1ZVYA

Crystal structure of the vhh d3-l11 in complex with hen egg white lysozyme
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
DVQLVESGGGSVQAGGSLRLSCAASGSTDSIEYMTWFRQAPGKAREGVAALYTHTGNTYYTDSVKGRFTISQDKAKNMAYLRMDSVKSEDTAIYTCGATRKYVPVRFALDQSSYDYWGQGTQVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin heavy chain antibody variable domain
publication title Molecular basis for the preferential cleft recognition by dromedary heavy-chain antibodies.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase/immune system
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zvyA00
4KRMB 4ZPTA 2VXTL 3LEYL 4JFHD 4YHZL 3HC3L 2R39A 4PJXB 4N8CL 3FRUB 3G5ZA 4N1HB 5D70L 3TA3D 2F58H 3GI8L 4X6DB 4Y16B 3DVNB 4YHLL 4ONOA 3BZEA 4KK5D 1AH1A 3P9LB 3FRUA 1A7NH 1QNZH 4HH8A 4CJ1A 3IYLW 3WHXA 3DVNA 3GHBL 5I0ZA 5EIQA 2W0PA 1YN7A 2FHBA 4NO5A 1U0QA 2VN4A 4TULH 3MOBH 3IFNH 4Y4HC 4JE4B 5F7KC 4X6FB 2DTML 4XPGH 5EA0L 1RVFH 2DD8H 2ORBL 3KPPB 5I75B 3BPLC 2XZQH 1QQDB 1A4JB 1MCSA 1LE5B 2ZCKL 4TSCL 4HUNB 3SGKA 1D9KA 3L3OA 4X6FA 3K2UH 5DJZB 4MJ5A 1FZKB 3L5XH 2EICA 1LDSA 4P2RB 3BN3B 3RWIA 4YHKH 4Y4KC 3RWHA 5D7JB 5E2WH 3GSWA 5DA0B 5DT1L 1FAIH 5I1DB 4QRQB 4LIQH 3BW9B 3H3KA 3W2DH 4GAFB 1IL1B 3QXWA 2N1KA 5DI8A 3W9DA 5I1DA 5F3HB 3BQUB 3OHXA 4Z18A 2ITCB 3BW9A 2FX8L 1MJ7L 2VE6A 3HUJA 4QRRE 5DTFB 4XBGB 2QQKH 3OJ2C 4XPBL 5CZVH 4EI5B 2HJKB 4XXCA 1FG9C 1IM3B 2ITCA 2VIRA 2NY4B 3MV01 4XBGA 3NPSC 4ODBD 1DR9A 2Z91B 4S0TD 1I7UB 3QPQC 5D7SL 1WAAE 1CXKA 2PTTB 1G1YA 2P5WB 1R6VA 2G2RA 2VDNL 3VXSB 5CGYD 3RDTD 3EDFA 3ARFC 1KNOA 1C08A 3G6AA 4XWGH 1NMAH 3QUXC 5IB5B 1XR8B 4GSDH 1XEDA 2P5WA 3ARDD 1HHHB 4OZFA 3ARBC 2GEEA 1J10A 5E70A 3RZCD 4PLOB 4DN4L 4FMKA 1BM3H 4NQCB 3KWWB 3OXRA 4OFIA 1KYOJ 2YUWA 4J3VA 1JPFA 5BRZE 3CDGB 3U82B 5ESVB 3RNKB 4NQCA 4PV8B 2DIBA 3KWWA 3QRFM 2FIKB 3MNVA 5FCUL 3VRJB 1NLBL 2D03H 4U2ZA 3TZVC 3ZDYF 5ESVA 4F9PC 4I0CC 5GS0H 2Y36H 3C08L 1U8PB 2PXYA 4LARL 1AI1H 3QDJB 1FYHB 1NFDE 5GPRA 3UXFA 1S8DA 9CGTA 2X09A 2VABB 4EVNA 3HZYA 4PG2C 4IMLA 3WFEH 2F5BH 3VG0L 4NO0D 3WBDA 1YMMB 4JO3L 1OPGH 4AL8H 3F58H 1L9NA 4OI8A 1E27B 3UPRB 4MXWL 4XNMA 1F2QA 4PTTB 2GAZA 3WJLC 3O4LA 4Z76A 2APBA 2UVEA 2G60H 5HHPB 1N2RA 3IDNB 4PTTA 1MI5E 1P9MC 1QBMH 4Y5YB 4Q0XH 4L3EE 1IC7H 3UJJH 1NMBH 2D0GA 4R8WH 1UVQB 2BRRL 3IDNA 2A1WL 4PUBL 3S35L 3HI1B 2V17L 2C7UA 2BX5A 2MCPL 4C56D 1UVQA 3DGGB 3T0EB 3VRIB 2VLKB 3UTPE 5EULV 2P8MB 3OAZK 2EO9A 2H26B 3CFEB 3HI1A 1K4CB 3DUUA 5EOQH 4Q6YA 3TC9A 1FBIL 3L3IB 4K23H 3V7AE 3TVMC 1WGOA 4ODVL 4ZFFB 5J56B 3N85H 5HHXH 1K4CA 1KEGH 1JHKH 1VESA 4WWKA 2FLRT 5CCKL 3L3IA 2NXZC 2Y23A 4E42B 3FMGL 3OKMB 3D85B 4ZFFA 3A67L 2Y9RT 1MCWW 5TDPB 1ND0B 1KBGH 4XXDA 1CE6B 3RVTC 1PQZB 3FQUB 3P11H 5F70A 2VQTA 1BD2A 2WUBH 1X5KA 2FGWH 3EO9H 2EKSA 1TXKA 1KJMA 1ND0A 5TDPA 4L8DB 2X4NB 1PQZA 1OAYH 1R3HA 3CC5B 3GUTA 3HG1B 3BRFA 3GNML 5HGDB 4U2YA 2DIJA 4OUUB 1E4WL 2VNCA 5HVHC 5FHAH 3CC5A 4MJIE 2EEAA 2FIRT 4TYUA 1SYSA 3U6RA 4IS6B 5GRXG 2VERN 4OUUA 5GS1A 3QPQD 1ZT1B 3GIZH 3SDDC 3ULUH 5DD3H 5B38B 1UM6L 4PB0L 1A4KB 4IS6A 5HYQB 4P9ML 4HXBH 4J4PC 4GJTB 4X6CB 3OB8A 4PJXF 5F7YC 1DFBH 5DQDH 1F3DJ 2E9WA 2VXUL 5AD0B 3HMXA 4X6DF 1OSPH 5HYSB 2AXHA 5DR5L 4X6CA 1EJOH 5DC9B 3S8WA 3BI9X 1CFNB 5BVPH 4OCMC 4F9LA 2HT3D 4BSWB 4DAGH 3BGFB 3CMOH 1FL6A 4YX2H 3PP4L 1CFNA 5IMKA 4N1CA 2Q8AL 4R26L 1TZHB 4WRLA 5C0BD 4HT1H 1MRDH 3TZVD 1INDH 3OB0K 3FFDA 4DVRH 3CK0L 2X4RB 3SKJL 5IKCA 3ROLB 5DMGC 5T3ZL 5GGQH 5IBTH 1EEZB 4D3CL 4UILH 1V7NH 3CU7A 2AXFB 5E99H 2DM2A 5C0AB 4HIIA 3O41B 4ZNEE 2V2XB 1T6WA 3ROLA 1I9RL 2WM0A 4FTVE 4KUZL 2AXFA 5C0AA 5KVEL 4EXPX 2BSRA 2IAMD 1UWGL 1RZ7L 2E3VA 2LVCA 4LGSB 4KKLC 1X5GA 4X4MA 3HUJF 2B7DT 2O5XL 1OAKH 3GHEH 3TLRA 4ZXBD 3EO1A 2W38A 3TBYA 5TE6H 4UT9H 5CINL 2IPKB 4TTGA 3ZDZF 5F7WC 4WY7L 2D3VA 5EH1A 2Z0BA 1KIPA 1LEGB 3DETD 3BH9B 4J3XA 5LGHL 4X5LA 5L2JA 2J6EH 5IESH 5J11C 4M48L 4L9LA 1LEGA 3BH9A 3OKNB 1ZGLB 3WNPA 4JRXD 3T3MF 2AQ2A 1BX2B 1KTRL 2H8PA 2OTUB 1CG9A 5EPMB 5ADOL 1OTTC 4M8QB 4N0YH 5I17A 2CLRB 4OJFL 4NJAL 1ZGLA 5FYKU 4BFIA 4M6OL 5HDLA 3CX2A 4HC1A 1BX2A 2KPNA 3S36L 5DHVH 3QCUL 5D7IB 2OTUA 5EPMA 3S5LB 4NN7C 5GSVB 4M8QA 4N0UE 4H0IA 5DJXB 3B9KB 2XI9A 1WC7B 4YWGH 2ATKA 3ARGD 3IDJB 1NFKA 1MRCL 5D7IA 5I18H 1DBMH 2OXHA 1C5CL 5GSVA 1JRHL 2QADC 3BO8A 5DJXA 4R90H 2AEWA 3EYSL 5B21A 1C12B 2F8XC 1AHWC 1AR1D 1NGPH 3QZWB 3B8YA 1DCLA 1AGFA 4LHQB 4OGYL 2JKXA 5E8EA 2AEQH 5IB2A 4ERSH 3QRGL 4MD4B 4GG8A 3BJ91 1BVKA 4Z7NE 1RURL 3BP5A 1A47A 5C09B 4DOHE 2EE3A 2X44D 2IH1A 1OL0A 1WISA 2DWDA 2VO5A 3MV8A 5DMKA 1VEMA 5C09A 4MA1B 3EFDH 3O0RL 3J8F7 1GHFH 3FB8A 3OAUL 4XNYL 2Z93B 2Z31B 4LMQI 1T66C 2IANE 1DBJL 3CFBA 3TT3L 1VEPA 3WS3A 1CFTB 4JDTH 1KF9B 3HCVB 1QHOA 4K3EL 4PJAE 5ENWA 1KIUA 1MHPH 2A9NH 2OSLA 4G6JH 1D5MB 3MBEC 4LVNC 5CJ8A 4BKLB 5TE7L 1RIHH 2BJML 3QULA 3O2WL 3GRWH 4FZEH 4JRYD 2IFFL 1DLHB 5EZJB 1YUHB 4IRSC 2X89D 3HAEG 2AJYL 3K8MA 1DBKH 2DQDH 4OI7A 5FB8A 4LDLB 1K4DB 3ZE0E 2DQHH 3HS0A 1DLHA 3DYOA 5EZJA 4G8GD 1YUHA 4HF5H 3LB6C 4LCCC 1ZGLM 4AQOA 5JTWA 4F2MB 4TSBH 3TJEL 5EU6B 4L8SB 1K4DA 1UM4H 1FFRA 1VB9A 4JPWL 4QRRB 2OP4H 1GAFL 