2EZ0C

Crystal structure of the s107a/e148q/y445a mutant of ecclc, in complex with a fab fragment
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Ion-binding properties of the ClC chloride selectivity filter.
pubmed doi rcsb
source organism Escherichia coli
total genus 36
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ez0C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ez0C01
5CJBA 3VGAB 4AL8H 1FAKT 5EUOE 3QDAA 4J3UA 2IJ0C 4KUCD 3UZVB 4AENA 2N7BA 2ZUTA 4WFFE 1KGCE 1A4JB 1C7TA 2IBBA 4OFDA 4HJ0D 3FFCD 2X40A 2BVPB 4PRPB 1YMMD 5IVZB 3OB0H 5D7JD 1OB1B 4DVBB 3RL1B 2BNRB 4QHUA 3SE4A 4YDLB 3SJVA 3L5IA 2CLVB 3WS6A 3UMTA 1J18A 4XWOC 2YUVA 5TJWK 2CIKB 4U7MA 1HHKA 3ZDYE 3HMXL 4J4PA 5GS2D 3VA6A 1ZA3A 2X6MA 2J7LA 5F7YC 3WCYA 4U1GB 4RISL 1ZGLB 2P8LB 2HT2C 3GIVA 4L8BA 5FYLL 1NFDF 1XF2B 4IIQC 5TDOA 3N50A 5EN2B 5A40E 1UVQA 1NMAL 2Z8WC 3MV8A 4PJIB 5GS0L 2CGRL 4QT5B 3ECBA 2CD0A 3HMXH 4C55A 1U8NA 2X05A 4Z7WB 4X4XB 3FAXA 4RISH 1NMBL 1XH3B 3ES6A 2AGJL 1QVOB 5FYLH 3ETBF 1Z0MA 1QPPA 3QUKA 4Q6IC 3TPUA 5L2JA 3OXSA 2GSIA 1NMAH 2ICEA 4WI2A 4RIRB 1F4YL 2DICA 35C8H 4N8VA 4YNYB 5GS0H 2FATL 3FT2B 4N0CD 1NMBH 4NQEA 3MCLL 1CDIA 5J11C 4Y4HB 5KOVC 2JCCE 1QLRA 2Z8SA 1MCSA 4JO3H 4R2GB 5I8EB 4P23D 1X5GA 4N0UA 4TTDC 4X98A 1INEL 1F4YH 2WP3T 1QBML 3Q48A 4Z8FL 5B8CA 3NFSL 3PL6C 3UZQA 2FATH 2GI7A 4IMKA 5IEHB 5IROA 4M7KL 3MCLH 3W2DL 2MMXA 4WENB 4G6KL 1CG9B 1U42A 2DI7A 3LOWA 1I75A 1HEZB 4JY4B 1RFDH 2F74B 3WFEL 3HE6D 4OZHA 4XXCC 1INEH 1QBMH 5H35B 4Z8FH 3NFSH 4OZFB 1D6EB 2G9HA 3MYJA 3KR3L 5CJOL 3FJTA 4M7KH 3GJFA 3BIKA 1A14L 5JO5A 5J11B 4PJGE 4E0RA 3W2DH 1OAXL 5BXFB 4J3WA 4MA1C 5EULV 2FBJL 3T77B 3NZ8B 1YJDH 4JPIA 4PRIA 4RAUA 3OXRA 2CO6B 3BN9C 3D9AH 4LSVL 3H9HA 3LRSB 2VR9A 1KF9B 2ERJC 1GHFL 2GHWB 4G8FB 4P2OC 5CJOH 3EO1B 3L5WB 1ZT1A 