1ZVYA

Crystal structure of the vhh d3-l11 in complex with hen egg white lysozyme
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
DVQLVESGGGSVQAGGSLRLSCAASGSTDSIEYMTWFRQAPGKAREGVAALYTHTGNTYYTDSVKGRFTISQDKAKNMAYLRMDSVKSEDTAIYTCGATRKYVPVRFALDQSSYDYWGQGTQVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for the preferential cleft recognition by dromedary heavy-chain antibodies.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase/immune system
molecule keywords Immunoglobulin heavy chain antibody variable domain
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zvyA00
5FYLD 4YDKH 3UTOA 3MSPA 1YMMD 3S88H 3X11B 5C0EA 4CADB 2YPLA 3K1KC 3BRGC 1F8TL 5HVHB 1B4JL 4IRZH 3GI9H 3HE7B 3OAYH 3MBED 3RWJB 4X7TB 4PRHD 1QFWL 3QXVA 4M7ZB 5IB1A 3X3GL 4G8FB 4NWUL 2P5WB 1I3RA 2PTTB 4WU5B 3LKQB 4LF3B 2DLIA 3ULUH 1FO0B 1H9VA 2BNQA 2AABL 1JGEB 4CU8A 5DK0A 1EFXD 2HLAB 4NZDA 4QY8B 4P5TC 3MGOB 5DJDA 4Z18A 2PYEE 5JW5A 3VG9B 1KIUA 3VDCA 4OD2A 4N68A 1XF2A 2EE6A 4AL8H 2FIRT 1FNSL 3NH7L 4HKBB 5E2JA 1AJ7H 3IJYA 4FFYL 2OL3A 1NQBA 1OAQH 3H0TA 3FQXA 2VXTL 2XA8H 1M7DB 1O5DT 5T1MA 4LSQH 3W11D 3D39A 3EZ8A 5TPWL 4PGBA 4MAYD 1XR9B 1TITA 1K4DA 3MLYL 5MEPA 3P9LB 1T83A 1KEGL 2VQUA 3OKNA 3S34H 4OGAD 4WCYL 4R0LB 3VG0H 8FABA 4W6WB 4S0TD 2VO5A 3VD5A 4XAKE 1I7TA 1U42A 4ERSH 4WY7H 2XQBH 4I0PB 1P9MA 4FQQA 4ZUSB 3VWKD 5BMFL 4S1RL 2X1WL 2QQKH 4JDTL 5B39B 3U0WH 2C3VA 2NY4B 3H7LA 5DK2B 1XF3A 3RNKA 3OGOE 1QQDB 4NDMA 1MREH 4OUOA 3GK8H 2JCCE 2P42B 5DHXB 4NJAL 4BZ2H 3S88L 2YMXH 1CD0A 4WW1A 4P4KA 3V79C 5AZ2H 3CFBA 4K8RC 4KI5D 4MAUL 5GJSH 1IC7H 2NYYC 1J8HA 1BJMA 1S9WA 1B3JA 2I24N 4MHHI 1D5BB 3V0WL 3GGWA 3QWOB 1KULA 3QJFB 4GQ9L 4BSWB 3REVB 3KPQB 5C92A 1YYML 3QCUH 1DL7L 2VAJA 3HFMH 1B0RA 5T5FH 1A6WL 1RZ7L 2XG5A 3LDBB 1OVZA 3PWNA 4YDVA 4J3WA 4PJHE 5C0BD 3VXQB 5SWZB 5KOVC 4N1EA 2C3HA 3J8F7 3O4LA 4XWOD 4WI8A 3U2SA 5FXCH 5FO7A 1GL4B 3SDAC 4V1DE 5HSFA 3MLPA 3QRGL 1YEHL 3CX5J 3Q0HA 5EBWB 2ZKHH 3SGDH 5F3BA 5F89A 4Y4KB 4JHWH 3LEXA 3SQBA 3TYGL 4YDLC 3QUMB 4LSUH 5GSVA 3T4AA 4PJ9B 4RWHA 1X5KA 4HQQH 4FQXA 2GTZA 4X4ME 3G5YB 1JMXA 2ADIB 1UXWB 1DBKH 5KTEH 3DYPA 5EUOE 5JA8B 3O2DA 1GPOL 3IDGB 1NGWA 4K94L 4NCC2 3BWAA 3B83A 2FIKB 3HG1E 3W0WB 1N0LA 3JWDC 4PRAB 4Y1AB 4PJCA 5BVJB 3OG6B 4XI5C 5D5MB 1PKQA 2CK2A 1CLOL 4MNGA 4I18B 5C08A 4QYOA 3BO8B 3F12A 2DWEB 3MV7B 3HMWL 1JGUH 4F57L 1HSAA 1X6NA 3G9VA 3FL7A 5J0BA 2YEZA 2JIXD 4HDIA 5CEYA 5TE7H 3S35X 1UXSB 1HHIA 4QOKE 1LEKA 1TETH 3LH2L 1ADQH 2C1PB 3TC9A 2Q7NA 2ADFL 2HT4D 3C5ZD 5KVEH 3D9AL 4PJXB 3KXFA 1YEGH 4JM2C 4S10A 3WSQL 2WWMC 5EG6C 2EDHA 4JDZA 4PRBB 3WIFB 4O02H 5ALBL 1HOCB 1ZT4B 2X4NB 3RL2B 2FHFA 2O61B 1B0WA 5B3NA 2ZSVA 4PJBB 4DKDC 1FFNB 3GKZA 3QXUA 3LN5B 3PV6A 4J4PD 4UT6L 1OSPL 1IC1A 2Y36L 3EO1B 4F9PA 2XPGB 5T33H 4G6MH 5CBEA 3QFJA 1KCUH 5F9JA 3WD5H 3VW3H 2DOCA 3LB6D 4NNXA 5EO1B 1HDMB 4MS8D 5I8KH 3NCBB 1L6ZA 3BJLA 1U8JB 3GM0A 4I48B 2HT3C 2OCFD 5J6GB 2B4CL 1Q0XH 5E1AB 3TPUB 5IVZA 5E08H 3LKPB 3N1GC 4ZFOL 5CJ8A 2W9EH 4D0DA 1TJIH 3FT4B 1OP9A 3SDXE 3NPSB 4L29A 1U8HB 1RULH 4IRSC 4DTGL 3OJMB 2X1XR 3MRGB 4K7PY 3EFDH 2BXYA 4L29B 1LK3H 2VZVA 3QDMA 4LLDB 2X05A 1AXTL 5HJ3A 5KZCD 1J0YA 4HSQA 1SMAA 1R5WA 5DD3L 2BY2A 1QVOB 1H5BB 4ESKA 3QO1A 2YC1A 4WHDA 3C8KA 4WI2A 1YMHB 3TIDB 4IEFB 4U3HA 3BQUC 4R8WL 1JGVL 1FH5L 3CNKA 1QRKA 1CICB 5FKAA 3KPSA 4HAGA 3RWHB 2DI9A 3F7QA 5CJOH 4Y4FB 4IS6B 1BWWA 4U31A 3SDDD 3SKMA 2EIEA 1ZKAA 3GNML 5D4QA 1NEZA 1QHOA 3LIZL 5J9PB 3QPQD 2NX5D 2BVPB 3D25A 4ZPTB 3G5VA 2P8LA 3U36A 1MH5A 4M6NL 2ADJA 3PHQB 5SWSD 4PLKD 4ONHA 2P7TB 3I6GB 3BGFB 3CXHK 4X7EC 1DQTA 2Q87A 4PJIB 3O4OC 3UP1A 3VH8A 4YHZH 3RL2A 4G6JL 1NAKH 3RY6A 3RDTD 3KXFB 4RFOL 5D7IB 3RDTC 1R5IB 1V05A 1NCWH 3QP3A 4U6TA 4NZTH 4JVUA 4YXLH 3ZT6A 5GRWA 1F3DH 1J0IA 3H9SB 1HSAB 1HHIB 1LEKB 5DJ0B 1XCTA 5IB2A 5C9KA 2KQMA 1F58L 4N0UA 2PKDA 3GSRA 1RFDH 2MQ3A 3R4DA 1U8LA 3U48A 5C08B 5ACZA 3ARVA 1JNLL 4Y0GA 1XCQA 3F12B 5IESH 4QYOB 3NFPA 3UTTE 1Q0XL 3LPFA 4F37F 4I5BA 3U0WL 3RWFA 3D2UA 4UV4H 2EDBA 1A1NA 3HZYB 5ESVB 5BS0A 1LE9A 3AM8A 5T5NF 1J1OH 2AXJA 4JO2L 5LGJA 4OGYL 4Y4FD 2IFFL 4ZPVA 4PD4J 1TJGL 2ERJC 4FQXB 3UTTD 2BNRB 3S96B 1KNOB 4JZOA 3VA2C 2XQYK 2DDQL 1LO0L 5DHVA 1G9ML 2GTZB 2XRAH 3QUZC 1AGFA 2PCPA 3DMMC 2GSGB 5EBLA 1I1YB 5A40E 3BPOC 4K3JL 5FOBB 5CJQH 2XXMB 3BYYA 4H0HB 3K80A 3FZUC 3PWPD 4U1JB 1S7RA 5BQ7B 3VFWA 2UUDH 3B6SB 3L7EA 3S35L 5JMOC 1I1FA 1ACYL 3TT3L 3P77A 1WWAX 1P4IL 2YWZA 4FQJL 3U0PB 2HP4A 1MY5A 2FR4A 1F58H 4N1HB 3VWJC 4K3GA 4M93B 4RX4D 2VXQL 3CFBB 1VGKB 2R0ZL 1S9WB 2VR9A 3TJHD 4WW2C 3SDDC 2XYCA 2DJ4A 1JGUL 4GXVH 3BXNB 4PJ8B 3E6HB 3BISA 4PRIB 4JFED 1KJVA 2CIKA 3ARDA 5IB3A 3BX7C 2HFFA 5TF0A 2D0FA 4LGSB 2DLEA 1Q94A 1UB5B 1K4CB 3L3KB 4Z7VB 4PJFB 4HKJA 4QRRB 1JTOA 4HHAB 3U4BH 4EEEA 1BIHA 2DTMH 3DRTA 3BDBA 4YQXH 4KAQL 3KLDA 1B6UA 2IALA 4LLVA 4O4YL 2GK2A 4JQIL 5DSCB 1S7VA 2Z35B 4OTXH 1EFQA 4NO5B 1LMKA 1N2RB 4LQFH 3LMJH 1IKFH 1BBJA 1JI2A 3MRHA 3QCVL 4NRZB 3QSKB 1GHFH 4Z95L 1E4KA 1OLLA 1U6AL 3EYFB 1T21B 4ZUTA 3HG1B 1SHMA 1B6DA 5C0CB 2DIAA 3NN8B 4NQCB 1RJLB 5CSBA 5JLZA 4KJQD 2HWZL 3BIBX 2BVQB 5CSZA 5GRXG 