1ZVYA

Crystal structure of the vhh d3-l11 in complex with hen egg white lysozyme
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
DVQLVESGGGSVQAGGSLRLSCAASGSTDSIEYMTWFRQAPGKAREGVAALYTHTGNTYYTDSVKGRFTISQDKAKNMAYLRMDSVKSEDTAIYTCGATRKYVPVRFALDQSSYDYWGQGTQVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin heavy chain antibody variable domain
publication title Molecular basis for the preferential cleft recognition by dromedary heavy-chain antibodies.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase/immune system
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zvyA00
2NXYB 2IGFL 1ZHNB 3U36B 3CK0L 3GI8H 4DK6A 2WQRA 1S7UA 1C5CH 3MUGA 2EDFA 1BZ9B 1TQCC 4I48B 2F19H 1U8LA 3NFSH 4E9LA 3DTXA 2X10A 1KELH 1QO3A 3ILQD 3ULVE 2XWBB 4P9MH 2VH5H 3VFMA 1ULVA 1EVTC 5ID0B 4N0RA 3BMVA 2APXA 4HPOL 2EIDA 4LVHC 5DD0L 1K4DA 1RZJL 2GJ6D 4ZUTB 4WCYH 4F33A 2VN4A 1AY1H 1R3HB 2X6MA 1TTUA 3NPZB 5JIKA 1XGUA 3EKCA 4QOKE 1MJ8L 5HYSG 3DRTB 4PJ9D 4UTBH 4XI5C 3GSXB 1LK3L 3QA3A 4RDQF 1WGOA 2GY7B 2J8HA 1NCDH 4QRTB 3P0GB 1JF5A 2F5AL 3LZFH 4XAKE 1QFUH 3TVMD 7FABL 3OR7A 4RRPA 4Q6IB 2GAZA 5ERWA 4G80B 2AERT 1CGSL 3U4AA 4RX4A 2HN7A 1FZOB 3FO1B 2EDEA 5HGBA 4HZLB 3PWNB 3WNPA 3KS0J 1VFOA 1MWAB 2DL9A 1XR8A 4JKPH 5JXEA 3QXAB 3FTGA 4PP1D 2QTEA 1N2RA 1QSFD 3P9MB 4U1JA 3LRHA 2NY0C 2UWEF 1F90L 2CGRL 4L8SC 4HKXA 2VJXA 1TZIA 3CC5B 2HT4D 2BNRD 2WLZA 2YMXL 4BYHA 5B38B 1OB1B 3ZE2F 5KZCB 1CICB 3ZSSA 3VGFA 1CE1L 1OAYH 2UWEE 4OLWH 1WFOA 4OF5A 5H2BA 3QDMB 4C57C 5E9DB 3IFPB 3T8XB 1A1OB 2H3NB 8FABA 1JNLH 2VLRD 1A6ZA 2ZSVB 2AXGB 3ZE2E 5E5MA 3SDDD 3VD5A 5DEGB 1E28B 1DBBL 3QIBB 4LFHG 1MI5E 5F9OL 2PR4L 3I2CL 5J57B 1B6UA 1K4CB 1NFKA 3OKMA 3G9VA 3ARWA 3VFVB 4X8JA 1UB5B 4CADB 2HH0H 3IXAB 4JZJC 2BY0A 4Y4FA 4Z0BL 3U6RA 5FCUH 3FZUD 4ZFOA 3KG5A 3EZ8A 4OLYH 4WHDA 3IXTB 4M93C 1XCQB 3WXVH 5I1GL 2AJUL 1EO8L 4JQXC 4R90L 3KNBB 2R0KL 4PS4H 2APWA 4HULB 4DTGH 4O5LL 4ZDHA 1NDMB 5GGRB 5FHBH 2BXYA 4YIQB 4LLMB 4TN9A 3RL1B 1JWMB 5FF6A 5E08H 2DD8H 4QF1A 5J12C 3DBXB 4JFFD 3DX7A 3S6CA 4X6CB 3TA3C 1ETZA 1CGXA 1NBYA 3GMLB 2C3WA 3GHBL 5IESH 1AJ7L 4G8FA 4UNUA 4XTRC 4G8EB 32C2B 3U7AA 3C6SA 2R4SH 5EO9B 4LCWB 4IRJC 5CHNA 4HIHB 4Y5YC 3P30H 5LAXB 3MV7E 2CJUL 1BGXH 4UT7H 4O51B 4MJID 2GSGB 2VLKA 2V7NA 1FCCA 3EOTH 2R1XB 3CVHA 3PNWB 4HIIA 1INDH 1RQ5A 4RISH 2XYCA 4NO3A 3L7FB 1E4WH 4R4ND 5FUOH 1AP2A 2OP4H 1RJCA 3GGWB 3RUGF 4HJJH 2EC9T 5FO7B 4HDIB 1NMAH 4MDIA 3SDCA 1QR1A 4QRPB 4S2SB 5D2LF 2D0FA 4NHUB 1IKFL 1G7QA 3OQ3B 3GIZH 3RUGE 1ZHKA 5EU3B 1DQLH 4DW2H 2VR9A 4XNQA 2R2EB 1GGCH 3AS2A 3WD5L 5DRNA 1U8IA 4XCEB 1F6LL 1IC5L 1BFOB 1FP5A 3PG2A 4KI5D 5E1AA 4CJ0A 1U8HA 4GRLB 3C8KA 2ICWB 4NCDA 5DEFA 1KPVB 2D0GA 5ESQA 5F1IB 3JVGA 1L9MA 5IJVA 5E5RB 3LEXA 4N0YH 4WRLA 3NCYP 4HQQL 1ZTXL 4GMTH 5C2BH 3O8XC 4ZPVB 5FOJA 3KLHC 3I50H 3QO1B 5JW4M 1OP5H 1KCSH 1U3HD 5I6XB 5CJBA 1JPTH 1XF5B 2J6EA 3MFFB 3ZDZF 2Z4QB 5BW7C 4KJPC 4UTAH 1N7ML 4F7CB 1K2DB 1PBYA 3UBXA 5HXMA 1V3KA 1OGAB 5EU5A 2BX5A 5CZXC 5LGHL 1HN1A 4KJQC 4MQ7B 1U8JA 2CO6B 1JV5B 3SE3C 3ZDZE 3NFPB 1RZKC 2B1HH 4ZSOB 4HH9A 4X7SL 4X5WB 4L29A 2FYYA 3NPSB 1MJUH 2AEPL 3IDJB 4M7LL 4OFIA 2AJSH 2QEJA 1U8OB 2ICEB 5HHPB 5DMIL 5E03A 3GJFK 1NFIB 2YPLD 2APBA 3MRRB 4IOFD 1SBSH 5JOPE 3WO4C 4LLUA 2ATKA 5I30L 4MD5B 3GBML 1VGKA 2GITA 3VMPA 4NQCE 4R7DB 5DK0B 2WLYA 1UZ8B 5A16A 3QEGH 5EUOF 4OZIE 3MJ7B 5D2LA 4BQ9A 3GKWL 1XIWC 5B21A 5DJYA 4JQIL 2B39A 4LASH 1EHAA 1U8PA 4X5XA 1FRGL 2DQHH 4AEFA 1D5MA 2V7HB 5CZVH 1CIDA 3IS1X 1KTDA 3K74B 4HIXH 3D69A 4F3FA 3GMQB 3BZFB 3AS0A 3WEXB 1G7IB 3BQUB 4P4RB 1IAIL 3WIHA 1QD0A 1XR9A 4M9OA 4YBQC 3KPOA 3ZDXF 3O9WA 4YHYB 4YAQA 4LSSL 4JFDB 4EIGB 4HXBL 3DGCR 4JRXD 1PD6A 1HXYA 5D7LB 4R7NB 3W11C 1WQVT 1VSCA 1RZKL 3MPCA 4L3CA 4XI5D 1UCBH 2OX5A 4KQ3H 4FZ8H 3ZDXE 4PREB 1D6VL 3FN3A 4LNRA 2WBJC 2PCPB 4WFGE 5IROC 4GW1A 1A1NA 1OAQL 2PYEE 4X6FB 3UTTB 1J87A 1ZLUK 1T03L 4R96B 2R1WB 4OT1H 4Z78A 2VDOH 2CSPA 5IWLA 3GMMA 4WJ5A 5EZOH 4EJ1C 3SGKA 2CK2A 5HJ3A 3FO2A 2X1OA 1I3GH 4XCFH 2LFGA 1QFWH 1IGIH 3IDYB 3D9AL 4W4NA 3BXNB 1N5AB 3HZVB 5DUPL 4JGMA 2YBRA 1C5BL 3QWQB 4KH2A 3OKNB 5KSBF 4OKVB 3TH4T 1RULL 2V2WA 1QHPA 1FGVH 4N9OB 2NY0D 3PP4L 1LDPL 1ACYL 4ZPTA 3HNSL 4GBXA 4LOUC 5EU7E 3LHPH 1T20B 3SJVD 4JG0H 2EDJA 5E8PB 1S7VB 2XXCB 1G0DA 3AU1B 4NKMB 5EBMB 4NQEE 2NY6C 3FMGH 3HE6B 5L2JA 5L9DL 3HA0A 4F8TA 2OSLB 3WUWG 1I7RA 3IJHB 2HVJB 1U8QB 2OZ4A 1FIGH 3B5GA 3S96B 5EUOA 3RWCB 5F96H 2DQEL 3O3BA 1KCLA 4JG1L 5E00A 5KVDH 1IE5A 2AI0H 2C5DC 2WIIA 3L1OH 4HPYH 4F7MB 5BO1H 1X6NA 5FDWB 5EWIL 5F89A 5JLZB 5KSAC 3S3SA 1ITBB 2XZCH 3F7VA 4MAYB 5KW9H 4UIMA 1EJOL 3RWIA 3IJSB 3WJLC 3BAEH 4G43A 4Z0XA 5ISZB 5C0FA 1DN0A 1XGYL 2ZCHH 3MLXL 4WHTA 1BD2B 4WW1A 1MCPL 2ZUQB 3NIGF 5DJDB 1RSFA 4EUPB 2E5EA 5ANMB 3DVNA 4DOHB 2I60L 4G9DA 1EEUA 1ONQA 2PYEA 4LRNL 5IM7A 5K9JH 5DD5H 4OQ1A 4RFEA 3L3KB 1JPFA 1UM6H 2FH8A 2A6JB 5I17A 1KIUA 1H0DB 1ZLVH 2VXVL 3NIGE 5C0GA 1MHHB 4IJ3B 2GJZA 1PLGL 3FB5A 4KXZH 4PGEA 5D1ZA 2Z93B 4EZMA 3FOLB 3PE9A 4GMSH 4JFPA 5FYJE 2OMBA 4XBEH 3SDXB 4U6VH 3K2UH 1T0NB 1G9MH 4DQOL 3OG6B 4PJBE 3O2WL 4TUKH 2CLRA 4TNWK 4R26L 3B5HA 