4HLZH 1A14H 1INQB 1J1XL 2IF7A 1OAXH 4RFNB 4NN6C 3DETD 2NY1C 3CD4A 2FBJH 2IH3A 3EFDL 1LEGA 1E4WL 2KL6A 2R56L 4ZS6C 4AM0A 1KNOA 3SDCC 4I18C 4NSKB 3O3BA 1UQSB 4IRJB 1G6RA 1MHEB 1GHFH 5I9QC 5CS7A 3OAZH 3ARQA 2FR4A 5DJZA 4P4KC 4XI5C 2NY6B 3D2UB 4MA1B 3X13A 5CJXA 3EFDH 3O41A 2R56H 1GGCH 5EPMA 1I1CA 1RJLA 1AGCB 2NMSA 3RVUD 2Y36L 3UO1L 4M02A 1A02N 1T1XB 2GCYA 1L9NA 5JOFA 5AD0A 4FQXA 1PD6A 2NY1B 3BHBA 3EHBC 2YPLD 1E6OL 2COQA 2V5TA 1LD9B 2W9DH 3ZSTA 5GJTL 2XZQL 4OD1L 1QFOA 3H42L 3VWKC 1TENA 4MMXC 3PDGA 2XXMB 1A3LH 5DEFA 3F7QA 2Y36H 2W9LA 3UO1H 5KG9B 4EI6A 1KUMA 2MQ3A 1KIRA 3FHAA 3AVEA 3C6LC 5LBSL 3VD7A 3KPSA 5K59E 2EDKA 3IJSB 2VAAA 1EHXA 1E6OH 2MKWA 5HI5C 2ZUQC 2YPKA 5C71A 4HK3J 1VEOA 3SEPA 5GJTH 2OP4L 2XZQH 4XHJC 5FXCH 2IANE 1FIEA 2FSEA 3I02A 3UTSE 2NW3A 4RGNC 5FGCE 1OAZL 3Q6GL 5KTEL 2Q87A 1KV3A 4QF1B 3L95B 1WAAE 5LBSH 4BH7B 3ARFD 5KS9A 2Z4QB 2APFA 4KI1A 1FNSL 1ZANL 5CBAA 3GSWA 5GRZA 3KPPB 5C70A 2IH1B 2OP4H 3NFNA 4JFHD 4ZODA 4ZXBC 3ZHLA 3HUJA 2X4SB 3O6FA 2E9JA 4XPHL 2ID5A 5C9JA 2XIDA 3O4LA 1OAZH 4G8GE 2ADGB 1BECA 5KTEH 4JFDE 2E5EA 3Q5OA 2I07B 4GMSL 2E27L 5EU5A 4LCYA 3VMPA 1RZFH 4DFHA 4MZ2A 1IE5A 1PKOA 1ZANH 4FFWD 4NOBA 1RZIA 5D2NB 1IGJA 5FUZL 3KLHC 2NY4B 3QSKB 2A6IB 4XPHH 5I19H 2BVUA 5BRZB 2IGFH 5C0DA 5IKCB 2DQGL 4ZQKA 2QSQA 5SWZE 4GMSH 2BVQB 1MAJA 3TJHC 3TWCH 5IGXL 1EEUA 4ZUWA 4LARL 5FUZH 3CFKA 4K7FB 4P5KB 3QNYB 2L4OA 4ZXBB 4PV8A 1CZ8L 2CUMA 4HG4J 1BBJB 4HKZB 5GGTA 4OLUH 5D6DC 5IHLB 4P3DA 5HHOE 2I27N 2DQGH 3T0EE 2Y5EA 4QXUL 3K8MA 3IDNB 3EFFA 3MREB 5IGXH 3W9DB 1YEKH 3KS0H 1G7HB 4LARH 1IKFL 1IGMH 1RUMH 5I75B 1V3KA 1G7LB 4MVBD 1DEDA 4G80B 4M1DH 5B22A 1HXYB 3VFPB 5J06A 5J6HB 5E00A 2HRLA 1FL3A 2AABL 3BXNA 1OGAB 4BFBD 4MCZA 3HMWL 5E8PA 1IKFH 1T0MA 2JTDA 3UBXA 3I6KB 4MXVF 4BH8A 1A64A 1FYHB 1T22A 1QLFA 3EDEA 4XAKD 