3S37X 4ONOA 3JV6A 5B4MD 5J12C 3FCTA 1MCQA 2F5BH 1JF6A 5FYKL 4NT6B 1FAIH 4DEPC 4TSAH 1T7ZA 4J3UA 1M05B 2P24A 4QT5B 1U8OA 5CAYB 2BNQB 3K1DA 5D1XA 2LAAA 1WIUA 3FQTA 1JHTA 1BBDH 3G6JE 3ZKND 5SWZE 3ZKMD 3GI8L 4KY1H 4OV6F 1MAKA 3MR9A 5DWUH 5EPMA 1HH6B 3NBNA 4S1RH 2YPVH 5I1HH 2AJYL 2BVYA 1L0XA 3QEGH 2O5YL 4YHIA 5EPMB 2CLZB 4Q0XH 1RZ8A 1T66C 1KFAL 3WMSA 1CFTA 1P1ZB 2C1OB 3C08H 3ECBB 4HS3A 3RWCB 3VMPA 1VERA 4YWGH 4MA1B 3RWIB 4M1DL 1CXFA 1PX3A 4OZHB 4OFYA 5JDSB 3ROOA 1U3ZA 1Z5LB 1ZEAH 2IQ9L 4PJDB 4LLMA 5C09B 4KRMB 3I84A 4XBEL 3N85L 2SEBB 2P48B 2ORBL 4L3EB 4JG0H 4XP1H 3KPLB 4OZFB 4PJ7A 4YR6B 2W9EL 1UT9A 4XTRD 4XZUA 3U46B 1OD7A 1C16B 5CP3A 1GGCH 4Y4KC 4Z7UB 1HILA 5IW1A 4PJGB 3GB7A 4RAHA 3EYFA 4LBEA 5DUMH 3BPLB 3HFML 3FOLA 2BSRB 3MRKA 2PYEA 4QRPD 4GAGH 1P6AB 3OR7B 2UZIH 2CLVB 3M45A 2CO6B 1LP9E 43C9B 2NY6C 2KPNA 3BZDA 4XX1E 2WV3A 1JHTB 3AY4C 1MCLA 1KCSL 3Q48A 1QBAA 4K8RL 5D2LF 1PYWA 2JIXA 3MQIA 4EUPA 5GHWL 1LWRA 4N0RA 4X80L 1MHEA 2E9BA 4LSUL 1QR1A 4HKJB 2W0KA 1AQDA 3AU1A 3ZE1F 3K4AA 2YUZA 1SY6L 3E6FA 4HGKC 4KUCF 5HGHA 5IBTL 1A4JB 4PRHA 3AREB 4TVPL 3F7VB 1WQVT 4JM2D 4QHLB 3WEXA 3ARGD 4YBLC 2BSSB 1OF2A 4KTEH 1I8KB 4HAFA 4WEBH 3HI5H 2MOVA 3TO2B 1ZWIA 4PGDA 1NCBH 3ULSA 4G9FB 4YFDB 3P73B 1BBJB 1YEIH 4L4TD 1A47A 3L3IA 4K71B 5EO9A 4X6BA 5H2BA 1AE6L 1IEBB 1A1OB 3MUY1 2F74A 4XCFH 4YGVB 4G6KH 4M4RA 4R26L 3F5WA 4G8GA 1E4XH 4OLZH 4RMQA 3LB6C 2OJZL 3MRCA 4JFFB 4NWTL 3VFPB 4OM1H 4LCUB 5HYSB 2EEDA 4TVPE 1OAQL 2DQUH 5CKGA 2GUOB 5LBSL 1QSFA 3EOTH 5DHVB 2QQKL 4JDTH 2CXGA 4K71C 4P23A 5DQ9B 3OHXB 4AYFA 3W5NA 4XBPA 1OGTA 2Y36H 4LHUB 5D7JD 4LLAA 3JUZA 1I4FB 1NGYB 4U6YA 4OLWH 4KK9C 3TJEL 1TTGA 3K8KA 4OF7A 3C5ZA 3FMGH 3MGAA 4FXKB 1JHKH 3G6JA 3QDGB 3KHOA 4EKXA 2X41A 3V0VB 4F7EA 5DMJB 3FB5B 1G7JB 4IDJL 1LP9F 4GRMA 5SV3A 2BOCA 1WBZB 2J7LA 4M7ZC 4NRXA 3T2OA 5C2UB 3B6SA 5EZOH 3MO1A 1MAMH 1SY6H 2DQHL 4CVZB 3IKCB 5DVOA 4M48L 4NNYB 3LQAL 4GRWB 2FB4H 3RIFF 3ZTNL 4XXDA 5I1CL 4HIXH 3MLUH 5F9WB 4H8WH 3QDJD 4N8CH 2DM2A 2RCSL 3NIDE 1QZ1A 3OKEB 4QRRD 4KWUA 2ATKB 4PJIE 4MDJA 5KW9H 1IAIH 2VLJE 1Z2KA 3UPCA 3KPTA 3QEQB 3WFDH 4OD3L 1C5BL 5D1QC 2VZ3A 3O9WD 4XNYH 3BESR 1LE5A 2VJXA 5F7DB 2X4RB 3DHMA 2ZNWA 4NRYA 3IS0X 1FBIL 3EGSA 4ODVL 3S3SA 1AGCA 1INDL 2OZ4A 5FIEA 3O2DL 3RIFK 4AJ0A 5AWNL 3UJTL 5C0FB 3RNQB 3CJJA 3P30H 3RP1A 1F8TH 2NCMA 4JY6A 2IPUG 3OR6B 5BO1H 3VFUA 1GZPA 3ZKQD 3ARGA 2CDEA 4XB8A 5GIRB 1U8LB 4Z77B 4LRNL 2W60B 3MNWB 1U8KA 1WUNT 5FV1L 3HZVB 3KPSD 4PYGA 4LGRB 1HN1A 5IKCA 3H9SD 1KCKA 4YNYA 1QO3B 1KBGL 5F1IA 2NXZD 2YC1B 1AXSB 2K1MA 5HDLA 5CEZE 5DTFB 3GDBA 2GKIA 3K2MC 4LDOB 3CX2A 4M61A 3VGAB 3DGGA 2E7MA 5F88B 4K3DL 4LNVA 2GJ6D 4S1QL 1ORQB 2ESVE 4B5EA 2PXYD 1U8JA 5J89A 5I1GH 1QSEB 2HVKB 2P8LB 2EO9A 4ZUWA 3U36B 3ZHDA 5F7MC 4Y2DA 1D5IL 3UPRA 5ILTL 3L7FB 4O5LL 1MJ7H 3V4UH 1LEIA 2WUCH 4Y4HA 2LABA 3A6BL 5ENWB 2EZ0D 4PV9B 2O5XH 3PV6B 2R2EA 2EECA 1DANU 5EZIH 1MCPH 1C12B 5CEZL 1WT5A 1YPZA 4EN3B 3L6FB 1BAFH 1QNZL 2V2XB 5BO1L 4G5ZL 4MQ7A 5SWZD 1H3XA 5F7EL 4HMCA 4ZFZB 4DZ8A 4PJ9C 2LTQC 3SE3C 1D6EA 2B1AL 3BUYA 2PW2B 3SJVA 5I2IB 5CINL 3QDGD 3WDHA 4EI6A 3BJ91 4D0CA 3OKLB 1T04B 3UC0L 2ED7A 1MHPH 5E5UB 1U8KB 5CZXC 5C0AB 2FL5B 3MOAL 1Q72H 4K7FA 4AT6B 3VRJB 4J23A 3QISA 5DS8A 3QFJB 3WSQH 3GIZL 4JZNA 4R90H 2R0ZH 4YHPB 1A9BA 5D7KE 5MP6H 5DD5H 1RK1B 4KXZH 1GZPB 2Q7YA 4F2MA 5L7XH 3DVGA 4K7PX 3SGKA 2JE8A 4DAGH 5IM7B 3RVWC 5E6ID 3IKCA 2AGJH 3OTTA 4P2QD 3ZT7A 1TZHB 5C0FA 1HWHB 1ZMYA 3KPPA 2EDOA 2NY5H 5DT1L 3B5HA 2EYTB 4HMEA 4HWZA 4LOUC 4B0MM 5EULV 3PL6D 5E8EA 4F7EB 5IWLA 2OK0L 4JE4B 2Y07H 2PYFA 4P3CH 4FQXD 2CR6A 4V1DB 5L8KB 3QUMA 5D1ZD 1QD0A 4HIJB 2WLZA 4WWKD 3BIKB 3DV4A 4KK8D 3HRPA 5I8EA 5D96B 5EBGA 2G9HA 2MPAL 2CPCA 3GNMH 4ENEC 4ZFOA 5CMAB 3QUXA 2OS7A 3S36X 1QLEH 4EIZC 4HXBH 3GSWA 3NACH 3N0PB 2H3NB 3C9NB 4XH2A 4ZUUA 3O6KL 2YRZA 2G2RA 4KV5E 5HDBF 3WXWL 3VRIA 3QEHA 1AD0B 4KRNA 4X7SH 3DOSA 5EZIL 1ZVHA 3MNVA 4PLKC 4MB5A 1J86A 4JFXA 1T1YA 1VENA 3F8UB 3IDJA 4PJCB 4OCNC 5GGUB 1MCWW 5DHYB 4JN1L 4P2QE 4IOIB 4RMRA 5GS1C 5CWSB 3WDIA 3FB7A 2VDML 2YSSB 2CLRA 5EO0B 2NY0D 5BOPA 4HX1B 5E70A 1WC7A 5GGSB 3D5OF 3SDXA 1YNKL 3DURA 4PJ9A 4JO2H 1NLBH 2DD8L 1C8PA 3BZFA 2OSLB 1BJ8A 2CRYA 2DMKA 4M6ML 5DWUL 3EDJA 1OB1B 4KRLB 1NANI 4E42A 2VH5L 4ELKA 3T0XA 3BRFA 5ACLA 4XP6L 3D2UD 1ERNA 1PY4A 4RFOH 1MCKA 3MCKB 1IGJB 5KVMC 2YHGA 1PLGL 1R3JA 1X5YA 2V17L 3JV4B 4X5XB 4ZXBC 1QSZA 4KVCH 5HHMD 2ZUXA 5C86A 3PGCB 5IF0A 1MCOL 2NY2D 5TE4L 1DLFL 1AQDB 3W2DH 4C83B 1ES0B 3G6AB 4FQPA 2NY5L 1IGML 3CDYA 4QHKI 4XVTH 5LVEA 4JFEE 1KYOJ 1RIVL 1NMAL 3KXFE 4OZGA 4H8WC 4LVNC 1RZKL 1HKLH 5CZKA 3ARBC 1OF2B 3K8LA 5DD5L 5C0CD 2H6PB 1QKZL 3RX8A 3MRQB 2EC9U 4KRPD 4LVNB 4MQSB 3N1FC 5I30L 1DQDL 3RVVD 2BSRA 4XAWH 2AKRB 4U7SA 5CJBA 4RDQG 3H9ZA 3NCFB 4HLZH 3U7AA 3LS4L 3F58L 4GW5A 4AENB 1RHFA 3TVMA 3ARGC 1KJ2B 1A7OH 2WIMA 4X9IA 5AUMB 5IMOA 4FNLH 1KEMH 2BCKB 2PN5A 5J13B 1A21A 5C0RL 3FAWA 3U9PL 1RUMH 1GGIH 4OD3H 5IB1B 2VDLL 4PY7B 2X89A 3VDAA 1E28A 2M8XA 3FTGB 1UEMA 5DRZB 2ERJB 3FOLB 3FT2A 3PWVA 5A2LH 1LK3L 3FFCE 4HZLB 4E9LA 5MENB 4A2MA 4BQ9A 1M71B 4BK4A 1H8SA 4LSRH 5K9JH 5GGTH 