1ZVYA

Crystal structure of the vhh d3-l11 in complex with hen egg white lysozyme
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
b'DVQLVESGGGSVQAGGSLRLSCAASGSTDSIEYMTWFRQAPGKAREGVAALYTHTGNTYYTDSVKGRFTISQDKAKNMAYLRMDSVKSEDTAIYTCGATRKYVPVRFALDQSSYDYWGQGTQVTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin heavy chain antibody variable domain
molecule tags Hydrolase/immune system
source organism Camelus dromedarius
publication title Molecular basis for the preferential cleft recognition by dromedary heavy-chain antibodies.
pubmed doi rcsb
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zvyA00
2BVPA 2B1HL 1MCSA 5IROA 2HVKB 4M6NL 5CZKA 3U0PA 2DOCA 3IF1B 2LFGA 1KC5H 1JPSH 3JV4B 4JKKA 4OZFB 3VXMB 3K8LA 3FQTA 3AGVA 2PYFB 1K6QL 1Y6MR 4NRXB 5HVGB 3C8HA 1IM3B 2VDRL 1B2WL 5DJZB 2X7LB 4YHPB 4M93B 4FXLA 4NKIH 3H9SA 3FQWB 5ID0A 4LSTL 4LQFH 1FLRL 3VFSB 3WFDH 5JQ6H 1RZ7H 3CDGB 1MY7A 4M1GL 1FG9C 2RB8A 1NGYA 1F4XL 3U6RB 3G9VA 1CGSH 3ARQA 1NCWL 2R8SL 2LU3A 1IC5L 5LG1A 1YEJL 1JUFA 2CKNA 2YS4A 1CLZH 5EOCJ 2NY1C 3PL6C 1WCBB 4OAWA 5A3ID 4WFGE 2ZUSA 4ONHB 5CJQH 4JO3H 1OM3H 2CDEB 4GKZB 3OF6D 2VZOA 2VQ1A 2HTKD 1NC4A 1XGYL 3KLSA 1XGPA 1SJEA 2YD5A 2HFFB 1DFBL 4FXGB 1HNGA 1P6FA 3ARXA 1NFDB 1JZ5A 5DD5H 5E8DL 2H32H 4UT9H 1ND0A 2WUBL 3L3DA 5DK3A 4I4WA 3K8MA 4HS6A 2Y9RT 3A6OA 4FTVA 5JW5A 1EVTC 2QSVA 4N8CH 1QYGL 1OF2B 4PJFA 1UA6L 3FOLB 1NC4D 4MAYD 3S3SA 2KH2B 1G7MA 1U8QA 4LOUC 2FGZA 5JO5B 3JSSA 4HUXB 5E0QA 1BD2D 2A9MH 1MFCH 4NQXB 5D7KE 4QF1A 4OFPA 1N2RB 1Q94B 5C0AB 4LEOB 5KSBA 2PTVA 1CICC 2DBLH 5FO7B 2YUVA 1A9BA 1ACYL 3ARPA 2FCBA 2PR4L 3ZYZA 5GS1A 2JCCA 3IDXL 4JFFE 1KJ2A 3LH2H 4TUOA 2CXGA 1CICB 1BIIA 2VLRB 4JZJA 3UZVB 4OGZA 1J5OH 1CFNA 3TZVD 3UBXB 3TO4C 3DXAA 5DUPH 2QHLA 5C09E 1O7SA 2YXMA 2F58L 2QHRH 3F7PC 5FM5M 1CDBA 1SYVB 5DD0L 5FYKD 5IB2A 1XGUB 3QCVL 5T1DH 3GJFK 3TBYB 3BIAX 15C8H 4K94C 3SCMB 2X4NB 2BJML 5CSGA 4ZFOB 1S9WB 3F12B 1NMAL 3CXDL 3ARGA 4N0UA 2IFGA 1PY4A 3CFDA 2A6IA 4HV8B 2VXTL 4H88H 1JNLL 4Q74A 2O61B 2BCKB 2JB5H 8CGTA 3CLEL 1T5WB 1KNOA 4MXQC 4FS0A 2OJZH 3OB0H 4Q9BA 3FO1A 4RZCA 3CFKA 3GSUB 4G5ZL 5F97E 1N59A 1HNFA 2A77L 5D1QA 3W9EB 3ZTNL 4PG2A 1SMAA 3O3BA 2R2BA 2FJFA 4HUWB 4FQIH 3JWDH 2O93L 3W5MA 2MJWA 5I30H 5FGBC 1EIBA 3BH8B 4QCIA 2EDNA 1KJ2L 1S7XA 1QLRB 3VD9A 4QOKD 4ETYA 1H3TA 1TETH 5F8QC 3TNMB 4HFUL 2MTPA 4QGYA 1L7IH 3T65A 1T2QH 4CN6A 1FE8H 4BQCA 3M1BB 2EXWD 4G8IA 3L7FA 4YHZL 2GTZA 1X5HA 4U1HA 2BNQA 5B39B 3MRQB 2NXYD 3V7AE 5D93B 3HC0B 5TDOB 4UT7H 4OM0L 1T20B 4NFDA 4X8XA 2GJ6E 4W4NA 2BSRA 3CC5B 2HT4D 3LRSA 3S4SG 4LCWE 4QWWD 3OJVC 1QRNE 1K4CB 4RMSA 3K4ZA 4XNXL 1G9MC 3KS0H 1CDCA 3H9SE 4ZO7A 4BUGA 3D0VB 5IB3A 3PWLA 5EO0A 3QDMB 3C6SB 4ZUWB 1KCLA 2VQ1B 5D1ZD 5J9PA 1EUTA 2NY0D 4JJ5A 4NHCL 3E6HA 4XPTL 5T5FH 4Y2DA 1MELA 3L5HA 4XMLH 5DMKB 4S0SD 2NXZD 4QGTA 5F7FA 1UG9A 1YNTA 4P2OB 4EIZC 2X41A 4ELKA 3CSGA 3W82A 5L2KB 4UBDC 2P49B 2NNAB 5E2VH 4I5BB 1RUQL 1JHLH 1JWMB 4Y1AE 5JHDB 2N7BA 3H9HA 4DUWA 2VL5B 2YMXH 4IOSD 2ICWJ 5IFHH 1U8LA 1U8OB 2E6JA 1OARL 3ZKNC 3SY0A 3X3FH 3MGAA 1NGQL 3WV0A 4Y5VB 1MEXL 3UTQB 1YZZA 1IEHA 3GK8H 3QQ3B 3VDBA 1XR8B 1I9RH 4M6ML 4QRTB 3VFPA 3MRJA 5EG6C 4WJ5A 1NBVH 5F9AC 4WDIB 3TP4A 4AT6A 1CD1A 1D6EA 3MV7B 4DTGH 4UDUB 4UILH 1QFOA 4PJ8C 3HRZB 4S1DC 1MREL 2D4FA 5D1ZA 5ALBL 4WFFD 4WHTA 2BNRD 1DSFH 3B83A 2E9IA 4Y2DD 4AZ8A 3EO0B 4YH6A 4PRHD 3C8KB 3FMGL 4JY6A 2EE3A 3EYOA 4ZPVB 3QDJE 3EYFB 4F9LC 3T09A 3CJJA 1YY9D 2VQUA 1KEGL 4ENED 1HSBB 1M7IA 2ADGA 4PFEA 3OAZK 4Q2ZB 5FOBA 2ZUXA 1S7UA 4PRNB 4FQXA 2D31A 2AJYH 4GLRH 4D8PB 2DKMA 4NQDA 3B8SA 5F7DA 4P9HL 3FO2A 5JDSA 3K4DA 1AGEB 3L3OB 4P3DA 4HF5L 5MP6L 2HT2D 4NKQB 3QB7C 1N6VA 1AGFA 1BZ9B 3H9HB 1D9KD 4NZTH 2VDKL 1XF2A 2YPLE 2YA0A 3DV4B 5LGJA 2MMXA 1OCWH 4O2CB 2EH7H 1UZ8B 4J23A 3N50A 3DX7A 4XRCB 1I1FB 1QO3A 2WIIB 4MAUL 4P2QD 2Z8SA 1ETZB 3VXUE 3TC9A 3NVQA 5INCB 1BECA 5C6TL 3HMXH 3BXNA 4BJLA 4GW4A 2F15A 2IMNA 2J1KA 3ZTJH 5FCUL 3Q6FB 1T04A 1X5IA 3HAEA 3T0EE 3UYRH 35C8H 3A67H 5D8JH 1E4XI 1QA9B 5BXFA 3MGTB 1RZKL 2VDNH 3J7HA 4U6TA 3GB7B 3MOAL 5EBGA 1XF3B 1KFAL 4NHCH 2DQGH 2HJFB 3ULSB 5C07B 3LH2L 5LQBL 5KVDL 3RY6C 4YHYB 3QUKB 5B38G 1I1AC 3KLHC 3RDTB 3RVUD 5GRWA 2WIIA 4M8QA 1D9KB 4O51A 1XF4B 1DQML 4Y2OA 5EOQL 1O0VA 1Z2KA 2R69L 2VL4A 5TE4H 5JLZA 2Q7YA 4U2ZA 2PTTB 4EUPA 2G2RA 3U4BL 2F5AH 3IJHA 2VH5H 1MPAH 1WZKA 5C6WH 1MCDA 3LS4L 3JXAA 4QRPD 1WC7A 3ZE2E 1P1ZB 3WIIH 2NX5D 3VFUB 1RAMA 1YEHH 4KV5F 4QF1B 3MGOB 3P11L 4XTRD 3QUMA 4Q2ZA 3UCRA 1KJ2H 3MUZ1 1KYOJ 5CP3H 4WW2A 2ZUQC 1A6ZB 2ADJB 1TVBB 4PJIB 4X9GA 2GK0B 4XP4L 2E7LA 5TH2B 3NA4A 3PWPE 1CU4H 1CGSL 4HFUH 4P9HH 3VI4E 3T0ED 2XA8L 3U0WH 4LSUL 2XZCH 3HPJB 1XCTA 4WFHE 5JPMA 5LGHH 3VXSA 1O7VA 1S9XB 2VLJE 1WWAX 2AJYL 2CR6A 1W8NA 4RIRB 2PTUA 4Z7WF 2X70B 1IKNA 1NFIB 5BCAA 4U1SB 1X6NA 2GFBA 5I8KH 5BQ7B 4LPCA 3S96A 1KLUA 2FBOJ 2CDFA 3U1SH 5C0CE 3VRLF 1MFDH 4C4KT 4L4VE 1KCUL 2GQHA 2KQMA 5B8CA 4LVNC 4Y88A 4DN4L 4RGOL 3SE4C 4KVNH 2K9UA 1P7KA 4LLWB 4OZIB 1NMAH 5BRZE 5F71A 4LSDA 4LFHD 4L29A 1JGUH 4A6YL 3O2VH 4MA1B 1G0DA 3QBTB 2IADB 3H8NA 1I9RL 2C9AA 4KVCL 3IXAA 1S7TB 5H94B 2VLKB 