5T5NG 1YN6A 3TA3D 3DV6B 5E2WH 43CAA 2C7UB 4NQEA 4MJ5A 5IBUB 5KSBA 3VWKC 1YEFH 2F58L 2YN3A 4XTRD 2QSVA 2H32H 3BPCA 1A4JB 1W72B 4IRJD 5EBWA 3LS4L 4BH7A 4WFED 4PJ9B 3RWFA 1N8ZB 3VFUB 2VXUL 5MP6L 5IQ9B 4CMHB 3UROR 1Q9KB 4G6AC 3V0VA 4Y4KD 1BF2A 1I1FA 1T0PB 4TTDD 4KQ4L 3ZTNL 4WI2A 2PKDA 5IQ7L 3KAAA 4MXWL 4DAGH 5EOCL 1J05A 2ICCA 4ODHH 4F80A 1NSNL 2A6IA 1AGBA 5T1MB 2WSKA 3TIEB 5ID1A 5KANG 5MEQA 2Q1EA 1XEDA 1F4YH 3V5HB 4OTXL 3TIDA 3HI1A 4KHXH 5IMLA 2QSCL 3U4EB 4M61A 1QSFB 4XWGH 5LG1A 3B3IB 4FZEH 4S1SH 3P4NB 5D5ME 1A9BB 4U1LA 3HR6A 5F7MC 3MXVL 3UZEA 3PQYA 1G9NC 4FQLL 3BGFB 3D0VB 3U9UA 5F9AC 2ZPKH 1MQ8A 1I4FB 4MHHI 1B2WH 1DUZA 4OAWA 4B7LA 1P4BH 3DXAB 1TMCB 3DMMC 4CVZA 2FWOB 5I18H 1ZANL 4P0DA 2IJ0C 1G6RH 4Y19E 1IAKB 5HDLA 5GGUA 4HUXB 4JFEE 3NACL 4G9FD 1KB5B 1DEEB 1UKSA 2VLRB 3BRFA 3CXDH 1IGJA 4Z77A 3BH8B 3QG6B 4G3YH 1KLFA 3SDDB 1P1ZA 3O8XD 4RDQG 4RMQA 1U6AL 3WDHA 3KLHD 2KZ1B 2ITDA 2GTWB 4L8BB 5DFWH 4V1DD 1HH6A 1R3IL 2X09A 3RA7L 2B5IC 4NQDE 5HYJD 3T08A 4N8VA 5EPMA 5C0DA 3MRCA 3QRGL 4KJPD 5HD8C 3KYMA 1NCNA 3VXRE 4UT9L 2ICWJ 4XH2A 4XMKH 4PRNB 1F45A 5CZXD 2IAMD 2VDQH 4KJQD 5J06A 5FGBC 5JOFA 2OLDA 3WFDL 3VFOA 5D1QC 5F70A 3ROOB 2W0FA 1FE8L 4GAJL 1YYML 2HJKA 5K9OA 3UTQA 2YN5A 3UCRA 4XZUA 4JPIA 3AMLA 3MC0A 4MCZA 1EV2E 5J11B 2K3TA 3VXNB 4GKSB 2WUBH 5CEZD 2HKHH 3VDBA 2VUOA 3PJSA 5K93A 1TCMA 3BE1H 4WGWB 3RGVA 2J88L 4AQOA 2HLAA 1J8HA 1CGTA 2ZCKL 4QRRA 1Q0XH 4LHUD 6FABH 3MLZH 1E4XH 4J7RA 1XIWD 4FXKB 1JZ2A 1UXWB 4X7CC 2EDRA 4M7JH 2CPCA 4V2BA 3UDWC 4Y19A 3IGAB 4PRPD 5DFTA 1FPTL 3NCJL 3QULA 3TNNA 5I1LA 2Z92B 4S1DC 2HAZA 3C09B 4MJIB 4XMPL 4IOSD 4ZS6C 5EG6C 4AG4H 5T1LA 3RHWF 1YEGH 1JNJA 4YBQD 1JYNA 4FQIH 3UX9B 1JL8A 4WHYH 1N0XH 3VXMA 3J8F7 2EEDA 4PLKD 1OF2B 4W4OC 4X6DE 3T1FA 2BC4B 4K3EL 1GHFL 1W0VB 5DVKA 5CILL 2XQBH 3W11D 4XMLL 1T22A 1QSEA 4JFYA 3FRUA 1JNNH 4NQUA 3RWEB 4PJGB 3FOMB 6CGTA 3X3GL 5T33H 1T6VN 3IAPA 4LP5A 4UDUB 2AABH 2O93L 1RZ8A 2OTPA 4X80L 1HYRC 1HQ4A 3D85A 1M7IB 2OTUA 2WBJD 3FT2B 3THMH 3IVKA 4HWEH 3BYTA 2F8XC 5EO1B 4FQHB 1IAOB 4ODVH 2MOVA 4JDZB 2ZWLT 2I27N 3GSQA 1IT9L 1FVCB 1UM4L 2A6DA 3P4OB 3T2OA 5JIIA 1GZPA 3HMWL 5AWNL 4HKZA 4QT5B 5IHUL 5ADOL 1KG0B 5E2UL 3VH8B 4R0LA 2XACC 5DZNA 4A6YH 1HK6A 1D9KA 1RK1B 3P4MA 4PRHE 1JK8A 4LOUD 2HJFB 3MFGB 2PTUA 1KC5H 4D0CA 3GSUA 4IM8A 5DJ0B 4YR6B 3NCCB 4EI5C 1NAMB 1MVFA 1OP5K 1MIEL 3QI9B 5AYQA 5T3XL 1SM3L 5J9PB 4H26A 2Q6WA 3KPTA 1NL0L 4MJ6A 4D9RD 35C8L 2JB5H 3T0WA 3WN5C 3CFJA 3DO7A 5DTFA 1TJHH 5KSAD 2YRPA 3OKEA 1H5BC 3GUTB 2JCCF 3LKPB 1T04B 2NY3B 4G5ZH 4GXUN 4NHCL 4JM2F 3HKFA 2D2OA 1OAXH 3DOSA 3AAZA 5MI0B 3TLRA 4MD0A 2VLMD 1YMMA 2YK1H 2YPLB 2JCCE 2PXYA 3DETC 5TQ2L 3IFLH 4MNGE 5BJTB 1JTTA 3UJJH 5FGCE 3HAEB 2R4RL 4YXKL 2E8YA 4WEBH 4K7FB 4J3VA 4XXCC 3TPUB 3VFNB 4L4TD 3BYYA 1ES0B 4WI7A 3GO1L 4NZTH 4TVSa 3U9PL 2VXTL 1U8KB 3STBA 5DSCB 5DD3L 3PWLB 3RWGB 5F1NB 4AL8H 1YEHL 4U0RC 2VE6B 4N0FB 4JRYA 3AM8C 2R23A 2DQTH 3TT1H 4M00A 3RHWK 1MIML 2DQCH 1EAJA 1NJ9A 2ED9A 3RZCC 1I8LC 4JRXB 4LFHD 3VWKD 1DSFH 4Z7UB 1K8IB 1G0YR 5DQ9B 3FJTA 1RPQA 1KCRL 3TM6A 4Y16A 5L2KD 4XPGH 3QUMH 3LQAH 2R15A 4U1NA 3W81A 1F3JA 2BCKA 5IP4A 3BEVB 1S7SA 4HFUH 4K94H 1MY5A 4NKIH 4WU5B 1XGQA 2OJEA 4X7EC 4NUGL 1A22B 3BEWA 2BVPB 1FO0H 5F8QC 5A1AA 3A6OA 2YZ8A 5DRZA 3X12A 2VQ1B 4MNGA 1P4IL 3C08L 2DRUA 4E42B 3KPSE 1PZUB 2RFXA 4JM2A 4LCCA 4OUOA 2NY0B 5FYKL 2AJZA 2JB6B 4H8WL 2A73A 1MRCL 2EDDA 1V3MA 1T80A 3SBWC 1G9EA 1ORQA 4JN1L 5F72S 4POZC 2BNQE 4OUUB 4PRIA 3U2SB 3AB0B 3O3AA 2FO4A 3DMMD 3DV4A 3WNOA 5FA4B 4PUBL 3T0BA 3OF6A 2YPVL 5SV4A 4LSQL 2FJGA 5AEAA 3JWDH 3D6GA 3HNVL 4LF3B 4TOYH 4E0RA 4BQCA 2AXJA 5GS2H 2DQGL 4APQC 1I3VA 5KVGH 1RUKH 4PJ8C 4N90E 2X9WA 1QRNE 2V2TA 1BEYL 2FB4H 1NBQA 2B1AL 4KY1H 1JFQL 3I3BA 4MXQC 4NM4H 4EDWL 4OLZH 2NW3A 4GG6B 4R3SA 5F6HI 5LGKA 1CFBA 3WNNA 1LO3L 3GMOA 3BDXA 3OGCA 3ARQA 2A38A 4P9HH 4WI4A 4UOW1 3ULVC 4ZNCD 4OZ4A 1A9EA 1D5BB 2Q7NA 5E56A 3N85L 2YUVA 1IGYA 1ZHBB 3ZL4L 3MZGB 4KUCD 4GKOA 2OMNA 1KJ2L 3MODH 1EEYB 4S1QL 5H35A 4PJXB 1KTRL 4JPKH 3MA7A 3IRZA 3NTCH 4D0BA 4L8DA 1TVBA 2F54B 1TNNA 4HHAA 1ZT1B 3IKKA 1ZLVK 4K23H 2OBGA 1BJ1J 1WBZB 2FX7H 2J12B 4HKBB 1F2XK 3GSNL 2R2HB 4U6HB 5T1DH 3MV8A 5HSFA 1HHIA 1IAMA 3CSBA 1XGTB 5LCVH 4F8QA 3I6GA 4NO0D 5J12B 1X5JA 4M8QB 5E2VL 1CQYA 4KVCL 2DIAA 3BGMA 3GM8A 3ULUH 3UJIL 3D3VE 2VR4A 2JK5A 1QFHA 4NC0B 3WLWC 4X0KB 5FUZH 3EGSB 4KK6C 1ZGLA 4ZTPL 4JHBA 1ZT7A 1ZWIB 2BSSA 3TO4A 1VFBB 1SMOA 5GRXG 5CJOL 3RVTC 3CFCH 3P40A 4S1DD 3SKMB 2N56A 4Y4KB 4H1LA 3ULVL 1FG2A 2JJUA 4UNVA 4ZS6D 3K81A 3MROA 4HLJA 3O41A 1U2CA 1U8MB 1ROWA 4OM0L 3V4VH 5ALBL 5TF1L 5LGJA 4N0UE 4ELMB 5KSVB 4TVPL 1QVOA 2O5XL 4JO3H 3T77A 4L9DA 1G6RA 4XP6L 4WNQB 3H2WA 1AFVH 1IARB 4O2EB 5HHME 3OX8A 5FGSA 1DR9A 2KL6A 3ARBA 3G6JF 3MO1A 3VRJA 3QIUB 5BZDB 1QA9A 3QFJA 5CP3H 2AV7A 5HHVL 1G7PB 3ABZA 1AO7E 4M6MH 3SCMC 1UJ3B 3O4LB 3TPKA 3CFDB 2HFGL 2P5EA 5EZLA 4ZNEE 3MNZB 3N1MC 4WO4C 3F6IA 5EOTB 1RU9H 3U7YL 3WLBA 2WV3A 1YNLL 3QR2A 1BZ7B 1JGVH 3OR6B 3B9DA 4HS3B 5TE4H 4QEGA 3D0LB 4WHCA 3DPBA 7CGTA 4L3EE 1CR9L 4G9FB 4YHNA 1WEJL 5K59F 1MFEL 4HXAH 3QSKB 1T1YB 2FJFA 2VQUA 1MCLA 