4PY7A 2VXUL 3H0TB 1CD1A 2DRUA 3PXJA 2GT9B 3C60A 1V7NH 4I1NB 3WFEL 4OLUH 4PGCA 1IEAA 4UDUB 5DRNB 1A6AB 4ZS7H 4WV1B 2P1YA 4FTVE 5IIEB 5D93C 4JFZH 3RX5A 4HG4K 3X17A 4GG6E 4ELME 4KROB 4FQCH 2AVGA 4HFWA 1I7UB 1ZGLA 4HS3B 4UI2A 1J5OL 1KPUB 1DLHB 5EOQL 4UQ2B 1RZ8B 4K94C 4ALAH 3RWCA 3KPMB 1T1XA 4OQ1A 2ATPB 1H3TA 3O6MH 4K3EL 2HT4C 2DIJA 2P8PB 4HWUA 4S2SA 3I6KB 1T1XB 5DMIL 5J8OA 3FB6B 5I73B 5KSBA 4FXGA 3MR9B 5K9QI 1JV5A 4EUPG 2WUBH 2DQFB 1BM3L 4B7LA 3HNVH 1QFOA 2PO6B 1DQJB 3FFDA 3U9PH 1IAMA 1PJ9A 3VDBA 2AXHA 4F7MA 1FAIL 4OTXL 3PWUA 3V6FA 4HEME 4C83A 5FF6B 3VGDA 2VB5A 2DWDB 1D5ZB 3VFGH 1P7QA 3TWCH 5F3HB 1Q72L 2LU4A 4UAOB 2Z93A 3ULUC 4GAJH 1OPGH 4XPAL 1ROWA 3EJJX 4L1DA 4OZHF 5AZEH 3UZVB 1B9ZA 3RDTA 4KDVA 3EYUH 3X3FL 5C0CA 4LCWA 2MCPL 2XQYG 4LFHG 4JANB 1S7WA 1NFKA 1DBJH 5FYLH 1XGUB 5EH1A 3R8BB 1JCKA 2HFFB 2QSCH 2A9ML 2F19L 5TQ2H 5ALCL 4P4RA 4U1HB 4I4WB 3VFMA 2NXZB 2R1WA 5EOQH 4KKBC 4XXCC 3SKJL 3HRZB 5DVMA 5F7KC 4N0CD 1ZGLP 1PBYA 5D9SB 1VGKA 3FAXA 3CC5B 2IALB 3BPCB 1NL0L 3QDJB 3BH9A 3GUTA 1GOFA 3UZEA 3QNYA 4KHTH 5IOPB 4TSBH 4JFOA 4X83A 1FNEA 5JW3L 2YD3A 1Z9SA 3ARDB 3QA3B 3S35H 1CGWA 5GGRA 1QFWI 1W8OA 5JHDD 1U91A 2VOTA 2E7LA 4MJID 5CMAA 3ARDC 4PRIA 2Q86A 5C7XH 4O51A 1NAMH 1QRNE 4X7SL 4D9LH 3HC3L 1MOEA 4RQQB 3MRLA 1QFWH 3IFLL 1FCCA 1B2WL 3K74B 3P4NA 1A6TA 2PXYC 2JF1A 4GKZB 5J11C 4GSDL 5GRJH 2EKJA 2QSTA 1DVFD 3EOBA 4G42A 1OP3K 1GGCL 4AY0A 5K59E 3B8YA 5ITBL 2F53B 5MERA 2W0PA 1G1YA 4X98A 4XMKH 1HQRB 5J7CC 1N3NB 4XPFL 3L7EB 1MI5B 3GK8L 4QOKD 1KEGH 4L8SA 1N6QH 3O81A 2H41A 4RISH 1UVQB 5EN2B 1A1NB 1N59B 5I1LA 1CL7H 3W9DA 5I8EB 3O6ML 1MJJB 1T2QH 1D9KA 4TULL 1CVSC 4O2FB 2WWMD 1LD9A 1PQZB 4NC1C 4QRTA 2DI8A 5FFLA 1IARB 2PCPB 1H15A 2BNRA 1AGFB 3S96A 5FA3A 4X8XA 3RU8L 1KJMA 3OXRB 4ZXBA 1F3DJ 1ZLUH 4HPOH 4M3JA 5BV7C 1CLCA 5DR5L 1UB6B 1Y18B 5ESVA 1NMCB 4DKEH 1JWUB 1T04A 1L9NA 2H2SC 4OKVA 2CH8A 4ODXA 1FLRL 5EOCL 4X6EA 4YHZL 4JG1L 4B53A 2UV3A 4MJIB 3S4SB 5F72S 2IANB 4GAJL 4XPAH 1AD0A 4AEFA 1FO0H 5KSBE 3MROB 4QEGA 2IPTH 3EJZD 4LQ1A 4EQ3A 1TJHL 5HYJD 4FQ1H 2P7TA 3I6GA 3KJ4C 3T0VA 3T0EA 3HPJA 1PG7L 1YC8A 1DVFB 4IMKC 2JB6A 1EERB 3C09B 3RJQB 1JNJA 3VFOA 4N0CC 5TH2B 3TBWB 4BFIB 2MKLC 2KH2B 1U95B 3B2VL 4QNPE 3W9EA 3WL9B 1IQDA 1MLCB 5C07B 4WWKC 1G7HA 4FG6C 4G8IA 4JM2B 4JN2A 7CGTA 1MCNA 1DQDH 3LPWA 3L3HB 3WKMH 3T0BA 4QRPA 4R4BB 3O6FA 1VADA 1MH5B 1U8PA 2HRLA 5L9DL 2OTUB 1FYHB 2BHZA 1D5XA 3IFNH 4YDKL 2QV2A 4HC1A 1FLRH 4KQ4L 1LO3H 4EDWL 3BW9A 1IM9B 1QFHA 2ADGA 2UWEA 1RUAL 1JRHH 1CZ8L 3TA3C 4JHAH 2YUVA 5DMIH 5C0JB 5E2WH 3HNSL 2W60A 4MVBC 4QCIA 2I25N 3BI9X 3OWEA 5FHAL 2IPKB 1FIGL 4FABL 4GBXC 1YN6B 5J6HA 2Y25A 1NGZA 1NCAH 1CTNA 3EO1A 2DI7A 4Z0XB 5FUOL 2FSEA 1A8JH 4P9HH 1V3KA 3NACL 1KENL 1A7QH 4HBCH 1J7VR 5IW3A 2O26U 2M2DA 1J1PH 2JJSC 1ZVSA 2ITCA 2VXTH 2XA8L 5GS3A 1QBLH 2ATKA 4I48A 1XF5A 1IGFH 1GZQA 2XPGA 1HDMA 3G04A 4IHOB 3O0RL 2XTJD 2YKLL 4XP4H 1CICC 5GZOD 4PB9H 1FFNA 5HHXH 4S1SL 4GRLD 5FYLL 4PJAF 2YBRA 4PJ5B 3MLVH 3QQ9D 3JUYA 1UCTA 1DUZA 4IOFC 1JZ4A 2CKBA 3MGTA 1ZVYA 3IAQA 3ZKNC 3E2HC 5CLWA 5D72H 3NFSL 3EFFA 1CK0H 3EJYC 5EU6B 3FT3B 1IQDB 2R23A 4LRIC 3RZCB 4KHTL 4AH2B 4XNUH 2AXGA 4QF1A 5BVJA 4OKVB 1U3HD 3L3OB 4LHUD 2C1PA 2P5ED 3S3JA 3IDMA 4XHJC 1WAAE 3BGFC 4OCRL 5IBUB 2O5XL 2AW2A 4OLWL 5KAQG 3ARBB 5IHUH 1WZ1L 5DEZA 2W07A 1QSFB 1HYRC 5GSVB 1DN0A 1KC5L 1RZKH 4MJ2A 4MSWB 5CHNB 1N7MH 3SJVD 3EYUL 3X3FH 5GGSY 3W0WA 3DYMA 3M8OL 2GIYA 4NC2B 4R3SB 3JTSA 3MRCB 4JFFA 3WBDA 5FHAH 2NY3C 4X8JB 1UZ6F 1DL7H 4NRYB 4LPWA 1QRNA 3PV7A 5FYKH 3C6SA 4I9WD 1YYMH 1B90A 2EE2A 5FA3B 1DBAH 3T4AB 2PF6A 5MERB 3QUYA 1UXWA 1HHKB 3GI8H 2Z8VC 4P2CG 1NMBH 3FQRB 4FQIL 1W0YT 3OF6A 4HMDA 3N9GL 4R2GB 5MEQA 3FB8B 4RAVB 1LP9B 2HA1A 4NQEA 1UKQA 5T1KD 2OL3L 2YPLE 1WZMA 3STBA 1K8IA 1YECL 4CVZA 5CEXB 4UIKL 3VFPA 2VMFA 2A9NH 4RA0C 2I60L 3O4LB 3OAYK 5TJWK 2OXGA 3D3VE 1NKRA 2NZIA 1B0RB 3OX8A 2VISA 3MNZA 5C0IA 5GGRB 4PJGE 4X6BB 3WHXB 4L9LB 3J7HA 1VFAA 2OZ4H 5DJZA 4B50A 15C8L 2OM5A 2AEIT 4KJQC 4L3CB 3RVTD 4D3CH 4RQQA 3TN0C 3ULUF 4XP5L 1OM3L 4LCYB 1KGCD 3UPAA 4M93C 4X4YB 5D8JH 2A74B 2XWJB 32C2A 4ZS6D 1R3KA 1W72L 4JKWA 3RNKB 3E6FB 4UOW1 3T3MF 4M5YH 3TH2T 1XF3B 4X6DA 1R3IL 5IOPA 1JP5A 4F7CB 4QRUB 4PS4H 5KW9L 1ZHBB 4BH7A 3B2UC 1JK8B 1VFOA 3QWQB 2OP4L 3R0MA 1HZHL 5DD0H 4WIQA 1E6JL 3B9EA 2CLVA 1WEJH 2WINB 5H8DA 4YFLI 2AJUL 1K4DB 5FHBL 3T65B 4J12A 1FYTE 1Z5LA 2EH8L 2H26A 3OKNB 2FO1A 1R3HB 4PP1C 4HUXB 4MXQD 5CGTA 3ARFB 1TTUA 4JY5H 1I8KA 4G6AC 1JGEA 2VITA 1P53A 5HHOD 3BGAA 4FTVA 4JDVA 5JOPD 5T3XE 4S0SD 3ARFC 4NHUB 1IGCH 4UB0H 4LPTA 2APVA 2X4TA 4FP8L 3GSUB 4XTRC 5JHLH 5EIIB 5C6PB 4LPCA 4HIEB 5HHVH 5EIQA 3WIIL 1G7PA 1CDCA 4OQTH 4QXTA 3VXMA 4HF5L 2WBKA 1M05A 1CE6B 1W72H 2WK2A 4G6KL 3ZKSD 4ZTPH 3ZZ1A 3NPSC 3JSSA 5HY9B 4FXGB 3HB3D 3QUXC 2FECI 1XZ0A 3B4NA 1G7PB 5TF1H 2R1YB 4NPYB 4PS4L 5A16A 1I7RA 1NLDL 4OI8A 1IGFL 1RJLA 3EOAA 3M1BA 5T3XL 4YDJA 3UBXG 5IK3B 3VU2A 3BD4A 1B0GA 3KG5A 2QADC 4P23C 5A43C 5JXAH 4RCAA 1RJYA 3A0OA 2XN9E 43CAA 2Z4QA 3BKML 4HJ0D 3FTGA 4NFCA 3W2DL 1A9EA 1XFPA 2EDNA 5J11B 2H26B 2AJXL 5FUCE 2W92A 3BQUB 4WUUE 1UADC 3CSGA 2ZUQC 