4HHAB 5BV7B 1G7LB 3QUZA 4RMQA 4FFWC 2FEDC 3OGCA 1NLDH 2VLLA 5IBTL 2I25N 5I8OL 2YMXL 1AO7E 2V9QA 4IRSB 1EJOL 4LNVA 4YZFF 3D0LA 4PD4J 4M3KB 3BISA 4I9WE 2X9YA 2HTKC 4OGAD 5GISH 1S78D 4OBSA 1IAMA 4OTXH 4YUEH 1WFNA 5D70L 1JZ6A 3SJVB 5TDOA 4WENB 1VKXB 5C0ND 1LGVA 2ZZUT 3MLVL 3GI9L 1IAIM 1G7HA 2GCYB 4KY1L 4X5XA 3U6RA 3AC0A 3L3JA 4GRWF 2E6QA 4RFOH 5DK0A 3S96B 3U0TA 5IKCA 4U1MB 3T77B 1VB9A 3TO2B 4NQEE 3PG2A 5D6DC 3S35H 4Y89A 2YKLH 3RUGE 1S9YB 3L5XL 4XWOC 3QUZB 3TPKA 5GIRA 5KG9B 1KBGL 3UP1A 1EEQA 2LE9A 3SO3B 4YBQC 1WEJH 3ZT7A 4GAYB 3TIDB 3VDCA 5DLML 5T3ZL 2CDGB 1MHHA 3GJFA 3SO3C 4GAGL 4NKMA 4GW1B 2APWA 1TPXB 5JW3H 3ULVC 4QRRD 3F8UB 1T1ZB 1KNOB 3BP6B 2EDEA 4PJ7B 2HVJB 4LSTH 3WSQL 4I2XE 5M95B 1HHHB 4OCRL 1NMBH 3P9MA 3UAJD 1RZJL 1INEL 3RDTD 2QTEA 2EYRA 4GG6B 1JPSL 3L3IA 4LEXH 2IPTL 1LP9B 1CLYL 5BO1H 3BP4A 3BPLC 4WO4A 4WEUD 5IQ9A 1N5YL 2XFXA 2VH5L 4LCWA 3D39B 5B3JF 4RWYL 3HE6D 3BW9B 5I8EA 1P4BL 4MB4A 4NSKB 3H9SB 4JFDB 1GL4B 3CX5J 1T7ZA 5JORA 1U8IB 3UJJH 4R8WH 1FG2B 3C6LD 2ED7A 1LE5B 2GUOA 1HHIA 5IUSA 3LKQA 4WI3A 2CRIA 4LLVA 5E24E 5DR5H 4FFVD 5I1GL 4G7VH 3FQRA 4EZMA 2XPGB 4X5WB 1IAII 3OAZH 4D8PA 3WL9B 1QD0A 2VABB 2Y06H 3SDAC 4EIGB 5MERB 4APQC 1DBKH 4PGCB 4NUGH 1X4XA 1NCTA 3MV8D 1RZGB 4YDJA 1KCSH 1UVQA 4OLUH 3V5HA 4WW2F 3B5TA 4I0PB 1OVZA 4OB5H 3KLAB 5ICYB 3WD5L 2ADIA 5IV2A 2RFXB 2BSSA 4JY5H 4RGMB 5HHVL 2XKSA 2EDRA 1FZJB 3C6LA 4KPHL 5DYOB 4ZUUB 3V6OE 1CG9B 2AK1L 2W0KA 5BS0E 2XA8H 3S88H 4NJAL 2FIKB 5D6DA 4Y5VA 4UDTA 2XQYK 2AJXH 1G7JA 3VD3A 1I3RB 3SKJL 2V7NA 3D2UA 3R0MA 4GMTL 5HGBA 4JHWH 3D1MC 5TGBB 1N5YH 5HI4C 3MGTA 3PP4L 4Z8FH 1RUPH 3V0WL 4PJ5E 1KB9K 4H0IA 5IMKA 1Y0LA 1IM9A 5IQ7H 1OWWA 5E70A 2HAZA 4IDJL 4M00A 1JPTH 2F8VA 1KUMA 1T6WA 3L3KA 5GGSB 3RGVA 2W9EH 1RHHA 2AJVH 3RVVD 3GBNH 5IK3B 4G6KH 2XKNB 1MH5A 3AB0B 3U4EA 1MIML 1ZA3A 2VAAA 3DX8A 4BZ1L 5KVEH 3K4AA 1U3HC 4LRNL 1GSMA 1T66C 3RAJH 1FORL 1CFSB 1S7RA 1FL3B 3IRPX 3C6SA 1G84A 1T1WB 4LSUH 1ZV5A 3SKOA 5E6ZA 2QJDA 3ARBB 2VSDA 3SGDH 3P4NA 4HGWA 1MJJA 1ZHNB 5ESVB 3Q48A 3PQYA 4K3HA 5CFHA 3C60C 4ZQKB 5CBEA 3O6KL 2BSTB 2VC2H 2HG5A 1VERA 2IG2H 3S35L 3FHAA 1XR8A 3K0WA 3HC0A 4OUUB 4GG8A 4JZOA 1T03L 3QEQA 4KJPD 2XTJD 4XNMB 5E8PA 2R29L 3H6JA 5FYJE 4XXCC 2Q6WB 5B8CC 4JM4L 2R56L 1MLBA 3WDHA 4M6NH 3CFEB 3KVQA 1SBBA 4MJIB 2PW1A 2EYRB 3ALPA 3ME0A 2DICA 2NY1D 3PL6D 4OTXL 4R96A 2YHGA 1N7MH 2LU4A 5D2NA 1P4LA 2F5BL 1I7ZA 5SWSA 1IKNC 4Q0XL 1FPTH 2ZNWA 3P0VL 3SE8L 5BW7C 3RJQB 3P9LB 1QFWI 2VDPH 3C9NB 5E2UH 1GC1L 4J3TA 4XPTH 5T5FL 4ZUTB 2X70A 5ELIA 4WFED 4MJ6B 4AJ0A 3NH7L 3FO1B 2EIBA 5DRXA 2D4DA 5LXGL 3D48R 4ZAKB 1R24B 4PY8J 3HZKA 1NAML 4DAGL 1MCQA 3EYQC 4WW2C 2I9TB 1UYWL 3HCVA 4WTZA 4OFYA 4KXZI 4JZNA 4PJIA 1BWWA 1QKZH 4E41E 1NL0L 3RVVC 4K3DL 3DARA 3FN3A 4C56B 1N26A 2F8XC 3QDHA 4L8SB 4KRPD 4RAUB 1H3XA 3F7VB 4IRJD 1R3JA 2ZCHL 1P4IL 2CRYA 3EHBC 4JG1H 4M9OA 4XCFL 4LDLB 3T1WA 2EYTB 1A6TB 4OLZH 2HH0H 1DZBA 2GSIB 3NFSH 3I6GA 4WUUA 4X4YA 5I1HH 4DN3H 2DQCL 5DRZB 4OZHB 4PRIA 1CICD 5C09A 1EFXD 4Y5XC 1XIWA 2AXJA 2ZCKH 1HEZA 4X99B 3RY6A 5GRUL 2FO4B 5SWZD 4E0RA 1CVSC 1JN6A 3MRNA 3JVGC 4HC1L 2GK0A 4HWEL 4NKOB 1T0NA 1RVFL 1CZ8H 2JTDA 3WFBH 4HV8A 1TPXC 2NW2B 4BH8B 4X7SH 2JLLA 2BOBA 4XNUH 5D1XC 4N0RA 1CGTA 4HPOH 3FB7B 3RWCA 3V7MA 3QIWB 1PKOA 4J8RB 5BOZG 2X4TB 1YNKH 5CZVL 1PW3A 5EPMB 2E3VA 3WN5C 5E94A 1IZJA 4MJ5A 2YBRB 4ESKA 4LHUB 3VGHA 3OF6A 3REWB 5CLTA 1WIOA 3IDMA 2FL5B 2ZWLT 2VNCA 1ROWA 3C6LB 3H42H 4UB0L 4ZTPL 2CQVA 3G6AB 2V7HA 5F7YC 2FD6L 1OTTC 2NW3B 1YN6A 2J5LC 4IRSD 5EOTA 1KJ2B 3CUPA 1CYGA 2VZ1A 4N68A 1NBQA 1A4JB 5L6YH 4P46C 1FV1B 5TDPB 1BQUA 2Z35B 3U30C 3ECBB 3G5VB 2Q8AL 2OTUA 1OAKH 4OCSH 5L2JA 2EDKA 3WHE0 1V7ML 2EEAA 5MEQA 1XR9B 3ULUE 2DIAA 4N8PA 2PETA 4GLRI 1A0QH 3P0YL 5J3HC 1F5WA 3EOBB 5I6XC 1QPPA 4ACPA 3GI8H 2X4NA 1OLLA 4K7PY 5LCVL 4FTVB 5JW5B 1UH2A 3KPNB 2H1PH 2VZ3A 3H3KA 2PYFA 3VFNA 1BVKB 2NX5A 3THML 4QRUA 4QXGL 3NIFE 4ZSOA 1S5IL 1AE6L 1OHQA 3MODH 1U92B 2FJGA 4POZC 5DJ0A 4LEXL 4OD3H 3ARGD 2DQIH 1MFEH 3QXTA 3P4LA 2OTPA 5C0FA 2V6HA 3IT8D 2MCG1 1MWAH 3MLYL 2JCCB 1S7SB 2YUXA 3MYJA 1KIUA 1I9IL 3TH2T 3MTRA 3LCYA 4KK9D 4HQQL 5D1QD 1MLBB 5J7CC 5F1NB 3ROLB 5JW4R 3GSXB 3CK0L 3LDBC 4GS7C 5C71A 4H8WC 3BDXA 2BVYA 1MQKL 1OTUD 4QRTA 4XAWH 5I1IL 3WKMH 5ABDE 3HZYA 4YE4L 5F9DC 1PSKL 4M7LL 3VFGL 2O5YH 3HE7C 3O4LD 1U93A 2ZJSH 3UTQA 1I3VA 4M6OH 5DD1H 4U6XA 1GH7A 1NCUA 3VD4A 2NXZB 3RVTC 4RFNC 3OKNA 1RU9L 1HILB 3FRUA 1WBYA 4NKMB 4BKLB 5J12B 4YDLB 4NRZB 1MHEA 4K8RD 2IQAB 3SGJA 4WU7B 4OIIH 1MHEB 4Y2DC 5ANME 5IEHB 4IRSC 5ITFB 5J12C 2XZQL 4ODUB 2NYYD 4OF8A 1MJ8L 1OAQL 1JHKH 3D6GA 3TGXA 2NY5L 2BMKA 2EE9A 4U1NB 4YGVA 4CAGA 4MJID 4R4NC 1I7RA 4K3GA 3STLA 4U3HA 3QDMA 8FABA 5D7SH 2YK1H 3ARBD 4KMLB 1U8PA 3OTTA 1YN7B 4HKZB 3GKWH 5E8OB 1FVEB 1FYTD 1KTDB 5F89B 1BM3L 4YDIL 3QEHB 4YDKL 5DR5L 2J7LA 1Q9OA 4EXKA 3VXUA 1KIQB 3ZKQD 1FO0B 1NKOA 3OR6B 5IFJB 2DTSA 2HT2C 3CVHA 2HLAB 5IB4B 1I8IA 3FQXA 3NCJH 4POZD 5JXAH 3VI3F 1X5JA 2HFGH 2QQLL 4YBHA 4ZNEE 1KSRA 4X6CA 4HH8A 3MREA 4XVUD 2QQKH 5JW4M 5KS9A 5FHBH 3HHRB 4O02L 1A3RH 2AABH 4EBQL 3WDIA 1DDHA 1TENA 3C5JA 3IJSB 3MSPA 3BAEH 