4Y5XC 4DZ8A 1KLUA 3FB8B 1RURL 4NNXA 1ZA3A 2FBJL 1KV3A 2YKLH 3KPMA 1F6AA 3S88L 5HYJB 4EI5D 4K2UH 3ZLQC 4LU5L 5K59E 2DMKA 4PP2B 2I5YH 2QQNH 4PFEA 5GZNC 1KEGH 4UDTA 5JHLL 4OB5L 3VWJB 1SJVA 1DLFL 5IW1B 2EE3A 1C1EH 3HE7C 1C12B 1CF8L 1J1XH 3V0WH 2DQUL 4PTTA 3BSZL 1P53A 2IAMB 4X5LA 2DLTA 3I9GL 3ARPA 1T5WA 4WI3A 2X70B 3MR9A 1OTUC 4LSRL 5HY9A 2NLJB 1X6LA 4OLUL 4FTVA 3I3EA 4QRUA 3TCLA 5IK3B 4MA3A 1CTOA 4U2ZA 2D9QB 3BO8A 4K3DH 2DQDL 4KAQL 4KC3B 2BP3A 1Q1JL 5TE7L 4LEXH 3DETD 3VXSB 1MHEB 2NY1C 4DN4L 2Z91A 3REWB 1TJIH 1WT5C 3GSWA 5BQ7B 3JXAA 4ZNEA 4PJEB 4YFLF 1W2KT 4XXDA 3T2PA 2BZDA 4R4FH 5T3ZL 1UYWH 4PR5B 3L6FB 3G6JA 2VXSH 5D93B 2QSQA 2UY6A 4J12A 3BD5A 1OSZA 4LHUB 4PB9L 4LCYA 4OIBA 2NZ9C 5HHOA 5IB5A 2NY4B 2UZYB 5FYKD 5C6PB 3MJ9H 1LO5A 5D2NA 3MOBL 5DMJB 2R0ZL 5E5UB 2JKXA 5BMFL 1TVHB 2Q3AA 2Q87A 4GRWB 4CGTA 1WWAX 3QQ4B 3VMOA 3QEHB 2Y25A 4NRZA 1HSBB 3O2VL 3PIQB 3RJQB 3U4BH 2CH8A 4BH8A 1NC2B 4HMEA 3BKCL 2YD9A 1PYWA 1ZXQA 1WZMA 2XWBA 3U0TA 3MV9B 4A6YA 4M02A 2DM3A 2NY5H 4WUKL 2NZIA 4JREC 3D18B 4HCRH 2ZCLL 1PKQE 3C6LB 4URTB 2P45B 2WBJB 2LAAA 1RFDL 3IFNH 3HC0B 3P3YA 5GHWH 2E9JA 1J7VR 3KYNB 3UTOA 2EEAA 4GG8B 3DRTA 4ZOBA 5DJ2A 5C0AA 1X44A 5E2TH 5JIPA 1FL3B 1S7TB 3NABH 1I7TB 5E8DL 1MFDH 1WTLA 2RB8A 4HT1H 3BD4A 3OJMB 1L6ZA 2PO6B 4MB3A 2Y36L 5IVXB 3LEYL 4Q6IA 1LE9B 1A0QL 1U41A 5ALCH 4G80A 4HIJB 5CSGA 1TETH 2ICWI 1MLCB 2XN9A 4K9EC 3L7EB 5DRWA 4DN3L 3FO1A 3MA9H 5F6IC 2ZNXA 4POZD 2HP4A 5D6DA 2CR6A 2OJZH 2BJML 5D70L 3R8BB 3QIWB 3G04A 1HI6B 3QXAA 3HG1D 3CDCA 3MLPA 1HHHB 2X4UB 1MVUA 4UAOB 1FZJB 5EIQA 5FM4A 5MHSD 4KJWC 3P9MA 1CE6B 3GSVB 5EU6D 4APQD 1WZKA 1NANH 4ODUB 4PJ8D 5DJZB 5AAMA 4H0HB 1YY8A 1PEZA 3CC5A 5GQBA 4MNQD 3GI9L 4MXQD 5DMYA 1X7QA 4P59H 1ZGLP 1MJJB 3E6FB 1FNAA 3C8HA 1P6AB 3ULVD 3LIZH 5ICYA 4XPTL 3ZT6A 2H3NA 4I2XA 1JPGA 4WTZA 1Q94B 1JUFA 3KPLA 4IRSA 1BQHG 4OD2A 4Y1AE 4EN3C 2G75B 1Z0MA 4GAGL 3HPJB 5DK2A 3FQWA 5I1AB 1K4CA 3L5XH 2GEEA 2EE9A 2QHRH 4M6AA 4QOKD 3T2NL 4K9EL 1OAKL 1TQBC 2DBLH 3NA4A 3LDBC 3VFVA 1UB5A 3G5YB 2KBGA 1CZ8H 3B5TA 4UB0H 4P3DA 3RPIB 1RZIA 1L0XA 5JMRA 1NAKL 4ELKB 1EHLH 5IBLC 3UMTA 4XAKD 5BV7C 4LVOB 1XCQA 1SYVB 1KYOJ 5IMKB 3W39B 5D8JL 1KIRB 2Y23A 1FG9C 5HGHB 4PGDA 4FQCH 1JGLH 3T0EE 2AS5M 2DQJH 2CDGB 2K1MA 3WLWD 3ULUF 4AZ8A 2NW2B 3ZKMC 3QZWB 1LNUB 2HYMA 1T1ZB 4KK6D 5GRJH 3TZVA 3D39B 5DI8B 4F9PA 2UVFA 3RVTD 1JHKH 2C9AA 1JWMA 3H9ZA 4OF6A 3ET9F 1QPPA 1PW3A 4XC3L 2EYRA 1MRFL 4HAFA 5EU7C 1EGJL 5SWZA 2ZG2A 2OK0H 2EIZA 2YC1B 5CJQL 5GSRA 3UTZB 4G8EA 3MRBA 3H9SA 2HKFH 4FQJL 5TDPB 4YHZL 5LAXA 2XWTA 4KKBC 3OJDB 4PJFB 2IQ9H 4O51A 1TFHA 3KPPA 1YYLL 4XVUC 3Q6GH 4JKWA 4M6NL 2VRAA 5F7EL 3MMEA 5L6YH 1HH9B 3SCMD 3B4NA 3VFGL 3JWNC 1MI5D 4DGIH 5BV7L 2E27L 2NY2C 1AY1L 1T2QL 3QUYC 1EK3A 2C4FU 1P4LA 2BSTA 4Q9CA 3QDGE 4UIKH 4YC2C 3GGWA 2JJSA 2I9LB 5E8NB 5IGXH 1FCGA 2M2DA 2X41A 3KJ6H 4Q0XH 4IIQC 1PKOA 3QUXA 1G1YA 5KS9B 4QRPA 3SDYH 1M6OA 1FZKB 2VDKH 3MRHA 1DQDL 2DQFA 1Z9SA 3MRNA 3LQZB 5D7JC 3OXSA 1WJ3A 3TYGH 4M4PA 3P9WB 5ACMA 4OD1L 4FOMA 3R1GL 2Z31B 4F15C 4P5MA 4O02L 3FQXB 3GZKA 4ZOEA 2R2CA 2N7AA 3HNTH 3GJEB 1P2CA 4AQ1B 1MPAH 2EDKA 1AGDA 5C0RH 1A3RL 1RZGB 3QAZC 3KJ4C 3U1SL 4BZ2H 1HKLL 2F53B 3DVIA 5GZND 3QH3A 1F4XL 4P2QE 4P46C 1L7IH 2MSPA 1JZ8A 3O6FC 3HE7D 5EBGA 3SY0A 4L4VE 3DVGB 4OZHF 5D7IF 5F1OB 4HK3N 3VRLF 2R56L 4Y4HB 4PLJC 1D7FA 3QO1A 1FAKT 2FNBA 1N5YH 4DGYL 1OTUD 4FQXB 4P4KA 4ZS7L 1GC1H 1RZFH 1RIHH 3FQRB 3MRDB 5GGSA 3A6CH 4QWWC 5SWSB 3WFCH 2J8UE 4OZHE 2F5BL 1BIIB 2FR4B 3MV7D 4JHAL 3VRLE 4F7CA 3MLTB 3OMZA 1RHHA 1ZOXA 2IWGA 4WV1B 4EOWL 2GTZB 4KDTA 1A6PA 2NY1D 2VKWA 5KG9B 1C08B 5L8KB 1WCBB 4NO0B 2WQ8A 2XG4A 3MLWH 4WVRA 3QO0A 5ILTH 3FFDB 3QDGA 1J0JA 1NFDF 4ZSOA 4O2FA 5JPMA 1I1YA 2DYPD 4X5WA 1CLZL 2IGFH 3CK0H 2YR3A 4JVWA 5JHDB 2NZ9D 5CP3A 1U8OA 2ICEA 3C2SA 1NFIA 3DRQB 2YEZA 3FAXA 3QDJA 3MRRA 1BOYA 5F9WC 1SY6L 4MA7L 1NFDE 4HPOH 4YZFF 2EYSA 3S34L 2YA0A 2X4NB 5FYJL 1OL0A 1DEDA 4KRPC 5MERA 4P2RD 1YNKL 1RZJH 1J0KA 4R7DA 3TN0B 3BP4B 4QXTB 3MJ7A 1VERA 4WFHE 1Q9OA 2KUTA 4HUNB 4LARL 3QEUA 2LAGB 2W59A 4JE4B 3VGDA 1MJ8H 5JDSB 1LK3H 3O3DA 1KJVB 2VR5A 4L9LB 3BZFA 5CSZB 4L4JA 3C5ZB 4WUUA 1IGTB 3FQUA 1NCAL 2F5AH 4PJDF 2NTFA 3S4SG 7FABH 4JFDA 3VFWB 4BFEA 4TTGA 1CGSH 2R1YB 3JUZA 1H8NA 3OXRB 4UQ2A 1ADQA 4XNYL 1LGVA 5D7IA 2RGSA 3RDTB 1SVCP 2A83A 1CFTB 5F7FA 5IB1A 5J1TC 4PJDE 5IOPA 4I3SL 5ESVB 5CCKL 3WL9B 3DI3B 3R06A 1IMHC 2DIBA 2NXZB 3H7BA 3LD8B 3STLA 4X6FA 1K3ZA 4R96A 5TJWK 1F90H 2CGRH 2R1WA 4OZFB 1M05B 2FZ3B 1MFBL 1LHZA 5EH1A 1S9XA 2YMXH 1B90A 1OVZA 4QY8A 2W1NA 4QHKJ 5F7KC 3BXNA 1CE1H 1N5AA 3HZVA 1KT2B 2ZUVA 3VXUA 1MUJA 4KJWD 5HYQB 5JOPD 1EFXA 4M6OL 1LEIA 4WHYG 1GAFL 2UZIL 1I7UB 3DGGB 1GPOL 1KPUB 3B8YA 4NQCD 1YN7A 1CDHA 4X7DC 4ONHA 1DBBH 5E8PA 5F9OH 5I74C 2PR4H 3I2CH 5CINL 5SV3A 4JFOB 2OSLA 4NQXA 5I2IB 1M4KA 4P2CG 3GMPA 1RY7B 3RWCA 1MCHA 4J2XA 3QUZB 4BK4A 4Z0BH 3ZKXB 3SKJL 4J23A 4J8RB 3WJJC 4WTXA 3IAQA 5JLZA 2XKUA 4DGVL 1DJSA 5I1GH 2AJUH 4YHIB 1EO8H 5ISZA 1GOGA 1I9RL 2D4DA 1GGIL 4R90H 2Q7YA 5C08E 2R0KH 1BFVL 1MRDL 5JW5A 3C60A 4O5LH 2OL3B 1IEBB 5DJDA 3TJHD 3X17A 3O11B 4RAVB 2EO1A 3C8DA 5ANMA 