1ZVYA

Crystal structure of the vhh d3-l11 in complex with hen egg white lysozyme
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
DVQLVESGGGSVQAGGSLRLSCAASGSTDSIEYMTWFRQAPGKAREGVAALYTHTGNTYYTDSVKGRFTISQDKAKNMAYLRMDSVKSEDTAIYTCGATRKYVPVRFALDQSSYDYWGQGTQVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for the preferential cleft recognition by dromedary heavy-chain antibodies.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase/immune system
molecule keywords Immunoglobulin heavy chain antibody variable domain
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zvyA00
1YEKH 4GG6B 4ZSOA 3WXVL 4LU5L 4JO1H 3RDTD 2O5ZH 2B1HH 1CFVH 2VXQH 5BXFB 2NY6B 2YPKB 3EYUH 3S35H 3WLBA 5I1AB 2BDNH 4OZGE 4FS0A 4PV9A 5AAWA 2FLBT 3QG7L 5D8JL 3LQZB 4UT6H 3UBXB 3O41B 4OQTH 4Y1AB 3RUGF 5K9QI 4MD4A 2HFTA 2H1PH 1HOCA 4Z77A 5HHME 3ARGD 2WP3O 4FQJH 3SKMA 3SQOL 4FFWC 4YHPA 3S4SG 5MEPB 3QUXB 5KOMC 2XRAH 1GCFA 1XGTB 2B4CC 1CBVL 1IFHL 2PXYB 1X4XA 4ETQA 3MRDA 2UWEF 4XPGL 4PJHF 4JFOA 4Y5YA 5CIPH 2ZSVA 3QXTA 4LP5A 3X14B 3IFNH 1G7JA 1LK3H 1MI5D 1DUZB 1NBVL 1JGDB 4GMSH 3WNOA 5D6CB 1D5MA 5GGTL 2W9EL 5EORL 5D1XC 3DIFA 2HKHL 2ESVE 5IVOA 3UAJD 1SBBA 5GRVL 4NO2B 3TBSB 1A1MB 3RWFA 4YK4B 3X3GL 4O51A 3V95A 4P46C 4MAYB 3RGVC 1XF3B 1KJ2A 1NLBH 5DK3A 2Q6WA 3H2WA 4LLMB 1A9BA 5MP6L 2YMXH 4GS7B 4P4RA 3OXRA 1XT5A 1OW0A 1EX0A 1IAIM 3HZMA 3TPUB 4YDLB 1A1NB 3VXMA 1UH2A 4HIEA 2HWZL 4K7FB 4JY4B 5F1OB 5EOQH 3K80A 1I8KA 4M5YH 2NY4C 2HRPL 5D93B 5ADPH 2JE8A 3FZUD 4KKAC 4XBEL 5GZND 3QUYA 5CJBA 3ES6A 5DI8A 4RSVA 3GMNA 3HAEH 3GI9H 1U8PB 3DPBA 4XZUB 4DN4L 3F7YB 4PJ5E 4DQOL 2YXMA 3BGFC 5AEAA 1RIHL 3I6LE 5TPWH 4BFBD 5DT1L 3N85H 3TO4A 2QBWA 5E8PA 3QNZB 5F89A 3KYMB 1KF9B 1I7UA 1UM5L 1TCRA 3SKJH 3E6HA 4PRDA 4G8IA 4V1DD 4OD1L 2AJ3A 3K1KC 3ISWA 3BKYH 1IARB 5GGQH 4ZTPL 5D7LD 1HEZB 4LOUC 3QSKB 4JB9H 1RK1A 3FFDA 1AIFB 2YA2A 4JM2F 1NSNH 4PLOB 4Y4FB 4PS4L 5TDNB 4LKXA 4Y0GA 1PKQA 1F3JA 3HNVH 4L29B 4PB0H 2H2SC 2DQFA 5HI4D 5I16B 1RZFH 4NDMA 5CJOH 3Q6FA 3TYFB 3D1MC 1CLOH 4ZUWA 3LCYA 1T80A 4XMPL 2VDRH 3TV3H 3W11C 4J8RA 1I1AC 4MNQD 5EC1B 4P57A 4QRQB 5D6DA 1F4XH 3HAEG 2OK0L 3OHXB 5GGUB 5DQDL 2ERJC 4GRWE 1NANH 1W8NA 3EHBC 4D0DB 2XPGA 1P2CA 4LPWA 1NPUA 1K4DA 3QEUA 1QFOA 1T1XB 4Y4HC 1IGYB 5EZLB 2P5WE 4RX4A 1INQA 2VXTH 2YPLD 3ARDB 5I1EH 3PP3H 3V0WL 4PGDA 1TXKA 3UBXG 4NNPH 2V17H 3OV6A 5I8OH 1YNKH 4QTIH 1NCUA 2KBGA 4AZ8A 4M4PA 4KJYB 4NQCB 5A16B 3KPRD 2W92A 2N56A 4G6JH 5B4MC 1BX2A 1Q9WA 4JDVB 4YX2H 3UPRA 3ARVA 1J10A 1NKOA 3B8SA 4N1HB 3MRGB 1I8IA 3DX6B 3A6CH 3AM8C 4WHCA 4GAJH 3BUYA 3QEQA 2EO9A 1RULL 2C4FT 2N7BA 4PREA 5FYKL 3QI9C 3V52H 4PJCE 3MV7D 3U2SB 1X5ZA 1T0MB 2GT9A 4DGVL 4JY6B 3MRPB 4POYA 1QUNA 1FNAA 5E5MB 5ISZB 5E8OA 3SE9H 1KFAH 1TFHA 3Q6FB 2UY6A 5E94A 5TFSH 1WISA 1ZVHA 3T08A 1PQZA 4EBQH 4QHNB 4JFDD 1NC2D 4P9HL 1VEOA 4S10A 3BDYL 1WEJH 1CXEA 1BJ1J 1AGFB 4KROC 2HH0L 3DUSB 1P69B 2PN5A 4WNQA 4LSSH 3QFJB 1NBQA 4Z76B 5A40E 4NM4H 3RL2B 2R0LL 5IMLB 3BP7A 2J4WH 2VXVH 1U8OB 4HKXB 3JWOL 4JM4H 4EZMA 2X4QA 4ZFFB 1T2JA 5IMOB 2CLZB 3NPSB 3RVVD 2APTA 2IPUK 3O3UN 3BUYB 5CLTA 3V6OE 1YPZA 4Z7UF 2BVOA 5I1JL 1LO0L 3ZE2E 5K9KA 2WP3T 4OM1H 1ADQA 3BE1H 1QA9A 3IDMB 3D9AH 3AS3A 4PJIA 3BHBA 4DW2L 1HSAA 1H15B 4K3EH 4ODSH 4C57C 5L2KD 4KJYA 4NQCA 1YN7B 3WMSA 3GSNB 3C5JA 2FIKB 5IVXA 3BP6A 1CZ8H 5I73C 1OD9A 2Z0BA 4YXKL 2DYPD 1OW0C 5JQ6L 1P4LA 4WUUD 5C09D 4YXHL 3O6FB 4KI1A 3P4NA 4ZQKB 2A6IA 2XY2A 5DO2D 4IDJH 1Q72H 2MCPH 3VI3E 4GO6B 5GRUL 5EUOE 1ZGLP 4UILH 4ZMAT 4ACPA 1N6QH 3N1PC 1T83A 4U6HA 3SHSA 5CBAB 4PG9A 5JHDD 2X4PA 4HLJA 2WBJB 3VFSB 5DD6B 3GMOB 2VZ1A 3BD3A 3O2DL 4WI6A 3O3EB 5DMKB 4OF7A 2BRQA 1D5XB 2WBJC 4IOSD 4OFIA 4JRXE 1IVLA 1YMME 3I50L 3N0PB 4HBCL 4QGTA 3GSNH 1K6QL 4HMCA 4U4BA 3D87B 3MCKB 5J9PB 4KK6D 1UM5H 1N5YH 1DEDA 3MLYH 4G7YH 1DBMH 5JDJA 5IEKB 1TJHH 1HILB 3KDMA 3HNSH 1MLBA 3IF1B 4TULH 3SE3C 5DRXA 4X9HA 1Y6KR 2GITA 2QQKL 4MCZB 3IDNA 3MV8B 3IGAA 2WUBH 1CF8H 3WUZA 2D7QA 1MNUL 3OAYH 4U1NA 5DVMA 5KAQF 2QSCL 3SDCB 4WW1B 4L9DA 5EBLB 1FAIL 1XZ0A 3OB8A 1U8MA 4ZD3H 1I1AD 1WCBA 3HHRB 3VG0H 1CLZL 2CDFA 3P0GB 2NTFB 5JIIA 3GM8A 1FH5H 3IFLH 5DI8B 1RURH 3IU3B 1KCVH 4HXBH 1G7PB 4LSRH 1MCOH 3C60C 4RAUA 5D2NB 3JSSA 1KIPA 4X4ZA 3OGCA 3ILQD 4NQCE 4OCXL 4IOFD 5A1AA 5JA9A 1FNSL 2D31B 5E6IC 5IKCA 3KYOA 4QRPD 4Y4HD 4I48B 2YZ1A 1EDQA 1KB9K 1KENL 5TGBB 2RCSH 4JFFE 4Z0BH 2DLFL 3GO1H 2VH5L 3EYSH 3QXAA 4OZFA 5TDPA 3S97C 2DQEH 4OCLC 5C07D 2NY1B 1ZA6A 4YIQB 3KJ4B 1U8IA 3QUKB 4KK5D 1UADC 4C83B 3BWAB 3UZEA 3RY6A 1GH7A 4O51B 2FATH 1H3WM 1KACB 2VDOH 3MO1B 3MBEA 1HYRC 1FVCB 1N8ZA 1UC6A 3CXHK 1R24B 1UKTA 3L3JA 2VLKD 1NAKH 3L6FA 2CKBH 3P4OB 4U6XB 1SBSL 2AGJL 2X70B 1DUZA 1W8OA 3IXAB 3KPPB 3U36B 4PJXB 4DOHB 1J1XL 1MHPH 4U6VL 1AO7D 3BD4A 1W72B 4X8JA 2VABA 1UACH 1V3KA 1NFIA 4NZDA 4EI6B 1NH6A 3B5HA 1JGUL 1F4YL 3U7AA 1IGIL 3RZCB 2VABB 4BFGA 4C59B 4K94H 4OLUH 3MPCA 4OZ4A 2HYMA 1LP9B 3VFUA 3MZGB 4P9ML 5C9KA 2H26A 3VXPB 2HN7A 3V9FA 4JY5L 1RZKH 3X3FH 1HHGB 4NNPL 3IDIB 4NP4L 3JTSB 2ZG2A 3MNWA 1CXIA 1ZTXH 1MCHA 1MJ8L 2ZCKH 3QDGA 3G6AA 4KDTC 1P7QD 3B9DA 2PF6A 1YEFH 3QNXA 3U4AA 