1ZHLA 3QHFH 1T04B 1X7QB 3VWJC 1LQSR 4HFWB 4KKLD 2GSGB 3C6LC 4PRNB 5KVMC 2A6KB 1KJ2B 2HG5A 3QQ3B 4QRPE 1FE8H 3C5ZD 4HXAL 3EYOB 3MOQA 4HFWA 1IAIM 2A6KA 5F6IC 5H2BA 1KJ2A 3QQ4B 2PYED 3PWUB 5CLWA 4N0CC 5FHBH 1H3GA 3QQ3A 3VFOA 3FN0L 3P77B 5IHUL 4X4YB 4RA0C 1FZMB 3MLVH 5DJCA 3QQ4A 2GUOB 2K7QA 3I3BA 3PWUA 3HE6B 3UJIL 3E8UH 1CDCA 3QG6B 3IU3A 3R06B 4WVRA 3P77A 1SEBB 2ESVD 1FZMA 3C8HA 1RUPL 4QY8B 2EH8L 2GUOA 3DTXB 3BYTA 1RZJH 2QQNH 1OTTD 3QG6A 4M62H 4OQTL 3R06A 4X6CF 3TGXA 2X2YA 4WHTB 3DVGA 3VRLF 3RHWF 4OB5H 5I1KL 4Z0BH 5BMFL 4JPKH 1WBZA 4BFGA 4MAUH 1N0XL 2HP4A 1UJ3B 5BRZA 4R0LC 3LQAL 3C2AH 5JZ7C 4LLUB 5SWQB 4ZUUA 1NFDB 2QADD 1IGJB 2VTFA 1HI6B 1UJ3A 3B2UC 5HGHA 4JB9H 3HLAA 4APQB 3ZZ1A 3O2VL 5SWSE 3ZHLA 2EIBA 1KB9J 2EDJA 4HHAA 3ZE1E 4NQDA 1NDGB 1JPSL 4BK5A 3QUMH 3K74B 2AJ3B 3IJSA 3IS0X 1A2YA 2YC1B 3IDGA 4R9HA 4RFNB 5T5NF 2BP3A 1BF8A 1X5LA 1CGSH 1QRND 3IVKB 1JYNA 1X5YA 1MI5B 2KH2B 4FQ2H 3SY0B 1FH5H 2FO1A 3VA2C 3OKOB 1U2HA 1KN4L 3L3GB 4NZDA 4L3EA 4PRPD 1H5BB 4LKCA 4IRJA 4JO1L 2JIXD 3O3BB 3UDWC 2HTKD 3JVGC 1KCUL 3PF2A 4YHNA 5DO2C 5DS8B 3HRPA 1UACH 3GBNL 1CK0L 1Y6NR 1U3HC 2D9QB 4FQIH 2GSIB 3N1GC 1P7KA 4F3FB 3NFNB 1T5XA 3CMGA 3PL6D 1IC1A 1EXUA 3IJHA 3MCG1 2NLJB 2DKUA 2VLJD 1OWRM 3VD4A 2W9LA 4ZFZB 3ZTJG 3NGBB 1G6RA 4XP4H 1C5BH 5HI3D 5SX5H 3AM8A 3WFCH 5D7IF 2NLJA 1WFOA 3CZJA 1F6AA 3CX5K 1T1XA 1LNUA 5FOJA 4ODHH 3IDYC 4JZOB 4K71C 1A9EB 1HCVA 4XP5H 5AWNL 1A1OB 1G7LB 1Q0XL 1QACA 3GSOA 2HYMA 4KK9D 3RIAF 2P24B 1AKJD 4QOKE 4TVPE 1NBQA 4ZOCA 2VXVH 3WCYA 1A9EA 5I1CH 4MJIB 3V0VB 1A1OA 1YJDH 3TBVB 4PB9H 2PCPB 1B0RA 1IJ9A 4NBYB 5TJWK 1ZLSH 4QT5B 4LVHB 2PCPA 1X4YA 2P45B 2NZ9D 3NA4A 1TZIA 3SO3C 3O6LL 4AG4L 2Y5EA 4HWBH 1QA9B 4M8VA 4XCEA 4X8XA 1TQBC 3ULVL 5DLMH 5INDA 3ZKSD 5GS0C 4X6BB 1QKZH 2WBWB 3V6BR 4XX1E 1QA9A 5I73C 3DSFH 3U0PA 2OX5A 3KJ6L 5F7FA 4B5EA 2ZPKH 1P4IH 1RHHB 2XN9D 4NNYA 1MFEL 3DRQB 4MD0A 35C8H 2V2WA 3TP4A 1CR9L 1HKLL 1RK0A 5J1AB 3CVHB 4MDIA 2PETA 3QIUA 2OJEA 4LP5A 2MPAH 4FTVB 3BKJL 5CEZE 5J1AA 3V52H 1A9BA 3CVHA 4F57L 4KI5C 5AUMA 4X80H 3JWOH 2GY7B 1SJEB 1J86A 2DJ4A 1MFBL 5EU7C 1P7QB 1VPOL 1F58H 2JJTC 3TO4D 1IGCL 1K85A 2YN3A 4FFWC 4ZS7H 3TNNA 2MMXA 5FUCC 1A6AA 3K80A 2YK1H 4IDLA 4Y19A 5EUOE 4KVNH 1R0AL 3FB5B 4WUUD 3WFBL 4Y2DB 3D9AL 3LEXA 4P46B 5E08L 4KHXH 5EN2A 4G3YH 4MHHG 1QFWH 4G8FA 4K2UH 3NCMA 4XCNB 5SWZE 4K9EH 1T1ZB 2Z8SA 1U3HD 3MRNB 4KRNA 4C56E 2MQCA 1D5XA 4HMEA 3FAWA 5FO8B 4M3KB 2NY0C 4XCNA 1T1ZA 3PNWB 3IRZA 4N0UB 4NM4L 3HNVL 4MHHI 4O51A 4HULB 5GS2H 3TT1L 1G7PB 4L8CB 3CSYB 3DUSB 3FQTA 2R8SL 3S6CA 4KK8D 3KPNB 3MRHA 1AGBA 1G7PA 1B0WA 3U36B 2R23B 3QQ9C 1YMHA 3HNTL 5TFSL 4JDZB 1HZHH 4LQFL 1HKFA 1P6AB 5EG6C 1IEAB 5K9QI 5F9OH 1MEXL 1G6VK 2A6DB 4JAMB 5C70A 3ULUC 4PJ5A 4JDZA 3BDXA 1HHIA 4JM2C 4PRIB 2RCSH 5ICXA 2A6DA 4OCNC 5DJDB 4TNWF 3W0WA 4KU1A 4OD3L 4UT6L 3FOMB 4XT1C 5D2NC 3D0LB 1HSBB 1B2WH 4LASH 1IM9B 3DO7B 3CAFA 4ODWA 5DJDA 3I75B 5A16A 5MHSE 4KRLB 2VDML 5IHLB 5E2UL 3DO7A 3QXDA 4M1DL 4U1IA 5DJ2A 2MFNA 5C0RH 3INUL 4PRHD 5HI5C 3I75A 5DUML 4UQ2A 1MSPA 1DUYB 1FYTE 4M5ZL 2IANA 1D5BA 4TPRL 1Q9OB 5FUZH 5GS0D 3BXNA 4NNPH 4ZUVB 1EFXA 5DEFB 3GSRA 1OGTB 4JQXC 5F1IB 5ALBL 2O5ZH 3EGSA 3MUY1 4PJAA 5DEFA 4KROC 5F1IA 2ZKHH 2AABH 4HS6A 5LVEA 3QIBC 1YY9C 5IV2B 2V7HB 4PJEE 5IB3A 1SEQH 1QFPA 1WFUA 2AK4D 1I3RB 4R4FH 3EOTL 3LOWA 4KMQA 4QXTB 3RY6C 3VXME 3SJVA 3M17B 2XQYK 4K3JH 4JZNA 5IV2A 3GKZA 3LN4B 1NBVH 4KJYB 4C4KO 1XGPB 1KCVL 4W70A 5FYKD 3MGTB 4K7FB 1UWXH 3M17A 3RPIA 2ADJB 2NW3A 4KJYA 3B2VH 2DWEA 2XWBA 1XGPA 5CJQL 3PQYA 4R2GC 4QRPB 2A6IB 1ZTXH 2ZG1A 4NKIL 1EA9C 4CKVX 1ZS8B 3OSKA 2HKFL 1MCKA 5A2LH 4G6KH 5T5FH 3BZFB 4EKXA 1S9WB 1MNUL 3LPWA 2NY6C 4E9LA 5MEQB 1ITCA 4DVBB 1NCWH 4CBPA 1CL7H 1FFPB 4S10A 3P4MB 1H0DB 4LEOA 3T09A 2JK5B 4ZO6A 2CKBA 3MUJA 4DVBA 1K3ZA 3I3DA 5I1IL 4B41A 4G80A 1S7QB 1FFPA 4HIXL 1KT2B 2B2XL 4P3WA 3CD4A 3KPRE 4M5YH 3CFKB 1UGNA 5AYUH 2IBGA 3H0TB 5H35A 2VAJA 3TYFA 1Q0YH 1S7QA 5I71C 3QUZB 2EXWD 3MA7B 1NCCL 2XZCH 4XZUB 5FYJH 3Q2CA 1FPTL 2KUTA 4NN6C 3U4EB 1SMOA 2XICA 3CFKA 2AGJH 3H0TA 5HHNB 1GPOH 5DK0B 1W0VB 4QHUB 4POYA 3QUZA 4IM8A 1AR2A 4XZUA 1NEZB 2P49B 5LCVL 5T1LD 3OGCB 3QQ9D 5CD5C 1U8MA 5SWSB 3FONB 5DD6B 1KN2L 1IAKB 3MLZL 4WWID 3QNZB 2GITA 2RQ8A 4HK3N 4BUGA 2EDKA 1U58A 4NSKB 4M00A 3RWFA 1J5OH 2QR0B 4KUCF 2XTJE 3NFSL 1NAMA 1N6UA 2EYTB 4JM2D 5C6TH 3BSZL 2OMNA 1OD7A 4DKFL 3WIFB 1Z3GL 1CD1B 5JA9A 4YHPB 5EOTB 4RX4D 5C0CA 2EYTA 1UQSA 4KWUA 3WIFA 5D1ZC 3IKCB 1J1OL 1J18A 4TOYL 4Z7UE 1DQMH 1LO0L 5JHDD 2XWTB 4EIZC 3UZQA 5E8PA 1BLNA 4PJBE 2J8UE 4NQVB 3KGRA 3QNXA 5HI5D 3H9HB 1WCQA 5HY9B 4M7JL 4O00A 1L7IH 2FSEA 4P4RA 3KVQA 3RL2B 3GSVB 1VFUA 2EZ0C 3TA3A 4HKZA 1FGNH 2VXSL 3EYQD 1HH6A 2V2TA 3RL1A 1CXLA 1D6EA 4ZSOE 1MCPH 2DTSA 3GSVA 5CEZL 2V5SA 3AS2A 4UDUB 2DLGA 3LS5L 5KTEH 4KROD 1RIVL 4NDMB 1J1XL 3BH8A 3WIIH 4LP4A 5JXAL 4UDUA 5CJOL 2BOBA 3KHQA 3HC4H 3BRDA 3WEXB 3R8BB 2OL3H 3HR5A 2DLTA 5JXED 2Q7YB 2DQEL 1QR4A 4TNVF 3CIQA 4QOKB 4DGIH 4M61B 1FQ9C 1UENA 3RUGE 2NY2D 2WWKO 1F42A 3DARA 3VXOA 1YEHL 4R2GD 4HGMA 3TFKC 2IF7A 5MERA 1HEZA 3BEWA 4QOKA 4X0KB 1CU4L 4M61A 5BV7L 3MJ9A 4WGWB 