3WUWB 1PVHA 3OKKB 4U1GC 5T1KD 5DHVB 4OCRL 5IBLD 4WFGD 2PYED 1UT9A 3SGEI 4DVBA 1REIA 4POUB 2DS4A 2B7DT 3BIAX 1DQML 3GHBH 5FKPA 4P3WA 1A6AA 1AJ7H 1MHHA 2D31A 1JZ3A 3UPCA 5A40E 3AXLB 3ZKMD 3WXWL 3LKNB 1S7UB 4P99A 3VFSA 3MUGB 3DHMA 4KZEL 1U8LB 2CJUH 3DTXB 3SDXA 4NYLB 1OD9A 1NBZA 3MV11 2GJ6A 4EQ3A 3FB6A 2C7UA 3QWRD 1K4DB 2N1KA 4F33B 3I84A 3CZFA 4NQED 1QZ1A 4JJHA 3BISA 4OFVA 1UM5L 1W72A 2VL5A 4PJ9A 4MZ3A 1XGUB 1A3LL 1LO2L 3BJLA 1BVLB 3RQ3A 4JO2L 15C8L 1Q9KA 4KKBD 1NLDL 2UUDK 3MUY1 4FQ2L 1LDSA 4XVUD 3CX5K 3RU8L 1IKFH 5IVZA 3B9KC 5SWQA 3TVMA 1S78D 1XMWA 5F7UA 4OCSL 2BY3A 1MAJA 3OR7B 5L8LB 1CG9A 5ERWB 2NY2D 3G08A 5FFLA 3WD5H 3QUYD 4I3GA 4MGXA 4NRYA 1MCIA 2HN7B 1IC5H 3V5HA 1L9NA 1NKRA 2AEIT 4HBQA 5HGBB 3HG1B 1QR4A 5FHAL 5I76B 1T6WA 5IV2A 5DJ8A 1XR8B 3HUJB 5C0CE 2DBJA 4P48A 2FHCA 2YS4A 1E6JL 1A9BA 3F12A 1TPXC 4HQQH 4RWHA 3V6ZB 4PJ8B 1ZTXH 2C1PA 1II4E 2BNRA 4HKXB 4XBGA 1TZIB 3VD4A 1IGML 4RFNB 4M7KL 3SEPA 1NBVL 1RMFL 2HJLA 2FWOA 5FYJD 1N7MH 4FNLL 5J6GA 4NFBA 4P46D 3UC0L 3WFZA 1DEEA 3O6FD 2VLRA 5H2BB 5JW3L 3OL2A 5LGHH 3LQMA 8FABB 5EN2A 3S5LA 2KKQA 1J11A 4PLJD 4ODTL 3Q1SL 4Y89A 5EUKA 4X7SH 2IMMA 4CN1A 4GRMA 5IKCB 4QWWD 2AEPH 4M7LH 3ZYZA 5B3JF 3OKMB 3O6LL 5DMIH 4X8JB 5CZKA 5F96L 5CIPH 4Y4FB 5I30H 1T21A 1V3LA 3U6RB 3GBMH 3QJHA 5HI5C 2VDLL 5LJYH 3GRWL 1K3IA 1A3QA 4BZ1L 3GKWH 5F93C 4GKNA 4JQIH 1X4YA 5HHXL 1FRGH 1AGCA 2OTWA 3VXNA 5GS1C 4ZDHB 4GKSA 2WWKT 4NZJA 1CLYL 2EKSA 4ZYKA 2HT2C 4JFFA 5EC1A 1IAIH 4NOBA 5FF6B 1GGBL 2ILLA 4KRPD 4QF1B 3MNWA 1Z3GL 1ZKAA 4YHKL 4LSSH 3DX7B 4DKDC 2EH7L 4HXBH 2YSSA 5C7XL 1ETZB 1MNUL 1NBYB 1VEMA 5JA8B 2WM0A 1WFTA 5IUSA 2P7TB 1QLFA 1JZ7A 3D25B 1RZKH 3IGAA 2UWEB 3EYUL 4ZD3L 5CHNB 3T04D 4Y19D 4I0PC 3I02B 4MJIA 4JFED 1GGYA 1D6VH 2XQYG 1GJIA 4XNMB 1OAQH 2V7NB 4OI7A 1T03H 4NO5A 5T1LD 1VFAA 3CLFL 3CVHB 1MI5B 5E6IC 3HRPA 1OF2A 4HIIB 4IDJL 3FL7A 1W0VA 4P5KA 5BS0E 4NQDD 2VZUA 2E6JA 1AP2B 1AXSA 3D9AH 5DUPH 1D6EB 3VXRD 4I13B 2CKBL 4LGSB 1C5BH 4P57A 3VFPA 1QR1B 1RULH 2QBWA 4GS7C 4KUZL 4E41E 3PP4H 1LDPH 2G9HB 4MX7A 1ACYH 4FQHA 1QSVA 3F8UB 3FRPA 3HNSH 2YD1A 3LN5B 2ESVE 4JDZA 3EHBD 1CFNB 1EEQA 1ZHKB 5IFJA 3KPNA 2BVOB 5JXAL 1BQUA 3P4OA 4I5BB 5DRNB 1U8IB 3QWOA 5L9DH 3RWDB 3WFEL 4EDXB 3BDYL 3K4ZA 3BGAA 5A2JH 1B9ZA 1NEUA 5E1AB 1U8HB 1KF9B 3VH8A 5DEFB 2DQEH 4JG1H 2EO9A 3GFUA 1TTFA 1B0RA 4MQSB 5ESQB 1JVKA 2WP3O 5I71C 5EWIH 4X99A 5IJVB 1XGPA 1X5LA 3LEXB 1EJOH 3W2DL 2OR8A 4DZBB 5CGMA 2AKRB 5DJ0A 1U3HA 1LK2B 1XGYH 3MLXH 3GBLA 5AZEL 4DKAA 3O4OB 5L88L 1MCPH 3GMNA 1EFQA 1AHWA 1LP9F 2I60H 1J9CT 1LO4L 4LRNH 2H1PL 3UBXB 4ISVB 3MYZA 3TBYA 1I9JL 4NBZB 1NCTA 1VKXA 3LKPA 5KAQF 1EJ6A 1NQBA 1U8JB 2VXVH 4X9FA 4DJMA 3OSKA 4LKCB 3MCG1 4OFDA 2DYPB 5DK3A 1LP9E 5HPOA 1PLGH 4HH9B 2R0WL 1VADB 3V8OA 1T89A 4L29B 3V4UL 2D7TL 1C7SA 2YPLA 3RVXC 1W8NA 1HOCA 4E41A 4P2OC 5BJTA 5FGRA 1KEML 4DQOH 3O2WH 2ED7A 5KVFL 4LLUB 4R26H 2ATKB 3RUGB 2EDOA 1VGKB 2GITB 3TPUA 4WI6A 4Z7WE 3VFNA 5A16B 4NQVA 2VZTA 2F58H 3K8LA 1EO7A 5D2LB 1CDIA 1FFRA 5DJYB 1U8PB 4X5XB 2VXUH 5DSCA 5MP6H 1R24B 5F1NA 4J3UA 3EIFA 3D69B 5DZLA 4F3FB 2KPNA 2X9YA 4Z9KB 3ZTNH 4BZYA 4PRHD 5IQ7H 4MXWH 2L7UA 4FRWA 1YNTA 3DURB 1KENL 4JRXA 3KPOB 1NSNH 3O9WB 1JNHA 4YAQB 4LRIC 3QNYA 4Z7UA 1W0YT 1F3DJ 5J13B 2X5PA 2AQ2A 1JZ5A 4HLZG 1PX4A 4OTXH 4ACPA 4MVBD 2QHLA 5JXEC 1RK0A 4L3CB 1OW0C 1FBIL 1FSKC 2QSCH 2IANE 4KTEL 3B9KD 4Z7VF 3CAFA 3PHOB 5HGAA 4LNRB 3K7UA 2IEPA 4GW4A 4GW1B 3MXVH 1RHFA 4FQLH 1N0XL 5I0ZA 3OKLA 4WJ5B 1QSZA 3GDBA 1JTPA 5HJ3B 3FO2B 4KRLB 2VQ1A 4Z7VE 4TYUA 4FFYL 1ZANH 2XXMB 3MOQA 3ZT5A 1V3JA 3KDMA 5E8OA 1JI1A 3BKYL 2YBRB 1M71A 4H20L 3NACH 1FYTE 3HS0A 5DRXA 4FMFA 4JZOB 4J3OC 4L8SA 4N5EC 3QCVL 4NQCB 3SJVA 5DYOB 1MEXL 4KZDL 4ZPTB 1OWWA 4GBXB 1U6AH 5CBAB 5H94A 3AMKA 1R3IH 3RA7H 3EJZC 3EYQC 3QXWA 5I0DA 1KLGB 1KJMB 3QRGH 2HFTA 2NX5E 3NBNA 4LF3A 3G6DL 4F2MA 5IHZA 4UT9H 4XRCB 5EUOB 2I25N 3QXUA 1HE7A 1HDMB 4UZGA 3O3BB 2E3VA 1OOAA 3IDXL 3WFDH 3QT2A 5F89B 1MOEA 5M7QA 1FE8H 4GAJH 5E7BA 1YYMH 3V9FA 3F7VB 3RWIB 1FL5A 3ALXA 4Z0XB 5IT2L 3BN9D 3RKPA 5C0FB 3ARDC 4E5XA 1JRHI 5CJXC 3FHAA 3MRMB 1UG9A 1ZHBA 2IANA 2OR9L 4JZJA 3VRIB 4ZFZA 2L0DA 3N1FC 3OHXA 2FL5B 1JYXA 1EEYA 3ZHDA 2MKLC 4G9DB 1ONQB 1VENA 2PYEB 1RJZB 5IM7B 4Z8FL 5HI5D 3BPLB 3NCBB 4RFEB 1QNZL 4JQXA 2J88H 3IU3B 4C4KO 1BFTA 5I17B 1ZT1A 5I9QC 1OSPL 5HDQL 3RVVC 2ZCKH 3UEZA 1WBZA 1S8DA 3BMWA 5C0GB 2R2HA 4U6HA 3LQAC 3FB5B 5ETUA 3PV7A 1U42A 1XGTA 5C0JA 5D1ZB 4KMLB 4OCWL 1FPTH 3NCJH 1BWMA 1IKNC 1FYTA 2MWCA 3KPSD 4JFPB 3CFBB 4XMPH 2HT2D 3VD3A 5I75B 1P7QD 4C56E 3TA3A 3NFNA 1JF1B 4M1CC 2CLRB 4K94C 3DSFL 1YN6B 1CFSA 2BNQD 3V6FA 5JUEL 4ZFOL 4K3EH 4NQEB 5C3TA 43CAB 1GHFH 4MJ5B 5K9KB 3WNLA 1ZWIA 5CILH 5KSBB 4IRJA 3DSNA 1VFBA 4XMLH 5HGGS 3BPCB 5FDYA 3L3HA 4YBLB 3X3GH 5EBWB 4C59B 5C0BE 4BH7B 3SKMA 3AS3A 4I0PD 2SEBA 4X80H 4Y4KA 3RWFB 3SDCC 1FORL 4QHKI 5I8KL 5CJ8A 3V0VB 3RIFK 5A2LH 1I1FB 1QRND 4ZUSA 4F37F 5KSVA 4I77L 1LEGB 5E6ID 5FXCH 4KU1A 2A6IB 5D96B 4WNQA 4PY8J 4XP1L 1IT9H 5DVOA 1UM4H 2X4OA 3B9VA 5GZOD 5ID1B 1C5DA 5MEQB 3HMWH 5AWNH 2H9GB 5IHUH 5ADOH 4KKLC 5E2UH 5BZDA 5H8DA 2EYTA 3ARBD 3OBAA 3DUUA 