3NGBB 4QRUA 3EDFA 4OCYL 1CD1B 5JLZB 3CSBA 3C6LC 4FTVB 2F9BT 5C6TL 1F6AB 4N9GA 2X4UB 2D03L 1T2JA 1EO5A 1XIWC 4EDXB 4OIIL 3VWKB 2ICEA 1CFTB 1P1ZA 3SQOH 5BV7B 1CR9H 4JLRB 1HQ4A 3MA9L 1VGEL 1U6AH 4Y1AE 2C5DC 5HDQH 2BP3A 3GSNH 4JEGB 1YEEL 3QQ4A 1DCLA 4UTBL 1EVTC 3QDGE 1NGPL 2OQJB 3MLRL 3NABL 1KB9J 1Y6MR 1N7ML 4MMXC 1K8DA 5DK3A 4OZGB 3WFEH 1NSNH 4XWGL 5CD3B 2HTLC 3MLXH 1W72A 4NZUL 4OUUB 3HNVL 5E8NB 4TQEH 5DGRA 5SX5K 1DE4A 4ODVH 4HCRA 4WTZA 2I07B 5EZOL 4WO4B 1OOAA 1ZLVH 4GKOA 4KRPB 2D3VA 1ZEAL 4RFNC 3VFWB 1X5XA 1W0WA 4OGAC 3ULVE 1DQQB 3ELAT 1GVIA 2FEDC 2FATL 4LVOC 5EZLB 1FPTL 5FM8A 3HUJF 5F8QC 2K3TA 4YGAB 3WFHB 3INUH 1IRAY 4LPUA 1DFBH 1LQSR 2E5EA 3SGJA 1YC7A 1TJIL 3HAEH 1J11A 4G8GE 5JW4R 4XP9H 5E0QA 4ZPVB 2IQ9H 4JKMA 3QIUA 4X5XA 4ORGA 1WBYB 5DQDL 4DW2H 4YBLB 3X13B 2Y06L 4JAMB 4NQXA 1MEXH 1ZHNA 4G6ML 5D7IE 4Q2ZA 1X5JA 3MRFA 2ILLA 3ULVL 1RZFL 4JJ5B 1Q94B 3D85D 3WV0A 1MIML 3HE6D 3CZFA 4C54A 1X5GA 1P7HL 2XN9D 4ETYA 3SOBL 3TVMD 5TQ0H 5JUEL 3RVWD 2VLKA 5ID1B 4ZFOB 3QIWA 3C6SB 3IFOA 4HZAA 3LRHA 3PHOA 2YSSA 3SPVA 5BS0B 1SYVB 1PW3A 3IDMB 4XT1C 4R3SA 3VXOA 2ARJQ 5IWLC 4KPHL 2AJSL 3GBLA 4H1LG 1R5IA 3MNVB 2M1KA 4OT1H 4OLEA 5D7IA 2VDQL 4KZEH 1WICA 2B1AH 2X89D 3RVUC 2Q3AA 4JFXB 1RV6X 4U1IA 5HHMB 1N26A 4CN6A 2FGZA 3P77B 2ZP0T 5CGMA 5MHSD 3WUZA 1Z0MA 3L95B 3JV5A 4P49A 12E8H 4M43H 1XIWA 4OSUH 2VKXA 1GOGA 4KVCL 1ZLWH 1V5JA 1QPXA 1KLGB 2B1HL 3L3OA 4WI5A 2HKHH 4RAUA 2IBGA 1F4AA 1IGMH 2PYFB 3BIKA 4XVTL 1XF5B 2XTJB 3OAZK 5JOPE 1T03L 2J8HA 2HTLD 1AO7A 4S1QH 4PJAA 4P9MH 2QHLA 3K2UH 4FFZL 3HR5A 5IEHA 4P3DA 1MIMH 3MLWL 5CJOL 3M17A 1H5BA 4QHMB 5D1QA 1Z9OA 3Q2CA 3IKKA 4EUPH 5KSAC 3MRGA 4PBWD 1A6VL 4Z0XA 1RK1A 1EK3A 4KPHH 3TBYB 1PD6A 1T22A 3GJEB 1MSPA 4OIBA 4JRYD 5E8OA 3NCYS 1C08A 4JY4A 1CGSH 4TVPD 3CXDL 2C3GA 3C8KB 1GJIA 2QL1A 4R2GD 5D7IF 3CFEA 4BQBA 5FCUH 4NYLB 5H35B 4E5XA 3BZ4A 3QCTH 4A6YH 1J87A 1WITA 3UDWA 1CDUA 3F65A 5FDWB 1AGEA 4NKDB 4UQ3A 1SJEA 5JIHA 4D0CB 5AWNH 3UJTH 4LKCB 2DYPD 5IV2B 1DBMH 4M48H 5IVOA 2FWOB 1MCIA 2ADFH 1VADB 4K8RD 4KI5C 4PFEA 3WXWH 3B5GA 1UZ8B 4HIIA 5ANME 4FP8H 4NSKB 5L2JB 2B39A 3BEWA 3TPUA 3ES6B 5FO8A 4NQCE 3GHEL 1HH9B 4J3XA 3WS6C 4PJ5D 1LDSA 3KLHD 1G7HB 4ZSOB 1HHJB 1I1AA 1HEZA 1OQOA 5DMYA 1S7UB 5LXGL 3HMXH 3TIEA 3OKOA 3SKMB 1AFVL 1WT5C 1TVBA 1AXSA 3HPJB 3D3VB 1QLFB 3IVKA 3IAPA 1NC2D 2ZG2A 3ORJA 1CCZA 4M7JH 1MJUH 1DUYB 4ERSL 1XIWB 4U6XB 3DI3B 4QGYA 3MNWA 4P46D 2CJUL 3DX9A 2LAGB 5E1HB 5ITFB 3DGGB 1FL3A 4PPTA 5FCUL 5BRZB 4FFVC 1BVKB 4YDIL 4MLSA 3ZE2F 4FOMA 1UGNA 3VXOB 3EGSB 2AJZB 4KKNA 3SPVB 3CLEH 4PUBL 3CFEB 3OXRA 4JGUA 1RJZA 4TTDC 5I74B 2YUWA 3SKJH 1HNGA 5GIRA 5E8OB 4Z77A 2NY1D 1RUAH 2F8OA 3H7BA 1RSFA 4TNVK 4LEXH 3QT2A 4JFQA 4K3DH 1FDLH 1NBYB 4ONFL 1PKQB 2DM7A 5KS9E 2P8MA 3DARA 3EYSL 4P5MB 5GISL 4I18C 4MWFB 3TBVB 1QSED 2F58H 4EXPX 1AGCB 3U6RB 2J5LC 2WUCL 4G43A 2FD6L 1T0NA 3NIFF 5EBMA 3CSYB 4OCLC 2AEPL 3C5ZC 3EOBB 4G42B 4Z0BH 1S9YA 4HC1L 4LSVL 1PAMA 1NL0H 3HN3A 2CDFB 3C5ZB 5DF0A 3DVFA 1YEJL 4J3TA 2KKQA 5DEFB 1T1WA 2B8OT 5EN2A 4N9OB 5IR1B 3LKNA 1YYLH 2WLYA 1P4BL 4IRJD 5EU7C 4YHLL 1JBJA 2XZQL 3AFLA 3HB3C 3HNTL 4H1LH 1QQDA 3BEVA 5TE4H 5F6IB 4NCC1 3WN5C 3IXAB 2MKWA 5FM5O 4PJBF 1H5BC 2ZCHL 1BX2B 1EBAA 4P4KD 2BVEA 5E8NA 4U1NB 4XNXL 2ZNXA 4JM2F 5C0AD 4NZRL 4X6FA 2FYYA 1VPOL 5E2VH 4G9DA 4RGMB 1OAUL 3LKSA 4IRSB 1UCBL 4M1CD 3MRLB 3L5JA 4FQ1L 2QADB 4P23B 4XPFH 2IG2L 3P9WB 4DAGL 1BWMA 2AI0H 3KPNB 3MV9E 5H2BB 4E41E 2B7DT 3NAAH 3ZHLA 1TETL 3LH2H 5DRXA 4F15B 3EHBC 4XHJD 2Q76A 5TE7L 5C9JA 2GW5A 3BIAX 3LRSA 4XCEB 4Z0BL 1X5LA 4Y16C 1VEOA 5D9SA 5I66B 1U3YA 4AIZB 1TQCC 1ZANL 1MVFA 1C5BH 4UIMB 2VLLA 1IZJA 2NX5B 3UYPA 1IAIL 2GJJA 4I3SL 2F74B 3RKDC 1HWGB 2AV7B 3QPQC 3DROB 2ESVB 1YQVL 4OGYH 2X4OB 3KYOA 1KN4H 5EO9B 4JFFE 3TO2A 1WFOA 4BFBD 2DL9A 1KIQB 9CGTA 3BSZL 2BSSA 4MB4A 3RDTB 2NNAB 2HJLA 4Q7DA 1FZOB 5FM5M 1NBVL 4GQPH 5ABDE 4LCCA 4HPYH 5IK3A 1NC4A 4JRXB 5SV4A 4X5WA 1E0OB 2R0KL 2OL3B 1QYGH 2V5MA 3MRPB 5GXBB 3ZYJA 3O8XA 4B7IA 3WFBL 1C5CL 4O2EA 1I7RB 4G7VL 4HS8H 1I7ZA 1L9MA 2HKFH 2LE9A 1BOGB 1DE4B 2CSPA 2BZDA 4GMSH 1RZJH 3S97C 4LCWE 3NH7H 1HILB 1MIEL 3S5LG 4EDWH 5JZ7C 2P5EB 5HYJA 1K3IA 5J4MA 5DVNA 5ISZB 1K8DB 5F7YC 2Q20A 5LGHL 3VXUB 1FE8L 3ZMRA 1V7ML 1ZT1B 3QXAA 1NFIB 2B5IC 3PQYE 3O3AA 1A5FH 4X7TA 4JFHE 2NX5E 1A9EB 4MNQA 5HDBE 4GW1A 1NPUA 2VLJB 3TV3H 3TCXA 3W0WD 5HGDA 2Q3ZA 4FXLA 1I8MB 4QHNB 4J3SA 4LLQA 4N9GB 1M7DA 5B38A 3NIGE 4P2YA 3OMZA 3EOAB 3M1BB 15C8H 4Y5XC 1IC5H 3CGTA 3SE4A 1U3HA 1FH5H 1JPFA 1XZ0B 5I8KL 1JRHL 2SEBA 2BDNL 4O4YH 2P5EA 5HYJB 3LKRA 3RGVB 1DR9A 3QFJD 1J8HD 4P48A 4Z7UE 1S5IH 4LDLB 3RWEB 1G7QA 2Y6SC 4A6YL 2G75A 1DSFL 4M4PA 4POZD 4KV5F 4QOKA 5B22A 4ELMA 5E99L 1RJYB 5DRZA 4Z95H 4NJAH 1E28B 4BZ2L 4ZAKD 4O2EB 2XICA 4PB0L 5DC4B 2CQVA 1RZJL 1IVLA 1W0VB 1JF1B 4MXQC 3UTQB 3MBEC 5JMRA 1TVHB 3MRMB 5T1DH 3DETC 3O8XB 1FZOA 2R1YA 4NPYA 3MBEB 7FABH 3IDNB 3DX8A 4ZUTB 3KDMB 3QI9D 4LLYA 3SEPA 3VXRD 3TGXA 2QQQA 4QXGL 3MV8A 1WBXA 3DROA 5DUML 1I7ZB 4NKIH 5DR5H 2XN9B 1EUTA 2ZPKL 3FCTB 5IBUG 1BJ1J 3MV8E 2V9TA 3CCHA 4AIZA 1FG2A 4C4KT 3BT2L 5EIIA 3HS0A 2YPVL 3DBXB 5GS2H 5CEXA 