2XNAB 5ERWA 4Z7NF 5GZOD 1BOYA 4GRLC 4CW1A 1CXEA 3VFTB 3QUYB 5CSZB 4X0KA 1U92B 5ALCH 4WO4C 5ETUB 3K81A 1GGBL 3MODL 3JWNC 3QUYA 1BP3B 1T5WA 2FJHB 2YPKB 4YPGA 4U6HB 5LBSH 1MCNA 1S7UB 4NYLB 4IRZL 3LHPL 4PP1C 4ZMAT 3EZ8A 2YPKA 3RDTA 3DNKA 1QLEH 4M43H 3VWKB 1MCHA 4KJPD 4NZTH 4NYLA 2JJUA 1JHLH 1MLBB 3X13B 4M6AA 1MY7A 3JV4A 4PJAF 3RZCA 4HIEB 2PR4L 3VWKA 4YUEL 4U1LA 1D5IH 4AT6B 3HMWL 3VD9A 5I15L 1MLBA 3X13A 4X4ZA 4Q6IA 2OK0L 1KLGB 5CD5D 1QFHA 4H25B 4LKXB 5CZXC 3VGAB 4G9FD 1E28B 3WIHA 2FECI 3LQZA 5I2IB 2EYSB 5KVFH 1KLGA 5AZEH 2PW1B 1JZ6A 1E28A 2MKWA 3OZ9L 5I2IA 4IJ3C 4U1MA 5I8CB 3V95A 3P30H 4AH2B 5I1JH 1LO4H 2J7LA 4Y0GA 1SJVA 5J8OA 1DQTA 3GDBA 3MR9A 2VDQL 5JOPE 4PRDB 4F37F 4HFUH 4M9OA 1RZKL 3V6FA 1EVTC 4RDQF 4KRPD 5D1ZD 2YMXL 1I4FB 4JO2H 4XP1L 5A2FA 5TH2B 3S34L 5EUOB 2X7LB 4HDIB 1E4KC 4DCQB 3D2UD 1RZFH 5FM5M 4R3SA 4EOWH 4I77L 2IPUG 5EUOA 2CKNA 1OOAA 2VUYA 3MLYH 4BSJA 5SWZB 2A77H 4LLYB 1PX3A 1FNAA 3WL9B 1DLFL 1H8OA 3O8XC 5SX5K 2BERA 4I18B 1XZ0B 2OI9B 2RGSA 1GXEA 5T3XE 3OX8B 2BY3A 4JVUA 5FGBC 2X1WL 3GBML 3WUWG 1T3FB 5IHZB 5AAWA 3GMNA 4UU9A 3DROB 4C56A 2D7TL 1XZ0A 3K0WA 2YD4A 3OX8A 2VQ1B 1S9YB 1NC2D 5F7EL 1JNLL 4Y1AD 1JPST 3L3JB 2PO6D 5E95B 4YDJB 3MRIA 2J5LC 5I1HL 1A6UL 1JK8B 1FVCB 3KYMB 3L3JA 5L0QB 4RAUA 3HA0A 3P9MA 4YDJA 1S7SB 1BFVL 1UCBH 2OZ4L 1TQCC 3BD5A 4B0MM 5DYOB 1PW3A 1CS6A 1FVCA 4RWYH 43C9B 3KYMA 4WI8A 4PJHE 1X6NA 4N8VG 5CUSL 1UB5B 3AREB 1S7SA 1CFVL 5EOCL 3SN6N 1CDBA 4R4NC 5F1NB 1VCAA 2BVPA 3QXAA 3S88H 4HLZG 2FEEI 1A6PA 5F1NA 3WDIA 4FQLH 4I0KA 1AD9A 4X9FA 2I9TA 3R8QA 2FR4B 2CLVB 3GI9L 2IFGA 4WI6A 3S4SB 1FYTB 4KGLA 3A6BH 4WFHD 2VQUA 2FR4A 1N3NB 2QSQA 2DQUL 2QJDA 4HS3B 3C09C 4OM1H 3H3PL 5IM7B 3AVEA 3BVNA 4XMLH 3RGHA 5FKPB 3CCHB 1FYTA 1TPXB 2GFBB 3SE8L 2LVEA 1N3NA 4FP8L 4RGOH 2H1PH 1XFPA 3BP4B 5FKPA 3TV3L 2GFBA 1PKOA 3OR6B 1NCDL 4EI6A 4PJEB 3HE7C 5EUKB 3UYRH 4EXKA 4ZNCD 1R5IB 4W6XB 4HJ0C 3VXMB 4WCYH 4S1SH 3F65A 1I7ZB 3D39D 3TIEA 1BZ9B 3P40A 1A22B 1R5IA 5F1OB 2F19L 3PJSA 1S9XA 5C0BA 4OZ4A 1I7ZA 1AXTH 2FH8A 1BZ9A 2H2PC 3PWPE 2W07A 3D5OF 4HUWB 4OLYL 2CR3A 5CIPA 1DQJA 3UO1L 1AJ7L 1RUML 2C3WA 3QO1B 3MRRB 2CUIA 1IBGL 3L6FA 1FGVL 3DUHA 2BVQB 4HUWA 3KR3H 3LEVH 2RB8A 2IAMA 2HTLC 4K9EC 1YEGH 4YDLC 1RZGA 1Z9SA 1FL3B 1KPUB 3GBLA 4QKXB 4K55A 5E5MB 5B8CB 7CGTA 4ZXBA 1EV2E 3L9RB 2J88L 3CLEL 4GKSA 1BBJB 4JQVA 1VKXA 4FQJH 1LD9B 1FL3A 1C7TA 4OZFH 5B8CA 1FCGA 3O6KH 4BQBA 2AXJA 3L9RA 3O8XD 1BBJA 1P4BH 3KPRB 5ADPH 3BN9C 4PTUA 2B1HH 3VDCA 5E8DL 4NUJB 2YD1A 1BMGA 4XGZB 1ZEAL 4OSUH 3LEYH 3V5HB 2YZ8A 4YHZH 3KPRA 4JRWA 3BEVB 1SJHA 5F8RC 3U2SA 4MAYC 5D70H 3MRGB 4XGZA 1ZT7B 3VDAA 2JJSA 4NFCA 3V5HA 3IU4H 3B83A 4LCWD 1JI2A 1KACB 3FFCB 3PIQA 1NSNL 2VWEE 5HDBF 2QQLL 2B4CL 1O0VA 1TJHH 12E8L 2WIIB 5JNYA 5GIRA 3O6FB 4P23D 1LILA 3DLQR 4S1QH 1VFOA 2XTJB 4U1HA 2DTMH 2WIIA 3OXSB 4XP6L 5EA0H 4HKJB 2PW2A 5IROA 5SV4A 2V7NB 4GKZA 3FO2B 1AC0A 3O6FA 1KUMA 2NTFA 5D7KE 3VFUA 4J23A 5DK2B 1KEMH 2H6PB 4MX7B 5IGXH 4GS7B 2BFVL 5DRXA 2DBLL 3ILPB 2Y6SC 3GSNB 3RWEA 2V7NA 4NC0B 1XAUA 2YUXA 2H6PA 1CFSB 1QYGH 4LSRH 2IPTH 4Z7UB 5D8JL 1DBBH 1PYWA 5T1MB 4CJ0A 4PJBB 3GSNA 1ONQA 1FO0L 2J8UB 1E6OH 2LU3A 3CGTA 4MQXC 4JVPA 2GT9B 5GRYA 4MZ2A 3VXPA 4GAYA 1CFSA 3T0WA 3UBXG 4KKNA 2IGFH 2ZWLT 5T1MA 4X99B 2Q76B 4CVUA 5EUOF 4ZS6C 2FX8H 1MJ7H 2D7NA 3ULVC 1MOEA 1MREH 5HYEA 2VR4A 4JJ5A 1X44A 4XNZC 5DQ9B 2X4TA 3UBXI 1S9KC 3O11B 1FLTX 4KVCH 5TPWL 4Z7VE 4ZSOA 2F53E 5DQ9A 1J8HE 4OCRH 2E27H 1XGTB 3P4OB 5IBUG 1S78C 2JJVA 2VDNH 4HJ0D 5HDQL 1QLFB 4QTHA 3KXFE 1TTFA 2VLME 3DBXB 1F11A 3P4OA 2CO6B 3KYNA 4IOFD 1L9MA 1I1AB 3JUZA 4NUGL 3B6SB 4X9IA 4XCFL 1P1ZB 3BUYB 5EU4B 2DQIH 4JRYA 1QLFA 1J88A 3KPQA 1I1AA 3RBSA 1KPVB 2HLAA 2I9LA 5FYKE 4DN3H 3RX7A 1FNSL 3RUGA 1EEUA 3L3DA 5EFIB 2G75A 3QWRD 5GGRA 1WCBA 1KPVA 1Y0LB 2ZOKA 4LMQE 3OKKA 2EC9T 2X6MA 3VXRD 5A2KH 1H3PH 5J6HA 3F6IA 1KXTB 1IGFL 2OR8A 4G43B 2XKNB 2R69H 2I60L 3MJ6A 2R0KL 4KMLB 3VG0H 2J4WH 2Z9TA 4E41D 4G43A 1BIHA 3NCYS 1XH3A 1PEZA 4TTDC 3HMXH 2OJZH 3QEUB 4WJ5B 2HRPH 2Z4QB 3G6DL 3VU2A 1VGEL 3TJHC 2GCYB 1BVZA 4MNHB 1CGTA 4LOUD 3WUWA 4HIHA 1JBJA 1CLYH 2FYYB 2Z35B 1FO0B 4PJ7E 4DEPB 2WWMD 3OKLB 4OCWL 5BJTB 4PLJD 4K7PX 3BP7B 1GC1L 2VDKH 2FYYA 2Z35A 2BRRH 5A2JH 2XKSA 4PJ9D 2VSDA 3OKLA 2ZUSA 5E6IC 5C2BL 4H0HB 4XVUD 2D7QA 1K2DB 4J1UA 5CILL 4U1KA 4B7IA 5CSBA 1T0PB 4KMTL 4RIRB 5CWSB 5LWYL 2BMKB 5DVNA 4DK6A 1JMZA 3DECA 2C3VB 5F9WB 4MNQE 2DI9A 4ODVH 4KKBC 1CICC 1QBAA 1INQB 4P3CL 3UYOD 1MCEA 1TVHB 3DVFA 4GW1B 4NQXA 5CCKH 3U46B 5D96C 2Y6SD 5D6DC 2IBZX 1Q9LB 2C3VA 5GJSH 1XF2B 3DX9A 3A67H 4IDJL 1JJUA 1TCRB 1TVHA 4GW1A 4OD2B 4WFEE 2V9RA 2FGZA 2V6HA 5E2JA 4BH7A 2KQNA 5TQ2L 3K3QA 1WZKA 4YFLF 3IXAB 4ODUB 2BSTB 3THML 5FF6A 4KAQL 2QHLA 3ZHKA 4EN3B 3SDCD 2IBZY 3A6CH 4PRPA 5F21B 2ZUYA 2HFEA 5DUBA 2JIXA 3OV6A 3L7EB 3CXDL 3SO5A 4EN3A 2N56A 1TJGH 2DQJL 2FB4L 2PTVA 5ELIA 4RFEA 2BCKB 1FVDA 2R0ZH 2XPGB 1NGQL 3GKWL 5DJ0A 5F1SA 5IIEA 2BK8A 3PL6A 4YDVA 1IAIH 2HFGL 2VXUH 2EC8A 4H20H 4NZUH 1BQLH 4GMSL 3ULSA 1M7IB 3SE3A 1SVZA 2VLJA 1KTLB 2P8LA 4PJHB 2B5IB 3DI2B 3KLDA 4KPHL 3SPVA 3WKML 3IXTB 4LPWA 1U8HB 2EDBA 3PWVA 5KSAB 