4OD3L 2H8PB 3TIDB 3AUVA 4I8DA 5IMLB 3QQ9C 3WSQL 3CFDA 3N1GC 3F62A 3MNZA 1U3ZA 1FVDB 5L0QB 4U1LB 1G7MA 1MCWW 3BT2L 4P9HC 2P47B 5C0IA 3KLAB 4UOJA 4FN0A 4ZAKC 5EDXA 3WYRA 2M8XA 1EIBA 1DQTA 2X40A 3KJ4B 3Q48A 2EC9U 1DUZB 1FZMA 1OAZL 1MIEH 1OGTB 4OAWB 5DA4A 2XT1B 5T3XH 3MJGX 4JGUA 5LBSL 1SM3H 4PRPE 4CVZB 1CLCA 1NL0H 4C56A 2EC8A 4G9FA 35C8H 3RNQA 1NUNB 3RI5F 2EDHA 5MEPB 3T0EC 3D3VD 3O8XA 4PB0L 2K7PA 5FYKU 1MAML 5EC2B 4R97C 1IGJB 4Z77B 5D7SL 2R2BA 4FQPA 1P1ZB 1JYVA 4V1DA 3T4AA 4NHCH 2ITDB 1V7NL 5BW7A 1HH6B 4PP2A 1QFWM 1HXMB 4N8VB 5IW1A 2E7MA 3MRCB 4ZUWB 3KYMB 5TQ2H 1CQKA 2IH3A 3NN8B 4H88L 3JV6A 3SKNB 3SE3A 2R4RH 4LAQL 3TP4A 4YXKH 2X70A 3VFOB 2W0FB 5AD0A 5AUMB 5GRVL 2HJKB 5K9OB 5HVFB 3UTQB 3ME0A 4I18C 5C0EA 1NGPL 3GO1H 4XZUB 1CBVL 3GMRB 5HHMD 4JPIB 3ECBA 4HMCA 2LQRA 4XPAL 1H3UA 3BP5A 3KGRA 3U9PH 2VXTH 2RHEA 3RVXD 4WWKC 3CJJA 5DD3H 2HFFA 3QDME 4P2OD 4QNPF 1YEHH 4NM8L 5E9DE 5C07E 1AO7D 4Q58C 1MIMH 4PR5A 3UTSE 1T3FA 3EYVA 2YRZA 1JWUA 3RGVB 4LHUA 4ONOA 4K7PL 1XIWA 1CD1A 2DM7A 3K0WA 4QRRB 4QNPE 1H9VA 4PRPA 5C09E 1KCRH 5DQJA 4YHLL 5GRUL 5T1DL 3WMSA 1AXTL 4U3XA 4Y19B 2Y06L 4L3ED 3QULB 3TNNB 5I1LB 3LH2H 4MHHG 4D94A 1U36A 4X6BB 2MNUA 5JOEA 3U83A 3H6JA 4YDIL 3QHZL 5T1LB 1DDHA 1HSBA 3PIQA 2BVUA 2MQ0A 5GIRB 3VXMB 5IFHL 4NCC2 3S37H 2XY2A 5IWLC 4NQDB 3T1FB 4GO6B 4NUGH 4U31A 5TE6L 5SX4H 1BBJA 1LVEA 1RZ7L 2DICA 3V5KB 1T22B 4JFYB 3FRUB 3D18A 1P4IH 3C08H 4OFYD 4RGOL 3VXRB 3O3EB 2VZSA 2YRLA 2WBJA 5CP7B 4Y5VC 5IROA 4M5ZL 1HQ4B 3D85B 3HC0A 3HFML 5FYKH 2C4XA 2OTUB 4H8WH 2RIKA 2HMID 1MRCH 2DLGA 3IVKB 4X6CE 3B6SB 1DANT 5IHLB 1E27A 4JN1H 4GG8A 3TEUA 2DI8A 2Y7QB 1VFUA 2VITA 3WIHL 3GSQB 1FL3A 2EXWC 3IF1B 5D9SB 4LCWE 2A6DB 1J12A 3SKOA 4PUBH 5C07A 2YPVH 3C2AL 3T4YB 4LSQH 3HRZA 4HKZB 2Y4SA 1ACZA 1PAMA 3HNVH 2Z8WC 4DUXA 3SHSA 2DQGH 4QRSB 4N5ED 4AEIL 1KFAL 1T1XA 2Q76B 3QQNA 1BEYH 1D9KB 2OI9C 2HRLA 2B1AH 1JFQH 4EDWH 4DCQA 5ITFA 1I9IL 5I1IL 4XX1E 1AC0A 2X4RA 4D0CB 3GSUB 1LO3H 3EYQD 4UBDC 5HYSA 1IQWL 1HHHA 2EXYC 1TCRA 4LIQH 2E9IA 4OF8A 1HHJA 3N85H 5H37H 5FM8A 1EEZA 3ZL4H 1L0YA 1A64A 3GKZA 1KJ2H 1YPZF 4MJ6B 4S1QH 5KSAA 2XWJA 1A4KA 3CFJB 3DO7B 5DTFB 1CVSC 3WJLA 4EKXA 3OKEB 3V0AC 3PUCA 3DVFA 2JJTC 2CIKA 5IEHA 3ARDD 4HUMB 1RJLA 2CLVA 3GSNH 1KBGL 4PJCF 3GNML 3CGTA 3AAZB 1J18A 4MD0B 1DFBL 1IM3B 2W60A 2YOCA 4XAWL 5DF0A 3ZSTA 5B8CC 3K46A 4LLAA 5E2VH 5BCAA 4ODBD 3KPQA 5DVNA 4KVCH 2GI7A 3LB6D 2BFVL 2VKXA 3ARFC 4X4MA 1S5IL 3UJIH 5I1AA 4PJCE 1YEDA 4L4TA 3RVVD 2FBOJ 2P5WE 1XF1A 3G5YA 2IFFL 2NY5C 3T0VA 4ZTPH 4ESKA 2OCFD 3L5WA 4EXPX 4OCNC 1LMKA 4CU7A 2ARJB 4ELKA 3ULVH 1B4JL 1OGAE 4OM0H 4PRHB 3W39A 2R23B 1LO0L 4M1CD 1BQHB 5ALBH 1NJ9B 4JQVC 4TVPH 3VWKA 2O5XH 2NW2A 3EOBA 4KUCF 4XP6H 2W91A 1N6QL 5DI8A 3TJEL 4JO4L 5LKNA 4NSKA 3UJTL 5L2KA 1I85C 4HC1A 2E8ZA 4K8RH 5JIHA 4ZXBC 5HHVH 1EBPA 3B9KB 4PJ5D 4U1NB 1F3JB 2BCKB 2I24N 2HFGH 1JYWA 4QTHA 4TNVF 4Q74A 5EO0B 1WICA 1YPZA 3U7YH 5DJ6B 4AEEA 1YNLH 1S7SB 4XHJC 5TPWH 3A67L 1Q8MA 1XGQB 1KPRA 2OJEB 1X5AA 2EEBA 3OJDA 1KGCE 2IH1A 4N68A 5GS2D 2J4WL 2JCCB 2YXFA 5DRZB 3RL2B 3X12B 4C54A 2D7MA 4HCRL 4MNGB 9CGTA 1CR9H 1WEJH 1MFEH 4Y1AD 1HH9A 1I3RA 1MFAL 5FGCB 2RFXB 4JM2B 4LCCB 4BKLA 4LPUA 2AJZB 5MENE 2A73B 4KGLA 1RURH 2BHYA 2FBJH 4KWUA 2J5LC 1ORQB 3BP6A 4RQQA 3S88H 3SO3C 5D7LE 4PRIB 5KOVC 3DMMA 4LU5H 3P77B 3QUXD 5JHLH 3O3AB 3MLVL 4OB5H 1DLFH 2FO4B 2GK0A 3DV4B 3ZE0E 3LQZA 1QLEL 1CF8H 2WWMC 2DQUH 2FJGB 4G6JL 2OXHA 3BSZH 4E0RB 4A2LA 4JANA 4NJ9L 3HN3A 3UTTE 3T0ED 3FQXA 3I9GH 1XFPA 3GJEA 4HFWB 2V2TB 2KQNA 5BRZE 1QQDB 4LSRH 1RZGA 2ZOLA 5HDBE 1WC7A 4OLUH 3WHXA 1K85A 2NW3B 1J0YA 3Q0HA 4R3SB 2IPKB 5ENWA 4OCXL 5T3XE 3GMOB 3OGCB 1UQSB 2DQDH 4YDKL 2BXZA 4KAQH 4OZ4B 1A9EB 1A14L 3DVGA 1Q1JH 5TE7H 4BUGA 5HI4D 4Y88A 3RTQC 1IGYB 4DN4H 2CXKA 5FGBA 1A47A 5H35B 4HH8A 5D1QA 5T3ZH 3FHQA 5IBTL 4G7YL 3L3IA 3MA7B 4D0BB 1S5HB 1TVBB 3FQRA 5CGYC 3MRDA 4PB9H 4YJZL 4HHAB 3CDFA 1BIIA 4MS8C 3MLTA 1KNOA 3MV8B 4PRBA 4WWKD 3KPSB 4YO0A 1INQA 1WCBA 3MOBH 3K2MC 1G6VK 2R0ZH 2A77L 5BMFH 1RUAL 1VPOL 3X11B 1F58L 5TQ0L 2WNGA 5IW6B 3O2VH 25C8L 4HF5L 4PGZA 4XNZC 2AK4E 4Q2ZB 1ND0B 4CDGC 3UDWA 3BKCH 4L1HA 3MRKB 1BD2E 2EDBA 1ZGLB 1NC4A 1ZT7B 1WAAA 2BSSB 3TO4B 4WUKH 4I0PB 4ALAL 3F7QA 3M8OL 2ZCLH 1F8TL 1A7PL 4DOHE 5D72L 4NNPL 3L5IA 4H1LB 3BP4A 1FG2B 4ZFGL 1RFDH 4QXTA 2A74A 1QRNB 3MROB 3O41B 2Y1VA 2XTJC 3U7WL 4FP8L 4W4OA 5LGJB 2VSDA 2GKIA 1QVOB 2LU4A 1CL7I 2FECI 3H7LA 1AGEB 5JDSA 4GW5A 1G6RB 3RFZC 1U93A 2DN7A 4JKKA 4PJ7F 1IQDB 3WCYA 3NIDE 5E8DH 2F8VA 4P2QD 1IGTA 4GAFB 4L4VD 3OX8B 5IR1A 4U7KA 3ARBB 3MO1B 3WFBL 2Y36H 2FSEA 4GS7B 3LEYH 1H3VA 3OB0H 3VFWA 1A0QH 1QA9B 4F7EB 2AV7B 3OXRA 2J1KA 3JTTB 5DMGC 4PJ7E 2HTLD 4AT6B 2YUXA 1OAUL 2BJMH 5D70H 2Y6SC 4NQSA 2EXWD 5ESVA 5AYUL 5CBEA 1X5YA 1TZGL 4QGYA 4EIZC 1LD9B 5JR1L 1M05A 4YHNB 2D3VA 4X9GA 2FJFB 3CFIC 4U6TA 4WI5A 3GK8L 3GI9H 3CH8A 1DQJB 1H15A 1KLUB 1BECA 1ZA3B 4EI5A 3JV4B 3B83A 1ZE3C 4UBDD 3W5NA 3KJ6L 2EXYD 2G5RA 2AAVA 1I1CA 4XC1L 4XPTH 5C9JA 3O45A 2CUIA 1DVFD 5F9JA 3W0WD 4LVNC 5TDNB 1I7UA 5F97E 3DGGA 1EFXD 1T2XA 4YNYA 1P7HL 2ENSA 4YDLC 2JTDA 1H5BA 4PTTB 4LAJH 4GAGH 3HHRB 