5HJ3A 3MYZA 5E70A 4JHWL 5ERWA 4WFEE 4JM2A 35C8H 3TIEA 2OL3A 5C3TA 2FHFA 4F7TB 3E2HC 3OKYA 3W0WA 2AKRB 5JQHC 1U8IB 3BIBX 2DM7A 1T1WA 3VFTB 3VFOA 5IMMB 1CG9B 1WFNA 1MHHA 1AHWB 1P4IH 1YQVL 2XFXB 1JGLH 1FL3A 4R26L 2BJML 1IMHC 5DYOA 3HC4H 1N59A 5DJYB 3LS5L 3T4AA 5FO9B 1BWMA 4KFZC 1M71B 5EULV 4HMDA 4PJ7E 4B5EA 1MI5E 5F1IB 4Y89A 3ARFB 4OCNC 1KFAL 3GSUB 4WU5A 1RJCA 4LK4A 1XIWB 5T1DH 3SDDD 5C0CD 3IJSA 2BNRE 5D4QA 3R0NA 5C9JA 5GGSA 4PTUB 4FP8L 5J56B 2LTQC 4PY7B 1K4CA 1N4XH 4PJDE 4DZBB 5F7UA 1MAJA 3EYVB 4PB9H 3OAUH 2GQHA 5CEYB 1NGZB 4JHBA 3AREC 1KJVA 5EU3B 3S36H 5ENWA 3VRLF 1T1YB 2I07B 3ZT6A 4NBXB 2J4WL 2VXVL 3WBDA 4I48A 2WINA 4PJFF 3WS6C 4EQ3A 3X11B 1TZIA 3CUPA 2VR9A 4WO4D 4P4KD 2GFBA 3IETB 1DQDH 5F9DC 1DBJH 1RZ8A 3QDME 4CNIA 3WIFA 2J8UB 4KHTH 3QIUD 3VXUA 1HI6A 4U33A 1T1ZB 1NGQL 5DEGB 1TTUA 3CLEH 1K6QH 1HIMH 3WNLA 4GMTL 5DD1L 5IBLC 2HA1A 5HGHA 2I9LA 3QWRD 1FZMB 5GGVL 4NT6A 1TETL 4NHCL 4NSKB 5EBLA 4P46B 2FJFA 4N0YH 4OJFH 5EA0H 2IQAB 3GKWL 2C7UB 4NFBA 1DSFH 1DR9A 1E4XL 1NGWB 5FO7A 3RUGA 1CDHA 1MAML 1KEGL 1IM9B 2EYRB 2A38A 5C08A 2WUBL 1RUQH 4LLUA 1Z0MA 1JTPA 1MLBB 5FYKD 4UILL 3WE6B 5C0IB 1M7XA 3BJLA 3EW3B 4XVSH 3TVMA 4DEPB 3KPTA 4PJ8D 1CFBA 1HDMB 1JGEA 4ZPVB 1ZAGA 5HGAB 3MZTA 1LEIA 1T0NB 3UTTB 5CGTA 2YUVA 3LQAL 4PJBF 5T1LA 3NCMA 2ZOKA 2PR4H 5ECJE 4QOKA 3KAAA 1QPXA 3BI9X 3BN9C 4NYLA 5E7FA 1CE6B 1TNNA 2Y07L 4U3XA 1UT9A 3HB3D 4KMQA 1N64L 1NCAL 2XKSA 3DECA 5ITBH 1KB5A 3DSFH 3H9ZA 1UXSA 1OSZA 4Z7OF 2NY4D 1HSAB 2NTSP 3OJ2C 2UYLB 4PJCF 4P2QE 4XVJL 4DCQA 1QSFA 4P4KC 4WWKA 3RVWD 4B41A 4ZS7H 2NR6D 5L0QB 3F65A 4KHXH 1EMTL 4M3JA 1ZLVK 5F72S 2BNRD 2ZPKL 2WBWB 1RUPH 3CZJA 1VHPA 2XKNA 3HZKB 4F7PA 3CMGA 1FCCA 2F74A 2A6JA 3A6BL 4OV5B 3DUHA 3U6RA 1RK0B 1OTTD 4HS3A 1CF8L 1XGQB 3MJ9A 3BP7B 3RU8H 1FNGA 1J0ZA 1G7IA 4IS6B 4RX4D 3CFCH 4P5TB 3SCMD 3MLUH 1ROWA 3UDWC 5HVFB 1IBGH 2VZOA 4JG0H 4Q9QL 4RMWA 1D5ZB 4QHUB 2YXFA 1QA9B 5F7HA 5K9KB 5E5MA 3CLFL 4MJ5A 3BZDA 3UZQA 3C2AL 2GT9B 1QRKA 3U46A 3NN8B 3GHEH 2C5DC 4MD5B 1R3LB 3MR9A 1UM4L 5CAYB 4MA7L 2VH5H 1B2WH 3C5SA 3F7QA 5T1LD 2X5PA 1ACYH 1ZSDB 1SYVB 3DURA 5DLMH 6FABH 4YBHA 4F33A 1AGFA 3HRPA 1X4YA 1CFNA 5FYKE 2ATKA 4XMLH 3HE6B 5DJXA 1G7HB 1OM3H 1KC5L 2DQCH 1G7LB 1PQZB 3ROOA 3HNTH 5ESAA 2X4UA 3LHPL 5E6IA 4OD2B 5ISZA 3SKUD 1OAZL 5CEXB 5EZLA 3U82B 3RY5A 2OXHA 1G7IB 4YHMH 1U8KA 5BMFH 1NL0H 2VN7A 4KKLC 1HH9B 1DQTA 3G08A 3LKQA 4NKMA 4OV5A 4NO0A 1CGSL 2W65B 4PPTA 2J8OA 5I1CH 1UZ8B 2FBJL 3AS2A 1B6DA 1G0XA 2DI9A 4OIIH 5F9AC 3TWCL 2OL3H 1OGTA 2JIXA 2DDQH 4PR5B 4YDKH 1IGFL 5FM8A 3WUWA 3BKML 3HG1E 3KNBB 4Z7OE 2QADB 3DJ9A 3C8DA 1GGTA 2DQFB 4EI5D 4PFEA 4M93C 4PG2C 5J13C 4WHDA 4UINL 2X9WA 2YD5A 1ZTXL 4WI8A 4WUUE 4WW2F 1S9VA 1INEH 2H2PC 5F6IC 2CDGB 4K3GA 3V2AR 3ZTJH 1AIFA 4TTGA 3FHQA 2NPLX 3C6LC 2E9BA 1HEZA 5D5ME 1MCKA 4FG6C 1F4WL 4FZ8H 5E8EB 1DVFA 3RWCA 1JNNL 3U1SH 4WEUD 1JGVL 2XTJC 5EO0A 4CMMB 4F3FB 4MJ5B 3HR5A 1NMBL 2F54A 3P9LB 4D9QE 4KRMB 4ZUUA 5F89B 2AJSL 1QO3B 4QTHB 4XP9H 3KLHC 4X5XB 4U1MA 2BY0A 5D1ZA 1MRDL 4Z7WE 4ODHL 1PJ9A 5SX5H 4MD0B 2BY1A 3FAXA 1S9YA 3I6KA 1Q38A 1PX3A 2UWEB 4KDVA 5DSCA 3OZ9L 4FP8H 5EPMA 1QSVA 3ROLB 2GIYA 3PJSB 4Q6IC 5E4EC 1RUQL 3X11A 1XR8A 1WZ1L 1S7TB 3MJ8B 3DV6A 5C2BL 1DVFC 5MEQB 5EFIA 1NLBL 3HUJB 4IRJA 1I7ZA 4DAGH 1E4JA 5MP6H 1EJOL 2ITDA 3OKMA 1S3KL 3F58L 5BZDA 4D0BA 1CWVA 1WUNT 2FIRT 5BS0B 1QSFB 4WWKB 5DXWA 4ZNEE 4XAWH 5JXEC 4PIRF 2XACC 1JCKA 4QY8A 2ZUSA 5JPNA 1NEZB 5FO8B 1OARL 4XCNA 1LK2B 4RWHA 4KROB 4OFVA 3V6FA 1MVFA 4QGYA 3PQYD 1NC4B 4NO2A 3W81A 4XMPH 1S7UA 4K23L 1I1YA 4FA8A 2EICA 1JZ6A 1KT2B 3T0DA 2XQBL 1KCLA 5DT1H 4C56B 5BQ7A 1NMAH 3VDCA 4PD4J 4IBLT 1U3HA 4CN4A 3JUZA 5D2NE 1A9BB 1TPXB 1IGJB 1Q0XH 5C0IA 1JN6A 5E1HB 1KJ2B 4MQTB 4Y5YB 5FUCC 1AY1L 1UJTA 1FFPB 3JTTA 2DM2A 1BIIB 3O6LH 2EH7L 5DZOA 5DO2C 4AIZA 1U8HA 2DQGL 4ODVL 1MLCA 3H6JA 4XC3L 4KXZI 4Y1AA 1HHIB 1NLDH 1NFKA 2IAMD 3T04D 5D6CA 4K2UH 1HXMA 4UNTA 4O2EA 3RBGA 2W0PA 1IL1A 3U4BH 4MA3A 1MVUB 1Z6JT 5F3BA 4KTEL 5DJ6A 1HI6B 4S0SD 1NCWH 4OCSL 4XBPA 4GKNB 1MCDA 1C8PA 3VXUE 5JW3L 5I1GH 3AMLA 3ULVC 4GG6A 4DKFH 1UM4H 2VLRB 3CSYA 1HQ4B 2F58H 2BCKB 2Y06L 4MMXC 4RA0C 5E4IA 3VFWB 4KHXL 1NFIB 5GISL 3EO0A 1A6VH 4P4KB 1RUMH 5KSAA 5ELIA 3K2UH 2IH3A 4NQDB 1S7XA 4TSCL 1DBAH 1HOCB 4K71B 2C3HA 1MH5B 2A83A 2HVJA 3NABH 2FX7H 1Q8MA 4PY7A 2DQDL 4Y5VB 2VITB 1NFDA 2IPUG 4MQXC 2EXYC 1UA6L 4IHOB 5SV4A 4PGEA 4JQXA 1Q0YH 1NFDB 1FL5A 2OR8A 1EXUA 1HHGA 1NEZG 5E2TH 4Y5VA 5JXED 2RBLA 4G9FB 5JLZA 2J1KA 2B4CL 3TCLA 2EDEA 1RMFH 2VB5A 1WWCA 2W38A 2HTLD 3GMQA 4P2OB 2VZVA 3ARBA 4I0CC 1BLNB 2CIKB 2DYPB 5HI3C 4J2XA 3CFJA 3E6FB 1HKLL 4HWUA 4MZ2A 4NPYA 4XP1L 3SEPA 3PXJA 5EU6D 4BJLA 2X9XA 3UPCA 5JUEL 4E41D 5IV2B 4YZFF 2D7PA 3WNNA 4O2CB 5ERWB 4MA7H 4LKCA 1K9TA 4DW2H 3GIZL 2K7QA 3W39A 3U0TA 3NH7H 5D2NA 1I9JL 4NUJB 3O4LE 1HXMB 3AXLB 4U1SA 5CBEA 4U31A 3TN0D 1C7TA 1N8ZB 5BRZB 4KH2A 2BRRL 4GAGH 5CGYC 3VXPA 4CVUA 3ULVH 2R4SH 1I85C 3HNTL 4AK1A 3WFDL 4KRPD 5I71B 1LP9A 2VLJD 3TH4T 1BFSA 3T2QA 1OAUL 1KPVA 4JREC 1CR9H 4JN2A 1JWUB 1JZ7A 1PG7W 5ESQB 3WKMH 1A9EA 2V7HB 4F7EA 3DHJA 2J12B 1UWGH 5FA4A 3INUH 5F7LB 1MWAL 