5FO9B 4U1LB 2Y07L 3W11C 4PIRF 2YA0A 1XGTA 1XH3A 1FFOA 2IFGA 2OSLA 4MVBD 3FB8A 1T21A 1TZIA 4G9FE 4LSPH 2QTEA 4NRZA 2XWBA 3ARQA 5KSAD 2NXYC 4S1DC 2FO4A 2GK0B 5L0QC 5EO0A 3O2DH 2FDBP 2FJGB 1R24A 5DZNA 2FBJH 5CWSA 3SDXB 3U9UB 3M07A 4IRSA 4F7PA 1DN2A 5C0ND 2JJSA 3MCKA 4EVNB 5E03A 5D7JB 3UBXI 3RY4A 1AGBB 4L5FH 2VXVL 4NOFA 4WI6A 1UB5A 1CG9B 3L3KA 3SKNA 4HW6A 2VL4A 3ILPA 1UCBH 3WCYA 5HPMB 2CDGA 4HUMB 4LPYA 1LDPL 1RUKL 2A9NL 1K4CA 2DLTA 3BKCH 5DUPL 2YD6A 5EU5A 1X5IA 2NY4C 4KDTA 2I9TA 2NY4D 5TDPA 3LKNB 2A74A 4HX1A 1I9EA 2XWJA 32C2B 4LSTH 4HEPG 4HKZB 2X09A 3T8XA 4U1JA 1K8IB 5BS0E 1EGJA 1WWBX 3ZKMC 3OKDB 2B4CC 1BQSA 3TBSA 2UYLB 3P4MB 3RZCD 2FR4B 4H88H 4D8PB 1BX2A 3KLHC 1VCAA 4YQXL 4WFEE 3IXAA 3V7AE 3FT3A 1JPTL 2V5TA 1HI6B 1I1FB 1UJTA 2AEQL 3SDYL 1IM3A 4PREB 1FIGH 4FABH 5LGJB 4UOJA 4MAYC 2P46B 2QSCL 3SCMA 5F1OB 1WLHA 4KUZL 4JHBA 2NR6C 2VXVH 4I0PD 2V7HA 1T6WA 3I6LD 4KK9D 5INCA 2CDFA 4YHPA 4I13B 3FO1A 1LNUA 3FQRA 1WZLA 2W9DH 4BK5A 1HHKA 2C26A 2ZJSH 5EU4A 3DTXB 5M94B 3BKYH 1ZVSB 5JORA 3KPPB 4YIQA 2F54D 1K5NA 2VNCA 2WW8A 1EXUB 4PY8J 3PQYD 3ILQD 1KCRH 1NBQA 1EHLH 3RHWF 4Z78A 4WTXA 3BKJH 3HZMB 2BNQE 1KG0B 1L7TH 1V7MH 3RRQA 1RURH 3EO9H 1N8ZA 3VH8B 1DVFC 5IMLB 3MGTB 4Y5VB 1RJZB 3VE0B 3QNZB 3L3DB 4PG2A 2YA2A 1TVBB 1VACB 4LEOB 3C08L 3ABZA 1XT5A 3WE6B 4CN1A 1V8HA 5C0BE 4K2UL 5C0CE 3SE9H 1WZ1H 4L8SC 3U4AA 1KYOK 1I8LA 2L4OA 4Q9RH 2PW2A 1H3PL 2HJFB 3KXFD 1BVLA 1BGXH 1MVUA 4EI5B 1CICA 4LRNH 4FFYH 3QUML 3TN0D 4PGJA 1CFBA 4RBPH 1H0DA 2VDOH 3P0YL 2PYED 4HIIB 3V8CA 3SBWA 1FVCA 1NC2B 5HHME 1BQHA 3T1FA 3MUGB 1J5OH 5C8JB 3BZ4B 4NQVB 4ZDHA 4WUUB 3NZHL 4CW1A 4Q9CA 5SX4I 1VACA 3QNXB 4Z7VE 2XZAL 5HDOA 3OKMB 4WU7A 2X42A 1AI1L 3RWHA 1OP5K 3QEUA 3KYNA 4KJYB 4U2ZA 1U41A 3EJYD 5GRUH 4OJFL 4WU7B 4NNXB 4J6RH 3KPRD 2ICWJ 4JR9H 5D1XC 1MQKL 5T1LA 3TBYA 1OCWH 3PWLA 1OGAB 4QTHB 2NY5C 3CH1B 4U6HA 2C7UA 4XCCL 5DA4A 3AUVA 3LN5A 4UNVA 5DURD 4R96B 2VDKL 3ESVF 3U30C 3MLZH 1CDBA 1P4BH 1H0DB 2VR5A 4U1SA 5F1IB 1CVRA 3QEQA 5KVFL 4JQVC 5HDQL 5EO1A 3VJ6A 2HT2C 2A2QT 4FFWD 4DGVH 2HT2D 4FFWC 3SDDA 2W9DL 1AO7B 2YZ8A 1B88A 3WIHA 1G9NC 3OR6A 3WE6A 2JB6B 3ZDYF 4KI1A 3LV3A 1X3DA 2XKSA 5D1QB 1AE6H 3NFNB 1KXQE 1KBGH 5FKPA 3O6FB 3SCMB 4JFFD 2NTSP 2BOCB 2D9QB 1YEEH 3IETA 3QQ3B 3PHSA 4D9QE 3BO8A 1LO4L 5F1SA 3TBTB 1TQCB 4P5TB 2R4SL 2IANA 2DQUL 2J8UE 4U1IB 1I8IA 3C2AL 3OGCA 4QRSB 5FK9A 4M1GL 3CU7A 5IROC 3DMMA 4WTZG 4ORZC 5IVXA 3MXWH 4OZ4A 1JI1A 3MUJA 5MEOB 2QSVA 1YMME 4I3SH 3LN4B 2WQ8A 2AK4A 2Z8WC 2VR4A 3UMTA 1NCNA 3WNLA 5DQJA 2IQAB 1FFPA 5D2NA 4XC1L 1KXVC 4Z7OE 2V5YA 3MJ7A 4DGVL 3FO1B 4YHOL 5IHZB 2MWCA 4FMKA 1MJJA 4LEXL 4ACPA 5HYSA 1UM4L 3KYAA 4L4VD 1RUML 2YKLH 4HKXA 3N1PC 4JRXD 1FGVH 4UBDD 1I4FA 2DLFL 3HRZA 1X5ZA 3L3IB 4CL7A 3OHXA 3DWTA 4Y7MA 5IQ7L 5F93C 1KIPA 3VI4F 3O2VH 1XGUA 3AS2A 3IJSB 3GGWB 3QWOA 4HH9A 4CJ0A 2R4RH 3V6OA 5EC1B 4H8WL 4TN9A 4JG0L 1DQQA 5AG9A 2A0LD 2RGSA 2IGFH 2PW1A 4NZJA 5B8CA 4JAMA 1E4WH 1KGCE 5FO7B 1NBZA 5L7XL 3BMWA 3FO2A 5E5MA 1UQSB 1E6JH 1NCUA 3LKOA 4C56A 4IJ3C 3D1MC 4POYA 4CVWA 3CCHB 1IEBA 4XMPH 5T3ZE 2DWDA 2XFXA 3H6JA 1G6RH 4I3RH 3F7YA 5T3ZD 5K9QG 4YUEL 4N8CL 3NZ8B 1CXEA 4QLRA 3UCRA 3P0VH 1A6TB 3PWJB 3IGAA 3RWDA 4PJAE 1KB5B 1H3VA 2WWKT 1I7TB 2GHWB 2VDNH 5F6HJ 1TQBB 4ZNEA 3ZDXF 5D1ZA 4NWUH 2FGWL 3A6CH 1KTLB 4OQTA 4MD0B 1HQ4B 2C4FT 4R0LA 8FABB 1J12A 4LAQL 1SBSH 2P5WD 1U36A 3FRPA 2RJMA 5E8DL 1S7QB 5I74C 1INDH 3W39A 4ZTOH 1CD8A 4Y19D 4PGBB 5K9KB 1O0VA 4GXUN 1OWWA 5CD3A 3TWCL 4HFWB 1UWGH 3QDJA 1ONQA 2DTSA 5IIEA 3TYFA 1ZOXA 3BGMA 4O2CB 1JPGA 3LKRB 3IU3B 3RGVA 2V7NB 3PNWB 5ADOL 3KPLA 5D2NC 2X7LA 4FQ2H 1AQKH 1WBXB 5I1GL 3MV8B 5CP3H 3FOMB 1T20B 2BSTB 1YNTB 4KUCD 1A2YB 2A6JB 2A6IA 4OV5A 1ZS8B 1TZGH 1VGEH 5EORL 1DQJA 3ECBA 2C1OA 2R0WH 3FFDB 1F6AA 4UTAL 4PBVC 1ZHLB 1JV5B 3RWIA 3EHBD 1C16A 3WJLA 3QULA 1KCUL 2P5WA 5BMFH 3MMEA 3QDJE 3WFZA 3DSFL 3ARSA 4R4FH 1YUHB 4RMWA 1INQA 2DQDL 1ZT1A 4Y16D 2F5AL 3I02B 3UJIL 4ZS6C 1NCAL 4BFGA 4I2XE 2EH7H 3TJHC 5DJDB 2WANA 2E9IA 3CFDA 4LCIH 4ENED 3HMXL 3H3PH 4DUVA 2NMSA 3QIUD 3V4UL 3PWUB 4GKNB 3MGOA 4Z7OF 2VXSH 4WV1A 2P24B 1INQB 4QT5A 2DQCL 2QKIA 2PTTA 5JNYA 4QXTB 1MI5D 4YDJB 3VMNA 5GGTL 1PZ5A 5CS7A 2IADA 2W0LA 3P0VL 2ZUTA 4HIEA 3U30B 5KZCB 1UWGL 1RZFH 4JFPA 4G8FA 4QKXB 4JRYE 1FCGA 1KTDA 5CIPB 1JGDB 2J3SA 2P44B 1TCRA 3C60C 4UT9H 3NCEB 1F2XK 1D7FA 2Q8AL 5HYEA 4MJ4A 4RWYL 3WJLC 1R3HA 2DQEH 1N6QL 1S7VB 1QEWA 2ESVA 1FRGH 1N2RA 4EOWH 1YY8A 3X12A 3JV4A 2FEDD 1GXEA 2Z31B 5DRWB 4J6RL 1JK8A 3LEYL 4M7KH 4L8DB 1P84K 1JPGB 5AYUH 5K9KA 1HZHH 1JNNH 3I2CH 3WO3B 5ID0B 5JHLL 5I0DA 3IDXH 2HYMA 1A3RH 3ARWA 1V3MA 1NANH 3ZO0A 1FVEB 3JTTA 3GIVA 5DRXB 1J1OL 5DFVC 3ZT5A 3FRPG 2VL5B 3U1SL 4XC1H 4WHYG 1OT2A 3W81A 3TJEH 2KZ1B 4DGYL 1NC4B 4DW2L 4XBEH 3FO0H 3E6HA 3V6OC 3PWJA 5EU6D 1JPSL 4OLXH 3GO1H 5MHSE 3FB7B 2HJLB 1AP2B 3THML 2CMRL 3OKKA 3WS6A 4EZMA 5SWQA 4OBSA 4QRRA 4Q9QL 4KRPC 5IP4A 1T1YB 4Y4HD 3T2PA 2X4OA 1WSST 3F7YB 3TNNA 4ZODA 3OJVC 1ZLSH 2XFXB 2DM3A 4Z6AT 3V6BR 5CJ5A 4XGZA 5TDNB 2GFBB 2H3NA 3C9NA 3GSWB 3QDAA 1UH2A 1C7SA 4BSVB 3AXLB 2ZSWB 3EIFA 2GSGA 2WNGA 3S7GA 3OG4B 4P2RE 1U8IB 1T89A 