1ZVYA

Crystal structure of the vhh d3-l11 in complex with hen egg white lysozyme
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
DVQLVESGGGSVQAGGSLRLSCAASGSTDSIEYMTWFRQAPGKAREGVAALYTHTGNTYYTDSVKGRFTISQDKAKNMAYLRMDSVKSEDTAIYTCGATRKYVPVRFALDQSSYDYWGQGTQVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Immunoglobulin heavy chain antibody variable domain
publication title Molecular basis for the preferential cleft recognition by dromedary heavy-chain antibodies.
pubmed doi rcsb
source organism Camelus dromedarius
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zvyA00
4ODVH 3C5ZB 1JYNA 3LPWA 4U6VH 2O5XL 5TGBA 3BRFA 1MREL 4YBHA 4JM2A 1GJIA 1MCEA 4HIXL 4NQVB 5IIEB 4LLDB 2BY1A 3HAEB 3QUXC 2FRGP 1CQYA 1ZSDA 2LAAA 1D6VH 1RVFH 5MENB 1YA5A 5GHWL 6FABL 4CU7A 4Z7VE 4UIKL 4M6AA 3KXFD 3TA3C 3CDYA 3MV8D 4HZAA 5IB4B 2VISA 2E8YA 2CKBL 1KEML 3KPSB 3RVXC 2NY2B 3FB5A 4N0UB 4UAOB 3U1SL 4G8GA 4RIRA 5HVFB 1KGCE 4ZFGL 2CMRH 3QEHA 3BPCB 4LPTA 3TNNB 1KCKA 2AABH 3O0RL 2AJZA 1MRCL 2QADB 5C08E 1K5NB 3U46A 3UTSA 1CE1L 1CWVA 3DROA 2FX7H 4WFFD 5DI8B 5EU6D 4X4YA 1I3RA 3MRKA 2DI8A 1FNHA 3I6LE 1NC4B 4MJIA 2J6EA 3I6GA 4Y0GA 3QBTB 1C7SA 2PCPA 1AFVL 5F7DB 1WJ3A 5E03A 1EEQA 3UTOA 4OFYD 4P3CH 3UJTL 2LTQB 5T33L 3NCYS 1ETZB 2K3TA 1B0WA 1MCHA 4WDIA 1BD2D 3MLRL 1I8KB 1XGUA 4HV8A 1U8JB 3EFFB 2FGZA 1BF8A 4OCXL 3W9DB 4QT5B 4L8CA 5FYKD 3DV4A 3P0YL 4YFEA 1P7HL 1AHWB 4OSUH 3BDYH 3PJSA 4JFPA 3G9AB 3O9WA 2EDRA 4TVPE 4JJHA 3BKYH 3ZE2F 3MLXH 2EIZB 3LKSA 5K9OA 3HCVA 2P8PB 4KY1L 2ZUQB 1NGQL 3G04B 5DJYA 4JPWH 2J8UA 4NYLB 5BMFH 2R8SH 2VXSH 3IDGB 3UYRL 3DLQR 4HKJA 4IIQC 3TWCH 4V2BA 1FNGA 1TVBA 1AGCA 4LVOC 2P5WE 4OGYH 3O2DL 3S35X 3EOTH 5C0GA 2ZZUT 2GHWB 3V5KA 4GQ9H 3KPMA 3BPLC 2FL5B 3GFUA 1OM3L 1OOAA 4NRXA 1G9NC 5FUZL 3SN6N 1KB5A 3KPQA 2AI0H 3N1PC 3HC4L 4JY5L 1TIUA 5ICXA 1OLLA 5D2LF 5I6XB 1I4FA 4K3DL 3ULVC 1NGPL 4F7CA 3KLAB 4K8RC 1FGVH 3Q6FB 4JM2B 1P53A 3T3ME 1G7HB 4MLSA 4ZAKD 2N56A 3BPNC 4P3WA 1U8HB 3IT8D 5EZIL 4LPXA 4P3DA 1KLUB 1WZ1H 1JZ7A 4P9HL 1TZGH 4PIRF 5CBEB 5C3TA 2GITA 1NGXA 1UGNA 1L7TH 1LEGA 1KBGH 2Y07H 4OV5A 4L3EB 1IAIM 2F19H 1YNKH 3QEHB 1JRHH 2NY3C 3UXFA 2AJZB 4LLWB 1KG0B 5HI3C 5AUMA 3U46B 1JV5A 1OAQH 1DQMH 4M6OH 1QEWB 3VRJA 4QRPE 5BZDB 1D5XA 1ZLSH 1FP5A 1PX4A 4MB3A 4OGZA 1S7XA 4HUVA 5T3XE 3DXAD 1IGCH 3I2CH 4MJIB 4FP8L 1FL6B 2AEQH 2FEDD 3VU2A 2IBZY 4L4VB 4JN1H 5JHDD 2X5PA 3OG4B 5KZCD 5KS9F 1HILB 3NMEA 4U3CA 4HWEH 2HTKC 5I0ZA 3GIZL 2NNAB 2EDXA 1NMCC 1UCTA 5GJSH 3RUGE 4UIMB 3HZMA 4P2RB 3RZCB 4LBEB 5TDPB 4GG6B 2YPLB 5D5MB 4GS7B 1MJUH 2OBGA 4Y5VB 3MRBA 2VAJA 5GGUB 4PRAB 2R1XB 1MAJA 1ZT7B 4W70A 3CZJA 43CAB 1IAKA 1I85C 1KPUA 1Q1JL 3VFTA 3W2DL 2YD4A 1U8OA 1FNEB 2PN5A 2APFA 1WAAF 4X6EA 5LKNA 5FUOH 4Y4FB 2OR9L 1WTGT 1YEFL 3QWRD 1D6EB 3HG1E 1NCWL 2AQ3A 2BY2A 3L3HB 3PWLA 4QRSA 3H9HA 4F7EB 1Q0XH 5EIVA 1QSFA 4HFWB 4FXLA 4EN3B 3GB7B 1KB5H 2EDNA 3F6LA 3NZ8B 3VGAC 3FO9A 2VABB 3MRCB 5SWSD 4U6VL 3CJJA 1XGQB 4PTTB 3OSKA 3BH9B 4L8SA 3QXTA 1HSBB 3D2UB 1KLGA 4J3UA 5D6CA 3MOBH 4H1LH 1D6VL 1RVFL 4MA8H 1K85A 2ZUVA 2H9GA 2MNUA 2H6PA 3UC0H 3KS0J 3PDOA 4Q2ZA 1P5UA 3LRHA 4OD1L 3E6FB 2YBRB 5J12C 4JREB 3QI9D 5J3HC 1T1ZB 3ZTNL 1DEDA 1KLFA 4H1LB 2CMRL 3CH1A 1YZZA 1J87A 4JFFD 4NO0A 4ENEC 1S9WA 2AABL 3ZKMD 1T7XA 5AYQA 2O5ZH 1BOYA 4P3DB 3VFRB 1Y6NR 4L1HA 1HEZA 1EO8H 5K93A 2QQQA 2YWZA 2GITB 4YO0B 2FX7L 1KIPB 5C0CA 3TH3T 1VFAA 3C5JA 4G80A 3FQTA 3ZT5A 2VUOA 3SGDI 5J4MA 4MSWA 3D39B 2ZCKH 2IPUK 3PP3K 2WNGA 3ARFB 4WUUA 1FJ1B 1KJVB 2G9HA 4XI5C 1Q9WB 4XPAH 1J8HD 5E1AB 4CL7A 4UBDD 2OL3H 2VH5H 2V5TA 3KVQA 4KKLC 4P3CL 5EORH 5B38B 1WVZA 2XPGA 3MFFB 4IMKC 3WO3B 4OLEA 3V6FB 5GRWA 3VDAA 4X98A 2RB8A 3TCXA 3FCTA 1D5ZA 4WU7B 4BH7A 2OL3B 4XMPH 4PJDB 2VL5B 3VXPB 3BDYL 5FKPA 1X5LA 2UWEA 1U3HA 3BKYL 3TZVB 5ICZA 3M8OH 3MLXL 5I76B 5C0BB 1P7QB 4KROB 2CH8A 2OP4H 3ARDD 2LE9A 4IRJC 4D9LH 4RGNE 5KSAB 4QWWC 1RZJC 1XF3B 4JPWL 3GZKA 3MZTA 2EDTA 5BMFL 2HJKB 4RWYH 2R8SL 4CDHA 4KUCF 2JIXA 5ELIA 1H3VA 3TWCL 3HLAA 4PJ7E 4GW5A 4LGPB 4UUJB 3SDDB 2BVPB 3DYMA 4OGYL 3WJLC 2LABA 4PJXE 1F11A 3L3GB 4GOSA 1F6LL 4FRWA 2AKRA 1XH3B 3CFEB 4GMTH 1WBYB 5EOTB 3VI3E 5C2BH 2DLEA 3MREA 3DMMB 4C56D 4P46D 3BIBX 4NQDA 1LE9B 2AI0L 3TO2B 4AG4H 4PJIA 4U1HA 1OPGH 4G6FD 1DJSA 4U7KA 5DQ9A 2FJHA 1FGVL 3QCTH 2DL9A 3JUZA 2F53A 1L0YA 1JNHA 3RNQB 3QEQB 1C7TA 3MROA 3SGEH 4QYOA 4G42B 2VKXA 4JY4B 3H3PH 5J13C 4TNVF 5E1HB 2WQ8A 5J1AB 4WI2A 5TE6H 3ESVF 1TZGL 4ISVA 2CIIA 4KI5F 3OKDB 4HKBA 1L7TL 3BGMB 1E27A 1KBGL 3D9AH 3GI9H 2Y07L 4XPTL 4QXTB 2F19L 1YNKL 5DEFB 1JRHL 1C5CH 2P5ED 3P3YA 2NCMA 1OAQL 1DQML 5JLZA 4M6OL 4JEGB 4KRNA 5J6HB 4WHTA 4NRZA 1ZLSL 1N3NA 3IDUA 3DTXB 3WCYA 5KVFH 4M8QA 2XTJD 5DJDB 3NCFB 5TQ0H 1IGCL 3I2CL 4HUNB 2AEQL 5BOPA 5HBBA 4JN1L 3EO0A 3AY4A 5F3HA 5IQ9B 2HN7B 4WUUB 1CG9A 4CADA 2X44D 1MLCA 1NSNL 4HWEL 1ND0A 5DJ2B 1ZGLP 1JF1A 2A9MH 3OXRB 1FORH 1KT2A 3CDGB 5JW3H 2AERT 3MV7D 1J88A 3H9YA 5GJSL 3KR3H 5F71A 3ULUC 4CNIB 3BGFB 4G8IB 4X98B 1MJUL 2RBLA 1LE5A 3EFDH 2C7UB 1ONQA 3RVTC 2FZ3B 1WIPA 2ITCB 2I9LB 1XF1A 2EYTB 3ETBF 5IHZB 2LU4A 2ICWI 3RGHA 2QQNL 5FUOL 5CIPB 2DQFA 