EA 2E7LC 2HJFA 3QEHB 1MI5B 4ZUWA 4OQTH 5I74C 4LPWA 43CAB 3K7UA 2W9DH 4E9LA 1N3NB 2NNAA 1E28A 1FZOA 1I1YB 1LWRA 5IKCA 3ZKQD 4K3EH 5IR1B 4YBLC 4F58H 1DEEA 1MIEH 2PF6A 3DETD 3INUL 4EXKA 2YPLB 2WINA 1VACB 2LAAA 4O9HL 5AAMA 3TO2B 1PGRB 4IOIA 5I8KL 5JIHA 5JZ7C 1IEHA 2FGZA 4ZUUB 4FQQA 4PJ7F 1MCKA 1AY1H 3OB8A 3GSNL 3DYPA 2E9IA 2XTJE 1XIWC 1CT8B 2FHFA 4P4KA 2ATKB 4QHKJ 2VXVL 2YBRB 4L3EA 4LIQL 3DRQA 1U8JA 3MRDB 5D70L 3ECBA 5E8DH 4AQ1B 4MXVF 4XAWL 5AZ2H 3RZCD 4KKAC 1YNTB 1MFAH 4RBPH 5TQ0H 1MJUL 2PXYD 3MODH 3GBNL 3MCLH 3FOLA 5F93C 5I73C 5EO1B 4ESKA 1FL5A 2FZ3B 4G3YL 3MLSH 4IOFC 2FGWH 5J1TC 3HPJA 4P57B 3V5KA 3PWJA 4FQLL 5MEPB 3FZUC 4KK5D 3DO7A 5DVMA 1MCWW 5DVKA 4L4VD 5IEHB 4U6TA 2G5BA 3KPTA 2CDEA 3PL6A 2HMIC 4HCRL 2Z8VC 3W9DA 3WFDL 4Z7OF 4OV5A 1BD2D 2DYPA 5DZOA 5EPMA 4ETYA 4JM2B 4ORZC 3VFPA 5BRZD 5D96C 3TVMC 5E6IA 4JEGB 2ADIB 1MHCB 3ULUE 3AAZA 2I07A 2EKSA 3BSZL 4FQIH 5E0QA 2YA2A 4LHUD 2HYMA 5H35A 1D5MB 4FN0A 1FL6B 1XR9B 3GMNB 3NCYP 5CZVH 3D2UD 5A40E 4L8BB 2P46B 1M4KA 7FABL 4TPRL 1QNZL 5EUKA 5DGQA 3I75A 3IXAB 3FB5A 3U7AA 3S4SG 1A5FH 4DN4H 3OKLB 4F2MA 4OLUH 1ROWA 5KVEH 2Q8AL 2Q87A <