4UOW1 4JFFA 4X8JB 2J8UB 3BEWB 4XVJL 3GSWA 4LSVL 1MNUL 3WFCH 1RIVH 5D1QC 1RUKH 3DNKA 5KVGL 1UVQB 3D0VA 5IB3B 5D7IF 1AD9A 5EU6D 5HY9B 5L88H 1OB1B 2OP4L 4L1DA 4B5EA 4OGXH 5BZDB 4J6RH 2I60L 3WNPA 4MNGA 4FXKA 1FLTX 3UYPA 3VG0H 1HQ4B 5GPRA 1F4XH 4A6YA 4N8VB 2UZIL 1YEKL 2JIXB 3BPLB 4XWOD 1D6VL 4AQOA 5GGVH 4JVUA 3F5WB 1NFDF 2HFTA 3RWJB 4Q97A 5BV7C 3GUTB 2YOCA 2IQ9L 5JHDA 2I07A 5CHNA 5D7IA 2Y72A 1JNJA 2COQA 4LHUA 5E2TL 3L5IA 4O5LH 4YAQA 2NQCA 4NQDD 4LSVH 3HNSL 2ZG2A 2W60B 2ED9A 1FORH 1EAJA 3EGSA 2Q8BH 1DEEB 3MLVH 4R7NA 4KAQH 2V5MA 3MNZA 4AIOA 3BH9A 5D70H 3G04B 3FO0H 4UUJA 3CX2A 1MQ8A 4ZUWA 3VFWA 4MAYB 4QHNA 4ZXBD 4BFEA 3V5KA 4KY1H 3AVEA 4MS8C 4P4KC 5I74C 3QXVA 4D94A 1EA9C 3TWCH 3MR9A 4GQPH 4BSWA 4DGYH 5AYQA 4LLUA 5E8EA 2AABL 2FZ3A 4YZFE 4FN0A 2VWEC 2WBJB 3MRBB 4JAMA 2EYSA 5HHOD 3IGAA 3OKOA 1WWBX 2ITDB 1RZIA 4R7DB 4ZO9A 4H0HB 4M7JH 2HMID 4OZGE 4MD4B 4JDVA 3F65A 2GTZB 4X80H 5I0DA 4NKOA 2IH1B 5ETUA 1B3JA 3I6GB 5J13C 4DOHB 3FONA 3RPKA 3EOAB 4PR5A 3ULUH 2YWYA 4RMWA 4PBVC 2IANB 2R1YB 4NO5B 3O6FB 4Z76B 1NGWB 1MRDL 4PTUB 1PVHA 5DUPL 2NCMA 1DBML 5EZIL 4CJ0A 3ULVE 1TNMA 2FX8L 5FM8A 3VXRE 3VXME 2FX9L 3EZJB 3RUGF 1H5BA 3RVWD 4EEEA 2RIKA 4KUCD 5DDHA 5C6TH 5I8KL 3TA3D 1BVLB 2X5PA 1T5XB 1T21A 4AEEA 2XWBA 2D7PA 2A83A 1LP9F 4KTDL 1Z5LA 3UJJL 2MHAB 3VW3L 4M6AA 1MFDL 5D7LB 1A6PA 4YHKL 5FF6A 1P4BH 4FXKB 2Q3ZA 4X6CE 9CGTA 3PGFL 1T04B 3HAEB 3VGAC 2Y25A 3CFDB 4TRPL 5BRZA 5T1MB 4RIRA 4Q9QL 4HS6B 2NZ9C 2BMKB 4IOFD 3GJEB 5TQ0L 1FZOA 4DW2L 3IAQA 4G8EB 3UTOA 2DQHL 1R24A 5ITBH 1YEKH 3VD7A 1Z6JT 2JK5A 4S1DD 4X0KA 4MHHG 1NQBA 5D7LD 4G43B 1DP0A 4NQEA 1HIMH 2JB6A 4JO3L 3SBWC 3F7QA 1WWWX 4QEGA 4ODVL 3BKYL 1KN2L 1SY6H 3O4LE 3CLFL 3GMMB 5IW3A 1D6VH 5DK0B 2HLFC 2ZPKL 5E08L 1Y18B 3VXRB 1A7RH 1I7ZB 3NTCL 2IC2A 3HZVA 4UAOB 2ZOLB 3DUUB 1UCTA 4XPGL 5GSRB 3OHXA 3UX9B 1FJ1A 2NY4B 1PZ5B 4WW1B 5E5UB 1Q9KA 4ZUVB 1CR9H 1OSPH 2J88L 4N90D 2WQ8A 12E8H 5EWIL 1ZK9A 1CDIA 1K2DA 3UTTD 4YHKH 3GI8L 1J1XH 1ORQB 3KYKL 2VO5A 1U95B 4DKFL 5IW1A 1NCCL 3FZUC 2HG5B 4GBXC 3ZSSA 2GT9B 2YPLA 5EU4B 1CGUA 4HKXB 1NEUA 1TVBA 4Z5RA 2EDLA 4WUKH 3SQOH 1HXYB 1D6EB 3CXHJ 4HFWB 1M05A 5L6YL 1I9JH 3SDYH 1PYWB 3QXUA 4N9GA 3T0DA 3SOBL 1OP3H 3OAUL 5FUZL 3RKDC 3G6JF 3S3JA 2FD6H 5CIPH 5HHQA 1AHWB 4ZFOL 2P7TB 3DSNA 3DX8B 1ERNA 1WF5A 3S35X 3GGWA 4Y19E 1U8LB 4HPOL 3DBXB 3EYUL 1MHCB 2VDQH 3HE7D 1NGYB 2EEBA 2YPVH 4QYOA 4JFXA 1KLUB 3NFPA 3EZ8A 2BY1A 5KVDH 1LE9A 1TZIA 4ERSH 5TDPA 4LBEB 2DKUA 1P6AB 2BVUA 2R0WL 2EZ0D 3KPSE 2C1OB 3IAGC 2RJMA 3LN4A 3VXPA 1WK0A 4P59L 1JZ7A 3PWUB 4M43L 1PG7W 3BUYA 1NCDL 4HWNA 4M9PA 4ZOAA 2C3VA 1U58A 2KDGA 2HT3D 5IT2L 1MWAA 1PSKH 4DKEH 4I77H 2R0LL 2WAHA 5FYJU 3GFUA 3B9VA 3MLRL 1G9ML 4UOJA 4YQXH 2CLRB 3DGGA 2VSCA 4N0YH 2V5SA 4AM0B 2BXYA 3L3OA 4LCCC 2ID5A 1AKJB 2P48B 4PJHF 4JRXE 4XMPH 4FQXB 4O9HL 1YNLH 2K7PA 1F42A 4KUZL 4ZUSA 1QQDA 3VWKA 4PJ9C 2Z0BA 4J3WA 1G6RL 2GY7B 3U36B 2G2RB 3AS3A 3OV6A 1B90A 1T0MA 5C0JB 1CF8H 4KU1A 4QXGH 5C2BL 4XH2B 2YA1A 3LD8C 4LMQE 2VXTH 3W0WE 1A6VL 1QUNA 4WO4D 1JK8A 4R97B 5TDNA 3U30B 4M02A 3CU7A 4NO2B 1HHGA 4YHOL 3UPRA 1S7QB 4LGRB 3DURB 3OZ9L 4ZAKD 3GHBL 4JHAL 3CFKB 3VWKC 3NH7H 1MNUH 4N1CA 3WFCL 5T3XE 4RQQA 5EUOE 1J8HD 4MQTB 1T1ZA 2VXUL 3BP6A 3X3GL 1SVCP 2OI9C 1OP5H 5CBAA 3B2UD 4NBZB 4M62L 4HJ0D 3DGGB 2Y07L 5DI8B 1JMXA 3IETA 2Z8WC 4ELMB 1A7BA 1CXHA 1FGVL 4P2CG 4F3FB 3PWVA 2L4OA 2OTUB 3D18A 5FA4B 3U7AA 2EEDA 1MIEL 1HHHA 4Y4FD 4BFIB 3ULUC 3QEUB 3DV6A 1KOAA 1F4YH 4CVUA 1A4KB 1A3LL 3RL1A 2Q7NA 3PWLB 1T83A 3H2WA 3B6SB 5D8JL 2HKHL 2VXQL 4JZJB 4ZFGH 5JOPD 1BIIB 2VLRA 1W72A 1WT5C 4X5XB 1ONQA 4JGUA 1QFHA 2ED8A 2F9BT 3CVHL 4LQ1A 3OHXB 5KVEL 5CILL 3NGBB 5BVJB 1G6RH 5EPMA 2MPAH 1M4KA 1J8HA 1NKRA 3DRTA 5F7NC 3LB6C 3QQNA 2PNDA 3TZVC 4HKJB 1RK1B 2WP3T 4LLMA 1RK1A 2DQFA 3GRWL 3VGFA 5CEYB 3QUYA 3DVGA 3PABB 3BP5B 4WEBH 2P42B 3SDXE 1DANT 2J8UE 4Y4HB 4WUUD 3V6ZA 5C1MB 5EC1A 1WT5A 1P53A 4XMKH 1NJ9B 4UQ3A 3IFPA 5JHDE 5L0QC 1T83C 3QWQB 1DL7L 3RX5A 2YN5A 1PQZB 3QZWA 1N6QL 3FQUB 2A9NL 4GBXA 3F7YA 4N5ED 4QTIH 2Q76A 2B2XH 3F7YB 4P46B 2KBGA 2LVEA 3L3HA 5HHVH 2CDEA 4GKZA 3QQ4A 1CFSA 4JQIL 2GTWB 4KUZH 2XN9A 3IKCB 4DGVL 3OKEA 4G8GA 1NGPL 1TQBC 3F7VA 1CFTB 4NQVB 4EI6B 1I8LA 2JB5L 4G6AD 4G8IB 3BPNB 3RWFB 4N0UB 2VIRB 1TNNA 3QO1A 1KACB 3ZTNH 2J3SA 3KDMA 5SX4I 1J0IA 4G5ZH 4JPIA 5HYJD 4WV1B 5IBLD 2DDQH 3NCFB 5BVJA 4X7EC 5D2LE 2XWTB 4KZEH 5DJCB 5AG9A 5HBBA 1HQRA 5I1DA 5EBMB 3RTQA 1QR4A 1NL0H 1E4WL 4X6DE 2QHRL 4HUWA 4TUJA 1RULL 4W4OC 3VMOA 4GO6B 5T3ZE 4PJXE 4G9FE 3UO1L 4WW2B 3UJTL 2V17H 4UU9A 4C56E 4QOKB 2UYLB 3NIFF 1Z5LB 3WS6A 4M3JA 5I0ZA 4I0PA 1S5HA 1U6AH 3KPQA 1NCBH 4PJAB 4XTRC 2BERA 3FT3B 5K9JH 4PJDE 4GRLA 4PUBH 4ZTPH 1JV5B 3QDGA 5AZ2H 1KIPA 1MCRA 2VKXA 5F7KC 4TQEH 1U36A 5FHAL 1JGLH 3MBEA 1IFHH 1J87A 5EUKB 2YR3A 3HUJB 4MD5A 1ES0B 4LLYA 1H5BC 1XH3B 4AEHH 4D2NA 5E8PB 1MVFA 4X5WA 2PF6A 3C5JB 1ZGLB 2ERJB 1CLZL 3D3VD 4LPVA 3BGMA 4YAQB 1KELL 2HRLA 4NP4H 1QFPA 2V2TB 2F54D 4ONHA 4LDEB 1UB5A 4PBWD 5KSAA 2O26U 5D72H 3W9EA 3F5WA 1URLA 2VLMD 1I7UB 1UCBL 2FNBA 4HSQA 3MRPB 1VPOH 3O2WH 3O4LA 1OGTA 5DQJA 5DURB 5DTFA 3U4EB 4EKXA 2BHZA 2WUCL 