2F5AH 1U91B 1LNUB 3OJDA 3OAYH 4J12A 4BZ2H 1INQB 2YC1A 5EBMB 3WNMA 1KB5L 2IADA 4D0BB 4KJQD 2G2RA 3O4OB 3RWJB 2E27H 3RY4A 4ZUTA 5E5UB 4D0CB 2APTA 4P5TD 4QNPF 5HPMB 2GK2A 3EDFA 3DX9B 3IJSB 4MA8L 3F8UB 1NFDF 2Y23A 3WUWB 3BP7A 4X8JA 4YQXH 3UTSE 4W6YB 4XCFL 2QJDA 2W0FB 1MCJA 3CC5B 2H1PH 3AB0C 2J88H 3F7YA 3CU7A 3FQRA 3IAQA 2D03H 5LXGH 4HS6B 5IMLB 3O3UN 1NGWB 2BMKB 4FTVB 1C5BH 4HKZB 4Y4KB 5EIQA 3RNKA 3HE6D 3MGAA 1UVQA 5FYJE 5LGKA 3FL7A 4EZMA 3AREB 4X9HA 2ITDA 5CSZA 2O5ZL 4XCNB 3MJ9H 5J1SC 4F37K 3GSVB 4WGWB 1FIEA 4ZDHB 5SV3A 4XVUC 2B1HH 4Y2DA 1EO8L 5IJVA 1DQJA 4FQCH 3T4AB 4MAUH 4QLRA 3H9ZA 2V7HA 3GJFA 4EDXB 3MNWA 1H5BC 2ZCKL 3C6LA 3P2TA 4E5XB 2FIKA 5C7XH 3KWWB 1I7UB 2WMPA 3T65B 1VEMA 3I85A 2OL3L 2VH5L 5DRWA 5EORL 3QNXB 1D5BA 3EGSB 4YDLB 2PXYD 4HIIA 1UKQA 3MRGA 4WHTB 5E2VH 4MS8D 3RPIA 2IG2H 4HUUB 3O3BA 1OGAD 1Z5LB 3MUGB 3HZYA 4PRNA 2BNQA 2J8UE 5D2LA 2BVEA 5T1DH 4MYWB 5DD3H 3BFOA 3ARGC 1F00I 1NL0H 1AGFA 4C55A 3U4BH 4XMPL 4JFDD 3U6RB 1CG9B 4OLXH 4YWGH 2VLRD 3M8OL 5DMGD 1YPZF 3HI1A 4C59B 2OP4L 2A83B 4K71C 4D9LL 3TBWA 5IGXL 2CO7B 4UU9A 2K7QA 5JQHC 2ARJB 5FA3B 2Z8RA 2QKIB 3MSPA 2WBJC 5CBAB 4RWYL 4XX1E 1CDHA 1W72H 2OI9B 5EU3B 4EUPA 1QLRA 5BZWA 1CICD 2AXHA 5F8QC 1A6ZB 5JA9A 3U0TB 5K9QI 1ITCA 3MGTB 4XBPB 1YNTA 4IHOA 4DFIA 4Z6AT 5TF1H 1MI5B 3OHXB 5F96H 4DGVH 2Q76A 4GMTL 1OB1B 2PR4H 1W72B 1OP5H 4NZUH 2OSLB 1ZVSA 5GS1B 1OPGL 1FO0A 3F5WA 2IBBA 3QCTL 4WCYH 5H37G 3GMRB 3MRPA 2NR6C 2DTMH 3JWOH 2I07A 5KS9A 4Z7QE 1YEDA 5D1QB 3V0AC 3O2WH 2ZNWA 1GGCH 2NQCA 1R24B 4Z5RA 3KGRA 4RAVB 4HZLB 1MLBA 4MDIA 43C9A 4TPRL 5TE6L 4EI6A 4YIQB 3BZEA 4NNYB 3FQRB 1JTOA 4WHYG 1S3KH 5CJ5A 4I0PB 1NFKA 1K4DA 2XKNB 4YAQA 3GMLB 1JPFA 2E9BA 2X4RA 2Z8SA 3GJFH 1J12A 1C5CL 1RULH 1UZ8B 2QHLA 2DJUA 2FATH 3IJYB 4N0YH 3WE6B 1SYVA 4JZOA 1WAAA 4W6WB 3Q5YA 3BMWA 3TYFB 3VXSD 4BKLB 3MRLB 3SGJA 2AW2A 2Y6SC 4S0TD 4F9PC 2D31A 4K7PH 4IS6B 4ZS7H 3RWIB 5KVFL 4ODTH 1WFNA 3DUSA 4YUEH 1NEZA 1PZ5B 1JHTA 1WUNT 5TQ0L 4NKOA 2EZ0C 4XH2B 1QRKA 4BH8B 4HGWB 4M3JA 3OKNB 3MLTA 3TYGH 3WSQH 3VWKA 4WJ5A 4RGMB 5E8OA 3MJ7A 3H7BB 3MRDA 5JW3L 1D5BB 1FORL 1TVHB 5ALBL 2PO6C 2Z4QA 3O6FB 2JJUA 4M93C 4Z7NE 1EHXA 3CMOL 2Y1VA 1NCNA 4EVNA 2BC4A 5DMIL 3OZ9H 3QEUB 1GOGA 4MB5A 4O51A 1O7VA 5AZ2L 2XWJB 4APQC 2AV1B 1P7KA 5CILL 3EFDL 4JFEB 4OIIH 4ALAL 3EKCA 4R97C 1U8NB 4L4TD 3HB3D 5C71A 4NQXB 4HBQA 4M62H 2F5AL 4JFXB 3VD5A 3TO4A 4EQ3A 1QHOA 1MRFH 3TBTB 1HI6B 4GW4A 4BZ2L 3CSBA 5SWQA 1NBYA 3ZKSD 2GSGA 5DO2D 4QF1B 4F80A 3WN5B 1U6AH 4JFHD 4L3AA 4AJ0A 2ZOKA 4JANB 5D7JB 1DE4B 5HDLA 4AK1A 1FO0H 5TE4H 1P4LA 4P48A 2E27L 2H3NB 5KSUB 4OZHF 1EDQA 5DMJB 3QUZB 5E6IA 2EEBA 32C2B 1XGTA 3S5LA 4G5ZH 3RHWK 2C3GA 3PXJA 4AEIH 2Q76B 1H3PH 2DQUH 5DC9B 4N8VG 4PB0L 3I02B 2GSIB 1X5XA 1CFNB 4D9QE 3STZB 5DQDH 2H1PL 2J88L 3L3DA 2F54A 1AKJA 2J12B 4UQ2A 5FGCB 1A7NH 5HTSA 2D03L 5LXGL 1GXEA 5FO9A 1Z9SA 1C5BL 5C0CE 2K9UA 1WV7T 4Z0BL 4OQ1A 4MQTB 3WIFA 5GISL 1E4JA 5L2JB 1CFBA 4H25B 1N8ZB 1MF2L 3MJ9L 4R4BB 3BH8A 1MLBB 5CZVH 1M7XA 1CI5A 4EI6B 4LMQI 2B1HL 4M1DH 2V9TA 4FQCL 5C6TH 4M48H 4UINH 4MAUL 3FO2A 2GJ6A 3LKNB 4JRXE 5C08B 2JK5A 1QFWH 4QRUA 3Q1SH 3OX8B 3HUJF 4K94H 4LSPH 4R2GC 1EUUA 4PRHE 5C7XL 4KK8D 1MY5A 1ES0B 1SYVB 2NY4C 1Q94B 1YY8A 2IGFH 3C60D 2UWEE 1MCNA 5KSBF 3KPNB 3ZTJG 5E2VL 1A2YB 1WBZA 3BZFA 1B0GA 4XMLH 2IG2L 3F7QA 4HJ0C 5JIIA 5KW9L 4ZUVB 3I3DA 4P59H 3L9RA 4QHLA 4WWKA 1G7PB 5DD3L 5T1DL 3M17B 3BEWB 4ZSOB 1BVLB 1A4JB 1NL0L 5DF0A 3U4BL 1A7BA 4PGDB 2AGJH 3S6CA 4X6FA 4OLXL 4YWGL 5FA4A 3MRDB 4YHMH 3WUZA 4M5YH 4PJFE 4X4XA 3UBXA 1T2XA 3FB6B 3MYJA 1NCAH 1CBVH 4GRLD 4LFHG 5DEGB 3RY5A 4PJGF 4JCLA 3HAEG 4MJ4A 4NQCD 2PW1A 4MNQD 4PJIE 2DB8A 1W72L 4K9EC 1KIQB 4UTBL 1Y18A 2BXZA 4KQ4H 5C0AA 3DUUA 3ESUF 4ODUB 1HSAB 1QQDA 3V52H 2F53E 1H3UA 2G75B 5F97E 2EDJA 4RNRB 5TF1L 5F96L 4DGVL 5FDWA 4NBXB 2EDWA 3WLWC 2O26U 2PR4L 2R4RH 2LQRA 3CZFA 4NZUL 4OIBA 3G5ZA 5CMAA 5F6HI 5JZ7C 3QCUH 3ROLB 4WCYL 3GJEB 2X4SA 4LRIC 2DTML 3JWOL 3VXRD 1XGTB 1HKFA 4OCMC 4Z7OF 2IAMC 4P2OC 1EFXB 4S1RH 3O2WL 1GGCL 4OCLC 4WI5A 1S7WB 2ATKA 4GXUM 1K8IB 1N5AB 2IANA 4UQ2B 2Y36H 5CFHA 4MJ2A 4L5FH 1S3KL 5C07E 1FAIH 3WXVH 3DNKA 4HULB 4X99A 2H32H 4U1GC 4QRRE 1NMBH 5LG1A 2FATL 4N0YL 2IJ0C 4DOHE 5E8PB 1D9KC 2VXQH 1O0VA 4JRYA 2NXZC 4WI6A 1OAXH 1SYSB 4FS0A 3BEVA 3LN5A 5GGTH 4K7PL 1WFOA 4N9OB 4QTHA 4ZS7L 3A6CH 1OTSD 3SJVE 2H32B 1LK2B 4WO4B 2H45A 3NAAH 1IM3B 3QNZA 1IVLA 1M05B 4LSTL 4LHUA 3JTTA 4JHWH 4XBGB 2X4OA 4BFEA 4I77L 4YFDB 2IH3A 3TYGL 3WSQL 4Y16C 3G6AA 4R7NB 2ESVB 3MO1A 1A6UH 2XWBB 3FFCA 5GGSB 1BIIA 2I26N 1UH2A 2VLJA 3D3VA 5DRZA 4F2MA 5MEOA 2BVUA 1R3IH 1NFDA 3OZ9L 1AD9A 3ZL4H 5ITBH 1TITA 2R56H 5D7LA 4KV5F 1UJ3A 3ZLQC 3KPRB 2HVKB 1IBGL 1HHGA 4LSDA 1OP3H 3DI3B 2NW3A 1T1WA 1MCSA 2A1WH 3RUGB 4X6FB 3FMGH 1ZGLM 5B39B 4U1JA 2LU3A 3ROOA 1LP9F 3EW3B 4M62L 2MHAB 3TEUA 2LVCA 3RWHB 3UPAA 1MRFL 2W07A 3C2AH 4YHNA 2RGSA 1CXEA 4XPGL 3TN0D 1U6AL 1EAPB 3U9PL 4ZUSB 2D0HA 1FO0L 4ZYKA 1KB9K 4G43A 1QQDB 2DJSA 1YDPB 5IVOA 2NYYD 1U3YA 4AEIL 2HJFA 1H3PL 2DQUL 4I5BB 5L2KB 2OQJA 2EIBA 5IB5A 1CK0L 3MJ6A 3ZKQD 4DEPC 2OYPA 1GGBH 1MHEB 2P7TA 3IDYC 5DQDL 4Y4HA 