3V0VA 2CRYA 3TZVC 5D5MF 2Y07H 1CICA 4HKXB 1IQWL 1KTLA 5LQBL 1TVDA 1J05B 3OKNA 2AABH 1T0PB 2FHBA 1ZA6A 4L1DA 5I1DA 2AK4B 3HMWH 3SDXB 1M7DB 4I48A 1G7MB 3QHFL 1FFPB 1JVKA 2XKNA 3WFCL 3H8NA 2WQRA 1P6FA 3K3QA 1YMHB 4HH8A 1I3VA 3N0PB 4MNGA 2H6PB 2P5EA 1LK3L 5LQBH 3F7VB 4XH2A 1F90L 2ATKB 4KFZC 4XB7A 5C0IB 3PJSA 2VZTA 2CPCA 3C5ZA 5HDLA 2QKIB 4JM2A 1GGTA 4PJDF 3QHFH 5DT1L 4F80A 1QTYT 4HUXA 2QQNL 3WFCH 3FRPA 3G6JE 3TZVB 4AEHL 4J3VA 4K94C 3H9SD 3PQYE 3IJHA 5IVNA 1A3QA 3TNMA 1F90H 4PJ8D 2WQ8A 2J8OA 4JFFE 2D7MA 4LKXA 4ONHB 3T2QA 4DQOL 5FO7B 1FBIL 2FO4A 3BZ4A 4G6ML 2V5SA 4BFIA 1U8JA 3PXJA 4CADA 5L8KB 5DT1H 4I0PC 4IMLB 4NKDB 4G7VL 2QQNH 3I75B 4AEHH 4GRWE 3P0VL 3S4SA 2C1PA 3OF6A 5IBUB 2E6QA 1W0YT 3RVXC 1RK1A 3D0VA 1FZOA 1XEDA 3WO4C 3RIAK 2VDOL 3N1PC 1EEYB 1FBIH 5C8JB 5ACZA 3B2UC 4G6MH 3LD8C 2NY2C 5I8KH 4DEPB 4F3FB 3RWEB 1L4IA 1HH9B 3SGEH 3ILQD 4G7VH 5C0BE 1UT9A 4CKVX 4JCLA 3P0VH 2R0ZH 1EFXB 3H3KA 5JOPE 4IOFC 4QTIH 3DWTA 2WNGA 1OTSD 3BFOA 4RA0C 5E95B 3C8KB 1CQKA 2VDOH 1MUJA 1RZ8A 3MNVA 4LCCC 5LGJB 3T65B 2XTJD 2OR8A 4MAYD 1NGYB 3V7MA 3S35H 2VZVA 5DK0A 5T1KD 1ADQA 2EYSB 5SX4H 1HYRC 4K2UH 3SDDA 4LSRL 3P30H 5C0FA 4GG6E 5FGRA 3GI9L 4ZNEA 1LO2H 1NBZB 1NC4B 2HLAA 4PRDB 3QEQE 2PCPB 1NDMA 3BH8B 4ZTOL 4WHDA 3K74B 3KXFE 1HINL 4ENED 3QUZD 1MY5A 1D9KB 2V5YA 4DWHA 2ITCB 4U49A 3LDBB 4LSRH 2BVOA 4HMCA 3P4LA 2V5RA 4YGVB 2YMXL 4LCCB 1EX0A 1KTDA 3STZB 4XMLL 1INDL 3MBEA 1XGPB 4JRYB 1A6ZB 4M9PA 3TT1H 3GMPA 2QJDA 4ZTOH 2BSTA 3TVMC 3VI4F 2ZUSA 4LCWD 1HINH 4KJYA 4M03A 2XOTA 5BVPL 1S9VB 1QA9A 2X9WA 2PXYB 3UP1A 4UNUA 4KVCL 5TQ0L 2E7HA 1INDH 5GGSA 4WUUA 5DMKB 1P4LB 2R4RH 4M6OL 4TNWK 5D71H 4PJFB 2CO7B 4PJHE 4QYOA 2NXZB 1CDHA 1RHHB 4KI5E 4XTRD 3W0WA 1JGVL 5ABDE 1JK8A 1CQYA 2M1KA 5C0AB 4ELME 2DQDL 1YNTB 4KVCH 5TQ0H 4F9LA 3TVMB 4OLWL 4WEMB 3D0LB 