1A8JH 3B5GA 3QXAB 4OZFB 1WBYA 4R90L 5L2KA 3O2WH 1QSED 2WIIB 4JPWH 3VU2A 1OL0A 1K3ZA 3TWCH 2XZZA 3O2DH 3L7EA 4WCYH 2Q76B 3LKPB 2GTZB 43C9A 3P4OA 4K8RH 3PP4L 3JV6A 1KIPB 1QR4A 4U6XA 1KOAA 5A2KH 4Z7WF 5DVOA 4J23A 1P84J 1MI5B 5GS0D 4XCNB 4R6UA 5A43C 2X1QA 1FNFA 2NY7L 3ELAT 3HPLB 4XT1C 2Z9TA 4NN5B 2FB4H 2AW2A 3JTTB 1KB9J 4QRTA 1OLLA 1WZ1H 2AK1H 4MLSA 1FPTL 3WO4C 5D7IE 1T2QL 2JJWA 5GS1C 3QUKA 3C6LB 1A7PH 4JDZB 1WFUA 4ODWA 4YIQA 2R15A 1ITBB 1DQQA 3FB6B 5IW1A 1T0PB 3VFRB 3LRGA 5H8DA 5MEQA 4M6OL 1ZA3A 5IB4A 4F7MA 5HYJA 1N6QL 12E8H 1RU9H 3GSOB 4A6YH 4LSPH 3AC0A 4I18C 3VXQB 3SGEH 5J6GA 3QRGL 5MERA 3C5ZD 3ROLA 1ZHLA 4ZUVA 1D9KA 2Z92B 5IHZB 4MSWA 2NX5E 2AJZA 1NUNB 4WGWB 2E7LA 5C07E 5EU6E 3GSXA 1N0LA 2IJ0C 1FH5L 3VH8A 5KAQG 4YDLC 1GZPB 4IRJC 2FIKA 4Q7DA 5IVXB 3MNVB 3LH2L 3QEHA 3P30L 1JPSH 1RV6X 2VTFA 1A7RH 4FZEL 4ZYKB 3TNNA 3MCLH 1XZ0B 2ED9A 2Q8BL 3N1MC 4MQXD 4P49A 4XMKL 3IVKA 4N90E 5IW6B 2R1YB 2FD6H 2HTKD 1PGRB 1W72H 2DLFH 3WDIA 5ANMA 2BK8A 2BMKB 3ARFC 2RGSA 4G42B 5HYSG 1TJHL 4JANB 3PWNB 3DV6B 3IGAB 5IMOA 3BQUD 5T1KD 4H20L 5FGCE 1ZOXA 3EYOB 1Z0NA 1Z9MA 3MA9L 32C2B 1ES0B 3B8YA 3MUY1 1KSRA 5C0ND 5DHVH 3RJDA 2AV1B 4YGAB 3RWHB 4PYHA 4AEHL 5SX5K 2OP4H 1AXSA 1R3KA 2UVEA 3B2VH 3SDXB 1HHJA 3T0EC 3KYAA 3UCRA 2KZWA 3EOBB 1D5XA 4KMTH 4C58B 1MFDL 3GMRA 1AXIB 4MNHA 2Y36H 2HJFB 2CRYA 1OHQA 5D2LF 4TUKH 3RVXD 4Y2DA 1OAXH 1F90L 2AERT 3ULVE 2D0FA 3SDXE 1UB5B 1V3LA 4TVPH 3TESA 2LABA 1SJXA 1JNHB 1W0YT 1YPZB 1FL6A 1F2QA 1KJ2L 1MJ7H 2X4PB 2CGRH 3IRPX 4NOFA 2DL9A 1WT5A 4NQEB 4WFED 4UZGA 3MRQB 4U0RC 2HT4D 3O11B 5GPRA 1MHEA 4NGHL 5F70A 1F3DH 2R39A 3MSPA 4P2QB 1NBYB 4TSBL 3HMXA 1EHAA 4GRWH 4LARL 1NC2A 4JG1H 4WTZA 1Q0YL 1YPZE 3D85D 4AL8L 1NGYA 4U7MA 2ZUUA 4IRZH 3SGEI 4OLXH 1KIUA 3OL2A 5EZIL 4ODVH 4JKPL 2L4OA 2EIBA 4N0CC 3S98A 2EDHA 1QFUH 4CUCA 3T8XA 3A0OA 1WZLA 1AE6H 4PJ8C 3M8OL 1S7RA 3AU1B 3DV4B 1TJGL 4KJPD 3MRPA 2EE3A 4N0UE 4WIQA 3ALXA 4N8VB 3QXVA 5JW3H 1QBMH 4Y88A 1U8LB 3TA3A 1EEQA 1LDSA 3GJFK 4JO2L 4HKXA 4AYFA 1I85A 1A14L 5A2JH 1JNJA 3Q5YA 3NAAL 1DVFD 3GSQB 2A0LD 3NFSH 1KCSH 1JZ2A 5SWSB 3QWQB 4N8PA 3VD3A 3VXMD 3BX7C 1AGBB 4ZXBB 5L7XL 1HH6B 5HHPB 4BSVA 2OI9B 3CH1B 3ZSTA 5C6PB 1GGBH 5CKGA 1JUFA 4ZFOL 5E08H 4LLDB 5D5MB 4HEME 4EN3A 2PXYC 2YC1B 4P9MH 5HHPA 3BZEA 1CFSA 4HK0B 2E27H 1SYVA 3DURB 3DGGB 1CN4A 1RZKL 4G7VH 1QSFE 4CU7A 5E8DH 1IEBB 4DUXA 3PWJB 3ARBD 4L8SA 1RK0A 4JY6A 4JHZA 3LSOB 3QCTL 3PWPE 4D9LL 1EV2E 4ODTH 4M6MH 5GGVY 2ARJB 3OJDB 3HZKA 4JJ5A 5D71H 4GRLC 1MJUH 2DS4A 2QKIB 1ND0B 4OAWB 2EEAA 2AK4E 1N7MH 1I3RA 1NBVH 1I8IB 3DRQA 3RNQA 3IB4A 2V5MA 5EU4A 4G8EA 4QEGA 1K3IA 4EDWL 4HIIB 1D5ZA 2D03L 3KJ6H 2EYTA 5F9WC 4ZFGL 5EIIB 4BFIB 4AH2A 2KKQA 2EIZB 4NJAH 4P9HC 3AMKA 4Z7NE 5DD5L 5JIHA 5LVEA 3PDGA 4XXCA 5FGRA 1TETH 2VDKL 3S36X 4F15B 1MIEH 3OR7A 4X80H 2OJZH 2X4NB 3RX7A 3LMJH 1MCNA 2NW2A 2WUCH 3F8UB 4DFIA 1QNZH 4OM0H 4X9BA 2X4TA 2MQ0A 2HKFH 1KEGH 3HG1B 3MLWL 4YNYA 2AV1A 2YMXL 1NMCC 3CGTA 1T04A 3CSPA 2P5WA 4P2OC 4M5ZH 2JB5H 1B0WA 1DLHA 3HC3L 3GBMH 3SJVD 5FYLL 5FECA 5C0DB 1CIDA 4KUZL 1ZKAA 5SWQA 5EN2B 5BRZE 2FGWH 3MRNA 4GSDH 7CGTA 3PWNA 1WC7B 3LQAH 1MEXL 4K94C 5DFTA 1EGJH 4I2XA 5E2UL 1CQKA 4NKIH 1FBIL 4WTZG 4P23C 2R69H 4JFQB 2AJYH 3Q3GA 5LCVH 1BBJA 3TNMB 3CDFA 1J8HE 3PP4H 5CMAA 3ARDC 2FX8H 5DUBA 3RI5K 3DSFL 2BY2A 5LKNA 3KGRA 4LLQB 4RFOL 5MHSD 1FIGL 3SKJL 4ZS7L 2AJXL 4WI5A 3MRJA 4N0UA 4OJFL 1ZLVH 3WFBH 4H20H 4BUGA 2FJGB 4TVPE 1A6ZB 1KCUL 5HYJB 5FO7B 3LKRB 3ILPA 5DUPH 4H25B 2E7CA 4YHNB 3QQ4A 5F6HJ 4LAQL 2C1OB 3BZ4B 4ONFL 1RJZA 1ZWIA 2H6PA 2CK0H 4GOSA 4LCWA 4YUEL 1YN6A 1RZFL 4P5TC 4HV8A 4RBPK 4CU8A 4KMTL 5JOFB 1JWSA 2R2HA 3MACH 4D8PA 3QIWC 2F5AH 4BH7A 4FQCL 1UWEH 1FV1B 1CE1H 3EUUA 3PNWB 1G9NH 5KSBA 5EBMA 4PRNA 5F6IB 5GS0L 2Q3AA 3DMMA 5DRNA 3MCLL 3C2AH 2BVEA 1J0YA 4TUJB 3LS4L 3A67H 3HMXL 4HAFA 2OJEA 2JK5A 5INCA 4GT7A 5IBUB 5BV7L 4HIJB 1S7SA 2EKJA 2ZUYA 5DFWH 4RQQB 1UJ3A 5D1ZD 1F13A 2PTUA 1A4JA 4LPCA 4ONGL 1NCBH 2CKBA 1OGAE 1H3VA 3A6BH 3T3ME 4AENA 3V7AG 4Y2DC 3RVWC 1YNKL 4L9LA 4QTIL 2A9MH 5FYKU 4J6RL 3DX7B 3UBXA 3U30B 3MRLB 1PG7X 4G5ZL 4I1NB 2IPKA 4PB0L 4M4RA 5IB5B 5BV7B 1MCLA 5JW4R 1M7DB 5GSVA 4NWUL 2DJ4A 2DM3A 4Y4KA 4U7KA 4JDTH 2M1KA 3O4LA 4NUJA 3UAJC 1A3LL 1T7WA 4ALAH 1P5VA 1YY9D 1AKJB 1DANU 3PWVA 2QQNH 1U8JB 2B2XL 1T1WB 4KJWD 3VFTA 1FNEB 4W4NA 1S9XB 3HUJF 1SVCP 3TGXA 1F4XL 3SDYH 1KNOA 1B6UA 1CD1A 4JM2B 1Z5LB 3MLTB 2GUOA 2AJVH 1KG0A 1FE8H 1HQRA 3GGWA 1P53A 1AGCA 1ETZB 2ERJB 3IXTB 4YLQT 5DMGC 4NWTH 3D3VA 3MXVL 3CSGA 1W0VB 3TPKA 4OUUA 5KVEL 3ALWA 4R96B 5D1XB 1VFUA 3HLAB 1RIUH 5I66B 5T3ZE 1FFNA 3VGEA 2B5IB 3PDOA 3QIWB 1G7QA 5E6YA 1EXUB 5F7EL 3VFUB 1OP5K 5K93A 5DQJA 2IQ9L 3CC5A 2EDKA 4XXDB 4YDJB 4LRNL 4IRSA 1AE6L 1UJ3B 3V4UH 3FQNA 1S7SB 4W6WB 3VXSE 2KL6A 3BDBA 2DBLL 3QR2A 3P77A 2RJMA 2XYCA 5TE7H 1BREA 5ALCH 3KYOB 3BESR 4RAVB 3BEWB 3G6JF 5HHVH 5KVDH 1CGTA 3O3DB 4I3RH 5JMRA 5HHNB 4HC1H 1RIVL 3LEVL 3ARXA 3IU3A 5ACLA 2Q7YA 3D3VE 4M9PA 5LG1A 3DI2B 4YXHH 3TZVD 5DD0H 1I3VA 4MZ3A 4KKNA 3MRMA 5C7XL 2Z8VC 4PJXF 3ZYOA 5SWZD 4HWBA 4PJ7B 3F12B 2R1WB 3VW3H 2R9HC 3HC3H 1RJYA 3L3HB 3TT1L 1F6FB 4UI2A 