4FXKA 1FCCA 1A7NL 4RMTA 4U6YB 2ZOLA 4POZC 1OSZB 5IBLD 1N6UA 4JZJB 1F45A 1KENL 3D18B 3DV6B 3TCLB 4AH2A 3S9DB 2EEAA 2H26A 2UVFA 3JUYA 1YPZA 2BY3A 4Z0XB 3MGOA 2WUBH 1IGFH 5FFLA 1A6VH 4WY7H 4MD0A 5DJ8A 4M1DL 3QXDA 1TCMA 3BW9A 5GSRB 4M48L 4UINL 1AXSB 4E42A 2BNQE 2ZSWB 1S9XA 3DGGA 4O2CA 5D2LE 3VWJB 3IF1B 4IOFC 4R4FH 3RDTC 3Q1SL 4I48A 4TTGA 3LDBC 4K94L 4LSPL 3V6OC 4R0LB 4TOYH 3O45B 3LD8C 2X41A 4U1MA 1QPPA 1FFOA 2IGFL 3B5GA 1DVFB 4RMRA 3U9UB 2RR3A 4I8DA 5DK3A 1Z6JT 1KULA 3OKLA 1UKSA 3KAAA 3T8XA 5I1KH 3FO0H 5GIRB 3QIUD 1BBJB 4XNMB 4XMLL 2X05A 3QISA 2EKSA 1BX2A 1MCBA 4UDUA 5D1ZB 3MZGB 5HHOE 2E7LA 2HLAB 4YC2B 3QHFH 5MEPA 5I16B 3JTTB 2DQDH 1MY7A 3V7AE 2BY0A 2AGJL 3CFJA 3NPSB 4HCRA 3VDCA 3QNYA 2HH0H 4YHML 1RUKH 1BIIB 2W38A 4M5YL 4ZO9A 3NPZB 5MP6H 3ULUE 1JHKH 4F2MB 5I8OH 4PJAB 1KB9J 5B4MD 5E2TH 1A4KA 1NCAL 1CBVL 2NX5E 2GCYB 2V2WA 1MCDA 1G7MB 3FT4A 4MQ7B 5IBTL 3TBSB 5D7LB 4BQ9A 2D7QA 2K1MA 4P5MB 4P4RA 3IU3B 4YH6A 3F7PC 1X5KA 2V5YA 4KQ4L 2HKFH 3BIKA 2BP3A 1HH6B 3ROOB 2XZQL 3V52L 1NCCH 1AC0A 3EYVB 5KS9E 4GBXB 4AQ1B 3PF2A 5C0JB 4H1LG 1ZHKA 1QFPA 4KRPB 4NKDB 2R4RL 5DVNA 3PXHA 1Y0LB 3BVNB 4KDTC 5IBUB 3TPUB 1IM9A 1I9IH 4PJXB 3UPCA 3R0NA 3ZDZF 4JQXC 4N0RA 3JV4B 2J5LC 3QCUL 4WTXA 2X4TA 3PGDB 2OJZH 3DRQA 4NWUH 5BRZB 3S3JA 2IQAA 1QSEE 2BVYA 4QRTA 4S1RL 5HHXH 2OTUB 1JZ4A 2OQJB 1M7DA 1WAAE 2ORBL 5EZJB 3OF6D 4DJMA 1DCLA 3F12A 4JPIB 5T5NG 1PKQB 5GRJH 3NFSH 3WBDA 2Y7QB 3VMNA 4QTIH 2Y36L 2EDLA 5B38G 4L5FL 3GKZA 5KN5B 1M7IA 2ICWB 3RL2A 5A16B 4LLVB 1KF9B 2CDEA 3UTPE 5I19H 1NMBL 2H26B 3BQUD 1KCLA 3QIBC 1AY1H 3SDAD 4XC3H 2ZUTA 7FABH 3UTTE 1TZHA 4RCAA 1FYTA 5LGJB 4JFQA 5GGTL 2XKUA 4XXCA 3A6CL 3ULSA 4KZDH 4MWFA 3NAAL 1DQLH 4K7PY 1FAKT 1CLYH 4O2CB 4BFIB 4TULH 3PL6B 4M4RA 1I9RH 4JHWL 4G8EB 1RURL 4OZHA 5DYOB 3O8XA 2C4FU 2YD6A 2Y25A 5BO1H 1Q9OA 2C4XA 2V2XB 3SKNA 5E6YA 1R3IL 4XTRC 5DFVC 3RI5K 4NM4H 1L6XA 1Z3GH 1NDGB 4F7TA 3SBWA 3UAJD 4NGHL 5HI5D 3WL9B 2FR4A 3ZL4L 2R56L 2LFGA 5FOBA 1SQ2N 1VFUA 1L4IA 4TRPH 2YKLH 3HZVB 3ZHLA 5EO1A 1QVOA 5DUBA 1I8IA 5F9JA 2A1WL 3FMGL 1R3LA 2GTWA 3K2MC 3VXQA 3D1MC 3FT2B 5EUOF 3GKWH 2WWKO 2EXYC 3FT4B 4AEHH 4XNZC 5I66B 3C2AL 4XXDA 1QFWI 3P9MA 5F3BA 3EJZD 1G6VK 1MQ8A 3RKDD 5CAYB 1ZLUK 2F54E 1HINH 4I0CC 3KXFA 3V6ZB 4XZUB 5T3ZL 1E0OB 1MHCB 3GBMH 5GGVH 1IL1A 4HGMA 1XF4A 3K80A 5C1MB 1KXTB 2G5RA 3IGAA 4Y5XC 3T0ED 2W91A 1EHNA 5KSBA 2ENYA 3P73B 2FEDC 3SDCC 1GGBL 1T5WA 2YS4A 4U05A 2NY0D 1H9VA 3JVGC 5TDNB 1VPOH 2GJ6E 1G7LA 4IOIB 3NCCB 4NCC1 1L9MA 3LMJH 1GSMA 3O81A 1KELH 3ES6A 1TJGH 1IFHH 1UA6L 3ILQD 2EH7H 5DZNA 1BPVA 4OFYA 3WNOA 1NC2A 3IS1X 4WEUD 5HSFA 2WUBL 1IGFL 1VFOA 3BDXA 4H88H 1A6VL 1JF6A 1ZHBA 4WY7L 3ZKXC 2CK0H 4PJGA 3CLEH 4V1DD 3GM0A 2ICES 5FO7A 5JPNB 1BD2A 2E5EA 3SCMD 3ARWA 4PLNC 1I1CA 1QZ1A 4JPKH 4PV9B 4OZ4B 3VJ6B 3QXWA 1QRND 1A02N 4TOYL 1KJ2H 4X6CB 1MWAA 4MCYA 5I8KH 5BV7H 3BWAA 3O3AB 3FO0L 4HPYH 5DTFA 5CJOH 3D87B 4YDVA 2YD2A 1AXTH 4FFZL 2YN3A 3FB8B 1T89C 1KJ2B 3QHFL 3F58H 4KI5E 4KHTH 3QPQD 2YK1H 1WWWX 4DTGH 3T4YB 3SO3B 4B41A 3OKEA 5DD0H 4FXGA 5C0AE 1RUKL 4YGVA 1Q9OB 4HD9A 5MP6L 1JHKL 1RJCA 3TFKD 1CIDA 1WZLA 1PVHA 5E2TL 4PUBL 1QBBA 4WV1B 4NBZB 3DWTA 1CL7H 1CZ8H 1IQDA 1KXVC 4JN2A 4M7ZB 2UZIL 1NJ9B 2VO5A 4DW2H 4WFHD 3IDXH 5C09E 2V9QA 3MV9A 5K59E 1C16B 3WUWG 4MMZC 1S5HB 1K3IA 2HKFL 1AP2B 3VD3A 5E4IA 4XC1H 1NCCL 2ICWJ 5FYLH 5HXMA 4ZAKA 5TDOA 3G5YA 4NKMA 2KZWA 3MMEB 4FABH 2CRIA 4PGEA 4PJ9B 4NO2B 3RWCB 4PY7B 1I9IL 4K3HA 3T2NH 2OJEA 2JCCB 1AGEB 4EI5D 2IANE 4Z78B 1J9CT 4P4KD 3LPGA 4QY8B 2FCBA 3FRPA 4GRWB 1FL5B 2X09A 3HUJB 1Z9MA 4PY8I 2OJZL 4NWUL 2AAVA 3ZE0F 4UDTB 4M9PA 3BJ91 3CFCH 5HGDB 3UBXI 3F7RA 5HHXL 4LSSH 5DD1H 1G84A 4N0FA 1DQQB 1NPUA 1Y6KR 4M6NH 3QUXB 1JWMB 5GRJL 4RISH 2UV3A 4JKMA 1YEJH 1J1PH 1YECH 5E00A 4QTIL 1IGTB 1RZFH 1YEHL 3FB7B 1G1CA 3DXAA 4JO2L 3FZUD 3BE1H 4JR9H 3TA3B 3EYQC 3ZYZA 3BPOC 4G9DA 3U7WH 4NKQB 4LQ1A 5E8DH 2HRLA 1MFEH 5JHDA 2J7LA 1AY1L 1E4KA 1UQSA 3L1OH 1LP9A 4X80H 4XC3L 3FFCE 1V3KA 7FABL 1UB5B 4NFDA 1ZHBB 3D3VE 1NFDE 2FECL 1N2RA 3D6GA 5JW5B 3C5ZD 4KH2A 3JV6A 1DQLL 4OQTA 4XP9H 1IQWH 2Q3AA 1CLYL 4TULL 5BCAA 1EMTH 2P4AB 5AWNH 2KL6A 4HFUH 3C5SB 5CEXA 1R5IA 4M3KB 1NANI 4MCYB 5IVXF 5BO1L 2Y4SA 4OKVB 5MEND 3K8MA 3QWOA 4GAJL 3MXWH 1G9MC 3IYLW 3WJJC 1I1AB 5KOMC 4NM4L 1A0QH 1Z3GL 5JDSB 1VGKB 3QWRA 3KPSD 5I1EH 2NY2D 3QA3A 1EX0A 4TRPL 5DHXB 4POUB 3BP4A 4U6HB 3U0PA 1J0IA 4NZDA 5EDXA 3DX7A 3MBEC 5SWSA 2JJVA 1A3LH 1ITBB 5DGRA 4YGVB 2YPKA 3KPOA 3GKWL 3RL1A 4R7DA 1UB6A 4O2FA 1YUHB 4AEHL 3QDAA 5EZLA 1JI2A 5DMKA 5LBSL 1NC4D 4BSWA 2WSKA 4OZFA 1HINL 3PGCA 1A6PA 3GBML 5GGVL 1I8MB 3QI9A 3IDJA 5F89A 3MRMB 4IIQB 1XF5A 1NDMB 1WC7A 2DTSA 3GGWB 4LVOB 2FX9H 4JFFA 4OZIF 3ULVH 1IT9H 4NCDA 1AGDA 3WFEL 4EIGB 1OGTB 2AV7A 3MRNB 3LPFA 5CZXD 4ACPA 3BPLB 1U2CA 1V3LA 5EU4A 4OFPA 3KLHD 2BNRE 4ZG1A 3EHBC 5CP7A 1YEKH 1T2JA 2GIYA 5L0QC 3MLSH 2FWOA 1HE7A 1RPQA 2NY5H 1YEGH 3OBAA 3LMJL 3LV3B 1KELL 3WEXA 1F58H 1TJGL 3Q2CA 4JFZH 1IFHL 1RZGB 1FL3A 2OM5A 3GMMB 5C0DB 3B2UC 1A1NB 1A9EA 3MX0A 3KYOB 4NDMA 5IVNA 1EHLL 4A2LA 1FNAA 4L8BB 2NLJA 1KPRB 3BPNB 4H88L 2WBWB 1NAMB 1N7MH 2CK0L 3U30C 