3KR3H 3MACH 4NQSA 3PWVB 5L2KE 1OD9A 1EXUB 1TZHA 3MJ7A 1A1MB 2BOCA 3GB7A 2WBJD 3ZE0E 5T3ZD 1P5VA 1QSFB 3DMMB 4GSDH 1ZANH 3HS0B 3D2UB 1KULA 3H9SD 5FHAH 3JV4A 4OZFA 1I1YB 3SE3C 4PGJA 3P3YA 2XPGA 4LARL 1OT1A 3QQ9D 2FHCA 2JJVA 4DW2H 4YX2H 5CSZA 2DQUH 2X09A 5J1SC 3IYLW 4E5XA 4O2FA 2FECL 4HKBA 1PJ9A 3BP7A 3FQNB 2OTWA 2WWMD 4I9WD 4TPRL 1NAMH 2HA1A 1CBVH 4YWGH 3NCJL 5JW4Q 5JXAL 4WHDA 3HI1A 3QIBB 5GGQL 3DI2B 4X6FA 5CIPA 3RP1A 1JNLH 3ZHDA 5F70A 3NFPB 5BMFL 3IJYB 1CVRA 2ESVB 5DJDB 3BWAB 4V1DA 3R8BB 2E7BA 4NBYB 2UWEF 4EDXA 3BFOA 4L1HA 3UTTA 5E4IA 1R3LB 4HUMB 4WHTB 2BVTA 1RUAH 5F9WB 3SHSA 4G9FA 1QHOA 1JWSB 2CO6B 2BNUB 1JYXA 3RZCB 3STZB 4CW1A 2ENYA 4XC1H 4EDWH 1YJDH 4X7TB 4OZIF 5FV2A 1U42A 5HHXL 4HUKB 2X89A 1PLGH 3B5HA 3SY0B 1EO8H 3UEZA 3S36L 3ILQC 3RGVB 1GOFA 4K8RC 4CN4A 3RUGA 3TCXA 2ESVA 4RCAA 5ACMA 3KLHD 3MRRA 3ECBA 4HZAA 3VXSD 2NXZC 4I5BA 1JVKA 3RWGA 3O4OB 3MRRB 5D7LA 5DEFB 2VIRA 2HKFH 3MC0A 3QUMH 4WHCA 4G7YH 5C0IB 1FFQA 3SDDD 2LVCA 2R2HA 2GYSA 1CE6A 1Q1JL 5T3XH 4LHQB 1P84J 2H26A 1CIDA 1W2KT 3OJDB 1FZKA 5DEZA 1AR1C 1LHZA 4MGXA 4LVEA 5I1LB 1IT9L 4R4BB 5A1AA 3P73B 2JB6B 1PY9A 5FO8A 3KPMA 1IKFL 4PRID 4F33A 4X0KB 3IF1A 1J05A 3ULVL 3AREB 4WWKC 4R2GC 5IMLA 3T2NH 4XCYB 5GIRB 5KG9A 2NX5B 1BVKA 4WI4A 3VRIB 4OD2A 2FLBT 3LHPL 3OAYK 4OCWH 4OQTA 1BLNA 4KROC 3TJHD 3NMEA 3B9KB 1H3WM 1S9VA 1OAYL 5I16A 4RFOL 3W81A 4QLRA 1SJHB 1IGYA 5BS0A 3RBGA 4PG9B 5AYUL 5T1KB 3RY5A 3MGOA 5DJYB 4P9ML 1SJXA 5K9JL 5I15L 5CIPB 4TTDD 3KGRA 1D5XB 5ENWA 2APBA 2E8YA 4LHJB 1QBML 1WC7B 1E4WH 5IEKB 3H7LA 5TF0A 2ZUVA 1XAUA 3DROA 3G5ZB 4WI7A 3L7FB 5HYSA 2F74A 2OMNA 5FDWB 2XY1A 1R3KA 3CFCL 1NCBL 5ALCH 5J8OA 4Y4KA 1DEEA 1R3JB 3OGCB 1LEIB 1MCPH 2EKSA 1S9XA 2AJZB 4MCYA 5MEPB 3U7YL 5CEZH 5ADPH 3D25A 3SGDI 2CUMA 1WLHA 3WEXB 1MI5E 1S7TA 4K7PX 4PP2A 5H94A 3IXAB 2NTSP 3F62A 3SGEI 1VADA 1CLOL 3IETB 2HJFA 1JWUB 1B4RA 3QCTH 4G6FB 2GAZA 5E8EB 1T0PB 2BDNL 2ZJSL 2W0PA 4K8RL 3LOWA 1KCUH 4BZ2L 2XZCL 4HIHA 3SKNA 3LN5A 4ODTH 1R5VA 2FRGP 4XAWL 3UJIL 5I1IH 4ZPTB 3CUPB 4NQTA 3SKMB 4TOYH 1MSPA 5GRUH 3E3QE 3VFUA 5C09B 2CKBB 4P46A 4NO2A 3N1MC 3F58L 1UXWA 3LZFH 3Q1SH 4JN1L 4R2GD 3D69B 4N1EA 2ARJA 3LVEA 1ZS8A 3HB3C 1MCNA 3QEQE 3QXWA 3WO4C 2I27N 3VFTB 3PABA 3JBG7 5D5MF 3BQUC 5FO9B 5J6GA 2OSLA 1XGQB 2B2XL 2XIDA 1C7SA 4LSSL 3G08B 1QSZA 4E9LA 4F7TB 1A6ZA 1JRHH 4QHKI 4KHXH 4LRIA 1YY8A 4LGSB 1VKXA 3WJLC 4NQDB 5D1XA 3W2DL 1CU4L 1VGEL 2VZSA 4ONGL 4PLJC 4CNIA 2AJUL 3RBSA 4OGXL 1F2QA 1LEGB 1PG7L 5EIVA 1ED3A 2CLZB 4PRDA 5BXFB 2DIJA 1M7XA 5SWQA 2Q76B 2NZ9D 2WNGA 5HVHC 3G6JE 4MZ3A 4P48A 2H8PB 3OXSB 5E6IA 1XIWC 1MEXH 2A73B 2JIXD 2ZNXA 5HGHA 1NEZA 3STLB 1EGJH 3VH8G 5AWNH 3CFJB 3EYOB 2A2QT 3ARED 2BVEA 5E5RB 1F4WH 5EOCL 3T4AA 2V2XA 5JDJA 3V52H 3OKMB 1A3RL 4LIQH 5HVFB 3G5YB 2LTQB 4UDUA 2W60A 2HP4A 1JPFB 2GW5A 1G7IA 1JGLL 4UINH 2IQAA 4WV1A 5GRJL 2EC9T 2FX7L 2YD6A 3EJYD 1BZ7B 4PREB 4Y1AA 3HE7A 2Z31D 2FYYB 4NNPH 1HKLH 3CH1A 5D2LA 1V7MH 2NY3D 2AJUH 4JRWA 1VSCA 3AUVA 1I1AB 3PIQA 4ZFFA 4FQ2H 4X6DA 5FYKL 5CEZD 3FFCB 1DQQB 1DE4B 2Y07H 2F19L 8FABB 3BHBA 1A6AB 2NPLX 2B1AH 5F96H 2D2OA 4XP9H 4XZUB 4RGOH 2A74B 5I18L 1OAZL 3R8QA 3PF2A 2GSGB 3QDJB 4NNXA 2A1WH 1U8MA 4S2SB 2GSGA 3QDJA 2QEJA 5BW7A 3U36A 4JJHA 4NRZA 3V79C 2PW1B 3LB6D 3LQZB 2IBGA 2R4SL 5D2NC 4UTAL 3MLTB 2VISA 1T4KB 2FEEI 1A6VH 3GHEH 1Q9KB 1XGTA 1LEGA 1V05A 2XACC 4ZODA 3EYVB 4DZ8A 2ZSVA 4WUUE 1Z0MA 3RL2A 1EMTH 2FR4B 1UB6B 4ZFFB 1AO7D 3FQRB 4KC3B 4Z8FL 3HZYB 4XXCA 4HCRH 5FGCE 5HHOE 4PJBF 4PGBB 5HGBB 5TDNB 5JOFB 3L7EB 5ALBH 1AFVL 3E2HB 1N0XH 3VXUB 2FYYA 3QEHA 1HWHB 3G5VA 2CK2A 3S7GA 2D7OA 3WBDA 2DLTA 2BC4B 1FV1A 1NPUA 4XMPL 1MUJB 4QT5B 3C60A 3GSNA 1JPFA 1J0KA 5T1DL 4ZPVA 1KJ3L 3EYUH 3WKNA 5E95B 4YPJA 5I1CH 4JM2B 3DXAE 2VAAB 4AH2A 4XP9L 4XNYL 2O5ZL 5F1IB 5DGRA 2J6EH 4OKVB 1H15A 4JM2C 1OGAE 5ISZD 3O8XD 4NDMA 3WJJC 3DBXA 5ADPL 4TVPD 1T66D 3VFNB 5FYKE 2R9HD 3LQAC 1MCPL 3LN5B 5F1SA 3PGCA 4PLKD 3S34L 4Z7OF 4FP8L 5TQ2L 1QSFE 3CMOL 4MA1C 3QUXC 2BZDA 1FNAA 2Z91B 2P5WB 3JVGA 1NAKH 1JHLL 2IMMA 5CGMA 4MB3A 2BOBB 2FX7H 5KSAB 4ZYKB 3C2SA 4M5YH 4ODXA 2DLIA 4FQXD 1D3CA 4Y5XA 5E00A 5IFAH 2DYPD 4Y5VC 5HI3C 3QRFM 1KFAH 3ZYIA 4Z7QE 1JZ4A 1CR9L 1BGXL 1XZ0A 2VC2L 1F3JB 4BSVA 2FO1A 1L6XA 3MCG1 1FCGA 3NN8B 4FFZL 3C8DA 2IANA 2V2XB 5MEND 5DUBB 5DUMH 1UB5B 5TF1H 5BV7H 3BOVA 1NDMB 2BNQD 3HG1E 2XTJE 4PB9L 2J88H 1TQBB 4QXTA 2VXSL 4TVPH 3KYNB 2WK2A 4GJTB 1PKQA 4PGCA 2EXYC 4MVBD 5E99L 5GZOD 1INEH 3ZMRA 2A6JB 2B8OT 4TULL 4JRYD 1IKFH 3CPLB 4YFLF 1ZTXL 1A3QA 5D1XB 3T1FA 3RVXC 4APQA 3GMRB 5DC4B 2ZPKH 1JRHL 5E08H 3SDAA 4YHOH 4RGNB 1MJUH 4LSSH 5TPWL 1NDGB 1OSPL 1HI6A 1ZHLB 2D0GA 2FDBP 1BD2B 5J11B 2PXYD 3HCVB 3F58H 3MV11 4J3UA 1PDKA 4CDHA 3PWPA 5J0BA 3MFFB 5IHUL 5ESAA 3W2DH 1OTSD 1SBSL 3MNZB 5EBLA 1KTLB 5I1EH 1OSZB 4JFDA 2OMBA 3LEVL 2P45B 1XGRA 3MXWH 5IMOA 3IU3B 4OIBA 3BW9A 4EUPH 2P8LB 1QLFB 4LP4A 4MJIE 2P1YA 4LBEA 3EO9L 4PRPB 3HNVH 4NCC1 4WFFE 3LPFA 4MXVF 4FRWA 3P9LA 1FZKB 1PLGL 3SE9H 2IALA 4JRYB 3AXLA 4NHUA 3SCMC 3RTQB 3L5WB 2X4RA 5ISZE 4J3SA 2R2HB 3B9KD 2PKDA 3N9GH 3O6LL 1PFCA 4K3DH 1OAZH 5EU3B 1KCSL 3B9AA 5KN5A 1U8HA 2WINA 