4EZMA 4P3DB 3UTSE 4PJHA 4Q9RL 4RGND 5AYQA 4UINH 5GISL 2DLEA 1U8HA 2C3XA 5KSAA 1NUFA 3QDME 4P3DA 4LU5H 5ESAB 3SKJH 1JGLL 5T3ZH 4D3CH 1AKJA 4EJ1C 1RJZB 3MA9H 1R5VA 3IDMB 4ALAL 4QEGA 5CMAB 4KQ3L 5JDJA 5ESAA 4X5XB 2C26A 1VACB 1I9RH 1XGQB 4G8EA 1RJZA 3RGVC 1P6FA 2VISB 1OLLA 2VZ3A 3B5HA 4YE4L 5FYJD 3MO1A 4G7YL 4OV5B 4MJ6B 4X5XA 1M71B 3S96A 3GM0A 1G6RL 3T2NL 3ES6B 4PJFE 4YXHH 4UB0L 1YY8B 3M1BA 3V5DB 4OV5A 4J3UA 4MJ6A 1ZT4B 4MLSA 2P7TA 5BW7C 4KDVA 4MXQD 5DJ6A 1T20B 4WY7H 1YY8A 3V5DA 2ZSWA 5DJYA 3MRDA 4NQED 4LAQH 3OTTA 2XZAL 5LGHH 3S37X 5EB9A 5FM8A 4UZGA 1EGJL 5E6ID 5GZND 2BZDA 2Q3ZA 5IWLC 2V5TA 4MLIA 2XN9A 4JGUA 1I7TB 3VFSB 1KG0A 5ADOH 5CBEB 2VRAA 3X3FH 1T1YA 2FNBA 3PWPB 4NJAH 4G9FE 3QUKA 1MCOL 2GQHA 4UT7L 1F4YL 3MRJA 2YWYA 4LEXH 4XAWL 3QI9B 3X17A 2NY1C 1F3JA 2XQYG 3DRTB 1OQXA 3QEGH 4E0RB 2XT1B 4JZJB 3KLHC 25C8L 3RUGF 1VFBB 4XPFL 3OPZL 1KJ2H 1JRHH 4D9LH 4LPTA 3DRTA 3EYSH 4KH2A 4ONFL 5IQ7L 5L2KD 1VFBA 2FEDC 1C5DA 3DX6A 1AE6L 1KJ3H 1CCZA 1H8NA 3S3SA 3TO4A 4FFZH 3ZLQC 3QRGH 4QHMA 5D1QD 1WT5A 2EE2A 1N64L 1T21B 1GGCL 4QYOB 3ROOB 4AEHL 4H1LB 4AIZA 4IIQB 1L4IA 1EUTA 3U4AA 2GHWB 2VDLL 2X4PB 3ALPA 1BQHG 4QYOA 1WK0A 2NYYC 1WJ3A 3ROOA 4R7DB 2CDFB 3AS3A 4IIQA 5FA4B 5CFHA 3RKDD 5IJVB 3LD8B 2YXMA 3TT3H 1ZLUH 2VLLB 4R7DA 2CDFA 1ZVSB 5FA4A 3P0YH 3RNQB 2JB5H 1TFHA 5JOEA 3G08B 3IDUA 3HFML 3WLBA 4W6WB 2BOCB 5TE7H 1N26A 2BJMH 1JGVL 4WENB 3KDMB 5JHLL 4OM0L 5BV7C 1E6JL 3NIFE 4JANB 3BKYL 1FIGL 1JV5B 4HK3J 4O02L 1A6VL 5ID1B 4K7PH 3DX7B 3KDMA 1Q1JH 5KJRL 1YNLL 1WIPA 4WU5B 2LE9A 1JV5A 1C1EH 3TJEH 2C5DC 5LGJB 1FVEB 3WFZA 4I2XA 3FN3A 2XRAL 3SGKC 1D9KC 4FQHB 1GAFH 3OJDB 1YECL 3I3EA 3CFDB 4KFZC 5LGJA 2R0LH 1R3IL 5I1GH 1YYLH 4Q9BA 4Z7VB 4PRHA 4F7EB 2YD8A 2F53B 3L3HB 3O9WD 1J8HB 4F8TA 1U8NA 3MRBB 4OF5A 3LSOA 4N0FB 2AQ3A 5EO9A 5IHUH 3RU8L 3VXNB 4F7EA 1U8LB 5F3BA 3KXFB 1RJYA 1J8HA 4PJ8D 2X70A 5D5MA 5C2UB 2XTLA 4XXCC 3U83A 3ZKNC 2Y06L 5I74B 2VXQL 4OIIL 4TUKL 3U30B 3B5TA 3N1FC 4DK3A 1YN6A 1MFCH 4WW1A 3SQOL 2VLRE 2GJ6B 5IHBA 1IKFH 2AK4A 1JN6B 2AKRA 4X7TB 5EO0A 5F96H 4HJJL 4PJHF 1N0XH 1UA6H 2NY1D 1AY1L 1XF1A 3LQAH 4YHOH 4WI3A 2A0LD 1JN6A 5DWUL 1O7SA 4FQCH 2BNRD 2YHGA 3L95B 5GGVL 1QG3A 2HA1A 5EU5B 4HPYL 1BJ8A 3T77B 1ZA6B 5IBLC 4A2MA 5TDNB 2IG2L 1YQ2A 2AJSL 3MLUL 4JKPH 3Q6FA 4MA8L 4OGAC 4BYHA 5EU5A 3UPCA 3LKRA 1T89A 1DQLH 1VGKA 1S7XA 3PWJA 3T77A 4F33B 5TDNA 1NDMA 2PXYC 4X98A 4OIAA 3GMMB 3ZYOA 2VMFA 1HXMB 4PJ7B 1HCFX 4WFFE 1GH7A 3O3EA 3WUZA 2FLBT 5HI4C 3MRCA 3MUZ1 2O93L 4KK6D 2HVKA 2FO4A 3MV9D 1SY6A 4PJ7A 3PXHA 1KN4H 4NQSB 1MIEL 1A7BA 1R3LA 3T1WA 1X3DA 3X3GL 1DVFB 4NZRL 4B7LA 4LCIH 2MOVA 5FYLE 2AAVA 1YDPB 3QWOB 3MMEB 3SCMD 2OR9L 4U7KA 5KN5A 3O2DH 1CK0H 1DVFA 4YAQA 3WD5H 3TBWA 4NPYB 3T1FB 4JY4B 3BPCB 1YDPA 1SYVA 3CVHH 3VD3A 3QWOA 4GUPB 4MNQB 2R2HA 3I6KA 5T1LA 4DJMA 2VL4A 3T0VA 4NPYA 1Q9WB 4OCSL 5CSGA 3BPCA 2B8OT 3N50A 4GUPA 3JBG7 2CKBL 4R6UA 4Y16D 5GS3A 1N6QL 1MJUL 1AQDB 2FZ3B 2BRQA 2ZCLL 1Q9WA 4UV7L 3JV6B 4XAKE 1MQ8A 4PY8J 2EDYA 5H37H 4OF8A 1YEFH 4K8RC 4LSVL 1ACYL 1AQDA 4HQQL 3S37H 2AJUH 1MHEA 4MWFB 1FG2A 5JW5B 1N4XL 1UZ8B 1HOCB 4OKDA 4WWKC 1F4HA 4JHAH 2M8XA 3TO2B 2FBJL 1EHAA 2ZOLA 4MWFA 4WV1B 5FO7B 5JHDA 5IMMA 5JW5A 1UZ8A 3BISA 4H8WL 3MNWB 2HH0H 4HBQA 4P2RD 4LSQH 4WV1A 4GG6B 3G6JA 5D1XB 4HD9A 5D7JD 5ACZA 1J12A 1UYWL 3LPGA 2EDXA 3GSXB 1PY4A 5DEGB 4L3CB 3HZKA 4N68A 3MNWA 2UY7A 3UAJD 1S3KH 3G5VB 3GSXA 1P2CB 4MNGE 3CVIL 1CDGA 3BWUC 3BQUD 1ZAGA 4NO2B 3T65B 2YZ1A 5D6CA 3TN0B 1P2CA 4P5TB 5GS1C 4ELMB 4EI5D 1WQVT 3L3KB 3UTSB 4RISH 2NY4D 2A83B 4U0RB 1QRKA 1TETH 4GBXB 5EBWB 4KZEL 4P2OB 5JXEA 3QDMB 3DV6A 3L3KA 2VDPH 3V79C 1MFEH 2A83A 2BSSA 1ORQA 2P5WD 4X6EB 3AC0A 5EBWA 1S7TB 2BVOB 3VXSD 4OFVA 1J11A 2I5YL 2KDGA 1BBDH 3EZJB 5JPNA 5CP3A 1WTGT 2YEZB 1AD0A 3RHWK 4GH7B 5DHYB 1LEKA 4FA8A 4F9LC 3IFLL 1G84A 2J6EA 3VXRE 3IRPX 2BVOA 5IBLD 4V2CB 4CUCA 2ADIB 3LKQA 4Y4FB 1URLA 4TUJB 5C8JA 4TRPH 1IC4H 4NQCD 5DHYA 3O3AB 4F57H 4R7NA 1U91A 1UCTA 4E41E 4Y4FA 4TUJA 3EYVA 3VGFA 4WTZG 5DHVA 5BXFB 3IFPB 4CVZB 2WQ8A 1B0GA 1CD8A 1VPOH 2NQCA 2VH5H 3QA3B 4PJFA 1YNKL 4D0DB 2ERJC 5KOVC 3KPLA 2R2EB 3QDJD 1RAMA 2R0WL 4K94C 5BXFA 4JFDE 2YBRA 4D0DA 2WSKA 1YMMD 1S9VA 2R2EA 5GJTH 5D5MF 1FZJA 4L1DA 3OAYH 5FGRA 4QRUB 4Z6AT 5TE4H 3DXAE 3N1QC 1LVEA 1KCSL 4F7TA 5E94B 4H5SB 4WGVB 2AEPH 4ZUSB 4G9FA 4X7EC 1I9IH 4HIJB 4M6MH 4NJ9H 4I0PD 4L9LC 1ULVA 2ARJB 3FJTA 1HXYA 3QHZL 5E94A 4G42B 3O6ML 2WBKA 2DMBA 2E8ZA 3DI3B 4ZUSA 1XCTB 1U3JA 4PGEA 3HNTH 5F97E 4KQ4H 4MJ4A 1MWAB 4Z95L 4KRPB 5K9JL 1DANT 3T0ED 1MJJA 2VLKD 2HMIC 1YNTB 4LQFH 4OCXL 2E7LA 1E4XL 1XCTA 1S7VA 2HT4D 4N5EC 3QIWB 4YC2C 3FAXA 2EDDA 1MWAA 3CZFA 3U7WL 2XY2A 5MEND 1YNTA 1JF1B 4I9WD 3LS4H 4X7FC 5ITBL 2D7OA 5INCB 2ATPB 3D2UA 2AERT 5C0EB 3K1KC 4MJ2A 3NIDE 1OP3H 5ANME 1OM3L 1DEEB 1N5AB 3WHE0 1EPFA 1QFWI 5ESQA 4HKBB 5C0EA 3D85D 3GRWA 1YEDB 3LIZL 3RIAK 1N5AA 2ENSA 1SVCP 5J4MA 4HWNA 5EBLA 2MQ3A 4PJ7F 3GMQB 4M1DH 2NR6C 1YEDA 3INUH 4X9GA 1UWEL 3GO1H 1HHGB 3WFHB 4UTBL 2COQA 4JO4L 1NC2A 3HG1D 2XV6B 4PBVC 4Y1AA 3RAJH 1PSKL 1JGEA 4HZAA 5AG9A 5IQ9B 4XWOC 3BE1L 3WFHA 4LCYB 1WTLA 4GLRH 4ZPVA 4NC2B 