3DX7A 4M6OH 5GIRA 1F6LL 2GITA 2IMNA 5C08A 5SV3A 1DLHB 2UUDH 2VWEE 4R7DA 1T66D 4UU9A 3CMOL 1NSNL 4OLEA 4YC2C 1BZQK 2DQDH 3QDJB 5FECB 1Q9KA 4HV8A 2C7UA 3QIBA 4OLWH 2YN3A 1F3DH 4X7DC 3U36B 1U6AH 2DLIA 1W0VA 4FS0A 2NLJB 3RVVD 1PEZA 1PVHA 4R8WL 3CGTA 1HI6B 4NZRH 4QHMB 1IGFH 1R6VA 5DD6A 3V9FA 4C56A 1NSNH 1OGTA 4NM8H 1YPZE 2AJ3A 3B9EA 2GSGA 4JFPA 5DQ9A 4HUUB 5A2IH 5EUOA 4IRZL 2RR3A 4M61B 4K7PX 2BCKA 2ESVE 4NM4L 4R0LB 2WSKA 1XR8A 3PGDB 4WIQA 4YC2B 1ORQB 3IFLL 3VXME 1EEZA 1P7HL 3HZVA 5HPOA 2LTQB 3VFRB 3LQZA 3SE3A 4IRZH 2P4AB 1KCVL 4P46B 5JDJA 3LEXA 4PB9L 3MV11 1PSKL 1X3DA 1OHQA 2C1OB 4HDIB 5JW4Q 4HC1A 4RRPA 3EYSL 4M43L 3MLSL 4PD4J 4UMGA 5DUPL 4JR9H 3BPCA 1IJ9A 3E6FA 3VWJA 4LPXA 1A6TB 4JHAL 1H3VA 5E2VL 4PGEA 1D6VL 4EN3A 5HYJB 3RTQD 4X5WA 1K3ZA 2YD3A 4V2CB 2X4TB 2K3TA 1IT9L 1C5DB 1KCVH 4TULL 2R1XA 5ALCL 2ICWI 4Y5XC 5L9DL 4PB9H 2R9HC 4U1KB 2F53D 3IETA 3VXUB 1T4KA 4I5BA 4DZ8B 3D48R 1NGZB 4KXZH 3EYSH 4M43H 1AC6A 3MLSH 5L2KE 1DE4A 5DUPH 4PGCB 3WV0A 2IPUG 5I1HL 2V9RA 4JHAH 2WIIB 5E2VH 3GI8L 1D6VH 1T1ZB 4X4YB 3V4PL 1NFDB 5GGTH 1JUFA 4XNQB 4PREB 5ALCH 4DJMA 5L9DH 1GYAA 2AV7B 5IHUL 4U1JB 1BZ7A 1WC7A 4F7EA 5L8JB 3BD3A 1FVCB 2NNAB 3KWWA 2JK5B 4HJ0C 3S88L 5E2TL 2DI8A 3TN0B 5D7JC 2JCCA 4LHJB 2FECL 5I1HH 4OZGE 2Z9TA 4M3JA 3MLPA 2G5RA 2X44D 2AK1L 4JQIL 4JO2H 5HYSB 3S96B 1KLFA 4Z95L 3CIQA 1TVHB 4HIXL 1XGQB 3QWRA 3CCHB 4LLYA 4XPAL 2I26N 1LWRA 3FTGB 3ZHDA 3I3DA 1I3RA 1KACB 3QH3A 4YXLL 4CL7A 3S88H 2YD7A 3V7AG 3EO9L 4L3CA 4YAQB 1TPXB 1G9NL 4X6FA 5FM5O 4JQIH 1FORL 4MD0B 4GRLB 5HHNA 1FFNA 4Z95H 2JLLA 3RIAF 1IM9A 1C5CL 3EJJX 4I4WB 1M05A 4P48A 1SY6A 1KB5B 4MX7B 5MERB 3SJVD 1ACZA 4XPAH 4E5XA 3U0TB 5HVGB 3UYRL 4YXLH 3SGDI 1GZQB 4R4BA 1ZT7B 3EO9H 4XBEH 4PJGA 4RMTA 3IXTB 1G9NH 1AGDB 4J4PD 5J9PA 4PIRF 2AQ2A 1FORH 3HTLX 3MV9E 1QOKA 4HGKC 