5FOBA 2CRMA 4P9ML 4DZBA 4PGZA 3DURB 5CBAB 5DC9B 4Y4KD 3MOBL 4HWZB 4MCZA 1KNOA 3SQOL 1DBML 2EYTA 2WSKA 4N8VG 4BQ8A 3L1OH 4IOIA 5L6YL 1IEHA 1S7RB 1SM3H 1KV3A 4L4JA 2YD2A 3TBVA 2FX9L 3QUZB 3VXPB 1LE9B 4KMTH 2MTPA 5DJ8A 3DI2B 1BFSA 3JTSB 4YC2B 1N0XL 4JGJA 4KTDH 3ARBA 1N5YL 1PEZA 3AMLA 3PE9A 5HYQB 4Y5XB 4LSPL 2PXYA 3KHQA 1M7IA 4F8TA 5GGSA 1NCDH 5C0AA 5IJKA 1IL1A 1WFTA 3JXAA 5IVXB 5DEGB 5KN5B 1R5VA 2MHAA 2VKWA 2XZZA 5JPMA 5F1KC 2DD8H 1CXKA 1QBBA 4OJFH 4LSDA 3NFPB 3O45B 3TBTA 1AI1H 1DN0B 4GG8B 3V6ZB 1U8NB 4O58L 1BQLH 4WEMB 4ZFZA 4W4OA 3GFUA 1INEL 2ADJB 3U6RA 2C3WA 4X6DE 4HS8L 4TUOB 3UTPD 3B43A 1JUFB 3KYKH 1CU4H 5I8OL 3QCVH 2HFEA 2G60L 4ZOAA 2H32B 2RFXA 3RZCA 1NEZB 1EZVX 2EEAA 1AO7D 4LSSL 5EU6A 1RK0B 1JPSH 4NKMB 4OLXL 2DYPA 4P4KC 2E6QA 3MRJB 4JZJA 4K7PH 3K8MA 4NSKA 3LQAC 2OR7A 1K3ZA 4XX1G 4Q0XL 5F88A 2E9JA 2RAMA 3GMLA 4NM8H 1RIUH 1U8QA 3BP4A 4UNUA 5F9WC 3QJHA 5J9PA 4W81A 2VLKE 2BX5A 4AQOA 5JA9A 3P3YA 5D7JC 3GBNL 1BF2A 4MCYA 4TRPH 1FFRA 5KVGH 4XC3H 3UYRH 1IM9D 5FUZH 4U6XA 4XP1L 1GIGH 1CLOH 2A1WH 4LVHB 1C12A 3UO1H 3BE1H 3GMRB 1A3QA 4ZDHB 4CW1B 4JO4H 3T77A 2VC2H 3TV3L 1U0QA 2ADGB 1F4WH 4MCYB 1BQLL 3X14B 2EIBA 5GS0H 1N64H 4BUHA 3RFZC 1G0DA 4QRPB 1T0MB 1NGZB 1YJDL 4BUGA 4JCLA 4EI6B 3TO4A 2RR3A 2ARJB 3DUUA 5GS1B 1JWMB 4PJ7E 1HHHA 2G60H 1I85C 3ARYA 3CUPB 2FNBA 4BQ6A 2A0LC 3SKOA 3AC0A 4NC0B 3TFKC 3IU4L 4PLNC 3L6FA 3CFJB 1X5HA 1SEQL 5C6TH 5DMGC 5DFWH 4K8RH 4OCYH 4PRPA 4NKDA 3KWWA 3UJJH 2FRGP 5ADPH 1KF9B 2XY1A 2D2OA 2HFEB 4H25A 1YYLL 4MDIB 4ZO9A 1IC4H 4AIXA 2QBWA 4W68A 4XVUD 4NYLA 2YD8A 4Y2DB 1IKFL 2V9RA 4MQXC 5HVFB 3UPRB 4G7YH 4MXWH 5D5ME 4GG6F 1EZVY 4U2YA 3VXSB 4YPGB 2VAAA 1DJSA 3Q3GA 5K9OB 4APQC 3MROA 3VE0A 4DFIA 3GSOA 5E4EC 1FG9C 1RUQL 2KBGA 5L88H 1EBPA 5J57B 1NFDA 2X4QB 4PJXA 1TXKA 5F21B 3RI5F 3TBWA 4GOSA 4BFIA 5I1JH 3G6JB 3QDGA 3WXVL 1IBGL 1X4XA 2H1PH 4RGOH 2XY2A 4M6OL 4Y1AA 1GC1L 4OI7A 3A67L 2VLRB 1AHWB 5JIPA 4YIQB 1IAII 5E7BA 2ADIA 5DD6B 4IOFD 4XBPB 4MDIA 4OFDA 5I71C 4MDJB 5HI5D 1LNUB 5FGRA 5IJKC 1IGYA 5F71A 1URLA 3MRBB 4I18A 3NFSH 3WIHH 2FGWH 3QUZD 4XXDB 5EBWA 4GAYA 4NN5B 3CX5K 2V17H 1MFCL 3NIDF 3JWOL 3DUUB 5GS1A 2W1NA 4POZC 3MACL 1LE5B 3IDGA 4GRMB 2K7QA 4GKSB 1T0MA 1BF8A 4JFEB 4LOUD 3FO0L 1FL5B 3KJ4B 1QHPA 5TDOB 4F7TA 2OR9H 5HVWA 3C8DA 3N1QC 1BEYL 3QJFA 5LGHH 2CKBH 4OFKA 1ZAGA 3SDCD 3R06B 1RVFL 4UINL 4ZS7L 5ICZA 2FECL 4AMKL 5CUSL 2R56L 3SDAA 3D87B 3QA3A 3S9DB 1CDHA 3HKFA 2BMKB 4KJWC 3AS0A 6CGTA 2IAND 2FB4L 1F3JB 3QNYB 3ZTNH 4CRPA 2Y7QB 3HUJE 2Q8BL 3BPCA 1QACA 4EVNA 3QHTC 1JFQL 3BH9B 3T08A 3GUTB 1UM4H 4DK6A 2XNAA 4X4ZA 3SGKC 1JRHI 3HMWH 2AQ1A 2BRRH 5DQ9A 5A2FA 4U1HA 4XVJH 1XR9A 1A64A 3HPLB 3KR3H 2VN4A 2P5EE 2Y72A 3MV9D 4WHTA 4H20L 1JGLL 4ZQKA 3HCVB 3VXTB 2EIDA 4LCWB 3TA3B 5T1DL 1JNLH 3CMOL 1KLUA 2X4PA 2HH0L 4RSVA 1FN4B 2X4SA 3FQXB 3WDJA 5H37G 3MJ9L 1P9MC 4I4WA 4TTGA 1L6XA 3QXDA 1FZMB 1U8MA 3QYCA 2NY2C 2YN3A 4H26A 1Y0LB 1Q8MA 3CPLA 2B2XL 5ALCH 2PO6A 4KXZI 1P4IH 4R9HA 4CDGC 4LLYB 4P2OB 1ZWIB 3LQZB 4PGDB 4ZYKB 2BFVL 5K33A 2E8ZA 4ETQB 3DX8B 3LKQA 4LF3A 3N50A 4UDTB 1B0GB 1KPVA 4KDTC 1IKNA 4YX2H 3O6FC 3EO9L 4RDQF 1FO0A 3AB0B 4M1CC 2ATPA 5F96H 4D0BA 2QR0B 5AZEL 4K3JH 4NKQB 5INDA 4QOKB 4LLUA 3VD3A 4DCQB 3KPMA 1T66D 5IG7B 3IJHB 2W65B 4ZOEA 3Q5TA 3L9RA 1CL7I 3GB7B 4PJGA 5FYKE 4F7MB 3KR3L 4G8EA 2E27H 4FS0A 5LG1A 1MHEB 4YAQA 4XWOC 3U79A 2ICCA 4JPKL 4KC3B 2BC4B 4FZ8H 3I02A 4RRPG 3U4BL 4L3EA 2CKNA 3I6KA 4MNQD 1YY9C 3MV7D 4R8WH 3SDCC 4AK1A 4RGNB 5CZVL 1P5UA 1U8IA 3CVIL 5DUPH 4JB9H 3TN0A 3MBXH 1HINL 3AXLA 4UQ2A 3MLSH 1MCEA 1T20A 3KVQA 2BK8A 4HF5H 4QHNA 5TDNA 1I9RH 1G84A 3QI9A 1YNTA 4U1GB 4Q9BA 4MD5A 1NFIA 2X2YA 3QO0B 3HHRB 3GJFA 3CVHB 5GRUL 1MNUH 1EEYA 2YS4A 1HHGB 4O9HH 5ISZA 3PNWA 4YC2C 5I1AA 2GTWB 4NHCL 3TYFB 4TOYH 3GHBL 2GITB 3FQTB 1F4WL 3EYOB 5C0RH 4X6CB 3RU8H 1MCWM 4NGHH 5BZWA 3SDXF 5D2LA 4PR5A 1EO8H 4G7VH 2MMXA 2AKRA 1NUGA 5DLML 3FT2B 1TENA 3TH4T 1X4YA 4Q58C 2R1XA 5IB3B 1AIFA 2X4TB 5IJVB 1UWXK 4H1LB 4HGWA 1MHCA 5BZWB 1N4XH 2N56A 5D1ZB 3CLFL 5GS2D 4JRXA 4LCYA 3MRDB 4L5FL 1BFOA 1UM6H 2DKMA 1MQ8A 3DX7A 2VIRB 1N0XH 2J4WL 4D9QD 3TVMB 4ZYKA 3LSOA 5C2BH 5ITBH 2ICWB 2Z31A 5DRWA 1ES0A 1EEQA 3D69A 4H26B 2EC9T 1CF8L 3DXAB 3RL1A 5GSRB 3WNPA 2R2CA 4Y88A 3MCLL 2R0WL 3RBGA 2X4SB 2WP3T 4CNIA 3TN0B 2PW1B 5B8CB 1IKNC 3KLSA 2Z91B 1X9QA 2R2BA 1HCVA 2DQDH 5I17A 4E42B 2R29H 4TUJA 3LRSB 5B8CC 4PJ8C 5TGBB 5I9QC 4PJEA 1UZ6E 2ZOKA 3EYVA 4WWKB 5ACMA 3GMNB 3BXNA 4PJ8A 2CLRB 3T1WA 3KPNA 3VI3F 2YN5A 5DSCA 1UH4A 1U3JA 1ZT7A 1MCOH 2BHYA 2NR6D 3BRDA 1OSPH 3U83A 1FZKA 1JHLH 4JGMA 1DQMH 1Z3GH 2AJXH 3D2UB 2PNDA 1T80A 5JIIA 3NIGF 4FG6D 1GGBH 3E3QE 2CMRH 3HNSH 3QZWA 4XP6H 2I9LB 1F3JA 4G80A 2RB8A 4JQIH 3QULB 1M1SA 3T4YB 4A2LA 3HUJA 3QEHB 4HLJA 1BZ7A 1CGTA 4YZFF 4X4MA 1FNGA 3FKUS 1XGRB 4QRQA 1YNKH 2VDPL 2FX8H 5K59F 1EFXA 1LVEA 4OZ4B 4Z7QE 1FZMA 4HWBH 4OM1L 3E3QC 5HPOA 4V1DA 3CAFA 4HUNB 2ZCLL 3RAJH 3TF7C 5E7FA 5KVGL 1JFQH 4MAYB 1CD9B 4P9HC 4P46B 2IGFL 5AAWA 2Z8RA 3KJ6L 5C3LD 1UFUA 3O11A 3PJSA 2DKUA 5F8RC 3CSYA 3SCMD 4MQXD 5DJ2B 2XKNA 3HC4H 2W38A 4X4XB 2AJUH 2MNUA 4ONGL 3FN0H 3I85A 2IH1A 3AROA 