3DVNB 4NUGL 5KSBF 4UIKL 2O61A 5IHZB 2UVEA 3RWCB 3V0AC 4L8BA 4Z0BH 2CUHA 1QBLH 4HIIA 1OB1A 3RRQA 2I9TA 2NW2A 3TBVA 3TN0A 3AMLA 3B9KA 5ACLA 3BRGC 3MV8E 4DVBB 5DMKA 4PJDF 4WNQA 2YPLD 5EU6B 4P46D 1VFUA 1YPZA 3KLDA 5DMJB 5EU6A 3GMOB 1JWSA 2VLKA 1YMHA 1FFNA 2IJ0C 2I5YH 2NY2C 5D96B 1PZUB 4L8DB 4WI2A 2Y6SC 1P5UA 3MREB 1R3LA 1WAAA 2AXGB 1LNUB 3RGVC 5CZXC 4GSDL 1X5YA 5FXCH 1I3GH 3HRPA 5F8RC 2XZQH 1EBPA 5EU3A 1JL8A 3S37X 4ZD3H 3KYNA 4U1HB 4UAOC 1P2CA 1W72B 4R90L 4FFWD 4FQHA 3AXLB 4LMQI 4NHUB 4WHYH 3ZZ1A 2ADFL 2FHBA 3BDYL 3QI9B 4G7VL 4OCRH 1PBYA 1QBMH 1T03H 3UTSD 3MA7A 1OM3L 4JZNB 4ZS7L 1HZHH 4P2QA 2Y1VA 2CK0L 3KXFB 2ICWB 4DWHA 4KK9C 1HH6B 1MI5A 3VGAB 5LBSL 1B6DA 4KKLD 2NR6D 3AREC 4ZUUA 4F3FA 3FQTB 4JG0H 4LU5H 1F90H 3IGAB 5JZ7C 5C7XL 4ZUTA 2ATPB 1G1CA 3B9KC 1RMFH 2ADJA 3HS0A 2OR7A 4J1UB 5I1KH 5I1LA 3ARUA 4X7FC 5E8DH 3DV6B 2D03L 5TPWH 1I9IH 5DS8B 4UNTA 3AS1A 3HNSH 3HPLB 1K4DB 4I2XA 3RVTD 3U2SB 4G7YL 4LK4A 1LO0L 1RIVL 1FHGA 3FOMA 1QRND 4XP1H 5J3HD 4MJIA 3UZEA 4Z9KB 4F57L 1ITBB 4JKPL 2VXSH 1E27B 3SCMA 1U6AL 5JHLH 3MUY1 4ETQB 4JFDE 3L3GA 3FT4A 3Q5OA 4PGDB 4XVJH 1G7PA 4D9RE 4KK5C 4XH2A 4GKNA 1MI5D 1KV3A 1F3JA 5CP7A 2C5DC 4HS3B 4U31A 5HHMB 1ZT4A 4PUBL 5GGVY 5CD3B 5M7QA 1GGCL 5DJAA 4OKDA 4HPYL 2VR5A 4WWID 3BT2H 1ZSDB 4ZO6A 1I1AD 3R4DA 4S1SH 2JCCE 4DK3A 5CWSA 3W0WA 2K1MA 1G9EA 1K6QH 4WO4C 1IQDB 1MCWW 4DCQB 4PJAF 1YPZE 4HCRA 2QSQA 5L7XH 1DBKL 5JO5A 4IJ3B 3BD3A 4AENA 1QSED 5DFTA 5CKGA 5BJTB 1HOCA 4OKVA 3O9WB 2QSTA 2FSEB 5H37G 1Q9LB 4XCYA 3HN3A 5AG8A 2PUQT 4NFCA 3DX6B 4LKCB 5AEAA 3BP7B 3FQNA 3G5XB 2C1OA 3QH3B 3VI4F 3DX7B 1JI1A 3ARFB 4OIIL 1TZIB 1BQLL 3T4YB 4TUJB 1FG2A 4D0CB 4XNQA 4KROB 3BE1H 4JHBA 4Z7WE 1BAFH 1AP2A 1I1AA 3OJDA 2WWKO 1F45A 4JQIH 4H26A 1BJMA 1FO0H 3PWUA 5DSCA 1E0OB 4HWZA 4MNQB 3UC0L 1IC4L 5IHLB 4GOSA 1Q9WB 4M4RA 4Z78B 3MZGB 3NAAH 3QJFA 5E5MB 4X98B 1JRHI 5B38B 2DLHA 4L4VA 5SWZE 1V3KA 3RWIA 4CUCA 1CD0A 3HC4H 3QUXD 2FB4H 1QSEA 3GHEL 4V1DE 3WSQH 1T0NB 4XBGB 2IEPA 5DTFB 3MUGA 3FT3A 4NWTH 2VRAA 4JM2A 1FL6A 1U8MB 4OLWL 4CW1B 1AGCB 4Z7NE 3H7BB 1CGWA 2VZTA 5IVOA 5T3XD 1BQHA 4KV5E 5I71B 3ZKMC 3QUZC 3REVB 1DDHB 2SEBB 3IJSA 4L4TB 3EYSH 5DEGB 1KBGH 3D39E 3KHQA 1SEQH 2ORBL 3MLSL 1ED3B 1C16B 3LV3B 3BYYA 5EOQH 3QHTC 2YN3A 4UMGA 2AVGA 4UQ3B 3GMQB 2D7QA 5H2BB 3OX8A 3HKFA 5FYKU 4MQ7B 1YJDL 2JELL 4NKDA 2VUOA 3CH1B 5F44A 1QRNB 3U46A 2P46B 3PE9A 5GZOC 4XCCH 2DI9A 3L9RA 4FZ8H 1R3IL 5DWUH 4RSVA 1Q0YL 1AD0B 1ZEAL 2VZUA 1VFMA 5E2VL 2ZOLA 1XMWA 2H6PB 2MKWA 2W65B 1LDPL 4OF7A 5J89A 4AK1A 2OJEA 4WFGD 2V17L 4F9LA 3T4AB 4YHIA 2H3NA 4JPVH 1BGXH 2FJGB 2ATPA 3X3GH 4G9DA 1Z3GL 4WU7A 1T7YA 3C9NA 2YSSB 4GXUM 3TNNB 1WIUA 4PJ8A 3K1DA 4GXVH 3FQUA 3X13A 2E7LC 3ARRA 3WE6B 4DJMA 3O3DB 2W9LA 3S4SA 2KUTA 4AL8H 3FKUS 4CVZA 3MXVH 3S5LG 1MCFA 5A2FA 1HK6A 2EE6A 1FCCA 1GGBL 3V2AR 3L9RB 4JN2A 4P4KD 3UYRL 2Q6WA 3CSPA 5EO9B 2P4AB 1TDQA 1N0LA 1FL5A 5KW9H 1CGVA 1KLFA 3E2HC 4ZMAT 4OT1H 3O4OC 4WV1C 2H2PD 4MQXD 2P44B 4G6KL 1ZLSL 5B3JE 3IDMB 1MLCA 3V6FA 4NM4L 5J1AA 3QQ4B 1F3RB 4NT6B 1FNFA 4DZBB 2AK4D 2QQNL 5E4EC 3PP4H 2CLZA 3LRSB 5AUMB 5E6IC 4WCYH 3GSUA 2H45A 4YFEA 3DMMD 3ZDXE 3FONB 1NC2B 4J3OC 4C83A 4CVXB 5DD6A 4PJHA 4RRPG 3UTZA 4W6WB 1TZGH 2APFA 2XTLA 1VGKA 1FBIH 5F9JB 1NDGA 4L3AA 1AH1A 5CZXD 5GGSA 1VGKB 5F9JA 2ZCLL 4IOFC 2GJZA 3RPIA 2W0FB 4PRHE 4TULH 3A6CH 4FZEL 5HI5C 5KTEH 3QCTL 3MRLA 2FWOB 1FGNL 3LKRA 3BH9B 3R1GL 2Z91A 4LLWA 4LSPL 3GNMH 4LVOC 5C0RH 4M61A 4FNLH 1CFVH 1UKTA 1CLOH 1CTOA 1LK3H 4NN6B 3BQUA 3QAZC 5C0EB 5DXWA 4I3SL 5IGXH 2NZIA 4LCYA 5T5NG 5EORL 1U3HB 3IS1X 2HLFD 1A6TA 5ERWB 3UYOD 3NCCB 3BUYB 5HGAB 1X5GA 4JO2L 1INQA 3FTGB 3QO0A 4Y1AD 5DVOA 1TTFA 4MA7H 4HBCH 4PD4K 4I13B 4PG2C 5IR1A 1T1XB 3EFDH 1ACYH 4JDZB 4WIQA 1ZEAH 3SQOL 1KCKA 1PGRB 2DWEB 3CFEA 3A0OA 4U6HA 2QSCL 3SDXA 3W11C 5HYJE 5C3TA 5FECB 1S9VB 1AD9B 1SEQL 4FQXC 5HYEA 1FNEA 3QEQB 4XNMA 3V7AG 1J1PL 4N8VA 3QWRD 5DD6B 4C58B 3QG6A 1ZHBB 2OQJB 3BQUD 3E6FA 3L3HB 4Z7UA 4ODWA 1ZAGA 1KN2H 3QPXL 3BGAA 3RKDD 4D9RD 1FSKB 2E9JA 4NQED 1X4ZA 5IIEB 4TSAL 4NQCA 5D1ZC 5I66A 2XN9E 4P2OC 4PJBE 1A9BB 5L9DH 2OR8A 1ZWIA 3MOBL 5IM7B 1X7QA 5C0BA 1XFPA 5GGSY 1RMFL 3MRHA 4BQ6A 1CD1B 3MV7A 4NFBA 2I24N 3DYPA 1A47A 1J10A 4F37K 3ZE2F 4YQXL 5DA0B 1GGIL 3EJJX 1J88A 2P5WD 1RVFH 4TSBL 3FOLA 5HI4D 3FB8B 3PDDA 3T2PA 4XBPB 5DHVB 1G0XA 4BSJA 4JO1L 5ID0B 4FQ1L 3BPCA 3RY4A 4MHHI 4E5XB 4EJ1C 1YEGH 3PQYB 5HGGS 1HSBA 1M7IB 4NJAH 1BFVL 5C86A 4QHMA 4XPFL 4HWBA 4G43A 2DIBA 1G7IB 4XBEL 1T6VN 4BKLA 4Z7OE 1NAMB 5L8JB 4YBQD 3DMMA 4M43H 1RZ8B 3MO1A 2P8PB 5KS9E 4U6VL 4Z6AT 2FX9H 4X4XB 2F19H 3LN4B 3GM8A 4KTEL 4OF0A 4XHJD 1MCBA 2D7TH 4KZDH 1GOHA 3TM6A 4O2CA 1BBDL 1WTLA 4P2RE 4KKLC 4MMZC 3PQYE 3GSXA 3VCLB 1UM4L 4L9DA 2VXVH 1UZ6E 4RX4A 5KVFL 3OAYH 1DLFH 3M8OL 1LO2H 3OJMB 4PGBA 1T5XA 1QBBA 4U6XB 3ZKXC 1NMCB 4C57C 1A6WL 4XC3H 3HMWH 3EDKA 1LNUA 4ALAL 5FKPA 2RGSA 3BEVA 4KI5F 5E1HB 1Z3GH 4WUKL 1B4JL 2BSSB 2NXYC 1CE1L 2EC8A 4WVRA 5I2IA 3HAEG 1RJYA 3DUHA 3TWCL 5C0BB 3HLAB 5FGBA 3SKOB 2NY3B 5T1LB 3W39B 4HUVA 4LLYB 3B9EA 5F9WC 3WNOA 1FFOA 4U2YA 5CJ5A 1S7XB 2C1PB 3EO0A 2H8PA 1KIRB 5E8NB 3BZEB 4MNQE 4GKSB 