2MMXA 3KS0H 4X6CB 3QIBB 3MV8A 4DAGL 4G6MH 2ZNXA 2DD8H 1JN6B 1N0XL 5JIPA 3QUXC 1VKXB 5E9DD 2HT2D 1U3HC 4XAKE 1E4WL 4WJ5B 1BD2B 5KSAD 1H0DA 1CK0H 2XXMB 5J3HC 5DJ6B 1RZ7L 4XCYB 3B43A 1UM6L 5JO5B 3OXSB 3TH3T 1MRCL 2B5IC 4Q9RH 5CMAB 3ULVF 4RMVA 1V7NH 3L3IB 4YR6A 3S37X 1QLFB 4OLZH 4YFLF 5JPNB 2J88L 4YHNA 1I3GH 4FXGA 3BN9D 4UU9B 1S7WA 4PJXE 2DJSA 4DOHE 1QNZL 2A73B 2YD6A 3P0YH 5HD8D 2YBRA 2WBJA 5BVPH 3BQUC 5D72L 4E42A 2QSVA 1OWRM 4M5ZL 1ZHBB 4U2YA 1XF2B 1RHFA 3WD5H 1NCCH 3NA9H 2IANE 1JK8B 2HLFC 3J7HA 2PO6B 3GJFH 4QYOA 3NA4A 4WFGD 1FJ1A 3WSQH 2P8MA 5SWZB 3KHOA 1XR8B 4PP1C 1V7ML 3AFLA 4OF3A 3E2HB 5HPMB 4EVNB 1BEYL 5LXGH 4QHMA 5D7LE 2IBGA 3VD4A 3U79A 3GSWB 4KKCD 4DJMA 3O3EA 5DMKA 5AYUH 1ONQA 3GUTB 1PG7H 4KTEH 2ZSWB 4EEEA 3FO0L 3DTXA 3MOQA 5C09B 1HZHL 4QHLB 4QTHA 3L3OB 4TQEH 4WW2B 1AI1H 2AXJA 1BVLA 3D3VD 4YHKL 4GUPA 4MQ7A 3MRNB 4PRIB 1OTUC 4QO1A 2V2XA 4GRWB 3I9GL 1IM3A 5I75B 1IAIL 1YECH 4HPOH 1XCTB 2NY2D 1DLHB 2HFEA 3WL9B 2X4QB 4K7PH 1YJDC 1EA9C 5FOBB 4R8WH 1FVDA 1U8OA 3SGJA 1WSST 1F42A 4L8SB 3IJHA 3MJ7A 4KZDL 4HHAA 1G9MC 4Z7VF 4JO3L 4MA8L 1R3JA 4P99A 3GDBA 4NQEE 4RGNB 4JFHD 4JN1L 1OLZA 4Y4KD 1E6JH 5JHLH 5LBSL 1OSPH 2ADIB 4OCWH 3KLAB 3MQIA 4ZOBA 4WTXA 3QHZH 2F5AL 1U9KA 4LPXA 3CVHH 4U1IB 2PYFB 5GS1B 4OGZA 1J1XH 1MHPL 4S1SH 1KIQA 1FYTD 5CSZA 3DO7B 3MLSL 1LEKA 1G84A 1I3RB 4X6EA 4WY7L 4M43L 4D9RE 4XVUC 3KYKL 1YY8B 1IQDB 1NCWL 2F54D 4OCXH 2YKLL 5E1AB 1DUYA 3IFOB 1P7KA 4NZUH 1QVOB 2P42B 3CVIL 3HZVB 5J12B 1XCQA 3OF6D 1I1AB 3D2UD 2Z31C 5T5FL 3QO1B 1QHPA 5C86A 1T03L 4OI7A 4FFZL 1H3PL 1CDCA 3U83A 3ZYZA 1AD0B 1QPPA 2VAAA 1JF5A 4QKXB 1JIBA 3RVTC 3SCMA 4LSQL 4KVCH 4HK0A 4UBDD 2I9TA 5B38B 1DBAL 5JHDA 3FONB 3BMVA 4PGBA 3U48A 2PYEB 2WMPA 5CJ8A 4GRMB 2XWJA 3HE7D 1MRFL 3DBXA 3ARRA 1V05A 4G5ZH 4WV1A 4JRXB 1G7LA 2EEDA 2AVGA 1JFQL 5INDA 1ZVSB 1RFDH 1J05B 2X7LA 1MY5A 4F33B 3WKML 4U6TA 4PR5A 4QRRD 5D96C 1IAOA 4PREB 2GJ6E 2XPGB 2CJUH 1OPGL 2GSGA 3P11L 3FKUS 4AEEA 5DUMH 2NY3B 4M7LT 4LLYB 3SDYL 1DUYB 2DQJH 3C09B 1V8HA 3UTTE 3NFNB 5F21B 4PJ7F 4EIGB 1T66D 3UPRB 3OTTA 1F58L 2W0LA 4KAQH 2DN7A 4K8RL 4PJFB 1F02I 4R4FL 4YPGA 1UQSB 1Y18B 1BD2E 2X2YA 3NH7L 4IDLA 4PGDB 3FFCD 4L29A 4X6DE 2WBKA 3RNKA 4OCRH 5F9JA 1WCQA 3FONA 1WAAE 5AD0B 1T1XA 3VG9B 1CD8A 3BPCA 3AROA 2A74B 2BHUA 4G80A 1R3JB 1E27A 3I3EA 4XNXH 2YK1L 2P8PA 5CINL 1B0GB 1BBDL 1JNHA 2BSRB 1UB5A 5IWLC 4LNRB 3SKOB 4MAYC 5EUOB 4HH9B 4XCFL 2HWZH 5JPMA 4J8RB 1AFVL 3D48R 3D39B 3MXWH 2Q86B 3T0EE 4GS7C 3SDAC 1RZ7H 3FMGL 4X6EB 2GJ6B 1A6UH 2HRPH 4EXKA 5IFJB 5MEND 1RUKH 2D9CA 4BYHA 2UYLA 1CL7I 3VGAC 5HHVL 5KVDL 2R4RL 3FOMB 4BZ1L 4KRLB 1JPSL 4OLWH 4OLZL 3N9GH 2CQVA 5EA0L 1EERB 1JV5B 3X13A 1IT9L 1MWAB 4ERSH 5DD0L 3NPZB 4PP2A 4WWID 2A77H 3DYMA 4OD1H 4MXQD 4ZFOB 1FNGB 4FQJL 2ORBL 2P5EB 3VXQA 4HF5L 4ZS6D 5JORB 3QB7C 3TPUA 2OQJA 3GRWA 4X6DB 5TDOB 5CEZD 5FDWB 1U91A 5HHOA 2A6JB 1I1FB 1PD6A 4NCC2 2OZ4L 5FUZL 3FO9B 1XCTA 1YEJH 4XPGH 4Y16B 4JDZA 5ISZE 1LEGB 5BV7C 4KKLD 5D7SL 3SDDB 3ZE1F 1DE4B 1FDLL 2IAMA 5C0FA 1A47A 4AEHH 1CFQA 2HMIC 5TE6H 1LILA 2MPAH 4JR9H 3VDBA 1MI5A 4NSKA 5D5MF 4HPYL 3V6OA 5ITBL 1R5WA 5EG6C 5FB8A 4PV8B 4X9IA 4MDJA 2H32A 1WIUA 4DN4H 5F7KC 3D85B 4WI3A 1OTSC 3WIFB 1I3GL 5C8JA 2DOCA 2DWEB 1UH4A 1ZLWK 4TVPL 2CXKA 4NQSB 4XMKH 5KVGH 3F7VA 3EGSB 5FA4B 1RZKC 3QFDA 4RGOH 4M1DH 4MA1C 4G8GB 2R2BB 4FTVD 5DC4B 2Y72A 3TT3L 5D1QA 2BOBA 4JN1H 3JUYA 2IQAA 2P5ED 1A1MA 1TVBA 4MD4B 5EOQL 5IBTH 1UCTA 5IR1A 3UPAA 2GTWA 2R0KH 4Z0XB 1Y6NR 3MOAL 1CVRA 4NRXA 2XKUA 3RGVA 4OTXH 3VFNA 4QXWA 5ALBH 2Y07H 3VE0B 3ULSB 4HKZB 4QXTB 5CD3A 3NCYS 5FA3A 2OBGA 5HHNA 4ZNCD 5I1KH 3QA3B 3A6OA 3PIQA 4MWFB 3O4LD 3I75B 3UDWA 2NY6C 1CICB 2XFXA 2EZ0D 2YPLE 3D18A 4H88L 5I18H 4RZCB 4TUKL 3PGFL 2VLKE 3RP1A 1LE9A 5ENWB 3V6ZA 5DLML 5F88B 4A2LA 1BOGB 2AXHA 3SE9L 3SBWC 4F80A 1OAKL 1ZT1A 2BVUA 2OM5A 3CIQA 3GFUA 4CW1B 2DRUA 1B90A 4PTUA 4NO3A 5C9JB 1MELA 5IB3B 3WLBB 4UV4L 3JWNC 4PLJC 2RQ8A 4AL8H 1TZGH 1E6JL 4EUPH 4TNVF 3O45B 1BQHG 3QZWG 4PJDA 5HHXL 5HYFA 4NZTH 3V4PL 5CFHA 2ZUXA 1CDYA 3G5YA 1VACA 4YX2L 3ZT7A 5DUML 4Z7QE 5GS3A 3VG9C 3QH3B 3RZCA 3SKNA 4F7CB 1BQHA 1AJ7L 1AP2B 3GB7B 3P77B 1BIHA 1CD1B 4Q9CA 3B2UC 3KPNB 3MLZH 3NGBC 3GMQB 1KYOK 4YK4C 5KTEL 2IC2A 4HGKC 1SY6L 3SJVB 2YD2A 5IVZB 5DURD 3C87A 3BFOA 5HYJE 1K8IA 4M03A 1BQUA 1HXYA 1TPXC 1YMHB 2VQUA 5T33H 5JOPE 2ADGB 3C6SB 4FTVE 2N7AA 5T5NG 3U9UB 3C60B 3C6SA 1FFNB 2JIXD 3MRLA 5CIPB 2NX5B 3RKPA 3VCLA 5EZJB 4MAYD 5HGDB 4M6NH 1DBBH 3D3VB 1INEL 4ZPTB 4HT1L 4XPTH 1T5WB 2E8YA 4MYWB 3SDAB 1NGXB 3C5ZA 3T77B 4LCCC 3G04B 1GC1L 2ITCA 1JZ4A 1GYAA 1BGXL 3A6CL 3NIGF 4LMQE 3LDBB 3ZYJA 1QRNA 4JM4L 3QH3A 1FBIH 4WDIA 4PJXA 2WWKO 1G6VK 4HS8L 2COQA 4TVPD 3D85A 3U36A 2JJSC 2AJSH 1IGFH 3AUVA 4Y4KB 4UTBL 2H8PB 1A3QA 5DA4A 4XNMB 3S96B 5J1SC 2VIRA 5IR1B 3L3DB 2P48B 4Q6IB 5E4EB 4EBQL 1EHXA 4FFYL 2NY5L 4I0PB 1AR2A 1P4BL 2BSSA 4G7YL 5JXAH 1WEJL 4P2RA 1CFQB 2OJZL 3JV4B 1ZT1B 4ZG1A 2AXGB 3BKCH 1QBLH 2IAMC 4G6AD 1OTTC 3V0VB 5KG9B 4FXKA 4OGYH 2V7NB 4S1RL 2ITDB 2BNUB 2CMRL 1IGJA 2LU4A 2D7TH 2A6KB 1EJOH 4HDIA 3DVNA 5GRUH 4GW4B 3VXRA 2EYSB 4FNLL 5CUSL 3BP4A 4EI5A 2EH8L 