5EWIL 3DVIA 3VI4F 3U0WL 4MS8D 1MQKH 4QHNA 3OQ3B 4KY1L 2DB8A 4UNTA 1F2XK 4S11A 3T08A 4XVSL 4YPJA 4PD4K 3UC0H 1W72L 3SEPA 3E2HC 3ARWA 5IVXE 4GXVH 5GRZA 2KQMA 1KCVH 3EYFB 3N0PB 4E5XA 4OGXL 3PP3H 3RQ3A 1ETZA 3CDYA 4DZBB 1L6XA 1RU9L 1T03H 5CJQH 4MA7L 2ZSVA 4NP4H 1CLZL 1QSZA 3NTCH 4JKLA 1JUFA 3KPOB 4NKIH 3HI6L 1HK6A 4HZLB 4DTGH 1SBSL 5I8KH 4M6NH 5HGBB 4YR6A 2APTA 3G6JF 5JW3H 1XIWB 4NQTA 3KPOA 1K6QH 5HVFB 3BKCL 2DRUA 2HJFA 4HZLA 5DD1H 5C0AD 3I02B 5F9JB 2NXYC 5HGBA 5I1LA 5LJYH 1P4LA 1PDKA 4M1GH 3MLSL 2UUDH 2Q6WB 4TSAH 3N1MC 1I1FB 5F9JA 2VLRB 3QUMA 4HIXH 4ODSL 4ONGL 4PGCB 2Q6WA 1NKRA 1IAOB 4TVSa 3P9WB 4JPIB 4O4YH 2VLRA 3D39A 1ZHBB 1CZ8L 1XF4A 4I5BB 2PUQT 2MCG1 1OTUD 3SDYH 2OM5A 2XXCB 4TVPH 3Q6GL 3MJ9H 4Y2OA 1ZHBA 3MUGB 4ZODA 4Z7OE 4PG9A 5CBAB 4I5BA 1DDHB 2V9TA 4YIQB 3WNNA 3SKOB 4GRMB 3V4VH 1ZOXA 1L0XA 2IQ9L 4LGPB 3MRLB 5JMRA 3GB7B 3BT2L 1I85A 1BJ1J 3LMJH 3MRKA 5K9OB 3SKOA 3WFDH 1NLDL 1CXHA 3TIDA 4JJHA 2I25N 3F7RA 4Z0XB 3V6OE 1V3MA 1CL7I 2F9BT 1JYVA 4G6MH 2AI0L 1UJ3C 1IT9H 4FFVD 3C6SA 1WWCA 3B9KD 3LV3B 2A74B 4XVTH 1OAZH 4PJFF 5GRWA 3ZT7A 5SX4I 1G7QB 1J1OH 4TOYH 5EBMB 3FTGB 3LV3A 2WV3A 5BQ7B 2A74A 3U79A 4Y5XA 4FABH 2XWJB 1G7QA 3F7VB 4L8BA 2EDEA 2EXYC 3G5YB 1EAJA 4MA3A 4ZUTA 5BQ7A 3BPLB 4RFNC 1PLGL 2C3GA 5IK3B 3I50L 3WIHH 5MEPA 5B3NA 4X7SL 3VJ6B 3WN5C 1YPZE 3G5YA 3MZGB 5DZLA 4XWOD 5T3ZD 1LO3H 4Y4KB 5C09D 4AEFA 4OF6A 2FD6L 1MF2H 3VJ6A 1KLUB 2P5EE 2Y25A 4Y4KA 4IRJC 2C1PA 3HZVA 3R1GL 4P23A 3HNSL 2RFXB 1UM5H 3MRMB 1KLUA 1M1SA 4Y5VB 2EC9U 2Z31D 3O4OC 4UUJA 4MMZC 3SGEH 1BHGA 2RFXA 2UWEE 2EIZB 5JQ6H 3U0TB 2DM3A 4Y5VA 3BD4A 4NC1C 2LABA 3Q0HA 4NWUH 4DKEL 3PDOB 4M93B 4U33A 1B88A 4C59B 2Q3AA 2L0DA 3U0TA 4ESKA 5J3HC 1PVHA 2CDGA 3ZYZA 3AM8C 4UIMB 4WTZA 3WJJA 1A1NA 3NIGE 3VXUE 1YEEH 2EH7L 2RJMA 3QUXB 4Z5RB 5E9DE 1NKOA 1T0NB 2BSED 4UIMA 3ARBB 4UQ3B 4WFGE 5I8EB 2ILLA 5HHME 3REVA 1T0NA 4MNGB 1UB6B 4U3XA 5EU6D 4FQQB 5I8EA 4HPOL 4TQEL 1KFAL 4QRRD 2ADFH 3FT3B 4C54A 4FXKA 1UB6A 5GGRY 3U1SL 3MJ7A 4FQQA 2ZUUA 3LHPH 2HJLB 2R2BB 3RX5A 4NKDB 3OKDB 4KHTH 1RMFL 3C9NA 5TDOA 2Y4SA 1GSMA 3DIFA 1B4JL 3KHOA 1RFDL 3UCRA 4NKDA 4NBZB 2MKLC 2MQ0A 2X1PA 4LHUG 3MRQA 4JFZH 2DM4A 5C3LD 3HE6D 4YQXL 1NANI 4GKNB 1BIIB 3FT4B 4OZIE 3NIFF 3RVWC 1B9ZA 3QWRA 1KB5B 3RP1A 3NZ8B 4NRXA 3VXRA 2FECL 4GKNA 4S1DD 2BDNH 4HJGB 1X6LA 3OZ9H 3FRPG 5D7LE 1KB5A 1WWWX 1JTTA 4E41A 3QPXL 4WEBH 3SE9L 4YBQD 2LV4A 3P0VL 4CN4A 3QIUC 1RZKH 1F8TH 5TGBB 5IP4A 4LVOB 4YO0A 1FL5A 4XP1H 4JFDB 3S34H 4MSWB 2ADGB 2B0SL 4APQD 3AGVA 4S2SB 4XBPA 1T83A 4LLQB 2X4SB 2PYFB 4MQ7B 3TVMB 2ZZUT 4S2SA 3DXAB 1DLFH 1PJ9A 4PJ9A 2NXZB 1IVLA 2PYFA 4MQ7A 4FG6C 2DQTL 1V8HA 2HWZL 3GBMH 1MI5D 3DXAA 1JPGB 4JFOA 2C4XA 4ZFGL 2D7TH 2EDRA 5DUPL 4L4VE 4L5FH 1ZLVH 3RA7L 1Q8MA 3D69A 3LKPB 3QG7L 4JR9L 3BGMA 1JPGA 1T2JA 1FNLA 5KSUB 1FP5A 4U1SB 1MLCA 5I1HH 3MNZB 5D71L 5TF1L 3LKPA 4M7LL 3VFGH 3CFCH 1W2KT 3UTPD 5KSUA 1BFVH 1M7DA 4RA3A 1T7ZA 4U1SA 5HVHB 3IETA 4UTAL 3CFJA 5C6WH 3C5SA 3SDDB 2QHRL 5J3HD 1KIRB 5I16B 4YXLL 1GIGL 5ANMB 1OW0A 3VGGA 5JLZA 3OGOE 2Y7QB 4OCYL 4EDWL 3FT2B 3SDCB 2WW8A 1EDQA 2E8YA 5MP6L 1G9ML 4TNVK 4R4BB 3VH8B 1SMAA 4WNQB 2Y7QA 2WUCL 5JOFA 5ID0A 3HZMA 2FEEL 3QXTA 5J06A 3MREA 3SDCA 2AK1L 3FQRB 4CDGC 4R4BA 1TJIL 3VH8A 2FL5B 4B53A 1YEKL 4NQUA 4U6VL 4QWWD 1G7HB 4P4KB 3CLFL 1DN0B 2DQUH 1HIMH 2R1XA 2R4RH 1CE1L 1A14H 4MJID 1G7HA 2DI7A 3ECBB 4BZ1L 1CDHA 2JF1A 4AEEA 4FFYH 4P4KA 1QSED 4S1RL 1DN0A 5IMLB 5F6HI 1OAQL 2YKLH 4UAOB 3ISWA 2VL5B 4HH9B 2ED8A 4UIKH 4TN9A 3MSPA 2UYLB 2VL5A 3GSNH 4KI5E 3OJMB 5IVXB 2H3NB 4NN5C 2W9EL 2GIYA 2FATL 3FL7A 5IVXA 1CD0A 1IEHA 5CP7A 3ZT6A 1OAXH 3LH2H 3HB3D 5JPMA 2R29L 4P2CG 4ZTOL 1EMTH 1RUAL 1AJ7H 2NY5H 3UO1H 4XCCL 3OAYK 1HSAB 1IBGH 4DUWA 3LZFL 5J11B 2YPVL 1FGVH 3NACL 1IE5A 2AQ1A 4NCDA 1LMKA 2AJVL 5DQJA 5CEXB 4KUCD 2JB6B 2YWZA 5BZWA 3ZL4L 3QDJE 4FTVD 4MXVF 2EECA 4F37K 4ZTPH 2JB6A 4GKOA 4LGRB 5IF0B 2HT2D 2YXFA 4NN7B 1D5ZB 2AV1B 2WAHA 4PJCA 5FEBA 5E2TH 4L4JA 5DVMA 4UMGA 3TNMB 2EDOA 1P7QD 3FQXA 3MYJB 5E2VH 2EKJA 1AHWB 4GRWE 1JHTB 1PD6A 1U36A 5I66A 5KSBE 2VZOA 3LKSB 3MYJA 4CVXA 5KSVB 1U6AL 1MVUB 2ITDA 4LRNL 5EZIH 2BHYA 1QEWB 5C0NC 2B4CH 4X4XB 4Y2DD 4XB7A 4P46D 3ULUE 1F3DH 1NBZB 1MVUA 4JKWA 1RUKH 1JGUL 1QEWA 4OLZH 1MAJA 4OZFG 1QBLL 1BQUA 5EIIB 4HWEL 3MOAL 3D3VB 2CMRH 1UKSA 3QUZC 5JW4M 5DMJB 5F93C 3ZKMC 3QH3B 4M1CC 5EIIA 1WZMA 2DBLH 4NNXA 1EHLH 5MENE 1MIMH 2G9HB 4H8WC 4NWTL 4ZQKB 4NCC1 3V6OA 4BJLA 3HR6A 1PY9A 4UBDC 4XPAH 1CFQA 5CKGA 1XT5A 5D1QA 3BWAA 1FNGB 4P57A 1NGZB 3GMPA 1BAFL 4ZQKA 1QVOA 3S9DB 2SEBA 3W9EA 1YYMH 4DFHA 1QFUL 5I30L 2F54E 3KYKL 4J6RH 1JZ5A 2ID5A 2OL3A 1HN1A 1FNGA 1ZWIB 1NGZA 2HN7B 3LN5A 3MLTA 3MBEB 4LVNB 1JGDB 4H88H 4YHML 1YPZB 1EZVX 4LPXA 1INEH 1RD6A 1ZWIA 2F58L 5DFVD 5E03A 4PRID 5T1DH 4IRSB 2QLVB 4NRZA 1BGXH 2P5EB 1YPZA 1QNZL 1SHMA 4JHZA 4JREC 1JNHA 5E7BA 1IM9D 3FB6B 4QRSB 2NY3D 3NFPB 4TULL 5F7UA 1K8DA 3MOBL 3TA3C 2DQCH 3X12B 1OLZA 4QRSA 2UWEB 4XPGL 3ABZA 1RV6X 4PGDA 4HX1A 3VWJB 4LNRA 2XZQL 8FABB 1X4ZA 3X12A 3U4BH 3K2UL 2UWEA 2VITB 3L5XL 4XI5D 4YDIH 4YHKL 4UOW0 2KBGA 1OAUH 2BXZA 5E2WL 3TPUB 2GY5A 2EDTA 4OF0A 