2BVTA 4WFHD 1P5UA 1T5WB 4KROD 5DR5L 4LIQE 3T2NH 4K9EH 1OAKH 3MR9B 1PQZA 3VD7A 1OHQA 4K7PY 4WWID 3O6ML 2C3VA 3DXAE 1NH6A 4KV5E 4QRUB 3TCLB 4MA3B 1YEJL 1NAKH 3BO8B 2QL1A 4RMSA 1S9KC 3MJ8A 1YUHA 4HS6A 4A2MA 5D8JH 3ARFD 4OFKA 4XXDB 1KJ3L 3D1MC 4XXCA 5GXBB 3G6JB 2AQ1A 2OL3A 1OSZB 2JJWA 3WUWA 4PY8I 5EIVA 5HHOB 1UA6L 4XCCL 3D2UD 1Q9LB 5IB5B 4L3EB 2QKIA 2XA8L 3VXQA 4PLOB 4XC3H 5D2NB 1MRFH 1OP3K 1EGJH 3ULVF 4O2CA 3PWPE 2X1QA 1I8LA 5CJQH 1ED3A 4G6ML 3M07A 5B38G 2C1OA 4Y2DC 2VMFA 5CS7A 4HBCL 2I9TA 3LKNA 4NRZB 3AVEA 4X6EA 2XI9A 4FQJH 4YHZH 4HWNA 4BH8B 4LSVL 2VABB 1PYWB 4NYLA 1CGUA 3U0TB 4KKAD 4A6YB 1YYLH 4ZXBD 1FSKB 4M6NH 5KSUA 5F7EH 3GHEL 3U30B 1ITCA 3VFGH 5FYJU 1YEIL 4TVPE 1UGNA 1Y0LB 5BV7H 2E27H 1T2QH 1BVLA 4XHJD 3QFDB 3F7RA 4WEMB 5FUCE 1A7QL 2V17L 5DJ2B 5C0AB 1AE6L 5DWUL 3WKNA 4K3GA 1DQDH 2YA2A 4KHTL 4U1SA 4NKQB 5E7FA 5I73C 4OD1H 5L7XL 3R1GH 3QEQE 1Z9OA 2QQQA 4W68A 3SBWA 5C08D 4O02H 5GRYA 4M1DL 1ZLWK 2XN9B 5DRWB 2IADA 1XAUA 2HFEA 3H0TA 3VFRB 2FO1A 5JPNA 1A3RH 3HG1A 4JFXB 5I76A 3SGDH 3U1SH 3G04B 2JLLA 4DEPC 3MREA 1HKLH 3HUJA 4PJGE 1Z2KA 1F4XH 3CFKA 1MVUB 4QRQB 3QNXA 5CUSL 2WWMD 5EU6A 4APQA 3SDAC 4U6YA 2R56H 4PJ8A 3V6ZA 5HHQA 2ADFL 2Z9TA 3NCYS 4MNQA 5E94B 4B50A 2LTQC 4GSDL 1YY8B 4DGYH 4AY0A 3TH3T 4ZS7H 3UBXI 3ZT7A 1X7QB 5HYIA 3BIBX 2F5BH 1I8KA 4WW2C 4JHAH 2BY1A 2X05A 4HKJB 2ADIA 5ICYB 4EOWH 5CWSA 3RTQD 1AQDB 4I2XB 3L5JA 4X98A 4FFZL 3HMXL 3Q5YA 1JPGB 3MBEC 1JUFB 3KPLB 4IRSB 4OD2B 5IMOA 4XX1G 3CXHJ 4NT6B 4D8PB 4QOKA 1CLZH 5CGYD 5DK2B 1O0VA 5IB3A 3FQWB 5IKCA 3IYLW 4TSAL 4RCAA 4MS8D 3QUMB 4EBQL 5J89A 3FO0L 4ODXB 3MGAA 2IBBA 3LPGA 1SY6H 4MA7H 4P3DB 1NEZG 1RZIB 3UZQA 3S34H 4KRNA 2V2XA 5FYJH 5T3ZE 1YNKH 5ICXB 3RX8A 4AK1A 4CVWA 3T1WA 2ID5A 2P46B 2FHBA 2MPAL 4PGDB 4LARH 1A6TB 1FO0B 1NGXA 2X1WL 4GXVL 2E7LC 4Q9RL 4CAGA 3IDNB 5K9QI 2EDTA 2YPKA 1AQKL 4XNXL 3TZVB 5C0CD 3W82A 5KVMC 1PZ5A 4YGVB 2VUYA 1PSKL 1NCAH 4MZ2A 1S3KL 3D48R 2EYRB 4QHMA 3VXPA 4JPVL 3LPWA 2N7BA 5SWZB 1HSAA 1NLBL 4RZCA 2EIZB 4XNYH 1A1MA 4LLWA 5GSRB 2P7TA 3BPOC 3C9NB 2ITCB 3D25A 3MRBB 4OGXL 3H9SB 2UWEA 5JQ6L 1MHCB 1F13A 4KGJA 5GJSL 3I02A 3CVIL 1AD0A 1UXSA 4I3SH 5CCKH 2XWTB 4O58L 4YHOL 4XNMA 4TUJB 3KPPB 3E2HC 1AD9B 3SCMA 3P9LA 3BVNA 1A6WL 1MI5A 3ARXA 1AR1C 3MMEB 5DMGD 1MFBH 4WO4A 5D1XC 1DE4A 5DD6A 2ADJA 1ZA6A 1MREL 1JGUL 1D3CA 4XGZA 1P4LB 1T7XA 2BSTB 2Y6SD 2A9NL 4HWUA 3PWUA 1D6EA 3GBNL 2ATPB 3O3UN 3QUXB 1OPGL 1JE6A 4NWUL 1BAFL 4M6OH 1M6OB 4UINL 1GAFH 2UZIH 2G9HA 3HLAA 4LQFH 3MRHB 1GPOH 4Y5XA 1EPFA 4GH7B 2DQFB 3LN5A 3MRNB 4O4YL 5D4QA 4HEPG 3OXSB 1CFNA 3MUZ1 4P2RE 2GFBA 1KCVL 2BVOA 4RGNE 4RGMB 4I5BA 4P5MB 5CINH 3RWDA 4EDXA 2EIBA 4S1RL 1P2CB 2FCBA 3G5ZB 1AGDB 4RA0C 3NCEB 2C26A 3PDOA 4M62L 3RVWC 2UY7A 3UPAA 3HE7A 3BP7A 1CVRA 1U95A 3SKJH 3QH3B 3HZYB 4J1UB 3SY0B 1NUFA 4ZO7A 1YQVL 4OQTL 3DX9A 4DGVH 5A2IH 4DZBA 3ZO0A 2DDQL 2CQVA 2AKRA 3GJFA 1U91A 1I9RH 1LK2A 1GGIH 1S9WA 4NZUL 1BFVH 1MRDH 3E0GA 4I18B 2IBGA 4P4KB 3ELAT 3LY6A 3MV7A 4U2YA 5GGSB 1FN4A 3F7PC 3ESUF 3TBVB 3ZYOA 5B4MD 1RHHB 1ZVYA 4ISVA 4OCRH 1S7XA 4NN5C 1WT5A 4MA1B 4WIQA 4YDJB 3ARGC 4U1MB 1T7ZA 1DQMH 5DUBB 1RUML 4HWBA 3TNMA 4LKCA 3QO0B 2HT3C 5BS0D 2DYPA 5TGBB 3QDGB 2AEWA 5JW4Q 4O2FB 5JPMB 1I1YB 3RY6C 2NXYC 3MUJA 4IDLA 3WXWH 1BF8A 1VADA 2O61A 1IL1A 4LPVA 4OZIF 3NIFE 4KZEH 2YEZB 4NNYA 2LU7A 2WUCL 3QDJB 4E41D 5GGVL 3VW3L 4P2RA 3RUGA 4J4PC 2EYSB 4GUPA 2ESVD 2GHWB 5FEBA 5MERB 5J1AA 3MRPB 2AW2A 1H3PL 2OQJA 2F15A 2F54E 4Y2DD 2BOBB 1UM5H 1Q9OB 3L95A 4MLSA 3QEUB 1A3LH 1LO2H 3KYKL 4K7PX 3TYFA 3P2TA 1X5GA 4JO2H 15C8H 1R24A 5LVEA 1NLDH 1WFUA 3O3DB 4JY6A 4GQ9L 4FQ2H 4NPYA 4L4VB 5FECA 3KLDA 3RU8H 4LP4A 3J7HA 5HGDA 3RKDC 3OV6A 4WUUB 3FQUB 3P4LA 4OCSH 4TNWF 3DURA 2NTFB 3LS5L 3OB0K 2FX9L 4BQBA 1HEZB 3ZKQD 4U49A 4LPTA 4UQ2B 2CRIA 2Z8SA 5EIIA 1VEPA 4OZHB 4EUPG 5D7IB 1U8NA 3ARUA 4W70A 5FHAH 2A83B 3UO1L 5IB1B 3UAJC 5IOPB 5ITBL 1OP9A 2K9UA 3PHOA 3R06B 1E6JH 4M1GL 3H7BB 4YEFA 3STLB 4JCMA 3SPVA 2OI9B 2ORBL 4KJYB 4ELME 3LN4A 1IGMH 1S9XB 1AKJD 4M7KH 5F7LB 1WITA 4QY8B 3VI4F 1NBVH 1CICC 1RMFH 3KLSA 2DJSA 2QR0A 2FATL 1SJXA 4FNLH 1DVFB 1CN4A 2YHGA 4OZGF 5LQBL 2LVEA 1NFDB 3UC0H 1G0XA 4AIXA 5JW3H 3VXUB 1MUJB 4JZOA 3WNMA 4ODWB 1EFXB 4NQCA 1LEIB 4R2GC 5DYOA 4LDLB 4OZIA 3VI4E 1URLA 3O4LE 1YN7B 3QQ3B 2ZJSL 4ODTH 5M94B 3Q1SH 3QIBC 3GSRA 5CBAA 4ONHB 4OZGE 5DQDL 4KROB 2MKWA 4DKFL 4L5FL 1KLGA 1X9QA 1KJMA 3BUTA 2P8LA 4NQXB 3JSSA 3VFTA 2FGWL 4OF3A 4GJTB 3GMPB 3O6LH 1W8OA 4XRCA 5E4IA 1KIPA 4W81A 4ZQKB 1HDMA 5B39G 2FIKB 1MWAL 1RD6A 4MB4A 2P8MB 4S11A 2DTML 3MBED 3UZVB 3U82B 2VDLH 4KK5C 3K4AA 3GRWH 3ARFB 4LCUA 1XCTB 4BZ1H 4LLDA 2Q7YB 5A2KH 5EULV 5HHXH 5JW5B 3C60B 4XPHL 2FX8L 3MRMA 4PJDB 4BA8A 5BXFA 2KDGA 2X9XA 3VRIA 5B22A 2FL5A 3D2UB 5T1KA 2IAND 3QHTC 1JBJA 5IF0A 1CLYH 4JFZL 3VDCA 1RJZA 1GGBH 1Z3GH 1R5VB 3IU3A 4YHKH 4DVBB 2EDLA 4QGTA 2EH7H 4OBRA 3V6OE 5C7XH 1MNUH 2C4FT 3CH1A 5FKPB 3VGGA 1WIUA 2X4PA 4PJBF 1A6AB 2D31B 2V5MA 4ONFL 5H37G 1IBGL 1SJHB 3NAAL 1KN2L 3TWCL 3EYUH 4ZD3H 1N6UA 3VFSB 2GK2A 3CFBA 1FYTD 5INCA 3KXFE 4X8XA 1NMCB 1TTGA 1MCWM 2DKSA 3VXSE 1JF1A 1NBZB 3X13A 1I1AC 3QWRA 3T09A 