5LWYH 4GRMB 5T1MB 3MMEB 1RMFL 1N0LA 1BQSA 4LP4A 1KIUA 1MI5E 1UB6A 1AFVL 3UYRH 5IFJA 3BP6B 1ZHNA 1CT8A 2A74B 2AXFA 5IHZB 4P2YA 3MV8D 3BRGC 4X9HA 4S11A 1ETZA 1F58L 3PGFH 5ETUB 3DRQB 3TCLB 1N2RA 2D3VA 1X44A 4P9HC 4PB0L 1RMFH 3OKDA 3F62A 1RHFA 1L6ZA 3S3PA 3QUYA 1NEZA 4PR5A 4LBEA 4G43A 4N5UA 4XP9H 2M2DA 4JN2A 3ZE1F 2B39A 4EUPG 2EKJA 5HDBF 3HE6C 2V7NA 2JB5L 4NQED 4PB0H 1A0QH 2IMMA 4AEIH 3HNSL 2EDNA 3QB7C 1MFAH 1SEBA 3FN0L 1MVFA 5IVXE 1H15B 1F6AB 1I85A 2OL3A 4PRAB 2YEZA 5CLTA 4OLZL 1OTTD 1CE1H 1ACYL 3MRGA 5DZLA 3LKQB 5DUMH 4L29B 2W65B 2AJYL 3DV4A 2BOCA 3FN0H 1UGNA 1OF2B 4QRQA 4LLUB 5CHNA 3TBTB 4KRPB 1VADA 4ZUTB 4KMTL 4MD4B 3ZZ1A 4D9QE 1UH3A 2CDGB 3S36L 5IV2A 1XCQB 1V3JA 1ACYH 5MEQA 4HH9B 4WV1A 1FO0L 3QXVA 1CN4A 2FNBA 2QSVA 1IEAA 3WNPA 3UTSA 2H41A 2AJYH 4KRMB 1AE6L 2A0LD 1J87A 5ESQB 1WAAA 2DQIL 2B4CH 2YXFA 1KPRB 2G60L 3WS3A 4Y89A 3ZDZE 5IR1A 4N0RA 1JZ8A 2VLKB 1QYGL 3T2PA 3RUGE 5EOQL 5TPWH 1G7JA 4TYUA 3TJEL 5F7NC 1IAIL 5ICXA 2F8OA 4KRLB 3GMQB 4G8GA 3IAPA 2X1WL 1AE6H 4JZNA 5ESAB 4JFDA 5HHME 4OFIA 4TSAL 1FZKA 2G60H 2BNQB 4FQHB 4LGPB 3KYMA 2P8PA 5J12C 5T3ZL 3TBWA 5HSFA 4G8EB 3KPMB 5EOQH 1KLGA 1ORSA 3EYOA 3TJEH 1IAIH 2ITDB 5TH2A 4JCMA 2B8OT 4XBPB 4MJ6A 2KBGA 4TSAH 5SWZA 1IAKA 2YSSA 1EO5A 5EZJA 5T3ZH 4FQXD 4NQSA 4OGYH 4OZIF 4PPTA 4PRPE 2UZIL 2NY3B 3DMMA 3QWOB 4K23H 5AZEL 3LKOA 4M5ZL 4NIKB 4M6NL 4MNHB 5HHOA 3T0EA 3ARFC 3KPOB 2EDQA 3MRDB 3OKEB 4LEOB 3IF1A 3CFIC 1XGTB 1DQJA 4ZPTB 1TNMA 2A73A 1X4ZA 4YXKH 3RNQB 3KPSD 2GTWB 2VL5B 2H3NA 3QQ3A 1J9CT 2UZIH 5AZEH 5I71C 1DUZA 1R5IA 3P77A 4KU1A 4M5ZH 3SKOA 1OD9A 2Q3AA 3QXDB 2EZ0C 5D1ZA 2AKRA 4M6NH 5HD8C 1JYNA 5HYQA 1P69B 1XF5B 3SDYL 5JA9A 3HZYA 4PJIE 2P47B 3G08B 2FX9H 3CLEL 2VQTA 4FFWC 3CFDA 4WGWB 1BGXL 3SDAA 5L0QC 4TQEL 3EUUA 1YEJH 3CX2A 4GO6B 4H88L 2XT1B 4EI5A 3K4DA 5JPMB 