5GS0C 5C0DB 4PJEE 4P5MA 1D3CA 2Q7YB 3ZE0E 1PY9A 4Y16B 4P99A 4OT1L 1NDGA 1EX0A 1IGYB 4FHBD 3TYGH 1E6OL 4GSDH 2WBWB 5IUSA 4YXLL 2Y7QA 2D4FA 2F54E 2VABA 4P57A 2VYRE 5B38G 4M6AA 1C5DB 5JUEH 4XAWL 3PDDA 3MLUL 1RFDL 3CH1A 4U6HB 1Q9WB 4KKLC 3LQAH 1GRWA 3SE4C 2IPKA 2L0DA 3ULVH 5CFHA 3D39D 2MQ0A 2V2XA 3C6LB 2CKBB 2F5BL 1DP0A 1I75A 5J6GA 4M1GH 2DMCA 5KTEL 3GSQB 3B9KB 3SDCB 3H8NA 3ARZA 3DVNB 4IS6A 2OTUA 1VEPA 2ED9A 2EDTA 3DV6B 3H2WA 4NIKB 3ZYZA 1GZQB 3S36H 4EJ1C 2VLRD 1FRGL 1ZA3A 2P47B 3HR6A 4M7LL 1F13A 4ZUWB 3WIHL 2O61A 4P2QA 2H32H 3OB0K 5I6XC 5IFAL 3IFPA 5JXEA 5ISZE 1KACB 2BDNH 2ZJSL 5IHZA 2DBJA 3WIIH 3MODH 1LEIB 1LILA 1YN6A 5J6HB 3WNNA 2AI0L 3U0TB 2HTKD 4NO2B 4POUB 1FV1A 2AEPH 1MCDA 4U3CA 3G6JF 1ORQA 5T33L 3GRWH 5DD3H 3QWRD 4MAUH 5GJSL 1XAUA 5F97E 3DMMB 4PRDB 5J56B 3QAZB 3TNMB 1YEDA 1A4KA 4GS7B 5BXFB 4X9HA 1KSRA 4X80H 1S5HA 4NGHL 5D5MA 1U8PB 3QCUL 1BIIA 3Q3GB 1QFPA 2CR3A 1OLZA 1TNNA 4MZ2A 3U4EA 1CGYA 4AMKH 3T3PE 2MCG1 3HI6L 1F2QA 3H3BC 3HR5B 4G9FD 1ZT4A 2X4NA 1HOCA 4OB5L 1WISA 4H25B 4P59L 4PRBA 4URTB 3T0ED 5EFIB 1NLBL 5EOTA 1MLCA 2IEPA 3OL2A 3VWJB 1EV2E 1T7XA 4Z5RA 3IDIB 3V5HB 1GIGL 3PGFL 4N5EC 4Y4KA 1MQKH 1LD9B 1PQZA 3EZJB 3OKEA 4E0RB 3QUKB 3AS1A 4TYUA 4I3GA 3EDEA 5TE6L 3DNKA 4U3XA 1AKJA 4JO3H 4NBZB 3L95A 1XGPA 1EHXA 1S8DB 2GJZA 1G7JA 4YK4B 3LZFH 1TPXC 1WBZA 4OAWB 3ET9F 3B3IB 1MFNA 3T77B 3ULVF 4DUWA 1MEXL 1IGCL 4UB0L 3GBMH 4JKPL 4ODXB 4D94A 1AC0A 5BW7C 1LDPH 1RUKH 4L4TB 3OKDA 1QUNA 4F37K 4HQQL 1SBBA 1NFDF 1I3GL 1MFBL 3HAEG 5HHOE 4RGOL 2ENSA 5TFSL 3QJHB 2DQHH 4DJMA 5F3BB 4GG6A 5DT1H 3RWGB 5IGXH 1MUJA 4Q2ZB 1UA6L 2WWKO 2D7NA 5B21A 3W9DB 2GUOA 5E24E 1B2WH 3NPZB 4WHYH 1YEJH 1U93B 3W5MA 4OZGF 1BVLB 3RA7H 3QEGL 2O93L 1R24B 1S5IL 4X98B 2OI9B 2EH7L 3DVNA 2ZOKB 3LN9A 3A6OA 3PABA 1YPZF 1ND0B 4KUZH 1JUFA 3VGEA 1KUMA 5T1KA 4TUJB 4GKZA 2UVEA 4NQUA 1P7QD 1UKTA 4X9GA 1Z3GL 3NMEA 4KDWA 5F1NB 4ZFGH 5CZVH 4KTDL 4Y19A 3HTLX 1OPGL 4LAJH 2ZSWA 3DBXA 4F9LC 4G8GB 5T3XH 4PBXA 3QDHA 3BZEB 5I76A 2BSED 1MFEL 2J6EH 1G7IA 3RPIA 1Q9KA 3MV11 1FORH 1FLTX 4U1GC 3VRLE 2YOCA 2VZOA 3MLTB 5IBLC 1IL1B 1TZGL 3Q6GH 3DECA 5ETUA 4WUKL 2DQGH 3CC5A 5D6DC 1W72B 4U1MB 1G7LA 3B2VH 4YDLB 4Y2DC 2OK0H 1J1XH 3RIAK 4I77H 3WEXB 4FQIH 1TDQA 5CEZD 3RHWK 4PRHB 5E08L 4P4RB 5IB5B 3KPRE 3QQ4B 1UKSA 1PG7X 1W0VA 4LIQL 5E4EB 3QHFL 3T3PF 2MPAH 1ZSDB 1CQKA 2IPUK 3DLQR 3C5JB 4X4XA 2ICEB 4YXKH 4M8VA 1ZGLB 3O6KH 2YMXL 1PYWB 2JIXB 3QIBD 5JDJA 2EICA 5I1AB 2HFGH 2JJUA 4WVRA 4YO0A 1RMFL 1MAJA 1NFDE 1D5ZA 1B4RA 3CH8A 3MXVH 1KCVL 1CF8H 1SVCP 5CD5D 2J12B 5JW5B 1FYTA 2ZOLA 4PP1D 3T8XB 5CD5C 2VLJD 4HZLA 1ZLSL 4LIQE 1KIRB 4PJDF 3I75A 1QTYT 1CDJA 4JVPA 4OCWH 3OXSB 4QRRE 4X99B 5T1MB 5F9OL 5LCVH 4PJ7B 4YE4H 4YR6A 2P8PA 4PRPE 4Z9KB 3B8SA 1BAFL 2FJFA 4IMLB 4PP2A 4ZAKB 3V5KB 3LEYH 3KPOA 1UG9A 4LDEB 1PKOA 2GJ6E 2VDNL 4CADA 4WFGE 5D6CA 5I1HL 3GMQA 2ZKHL 4M03A 2ID5A 1N5AB 1ZANH 3AGVA 5DXWA 5JW4Q 4OZHA 1I7UA 1MJ7L 3OAZH 5HYIA 1CI5A 4I0KA 2L7JA 2DN7A 5DFVD 2PO6D 5DC0A 2VN7A 1VFMA 1IAOB 4HCRH 4Z7WE 1KB5H 4PRNA 1C7TA 2FBOJ 4LNRB 1CBVH 2GT9A 3C60B 3FQWB 1HH6A 1I9IL 2FEEL 2E9WA 3U7WL 3F62A 2BVOA 5CCKL 4KMTL 4MD4B 3DO7B 4NO0A 2XTJE 5GQBA 2N4IA 5DMKB 1FZJA 5BW7A 3UBXB 2AJYH 1K85A 1CFVH 3V0WH 5E00B 2ZUSA 4HUXA 3VFNA 3HMXA 3MXVL 2HVJA 4OM0H 1YEFH 2YRPA 2BSTA 1WWCA 1MFAL 1HCFX 3HAEA 3CVHH 2HLFD 4PB0H 3TPKA 1QSFE 2ED8A 5CP7A 2VLLB 4DVRH 3ETBF 2DQGL 3O41B 1IFHL 3L3JB 1IAIM 2X44D 4EBQL 4M7LT 5DJXB 2FX7L 4Z7NE 2A6DB 5MP6L 1DDHA 4UV7L 5FGSA 3RQ3A 4WHTB 1MHCB 3GMPA 4X6DB 2WBJB 1KLFA 2BVOB 2A83A 1U92B 3IF1B 3ZDZF 1YN7A 4ONGH 2HG5B 2I60H 4NO5A 5BS0D 3MCG1 4X6DF 3HC0A 1WC7B 4MD0A 3ME0A 4XVSH 1KB5L 1OAKL 3CU1A 3HLAA 4OD1L 5HHQA 2QEJA 3DSFH 4GT7A 2OTPA 4JHAL 5DJZB 1MRCL 1NKOA 5JO5B 3TFKD 5LGKA 2E7HA 3PGCA 4F33B 1WAAA 1OAYL 1DBBL 3CDFA 2IPTL 3Q5YA 2K7PA 4JFYB 4OSUL 5IFJB 5C0BA 3AB0C 2CIKB 1HSBB 4FQCL 1KJVB 1S9XA 1R3JB 5I75C 1IGJA 3MNZB 4FQJH 1ADQA 3LKOB 4HJ0C 3E8UH 1KIRA 2EIZB 4OCWL 2BY1A 3SGDI 5BQ7A 4TSCH 2X7LB 3BFOA 2JJTC 4HH9B 2BY3A 4Y5YA 3O0RH 4XP4L 5JQ6H 2BC4A 1JZ6A 5E8EB 3KPRB 4YHML 5LQBH 4YZFE 1BJ1H 4RMSA 5C70A 3HI1B 1XF1A 3NCYP 1EH9A 3P4LA 2NW2A 5LAXB 3U1SH 4P9HL 2OR8A 1SJHB 1MFDL 3OAUL 1BOYA 4X8JA 4JHZA 1SEBB 2H2SD 5E6IB 5C08D 5AEAA 5J1SC 5IB5A 4MSWA 3RGVC 2I26N 3ULUD 3RGVD 2Q8BH 2ZCKH 4R6UA 2B5IB 3VXRE 3PQYB 4A6YB 5E9DE 4BZ1L 4WENB 2BY0A 5DS8B 3RWDB 3G5ZA 3GSVB 5FUCC 5IB2B 4NC1E 2W9LA 4P2OA 2MCPH 4N0UB 4N0FA 2B20A 1KIQA 1AHWA 5HGAB 1DFBL 1I1AC 1MHHA 4M1DH 1RIUL 3ZKXB 4PJEF 4XMKL 1RI8A 3MZTA 4HK0B 3MLTA 4HIJA 1NAML 2AV7A 2FX9H 4QRSA 3O3EB 1KEML 1EHNA 1I8IB 3FO2B 4NWTH 4YBQD 4N5ED 3BDYH 4Y8DC 3O6LH 4PJIA 3V6OE 4EBQH 5F1NA 3GSRB 2DMBA 5E94B 3VXTA 2LU3A 1OAYH 5T1KB 1ZHKB 4P0DA 3UTPE 3MJ9H 1E27A 5L2KD 1KIPB 4MJ5A 1IGTB 4HFUL 4QRPE 4PV9A 5IMMB 4MJIE 1MAML 2ZWLT 1IGIL 4NUJB 4TTDD 4YXKL 4YEEA 4PRPB 4Y89A 3SO5A 5IEKA 3WFCH 3VFVB 4MX7B 1R3LB 3LS5H 3LKSB 5FKAB 3BDXA 2OJEB 1UZ8A 3F7RA 3O9WB 5CJXC 3V8OA 1HXYA 3G5VB 1A14H 2X6MA 3OB0H 2BVPA 1YNLL 4M6OH 1QVOA 1S7TB 3H42H 4ODUB 2BMKA 2D03H 3REWA 4DGIL 5DTFA 4LLDA 4M62L 1J05B 2UVFA 3OJDA 5FYKD 4ZTPL 5DA0B 