1CVRA 3VXUB 2E7HA 4U3CA 1CGVA 4LIQL 1AGCB 1AGEA 1FNEB 4PJDE 3W2DL 1HWGB 5E9DB 5T3XH 3TPUA 1FNHA 1A3LH 3NIDF 3WSQH 4L29A 3MROB 4LSTH 3BIKA 5HHMB 4GFTB 1KENH 2E7BA 2QQKL 3O3DB 5CEYB 3SQBA 1AO7E 3MROA 4G8IB 3O9WA 1OSZB 3O3DA 2X4OA 1HQRB 4LSSH 5CEYA 5K59E 4R0LB 5GGTA 4I3SH 3V8CA 4HUXB 1X9QA 1JMXA 2I26N 4QRPD 5FKAA 4GAGH 2W0FB 4YNYA 3M45A 3KYOB 1N8ZB 5DJ8A 3R4DA 4XWGL 1IQDB 1NMAL 3HPLA 4HUXA 3HN3A 2XYCA 3BYYA 1KIQA 2YD3A 4GSDL 3QUYC 2W0FA 2GKIA 3S97C 2BXYA 3RFZC 1IQDA 4QTIH 1RJCA 5IFAL 5C0ND 1EFQA 4OZIB 5CILH 3RDTC 3LPFA 4POZD 3IJYB 1IEBA 3KNBB 4D94A 1QLRB 3MRPB 5LWYH 5B38G 2IMNA 5GS0L 3RZCC 2Y36L 5BS0E 5D7LB 1AI1L 1I1RA 5IVXF 3VWKC 3NMEA 3QUZD 1IC5H 3EO0A 3MRFB 4M1CD 4QHKJ 4TUOA 4Q6IC 5HYSG 3WFEL 5D7LA 2F5BL 3EOBB 4ODTH 4GW4A 1OPGL 5EO1A 4OQ1A 5JO5B 3U9PH 4IDJH 4YEEA 1IKNA 1GGIH 1LE9B 2VZVA 5SWSD 1ZHNA 3QEHA 4NFDA 2OYPA 5JO5A 4PGBB 4RBPK 2O61B 1BEYL 1QBML 2XA8H 2ICCA 1ZE3C 5F72S 3MV9A 5KG9B 4Q0XL 3THMH 2BNQE 3FHAA 4JGMA 1IC7L 3UJJL 4ZG1A 4PJCF 3TF7C 5C86A 1L6ZA 3CJJA 2QL1A 3IF1A 4HUUB 5DRWA 5KG9A 5TQ0L 4L4VB 4NHCL 1J0YA 1N7MH 1JWSA 1HNFA 1CWVA 2DBJA 3SCMA 43CAA 3STBA 2AV7A 2DQJH 1CI5A 4F58H 1GZPB 2D31A 2EO1A 4L4VA 2NW2A 3NAAH 1BZQK 4X5WB 1UH3A 3U9UB 3WNOA 2DDQH 2HFGH 4K23L 2ICWJ 4N5UA 4PJXA 3SKMB 3DYMA 4RZCB 5F8QC 3BPNB 2F5AH 4X6DA 4L4TE 4Y16A 3N85L 5HHXL 1KEGL 1JHKL 3WKMH 4HAFA 3CDCA 3P9LA 3T2PA 1K8IB 5ICYB 1NPUA 4MDJB 1MUJB 3E6FB 1FC1A 3P11L 3IAPA 1K8IA 2WUBL 3GJEB 2J2ZA 2FGWL 1MUJA 3EO9L 4MDJA 1BQSA 5GRVK 4GXUN 3LKOB 3BFOA 3BP6B 3KLSA 1OAYL 5F7NC 4WI9A 3P2TA 3KPPA 4U1NB 4ALAH 2APVA 3VMPA 5J6GB 1QQDA 1A4JA 5HBBA 1LE5A 4H1LH 4KQ3H 3VW3L 3S5LG 3DHJA 3LKOA 5DJZA 3W39B 4OLWH 1FZKA 5FHAL 1JTPA 5I73B 4P2RA 5J6GA 1IGMH 1YEJH 4YE4H 5D7JA 1J05B 2Z8VC 4QOKD 4JPVH 4MD5B 3ME0A 4TVPD 4LLDB 3GIZL 5EU6E 4QRQA 4ZFOL 3ULUL 2P42B 4U1JB 1BZ7B 1HH9B 2IJ0C 1N6VA 5DD3L 3WXWL 4ZO8A 5HJ3B 4CU6A 2NX5E 3TM6A 1V3LA 1IL1A 2FBOJ 4LLDA 1IAII 4HXBL 5F3HA 2VR9A 1YPZF 3BQUA 1DFBL 4HGKC 5D93C 5DQDL 5C9JB 2EYRB 5DTFA 3QUYD 1I9EA 1OSPL 2XIDA 1EJOL 2HJKA 2XZAH 4EI5A 3MJ8B 1AQKL 5BVPL 1IM3A 2VZ1A 2Z91A 3VFWB 1I7UA 1FRGL 1DANU 2JLLA 4QNPE 2PTTA 3DV4B 3RI5F 4GMTH 4HT1L 1MRDL 3CH8A 2UWEF 3VXSA 3VFWA 1TPXC 3AUVA 4DVRL 4J3TA 3VWKD 3W11C 5IB5A 1XR8A 1F4YH 4UILL 2HT3C 1V7NL 2QQQA 1HHHA 3O81A 5E99L 1UEMA 1G7IB 5EOCJ 5A2IH 1I3GH 5TF0A 25C8H 1EH9A 2E6PA 4NRYB 1CXFA 4XPTH 2EEBA 1EAPB 3RJDA 2DAVA 1YQVH 3NIGF 3Q1SH 3CDGA 4ONFH 5IQ7H 3RNKA 5BVJB 2IADB 4NRYA 5JMOC 4PV8A 1ZANH 2R2CA 5ABDE 1EAPA 1OAKL 2FIKA 3GHEL 3VRJA 5CEZD 6FABH 1FN4B 2X41A 2NY0B 1ZLVK 5BVJA 1U8PA 3M8OL 5TE6L 4UT9L 3QDJA 2NNAB 3VFRB 3IDIB 2VABA 5AZ2L 2IAMC 1N64H 1YMMA 4V1DB 1GGCH 1XR9B 2NNAA 1CT8B 2J6EL 3QQNA 5J1SC 4BZ2H 3VFRA 4GRWB 4ZXBC 4DZ8B 4BH8B 1E27A 5KSBB 3UPRA 4JQVC 2Y5TB 1KYOK 1XR9A 2XXMB 5FYKH 5B8CC 1RULH 4I0PB 4DZ8A 4BH8A 1PG7X 3DETC 4N0YL 4ZFOB 5KSBA 4AJ0A 2Y5TA 2YR3A 5HHPA 4Y5YA 5DRZB 3NBNA 5SWZD 4I0PA 4HWUA 4RFOH 1K5NB 1NCBH 5D2NB 1RJLB 4YWGL 5DRZA 4RMSA 5KVGL 5IB4B 5I18L 1DBML 2JJSC 3LKNB 1K5NA 4R90L 3DGGA 5JORB 4OF7A 3VRIA 3T0EA 5MENB 2VLKA 3MGOB 1NGPL 3MUHL 2P8MA 2DLFH 2OS7A 2H26A 1KSRA 3CFEA 1A6WH 3OG6B 3AXLB 2AEQL 1A6ZB 4ERSL 5MENA 2J12B 1KXVC 4RAVB 3ARGC 1SY6H 3CFIC 3DJ9A 2F15A 2F54B 1ZV5A 5IROC 2ZUVA 1D7FA 1U8KB 4E42A 1AR1C 5I6XC 1VERA 1S5HB 3OKMA 2ZG3A 3D85A 1OD9A 1RHFA 3WKNA 4EDXB 3ARED 4O2EB 2R1WB 1CE6A 1G9NC 3OR7B 3CXHK 2BVTA 1R3IH 3EFDL 3FQUA 5IT2L 1U8KA 1GHFL 1AFVH 3QIBB 1S5HA 1MH5B 1WBYB 2D0HA 3C5JB 1JZ4A 1V7MH 4L8DA 2X4NA 3V5KB 4M7LT 3HG1A 1WBYA 5HGDA 3RVVC 1QSEE 4RMVA 5MHSD 4JDTL 2G5BB 4GAJL 1IFHH 2EIEA 1L7TL 2W92A 1JFQH 2VZTA 1MHPL 2A9NL 4G6JL 1FYTD 3OKEB 3MLWH 1ZT1A 4OIIH 5IR1B 4I13B 1RIHL 4RRPG 5B38A 2AJXH 2QKIB 1A4KA 2EDQA 5HYQA 1U9KA 1DBKL 3W11D 1T1WB 3BHBB 2VR5A 1MAMH 2M1KA 2NY6B 5AD0A 2DQHL 3K7UA 4JCLA 1JWUB 5F9AC 3K8LA 4PJDB 3REWB 5HYSA 4HF5L 5IEKB 5I19L 4TSBL 4BSWA 1GRWA 1G0YR 5IEKA 3VXMD 3RKPA 5GGVH 2JELH 3H42H 2OP4L 3V7AG 3QHFL 4KDTA 1I1AC 2BVEA 2EDNA 4WI4A 1AO7B 2ZUQC 1TZHA 4Z78B 5JDSB 1ZK9A 2AJSH 5EZLB 3F7YB 1FFQA 2X4RA 3F6LA 1OGAE 1EEZA 4JCMA 4OZHE 3MCLH 4NN6B 4Z78A 5FHBL 3O41A 4K07A 4AYFA 2V2XA 1NUGA 3I9GL 3MLVL 3QCTH 5E4EC 4J3WA 3E8UL 2IPUK 3C5ZC 3NA9H 1RIUH 1NFIB 1XMWA 1O7VA 3AY4A 3QT2A 4LLMB 5F88B 1QSFE 1RZJL 2QQNL 4M62L 4FZ8H 5IFHH 1IRAY 3GZKA 5CP3H 1WBXB 5F88A 2IPKA 3ZHDA 3GM8A 3UTTB 4OB5L 4Z0BL 3T3PF 4H26B 4JPKL 5A3ID 4QO1A 4MAUL 3KPRD 3C2AL 4HKXB 5BS0B 4KI5F 1BFOB 5DMIL 1A0QH 1H3UA 1EX0A 3OKNA 2CUMA 4JB9L 4HKXA 4QXUH 5BS0A 1XGUB 1Z9MA 3H9SE 1BFOA 5JR1H 1W0YT 2EDHA 2CLRA 5LXGH 1G9MC 3FFCD 5L9DH 2ZJSH 3S5LA 3UROR 4LSVH 1CGSL 4HQQH 3ULVE 1FFOB 1OB1B 5B39B 3ZTNH 3B9KA 3O6FD 1WC7A 3IDJA 4OLEA 3UP1A 3G04B 2XTJD 1F6LL 3DURB 4FQ2L 2CK0H 4OFPA 4QXGL 5JW4R 2EE6A 2BNQB 2J3SA 4FN0A 2FBJH 1C12A 3PG2A 5F9WC 1CIDA 1UZ6E 3QZWA 2YPLB 4YK4C 5J57B 1ZSDB 1TVBB 5CGMA 2DMKA 4PRIE 4MD4A 4U6YB 3RVVD 5GSRB 3CPLB 2NY7H 1UACL 4KJWD 2Z92B 4MMXC 5KW9H 1T7VA 3GEWB 1MCWM 1HHJB 1WITA 3AS0A 4FQIL 4GRWF 3MC0A 4AIOA 1B90A 5KSBF 1JZ7A 5GSRA 4IOIB 5H37G 2DICA 4K3GA 4F15C 4L4TB 1CF8H 5KZCD 2O26U 5FM4A 4ENED 