4KGJA 3G6DL 1RQ5A 1N7MH 3O6FD 1YN6B 2BNUA 1RULH 2WLZA 3O4LD 3DIFA 1NJ9A 1UACL 3CLEH 4I77L 4KZEL 4AZ8A 3KJ4C 3UC0H 5C0EB 1AC0A 1JPFA 1BGXH 1N64L 2P1YA 2DWDB 3BESR 1UM6H 5B39B 4Y4KD 4J6RL 4H88H 3KYOA 4JZJA 4DOHB 5D5MB 3P0GB 4E41B 1MCCA 4Y5VB 1U8KB 2LAAA 3EO0A 4I77H 5D1QA 5EU4A 5F7HA 3KYNB 5L0QB 5E2WL 2VXTH 5HI3D 4MVBC 3T8XB 4I3SL 4J6RH 3G6JA 1AR1D 5IHBA 4HC1H 4M1GL 3FL7A 1MY7A 3PQYA 4M8QA 1D5BA 2KDGA 4QRUB 2VISA 1WWCA 4JFFA 4XRCB 1JYXA 5CCKL 1R5WA 4HFUH 4HIJB 4MHHG 5E2WH 2VDRH 1AJ7L 3QBTB 2NZ9D 4YBHA 3VJ6B 4CVZA 4M1GH 1BVKB 5EZLA 3VFGL 1ND0B 2HP4A 2AJSH 2ADJA 1U58A 3DV6A 2ZCLL 5CCKH 2EH7L 1NAMB 5ACLA 4PRBA 3CSBA 1AJ7H 4U1MB 4R4FH 1HHHA 5C0BA 1X5IA 2R2BA 4X99A 3U4EB 2Q7NA 3MV7B 1I7ZB 1D5MB 3O3DB 2YUWA 1MJ8L 2ADIB 4LQFH 3R06B 1CE6A 4LKCB 3VFTA 1ZEAL 1ZVYA 4X5XA 1WQVT 2ZCLH 1LE9B 1CICD 3S5LG 1UJ3B 1GAFL 4OF6A 4U6XB 2FIRT 5BQ7A 3LQAL 2L0DA 3EDJA 43C9B 4BK5A 3IXAA 1B0RB 4U3HA 3RAJL 3GB7A 2GY5A 3KNBA 1MJ8H 3DBXB 4EEEA 2CJUL 4ZFFB 3IDIB 5I8CB 4GG6A 4PJ8C 3ROLB 3O3EA 5ICYB 2XV6B 4PV9A 1GAFH 2P5ED 3GSVA 3QEQA 1XIWB 3HAEH 3OV6A 1SY6H 3HCVA 3LQAH 3KXFA 3RAJH 5EZOL 4JM2D 3UTQA 2XZCH 2CJUH 3CSGA 3VRLE 5HHQB 1CU4L 4PY7B 3GMNA 4HBQA 1R5VB 2XZAL 3RGVB 4HK0A 5DSCA 5EZOH 5C92A 2JJTA 1AD9A 5HY9A 1AD0A 1MCEA 3QUXB 1WEJL 3ORJA 4KK6D 3MOBH 1NGWB 1P7QA 3DRTA 1OTSC 5A16A 1ZHLB 3IDYB 3P4OA 3OF6D 3FRUA 2MHAA 1J0YA 1M71B 5IFAL 2XTJC 2C9AA 3JSSA 2XZAH 4MAYC 4HPOH 2X4OA 1V3LA 3CFEA 5ADPL 3HPJA 5FA4B 5FYKL 3FT4B 2DYPA 1YJDC 4PJHA 3KLSA 2AVGA 5FK9A 1ZHBA 2CLZA 3SCMA 1MHHB 3JUZA 2W59A 3MNZA 5E8NB 1A2YA 4TVPD 4JFXB 4ELMA 1PZUB 3FOLA 5IFAH 1ZT4B 1VCAA 4FTVB 4ENEC 4OQTL 3QUZC 5ADPH 3HS0B 2VITB 2OL3H 5FYKH 5L88H 1RJCA 4Z7UF 1OP3H 1VACA 2V2XA 4PTUA 5D2NE 4H5SA 2PW2A 5EC2B 5F6IB 3SDDD 5J4MA 2IQAA 3VFNB 3G5ZB 3RX5A 5EUKB 1IAIM 3GSQB 1OARH 