4I3RH 3BYTA 1Q38A 3ZLQC 1RZFH 4JANA 1RI8A 4GQ9H 5HDQH 3D5OF 4ZTOH 3VFRB 4JPWL 3QUML 1DQDH 1S3KL 2X9XA 1IJ9A 1J1OH 2XG5A 3DIFB 1ZVYA 4GRWE 4MQSB 4N8CL 2BXZA 4IRZL 3QDMD 4PIRF 4MXVE 4R4ND 1CF8L 3NACH 3UBXG 4RISL 4UT9L 3VFOB 1AP2B 3JWOH 5DQ9B 1WV7T 1D5ZA 1CG9A 4RGMC 1P7HL 5KVGH 4ZDHB 2EE2A 1ZTXH 5T1LD 1Q8MA 4M48L 4X9HA 1JMZA 5GGUB 1ZHKB 1UWXH 3EO1A 1IM9D 4LGPB 3V8OA 1WBXA 4JZJC 1A7PH 1IC4H 3SE3A 4MNGE 2B1HH 2QADC 3ORJA 1MFBH 1B0GA 4HWUA 3HB3D 5GS1C 1Q72L 1CICA 1NEZB 2X2YA 3CXHK 3ET9F 4KUCF 4EN3B 3I85A 1C5BL 1D5IH 3RZCD 3OKEB 5ITBL 4H0GA 3F6IA 1KPVB 3RVXD 3EUUA 4OD1H 1DBBL 1QLEH 4HK3N 3PWJB 5HHPB 3LKOB 1TTUA 4ZS7H 4Y4FA 5I1AB 4TTGA 5HHME 3T8XA 3O45A 1YDPB 4YDIH 5E6ID 1HCFX 2FATH 4OZHA 5I16B 1A7OH 5IVZA 4OZGA 3O8XA 3IDIA 3VGGA 5ACZA 1FFNB 1JPGA 4KTDH 3M1BA 1KB5L 1JZ8A 4G6JL 5KSAC 2NY5H 3O3EB 3STBA 2C7UB 2OCFD 3O2DA 2I9LB 4NOFA 3GKWL 1U2HA 1UENA 35C8L 3A67L 4OB5L 5DJCA 4ODHL 2ZUTA 4L29B 5E00B 2V5YA 3PL6A 1P2CB 4JN2B 32C2B 1JYNA 4XPAH 1K85A 2DD8L 4PV9B 1J8HB 4X9FA 3MBEC 1SQ2N 2CKBL 4RNRB 1YMMD 4PJAA 4X7CC 1QLEL 3Q0HA 4KDVA 4QRPA 4F2MA 4LVHC 1AGBB 4AMKH 3I2CL 3MRKB 1D5IL 4OZFG 3HFMH 2XN9B 4G8FB 3LEXB 2FATL 4HKZA 1ZGLM 3IDYC 1BFSA 3N06B 1BBJA 1QYGH 1FQ9C 1YMHB 1FYTB 1HHJA 3N1PC 2AJSL 2R0ZL 4HQQH 3RKPA 3O3DA 3ZDZE 1CFQB 4N0FB 1BHGA 4HK0A 2B4CL 2IAMB 4NN7B 5CLWA 3N9GL 3O6LH 2UZIH 5IROC 5D7LE 2W1NA 1LO0H 3GO1L 2DB8A 4W4OA 4HUVB 1XGPB 4NP4L 3FT2A 1H0DA 4ZDHA 3RTQC 1RPQA 2BRQA 4ODBD 3TO2A 4KAQL 4PRAA 1MCWM 3CVIH 2Z92B 4FQHB 2F74B 2W65A 3DROB 3G5ZA 3PHSA 4IIQC 3FQXB 4OCXL 1A64A 1YEHL 3R06A 2XRAL 1UWGL 1IAIL 5D71H 3L5XH 5DRNA 3IJHB 5BZDA 1UM6L 4NQXA 4P23A 2JCCF 3ELAT 2QKIB 5SX5K 3SEPA 1LMKA 5GQBA 1UGNA 3LQZA 2H1PL 2AS5M 5FOJA 5CMAA 1RUKL 3K74B 2AEWA 4OFVA 4CMMB 1A21A 4FFVC 1YPZF 3BJLA 1FN4B 3OXRB 4J6RL 5I75B 4U1NA 4YGVB 5C70A 3H3BC 2QSCH 4HHAA 1TITA 4P4RB 1BD2A 4XP5H 1UM4H 3ZL4L 1F6FB 1EBAA 1SY6A 4PRHB 3UTPE 4UIMA 2NY6D 1GGTA 1BEYH 3H0TB 2CXKA 2ITDA 4L4VB 4R7DA 4HBCL 5J06A 1S8DA 1SEBA 5AD0A 1A6WH 2YD7A 1HHKA 3QDGD 5I1JH 3T0EC 4JO2H 2ITCB 4JQXA 3AFLA 4P5KB 4PB0L 2BRRH 3MUGB 5IB4A 5DZLA 4HX1B 3RWEA 1LO2L 3DUSB 3DO7A 2H9GA 5E1AB 1KCVH 1BWMA 3TZVA 5KTEL 4V1DB 2X4QB 4HAFA 2HJKB 3MJ7B 4QHNB 4YFLI 5EORH 5C0IA 2EDTA 5GS0C 1JWMA 1OAUH 5IESL 4YEEA 1HYSD 5F1IA 4YWGL 1GGYA 5DGQA 2WBJC 3KNBA 4LSQL 4E41B 4FABH 1H8OA 5CEXB 25C8H 2BX5A 1CK0L 3TVMD 1YNTB 4QXUH 3NA9H 3PJSA 1TJIL 2YC1A 3PDGA 4KGJA 1RZ8A 4H25A 4R6UA 4MQXC 3UROR 2Y7QA 4NC1C 2BFVH 4Q6IC 3TF7C 4XPFH 4GRMB 2UVFA 4EXPX 1YEDB 3G6JA 3GJFH 5TH2A 4HXBL 3VU2A 1U8NB 4L9LC 2NY0B 1EZVY 4OLYH 5DJ8A 1T1YB 2X42A 1A5FH 3VXRD 3C5ZC 4DOHE 1DUZB 4MD5B 6FABH 4MA8L 3RIAF 1U93B 5DRWA 1L7TL 5FIEA 1H15B 3ARSA 3X12B 4EVNA 4XT1C 4BQ9A 1M7DA 1WAAF 4ZXBC 4F58L 2VDMH 1XGQA 4JO1H 3JWOL 4N0YL 3DSFH 3FAXA 3PP3H 4LHUG 4XP4H 4OZGF 4U1KB 5KW9L 4DVRH 4JY6B 3TJEH 2X4SA 1R5IB 4JDZA 2C3VB 3BIKB 5CJOH 1G9NH 2GITA 4TSAH 4JRYE 1DTUA 1SVZA 4FQLL 4QXUL 3QIWD 3VGDA 4OD3L 4E41A 3BP4B 2OL3H 4S1RH 4WO4B 4XPHL 2OP4H 5E2UL 5A16B 2YD9A 2BK8A 4XWGH 2AXFB 1DQQA 3IDGB 5D1QB 1FFPA 3HE6B 2VDLH 2Q8AH 2IAMD 4QRUB 3BPOB 2X4QA 3SKMA 3EJZC 3M17A 3VXRA 3N1GC 2HN7A 4Z95L 4J2XA 5AZ2L 3QYCA 3WIIL 4M61B 5K9OA 1HYSC 3PGCB 1F3DJ 2HT3C 4XX1G 1X9QA 3QO1B 4ZNCD 1FPTL 5EZJB 3U9PH 4K3JH 4H5SB 4PJGF 3HR5A 1U91B 3BX7C 4X6CF 4JREB 4S2SA 3TVMC 1IGCH 1S9WA 3EOYG 3HZMB 3QFJB 3QNYB 2QQQA 2V9TA 4ALAH 1A7QL 3U2SA 2W9DH 1PG7X 4D0BB 4TVPE 2ZSWA 2GT9A 2YPLB 4ODUA 3HR6A 2IG2L 1U8JA 5KZCD 5DMIL 2AEIT 3W5NA 4CRPA 1FN4A 4NC1E 1QSFD 3VWJC 3VWKD 5CEXA 3KYKH 1AIFB 5E6IB 3OKLA 1JNHB 4U6YB 3IVKB 1HSAB 1AXTL 2FLRT 3JUYA 2B20A 1FNSL 1G9NL 2XT1B 2FGWL 1EO5A 3NBNA 4KZEL 1P4LB 4KTEH 3ARDB 4U49A 2EYTA 1NUGA 4NWTL 4BZ1H 2HRPH 1AD0A 4KDTA 3RWDB 4XPGH 2P7TA 4P5KA 4O2EA 2NY7H 1DQLL 3GMLB 5E7FA 4LCIL 2X05A 1LK2B 4L8DA 1W0WA 4H8WL 3D0LB 1A1OB 4JVPA 3T0AA 4HWEH 1E4XL 3ZYOA 2AXHA 3FB5B 1F6LL 3O81A 4TVSa 1A5FL 3GDBA 3HMXL 4KWUA 4PJHB 3DRQB 3RNKA 3SJVE 4QRRA 1YYMH 3TFKD 5INDA 2IF7A 2P5ED 4Q9CA 3RQ3A 1XIWB 2LAAA 5I73B 3K2MC 4EN3D 2A73A 5IMLB 2Q86B 2RBLA 5EU5A 4WEMB 1FE8L 3Q1SL 3DWTA 4JN1H 3U9UA 5DK2B 1QKZL 4Z7VE 3MRBA 4JAMB 1IE5A 3VDAA 3PQYD 2DQEL 1U3JA 1JNNL 3IS0X 25C8L 1KGCD 4MDIA 1Q0XH 3MRQA 4U4BA 1AR2A 3BE1L 1I75A 4JFYB 4BZ2H 1DBJH 4GXVL 2A1WL 4G6ML 4LCIH 2AKRA 2VDQL 4LLMB 3G6DH 4OCMC 4NUJA 2VL5A 3WN5B 5IBUB 4RAHA 4XXDA 5C0AE 4S11A 5GS3A 2WINB 2E8ZA 1YC7A 3OR7B 1T1XA 5FGCB 1W0YT 3QPQC 5GRYA 3VXSB 3T08A 1FVCB 4W6YB 4NN5B 3RGHA 1NGXB 3T0XA 4JKMA 3EBAA 4M1CC 4PYGA 1J1PH 5HDOA 1QZ1A 1U3YA 1TCRA 4FMKA 4W6XB 5FUOL 2YRPA 1N4XL 2HWZL 1WITA 5IW6B 1HI6B 1ZHLA 2RFXA 4HT1H 1A7NH 2BVPB 2EZ0C 2SEBA 4L4TA 3P0VH 3SE8H 1LO3L 5JPMB 3MRMB 3GMRA 4A2MA 1U8KA 1Q9LA 5L2KD 1OLZA 1JF6A 4CKVX 5JIIA 1BIHA 1JGEB 5D7JD 2DM4A 3QNXA 3AROA 5F7UA 1JWUA 1KB9J 2G9HB 5DI8A 4BYHA 4DGIH 5I17A 5LAXB 2A9ML 2JJTC 4K71C 1W8OA 5MEOB 4L8CA 1TFHA 2C1PA 1I9JL 3SDYL 3FCTB 4FTVE 3EDDA 2FEEL 5D6CB 4PLJD 3TEUA 4DFIA 3HG1A 3PHQA 1WBZB 2DBLL 1IT9H 3ARDD 1NGZB 3VI3E 4PJXA 4H20L 4KK6D 5CWSB 1PKQE 2D03H 3NOIA 4FZ8L 3RZCC 1B9ZA 1F3DH 1NFDA 4LLVB 2IFFH 5JTWA 3O3AA 