2VZ1A 3VFSB 4JPKL 1QA9B 3VH8A 2CRYA 1AGBA 3PWNA 5FK9A 4U7SA 3P77B 1JHLL 2GQHA 1CFVH 4G9DB 3B9KC 2ZSVA 4FFWC 3LKRA 1KJ2L 3ARUA 2F74A 2D9QB 4ELMB 1R5VA 5I8KL 4J3WA 1JGEA 2NY3B 3ARDA 4JRXB 3OJMB 5AD0A 5CJOL 4JDZA 3L5IA 1BQUA 4HIHA 4X4MA 3C8KB 1BQHA 1JPSH 3L3JB 1IC7H 4PRHB 1AXTL 5D7IB 3DSFL 3SKOA 5CD3B 4HT1H 1JFQL 2HKHL 3MNVB 3F58L 5FHAH 4JM2D 4X5XA 4WW1A 4D0DA 5DD0L 5A2FA 2VIRB 1HXMA 2DRUA 3MYZA 5IMMB 3QRGH 3GSXA 4M43H 3DECA 4LKXA 2DMCA 1CL7L 3HE6C 3V5HA 1KCRH 1CZ8L 3MUJA 1NMCB 4QKXB 4C56A 4GKSA 4P46A 1FZKA 3IDXL 3QUKB 4PJFB 4S2SB 3SPVA 4MXQD 3VFWB 1D3CA 2GTZA 3VFVB 2ADIB 2A73B 2DI7A 2X1PA 3BSZH 3MBXH 4XC1L 5FYLL 5GZOC 3RZCC 2IQ9H 3UPRB 5SWZE 3PNWA 5F1IA 3IJHA 1WLHA 1T83C 2C4FT 5LJYH 3HPLA 4UT9L 5DR5H 3S96A 2R23B 4FABL 2D4FA 5CHNB 4PFEA 3U48A 2V9RA 3LEYH 4WW2F 4WI9A 4XHJD 3WS6C 4MJID 3P4MA 3CXDH 3T2NL 4ZFFA 4HC1A 1CLCA 3W39A 4X0KB 1BGXH 3QDME 4CUCA 4EIZC 1CS6A 2PXYC 3DPBA 3BZ4A 5IHUH 1ZLVH 4YPJA 1XR8A 1JZ2A 3VGAB 4F3FA 5IKCA 1OCWH 3CFCL 4LSSL 5DD1L 1S8DB 2XACC 1S5IH 2KQMA 4BA8A 4M6NL 2BVQA 2YPLD 4RISL 3UROR 1YEJL 1J1PL 1RZFL 2FD6H 3STLA 3QJHA 3HFMH 3NA4A 2FWOB 4NQSB 1OP9A 2KDGA 3BE1L 4JR9L 3BXNA 3U7WL 5J12B 4KK5C 1MFEL 4Y4FD 2BVOB 3L1OL 3QT2A 4S1SH 3CX5K 3R1GH 2YUZA 4X80L 4HWBA 5C07B 4X9GA 5EUOA 1V3MA 1M71B 2FSEB 1W0WA 4PRPA 3MV7A 1CFTA 1MCFA 1KNOB 3P4NA 1LDSA 4EN3D 1A8JH 4LCYA 2CUHA 2WANA 3V6OE 1SMAA 2QSTA 5EZOL 4DOHB 1IQWL 2QR0B 4WU5B 3WHE0 4OUUA 1EMTL 1K2DA 5AWNL 1DBAH 5E8EB 5GGRA 3D2UD 1VKXB 3S97C 4OCWH 3SE4C 3HC0B 4HFUL 1CE6A 4P57A 1AQDB 1X5GA 3IDMB 5ITFB 5KVGH 1G7JA 5B8CA 1H0DB 3FOMA 3SJVB 2SEBA 4O4YL 2CLVB 1OQOA 1ZS8B 4YFLF 4MJ5B 3MXWL 5AAMA 4N9GB 5FO8B 1A0QL 4B53A 2IFGA 5AYUH 4XCEA 4PJCF 2QEJA 3PG2A 5J6GA 4ELKA 4GAYB 5I1EL 5J06A 1TJIH 4PG2A 3MRRB 1JZ3A 4FQQA 3LEVH 4U1SB 3EOBB 4D3CH 1OTTC 3KXFE 3BP6A 1S7VB 3RAJH 3MV8E 1A3LL 5A2LH 1I7TB 2HVJA 4GLRH 5E7FA 3U2SA 1PYWB 3FO1A 3MNZA 2DDQH 3FOLB 4P5TA 2P49B 1O7SA 1A6AB 3T2OA 3X11A 5KSBE 3KYMB 1IKNC 4PBXA 2A6KB 4IRJB 3SDYH 1GOHA 3PWPB 4P2YA 5IB3B 4PLKD 5HGAA 3D39D 3A6BH 2HA1A 5F7UA 3ARFD 4HC1H 4KJWD 4WFFE 3QUMA 5EU6E 5DHVH 4LSVH 2APBA 4OF6A 3VFMB 3ABZA 4ZO6A 5HYIA 1RJLB 4WUKH 3IFOA 1E4WH 2VYRE 4GSDH 5IHBA 2FX9L 1HDMB 4UQ3B 1SBSH 1JK8A 3S96B 3ULVL 1RZIB 1IT9L 1I8LA 5DWUH 3TIEA 5DJZA 4DGYH 2X1QA 4PJGE 5F6HJ 2X4NB 3FQWB 3RA7H 5DHVB 4JFOB 1BD2E 1YEKL 3SY0B 1U8QA 1E4XL 1RJZB 3FQUA 1BBDH 3MLSL 5J8OA 3TZVD 1T1XA 3BDBA 4Q6IC 4G6AC 1EZVX 2NY5L 3G5VA 1FLTX 3C2SA 5FYKE 5C0BD 1P7QD 5DJCA 1F58L 2BOCB 3NN8A 4JFZL 4OM1L 4YHYC 5KSAD 2GJZA 5JTWA 2AJ3A 4TSBH 3JBG7 2EDOA 4HWBH 4YZFF 3R06B 1T1YA 5J13B 1S9VA 4LIQE 1OGAA 2DIJA 4GAGH 1KJMB 5E56A 3SDDD 2BRQA 4HUWB 2CLZA 2EC9T 2E6QA 4NUGH 1FG2B 2ADJA 2XZCH 3VXNA 5H94B 4TVSa 1CFVL 4LSRH 1NKOA 2AK1H 3S3PA 1T7WA 3EIFA 1QO3A 1YY9D 4Z7OE 2VLRA 4KK9D 1GH7A 3MOAH 5B39G 1QSFD 5I1DB 1JNJA 1JPSL 1IC7L 1T20A 1H3XA 4HT1L 1S9YA 1OAYL 1NFIA 3HN3A 4OUUB 5FHAL 2WK2A 3QEQD 5DHYB 2B20A 1CGYA 5GPRA 3PIQB 3OAUH 1CICA 3QDJB 3VXMB 5J57B 2DAVA 4L9DA 4DKDC 2JF1A 5HHOB 4M43L 4JO3H 4OGAD 1CFSB 1CGVA 1M1SA 2HWZH 1KCRL 3RVWD 1ZANH 4PJ8C 3CFKA 3C6SA 3T0XA 3QQ4A 1RUQH 3BUYA 4NO0D 5EH1A 5FIEA 5IB1A 2NX5B 2IPKB 4XMKH 3BSZL 2BSRA 4MNGA 3MBXL 4PRDB 4Y89A 1MCQA 4LOUD 2VMFA 2GJJA 3NZHH 3U2SB 2IQ9L 4ZXBC 1GCFA 1IEBA 3QUMH 1DSFL 2QQLH 1VSCA 1LEKA 3VA6A 2NW2A 3U36B 5INDA 1DDHB 2FJGA 1ZVYA 2Z91A 1CVSC 3LEYL 5IWLC 3QO0A 2H8PB 2BOBA 3E2HC 3CXDL 4PRBB 3C60C 5EO0B 3MCKA 2X4UB 1BGXL 5EBWA 1I3UA 4KV5E 1A9BB 4MA1C 4WUUD 5CKAA 1FHGA 3DXAE 5C0EA 5IHUL 2P45B 1F97A 4JQVA 1OCWL 5JHDE 5IVXA 1A14H 4LSUH 5FF6A 4P99A 1LP9E 1S5IL 1BOGB 3VXSA 4CW1A 1QSEB 1TENA 1B6UA 3AVEA 1SJHA 2FD6L 4MHHI 3SQBA 1FRGH 1U93B 3HFML 4HF5H 2JB6B 3H0TA 3KLSA 4MD5A 5DRNA 1JNNH 3AB0B 2HFEA 3MTRA 2WIIA 4GRLC 3EZ8A 3EJYC 1RMFH 4B50A 4S1SL 3R1GL 3QFJB 4MXVE 1QFUH 2Z92A 5LAXA 3GIVA 5IEHA 4X7TA 2V7NB 2YD5A 4LGRB 2RQ8A 3KDMB 1IGIL 1SVZA 5DDHB 1DBAL 1XT5A 1W8OA 4PJ5B 4OCWL 3UTTB 1JIBA 3OAZK 4L4TA 5KVGL 1CT8B 3P30H 5SWSE 4E0RB 3KNBB 1FN4B 2Q8AH 1H5BB 1MPAH 3L3IA 4OZIA 1CR9L 2GW5A 2WP3T 4NQDD 5F8RC 5SX4H 3HS0A 4MDJB 1JWUB 3CPLB 2CDFB 1FLRH 1ZHLA 4OLWH 4LEOA 1TJIL 1BJMA 4FTVD 4U2ZA 4Y4KD 4OF8A 2JJWA 2R0ZH 3LEVL 4ONHB 1EGJH 4ODBD 4D3CL 5IBUG 5E7BA 4AZ8A 1B88A 4LQFH 3RAJL 2BDNH 2B8OT 5IW1B 3ARED 2P42B 3ARGB 2EICA 7CGTA 2ZP0T 1ORQA 4G7YH 4JFFE 4I2XE 3ZYIA 3GSWB 3GK8H 4K71B 5JR1H 3SDYL 1NGZB 2R9HD 3CFKB 1ZWIB 4CN4A 3L7FA 4OCNC 4LVNC 3A6BL 3VW3L 3S7GA 2IH1B 1RZ8B 2DQIH 5ACZA 2WBJB 4LSVL 4N5EC 3HE7A 1AE6L 1IEBB 3BT2H 1E4WL 1A1MB 4GSDL 1SBSL 5ERWB 2GYSA 4OGXH 1J8HE 3G6JE 5DWUL 5I30H 3BWUC 4BQ6A 4ZUWB 5ESQB 5INCA 1T21A 3P0VH 4DGYL 4PV8A 4U6XA 4GFTB 3TBYA 1H8SA 1JWSB 3VXOA 1BBDL 5ADOH 4RFEB 2P8MB 1BVKB 3DETC 4F7PA 3ET9F 3Q6GH 5CINH 5C0IB 3EJJX 5CEYA 1P9MA 1PX3A 3DARA 3WIIH 4LLMA 2K7PA 5E99H 3T1FA 1Q9LA 4TSBL 5JO5A 4OKDA 3W5MA 4L9LA 3S36X 1UWEH 3DVGB 3OGOE 1EV2E 3L3KA 4P2QB 3DX6B 4LK4A 3PDGA 5H8DA 5C3LD 3ZDZE 4QCIB 4NUGL 1SJVA 2XZCL 5F7WC 2AQ2A 4LSRL 3ZO0A 2DMBA 4NO3A 2AK1L 1H3WM 1MI5D 2QSCH 5LWYH 2VITB 3B2VH 1CD9B 4XRCB 5E5MA 1S78D 3GNMH 3J8F7 1FFNB 3MOAL 5DS8A 