2YRZA 4XHQA 3D18B 4KI5E 5D7SH 2AXFB 1YMMD 3Q5TA 3IDNB 4CVXA 1QSEE 3EJZC 3DYOA 4GJTB 4K3DL 3MJ6A 2Y6SD 5J1AA 3MTRA 4BQ6A 4N0UB 1PLGH 1BZ9A 2WQ8A 1S5IL 4YWGH 5EC2B 4WI9A 5IBUG 2VDLL 4DZ8B 3RHWF 1XF5A 2X1PA 1OGAD 5H37G 3RGHA 1MCOL 2DKSA 4D2NA 5T3XE 3VRLE 1ZLWH 2H6PB 2DKUA 4BZ2H 1TVBB 4F3FA 4L3CB 5LGHH 1J88A 3CPLB 1OOAA 2JKXA 5K9JH 4WW2C 3CFKA 3SGKA 4L5FL 4U1NB 2FCBA 3EJZD 4IRJB 4MJ6A 1OB1B 4D3CL 4NIKB 3ZKSD 1U91B 4OB5H 1BQLL 3VGGA 4X6DA 3PWPA 1O0VA 3QI9A 2LAAA 1RHHA 2QJDA 5BVJA 2YPLB 5A2LH 3QWOB 4L3EB 4NKDB 5GJTL 1QBBA 5HGBA 4Z7UA 2A9ML 1MNUH 3PL6D 1BM3L 4Q2ZB 4PV8A 4Z8FH 2UZIH 1MCBA 4CVZB 2LU7A 3UO1H 1QG3A 4QRPE 4PBXA 3JWOC 4Q0XL 5GGTA 1YEIH 3WHE1 5HHQA 4OBRA 2HT4C 3GJEB 2GJ6A 3MV9D 1RURL 2FH6A 3FB7A 4OZHE 4NN6B 1J8KA 1FYTA 3BGMA 4UAOB 5D1XD 5HPOA 2VR4A 2ICWB 4RIRA 1FQ9C 4WO4C 4F9PC 2EC9U 4Y16A 2H9GA 2P43B 4X4XB 5BW7A 5K33A 5HHOB 3ZE0E 2FBOJ 4NO0B 1UVQB 4X5WB 1TNMA 4Q97A 1MFAH 4QF1B 1E27B 1Q0XL 4LVOC 4OQ1A 4UDTA 3BH9A 2P5EA 2F9BT 5IMLA 3O2DA 1AGDB 2DIJA 1NCBL 4JFDB 4BH8A 1MWAA 4K8RC 3O0RL 4HCRH 5IJVB 4LSVL 1SJHA 5BS0E 2NW2B 1JHKL 4P3DB 1S5HB 3OR7B 5J6HA 2JF1A 3BZEB 1VADA 1YNTB 1CXLA 1ORSA 1H15A 3O8XC 4MMZC 1QHOA 3QDMA 1FZJA 3O6KH 3D39A 3K8KA 4XWGH 3GK8L 5FCSH 3JV0A 5GRZA 3RNQB 1JWMA 4YHIA 2AGJH 3TZVB 3AGVA 5D1QC 5J0BA 2GY5A 1KJ3L 5DFVD 4XTRD 5CCKL 4F57H 1B9ZA 5CZXD 2D0HA 1ZT7B 2YPVH 1C5DA 1P9MA 4PJ9D 4OGXL 1L7TL 1MF2H 3P2TA 3S37L 1EVUA 1NJ9A 1R5VB 1RUML 5C0CA 1J1PH 4R2GC 1ZT4A 3OQ3B 4NHUA 3EYUL 3S35L 5C0BE 2P5EE 3UTTD 4XBGA 2J8UF 2P1YA 2IANB 2IG2L 4ZO8A 3MGOB 1Q9WB 4JDVA 1HSBA 4UT6L 1AQKH 4Z7WA 5IB1B 5JHDB 2FWOA 1LHZA 4Z7WB 3T1FB 1HSBB 4HWBH 2XXCB 1CR9L 1ZSDA 5IM7B 2R8SL 1AGBA 4GQ9H 3U9PH 1SEQH 2YA1A 1NAMA 1U8QA 2Y5EA 3KPQB 4JFDA 4HWNA 3VWKD 3E8UH 5MEOA 4P2QA 4QOKE 3IFOA 3PWUB 3WDJA 2HFEB 4L4VE 5IUSA 2OYPA 3RI5F 2X4RB 2BXYA 2VDQH 3ARED 4NCDA 1KN2L 4E5XB 3CLEL 1UXWA 1TQCC 1JYVA 3LV3A 2IF7A 1ORSB 3K0WA 3GJEA 4FQLL 3WJJC 2MQ3A 2PYEA 3MV8D 3EFDH 3QUXD 5HYQA 4JZOB 3HI6L 4HX1B 3AVEA 4L4JA 2IMNA 4OI9A 5F3HA 2ADFL 1JF6A 1A7PL 2WM0A 3QAZB 1DBBL 3QEUB 2IGFL 4W68A 2IAND 4QYOB 3RWJB 4WHYG 5I15H 2MQCA 4OF5A 3WJLC 2YUZA 4HT1H 4JHWH 4LGRB 1PDKA 4H26B 1P7KB 5C08B 4GUPB 1U93A 3EDKA 4I4WB 3BGMB 4IOFC 4PRID 3I6GB 4KY1L 3FO2B 3VGAB 3IAGC 4UMGA 1B4JL 1UB6A 3CFBA 4HD9A 4JGUA 5GS1A 3IVKB 1IQWH 1Y0LA 4Y4HB 3SGKC 4DQOH 1I9RL 2BP3A 3CZFB 3K4DA 5I16A 4CVZA 1ODAA 1YJDL 4O5LL 3QPQD 4Q2ZA 4XZUA 4LVNC 3IDGA 4HUKB 3ZTNH 1HIML 4XCYA 4JHAH 3GSRA 4IRSD 1NBZA 1JZ3A 1FVEB 1NQBA 4DK6A 3MLVH 1URLA 3B4NA 2V2TA 4W6XB 1MCRA 1T6WA 2BY3A 3REWB 1IM9A 1T7XA 4PJ8A 3HC0A 3VWJA 4HUXB 2VNCA 2M8XA 3RA7L 3T4YA 4KZDH 1A6AB 2W9DL 3CAFA 4LLMA 3HAEA 2FLRT 1ZE3C 2OMBA 1M7IB 4HWZB 2R1YA 1K8DA 1QFWM 2YOCA 5F7MC 3ME0A 3L1OH 3G5VA 3Q1SH 3FT4A 4KHTL 3JV4A 4EOWL 1NGQH 4LHUG 3BH8A 2LVEA 2NX5D 15C8L 5DS8B 5DD1H 4DVBB 2WWMC 4POZD 3UJJH 3STBA 4YFLI 4WUKH 3MLSH 2BERA 2ESVA 2LQRA 1RIHH 5IFAL 4QLRA 3ZT5A 2CUHA 5L2KE 4OZGA 5GSRB 1ZEAL 2Q7NA 5C0EA 1MFBH 1KJ2H 1MJ7L 1G6RA 2CGRL 1F6AA 1C5BH 5FGSA 1S7VB 2UZXB 1X5GA 4MDIA 3T0EA 1H3PH 4HDIB 3VWKC 1E28B 4QRRE 5I9QC 1BQLH 4PY8I 5IG7B 1Q94B 4N9GB 4RISH 3HTLX 1LNUB 5KG9A 3SDAA 3F7RA 1BJ8A 3RBSA 5B3JE 4TPRH 5C07A 1U95B 4G6FB 4NKOA 4HGWB 1K85A 4JFEA 4CKVX 5HDLA 2H26B 5E95B 1WBZA 5FHAH 4LFHD 1RFDL 2Z4QB 4U1JB 1W2KT 3SOBL 4DN3L 4FFVD 1YMHA 1W0WA 3QUMA 3WYRA 1CLOL 3LY6A 3BEWA 1HQRB 2CJUL 3GGWB 3P11H 1N6VA 2FECI 4YQXL 1EFXA 1T3FB 1MCJA 4XP4H 5I1LB 3VXSD 1UEMA 4EI6A 3BPOB 1X7QB 3W0WB 3H3BC 1F45A 3QUYD 4NNYA 3GM0A 1A9EB 2J3SA 2EDOA 3LRHA 4ZPTA 5HJ3B 1KPRB 1AKJA 5IROC 2LTQB 4G8FA 3ZTJG 1G0YR 3ARFD 3F12A 3SKMB 5ACZB 2PW1B 4BQCA 4TSBH 5FM5M 4AIXA 4E41E 1FVCA 2FX9H 3KLSA 3N06B 4IOIA 4XMLL 1BOYA 4ODXA 1DQJA 4C56E 4RGMC 4NM4L 3TO2A 3LRSB 1CD0A 2O61B 5SWZE 1G1YA 4P2RD 5FCUH 2GUOB 1PW3A 4NM8H 3IAQA 5C71A 4UNVA 2XI9A 1JFQH 3E3QC 1SJVA 1D5IL 1BOGA 3GMLB 1AC0A 1BFVH 4HIJA 4YO0B 2Y7QB 4LPYA 3KWWA 4RNRB 3M07A 3WJJA 4TUJA 2RB8A 3FN3A 2YPVL 1RUKL 1T6VN 2VLLA 4UQ3A 1GGIL 4OFKA 2F5BH 5LAXA 1M7DA 5GSVB 1OQXA 1NMBH 3V52L 1F4HA 1JZ8A 3L3JB 3LN9A 3MNZA 3H7BA 3ULSA 2X10A 3RFZC 2X1XR 3QBTB 4JPVH 4IHOA 3RGVB 3VFNB 2NY0B 3EJYD 1ZWIB 4LCWB 4XI5C 5D1XA 2YRPA 4JPKL 4L4VB 1KGCD 3L95A 5HGGS 5CZVL 4XHJC 1PAMA 2HH0H 3QQ4B 4E0RB 2VZUA 3VFPA 3VXNB 1HK6A 4UQ2A 1KPRA 3LKRA 3R1GH 3MA7A 5IFHL 4NCC1 5D1QB 4MJIB 5FUZH 1TMCB 1XH3B 4Z95H 4HKBB 2EC8A 2BZDA 1WZKA 3IU4H 1HQ4A 1BVKA 3ET9F 5D93C 5E2WL 1RPQA 1JNLH 4OIIL 3MV7E 1N7ML 1JTOA 3DARA 4RAUB 4QRPA 1A0QH 5FXCH 4M48H 2XNAA 3ALPA 4JZJB 4Z5RA 4K07A 4ZXBD 3VE0A 3D9AL 5D7JB 4Z0XA 2IPKB 4H0IA 4K3EL 4ODSL 2RAMA 3CZFA 1HHIA 1QLEH 1NC4A 4RMUA 1U8NB 1M7IA 4JKKA 2WUCL 1NMAL 2CLVA 3VDAA 3BSZH 2R2BA 4RFEA 3CCHA 1EK3A 3ARPA 1OGAA 1FFPA 1SEBB 3GHBL 1O5DT 4M8QB 4P2OD 4RQQA 2OR9H 3NCEB 4KMLB 3RKDD 1IGCL 4BUHA 3L3GB 1LO5A 4N0FA 2AK4A 3GKZA 4NQSA 2AI0L 2GY7B 3DETD 2IBZY 1BPVA 2OQJB 1SJEA 3RPIB 4L3AA 1S3KH 4G6KL 3UROR 1JGVH 3MRHB 1KELH 2VXSH 3IDGB 1I1YB 4M7LH 4JLRA 3LKNA 3U0WH 3SDCD 5I17B 3HE6C 4Y4HA 1NFDE 5KW9L 2VXUL 2NY0C 4NBZB 1X5XA 5D7KE 3V5DA 4AM0A 2EDLA 1KUMA 3IDYC 4I2XB 2YEZA 