3L5IA 3LD8C 3OPZL 5GS0D 3QQNA 4XPTL 25C8H 5J12B 2V2WB 5EA0L 2HRPL 1SJVA 1K6QL 4JREB 5C0JA 2V6HA 3ZTJG 3KYNB 4KJYA 1FJ1A 4L4TA 2V2TA 5ANMB 1MELA 1CFNA 3PP3H 4P5TA 5CBEB 4ZXBD 1A6ZB 3DPBA 4JCMA 2GJZB 3GMLB 4X7CC 1BQHB 3PL6B 3D48R 2XWTB 5FKPB 4PJBA 3L3HA 3LV3B 4J4PA 4P2RD 4I2XA 3S36L 1WF5A 5IEHB 4HUVB 3CLFH 4JO1H 4PRPD 5SWSB 3O2WL 1NBYA 3IAGC 1NMBL 3UTTA 1TCMA 2APXA 4O02L 5I1DB 2B4CH 3DUSA 4NHCH 3H7BB 1F3RB 5EFIA 4O00A 4IRJB 4YFLF 4L9DA 3FQNB 4BJLA 2AK1L 4LPVA 5D70L 5EOTB 1EO8L 4YXHH 4U1KB 1ACYH 4N5UA 3TT3H 3WO4B 5CEYB 3U4EB 2AJZA 4I3RL 5FYLE 5BJTB 5I8CA 1CXIA 5ICXB 3WIFA 1RIVH 5ESAA 4HXAL 2CK0H 5IMLA 3HZKA 2APBA 4HBCL 2R4RL 1EEZA 4KK6C 1JHKL 4KK6D 5F7FA 1E4WL 2DQJL 4Z78B 3GHEH 2YPKB 5BVPL 4XNMB 5H37H 5EDXA 5GGVL 1U9KA 1HXMA 1NGYA 4QXGH 5FHBH 5HHPB 3WHE0 2AJ3A 2X5PA 3QH3B 3ILQC 2J1KA 3MRRA 2FZ3B 5I1IL 3FHQA 3HI6H 3U0TA 3G5YA 3LS4H 3REWB 2IH3A 1J0JA 4AG4L 4CUCA 1P4LA 3IFPB 4JVWA 5F89B 5KJRH 3RKPA 1J0ZA 3O9WA 4M9PA 1UVQA 4I77L 1J10A 2W0FA 5BCAA 3UTSE 1T1ZB 4IDLA 5F96L 3DSNA 4PJXF 1AQKL 2HJFA 2AQ3A 2Y1VA 4WO4C 4NRXB 5MEND 4Q6YA 4Z8FL 1ZA3B 1OGAD 2P49B 4LGPB 4M62H 4LMQE 1N3NA 5ICYA 1BLNB 4ZO6A 2PETA 3TZVD 1IT9L 4JPIA 4DZBB 3B9KD 4E5XB 2GI7A 4OGXL 3B9KC 3GSQA 3SDCA 3T0EC 4U0RC 3I50H 1DQLH 1F11B 5FYJL 2UYLA 3VMOA 1Q9OB 3MRNA 3GMMB 2EO1A 1JL8A 4CKVX 3N06B 5DJ6B 1OGTB 1W0WB 1IBGH 5SWZA 1H8OA 3ZL4H 2GFBA 2XTLA 5AAMA 1NCDL 3AREA 5TDPB 4IM8A 4FA8A 3BH8A 3P9MA 5JQHC 3TM6A 1I9JH 6FABH 3EYQD 1FNEB 4P57B 4U6VL 4J1UA 4LCCC 2XZCH 4KVNL 2WM0A 1D5BA 5EOCH 5SWQB 4CU7A 3VXMD 5EWIL 5FAAA 4PYHA 1AP2A 3VXRB 3T2NH 3VFMB 2R69H 1A1OA 5JXAL 43C9A 4MA3A 3IYLW 2FJGA 1A3LL 4U49A 3QDME 4R7DA 4RNRA 2QJDA 1F42A 3EUUA 4UT6H 1RHHA 3MV9A 4BA8A 1IT9H 1MRFH 1OL0A 4QXUH 5E5RB 4KKBD 3HE7C 4OCRH 3S34L 3O11B 1N4XL 4LSSH 4G6AD 1HI6A 4X0KA 1UACL 3VFGL 1CXLA 1P7QB 2NZ9D 2ORBH 4GLRH 5CJQL 4CMMB 4ODTH 1DEDA 1UC6A 4L3ED 4NQCD 2X9YA 5C2BL 1KJ2H 3SBWC 4YHKL 4MYWB 4DOHE 2HLAA 4QY8A 3PHOB 4XPHH 3TT1H 4N0FB 5JDSA 1F02I 43CAB 4F9PC 4EUPB 3ROLB 5DI8B 3GSVA 4DN4L 2F54A 2DQFA 2BHUA 3PDGA 3ZE1E 1MPAL 3DGCR 1S78C 3FB6A 3CZFB 1FP5A 2A73A 7FABL 3WLBB 2PUQT 4G80B 1S78D 2D7TH 2I5YH 3C5SB 3OBAA 3HE6A 4NZUH 4NM4L 5HBBA 3VXNA 5D8JL 1QBMH 2EKSB 5M7QA 1OGAE 4S1SH 5I30H 1AY1L 4DGIH 3WNMA 2YXMA 4NKIL 1MRFL 4TSAL 4D9RE 3LVEA 1ZT7B 1X5FA 1LO3L 1XF4A 1YZZA 1M4KA 1T0PB 2XWBB 2EYRA 2ZUVA 5I16B 1T5XB 1T7VA 2PR4L 3MRIB 5HTSA 2FJHA 1IJ9A 1BD2B 2JK5A 4WWKA 3RVTC 1FNLA 3PGDB 3GSUA 4P3CL 5HGBA 3QDMD 2GY7B 2C4FU 3QG6B 5IFAH 1J0KA 1BFVH 2R29L 1GGBL 3HG1A 5BZDA 3WLWD 5DUBB 4N90E 2ARWA 3QR2A 1T3FA 4H5SB 3P11L 3P4OB 5EUOA 5HGDB 4YHKH 2FHCA 4PGEB 3L5HA 2I07A 5FECA 3CFCL 4N0YH 4ELMF 4MNQB 4M5YL 4HGMA 4U4BA 2IAMB 2NQCA 4TUKL 2HRPH 5HHNA 1NEUA 1WCQA 4KKLD 1OSZB 2OJZH 3GIZH 2VQ1B 4HC1H 2HVJB 4CVXB 4BH8B 1D5MA 3GSXA 1VB9A 1Z0NA 1FE8H 4F7CA 4X7DC 5KSVB 5AUMA 1FC1A 4L9LC 4XNYL 1AIFB 2EC8A 4WW2F 4GW5B 4XRCB 2IAMA 4LCIL 1CGUA 5IB4B 1A6UH 5T1LD 3GZKA 3GIVB 2H6PA 1R3KB 3JTTB 5TQ0L 3PIQB 4KZDL 2WBJA 2BFVH 1KTLA 1EEUA 4NJ9L 4OB5H 5IHUL 1S9KC 3ARFD 3KYMA 4M6MH 3D39E 3IDUA 5D93B 4M8QB 4WY7L 3D18B 1EAJA 2Y5TA 3VA6A 3NZ8A 1HHGA 5D6CB 3QI9C 3KPOB 3UTSD 4UIKH 3MLWH 5FECB 4KK5C 2X9XA 4JPWH 1DZBA 1NJ9A 4IDJH 1WIOA 1NAMA 3VXSE 3MRIA 3QI9B 2Z35A 5IF0B 1F6FB 4HT1L 5C0IB 3FN0L 1WVZA 3OXSA 5BZDB 1TVDA 2OLDA 3PDOB 3P30L 5HI3D 1QPPA 4Q9RL 2NY6D 5HI3C 5IHLB 3STZA 3D9AH 4NO0B 2VXQH 4LVEA 4OBRA 3I50L 2EDJA 3PGDA 3BZFB 2KDGA 4UU9B 5EUKB 3WLBA 1F45A 3UROR 2VE6A 2VDRH 2QADD 4P23D 4F80A 4V1DD 3GBML 4JKPH 1PZ5B 2KQNA 2Q8AH 1A0QH 3BN9D 4HUWB 5JPNB 3RGHA 3L5WA 5DYOB 5LXGH 1VEMA 2R0LH 4G8EB 3ZLQC 3NAAL 1YQVH 2R2HB 1U2HA 1P7KB 2A38A 5L9DH 1BOGA 1K2DA 4E41A 5C0NC 2WIIA 5TFSH 1CS6A 5GGUA 4ZAKC 5BV7L 1A7OL 1GOHA 4X6FB 1YUHA 2K9UA 1G1CA 2DIBA 3ISWA 4LLUB 5KJRL 1JIBA 4ZAKA 4CMMA 1VPOH 2UY7A 1BZ9B 1TNMA 4LL9A 1OM3H 3FJTA 4OFPA 4X0KB 4KI5E 3QUXB 3BEVB 1CDGA 1XEDA 1BP3B 3UXFA 4WW2A 4LHJB 3VFTB 1SYSA 1JZ3A 1AC6A 4I8DA 1L4IA 4AEIL 3H9SA 1T1WB 5EBLB 3T65A 3NCMA 1CFSA 4XMLL 5DQDH 1GYAA 1KENH 1UACH 3IFLH 5ELIA 5FYKU 1Q9KB 4LKXA 3MOAH 4KHXH 2H8PA 4L8BB 4L3AA 1YPZE 1NAKL 3GO1L 2P43B 5E9DB 5I66A 5GGVY 1K6QH 4AEEA 1M6OB 3UX9B 4BSJA 2X4PB 1KLUB 4XAKD 3WXVH 3T0WA 4WUUD 1JTTA 4ONHB 4NQDA 1I8LC 1R0AL 4CN4A 1TFHA 4ZPTA 2YBRB 4PJ5A 4DUXA 3HPLA 3S5LB 5D7SL 5E2UH 3DVGB 3GMOA 2P8MB 2X1PA 4NJ9H 4ZOBA 4L4VA 5E9DD 3L3GA 3O2WH 1F6LL 5EZJA 3Q5OA 4K7FB 4AT6A 5L8JB 2BNRD 2FL5A 5SX4H 2KUTA 4G6JH 3R8QA 3VWKC 4JO1L 1Q9OA 3IGAB 2DQIL 4R97C 5C08E 3VRJA 3JWNC 3AAZA 3STLB 5DJ0A 1Z9LA 4J1UB 1OTUD 1XR8B 4JPIB 5JW4M 5LKNA 3QUYC 1RZJC 2B0SL 2G5BA 1ZLVK 3T3ME 3G5XA 3PWLB 3GMMA 4L4TE 3SJVB 5I2IA 1WTLA 4FRWA 4JJHA 1D6EB 1WFUA 3LKPA 1EAPB 3L5XH 1JZ5A 4K55A 3RZCC 1L0QA 1NMCC 5I15L 5HD8C 1A5FL 1DUYA 4KMQA 1J88A 1IAKA 2E3VA 3WYRA 5I75B 1FL5A 3L7FA 2J2ZA 3RUGE 1FQ9C 4OM0L 2VZTA 3H3PL 3MRRB 3T1FB 4PJHA 2F58L 4HFUH 2HN7B 5J1AB 4WCYH 2R8SL 4NO3A 4GAYB 4JM2A 1QSEA 1JNHB 1WTGT 2HVKA 3MJGX 4Y5VC 5L2JA 2VLME 2COQA 3QO1B 4EI5C 2N7AA 3IDXL 3I3DA 4J7RA 4JFQB 4EI5D 5HVGB 3QDMB 1QBML 3CFIC 2VC2L 1ETZA 4LKCA 5IV2A 5JHDE 2XKUA