3CDCA 1ONQA 4YHLL 5FUOH 4XVSL 1LEKB 4HFWB 5F6HI 3DGGA 4ODXA 4Y8AA 3T1WA 1SQ2N 4HUVA 4NP4H 4RQQB 1VHPA 1Y6MR 4ZOEA 4X7CC 2PO6B 4GW1B 5JQHC 2EDXA 1YPZA 5BVJA 2OYPA 1IGYA 1XGRA 1CFBA 2FJHB 2EDYA 3U1SH 3EOYG 1MLBB 1YEFL 3OKMB 2VLLB 2VDKL 5I66A 3MBED 1F6FB 2ESVA 2H9GA 4XTRC 1CTNA 4QRRB 3T4AB 4F33B 1AGFB 1ZVSA 4DTGH 1A6UL 2QEJA 4GKNA 5GGRA 3X11A 3NCEB 2VDNL 3VXMA 1KJVA 4CNIA 1F11A 3CC5B 3WJJA 2ZKHL 1VKXB 1J1OH 1YEFH 2VDKH 4JANA 1I1FA 4WUUD 3BEVB 5BJTA 1IEBB 1FNEA 2ZCKH 3HZKB 4LLMB 5GGVL 5DVLA 1OGAE 3WEXB 4J1UB 1EHLL 1A6UH 5ID0A 1EBPA 2VDNH 3W0WD 2Z91A 4GKOA 4WW2F 2K1MA 4XVUC 1KB9K 1EUUA 1TZIB 3RVVC 2ICWJ 3EIFA 2AK4E 2GKIA 2I9TB 5BW7C 3SDXE 5L2KA 4JN1H 2CSPA 3FT3A 5DRXB 1EHLH 1K4DA 3UDWA 5C08D 4ZAKB 4C83B 2FRGP 4YFLI 1QQDB 2A6JB 5I17A 5GSRA 3U6RA 1ZE3C 2MWCA 4KQ3L 3SQBA 2DBJA 2GUOA 3ALWA 5H2BA 3O0RH 4U6VL 3DVGA 3QIBD 1NL0L 4I0CC 2X09A 2G2RA 5BV7C 1M7XA 5DD1L 3TO2B 1R3HB 5FDWB 3HI5L 3QIUB 1Q0YL 2EIDA 4OAWB 1T0NB 4OZGA 3TBYB 4J12A 4JFOA 1QBLL 4LHUB 1A1OA 4LQ1A 5AUMB 3JXAA 4KQ3H 3D18B 2HVJB 4RMSA 3C8DA 4UUJA 2F15A 3MJGX 3FQUB 4K3DL 4YHIA 1LE5A 5DD1H 3WE6A 1BFTA 3HI5H 4Q9BA 4N9OB 5EBWB 4WFFD 1HHGB 2FJFA 3G6AA 1YQVH 1KGCD 1MLCB 2Z35A 3QDGB 5DEGA 4DGIL 2F8XC 1H3UA 5K9KB 3RKDD 4ZFOL 3RTQC 1A4KB 4X9BA 2X4PB 1QBLH 4F9PC 1QEWB 4DZBB 4Z6AT 15C8L 5DLML 4A6YL 4K3DH 3E6HA 3EYQD 2GJJA 3U7AA 3L3JB 5ADOL 2LE9A 2UY6A 3IS1X 4ZUSA 1K8IB 5IB3A 2B7DT 2R23A 3VW3L 5EZIL 2DMCA 1U8OA 4DGIH 3O3AB 3MV9A 4YEEA 4KJWD 3MLYH 2A1WL 3VWJD 3JTSB 1HOCB 1YNKL 2B5IC 5F3BA 1A9EA 1DDHA 4EN3D 5DLMH 1MI5A 4A6YH 2JJVA 4PJEF 3VXOA 3BH9A 2OS7A 3BYTA 2HFGH 5ADOH 3MA7A 2N56A 4GAJL 5D70H 3BP4A 5E4IA 3VFWA 3ARBB 5CGMA 3VH8G 3FQWA 3BPNB 1N5AA 1NH6A 1MCKA 3QXAB 4QO1A 1YNKH 3LKSA 4PJ5B 1E4XL 1HYSD 4GKSA 5MHSE 4RBPH 2ZNWA 1YY8A 2D7TL 4YZFE 1H3TA 1HSBA 1QKZH 