1K8DB 3LS4H 4G8EB 3U7WH 3UTPE 2VLJB 3OZ9H 4DKFL 3D6GA 4D9RD 5BS0A 3QZWA 2HG5B 2ENYA 2PW2A 4YHYB 2QV2A 1ZVYA 4L9LC 5CBAA 4ODUA 1TDQA 5E6ZA 3FO9A 5HDQH 5JPMB 4RCAA 2VISB 2ARJA 4JJ5B 1IAKA 1YEEH 5EUOA 5DHVA 4HAGA 3G9VA 4FABL 4IMKC 1DZBA 5E0QA 3EZJB 4X7TA 1U8QB 2NY2B 3HE6D 2BVPB 3O6FA 2W9DH 3M1BA 4HX1A 4OKDA 3H9HA 2X4NA 3G5ZA 1T2XA 4W81A 2NY1D 4YGVA 1ZMYA 1IGTB 2VKWA 1M05B 4EN3B 2HT3C 1R3IH 1J0JA 4L8DB 1E4KC 1BAFL 1EO8H 3D25A 4OV6F 1BBJB 1RZJC 4Y4FC 3WV0A 3FOMA 5KVFL 2F54B 3KPSA 3P9LA 3P0VH 1ZGLM 5TF1L 1ZT4B 1T5XB 4NHUB 2WSKA 4JCMA 1CE1L 1FGNH 1T0MA 5HY9A 4EN3C 2CLRB 3H3PL 4PJ5D 4JZNA 5JOEA 3RWCB 4PJFA 4ZO9A 4I2XE 1KEML 4JFFB 1FNSH 4XNUL 1MQKL 2R2CA 2C1PA 1JI2A 1VEPA 2EE6A 5I1GL 4R4NC 4O58H 1A3RH 1KIRB 2BXZA 4HG4K 4K94L 3FQXB 3GO1L 3WN5B 4GLRI 5BV7H 5DVNA 5FOJA 5AD0A 4J4PD 1CFSB 5F3HB 3D69B 3CFEB 4LLDA 3MFFA 4EIZC 2PTTA 1OP5H 5FF6A 3X17A 4TPRL 1LVEA 1T7ZA 1AO7A 2DQDH 4F15C 1HH6A 5E94B 4XC3H 2X4UB 1BF2A 5T5NF 4YDIL 1AO7B 4XBGB 1ZS8B 3RDTC 5EB9A 2GCYB 1BVZA 3Q5OA 3LQAC 1UXWB 1TJIH 2G60H 2C3XA 5ICYB 4OFYA 4O02L 1X5IA 5D7IB 3QPQC 3RUGE 3FQRA 4HZLB 3MRQA 3RTQC 1U58B 2EXWD 4MNQB 3FO1B 5SV3A 2HJKB 4X4XA 3FQXA 5F7NC 3UYRL 1GJIA 1J7VR 3C8HA 4XP6L 4HZLA 1JGLL 3QHFH 2BJMH 1Z2KA 1GL4B 3AREA 4LU5H 3IFNL 5E1AA 3UTQA 4K9EL 3AY4C 3T0ED 3QEQD 1JPST 2HJFA 1KBGL 4WV1B 2EEBA 2OXGA 2AJUH 2BDNL 5DMJB 5EORH 5ESVB 2VUOA 4JM2C 5ANME 2FX7L 5HHQB 3P73B 4NDMB 1YEKL 1XGUB 2JCCA 5ICXA 2I24N 4P3DA 1I9JH 5FGBA 4RDQG 5IJVA 1A02N 1IAII 3TVMD 4J3VA 2QQLL 1TZHB 3PGDB 3QDJE 3AS1A 1NBYA 5SWSA 1I7RA 5DJZB 4LEOB 5CILH 4WRLA 1OF2B 1MIML 4S2SB 1KIRA 2BHZA 3M1BB 4IS6A 3NIFE 4QNPF 1RHHB 3RWDB 4FQIL 5F44A 3U30C 3ZYIA 2FRGP 1R3LA 3MR9B 1YY8A 4JGJA 4G42A 1DQDL 1KTKE 3WFEH 4F37F 3U4EB 3M45A 3ULUF 3FJTA 2PNDA 3N1GC 4K71C 3CFKB 3VWJD 3N1FC 4WENB 5IW6A 1I7UB 3Q2CA 3KPSB 3VRJB 3T3PE 3QZWB 1P4IL 2N1KA 4Y5VC 3OKEA 2HKHH 5ADPL 5C0AD 3VXOA 4AEIH 3FQUB 1IC4L 4OUOA 4AT6A 3D39D 3IKCB 1NUFA 4GMSL 4QHLA 2RIKA 4FQXA 1VADB 1WFOA 3QIWD 1DDHB 2V9QA 4UDUA 4ENED 1MCEA 2Z8RA 3UC0L 2FL5B 4MLIA 3QUZA 3HCVA 4NYLB 5DWUH 1IE5A 1NC2B 1BZ9B 3PL6B 2DMCA 2YA0A 4X7TB 5F7FA 5K9JL 2NY7H 2YD4A 5M95B 1EEYA 4JJHA 3HS0A 3IFPA 5GGQL 5J11C 5J89A 4PJHB 4GW1B 1FJ1B 1X5AA 3KPMA 4M8VA 3S35X 3LEYH 4CMHB 3MRFB 2FZ3A 4X98A 3O3AA 2OTWA 4PJEF 2XN9D 1DCLA 3QNZA 3NFPA 5HVGB 5E2WH 1BVLB 4NRZB 5MENE 3FB7B 1ONQB 4Y16D 3GI9L 1CK0L 3RWFB 1EEZB 2BSED 4ZAKC 1A5FL 5AYUL 3TIDB 2HRLA 4AMKH 4LCCB 4H8WC 1XF5B 3KXFE 3LN5B 1CU4L 2ZSWA 3LKNB 2OX5A 5GGTH 1HZHH 1S5IH 4YWGL 4M5YL 4XC1H 3S9DB 1QFWL 1AXSB 3BPNB 3C8KB 3U7WL 1FFQA 5IHZA 2FEEL 2GTZA 3UTPD 43C9B 2VRAA 4JY4A 1UFUA 3KPSD 4GKSA 3ZDYF 4PJAE 4XRCB 5I1DB 2WIIA 1OT1A 1IAIH 1TQCB 1YECL 4L8SC 4AQOA 3GSOA 3QWOA 4CNIB 5AAMA 1CTNA 1FORH 4GW4A 2B0SL 3I85A 5L0QC 2I5YL 1SEBA 2YBRB 4P48A 5D72H 2V7NA 1AGEB 4XH2A 2G2RB 5E9DB 4ZTPH 4A6YL 3MLUL 1KPUA 3BT2H 3C08H 2HP4A 5DQ9B 1EPFA 3EYVA 3HPLA 3TBSA 5FKAB 1JHKH 2FJHB 3TBYA 2FECL 4OLEA 4OCWL 2HLAB 2VIRB 1I4FA 4G9FD 2PCPB 5TH2A 3U9UA 4F8QA 3RGVD 3IDYB 2EIDA 1QFUL 2XG5A 1GAFL 2P24A 4HXAH 4WU5B 3H3PH 4N9OB 2X89A 4D9QD 5C0NC 4CJ1A 1G0DA 2QHRH 4HLZG 1RUAL 4KV5E 1AP2A 3DHMA 2EYSA 3I9GH 3BKYL 2Q87A 1GXEA 2PO6D 2QLVB 2LE9A 3P4MB 5IOPA 1U36A 3B9KC 3WO3B 3MA9H 4RMQA 3NTCH 3MRBA 3O41A 1XGPA 4P23A 3TCLB 4MNGA 3S88H 4DKAA 3LHPH 4I0PA 2Q7YB 3L3DA 4PGEB 5CWSB 1FC1A 1SYSA 4HCRL 4UNUA 1C12A 1CFTB 1WITA 4IOIB 1NCDL 4WTWA 3ZL4H 4HIXH 1L0YA 3ARFA 5E8DL 1WBXA 1JTTA 3LKPA 4XWOC 4GG8A 4A6YB 4GKZB 4WEBL 3QCVH 4WDIB 4I77L 1MJUL 4N90D 4I0KA 4KRPC 1QACA 2V5SA 2XA8L 2OL3L 3S8WA 5CGYD 1TVHA 1CICA 4KV5F 5I19H 1NGXA 3I75A 3DX8B 1IEAB 4GAFB 3LQMA 4HUWA 4JN2B 2ED7A 5GIRA 2D4DA 5FYKH 4M7KL 3PWVB 3REVB 4FFZH 4ELKB 4L1DA 1XIWC 2ICES 1KJMA 3BAEL 4G9FA 4YEEA 1IL1B 4EKXA 6FABL 4HULB 5KVMC 3NFSL 3QDGB 1J8HB 3EJJX 1WTGT 2DQCL 1J8HA 4ISVA 1RQ5A 2R1XB 1AQKL 4KVNH 3X12A 4PJGF 1KCRH 3P9WB 3QG6B 1Z9SA 5BOPA 2JB5L 2J6EH 4Y8DC 1LD9A 2DTSA 4ZOCA 1CICC 1M1SA 4YE4L 1TVHB 3WNMA 1IKNC 3QCTH 4O4YH 3BJ91 1A7QL 4EUPB 2G5BB 5I8KL 5DK0B 4RMTA 1O7SA 1W72A 1QSZA 2E9IA 2UUDK 4IEFB 1UJ3C 2D0GA 2BVYA 1ADQH 3K81A 2IPTH 4RWYL 2CD0A 4H8WH 4ZOAA 2C3VA 4UIKH 3OG6B 4HK3N 1F58H 1QLRB 3OAYK 4KAQL 3O9WB 4NUGL 4X5LA 1KCSL 4OM1L 4ODHH 4KKCC 4NRXB 4HGWA 5L7XH 1DEEA 1RD6A 4P59L 3FFCA 3PGCB 4L9LB 1T7VA 3LN5A 5DS8A 4DVBA 4NJAL 3ZDZF 1FLTX 1EUUA 1P84K 3IS0X 4FQLH 1A1OB 2BHYA 5IF0A 3BRFA 1FLRH 2BOBB 3MRBB 5J06A 3FTGA 3TA3C 5IG7A 1RJZB 3FL7A 1KLUB 3U7YL 4MXVF 1E28A 4G9DA 3L9RA 1MSPA 5CILL 5D2LB 4GG6E 2C4XA 3LEYL 1I7ZB 1EGJA 1S7VA 4D9LH 2J7LA 5DMIL 5EFIB 2X05A 3TN0A 3KPMB 1LWRA 4OZGB 5GSRA 5EIQA 4PRNB 5JW4Q 4FMKA 3KPRB 3K1DA 4KK6C 5ADOH 1OP9A 5IMKA 1AKJD 4PP2B 3I50H 3KDMB 4HBCH 1J0HA 3MV01 2IADA 1K5NB 1Q9KA 4EDWH 2KPNA 3PNWA 3V6FB 5DD3L 2DL2A 4H5SA 4CAGA 1HE7A 1IC4H 4QXGL 4FHBD 5JDSB 4WUKL 2EDFA 4FQ1H 1I4FB 5IT2L 1QYGH 4F8TA 2FX8L 4AIZB 4J3UA 4X4YA 1DE4A 3FRUA 5IFJA 3VA2C 3BXNB 4Z78B 2Y1VA 3BRDA 4L4TE 1NC4D 1RZGB 2ZJSL 4RMSA 3ILPB 1Q1JL 3H8NA 3HUJA 5I1IL 5BS0D 5C0RH 3IJYA 3QO0B 4ZUTB 5FYLH 2WAHA 3KPLB 4NNXB 3NBNA 1P1ZB 2EH7H 5AG9A 3LKSA 4QNPE 