2GJ6B 3CLFH 4MNHA 1GVIA 4OZGA 3FB6B 1DBAL 4IDJH 3C87A 5K9KA 2VTFA 4QO1A 4M7ZB 1BREA 1Y6NR 5HI3C 3CZFB 5F3BA 4AJ0A 5GRWA 2VL5B 1NGWA 2NX5D 4FQQA 2PN5A 4FXGA 2CKBH 4NN6B 3FN0L 2D7PA 2GT9B 2NNAA 1EAPA 4MJ4A 4KUZH 1BLNA 4QKXB 2GUOA 4P23C 4I0CC 5IVZB 1LEGA 5SWQB 3TVMB 5E4EC 1AR1D 3I6KA 4FFWC 5HPMB 4K71B 2OM5A 4GRWE 5D1XD 1J1OL 3QUYA 5JXAH 1CG9B 3G08B 3S98A 2J5LB 3VGAC 4GKZB 4NRYB 3WFEH 5D5MF 4IIQA 3BDYH 1XF4A 3RWHA 2H9GA 4GRLC 2RR3A 3H9HB 2H8PA 1OQXA 3MV9E 5T5FL 3PXJA 5DJ8B 3ZMRA 5IV2B 1G7HA 3MRLB 12E8L 2PTTB 1FVDA 3BZEA 3W2DH 1XF2A 3F12B 5C8JA 1I3UA 3RBGA 2C1PB 1OARL 3KLAA 2BNRB 4BFIA 5IVOA 4W6YB 5I6XC 5M95B 3L9RA 4XBGB 5AZEH 5L88H 1OGTA 2ERJB 1YJDL 4RAUA 3RVWD 3O0RL 2HJLB 2VL4A 2RCSL 3KXFA 4G42A 4P46A 3FFCE 3EDEA 3O6FA 4I4WA 2BDNL 4PJBA 1LO4H 2H1PH 4C56D 5J6GB 3H42L 4J3TA 3WS6C 1TNMA 5IVXE 5MEPA 1OD7A 1I9JH 5EC2A 5LXGL 1JN6B 5EN2B 3S5LB 1FFPB 4QXGL 2JELL 1P6FA 2J2ZA 5EUKB 2R0WH 1HXMA 1R5IA 1A6UL 3NPSC 3SGJC 2QV2A 4FA8A 4GRMB 5C0BD 2NQCA 3V4UH 2D7TH 3CUPB 3RNKA 1G84A 2UV3A 4ZUWA 5E99L 1I9EA 1EMTL 4LEOA 2IMNA 2BVYA 4M43L 4JKMA 3NN8A 3QCTL 43C9A 4JFHE 1KEMH 4X7FC 4G7VL 3SKNA 3TV3L 5KVFH 1D5IL 4HJGA 1T21B 3LEVL 3QJHB 5J3HC 1L0QA 2MCG1 1FH5L 4N8PA 5AUMA 2ADGB 2HT3D 3ZTJH 4GAYA 1C7TA 3OAZH 4XNZB 2NXYD 5JMOC 4QHLA 3GMRA 4GKNB 2IPUG 4Z7QE 4OGYL 1U92A 1AGCB 2OTWB 5C0CB 1JHLL 1QFWI 5D5MA 3BQUC 5TDOA 2EKSB 2X4SA 4ZYKB 4AENA 4JFFB 5EC1B 5C3LD 5DHVH 3MNWB 2H2PC 4YHYC 4IMLA 1KENH 3VG0L 2GJJA 3C5JA 4Z76A 3SE4A 4Z95L 5CMAA 5EU4B 2YSSB 3OJVC 1DLHA 2UYLA 3T0AA 1E6OL 4OFPA 1LWRA 4G6KL 1QLFB 5DURD 3HB3C 1T2JA 4JN2B 2ZG1A 4JFEA 4X6DF 1T83C 1U2HA 3O6KL 1FBIH 2CDFB 3PL6C 4X6BA 2AQ3A 4KTEH 3RKDD 2Y9RT 3LOWA 2COQA 3UYRL 2NR6C 3MRGA 1PGRB 3W9DB 2NMSA 1F02I 1QRKA 5GS3A 3BW9A 1DBML 1VACA 1KB9K 5GIRA 4NO5B 1VFAB 4NQDA 4KK8C 4KTYA 3WBDA 3IB4A 3TBTA 3W9EA 4P5KB 1F97A 3BUYA 3V5KA 2AEQL 4OSUL 1MCSA 3IDYC 3JWOC 3VXRA 4FFYH 4IS6A 1AXSB 3D39E 3O3EA 1IGCL 3UAJD 3NGBB 3CCHA 3WHE0 5CP7A 3BKYH 1BX2A 4H20H 1NDGB 4MA8L 4P57B 3VFPB 2B20A 3RIAK 4TQEL 3HAEG 3DROB 1IJ9A 3QUKA 3QCVH 3FAWA 4M8VA 3B6SA 4C58B 1MEXH 4KZDH 4MX7B 3JBG7 2VO5A 5A3IC 4Z7NF 3MLSL 4HV8A 2Y7QA 1JCKA 4UOW0 5IFJB 1YA5A 3KPNB 4NP4L 3HE6C 3IF1A 5D9SA 4KVNL 1U0QA 1CICD 3QWOB 4ONGL 3T4YA 5LWYL 1BIHA 1ADQL 4NN7B 3HI5L 3G6DH 3QDMD 2ED8A 2V5TA 4KXZI 4PJFE 5E9DD 5IB4A 5C07D 4Z7NE 2AGJL 3DYPA 4UV4L 4QRSA 3DUSB 3IDGA 2BERA 1BJMA 1B0RB 2Q76A 3IDXH 4R2GD 3UTSD 2I07B 4MAYC 4X99B 2G60L 1EHXA 2R8SL 1XGPB 1XF3B 3QIBD 4PJAF 3V6BR 5IT2H 1U3HB 1C8PA 2NY6D 3MV01 5CEYB 2Q8AL 5C09D 3ZYJA 4JAMA 2ZUQC 4KDVA 3UPRB 4M7LT 2OR9H 5ECJE 5KS9E 3GMNB 5IFAL 3WJJA 4PJAE 1AHWB 3JWOL 3ZHLA 2VN7A 4Z8FH 4PD4K 1QNZH 1MHPL 4X6DA 4XT1C 3TBYB 5GGVY 1VKXB 2MHAA 1SBBA 4HUVA 1OSPH 5HDQH 4G6FD 3QXTA 1MH5A 4IJ3C 3N1QC 1PY9A 3TGXA 4XP4L 2DMCA 4OCWH 1M7DA 3CPLA 4XVJL 2F53E 1IM3A 4YQXL 4EXKA 1HOCB 4E41B 1BBDL 3REVA 1MF2L 2AV1A 4CN4A 4FQ1L 5DT1L 3ARRA 1HHGA 3DSFH 1KTLA 5JUEH 2VZOA 1EXUB 4NQVB 2W0LA 4LCWD 1P7KA 2ARJA 1Z6JT 3QNZA 5SWSE 1TQCB 4EEEA 5JO5A 5EBLA 4DFIA 3MYJA 1BHGA 1FORH 3BOVA 4CMHC 5I8KH 4H8WC 4PTUA 1F42A 2XZQL 2D4FA 4PRHA 3TH2T 4LVHB 3MBXL 3LKQB 4ERSL 2F74B 1BQHA 1I1AD 4I77H 5I1HL 4Y0GA 1DTUA 1UKQA 3JZ7A 2JJVA 1XT5A 1YNTB 1ODAA 3F6LA 1JNHB 4XP1H 3QNYB 4XP5L 2GIYA 5DJCA 1NPUA 5JHDE 1B4RA 1JTOA 1UH3A 1XH3A 4LDOB 4G6AD 1RK0B 4OD3H 5E95B 5I66B 3B9KA 4OF0A 4AEHL 3LH2L 5FO9A 1IAIM 3WSQH 4RWYL 1VHPA 3WO3B 1EZVY 4P23D 5ICZA 3TCXA 1E4KA 3B2VL 4FFWD 5HGAB 4HSQA 5EO0A 4GW4B 3BT2H 2BSRB 5DJ6A 1FVEB 4PJHF 5FV2A 1LP9B 1EX0A 3S37L 1AKJB 2XFXB 4AM0A 3OKLB 4LQ1A 1AGFA 3DNKA 4GRLD 1OAZH 2JCCA 3RL2A 5LBSH 4X4XA 1W72L 2VC2L 1X5ZA 1ZHLA 3GB7A 3GRWA 2YD5A 3KDMB 5E8OB 4PJHE 1M71B 4YHPA 3HS0B 5DRXB 3P73A 4IRZL 4ZMAT 4J3XA 4L8SB 4PB0H 3SDDC 1MAMH 3SJVB 3E8UL 2LTQB 5D7SH 2P5WD 2XZZA 2MQCA 1U3JA 4ZUVA 2RBLA 5F7DA 2XNAA 5BVJB 2MCPL 5H94B 1V7NH 2X44D 3P77A 5DA0B 1E4XI 2Z35A 4OCYL 5BVPL 1A7OL 1QFPA 1OGAD 4F2MB 5FA3A 5IHZB 4PRDA 4LNVA 4H88H 3BN3B 3WHE1 3MBEB 4LAQH 1YMHB 1WBXA 3INUL 4HFWA 1ZVHA 1QQDA 4JVUA 3QJFA 1DL7L 2IPKA 4X9HA 1FL5B 1X5KA 2XKNB 3WKML 5KTEL 1NGPH 1CBVH 1UQSA 1IC7L 4LIQL 4WDIA 2VISA 5J11C 4XPAH 4E5XB 1PG7L 5HD8D 4JZJB 2IANB 2R9HC 4NM8H 2D7QA 4I9WE 4ZFZB 1EUTA 3OHXB 4HG4K 3MACL 4PJIF 2VNCA 4M93B 2H32A 5J3HD 5D1QD 1PX3A 2CDEA 5GGTL 1KB5L 1S5HA 3ES6A 1QLRA 3ZZ1A 1JZ4A 4JZNA 4K7PH 1GXEA 1VESA 1ZSDA 2CKBA 3M1BA 3UYPA 1MQKL 1S8DB 4K8RC 5FUCC 5GS1A 4Z7VB 1KGCD 4YHLH 2FGZA 3BH9A 5GRUH 1AXTH 3NOIA 4PJIE 3KPSA 5ETUB 5C0JB 2Y06H 4JGJA 4YXHL 5FK9B 1S7QA 1FYTB 3MLUL 1P7QA 3HZMB 4PYGA 3L3JB 3BQUD 3BRGC 3X11A 1XGRA 1T0MA 4YDIH 5MEND 2VDML 3QHZH 2A6KB 3TA3B 5C9KA 5IW6A 2BNQA 2YD2A 5GGRY 4PG9B 2R39A 3NFNB 4BSVA 4OV5B 3EO0B 1ZLSL 3VMNA 5IFHH 1HKFA 4Q2ZA 1ND0A 1CFSB 3V6FB 5D7LD 1UWGL 2DLHA 5TE6H 3MRKA 1HINL 3PV6B 2NX5B 4IRJB 1RZ7H 3STZA 3IJYA 5SX5H 4Y5YB 4I0PA 3KWWA 3L3HB 1NC4D 4RGOH 1X4XA 2V5RA 3L5HA 3PGDA 3PL6D 3V4PL 2SEBB 1BMGA 4M5ZH 1T5XA 2AJYL 3KPRE 4RMTA 1QRNA 3HFMH 3QP3A 3P0YL 3UTTD 2NR6D 2EICA 4OIAA 5E6IA 4JDVA 4ODSL 5BRZD 4ZUSB 4D0DB 4JVPA 4KK8D 3WIHH 1AGEA 5T3XD 1IQDA 4KI5C 