1BFOB 4GW5A 3DYMA 1RJLB 3OPZL 4OGAC 3QUKA 2R2CA 2B5IB 1KG0A 4I48B 3LQMA 4PGZA 2NY3C 3NIGE 4KHXL 1G7PB 4KQ3H 3JV5A 4PJDA 2CKBA 2EYSB 3L3GB 4Y4FB 3WDJA 2MFNA 2VR9A 1AGCA 3JTTA 1RUMH 3GMNA 4P5TA 4LKCA 3JZ7A 4GMTH 1FLRH 3WFDL 2X1XR 1CXFA 2QADD 43C9B 3TYGH 3BDYH 4U1LB 5LBSH 2J4WH 1OF2A 5I1HL 4X98A 4RMVA 3V0WH 4P4KA 4Z7VA 4HC1A 2X1WL 1C08A 5C0AD 3HZKB 3BIBX 4M1CD 5GS0D 5J1TC 3RIAK 4AIXA 3BGFC 4N0UE 1E6OL 4PJFE 3U7WH 3AB0C 1NC4B 1OAXL 3C5ZD 3P73A 2VLRD 2Y5TA 4FQIL 4M7KL 1WBYB 4GW4B 1JTTA 5EULV 5FDWA 3TJHC 4Q9QH 3GM0A 4JY5L 4EI5D 2N56A 1F11B 2W92A 4J3VA 1F8TL 2C26A 1D5BB 5FKPB 3TT3L 3FAWA 5H35A 4AQ1B 3FB8A 3GSNB 2F53A 1F13A 1HQ4A 5SWSD 3WLWD 3RWGB 4A6YH 3HE6C 4HJJH 5C08E 2WIMA 2IAND 3Q5YA 4NKDB 2UY6A 4LVHB 3GBML 4MNHB 4MB5A 4X6EA 1EVUA 1CD9B 5I1JL 4KMTH 4ZS6C 4IRJC 3OKDB 4LARH 5H2BA 5DF0A 1I1RA 2CJUH 4OZFH 2ZSVB 5AD0B 2DDQL 2P8PA 3O9WD 4IMLA 1T22A 3GMMA 2IAMC 1T80A 3CFBB 1S7WA 1MJ8H 4XVTL 1TCMA 5FA3B 1U8NA 3G6DL 2XZAL 3TCLA 5AYUH 3HI6L 5F3BA 1YEFL 2FBJL 5B4MC 1C5DB 3JWDC 3MRFA 4LLDA 4YPGB 4HDIA 3DGCR 4L3CA 2DAVA 1FL6B 3EOTH 3VWJB 7FABL 1ITCA 1DQTA 1IGFH 3QHFL 4E41D 1EAPB 4U3CA 1WQVT 3KXFA 1AC6A 1KCRH 3OGOE 2H2SD 1E27A 4LCUB 4PGEB 2J6EA 4NZUL 4WW1A 3RU8H 2M2DA 3QIBC 5EBWB 3VJ6A 3LY6A 4PJIF 3U0WL 4G8FA 1DFBH 3I75B 4XNZB 2OX5A 1KTKE 2DJSA 1RJZA 1A7RL 3NTCH 4M7ZC 5DZNA 4I0CC 3WNLA 2EIZB 5EN2B 5IJVA 3SPVA 3MYJB 3QHZL 3TBWB 3INUL 3MV9B 4M8VA 1J8HE 2BY2A 2J4WL 1OGAA 5DQDH 2BNUA 4K7FB 1UC6A 2WMPA 1DBAH 4OCYH 5A2IH 5TF1L 1A2YA 1F6AB 3NAAL 2VLJA 4JEGB 4PBXA 3DI3B 4IRSA 4I8DA 1MOEA 2VLLB 3SGJC 4GRLD 5ESAB 2JJSA 4GT7A 5C7XH 2I26N 3IU4H 4LCCB 1VFAB 3PHOB 3QA3B 1EXUA 3QDGB 1UXSA 5B21A 3WNMA 4HIEA 2G9HA 1LK2A 5FV1L 4KXZH 3KPTA 2GCYA 4PRPE 1EEUA 1U8HB 3DVNA 5GSRA 5IR1B 3DO3A 3VXTA 1B0RB 3LKNB 3WO3B 3DOSA 4JY4B 5DRZA 5DC9B 1EEYA 1GRWA 3FTGA 3MNWB 4LNRB 3UJTH 4MAYA 5AAWA 1R5WA 5HPOA 3V0VA 2Y6SD 4GW5B 4PRAB 3CIQA 1VENA 4RX4D 3EDFA 2D0FA 3S37L 1GZQA 4P2RD 4PGDA 4M8QB 2DJ4A 4HJJL 2BHYA 5CS7A 2CJUL 4L8SA 2NTFA 3ZT6A 5CGTA 4P5MB 5GGQH 1IGMH 2WW8A 4DVBA 3VH8B 1DLHB 2H32A 4Z18A 4JDVB 3KDMB 1NH6A 1ACZA 4ZG1A 3CZJA 4LPTA 2PO6A 1I8MA 1YDPA 1GGCH 5FUCE 3P9MB 2NYYC 5DA4A 1WIPA 2DQUL 3KYOA 4ZOBA 3CCHA 1CZ8L 3UTZB 3WE6A 3LKSA 3GMPB 1UACH 4YR6B 4C83B 1EMTL 3BRFA 4LSRL 5BZWB 3B43A 1MFBL 2ZCKL 1HDMA 4X6BB 5CJXC 2VAJA 2DQTH 4W70A 2F53E 4Q58C 32C2A 1UH4A 2ICWI 5SV3A 5LGHL 1MI5B 2VYRE 3U7WL 4R26L 1WZ1L 3KR3L 5IF0A 4JFHE 3VMPA 3HLAA 4P2QB 4JO4L 2PCPA 1OY3B 3B8YA 1NGZA 3QCUL 4RMTA 5EH1A 3MLUH 1IL1B 1A1OA 3WN5A 1CN4A 5GGVL 2FJHB 3ARTA 5EO1A 2Z93B 4MCZB 5HJ3B 4KQ4L 1KN4L 1MCEA 4L8CB 1LD9B 3MJ8A 3Q6GL 3U4AA 5ID1A 3ESVF 3AMKA 5GS1B 3QA3A 1ZKAA 4D9LL 4WGVB 2FO4A 1X44A 2OR9H 2AQ2A 3MX0A 4DKDC 4U0QB 4NNPL 5DK2A 2E6PA 3MLTA 4KKBD 2DM2A 3K3QA 2VWEE 3LSOB 1JE6A 4IOIB 2YPVL 3UTTE 1KJVB 1FGVH 5LVEA 4UUJB 4HLZH 1J9CT 1C1EH 1OT2A 4C59B 1IRAY 4FFZH 2YPKA 3CH8A 3ARBC 3I3DA 2PYEE 1ZT7A 1F02I 2X10A 2VXUH 4OF6A 3HZMA 5D2NB 1A6AA 3EO1B 1MIEH 3DVGB 2YXFA 3RWIB 4UINL 3ARFD 3WO4B 3OR7A 5HDBF 2YWZA 3KPOA 2JF1A 3V52L 2VR4A 1A3LH 5K9OB 3S9DB 3X14A 3ZE1E 4CVWA 5KVFH 2APVA 3VGBA 3CU1A 3GIVB 4NZJA 3TA3A 2EDHA 5JUEH 4XVSL 1BM3H 2X4PA 2FIKA 3OSKA 4ZAKA 1QA9A 3O2VL 4DZ8B 4N9GB 4HC1H 1PYWA 3ZKND 1AIFA 3VWJD 3IVKA 1UM6H 1NBYA 4HH9B 1OQOA 2VDNL 1M1SA 3MLUL 3DX6A 3BZEA 2FIRT 4LLAA 1B88A 3BSZL 5F7EH 3VA6A 3BKMH 3ISWA 1KTLA 2NY6B 1KN4H 4KKAC 1QO3B 5F6IB 3OKDA 3TJEL 2MCPH 1WAAE 1QFUH 1ZA3B 4MVBC 4XGZB 4QHMB 5HPMA 2DQTL 1NBZB 2VDML 1FNGA 4CL7A 4EVNB 1KEML 2ZKHL 4AY0A 5JHDD 4MA3B 2AV1A 2AJVL 1UEMA 1W0WB 2KKQA 3QISA 1K3ZA 3I02B 4R26H 1CT8B 1S7VA 3UTTB 4O9HH 2E27H 5TE6L 2AK4B 1DEDA 1Q9WA 4JCLA 3FMGH 2DQHH 4NPYA 3NZHH 1AKJA 3WIHH 4WI9A 1DL7H 3BD5A 3LZFL 5GXBB 1JK8B 2NY4D 1N0XL 3A6BH 3EDJA 1FO0L 2R4SH 4PJEA 4RDQG 4PRPD 5F6HI 4DAGH 1YN7A 5E8OA 1I9EA 4G8GE 4D9QE 5C0CA 4RFEB 4DKEL 4JCMA 5CSBA 1LWRA 1FL3A 2BNRA 4LDOB 5GGTH 3FB6A 1TJIH 3UTSB 5IMMA 2MWCA 5F93C 1FRGH 2A74A 1CK0H 4Y5XB 3HC3H 3KLAA 2FL5A 4KRNA 5B39G 1RIUL 2DLFL 1NBVL 1QFWM 1U3HA 1VESA 4Z7UB 2HJKA 5C0CD 5EZJA 5K59F 1DUZA 5BV7L 4YC2B 3SKNB 2ENSA 2CGRH 5D7JB 4WFEE 3VXOA 4UILL 1DQMH 2Q20A 1UJ3B 3SDCC 4G6JH 5TJWK 1MHHB 3GJFB 1NCCH 4CNIB 4NCDA 1BVLA 1NANI 5HYIA 1NANH 3EYQD 3X14B 3WCYA 4HFWA 1L9NA 1CS6A 1EO7A 2DWEA 1A7OL 3QP3A 4PV9A 4YGAB 4FQ2L 5FKAB 4CU7A 4F7EA 5D2LF 2MKLC 2CH8A 7CGTA 12E8L 3FFCD 5EWIH 2GHWB 4HPYH 1NCAL 1BQSA 5DVKA 2B5IC 1BFOA 2EKSB 1SYVA 4KJWD 3HMXA 3C6LC 4YDVA 4QRQB 3O3EA 4PRIB 2BHUA 2BNQE 3HG1D 1EPFA 5EZLB 3RDTC 1CIUA 1IGCL 1MCHA 4JFXB 5F9OH 5JHLL 3MNWA 4LNRA 5FYLH 1CDUA 5MEOA 1L9MA 5IBUG 5IHBA 3O3AB 3RAJL 4RMUA 2RHEA 5I17B 1K4CA 3QHZH 1PG7H 5DT1L 5A2KH 5MERA 3KPQB 1N2RA 1Q94A 1G1YA 3O6ML 5AWNL 1WBZA 4OCXH 4ZPTA 3HC4L 3HUJA 1E4KC 3W0WD 4LL9A 3FB7A 1K4DA 1JPTL 2ATKA 5D6CA 4O5LL 5BS0B 3H0TA 3BD4A 4UIMB 5LGKA 5L0QB 3MROB 5ISZA 4P5TD 2A6KB 4K55A 4EN3A 1RZ7L 2VDKH 4S1RL 4XPHH 5C0BE 1JN6B 3PNWB 3O41B 2YD4A 1UWGH 4TRPH 1PX4A 3EJZD 1LE5A 2DJUA 1V5JA 4R0LB 1K5NB 4F15C 4BM7A 4NNXB 2K7QA 1K8IB 4PLKC 1K3IA 1QVOA 3UDWA 1AI1L 3FT4B 4ZTOL 2QLVB 4FQQA 2X4UA 5EIIA 5CUSH 4JVWA 