1T04B 1XIWC 3NTCH 2MSPA 4WHDA 1O5DT 4WW2A 1U36A 3HR5A 4JJ5B 4M7KL 1HKLH 1G1YA 4Y8AA 4NQCA 4MNQA 1MJ8H 3OAUL 5D1QD 1I1FB 4HWZB 3TNMA 1FVDB 5JHLH 3X13A 5HYQA 6CGTA 4JO3L 3N0PB 5EB9A 4KAQH 5H35A 1ZHLB 1VDGA 2PO6B 1I75A 2XN9A 4M93B 3ZMRA 3A0OA 5I1LA 5KVEH 1LO5B 5E08H 3GMNA 1ZANL 4XWOD 5FUCE 2X4QB 1VFBB 1U58B 1RUQL 2VSDA 4APQB 4LDEB 4XMKL 4NHUB 1OT1A 1N5YH 4LEXH 1MHPL 3NZHL 4YK4B 4R97B 1UEMA 3QUML 2DD8H 4Z8FH 5IFJB 4TTDD 1FZOB 2QQLL 3TVMC 3HPJB 5C09B 3BN3B 2P5EE 2AXJA 1SJEA 4BM7A 4ZPTB 1Z0NA 4PP2A 5KANG 3T09A 3RWEB 4LCWB 4E41B 1PSKH 5C6PB 1QOKA 1B4RA 1HK6A 4D94A 4G9FB 1WITA 2XTJE 1DQTA 3S34L 3ZE1F 2F15A 3NCMA 1DLHB 1S7QB 4HIEA 2Z31C 5EIIA 3GSOA 5K9QG 3IFPA 5J89A 1I1YA 3NBNA 3O6FD 3TM6A 1J05B 2P47B 1C5DA 3P4OB 1A14L 4LSUL 4LRIA 3EOAA 2KBGA 4YJZL 4X4ZA 2Z0BA 3MV7E 2RFXA 4PJCA 4Y19B 3OV6A 1UWXK 4JFED 5ISZB 5IROA 1TNMA 1FRGL 4HF5L 5IM7A 4GLRI 2R2HB 1JNNL 4JZNB 3G9VA 4DN3H 3R8BB 4HLJA 1RMFL 4I18C 5C6WH 5HGBA 1MFCL 3LB6C 5J9PB 5CEYB 1FSKC 4YDKH 35C8H 3JV5A 1J1XH 4UI2A 1QFUL 3LKPB 1U42A 2A74B 3NA9L 5IFHH 4J2XA 4GKNB 1D9KA 1E28A 5A40E 5BS0B 5D7JD 4XNXH 1HXYA 2YHGA 2JJSA 3JTSB 4H26A 5JOPD 4F9LC 3D5OF 3L7EB 3P30L 4UNTA 2Q8AL 1A6TB 4MJ6B 1MPAL 5DRXA 4R2GB 4JDVA 3QHTC 5I71C 4HS8H 2NY4B 3NFNA 3OMZA 3SDXE 4O2EB 1EXUA 2UUDK 1FLRL 3OKKA 4YPGB 3U7YH 3U7AA 5I75B 1JN6A 3TN0A 1WCQA 1NQBA 2R0ZL 4JVPA 1P4BH 1EGJL 3IKCB 4XWGH 1K4CA 2V2TB 1CGSL 5DT1H 2BDNL 5IG7A 2R69H 3NH7H 4RQQA 3GRWA 3TJHC 2EDQA 4G7YL 4K9EH 3GSRB 1XCTB 3GK8L 4I4WA 5D96B 1TDQA 2YRZA 3BQUC 2Q6WA 3K7UA 1WFTA 5A3IC 2W9EH 4NPYB 3C9NB 3MV11 4HMEA 1MCOH 2YSSA 3DURB 2W60B 4QHNB 4K3GA 5KTEH 1BWMA 3PV6A 5T1MA 3UZEA 4MA3A 1X5HA 4OGXL 3WIHA 5I30L 3K8KA 5TE7L 1QKZH 3P0VL 1DBMH 1BZ7B 5GXBB 1OGAE 4ZO7A 4LNRB 3VRIA 1IE5A 4LCUA 4MQXD 5F7EH 2IEPA 3H7LA 4PYHA 3Q6GL 5CINL 2BNRB 2IALB 4JFDE 1WSST 2Q86B 2VLRE 4YHZL 2IAMB 4P2OB 5E99L 5L88H 3EYOB 4HSQA 4KUZH 3O41A 1UWEL 3W9EA 1YEIH 4PGJA 2Y5TB 2ERJC 4FQHA 5HGHA 4PREA 4WTWA 1KCSH 1R5WB 1HHKA 1ORSA 5GS3A 3E6HA 3UDWC 4RBPH 5EFIB 2QSCL 1U2HA 3ZE0E 5LWYL 4KPHH 3B2VL 3RWGB 4KQ3H 3RKDC 3LKQA 1HOCA 3QQ3A 3W11D 3KPPB 1FV1B 3GNML 3INUH 5GGRY 4NP4H 3NTCL 4NO5B 3PWVA 2NXZB 4YXKH 3WDIA 1WBXB 1HKLL 2RHEA 2FO4B 1EEYA 3T0EC 5D2NA 5JXEA 4GG8B 2EYRB 5E8NB 1MJ8L 3TJEH 4OD3H 1EFXD 4QO1A 4IRSA 2FH6A 5JHLL 4K23L 4XP5H 5DRXB 3DRTA 5CGYD 5HHMD 5F7KC 3GUTA 3QWQB 3RY6A 4HUMB 4Y16B 1GZQB 1G0XA 4OCRH 3VG9C 3OKKB 3ARBC 4FQXC 5ECJE 3THMH 5E08L 4KK6D 1VACA 4GXUN 3ILQC 3QFDA 5HVGB 4HUKB 3PDDA 4X5WA 4ETYA 1GAFH 4GQPH 2HFFA 5ID0A 3IETA 4FZEH 4UZGA 4DK3A 3C08H 3BI9X 5IVXE 1MHHA 3MJ8A 2ARWA 4NT6A 4WO4D 2ZCHH 2R2EA 2EE3A 3VXSE 1PSKL 5SWZB 5F88B 4MAYA 3MR9A 4OM0H 1HHHA 4PRIB 1U8KB 2ESVD 5C0FA 3BD4A 5L6YH 4XPHH 2DS4A 5DVLA 1CLZH 1JZ8A 2ZNXA 2FYYB 3ARPA 2J4WH 4PD4J 4ZPVA 3SDAA 4P23C 4KTEH 4YDJB 5KG9B 2WP3O 4JAMA 3QPQC 3QDMB 5E2WL 2C1PA 3JSSA 1A7QH 4WWKD 4XB8A 3KPRD 1D5IH 1T0MA 3D48R 4EDWH 4XCYA 4HWUA 4DEPB 4FFVD 1B3JA 5BW7A 1YMHA 3IDYB 1N59A 3O6KH 2DQHH 4DN3L 1H8NA 4U31A 3PHQB 1EH9A 3QIWC 2Q7YB 4BYHA 4JGJA 2XG5A 4ETQA 5AEAA 4L4TE 4YDKL 5IMOA 35C8L 3EOYG 3MA7B 5IFHL 3ZDYF 2ZUWA 4EOWH 4GG6F 5D5MF 3VGFA 1FVEB 4K2UL 3GSUB 4JPVH 4O58H 4XNXL 1FNFA 1ZLWH 5HYSB 4Y1AB 3M1BA 2A6JB 2X7LB 5E6ZA 3FN0H 2XXMB 5I8EA 1X5YA 2Y06H 4KJPC 4JFHE 4GKZA 5L2KD 3JWDC 4LDLB 3RDTB 4HW6A 1MFBH 4X8XA 3LDBB 1DUZA 1IGML 4EI5C 1CFQB 3VFPA 3LSOB 4OIAA 5T3ZD 4PG9B 1T0NB 4MB4A 2CKBA 4U1IA 5EO9A 2R1YA 1KTDA 1DEEA 3U7YL 4Q9BA 1HH9A 2CRMA 2HG5A 4ZOEA 4F57H 4R26H 4YX2L 3SEPA 4DZ8A 3CSPA 3O11A 1CCZA 3D0VB 4XWGL 2VDKH 3GMQB 3CU1A 5DT1L 3VCLB 1IARB 2R69L 3NH7L 3FT3B 1C08B 1GZPA 2AXFB 1Q9KA 1TXKA 4CN6A 3G6DH 5JOFA 4ONFH 3B6SB 3DVFA 4K9EL 3MV8B 1PKOA 3FN3A 2DKSA 4G6KL 4NJAH 2FBJH 2Z8WC 5JORA 1OTUD 4Z76B 1ZT4B 4PGZA 4X9FA 2W9EL 5DJ6B 4HMCA 2ED7A 4AENB 1X7QB 3QUYA 1F02I 3MCLH 1MCOL 1MFAH 4JRYD 4X7EC 1RHHA 2XKSA 4HWNA 1F4AA 5D1XC 1Q0YH 1MVFA 3EDJA 3L3OB 3RVVD 4POYA 5EU6B 5D1ZD 1QKZL 4ODXA 3TBVA 1PLGH 2PUQT 4RGNC 1DBML 5TJWK 1R3JA 3DYOA 4M00A 1YQ2A 5T5NF 5GQBA 4ZFZA 3OR6B 2J5LB 2QHRH 2VLJD 5F7EL 1QRNA 3TP4A 5HJ3A 1OAUH 3T04D 2HT4D 5DJXA 3EUUA 3U82B 2FLRT 3QH3A 5LQBL 4C83A 5D71L 4NRYA 4OZGE 2CIKB 3EO1B 5D7LD 1QD0A 5DK0B 5L88L 1XGPB 2VC2H 3OQ3B 4JVUA 4JFYA 1YNLH 4XCYB 3S3SA 3O2DA 5K9KB 2BSTA 2HT2D 1KCSL 1P2CA 2O5XH 4NQCE 4PJDF 1EIBA 4MNQE 3G5XA 3K1DA 4Y5YC 4KTYA 4YHLH 4GBXD 3V4PL 2EYSB 4KPHL 15C8H 4HH9B 4KQ3L 4KRPD 3IDIA 3RGVC 1B0RB 3INUL 6FABH 1KTLA 3QIBB 4NP4L 4DVBB 4Z7UF 4YXKL 3B3IB 2OXHA 1U8PB 4LKCB 4HS3B 4RX4D 5H37H 5BRZD 1IC1A 4N8VA 3NIDF 2GAZB 1IAIH 3TJEL 4YHIA 3WFCL 4XP5L 3PABB 3GSNH 4WENB 4LF3B 5DGQA 3SKUD 1LO0L 1S7RB 3KLHC 1F6AA 5F7YC 2O93L 3VXRE 5I1AB 4OCRL 1CD1A 2XV6B 2X70B 2CR6A 3N1GC 1F4YH 4W4NA 2F8OA 3THML 5ACLA 3S8WA 4K7FA 5CSBA 5IK3B 3HRZB 3GSNB 4TUOA 5D7KD 1GAFL 4R3SA 5AAWA 4P4KA 3MRIA 4FZEL 3P9LA 5JIHA 1IGJA 1BFOB 3WNNA 5KVDH 1G7QA 3FTGA 1Q9KB 1QLEH 1CDGA 3C08L 5T33H 1U95A 3UJTH 1P5VA 8FABA 4WNQA 2VQUA 1R3KA 1X6NA 2IMMA 4KKCC 2ZCHL 3ZT6A 4J4PA 1OT2A 3DBXB 1XGRB 4XNZB 2X9YA 4PJCE 2VXTL 4RA3A 1FNLA 4OM0L 4KJYB 2C3VA 2F5BH 4KVCL 1S7UA 