2X4OB 3K8MA 1WF5A 2XG5A 1RJYA 5CJ5A 1C5DB 4BSWA 4LSTL 3C2AH 2WZPD 4K8RL 1U58A 4YXLL 2EYTB 4F7EA 3DUUB 1VGEL 4JEGB 4D3CH 5AG9A 4AEIH 1KFAH 2XIDA 3JTTA 4YFLI 4ENEC 3EFDL 5A3ID 4UT6L 3T3PE 4AT6A 4TRPL 2V9QA 1I9IH 1G7MB 4XCNB 5I1IH 1OCWL 4IMKC 5C0IB 3HE6D 4HJ0C 1IQWH 5TPWL 4BFBD 5CIPB 5DUML 3QI9C 5DXWA 4CVXA 5CEXB 1FZMB 2ZUWA 4GT7A 3IU4L 4M3JA 1OTSC 1LD9A 4C56B 3S4SA 4C83B 3RNQB 3BPNC 2EDXA 1EDQA 3D3VA 4MAYD 3FO9A 1DQJA 4OV6F 1AIFA 3O8XB 2AK4D 4IOIB 2NY3C 3JV4A 2R2BB 4V1DB 3T4AB 5AAWA 1BD2D 1A7RL 2FD6L 1KBGH 3GNMH 5MI0C 5TDNA 1DFBH 4IOFC 1GGUA 4XAWH 4TPRL 3F5WB 2IH3B 1GRWA 1YEKL 4N0UA 3JV6B 5GGSY 2BFVH 1S5IH 5ACZA 3ZE1F 1V7ML 5E2JA 5BOPA 4BM7A 1V8HA 5AD0B 2IFFH 1D5ZA 1JMXA 4B7IA 3EYOA 3OAZK 5C0EB 3SOBL 1HYSC 1C16A 3ECBB 4WI9A 1RVFL 3BP5B 4P2OA 4TUOA 1NAML 4HLZH 1B4JH 1AO7A 1RV6X 3ZE1E 1MLBA 2HFFB 2R0LL 3WO4B 2DI9A 4KDWA 1LO0H 4OI8A 2Y07L 4H0IA 3DX6A 5CFHA 1JWSA 3X14A 5FIEA 1T3FB 4OLVL 3EYVB 3S97C 1JWUB 3B9EA 3R8QA 2QSTA 1XIWB 1CCZA 1N6QH 3TJEH 1CD1B 1Q72L 4JO4H 4PBXA 3UJTH 1SVZA 1Q9WB 5DURB 4CBPA 4PRPB 1Q9LA 4KKCC 4L3EA 5DQJB 4QYOA 2Q8BL 3IFOA 2ZUSA 4NO2A 2QQKL 5J6HB 3PWVB 2W9EL 3EOYG 5GJTH 4RGNC 1QYGL 3RZCD 1J10A 4F58L 1Y18A 3PGCA 4LRIA 3IDMA 3RRQA 1DDHB 5TFSL 4U33A 1JGEA 4NFDA 2C3XA 3VA2C 3OKDA 3A67H 2VABA 4EVNB 3I75B 4NC1E 1BBJB 1OW0A 4M9PA 4OFYA 2J4WH 1XZ0B 1UVQA 4Y7MA 3LKRA 4NRXA 1R0AL 1MFAH 4WY7L 5JW4N 1Y0LA 5I8EA 3ARYA 4GQPH 1E27B 1QP1A 2ZKHL 3QFDA 3AB0C 2VITB 2UUDH 4JDTL 3DXAD 4UQ3A 1JHTA 4P2YA 2X4TA 2Q20A 3MLVH 4IHOA 3SKOB 5C07B 3MZTA 1QLEH 3CDGB 3HRZB 5I19L 4G6JH 4U6XA 4NJ9H 4R2GB 3UTSB 3WFHA 2VLKE 3VU2A 1T1XB 3EW3B 4QCIB 3NCMA 3VFRA 3QZWG 4JFXA 4KI1A 5ITFB 4DCQB 2NY6B 4OCXH 2DLFL 2X4RB 5C09B 1BQLL 5INDA 3IAGC 1KN4L 4TULL 4ETYA 5HYSB 1TCRB 4YDKH 4QRQA 1FJ1A 1HHJB 1A14H 3QYCA 4BK5A 1TIUA 4UV7L 2YUZA 1EZVX 1EEZB 5IJKC 2H45A 4F7PA 8CGTA 2CLZA 2FRGP 3PWPD 1FLRH 5KSAB 2XWJB 5E94A 1NGYA 1A4KB 4PJ5E 3EYFA 1DQQA 4TSCL 4K3HA 3JV5A 5IBTH 4MSWA 4G7YH 5HTSA 3LCYA 5DGRA 1SQ2N 4G6FB 3EDDA 1VB9A 4XB7A 3RGHA 3ARDA 4FABL 2CIKB 5CJXA 5IEHB 1INEL 4PGJA 1QBML 3L3GA 1RJLB 2CLVB 4HKJA 4LMQI 2DLIA 1PKQA 1S7WA 1V5JA 1AQDA 2R9HD 1FHGA 2A77H 3OWEA 2GCYA 1HWGB 1YEEL 2W60B 4TVPD 1RUAH 1VPOH 3TBSA 1F58H 3SQBA 3KPQB 3ULSA 5DC9B 5TQ0H 4NT6A 4D8PA 25C8H 4HGWA 3HI6L 3AREC 4HF5H 4YWGL 1YEDB 4L4TB 3QUMA 4XNUL 4WENB 3LKOA 4K8RD 3BZ4B 5IMMA 4ODXA 1AI1L 1FNGA 3IS0X 2ZNWA 1IKNA 1SMAA 3L5WB 4NZDA 4ALAH 2R69L 5EZIL 1IFHL 3M8OH 1F8TH 1A7PH 4Y4KC 1R3JB 5D72H 1DP0A 4NNPH 5ICXA 5TH2A 2DF3A 4ZFGH 4TTDC 1JJUA 3CNKA 3QEQD 1MJ7L 1MCRA 1I1AB 4XP9L 4MQXC 4EI6A 3U7WH 4FP8H 1IEAB 1A6TA 1FO0A 1IGFL 3K80A 5DJAB 3HPLA 3IDNA 3AROA 3CMOL 4LLVA 3VWKB 2DWDB 3EOBB 4JY5L 4NSKB 4YGVA 1EERB 1LILA 5L2KB 5DHYA 5K33A 3WDIA 3WFBH 3QIUC 4PJ5A 5BZWA 1NEZB 4P23B 3EDFA 1UJ3C 1OY3B 1L7TL 5E4EB 3FT3B 3N06B 5EZJB 5FO8A 3C9NA 4W6XB 2ITCA 4QTHB 1FNFA 3OAYH 1OAUH 1DCLA 2A1WL 3VGAB 2D7OA 1MHCA 1YPZB 5D2LE 2PUQT 2YWZA 3EOAA 1NCCL 4PV8A 4NZRL 5AYUH 1HCFX 1KPRB 4TUJA 1TZGH 4N1HB 2IH1B 1CDJA 2XPGA 4RMVA 1AD9A 4Y1AA 5JR1H 3TBWB 3VA6A 1I3RB 5F1SA 4ENED 3GK8H 4PJCB 4BKLB 5KJRL 4HUKB 4WO4D 2P5WB 3H9YA 4MD4A 4ZAKA 2E9BA 1FDLL 3JUYA 4HJ0D 3BP6B 4QTIH 1CDGA 4RQQB 2XA3A 5DHXB 2ATPA 2XY1A 4XC1H 3DMMB 1NGQH 4CDHA 3T65A 3QI9D 3VWJC 3F65A 3FONB 4JB9L 1Z0NA 1G7JA 1OTSD 5E6YA 2KQMA 3A6BL 2W65B 5T3ZD 2GK0B 4O9HL 4YE4L 4QHNB 2IAMC 3T0EA 1QHOA 3V6OC 4JANB 1IC1A 3EO1A 3QDHA 3R4DA 5DR5H 2NY3D 3G6AA 3G5ZA 3BHBA 4DKEL 2ZOLB 2B5IB 4YUEL 1WC7B 5GRVK 3WHXB 4U7MA 3O6MH 5ENWB 4CU8A 1YEJH 1P9MC 3HZYA 4J1UA 4LGRB 2VXQL 4N9GB 4I3RL 2J8UF 2DB8A 4NKOA 3HC4L 1Q0YL 4NJAL 5F6HJ 5D1QB 1M1SA 1KJ3H 5D93C 4I18A 3L3IB 5C92A 3PABA 2XQYK 1EHNA 4WI8A 5FYLE 2W9LA 1WISA 1HZHL 4Y8AA 5E1HB 3TBVA 4JY4A 1HYSD 1UA6H 4WWKA 2NY4C 4XCCH 4PG2C 1D5XA 1I75A 3WV0A 2P24A 1TITA 4YDJA 1KNOB 3KYOB 4HZAA 2XA8H 4PRBB 5EUOE 4YO0B 1INQB 4U1MA 4YPJA 4JO1L 4HIEB 1N4XL 4OZFG 1GSMA 5DUBA 5MENB 1A5FL 4LLYB 5TGBA 1S7RA 4G6MH 3C5SA 3DECA 4PLKC 3VXTB 1MCEA 4HBCH 3LSOA 1B0WA 2GSIA 4DWHA 4U4BA 4LLQA 4OCLC 4LSVH 4MWFA 2FDBP 4HUWA 4KKCD 1NC4B 4LK4A 1UB6A 4K55A 5SX5K 1HQRA 3PL6B 4OIIL 3W0WE 4H25A 3GHEH 3C6LC 3MRPA 5DO2C 1YEIH 4RGND 2YXMA 5CEZL 2A74B 3AY4C 3LRSA 1JZ6A 1O7SA 5BRZB 2BOBA 2P48B 4D9LL 1NANI 4U3HA 2VQTA 3Q3GA 1JRHL 4BELD 5F44A 1QBBA 1FC2D 1A7QH 2V17H 4P2QA 4GW5B 1U93B 1AE6H 4L4VA 5DWUH 5DDHB 5C6TL 4Y5VA 4KHTH 2PO6C 5IR1B 3ZTJG 2FSEB 2FJHB 1I7ZA 5L7XH 3RWJA 1HEZA 1I8IA 2IQAA 4M1DH 1UADC 2J8UA 4OZHA 1BPVA 3QIWC 4L1DA 1CTNA 1UWXH 5KSBE 2P43B 1F4HA 3KS0H 4NQSB 5I15L 4UAOC 3WIIL 5CBEB 5CUSH 2YWYA 4CJ1A 3OG4B 2ADFH 5F7HA 2Y72A 4KJYA 5I1KL 2MQ3A 4GSDH 4YDVB 3RX5A 2VERN 5F88A 1DANU 4KTDL 2AK4B 4JHWL 3QG7L 1H15B 2HTKC 3U0PB 2WBKA 2CK0L 2ICES 4XHQA 4EI5B 2L4OA 1DVFA 2N4IA 1NFDA 3W0WA 5C9JB 2BNUA 3O45B 3RAJL 2VSCA 4ODWA 5E0QA 1IILE 4POYA 5I8CB 1UJTA 5F9JB 4FFZH 3HMXH 4LQFL 3WN5B 1ZEAL 1HWHB 3QQ3A 4YNYB 1ZS8A 5FOBA 5I16A 1H5BB 1TJGL 5DEZA 2CRMA 4OKDA 3PXHA 2F54D 4ZO8A 3PHQA 4AYFA 2JJTA 3QPXL 4LHJB 2DJUA 3PQYE 4TSAH 2P8PA 3MJ9A 4J6RL 3G5VA 4EBQH 4HWZA 1KXQE 1PQZB 3FO0H 4ZQKA 4B53A 4CMMA