4Y8DC 1JFQL 3GSVB 3G6AA 4P2RA 4OJFL 5J1AB 3BPNC 4YHIB 4X6BA 4FFYL 4GH7B 2CLVA 1QACA 4PPTA 4BELD 4NZDA 4QY8B 1FDLH 5FYJH 1DBMH 4PJ7E 1RJCA 3LKSB 3MV9E 4JFZL 2AJ3B 5CP3A 1HN1A 1A9EB 3K46A 3P30H 4D3CL 2IWGA 4MNGB 3KPLB 1H0DB 1S8DB 2AV7B 5IB5B 5C0DB 4GKSA 5B22A 4CMHB 4JB9L 4M6MH 2VOTA 4R9HA 3H3PL 2QL1A 3BGFB 5IWLA 3L6FB 3G5YA 3PHOA 3OWEA 1FZMB 4TPRH 4P5MA 1EHLH 1IMHC 4NRXA 2IH3B 2YSSA 3TNNA 1SYSB 5ADOH 1FNHA 1FYTA 3TH3T 3IXTB 3T2OA 1XIWD 2ZOKB 4OFIA 5BMFH 4MS8D 4PB0H 1CXKA 1KXVC 3L1OH 3IDIB 4Y5YC 3REVA 2ZUWA 3JTSA 2R1WA 4QTHB 5C3LD 1AGBA 2F54E 4Y4HD 1JYWA 4JY4A 2Z8VC 3TBWA 1QG3A 3QUZD 3C08L 5SV4A 4JDTH 5EC1B 5IK3A 5IVXB 3NIGF 5FUZH 3V5KB 1OP3K 1OOAA 1OP9A 1GJIA 5A43C 2UWEE 5HI5D 3IKKA 1CDYA 1Y0LB 4U1JA 1DVFC 2D7MA 3VFTA 5F21B 1OTUC 4POUB 1NUDA 3ARFC 1QRKA 4N90E 4PTUA 3RWDA 4WTXA 5EDXA 3IDYB 2OR9L 3SGKC 1AQDA 3GRWA 3HPJA 4GFTB 1WVZA 3WMSA 2F54B 1VHPA 4IRZH 2X7LA 1VACB 4OGYL 1CFQA 4N0FA 5D7IB 1NAMA 3FN9A 1K5NA 2WUCH 3WNKA 4XAKD 3T4YA 1U91A 2E9WA 1II4E 3LS5L 1SBSH 1H3GA 3U83A 4OCWL 4CU8A 3U79A 4G9DB 4OZIE 4U0RC 5KSVB 1VPOL 5HHPA 4NCC2 4G9FD 3VXOB 2YKLL 4MXQD 1U8JB 1NLBH 2A0LC 4D0DB 1Q1JH 5T3XL 1DQJB 4AEHL 4U0RB 2D9QB 3X11A 1EHNA 1RJZB 1S7QA 3SE4A 5C07E 5CGYD 3UZQA 5IQ7L 4XX1E 3NIDE 5DEFA 3WIHA 5FCSH 3HI6H 2AXFA 5HYQA 3NCYP 5B3NA 5I1KL 3KPPB 5IB1A 3RNQA 3EDEA 4GKOA 5FYLL 3UTSE 4PP2B 2R8SH 3TBYA 5GISL 4HBQA 1AXSA 1GAFL 4RBPH 4Z0XA 4ODTL 2EO9A 3D3VE 5JNYB 1IM3A 2I60H 1A7NL 4B53A 3K81A 4PRBA 5IIEA 5IOPB 1FZJA 3QSKB 5GRVK 3RHWF 3S6CA 1J0JA 4IHOB 2GUOB 4NO0D 4U3XA 4KKAD 5F7MC 2X40A 2XQBH 1U92A 2PN5A 1UB6A 2OI9B 1T22B 2GK2A 1RD6A 3MCKA 1CT8A 1S7VB 2CIKA 3OR6A 1WISA 4NQUA 5IFJA 4OF5A 2PW2A 1BF2A 4KJQD 1FNEB 1BX2B 3ROOA 4XVTH 1I3GL 4JPKH 1YMMB 3QXDA 4MYWB 3P77B 4Z7VB 4GRLB 5F72S 1JGDA 1RURL 3IJYA 4PJBB 5HD8D 4H1LG 3WL9A 5EZIH 4WHYG 4FFYH 5J56B 3H9YA 2X6MA 4TUKH 1XF4A 4HUUA 3HNVL 2R39A 3ALXA 3MV9D 4PJIE 5E4EB 1UKSA 3SGKA 4UI2A 4Z7WB 1TCRB 3T0VA 4Z7WA 1I1CA 3BKCH 3FRUB 2Y7QB 5A3IC 3ARFA 2F54A 2X4PB 4PRIE 3SPVB 1FYHB 1JNNH 4Z0BL 1XF3A 1RU9H 1DVFA 1MAKA 5MENA 1QFWL 1N3NA 2O5XL 5EUOA 4UIKH 1EFXA 1DBBH 4Y16B 5D7JA 4M7KH 4KK5D 3QZWG 2MSPA 3QIWA 3N0PB 5D72L 3T77A 4MSWA 5TE6H 4JANB 4QHLB 2W0FA 1HOCB 5K93A 4EI5C 1MJ7H 1QBAA 1CDJA 5E2TH 4NQVA 3QUXB 1T3FA 3MRHB 4NQSB 5T33H 4EI6A 1YEGL 3E8UL 1RSFA 1JFQH 1TVHA 4PY8I 3MODL 1JJUA 1UCBH 2AEPH 4Q9RH 4Y5YA 1VCAA 3CZFA 4R2GB 4Y16D 4MX7A 1F90L 5CCKL 3W11D 3KWWB 4LF3B 1KJVA 1JZ2A 4OFDA 1BOYA 5K9KA 1X5FA 3ZHLA 2P5EE 4YHMH 1LVEA 2R1WB 4QTHA 1DQDL 4KKBC 2JKXA 5HHMD 3W9DA 1IQWL 1AR1D 3ZT5A 5IG7B 5I8CA 1HE7A 2DQDL 3D85B 2GSIA 5FAAA 2NX5E 4LIQE 5IWLC 2IPKB 4QRRB 5EA0H 2FR4A 4WWKD 1J1OL 2ADFH 3SN6N 3QIBD 4MA7L 3NCEB 4PLNC 4LLQB 4WTZG 4IRJB 1CDGA 3QXAA 1MAML 4JQVA 1CCZA 2AI0H 3BRDA 4PJEF 4YNYB 4JKWA 3T0BA 4B41A 4V1DD 5FUOH 3RGVD 3GSNL 1PEWA 3R06B 5ANMB 1AGDB 2WQRA 1WJ3A 5GRVL 5KJRH 3QNXB 3VFMB 5GJTL 1IEAA 4P57A 1Y18A 4TNWK 1FSKC 2H41A 4P3CH 3MO1B 2R15A 1U8KB 1R3IH 3GJEA 5BQ7A 3S98A 1T7VA 1J12A 3BJ91 1NUFA 2JJUA 4JHZA 5KAQG 5KSBE 5FUCC 2R23A 2UUDH 3QEUA 5BS0D 4X9IA 5LQBH 1KPRA 1NGPH 5D7SL 1NGXA 1JGUL 5L8KB 3L6FA 5C2BH 3ZHKA 3N1QC 1V7NH 2WM0A 1I85C 3MJ9A 1MRCL 1XF1A 1T20A 5DURD 3J8F7 3BMWA 3FN0H 3GSOB 4KKCC 5CAYB 3OG6B 1P7KB 4LAJH 4Z7UF 1NEZG 4U1MA 5K9QG 1TIUA 2NY1B 3PL6B 5JOEA 3RVUC 1IGTA 2XWJA 3D25B 1MCJA 3O0RH 1XGUA 5DO2D 3GMNB 1A6UL 1EUUA 2P5WE 1GZQB 4YEFA 4RNRA 1YYML 1M6OA 4PJDB 4DK6A 3R1GH 1I3UA 3WHXB 1LO4L 3V4UL 1A14L 4P2RB 4ZQKA 5CBEB 4F7MB 1LO5B 4XBEH 5KSUA 4PLOB 2IH1A 5ETUB 3WFBL 3B2VL 4MD4A 1AI1H 2Q7YB 3DETD 5C0EA 1RZIB 4GMSH 3UC0H 1DSFL 3SDDB 5K9KB 3LAFA 5KSBB 1P9MC 3K1KC 4PJXB 3LN9A 1ZHBA 1MFAH 3PHQB 1ZVSB 4DTGL 4YR6A 5J6HB 4FABL 3GMPA 2R0WH 2ZSWB 4Y0GA 2VLRE 1OQXA 1Z0NA 3SDCA 4H8WH 2EXYD 2BFVL 2CSPA 3QDJD 1QSEB 1AJ7H 4CVZB 5B38A 2DLGA 1ZVHA 3PWJA 1IAOA 5HVWA 4GAFB 1JGEA 1HKLL 4LLUB 5GJSL 1ADQL 1ZT1B 2YD3A 5J13B 3QEGH 4Z77B 3UPCA 2V2WA 3GRWH 5GGUA 2UV3A 4J12A 2HFFA 2ARJQ 4U1GC 3SDCD 1I3RA 1IFHL 1LEIA 1YEDA 2ZUYA 3G6JB 1EGJA 3BKML 5KSUB 4OF3A 4K2UL 2VERN 4ORGB 1DR9A 4XNQB 5E2WH 4PTTA 1B0GB 1QOKA 3BXNB 4U1GB 1UYWH 3IAPA 1OPGL 3ZTJG 2CPCA 1F58H 1KENL 3DECA 1F97A 1HQRB 4POYA 3QIUB 4AIZB 2QV2A 2JELH 3EFDL 4XAKE 4BFIA 3CCHB 3P0GB 3LMJH 3BKJL 2XG4A 2CD0A 1KIRA 3DUSA 1CFTA 3FQWA 3EYSL 4I0PD 3IB4A 4OZHE 5CGYC 3ARGC 3QT2A 1N64L 2Y5EA 1DN0A 1C5DA 3MRFB 4V2CB 2F8OA 4YHLL 1Q0YH 2BSTA 5GGRB 1EDQA 4LIQL 1VA9A 4OQTL 4F57H 1RIUH 3CLFH 4LRNH 5I8CB 5IG7A 1YNKL 5CZVH 1FRGL 4Z95H 5INCA 3CSYA 5IOPA 4OCYL 3QULB 4X6CB 2WV3A 4YIQA 1TETL 3PP3K 1N8ZB 1YNLL 5CP7B 3JV6A 2GITB 4KTYA 4LHUD 4KI5C 3TO4A 1U58B 5DUBA 5C0NC 3LDBB 1WCBA 1RY7B 4OAWB 1E4JA 4B7IA 5CMAB 2X4OB 1NJ9A 1WTGT 1Y6NR 4N1HB 3PJSB 3O11B 2DQDH 3JV0A 4JGMA 3QXAB 4HLZG 3VCLA 1QSVA 1AFVH 5KSAD 4UT7L 4PY7B 4C56A 1AJ7L 1YA5A 4RBPK 3L7EA 4N9OB 3TA3C 2APXA 1QNZL 4ZUSB 1FBIL 2LABA 1HCVA 4NM8L 1N6QH 4N8VG 3OKYA 4RGND 2ICEB 4MLSA 1PX3A 1P84K 1EAPA 3AAZB 4L3ED 4I4WB 5IVNA 3NA9L 1NC2D 1KEMH 3KJ4C 3SKJH 5FDYA 4M4PA 1AHWA 4S1QH 4GW1A 1BAFL 1C5CH 4FXGA 3ARBA 4R0LC 4F15B 4FMFA 3FT2B 4XGZA 1OGAB 4TNVF 4