4A6YB 5ESVA 5L6YL 4XPHL 2V17H 3I75B 1ZA3B 1CLZL 4LLUB 5IVZB 1X5IA 1N0XH 1UCBL 4KTEL 1TCRB 1F13A 2OR8A 1NGQH 2XNAB 1OD9A 4BSVB 4Y5XB 2E6PA 2R1WB 4XGZA 1A7QL 4F37F 4NUJA 2EIEA 1U8LA 4EDWL 1D5IL 2PYFB 3V4UH 1T5XB 2VLLB 3C5ZA 3SDCB 1F3DH 4PJBB 5KZCB 3O6KL 3X12B 4DQOH 1ULVA 3T3PE 2DQHL 4PJHB 5E5RB 1NGYB 5DZLA 4NQVA 5IIEA 4LLDA 4MNHB 2FEEI 3HAEA 4GW1A 3MUZ1 4MXQC 4EOWL 4JY5H 3T2PA 2AJYH 2VZOA 4JPVL 1F3JB 4OAWB 1NCUA 3ZKXB 5IB4A 3KPSA 2NZ9D 4N0UA 3V7AG 1MFNA 4HKXB 3FN0L 1DZBA 2Y06L 3BPCA 4IDJH 3TNNA 5BXFB 2JELH 4YFLI 1MFBL 3IDIB 3QYCA 3MUY1 1IEAB 2X89D 1KTLB 4XBEL 1MH5B 2RAMA 4P9HH 1T4KB 2WUCL 5DQJB 4YZFE 5DI8A 3AU1B 4F57L 1XCQB 3CGTA 4R26L 4AT6B 1NC4A 3TT3H 1CN4A 4MA7H 5F7DA 2HFTA 1J0JA 1JE6A 5ENWB 1G7IB 2KQNA 1HYSD 3KJ4C 3HNSH 4ONFL 1X5AA 1ETZA 5FM5M 3O9WC 5IV2B 1I8KA 1QR4A 1U8JA 4XNUH 3EFFA 3W9DA 4HX1B 4QT5A 1ERNA 2FBJL 5C0RL 1AHWA 3MCLL 4RWHA 4I2XB 2DIAA 1MFAL 3IDNB 4LVHC 2AJSH 2EIZA 1W8NA 1FYTD 4ODWB 5DD5H 5HDBF 5HYJB 4WNQB 1Q0YL 2P8PA 2DLHA 3EYFB 3G04A 5IB2B 2L7UA 4NYLA 4U6TA 1PLGL 3QDGB 2X2YA 3V5DB 2B4CC 2DQJH 3BKJL 2QBWA 2BCKB 5E9DB 1W0VB 3CFBB 3AXLB 4KKBD 3H2WA 1J8HB 3G6JB 1Z9OA 2QHRL 3EZJB 2PYEB 1OAUL 2MQCA 4KI1A 1A5FH 2FL5A 1SBBA 5DURB 1NCWH 3HAEH 4NUJB 2VC2L 3K4DA 1YNLL 3FONB 3O4LB 5C86A 3KLAA 1J0ZA 2A6IB 5D2NE 3Q6FA 5FB8B 1EAJA 5A1AA 4YHLL 1G7HA 2WLZA 2MKWA 4GW1B 3ZKNC 5B3JF 1SY6H 1GC1C 15C8L 1U8HA 5J11B 3K0WA 2X9WA 3BPOB 3B9KA 1XR9B 1I7ZB 1KLUA 3QO1B 1VHPA 3BRDA 3MPCA 3D25B 4PTUB 4K3EL 5CBEA 2H2SC 4OD1H 5H2BB 5FYLD 3TIDB 2IBZX 5DFWH 1JL8A 5IMKB 5L7XH 3ZTNH 3DX8B 2MQ3A 2VDRH 3HTLX 1RD6A 3SGKA 4UNVA 3H6JA 1EJOH 4L3EA 3JV0A 1IAIL 3IB4A 5ESAB 3VFUB 4CBPA 3MRHB 1P6AB 3GSNL 4LLWA 1KG0A 3QULB 4J6RH 3L6FB 1PY9A 1EEUA 2HRPH 5ICYB 2ZCLH 5IW6B 1QEWA 3BHBB 1NBVH 5BZDA 3QXVA 4HIJB 2J2ZA 3KS0H 2D7NA 1F4YL 2C1OB 5DLML 4MD4B 3MC0A 3TA3D 1FL6A 3KYNB 1VESA 4F7MB 3FRUB 3PWUB 3QXAB 1C12B 4L4VA 1I9JH 4YBLC 4ZFOB 2XFXB 1I1AC 2V6HA 1HILA 1NUGA 1NC2D 5KVDL 1QLEL 4BFGA 2NNAA 3RHWF 3MBEB 3UZVB 4UIMA 2WWMC 4P2RA 3RZCA 4LBEA 4PJEB 2E3VA 4XVJH 1B9ZA 5TDPA 1T83A 4GG6A 2YPLA 1F3DJ 5D5MA 2LV4A 1G0YR 1UJTA 1NCTA 4Y5VA 3D85B 5GGUA 2YD9A 4PRAA 2R1XA 1ZT7A 1NCBH 2P5EB 1PFCA 2AS5M 43CAA 4R96A 1QR1B 3CX2A 2F5BL 1NKRA 2I9TB 5IUSA 4Z7WE 4OTXH 2V17L 1FNEA 2VN7A 4XNQB 1TZIB 1HWHB 4Y4FA 1N0XL 4Z77B 3FJTA 1UG9A 4L8SC 2FJFB 1D6EA 1JUFB 3PE9A 1N4XH 3L3HA 5AZEH 4LASH 4F7EA 1TPXC 3EYUH 3WFHB 1JZ5A 2D3VA 3V4UL 4HFWA 4EN3A 3GB7A 2R15A 3NZ8A 4ERSL 1I3VA 2VABA 3MRCA 4DQOL 2Z8VC 4TNWK 4NHCH 3RVUC 2ICCA 1XGQA 4PTTA 5L0QB 3BH9A 1JYVA 3LKOB 1HSBA 3D2UA 2G60H 3RVWC 1ZEAH 1RZKC 5FGSA 5IF0B 3W0WB 2E7HA 1KXQE 3OWEA 1MVUB 4UNUA 3MV9D 1JGVH 2DQGH 3OKMB 2AJYL 4ONOA 3RJDA 5D7SL 4G6JH 2BSED 3E6FA 5JDJA 2YBRA 3U30B 5DFTA 2VOTA 1T1ZA 2FLBT 4H1LA 2AK4E 4IDJL 1A6WH 3DVNB 3WNLA 2JELL 2WZPD 4YHPB 2CPCA 3B9KB 2Y9RT 1NEUA 2FHFA 3ALPA 3VFRA 1T22B 3T0EE 4AM0B 1MCWM 1A3QA 2OK0H 4YO0A 1A3RH 4X7SH 1KIPA 4QHMB 3ULVD 4XPTH 3TT3L 4MA7L 3VXTB 3D39A 3RTQC 4PS4L 4X7CC 3SDXB 3L5JA 3ARFA 1MIMH 1BMGA 1FJ1A 1KJVA 1Q9WA 5MHSD 5E1AA 2VERN 2YA1A 5B38A 3HNSL 1LO4H 1WZKA 3PP3H 1U3HC 3MFFA 2FIRT 5GS0C 4RFNC 4XNUL 1IGYB 4MMXC 1T0PB 2XA3A 3MLZH 3V6FA 3HE6B 4V1DE 4WU7A 2OL3A 4P2CG 1HQRB 2VL5A 1Q8MA 2X1WL 3HZKA 4PJDA 3VXPA 1NSNH 3TZVA 1FFPB 3LRSA 5I76A 2FHBA 2AJSL 2NY3D 5C0BA 1P7QA 1QRNE 4HHAB 4X9IA 5DD5L 2DWEB 5HI3D 4OT1H 5KSAA 1DN2A 4U2YA 1XF3A 4O02H 4Z7UA 3LQMA 3H9SB 3BX7C 2HJKA 2DQJL 4M61B 3IU4H 4KGJA 4UUJA 4R96B 3SDDA 4IEFB 3VE0B 2BVPA 1PG7H 5J1TC 2OTWB 2QQNH 2VLMD 3L3GA 2W0LA 4ZO8A 2PXYB 2HTKD 1XH3A 3CFEA 1WBYA 1F4WH 1A5FL 2JKXA 3DO3A 5EOTA 5FKAB 3DMMA 3QAZC 1LE9A 3TO2A 3BN9D 3CCHB 4DCQB 3K1KC 4LRNH 4RZCB 1JPGB 4X6DB 4PGCB 4HUXB 3B43A 4WFHE 1EHAA 2GK0B 1QSVA 3RNQA 2EDHA 3QEQA 3TV3H 4GRMB 3ZE1E 1SY6L 4I0KA 3ARXA 4G42A 4JY4A 2AXGB 4LP4A 4OF5A 5FAAA 4XCFH 5J1AA 4NIKB 1KSRA 4Q0XL 3OKDA 2I27N 3HI6H 3BGMA 5L7XL 1LO2H 5F7HA 2VDRL 5EC1B 2VJXA 1G9ML 4QXTA 1EJOL 5I74C 5DEFA 3STBA 4FFYH 3RL1B 2P8LA 5HGGS 5I1IL 4ZUUB 1OVZA 3QP3A 4J6RL 1PAMA 3E0GA 2HRPL 3WDHA 2ZCLL 3AY4C 1NBVL 5J6HA 5DA0B 3GMPB 3DTXA 5DJDA 4OJFH 5J0BA 1CXLA 4LSQH 3VD7A 2ZUYA 4UV7H 1I9JL 5J3HD 4W68A 5IQ9A 1XF2B 2HN7A 3CVHB 4PJ8A 4NQEB 3U4EB 4BFBD 5TH2B 2JLLA 5DJ2A 1UT9A 3OXRA 3CUPB 3CDGA 1D5MB 2VTFA 1ZHNB 5DC4B 2HTLC 4OLYH 1S7SB 4XVJL 4CNIA 3BRGC 4G8IA 1GGYA 4LPUA 1JCKA 2IC2A 3H3BC 2C7UA 2AJVH 2FZ3A 3I84A 4DZBB 5IWLA 2ITCA 1F42A 3HZKB 1NCBL 2I9LA 4PGBB 4F33B 3U0WH 3VDBA 2EYTA 4PR5B 3LRSB 3KPLB 5IHZA 4OTXL 1DLFL 5D93C 1R3HB 4XI5D 5CIPA 1OF2B 2BJMH 5IGXH 1QNZH 4KKLD 1U91A 1LNUA 4Z7UB 3VXUB 3ZHDA 1N4XL 2ATPB 5AZEL 5MENE 3HNTH 4LASL 1INQA 3EYUL 3MRFB 5EBMA 1G6RB 5DZOA 3AMKA 4D0BA 4ZNEA 3Q3GB 3KPSE 3WKNA 5BJTB 4NHCL 3RWJA 2GUOB 4N0UE 2MPAH 1WWAX 1A1OB 2G60L 4QHUB 1ZEAL 5CS7A 4D0CA 1U9KA 4Q6IB 4CVWA 1I3GL 2VDLH 5HPMA 3DX9A 3IJSA 3VRLF 3WUWA 4IRJD 5HHVH 4YHYB 4YGAB 1V7NH 3PWPD 4JDTL 2BSSB 4HK0B 2W0FA 3CC5A 1JGVL 4QWWD 2DQGL 2P1YA 4G6JL 3T0BA 2PW2B 4HS6A 2X4PB 5IMLA 3ZDXE 1NGWA 2BMKA 4FTVA 4HKZA 4Y2DC 4Y4KA 3RUGF 3K4AA 5CEZH 1A6WL 5EUKB 4OF0A 2V5MA 3AREA 3UEZA 3BO8B 4XCNA 