2HTKC 3BKML 2YS4A 4QGYA 2Z93A 4YBLC 4EN3C 4IOIA 4M4RA 3RZWA 1MWAH 2Z31A 4GRLB 3BOVA 1BWWA 3E3QE 1C5BL 4NHUB 4OZGE 4XP4L 5C0GB 3WFCL 4Z7QF 3SOBH 4DQOH 3QXVA 1CFTA 4JDVB 4WO4B 4HS8H 1J0KA 1NBYB 2OMBA 3HCVA 4CMHC 3PL6C 4NHUA 3QBTB 4ODHL 1DTUA 2KL6A 4XP5L 3SE3C 4JDVA 2L7UA 3W5MA 2UZXB 1D5MA 1NBYA 4LBEB 1CGUA 3IFLH 5DVKA 1I1AD 5HI3C 4BKLA 4OKVB 2VXVL 2X4UB 4PB9L 1Q38A 2B5IC 1PG7H 5D72H 1ZLSL 5KSAC 2IH3B 4JFEE 2YUZA 2WZPD 3OJVC 1EEQA 3PHOB 1RQ5A 2P46B 4ETQB 2NX5B 4KK9C 1D3CA 2F74B 4F2MA 2WK2A 4U49A 5EU6A 4CMMB 4L8SA 3K4ZA 4Z8FH 1NUDA 3NVQA 4QRRA 1RI8A 1T7WA 4RMRA 4PJGE 3EDKA 4HWBL 5IB1B 1T04A 1X7QA 2F74A 5IW3A 2LQRA 2GSGA 1WSST 5FA3B 2A9ML 3EOAB 4PRNA 4NGHH 3GSUB 1F4XH 1QKZL 2NZ9C 5DA4A 2GI7A 5IB1A 3EYOA 1ORSB 5I76B 1MJ8H 4AEIH 4IJ3B 3GSUA 1WAAA 3A6OA 5KANG 2ZPKL 1P4IL 4X4YA 4BM7A 3NN8B 35C8L 3HE6A 3SDAB 3L1OH 5DJAB 32C2B 1SEBA 1WVZA 4KKCD 2X1OA 3KG5A 3SBWA 4W6YB 4QY8A 1GGUA 4YZFE 4FRWA 3DTXA 5E8OB 1HYSD 5C0JB 3HKFA 2MPAL 3I2CH 1R3JB 3SDAA 4OFKA 5LQBH 4WHTA 3NZHH 3V52L 5D4QA 5E8OA 4XC1H 4XHQA 4WTXA 3JWOL 1CTNA 4Z95H 3FZUD 2DLIA 5DDHB 4LLUA 2A73B 5SWQA 5E24E 1P5UA 5ICZB 1NFDA 1F58L 1IGJA 1A7QH 4WHYH 4JFXB 1HI6A 4OI9A 3TCLB 1CLOH 1QUNA 3M07A 1A8JH 3C8KB 5C6PB 4APQA 3GK8L 5JOPD 1NDGA 4KVNL 2J5LB 5CS7A 5K59F 2AJ3A 2B20A 1OARH 4PBXA 2YC1A 1KELH 1AXSB 4KHXL 3LIZH 4G3YL 1QFWL 4K2UL 3TCXA 3EJZC 1TQCB 5EC1B 3TO4C 3PV6B 4RDQG 4K9EL 4GW5B 2R9HC 1YC7A 1A6TB 2YD6A 3IVKA 5F7HA 1AXSA 2CJUH 1MI5A 4CNIB 1WT5C 3WDHA 3SY0A 3U7YH 2MHAB 4JO4H 2W65B 4RRPA 1ODAA 3AMLA 3BAEH 3MXWL 3OKOA 5T3XD 3L3GA 4EN3D 1PX4A 1OVZA 4JHBA 3T4AB 3L5HA 5FOBB 2MHAA 1H5BA 3RTQB 2W65A 3O3BA 2BC4B 5EWIH 3HPJB 3U0WH 4IIQC 3DMMB 5DS8A 1MCCA 5E1AB 5FOBA 3RTQA 2WP3T 3S98A 1HZHL 1A7OL 2GSIA 2VWEC 5B3JE 5IEHB 4F3FA 3DMMA 4QCIB 3NFNA 4A6YL 2YD2A 3LD8C 1XGRB 3C09B 4KK8C 3ZDYE 3W82A 1MY5A 2RCSL 1CIUA 3QFDB 1J0JA 3I6GB 1XGRA 4ZFZA 3RWJB 1DBAH 5KSAD 4LASL 5KS9E 2X1QA 4QF1B 1NEZG 4OQTA 5FYLH 3QFDA 4ISVB 3HE7B 3I6GA 3QFJE 1U8JB 4LSUL 3TESA 1A1MB 4JZOA 3HRZB 4QF1A 4K3DH 5CD3B 4Z77B 1G7LA 5C0RL 5J89A 4HV8B 4NBXB 3Q5TA 4ISVA 1QSEB 2P24A 2OQJB 3UMTA 1A1MA 4MJIA 3V0VA 5FUZL 4Z77A 3TBVA 3V0WH 4NNPL 4EIGB 1QSEA 1YC8A 2D4DA 1MPAH 4QT5A 1AP2B 1F45A 1TZGH 3D1MC 3BZ4B 3K46A 1FNFA 4ONGH 5EBGA 2MWCA 2AABL 2ZKHL 4NKMB 4ZOAA 1SEQL 4YDLB 1L0YA 2OTPA 4K3JL 3IKKA 1AC6A 1NBVL 5I8OL 5IMOB 1PZ5B 4X6BA 3WNKA 4XMKL 5DSCB 4XPHH 4JFYB 1QHPA 3VFNB 2BVUA 3B2VL 3EYUH 4AENB 1DQQB 2DS4A 2IQ9H 2YD5A 2Y07H 1RHHA 4JFYA 4U1GC 5GHWH 1Z0NA 1ZTXL 3DRQA 1OGAB 3W5NA 3PWPD 4LRIA 3G9VA 4OZHB 3O2DA 1DQQA 2LTQC 4P48A 1SQ2N 5T5FL 5MI0C 1MCBA 3GSQB 4MAYB 4ZNEA 1NEUA 5L7XL 1A3RH 1Q72H 2ZP0T 5DC0A 4DGVH 3QI9D 4A6YB 1EK3A 2H32B 1NCWL 5BO1L 3WHE1 4FTVA 1CL7L 4WUKH 2MJWA 3RIFK 1WV7T 4ZDHB 1BFTA 1KTKE 4GQ9H 3SGDI 5C08E 3FKUS 2H32A 3D48R 3EJZD 4HUMB 5IW6B 1QSFB 1SJEA 5EORH 2R9HD 4U6XB 1T89C 3HI5H 1P7QA 5LG1A 3FO0H 2OTWB 1QSFA 2C1OB 1NAKL 1Q0YL 2D7MA 4U6XA 5F44A 4G5ZH 2XZCL 1WAAF 5FYJL 5IUSA 3IT8D 4LQ1A 1T80A 2GTWB 3MCKB 4BFBD 1GPOL 3FB5A 3F5WB 4Y2DA 1CLCA 4HMCA 3EDEA 4P46A 4LLVB 4QNPF 3JV0A 4HSQA 1KB5H 3H9SB 4P5KB 2GTWA 3MCKA 5C0IB 3HNSH 2EXWC 1EO8H 3MRNA 4XX1G 1KCRH 3VMNA 3PWLB 4P5KA 1J5OL 3QO0B 3MLRH 1DVFC 5FO8A 3VFPB 3PNWA 4N0UA 5C6TL 2GTZB 5FK9B 3K4AA 4L8CA 3PWLA 1IZKA 1U93B 5M94B 3CSYA 3DUSA 4OAWB 1E4XI 1VENA 3VFPA 2FJFB 3KPNA 2FDBP 5FK9A 3U36A 5D7KD 1NFDF 2R23A 1QP1A 1CBVH 1U93A 3OAZH 2QEJA 2QV2A 4O9HH 1DQML 2FJFA 3V6ZB 1IEAA 2EH7H 3EJYD 3UTZB 1FLRH 3HUJE 4N90E 4G7VH 2AJZB 4JAMA 1FSKB 3V6ZA 3T0AA 4PRIA 1FGNL 2DQFB 1AIFB 1NGWB 2GK2A 4XB8A 3ZDZE 2NY3B 1I9JL 1MCPL 1TIUA 3FOMA 2Q7NA 3BESR 3D0LA 2I07B 3RWDB 1HSBA 1IM9A 3VFVB 1I75A 1NGWA 3H8NA 4P2QE 5KTEL 2NPLX 4XP9H 4WV1C 3F62A 2I07A 5HYJB 3WIIL 3PDGA 4OZGB 3VFVA 3QISA 2Q8BH 3T3ME 2IALB 3EYQC 4DUVA 5HGAB 2F53D 1J8HD 1DUYA 2ARWA 4HUKB 4OZGA 2IEPA 5J9PB 1DJSA 1Q9OA 3UTQB 4KZDH 5HGAA 4ZUVA 4F8QA 1OGTA 3KXFD 4M4PA 1NCAL 2VLMD 4OT1L 3HC0B 1H15B 4DGIL 5B4MD 1I1YB 4JHWH 4JKMA 4ONHB 4I3RH 1VFAB 3HC0A 1H15A 2V7HA 2GJ6D 3L5WB 5JXEC 2P4AB 4ONHA 4JFEB 3CDFA 1I3RA 4QXTA 1VFAA 4U0RC 2DQGH 3L5WA 3LN4A 5ALCL 3SE9H 2NY2C 1RK1B 1QBBA 4XTRD 4KTEH 1DQDH 3MGTA 4K7FA 4PJGB 1JIBA 4UV4H 5I1EH 4P9HH 2CPCA 3PDDA 1UXSB 4UDTB 3O4LE 2ADJA 5GZOC 1RK1A 3OB0H 2BNUB 5LBSL 4PJGA 4QRPA 5F7MC 4UDTA 2A6IA 3VMOA 4YH6A 4YXKL 1ZS8A 1QLEL 3CSPA 4HK0B 4M43L 3V9FA 4NZTL 1JZ8A 3BZFA 1S9WA 1CICB 1JHLL 1MCQA 5MEQA 1ZLWH 4JG0H 3RVXC 1IZJA 4XNQB 4PRBB 5D96B 4C83B 2DQTH 3EDJA 1AGDB 3P4MA 1H0DA 2W0KA 2VDOH 2JK5A 4D0CB 2CLZB 3N9GL 5DUPH 4DUXA 2Q86B 3V4PL 4KJPC 2VDRH 2EIDA 3RA7H 1KT2A 4D0CA 5AZEL 4N9GB 1DVFD 1M4KA 5ITFB 2ZNWA 5EC2B 3AROA 3TYGL 5D71H 3OF6D 2O5YL 3P4LA 4AQ1B 3MA7A 5IOPB 5I1AB 3U4EA 3P30L 3FFCE 4RMQA 5I1JL 4DFIA 4HCRH 4N9GA 3SKNB 5HHNA 1EHNA 5DK0A 1W0VA 5EC2A 5FECB 4QHUA 3I6LE 1PFCA 2DYPB 4UTAH 5GGSB 4F7CB 2CRMA 4PS4H 1BOGB 1NEZA 1BD2E 1FFNB 4MNQD 1JF6A 5FUOH 3MPCA 3OGCA 4YXLH 5SWSA 1GIGH 1Y6MR 2A6JB 3SKNA 4JO2L 3AS1A 3FONA 1T4KB 3QEQD 5DD6A 5FECA 3RRQA 1IAKA 5GGSA 1RZFL 3QNZA 1SM3H 4NSKA 2P47B 1WICA 3P73B 4EOWL 1T4KA 2QR0A 2E7LC 3MLYL 