4RGNE 1CLZH 3RIFK 4G9FE 5F96H 4Z9KB 1Q9LA 4ELMB 4ZSOE 2BFVH 2PO6C 3KYNB 4U1MB 5FB8B 2O93L 1IC5L 3BPLC 3QIUB 3RL1A 1OD7A 1A5FH 5C0BA 4XNQA 4ZAKB 4KDWA 2OMNA 4FQCH 2MNUA 4KWUA 3OSKA 3UJJL 1A2YB 1BMGA 4HQQH 2IAMB 4K23H 5E8EA 3OR6A 4H88H 1DBML 4IIQB 3PGFH 2XZCH 3HI5H 4LLYA 3O8XD 1VESA 4MVBD 4HUUB 1INDH 3A67L 3MRKA 2R29H 4HH8A 1CLCA 5KVGL 1FE8L 5CJQH 4YNYB 4ZFZB 3NABL 5E8NB 3LD8B 3HMWH 1T04B 3KR3L 5CD5C 4WGVB 1D6VL 2VDOL 5D7JC 1VFAB 2V2WB 3FQWB 3V5HA 3P4NB 5DVKA 1NAMB 5FM4A 1NCDH 3FZUC 1EO7A 4HWEL 4ZD3L 4BQ9A 4NN6C 5DC0A 3GSNA 5DMGD 1JUFB 1L4IA 5ABDE 2HJLB 2W07A 4QXUL 3SE3A 3BIAX 5BOZG 2VSCA 4XPAL 1DFBL 3UYOD 5EO0B 4MJ2A 5C0GA 3CD4A 5F93C 2XQYK 4P2CG 4XPFH 1JGUH 2NY0D 3K2MC 1X9QA 1JF1A 4YQXH 1D5BB 4U6VH 4PRHE 3J8F7 4JFFA 3W9EB 1R5IB 5MEOB 4KZEH 4XVTL 1D5BA 1RSFA 3UP1A 1B88A 2EDRA 3H9SE 1HHKA 2ICWJ 3DX6A 1OF2A 5EU6B 3RJQB 4HC1L 4ZDHA 4S1DD 4PJIF 1GGYA 4HG4J 5FHBL 4U2ZA 3F62A 2CKNA 3DUSA 3ECBB 4OLUL 4QHUA 3T8XB 4B7LA 1A7BA 3ECBA 4KVNL 3GSVB 4AQ1B 3HE6A 5DJXB 4U0QB 4PJHE 2IANA 4P3WA 2E7HA 3BOVA 4HLZH 3QXUA 5ESVA 1R0AL 5E8OB 1J1OL 5D1ZC 5D9SA 5DZLA 1IGMH 1R5IA 2NYYD 1J87A 1I1AA 3SO5A 1UEYA 4YEFA 2F74B 3KXFB 1YQVH 2VDNL 3FO1A 2W65A 1IM3B 1BFVL 2IPTL 4OZIE 1A7OH 2XA8H 4J1UB 1LEKB 2EDNA 3MLZL 2E7MA 2KQNA 3MBEC 2R23B 1UXSB 5AUMB 5BRZD 2YEZB 1VGKA 1UM6H 3OR6B 5J6HB 3BAEH 3GJFB 4U1HB 3B9EA 1OT2A 2GAZB 4LBEB 2VO5A 5KS9A 1NFDF 1KV3A 4NHCH 2K3TA 1G7HA 3H0TA 5J7CC 2VE6B 1LMKA 4PUBH 3MJ7B 5CP7B 3GZKA 1F8TL 1GHFL 2VAAB 1QZ1A 2IQ9H 4W70A 1FSKC 3THMH 3EZ8A 2VMFA 2AK4B 4YFDB 5AG8A 4PLKD 1OAQH 3MCG1 3WN5A 4F7PB 4UT7H 2ZUVA 5MHSE 3FFDB 12E8L 1RU9L 1ERNA 4M62H 5BVJB 4ZTOL 5EUKB 3R1GL 4KU1A 4QCIB 2XZQL 4ZUTA 3RVVC 4FMFA 4JANA 3Q6GL 2DLIA 3JBG7 2VERN 3TZVC 3PDDA 1A4KA 3WIIH 5AZEL 3SCMC 3U0WL 3CPLA 2F8XC 4WCYL 4CDHA 5E8PB 4X7FC 5EO1A 3GSWA 2BSTB 2FEDC 3KYNA 1CCZA 4ELMA 2F8VA 4BZ2L 3H9SA 4TSAL 4NQXA 5DDHA 3QDMD 1DSFL 3LB6C 4X9GA 3H9HB 2NY5H 4L3EA 4LKXB 4YHKH 1T0NA 4L5FH 1D6EA 1I8KB 1AR1D 5JXAL 1XGQA 2GJZA 4IMLA 5C0RL 2EDBA 4M61B 4HPOL 3TT1H 3ARYA 2PXYD 4JAMA 5IIEB 2Z93A 2O5XH 2AQ3A 3HB3C 2JELH 4JRXD 1S7WB 2HG5A 4M6OH 4L3CA 2FJFB 3W5MA 4MHHG 4XVSL 2SEBB 1RY7B 3HNVL 3KYMA 3WSQL 5H2BB 4YR6B 3MFGB 2VUYA 1GZPA 1V7MH 4UAOC 3IJSB 4NZRH 1MY7A 3CX5J 3OBAA 1DQML 1N64H 1N6UA 1NCAH 2R56L 3FQTA 2G5RA 1BEYH 5CLWA 2X44D 5EC2A 4K9EC 4MX7B 5DD3H 5HHMD 5BW7C 2Y36L 3S96A 4JLRB 3MNZB 3QJHB 4IJ3B 1FGNL 1ZK9A 3DROB 2EDDA 3LIZL 2VZSA 4UQ3B 4ZUVB 2Q76A 4N5ED 2ZKHH 1S9WB 1AHWA 5TQ0L 3W2DH 4F7MB 1INDL 5IMMA 4POUB 4U1GC 5EOCH 3AB0B 2BNUA 3MRIA 5EU3A 4FXKB 1NAML 3JVGC 3ARBC 2EYRA 4M8QA 2Q6WB 3OJVC 1OGAB 5ICZB 3QQ9C 4NRYB 3LKOB 4XAKD 3MRMB 3BPLB 3QIUC 4OCMC 2ESVD 3V5KA 2H45A 4LCIL 1FG2B 3AY4A 4HCRA 2D7NA 2H8PA 2NX5A 3VCLB 4OLYL 5F1IA 1HKFA 2BNRA 2XV6B 2DQTL 1N3NA 4PJBA 5IHBA 5B8CC 2C3VB 4HMEA 5IHUL 1D5MB 1HWGB 2C9AA 5BMFL 4H0GA 3MMEA 5FGBC 4MS8D 2CRZA 4ESKA 1KG0B 4JO4L 3MJ9L 5FUCE 1BECA 4JGMA 3CUPB 4HUMB 1YEDA 1MUJA 3ILQC 1JBJA 1A6PA 4OGAC 5F7YC 4PJGA 1D7FA 2K7PA 1KNOB 4M43H 1PKQE 5LQBL 1JRHH 4JRYE 1CQYA 2XZCL 1F90H 1JWUA 1P6FA 2I07A 1Z3GL 4HKJA 4PJEB 1T66C 3SKNB 4F7CA 3DI3B 4R0LC 3IXAA 4TTDD 4YJZL 1W0WB 2MTPA 3L95B 3EO1A 4Z77B 1EEUA 3EBAA 2MHAA 4EQ2A 4PJ5A 3PDOB 1J9CT 4KVCL 5DEZA 4DGYL 1WTLA 1SHMA 4GRWF 2H3NA 2A9NH 1C12B 4P23D 3BN3B 5C6TL 3S5LA 2D2OA 4OLXL 1OSPL 3GI8L 1XR9B 2R0ZL 1MIMH 3HZYA 3EAKA 4NRYA 4YDIH 1N59B 5DJYA 5FO9A 3MLTA 1WIOA 1LNUA 3KPNA 1RAMA 2VLLB 4WEMB 3FB5B 1MHHB 2ZZUT 4YHML 2VDQL 5FUOH 1S9XA 4PJEA 3BGAA 1BLNA 2CIKA 5T3XD 3IDJA 3VMOA 3ARBB 4GAJL 3MXWL 5FYLD 2B20A 3UYRH 2I60L 3TIEB 4I5BB 4L8CA 5D7LA 1IAMA 5I76B 3R8QA 3S37H 1BF8A 3GNML 5GS2D 4XP9L 5DQJB 5KS9F 1MVUA 3DX7A 5F3BB 3N9GL 3T0AA 1G7QB 3OAZH 2P24B 3VFVB 3BYYA 1FAKT 4ERSL 2E9WA 3FT4B 1NDMA 4BQ8A 1DBKL 4UUJB 2CKBB 1L0XA 2SEBA 3WEXA 2WWKT 4PJ9B 5DHYB 3GBML 4CJ0A 4HJ0C 4M7ZC 1SQ2N 4NQDA 5GRXG 5KANG 1OPGH 3L5XH 4MCZA 4X8JB 4FRWA 4MAUL 4NN7C 3DMMB 5IQ7L 4WFHE 1U42A 5F7DA 1AH1A 3MV7B 3H9SD 4U1LA 1S9WA 1ZANH 3JXAA 3UZVB 1I9RH 4Y8AA 2NY2C 3OKDB 1CU4H 5J9PA 4JRYA 2IMMA 4LSTL 1FO0A 3BKMH 5GXBB 2PCPA 5TH2B 2IFGA 1EFQA 2F53A 3WIHL 3MBEB 2NXZD 2G75A 3RWIA 5BO1H 3FT3B 5J8OA 2APXA 3Q3GB 4DWHA 4OCRL 1II4E 4KTDH 4Z7VB 1FRGL 2IFFH 4LCCA 2YD9A 3CFBB 2NCMA 1FORL 1I8LC 5JXEA 1FO0H 4P5KA 2F15A 4KRPB 3G6JB 3S3PA 1KLFA 4R97B 2YD7A 3PABB 1A6ZA 3MLWH 1G9ML 2LFGA 2X6MA 3MLPA 4AIOA 5EN2A 1U2CA 2B8OT 5JIKA 1U3HB 4B53A 5T1MB 5J1TC 4D94A 1HILA 4XRCA 1KT2A 1FAIH 5IK3B 2D31A 4XCFH 2ZCHH 2XZQH 4GSDL 1IILE 1XGRB 2CK0L 4YUEH 4NZRL 3ARTA 4OGAD 1T89A 4I3SH 3QT2A 3VXRD 4YAQB 1XFPA 3BP5A 4LAJH 1GOHA 4HXBL 1OP3H 4ZO6A 4QRUB 4FQQB 5DR5H 4PRHB 5L8LB 3FQTB 4HK3J 5HI3D 1O7VA 1HWHB 5FEBA 4NRZA 4PTTB 5C0FB 3V0AC 5FKPA 1BZ7A 4NQUA 4HWZA 2CDEA 2AEQL 4WU7A 2A77L 1EJ6A 2AJXH 4D0BB 5SWQB 5CKAA 1S7TA 1A6VL 3K2UL 2Z93B 3PWUA 5DJDA 4ZFOA 2CR3A 2HT2C 2DMKA 1I3UA 1ZGLA 1MCCA 1IEBA 2XTJD 3WFZA 5DTFB 4X6BB 3MV9A 3T65B 5D1ZB 4HIHB 2UWEA 5DSCB 4NQXB 3BP6B 2X9YA 1R6VA 5DDHB 3ZLQC 1VDGA 1KB5L 3U4BL 5E24E 1U3HD 5C09E 7FABH 1T4KA 3OG4B 1Z9OA 2DQGH 3SOBH 2BSTA 1EUTA 5DA0B 15C8H 4X7CC 