3C6LC 3GSVA 5FCSH 1TETH 4FQJH 4TPRH 4ZDHA 3F6IA 1NLBH 4ONGH 2OK0L 3T4AA 1A3RL 4X7SL 2EDDA 4EDXA 5T1KB 4GMSH 2HLFC 3MJ9A 4E5XA 2P8LB 3KWWA 1I7UA 1MIML 3N1FC 3T65A 5JW4Q 4YDIH 2KZ1B 1EO5A 3QNXA 2CO6B 1U8IB 3EGSA 4PYGA 1LO4L 4OI8A 2JJTA 5IOPA 3X14B 2NY1C 1RUAH 1D7FA 4HUUA 1Z5LA 3MUGA 1OWWA 5A2JH 3MLZL 4GT7A 2H2PD 5FGBC 1OD7A 4NNPH 2YN5A 3U6RA 4PJ8B 1LEIB 1AO7B 4AYFA 2NZIA 1RFDL 4L8DB 1RJYB 4PRPD 5ALBH 3LN4B 2A83A 2J1KA 3CMOH 5ANMB 3VGGA 1NH6A 4R4NC 4OT1L 4ZXBB 5DMIH 3T08A 5CIPH 3F7VB 4O02L 5ALCH 3LS4L 5AZ2H 3S88H 2ARJA 5FA3A 5CILH 2QKIA 2XICA 5CBAA 4J8RB 2PTVA 5EU3A 4ALAH 3IU4L 3QDJD 3VXMD 5I1JL 3PQYB 1A6ZA 3E2HB 3U0TA 4CMHB 1PG7L 3AM8A 3C60B 3MGTA 4Q58C 4XBPA 5HHOD 4MA1B 5HYSG 1KV3A 1MI5A 3OHXA 3R0MA 4HK3J 1CDBA 1YQVH 3KHQA 1F4WL 1OB1A 1W72A 1CU4H 2KH2B 1HWGB 2EDKA 1FVCB 2OSLA 2CDGB 5GS1A 5CCKH 4LRNL 4U1KB 1HZHH 3RVTD 4IDLA 5I2IB 3GMRA 4OZGB 4G8GE 4ZOBA 3REVB 3TV3L 5D1QA 4GRLB 4Y2OA 4PJAF 4PB0H 1HQ4B 1AD0B 3TESA 1ED3B 1R24A 4RAVA 4HZLA 3WFZA 3NIFE 1F5WA 4YIQA 4NNYA 2EXWC 2VE6B 4I0PA 3HI6L 4UTAH 3RIFK 1LO2L 2XKNA 4MJIE 3GMLA 4Z0BH 5MEQB 4OFDA 4FFYL 4K94C 1UZ8A 3IJYA 5GISH 3WE6A 2WINB 5EOCJ 1MF2H 3TYFA 1EK3A 1U92B 3CVHL 2YEZB 4BKLA 3PHOB 3WLBB 3MRLA 3VWKC 5JMOC 4MQSB 4NFBA 4MCZB 4IS6A 3RWIA 5F7FA 4PJXF 1YN7B 1MELA 1UC6A 1FDLH 1PZ5A 5JNYB 4OJFL 3ZDYE 4GG6E 2YPLE 4LSQL 3GSQB 5D5ME 1BLNB 4XH2A 2OX5A 4Y88A 4BH8A 4UV7L 1QG3A 3VI3F 3VXRB 4HGWA 3OKNA 4L29B 1ZE3C 2ARJQ 4NCC2 2XZAL 3QFJD 3H7BA 4HQQH 4M9OA 1TVHA 1IRAY 5EOCL 3O6FA 5IOPB 5HY9B 3KJ6H 2ZJSL 5KW9H 4OLYL 3BP5B 3D0LB 3OXSB 4XVUD 3QEUA 2XWJA 2AV1A 3TO4C 4KMQA 2J8OA 2A2QT 2AJVL 4JFEA 4JY6B 4PJ5D 3E8UH 3FKUS 1U8NA 1QTYT 3U0WL 4ZQKB 4NQXA 4LVNB 4H8WH 4U1NB 2VR9A 4JFXA 3VA2C 2BJML 4KKAD 1QNZL 5HD8C 1OL0A 1T03H 5E6IC 5F1OB 2Z31A 4AIZB 3TBTA 1HI6A 3O6LH 4HDIB 2NXYC 3HNTL 1WWCA 1JRHI 1BIHA 2OXGA 1KIRB 4QF1A 4KGLA 3OGCB 1CIUA 3WN5A 5DJAB 4S10A 1EVTC 4UTBH 5CGYC 1ZGLB 4JANA 5D7JA 1DE4A 2W65B 1P84K 3ARGD 2H3NA 5KSUA 2MPAL 3QUZA 32C2A 2HJLB 2VLKB 3QXUA 5DA4A 2VDLL 5I9QC 4QOKB 5HYFA 3I02A 1QFOA 2GSIA 5HHVL 1V7NL 1CFNA 3QJFB 3STZA 2XQBH 3QDHA 3LQZB 3QQ9C 1XGYH 2JE8A 4NNXB 1SEBB 4KU1A 2WBJD 5F93C 3UTQB 4DKEH 5IEKB 1JPTH 3D39E 3N06B 3RX8A 5CEZL 2YA0A 4CVUA 5L2JA 4LLQB 4H25A 1N8ZA 4J3TA 4R4BA 1TETL 4FQJL 4CN1A 2YXFA 4QRQB 1NLBL 1FGNH 5D6DA 1CD0A 4ONGL 1FZJB 1NBZB 1CGTA 1XIWB 3LKNA 2DMKA 5FDYA 3RRQA 4NN5C 4KMTH 5C08A 4GMSL 3OX8A 2DJ4A 1ES0A 4WWKC 1Q94A 1B90A 4PPTA 4YDIL 5C0BE 4FFVC 3KPNA 4ORGB 1A2YA 4LPWA 1RUAL 1CF8H 3UTZB 2D7MA 4P2QD 4ZUVA 3MODH 4N68A 4LSTH 1G7PA 3M17A 5F9OH 3BEWA 4ZSOA 1BVLA 1A4JA 4NNPL 5JW4R 4I77H 4PGDA 3TT1L 4X9BA 1YMMB 4KI5C 3NIDE 1GPOH 1HCFX 5FM8A 1P84J 2MCG1 3FB6A 4Q74A 5DEGA 1BZQK 3BUTA 5B22A 5ALCL 3TVMB 3S88L 5F1NB 4LMQE 1IBGH 1J86A 1QSFE 1UKTA 2R0KH 5HHNA 3QRFM 4Z18A 4YK4C 1KIQA 4TUJB 2EZ0D 3SKMB 2UYLB 4M1CC 5HI4C 4ODUA 3FAXA 1UADC 1HSAA 4X6CF 2PTTB 2Q7NA 2DBJA 2G75A 3QEQE 2GT9B 3QIUB 4RMSA 4RNRA 1YQVL 2Z31B 1RIVH 1FPTL 5EN2A 2PO6D 1CU4L 4XPGH 1K8DB 3S37H 5CCKL 3U9PH 3I9GL 4APQD 3ROLA 2XOTA 1HZHL 1CGWA 5EBLB 3ZHKA 3GJEA 5IT2H 4YHOH 1T66D 1WT5C 1BAFH 1DANT 2DBLL 1TQCB 3TH2T 1EFXA 3RWDB 5IFAH 4I18B 1P4IH 4G8FB 1CK0H 1FSKB 1S7WA 4LCWD 2I60H 2P24B 4E41D 2AVGA 3NGBC 1K8IA 1N5AA 4Q7DA 4EEEA 1AXIB 1KFAH 4G9FD 1FH5H 3WKMH 1YN6B 4UTAL 1YJDH 4OI9A 3HE7D 4XPBH 5E94B 1KENH 5HHQB 3K2UH 2N1KA 4ZTPH 4WUUE 4Z7VB 1X5ZA 1F6FB 5E8PA 3IFLH 1WQVT 4TUKL 5C8JB 1JGLH 1SYSA 4Y19D 5ISZD 2YPVH 5EPMB 2X10A 4NN7C 2OMNA 3RKPA 5I71B 3CIQA 1FDLL 2H32A 2JCCF 1LK2A 4WO4A 1IM3A 4XCCH 1M05A 4H0IA 4GRWF 2YOCA 2XI9A 2H41A 4XBGA 1T3FB 2R29H 2XIDA 1UJ3C 3CFDB 4R7NA 2ESVA 1LD9B 2XWBA 5GGSA 4HQQL 5GGTA 1IMHC 2HT2C 3KJ6L 4FA8A 4CMMB 5I75C 5BVJB 1E6OH 5BS0D 3ILPB 4X6BB 3SGEI 1M4KA 3KPRA 2HVKA 3CMGA 4LHQB 4TVPH 3E8UL 3BQUB 1H3TA 4ZNEE 3RUGA 3TPKA 1I1RA 5ADPL 4FQ1H 5B39A 4H8WL 4R2GD 2MHAA 2NY6C 5D96C 1UXWB 3RWHA 5T1LB 3ARZA 1T03L 5KSVB 5IBTH 3O6LL 4LLYB 5C0NC 3IXTB 4NQDE 4HJ0D 4Z7WB 5HHNB 4CVZB 1EAPA 5FCUL 4ZUSA 2BNUB 3JZ7A 2W92A 4Y4HC 4FTVE 2XZQH 3O3EB 1WCBB 2DWDB 2KKQA 3I6KB 5I73C 2RCSH 1ZTXH 1YDPA 5L2KA 4I5BA 5EN2B 1UXSB 2XN9D 5I17B 3DIFB 2P5WB 4R9HA 1MHEA 3WV0A 4H20H 2XQBL 3BESR 5CJXC 3S35H 3LRGA 4PLJC 3V9FA 1XGYL 3IRPX 2DLTA 4U6YA 3GI8H 1OSZA 4DKEL 4Q9RH 1JPTL 4JZJA 2ERJB 1FCGA 3D18A 3DV6A 3FFDB 3TCLA 3PWJB 5ID1B 2ORBH 4Z0XA 3WXWH 4D8PB 4JQIH 1RUPH 4ZMAT 1F3RB 1H15B 3WLWD 1FGNL 5JPMB 4RMVA 2AK4B 2D7PA 4GUPB 5GSRA 1AXSA 5GSVB 3BGAA 1MQKH 2ZSWA 2UY6A 4KMTL 3VWJA 5JZ7D 3IF1A 4YLQT 4Y7MA 1CLOH 3MLVH 4NZJA 1ZA6B 4R0LA 3T0EB 2E7LC 3O45A 2WQRA 1DVFA 1A21A 3U9UA 2IAMD 4P2OD 2UVEA 5GIRA 4XNMA 1BBJA 3A6OA 1P1ZB 1CQKA 4P5KB 1CF8L 1PD6A 3NCEB 4Q9QH 5FOJA 4JLRB 2OCFD 5D1ZA 5SX5K 3MODL 1CDJA 2HLAA 5DJ0B 3VG9B 4JB9H 5F9OL 5I16A 1BEYH 1T7VA 3ARBB 1A47A 4FQXB 4QRPB 4QXUH 4LCCC 3ULVF 1RURH 2YZ1A 3V0VB 1GPOL 1A7PH 1B6DA 3CSYB 4PJAA 2CLRB 1D9KD 2GCYA 1MI5E 4V1DB 2NXZD 1G7MA 2VUYA 3SCMB 2VR4A 4NGHH 4MQ7A 5HDOA 1HHIB 1IZKA 4IMLB 3TBSA 1TQBC 3RIAK 4P5MA 4URTB 2R0KL 1IAOB 3D69B 3IU3A 2DQEH 3CD4A 3SGDH 3U83A 1DUYB 3WHXB 4WFED 1HH6A 3O2VL 2W9LA 