3VG9B 1OT2A 3ALXA 2A77L 3MV7E 3E6HB 3QP3A 4WFED 1CD1A 4KRPC 1TJIH 4YHPA 5EOTA 4LHUB 2M2DA 3GIVB 4EQ3A 3QNYB 5L88L 1MHHB 1IGIL 3IKCA 2XWTA 3QNYA 4YHIB 15C8H 5IVOA 4KXZH 2FH6A 4NQVA 4PRAB 2CXKA 3H9HA 5HY9A 1HHKB 1R24B 5D1XD 4YHIA 2WLZA 3RL2A 3ARRA 2WIMA 1TNNA 3NH7H 1WWBX 1UCBL 3VRLE 1R5WB 1OY3B 4YFLI 3OWEA 3NABH 4HMDA 3RGVB 4CADB 4RWYL 1R24A 2CDEB 3NCEB 2PO6C 4PFEA 1LO5B 1RUQH 3SE4A 1A7RH 4JY5L 3BMWA 2IQAB 4V2BA 3ARQA 4NDMA 3UZEA 1HWHB 3TN0D 1LO5A 4P5TD 4JN1H 4CDHA 3S88L 1A21A 5KS9B 1QR1B 4AMKH 1NJ9B 2IQAA 3UTSD 1PKQB 4PLKD 1EIBA 3WEXA 4ZTOH 4GBXD 5CKAA 2EDFA 3QFJB 4P2OD 3QDMD 3ET9F 1NJ9A 1J8KA 4NKOB 1HINH 2Q7YA 4PR5B 3PGFH 3QFJA 3KLAB 4JGJA 2UZYB 3A6BL 1NC4B 1NGYB 2AJVH 3KJ4C 4NKOA 4OM1L 4XMLL 4OTXH 1RZJC 3ZL4H 1FORL 1MCJA 4NOFA 2XNAA 4ORGB 4Y4FD 3JWDH 4RGOL 5DFWH 1LK2B 3BJLA 3VFTA 5CSZA 2W9DL 2H1PL 3ZMRA 1U92A 3RVXD 1KULA 1F6FB 4HAGA 5ETUA 1CDUA 3T0XA 1N5YH 3UYRL 4X7DC 5DF0A 5KOMC 1J0ZA 3BPOC 4S1SL 2FJHA 5CZKA 3KPMB 3TWCH 4G6FB 2VAAB 4U6HA 4XRCB 1S7UA 4OZGF 1AXTL 2HVJB 1MFDH 4DGYL 5HD8C 2VAAA 1DSFH 4XRCA 1EEYB 2FX7L 4PP2B 3SGJA 2HVJA 4HIEA 1JI1A 3DGCR 1FZOB 3D0VB 1LP9E 4AT6A 3KR3L 4NO3B 3MFFB 3LEVL 1N59B 4PP2A 3MOAH 1H9VA 4OD1H 3ZE0F 1FZOA 3EIFA 4H25A 4LKXA 5GGTH 2ICES 3TBSB 5T33H 1TMCB 1V5JA 3VXTB 1N59A 2EYSA 1D6VH 5C08B 1X5IA 4FQJL 2PW1A 3TBSA 4YGAB 1I85C 3VXTA 2DKSA 5KBNC 4KGJA 3QCVH 2CQVA 3KS0J 3N1PC 4ZPTB 5I8CA 4AH2A 1P4BL 5ADPL 4PJGF 3MLXH 2B1HL 4PRDA 3QIWD 2QSCH 4FQXB 1DL7H 4OSUL 3BZEB 1I3VA 1FDLH 2KKQA 1I4FA 2K7PA 4YHMH 5TH2A 2X7LA 4HDIA 3WHXB 3EJJX 4DCQA 2CH8A 4FQXA 5BV7B 3IU4L 4JG1H 1YN7B 4UI2A 4NO5B 1PGRB 5EZOL 5SWZA 4JVWA 4LLYA 1TJHL 4Y5XC 3ARXA 3WL9A 1ITBB 1KC5H 4I18A 1F4WH 4ODXB 4S1QL 5FAAA 1D9KB 4G9DB 3L3OB 4B50A 5KVDH 3V8OA 5IVNA 1T3FA 4MJ5B 3ILQD 5IHZA 4Q74A 4YZFF 3DROA 3RWIB 3RWHB 2VQ1A 1IILE 1S9YA 1KEML 3AFLA 4ODXA 3GSWB 5IGXL 4G9DA 5L8KB 1YJDC 4KI1A 5F7DB 4XVJH 1ADQH 4P23C 1J0HA 3GGWB 1JK8A 1QYGL 4LSRL 2IPTL 2CGRL 1DBBL 5DI8B 3W9DB 2A38A 5FV1L 1XGYL 5F7DA 3OHXB 1E6OL 3ZE1F 3KYAA 5DYOA 2VE6B 3HUJB 3GGWA 1P5VA 43C9A 2ICWB 4JFFE 2IGFL 4O2FB 4Y5VC 1UB5A 3AREA 3LVEA 2VIRB 4Y7MA 2C3HA 2ICWA 1MREL 4O58H 3S35X 4O2FA 4LHJB 4K8RL 1NMCC 5MEOB 4M93C 1OTSD 1WLHA 4P2QB 3WJJC 2G2RB 4KVCL 1JYXA 1KNOB 1C08B 3G6AB 5L6YL 2R56H 4OCRL 1CTOA 2E27L 5I9QC 5MEOA 4P2QA 4OZFB 2CLVA 1HE7A 3K1DA 3S4SA 3OXRB 4XHJC 2Y72A 4ZD3H 1XIWD 1IQWH 1JPFB 4HS3A 2DQIL 3V7MA 5IM7A 1C7SA 3B4NA 5JUEH 3CCHA 5IFAH 2HKHH 3WLWC 2B1AH 3MNVB 5HD8D 4W4NA 4YHYC 2PXYB 3JWOC 3BP4A 4DN3L 3D87B 2VLRD 3OR6A 5B3JF 4PJEA 4IOFC 2CRZA 1S8DB 5EUKA 4I8DA 4EVNB 3HZYB 3VXMA 4IMLB 4JFPB 4BQ8A 1QFOA 1H3PL 4NQDE 2R69L 3B9VA 1I3UA 4QRTB 4XNUH 4EUPB 2BY0A 4XNMB 4JFPA 5KS9F 2J4WL 2GAZB 3ZT5A 3O4LB 4Z76B 5HPMB 4HUVB 3HMXL 2X05A 4QRTA 4PJIE 2OJZL 4EUPA 2HRPL 1N2RB 3TEUA 1F90H 3QAZC 1JPTH 3QO1A 3MBXH 3MRRA 5DURB 5ILTH 5HPMA 3FN9A 4HUVA 1Y18B 4Q58C 2BVQA 3OBAA 3F7QA 1CLYL 4NM8H 3FO1B 2OZ4A 1BEYH 3JUYA 4LPVA 2LFGA 1DUZB 2X40A 1MELA 4HBCH 1W0WB 2EE9A 1Y18A 1KPUA 2VDKL 4OLUH 1X5JA 5E5MA 2C7UB 1GGTA 3FO1A 4WFFD 3CXHJ 1DUZA 1LD9A 3MACL 5TQ0H 4AM0B 5L8JB 4NHCH 1W0WA 3ZKXC 4LOUC 1T83C 4LVOC 4EQ2A 3DUUB 5FFLA 2VXTH 5J13C 3HC3H 5C0FB 2WWMC 4NC1E 4AM0A 4N8CH 4K94L 4PLJC 3QWQB 4NUJA 4Y4HD 3GI8H 3RX8A 4YHLH 5C92A 5FYLD 4WWKB 4PJ9C 5C0FA 3BEVA 4HEME 4XVUC 3MRGA 4XXDB 1ZT7A 3GHBH 4UOW1 1BD2B 4D8PB 4Y4KD 5GJSL 3PHSA 3FFCA 2EKSB 1KJMB 5JW4Q 4PYHA 4RMWA 4WHDA 1R3HB 4D8PA 2ORBH 3GUTB 4ACPA 2FCBA 2ZCKH 4TSCH 4BQ9A 2XKUA 3MV7B 3OXSA 2G5RA 4HKJA 3WYRA 1MFAL 4XAKD 4MYWB 3FO2A 1SYSB 1ES0B 5DK2A 3U6RB 5DT1H 3VW3H 4MX7A 3PWNB 4GRWH 5GS1B 3MV7A 3ILPA 3A6CL 4GO6B 3RVUC 5ISZE 1OW0C 4HC1L 1ES0A 4Q9QL 1OP5H 3PWNA 4Z7UA 2X9WA 1TJGL 5HHVL 4PJBA 2XZZA 2J8UA 3WXWH 3S36X 2GT9A 5KZCB 1ED3B 2DN7A 3KPSE 4XPBH 2K1MA 2R0ZL 1B4RA 1IMHC 1ZKAA 3ARFD 4X99A 2Q76A 3SDCC 3QUXD 4XHJD 4X83A 1IAIL 4H20L 1KGCE 4NZUL 3ARBD 1ED3A 1BQLL 2HFTA 1FL6B 5IJKA 2YRLA 1AQKH 5D7SH 5IMKB 1E4JA 1UWXK 3WLWD 3O11A 2VC2L 4H1LG 3FFDB 5FO9B 1FRGH 4UINL 5CHNB 4P4KC 5IKCB 4N1EA 1XGTA 4P9HC 1Z9OA 4LU5L 4HIIB 2ERJB 4EBQL 5FO9A 5CHNA 4DN4H 3DBXA 4OGZA 3MA9L 3B6SA 2GJ6E 1WEJL 1P1ZA 3BUYA 5DD0L 5EU4A 2BSRB 4UAOC 4RGNC 1ZLWK 1CXIA 5FCUH 1NLBH 2VOTA 3EO1B 4OLVL 3C08H 3T0DA 3TBYB 4LARH 4WW2B 5EFIA 4YXHL 4KTDL 1KIPB 1Y0LA 4CGTA 3M8OH 4JO3H 3GFUA 5L2JB 4Y19E 4WW2A 2OR7A 2XKNA 4L9LB 3EUUA 2DJSA 1S5IL 4WI7A 5AZ2H 4R96B 4MXWH 4LAQL 2H8PB 1OCWL 1CG9B 1I8IB 3JSSA 3VGBA 2E5EA 3QDGE 4R96A 5I17B 3QEUA 4WJ5A 3LDBC 4LNVA 4BFIB 2Z4QA 4JFDD 4MXQC 4RAHA 2GCYA 4M3JA 4MNHA 1I8IA 4YC2B 3X3FL 1FO0A 5C07E 5AG8A 2A1WH 1U95B 2ATKB 3TVMD 5BJTA 4LEXL 5GZNC 4PUBH 3BP7A 1LP9B 3DXAD 3S35H 3BO8B 1CQYA 2V17H 3QDAA 2MCPH 1UH4A 3QSKB 3QEGL 3WS6A 1FCCA 1U95A 2NXZD 4LPYA 4PJEF 5KVGH 1OF2B 3RWGB 2E9JA 1KJ2L 1LP9A 1AGFB 1K2DA 4D9LL 5E8EB 3RVTD 3JTTB 7FABL 5C7XL 5IB2B 1FBIH 2LAAA 3KPTA 1CYGA 4GG8B 4K7PY 4RIRA 5CWSA 1BVKB 1OF2A 3RWGA 2BMKA 1KJ3L 4PJ5E 1F3RB 3BP5B 2DMCA 1WIUA 3QEQE 2WBJB 3JTTA 4FFZL 3FMGH 3V2AR 2IH1B 3W0WE 2DWDB 1IARB 1INQA 3MV8B 5DMKB 2WBJA 3LQMA 3U46A 3RVUD 1Q9LA 2WANA 1XF2A 3FB8B 3H9ZA