2JCCE 3GSQA 1OQOA 1UB6B 2BVOB 1VGKB 3U2SA 4M1CD 3B3IB 4PJIE 3E1F1 4KGJA 5HD8C 1ZT7A 1JF1B 4DUWA 5EUOF 1OWWA 3ARZA 4ORZC 2QSQA 3GIZH 1YMMB 2DQUL 2H2SD 5FV1L 3DXAD 4HJ0D 1CFVL 3WFCL 2EDYA 1BX2B 3VGHA 2X89D 4K3JL 2VE6A 4ETYA 5L6YH 4FQXC 2YD8A 4ZUSB 4QHNA 3BKJL 4FQPA 2ENSA 1LE5A 1PX4A 2UWEE 5DEFA 4ZUSA 4ZXBA 2YWZA 4PRIE 4TN9A 3S7GA 5ESAB 1NLDL 1BFOA 4AH2B 5CEZH 2MWCA 1VFAA 3G6DL 3LN4B 35C8L 5E2TL 5I30H 1K4DB 2XTJB 5EU4B 3RPKA 1NUGA 5E00B 5E8NA 1GC1H 3KHQA 2OSLA 3FOLA 4NFCA 4OIAA 1U8LA 4IM8A 3MJ9H 1YMMA 4MA1B 4KK8D 3ULUE 3MUJA 3CNKA 4KROD 2OSLB 3FOLB 3FQRB 1XCQB 3W9EA 5C08E 3MRGA 3WJLA 4QRSA 4H8WL 1HYSD 5C0BD 2ICWA 4R7NB 1HH9A 4NKMB 2WQRA 5L88H 3WHXB 4UTBH 5IB2A 1RZJH 4IIQC 4OZHF 5CSZB 3DO7A 1BP3B 1AR1C 4P2QD 5D8JH 2NXYB 1IZJA 2H1PL 2QQQA 1UA6H 1OAUH 1A6WL 2DM4A 2OTUA 1B3JA 3OAUL 2NZ9D 4Z18A 4G6AC 3EDEA 4G3YL 1LDPH 5IFHH 3MV9B 4KXZH 4ENEC 4X6BA 1J0IA 1P1ZA 2Y5TB 3L5XL 4JFZH 4X7EC 1EBAA 4NM8L 3ESUF 3EYOA 1EZVY 4FNLH 5CUSH 3U46B 4KQ4H 1RZIB 2CXGA 3QO0A 3PE9A 4YBQC 3PQYE 3P3YA 1IFHH 4JZNB 4X7SL 3VXME 4YE4H 2FNBA 2GK0A 5ADOL 4R97C 4HFWA 2Z35B 2Z31A 3QIBD 1MWAH 3BVNB 1A0QL 4ODUB 3KPSE 5JMOC 2FYYA 2CDEB 2VLJA 1MHCA 4GMTH 1I8LA 4JPWL 1SY6H 1HHJB 3LS5H 1HCFX 4NO0D 3I2CH 4XGZB 4YHZH 2IFFL 1GVIA 5TDNA 1GZQA 3QG7H 4HHAB 4KK9C 3TJHD 4I8DA 4BH8B 3SPVA 4OQTL 4QHMB 5F8RC 3NZHL 32C2A 1AGDA 4QOKB 3WFDH 5F7WC 1MAMH 5ID0A 3GHBH 5IEHB 2X4OB 2QR0B 1DQLL 4QWWD 1FLRL 1T89C 1IAKB 5B3NA 3U6RB 1FGVL 2D7MA 1LEIB 4D0DA 1PEZA 2BMKA 2XKNB 2CMRH 3E6HB 4LQFL 4G6ML 5F71A 2UV3A 4D0CA 5ACMA 2DD8L 3VI4E 2WLZA 4RIRB 4NC1C 3FAWA 5K59E 3PXHA 3MGTB 4MXVE 3V4VH 3G6JA 2BFVL 2VZTA 4ZS6C 5CSBA 4QT5A 3WDHA 4HFUH 2VXUH 2XN9B 1PLGL 3ARWA 3QDAA 1YEIL 2YUXA 1CL7H 4Y19D 3TC9A 4KJPC 5D1QD 5HPMA 3WIHH 1PKQB 2G75B 4XBEH 3RWIB 1S8DB 5DRZB 4E41B 2FD6L 1XGRA 1V7NL 2BNQD 3OXSA 5DHXB 5DEGA 1XEDA 1G7JB 1T1ZA 3OJMB 3ZKMD 2MCG1 2ZPKH 1YEGH 3TEUA 5A3IC 4JQIL 1JI1A 1U92B 3EOTH 1YEEL 4S1DC 3ULUL 3HG1D 4JB9L 3QCUH 5F7DB 2YN3A 4LNVA 4ODWB 2EE9A 1UKSA 3FN0L 2A73A 5IW3A 1NSNL 2QL1A 2XTJE 2R0WH 3AM8A 4YHPB 1NGWA 1KJVB 1RJLB 4M1GH 4TNWF 1MFNA 5E03A 4NC2B 4BM7A 4PBWD 1NGPH 2JB6A 3B2VL 3MJGX 4PJGE 2R1WA 4M7JH 4NBYB 3TJEL 1FZMA 1J11A 4TRPL 4JFXB 1ZLUK 2EKSB 3OWEA 3ZMRA 5SX4I 3U0TB 5I76A 2B39A 4ZSOB 3AAZA 5CJOL 4PJAF 4TQEL 3SO3B 3FN9A 4HUWB 3TVMC 5J1AB 5L2KB 5F97E 2AABH 1IM9D 2GJJA 3NCYP 1N5AA 1NUDA 4GBXB 1BWWA 3CXDL 1BQHB 3MA7B 2FH8A 5DK0A 3IYLW 1T22A 1X5FA 1G7MB 1CGVA 1I7TA 1J1PL 4PJ9A 4JFED 5DHYA 1VACB 3LEXA 1A6TB 1SMOA 1OP3K 1AC6A 2V17L 1WBXB 5K59F 4XXDA 5E2VH 3X12B 1A7NL 2DTML 4V2CB 4JKPH 4XPHL 1JP5A 1DLFH 3HZYB 3GSUA 1YEHH 3RTQA 4LARH 2QEJA 3G6AB 5I74B 2OP4L 3RTQB 3BGFB 4XNZC 4LSVH 3U9PL 1VFOA 3GIVB 4JKLA 3HLAA 2MHAB 1YDPB 1GOGA 2NY4B 1QR1A 2Y4SA 4M6ML 3MRRA 3VWKA 5F88A 3K8LA 4Y19E 1DFBH 4H1LG 3T2OA 1KN4L 4KUCD 1VCAA 2G5BA 3CFJB 3E6FA 4PD4K 3D0LA 4ZXBC 3IDXL 4PLJD 3MRDB 2VLRA 3CSYB 4IRSB 3D0LB 2PXYA 4P2RE 5AZ2L 4HUVA 1FNEA 1A3RL 3AAZB 1KPVB 8FABA 1YEDB 4OZHA 2NY3D 3QG6A 2NLJB 4YHYC 3VFGH 1MCQA 4P9HH 5B4MD 5A2IH 3W9DB 3Q48A 4JG1L 2Z4QA 3TO4D 2QADC 3IKKA 1MLCB 1N3NB 5GRYA 1WV7T 2FJHA 3TBYB 4UOJA 1AXTH 2HVJB 1J5OH 1CXKA 2R0LH 1WQVT 3PHOA 4JFZL 3VRIA 1FC2D 3REVA 4ELKA 3G6DH 5GIRB 4KQ4L 4NJ9H 4JE4B 3F6IA 4XH2B 4C54A 5JNYA 3MRIB 1IGML 1MCSA 1I7TB 2FGWL 5TE4H 4Y1AE 1PY9A 4NPYB 5EZOL 5D71L 3QUMB 4MDIB 4MJIE 1PZ5B 3FT2A 1L7TH 1MF2L 4RRPG 3S34H 1QR1B 4K7PY 5C0EB 2DLGA 4DGVH 5I1JH 5L88L 1MIEL 4O2FB 5H35B 3GIVA 3MO1A 3WIHA 2NNAB 1ED3A 3BE1L 5KSBB 2P4AB 5JQ6H 1FG2A 5TFSL 2J2ZA 5DWUL 1I9EA 4RFOH 4XPBL 2Y25A 3EYFB 1FIGH 1GGBL 5E08L 5JHDE 5H2BA 5B8CA 3CFIC 3FRPA 5DMYA 2ZUWA 3EJYC 2ID5A 4R2GB 5FDYA 2VQ1A 4UINH 1SEQL 5DQ9A 5T3XL 4C4KO 4OF6A 4CVWA 5HHMB 5I2IA 5DK2A 4IDJL 3TBVA 1G7MA 2H2PD 5KSBF 3EO0B 4N1EA 1OAQL 4H1LB 1U3JA 3HC0B 9CGTA 2P47B 4M62L 5TGBA 2KZ1B 4M7ZB 5TQ2H 3CVHA 3MLRL 3PIQB 5EOTB 2OTPA 1F4WH 5D96B 3Q1SL 4JR9L 4X4MA 1CGYA 4EOWH 4BH7B 1KULA 2NTFA 1J18A 5F9OH 2NXYC 3L5HA 5IVNA 2W0FB 1CLYH 4X0KA 4S1QL 5C0AE 2EO1A 3TLRA 4E9LA 3LIZH 4GRLD 1CIUA 2E3VA 4FFVC 4H25A 4U49A 1DP0A 5JR1L 2HFGH 3TJHC 3RHWK 4JFQA 1KLGA 4JHAL 3OKMB 4LIQL 5BZDB 1DVFB 1QP1A 2Z35A 3JWDH 1DQLH 1X5HA 1AGEA 1NAMH 3SKOA 4X98B 1KYOJ 1FGVH 5DUPL 4QCIA 3MRJB 2P5WD 5C0CE 5J12C 3TT3H 5KSVB 3KS0J 2PYEE 2OCFD 3B9AA 1NBZB 4XCEB 1S9VB 4G43B 3ARDD 2UY7A 1ACZA 3TBTB 1KTLA 3WXWH 3DX9B 3B5TA 5IEKA 3RWJA 4GKSB 4G8GD 5E2UH 2OTUB 1ZLUH 3L3KB 4BSWB 5DRZA 3SPVB 4I18B 3LDBC 4X4ME 3C8KA 4X5XA 4DEPC 4UT9H 5L9DH 3TNMA 4LBEA 1JZ5A 5CHNB 1NEUA 2EZ0C 3MC0A 2CKBL 1CL7L 1A4KB 4N0RA 4Q9BA 4KPHH 1A3LH 4PRPE 3GJFA 4JO4H 4I4WA 1UWEL 2AABL 3OKEB 3VA6A 2WW8A 3VXTA 2Y06H 1G9NL 2VLJE 3ZKND 2R23A 1DN0A 5AUMA 1LO3H 3M17B 5GS0H 5HXMA 2DI8A 1ZEAH 4MJID 4TULL 3VD5A 1OCWL 1U58A 1IAOB 5E00A 1QSFD 4WWKD 3G5XA 2A6IB 2DQEL 3S88L 2Y5TA 3WUWG 3WLWC 3BZFB 3ARGC 5CEXA 1MFCH 1BFOB 3HA0A 3BT2L 2AEPL 1TZGL 5AWNH 3GSVA 4APQA 1M4KA 2EIZA 4M7JL 4L1HA 5DEFB 3VG0L 2FATL 3QFJD 1SBSH 1U2HA 3QDJA 4FQXB 2NW3A 1QRND 3MOAH 4AT6B 3V4PH 1VENA 3IFLL 4OLYH 1B0RB 2BNQE 4TRPH 1KCVL 4LSRL 2FR4A 3BW9A 2VLMD 2WK2A 1OGTB