3PP4H 3UMTA 3EYVA 2E9JA 4ELMF 4GBXA 1MCLA 1DBJH 3FQXB 4HAGA 5C0JA 2E6JA 1MCPH 3LCYA 1RIVL 4WTZG 4NKDA 1Y0LA 4A2MA 3BVNA 3TPUA 4P23B 5D7IF 4PJXA 5BQ7B 3S37L 1KPVB 2UWEF 1HYSC 4XAWH 5T3ZH 3JV4A 1M6OB 3QSKB 4RX4A 1ZK9A 3PGDA 1LDPH 5IT2L 3HG1B 4YHOL 5BRZA 1BAFL 2AEWA 3ZE2E 2OTUA 1ZT1B 1AR1C 5IFAL 3QIWB 1P4IL 2VQ1B 1WZMA 5EZJA 3K4ZA 4JPIA 1PKQA 2DQCH 4RGOH 2I60L 4K7PX 2Y7QA 3ARRA 3RGVA 1KFAL 5KN5A 4PJFF 2Q8BH 1FH5L 3N1QC 3WKML 4PRID 3HMXH 3NOIA 1YJDL 5CWSB 4CJ1A 1WEJH 4HJGA 4XPBL 2ADGB 3FQNB 4U0QB 2FX8H 2ICWA 4XXCC 5A16A 5GZNC 4LLVA 4ZS6C 3K2UL 3TF7C 5L8KB 2Z35B 1PQZB 1UA6H 4ZTPL 1A7RH 3E3QE 5EU5B 3IFLL 3T0WA 1X6LA 5IQ7H 5BV7C 1JGLL 3DO7A 5LGJA 3O8XC 2IPUG 2YPVL 4DAGH 4EI5B 1TNNA 4JRWA 4M4PA 4AEFA 5KJRH 4XCCL 4BFIA 5C9JB 3PL6A 3SBWC 4JFEE 2CSPA 5I8CB 4G8EA 2OZ4H 1ZMYA 2R29L 4S11A 2ZG2A 3VFNB 4BUGA 5DYOA 3SE3A 4PBWD 5CJBA 1RHFA 2V2XA 5GJTH 1U3ZA 4ZOCA 1RZ7L 2AJUH 5ETUB 1NDGA 1RAMA 1E6OL 1PG7W 2M8XA 4M03A 3WL9A 4FFZH 4WI4A 1LWRA 4Y1AD 3G08B 4OLZH 1TLKA 3T0AA 3HZVA 3QEGL 3RX7A 3WS3B 4TVPL 4ODSH 1X9QA 2C5DC 1I7RB 3RDTD 4FQ1L 5EC2B 4YNYA 4MX7B 5JOPE 4JHAH 2R2BB 1L7IL 3FT2A 4PUBH 5F9WC 4YR6B 4NFCA 1DN0B 5I66A 2XWTB 2O61B 2PKDA 2UZIH 4UILH 5D1XB 2VWEC 5JXED 1ZAGA 1OLZA 1MUJB 1FFQA 1QLFB 1RK1B 3MCG1 4IRSD 4XZUA 5FGCE 3V6ZA 1MHCA 2BZDA 1AH1A 4RGNB 4J1UB 1PEZA 3VFOB 2RCSL 1ZLUH 1ZTXL 3V2AR 4X7FC 2HAZA 3U79A 4PJ7B 3P73A 2VAAB 1QBLH 4TN9A 1EO7A 3HKFA 2X89A 4U1LB 1UM4H 2N7BA 3QZWB 4H20L 3S35L 3L5WB 1EEZB 3WHE1 5TDNA 5TF0A 3GI8L 2NTSP 5AG8A 4Q9RL 4IOIA 4JGUA 4ORZC 3LOWA 3OR7B 4KHXH 1HCVA 3MRJB 3T0DA 4Y5YB 3QG7H 3OKOB 5FV2A 3WXWL 4JQIL 3Q5TA 1RUPL 2DLIA 1JJUA 5D70H 4L3CB 3IXAB 4MAYD 3RGVB 4P49A 5JPNA 1YEHH 3W5NA 2BK8A 4N5UA 4PV9A 4RAUB 4NC1E 1MQKL 4JO2H 4OZ4A 4HJGB 3VJ6A 1CLOL 3MLVL 4OD2B 4ZSOE 2F8VA 4ESKA 3I3EA 2BHUA 2W0PA 4X6CA 1MJJB 5FYJU 3MA9L 1EPFA 3O3AA 3DO7B 5T3XL 4NSKB 2AP2A 4Q9QL 1N6VA 3FB8A 3S4SB 1JVKA 1BJ1J 4G6MH 4TQEH 1KJ2A 1QBML 4JB9L 1BEYL 1U8MB 4QXUL 3R4DA 3T4YA 4HEME 5C92A 2HYMA 1A7PL 2ICEB 2R2CA 4XAKD 4GAJH 3QIBD 2NTFB 1E6JH 1V7MH 5EG6C 3RWFB 4WV1A 1RUMH 4ZAKC 1NJ9A 3TH4T 4Q97A 1WK0A 1C16A 2DQEL 1S5HA 1MEXL 3DGCR 5M94B 5DK2B 1AP2A 4YNYB 3UO1H 1X4ZA 3PP4L 1ODAA 2A6DB 1BZ9B 2Z93B 3MLWH 1DBJL 3B9DA 2EDFA 3FHAA 1MCPL 3MMEA 3DI2B 3SHSA 2X6MA 4LDOB 5LBSH 4XTRD 5HHME 5DFVD 5TGBB 4PJ9A 4S0SD 4NO2A 3RWCA 4RMWA 4PY7A 4LNVA 4W4OA 2JCCA 1AGEA 4NJ9H 4XAWL 4Z78A 4QY8A 2YD7A 1FL5A 1ZSDB 1LDPL 3HUJA 3DOSA 4JG1L 4UDTA 2NY5C 3V6BR 5IJKC 5HGDA 4NM8H 25C8L 3WFEH 2VISB 1DQQA 4HEPG 2EXYD 3QUXA 3FB5B 1JWMA 1E4KC 2DQCL 4RGOL 4G8GB 4RIRB 1IGTA 3QUYD 3FB7A 3JWDL 2Q8BL 3ULUF 2J6EH 3HMXL 5FYJH 2R0WH 1WEJL 2APWA 2FX8L 3TA3A 4LVEA 3UTSB 1CDUA 3ISWA 4O00A 1A7RL 1L0XA 3ARSA 2ESVE 1EHLH 3DROB 2MCPH 5IQ7L 2XG4A 4X4YB 1I3RB 2VQTA 1UB5A 3MRKB 2WLYA 5C2UB 4W81A 3I6GB 4DAGL 2PCPB 3VRLE 4NC0B 1PGRB 5JW5A 3SDCD 3SE8H 5KJRL 1QUNA 1LK3H 1JHLH 3KPRE 1YC7A 1H3GA 2CD0A 2ENSA 2OZ4L 3C5SA 4WDIB 1XGUB 3BN9C 4HV8B 3SKJH 4OKVA 5EU7C 2KUTA 5GJTL 2VKWA 3VGHA 4L8CB 1I1AA 3DV4B 2AJUL 5JDSA 1P69B 1VGKA 3B9AA 3KJ4B 3DSFH 3PJSB 4JFPB 3O9WB 1JFQH 2HKHH 4OLZL 3LKSB 4U6HA 4ODSL 5K9OB 3HCVB 1RI8A 2GKIA 1I9EA 5FGRA 5DJYB 1ZOXA 2XZZA 2J8UB 4JHAL 3F65A 1UM6H 2B4CH 4MGXA 4LVHB 3QI9C 1YUHA 4ODVL 5L2KE 4HKJB 1NUFA 1FNGB 1TVBB 1AGCB 4UILL 5T3ZE 5C0GB 3GHEH 2AJXH 3ZKMC 3V5KB 1RIHH 3KPMB 4D9RD 5FM4A 1I8MA 3NCBB 3MRMA 4IIQA 4NRXB 4GRWH 1NDMA 1KB5B 3KPQB 1L0QA 3GGWA 2DKUA 4UT9H 3QPXH 5ICXB 1I4FB 4F7CB 1OGTA 1QBLL 3MRNA 1UM4L 5ACMA 2EC9U 5EBGA 4UBDC 3E1F1 3Q0HA 3B5TA 1GC1H 4UMGA 3H3KA 2WAHA 3LV3A 1J0KA 4KHXL 4N90D 5HYJD 1RZGA 5C0DA 1EVUA 3GMMA 1A1NA 3K3QA 3QG7L 3KYOA 1NGXB 4JRYE 4AIOA 4YEEA 1LEGB 4L8BA 1KPRA 1WF5A 4J4PD 5D70L 3QDGD 1NAMA 2R0LH 4OV5B 3VFSA 5E9DD 1QA9A 3ARDC 4UV4H 5F6IC 5AUMB 3P77A 1JV5B 5J11C 1UWGH 4N8CH 2PYED 3VRJB 1D5XB 1VCAA 1S7XB 5FHBH 4HUVB 4ELMA 5DURD 1BF2A 5HPOA 1XFPA 3RTQA 4HJJH 4QNPE 2VLJE 4JRXA 4PJAE 3O4LD 3C8KA 3L3JA 4OSUL 4PRHA 2J8HA 5CD3A 5D7IA 1F2QA 5EZOH 5GGSY 5D7LE 4G6ML 4TQEL 4QXWA 3LZFH 3MNVA 1LILA 4LFHD 4KKNA 4P46C 4GAFB 5KVMC 3HZMB 4CU8A 3EYQD 2VIRA 3BISA 4O4YH 1ZXQA 4YBLB 3IAPA 5IMMA 1E6JL 3MRBB 1V7ML 2VXSL 1GGUA 1RUML 5I18H 1IAKB 1KPUB 3VFTB 3QUKA 5FECA 4EJ1C 1U8OB 3EOTL 4PJFA 1JGDA 4S2SA 4X6EB 4GQ9L 3VFWA 3VFVA 2ADIA 2A73A 4OUOA 5FUCC 1F2XK 4CAGA 2QADD 1LO3H 3UO1L 5BRZE 4CKVX 2I5YH 3PWLB 4QRSB 3UPRA 3H9HB 3MLWL 1I85A 1QSFB 4B7IA 2R23A 5CHNA 3FO9B 2DYPA 1PKQE 1J0HA 3V95A 5HVHC 2IWGA 4L8SB 4NJ9L 4I9WD 1SVCP 1RZKH 4X0KA 1KLGB 4JCMA 1UH3A 5D6CB 1TPXB 5D9SA 3WDJA 3KYKH 2Y5EA 4ZTOH 2H9GB 1G9NH 4RA0C 2H6PB 5D7KE 1WZ1L 2XTJC 3PDOB 3MBED 4Q2ZB 4NM8L 1TVDA 1YPZE 1S8DA 3LQAC 2H2PC 2ZG1A 4K8RH 4JHZA 4LARH 3V8OA 1CYGA 2B1AH 3D85D 3CH8A 3CH1B 1OHQA 1E4XH 4NO0B 1NAMH 2J6EL 3IKKA 3B4NA 1S9WB 5FYJL 2R0WL 4NQSA 4BELD 3C8DA 1MCKA 3LVEA 1HEZB 4OM1H 2BVOA 4MZ3A 4X83A 5C07A 2MCPL 5K59F 1M71A 2FSEA 1AI1H 1IC4H 5C0CB 1VFAB 3C5JB 4G80B 3FQTB 1KNOA 4NQTA 5B8CC 4MSWB 1HHJA 1UEYA 1KN4H 5ABDE 2EC8A 1JMXA 3SE8L 4QRRA 5A2IH 2G9HB 1LHZA 1LK3L 2QR0A 4WU5A 2R4SH 3EHBD 2ED9A 4QGTA 5E8EA 1VKXA 3HC0A 5GRUH