1J0KA 3D85A 3OL2A 4GAJH 5K9JH 4PTTA 4HS3B 3L3IB 3BWAA 1LK2A 4KKAD 4HWZB 1E4XH 3SE4C 5I74B 1ED3A 2JIXB 4NZUH 3IVKB 1BIIA 3WS6C 5IVXA 2D7TH 4JRYE 4K8RL 5DUBB 3QWRD 2VR5A 3WJLA 1DFBH 3GHBL 3CVHA 4J4PC 4UINL 4LSSL 5DK2A 1H5BA 3MLXL 3ARPA 4U6HA 4PYGA 2YBRB 2CRMA 2OM5A 4U7KA 4YH6A 4PGBB 2V7HA 1IM9D 1NC2B 4K8RH 4HHAB 4YUEH 3GHBH 3TO4A 1MJJB 4UINH 4LSSH 3WIFA 4PJFE 4OJFL 3MLXH 1PZ5A 4MJ5B 2XKUA 5I8OL 1J11A 4K9EH 4QHUB 1R3IH 3HRPA 4IHOA 5C0AE 4Y2OA 4Q97A 1ES0A 4U6YA 5FHAH 1MREL 4M00A 2J2ZA 4J7RA 1V5JA 1C16A 3V0AC 3PHOB 5M95B 1F13A 4G42A 4MD5A 1TTGA 4LCUB 2R29L 4OJFH 3T3MF 3S36X 3QUMA 2DD8H 1YY9D 5I8OH 3RUGA 4WW1B 1MFEH 3BGAA 5DJYA 3QO1B 2PR4H 4QHNB 3QDJE 1MREH 1UYWL 2YR3A 4K71C 5B8CC 3EYFB 4IMKC 1OTTC 5IROC 4D3CH 5E2JA 2P8MB 1U8NB 3G5XB 5INCA 4X0KB 3NTCL 1OAUL 2WINA 5JR1L 2ZOLB 3OXSB 4NO3B 1AQKL 5IT2L 4Q2ZB 1UYWH 4N8VB 2VAJA 2BMKB 5A43C 4LAQL 4AYFA 1P9MA 2E7CA 3MO1B 3DUUB 5C0RL 1CF8L 1VGKB 3I85A 1A4JA 3GRWA 3NTCH 5JLZB 1OAUH 2HTLD 1A7PL 2BVPA 2DQUH 2RQ8A 5IVZA 3A0OA 1OB1A 1Q72L 4JPKH 4DVBA 5JR1H 3RL1A 2BOBB 5IT2H 2A0LC 3MRNA 1B4RA 5B8CB 3C2AH 4KK8D 5GQBA 4LAQH 1XF3B 2CLVA 5JW3L 4FQCH 4B41A 3DHMA 3PIQB 1A3RH 2BY0A 5C0RH 2CIKA 1CF8H 4LPUA 3HA0A 1TXKA 3QRFM 4Y2DA 1ZGLA 1A7PH 2P8LA 1U91A 3Q6FA 1Q72H 4MJ2A 3IDJB 4GAYB 4O2CB 4F7TB 1XF2A 1I3UA 5DI8B 2PW1B 5J57B 5HYJE 2IAND 2G9HB 3UTSD 1H9VA 4HPYL 4N0YL 5EN2A 5JW3H 4P3CL 5CD3B 3PV6A 4PJIA 1KJ3L 3MFGB 2F19L 3BIKB 5C0GB 3VXUE 3UBXI 2VDML 4OV5B 2HJFA 4MB5A 4AY0A 5CJXC 4PRIB 1XH3A 2RBLA 3AROA 1QVOA 2B1HL 2BXZA 3H9HB 1CDUA 2J3SA 4DGYL 3LZFL 4QNPF 2ED7A 1NFDE 3NH7H 4N0YH 1AP2A 4ZD3L 4F15C 4YNYA 5TQ2L 4G8GD 1KJ3H 4NT6B 5DJ6B 2F19H 3I2CH 2VDMH 4JFDD 4FQXC 1WISA 3FT2A 2XN9B 4LDEB 2IH3B 5AYQA 3LHPL 4Y4HA 4ODBD 2B1HH 3JV4B 4EIGB 4YEFA 2NW2A 2Q20A 1G7IB 5E6ID 4DGYH 3LZFH 3O2WL 5IMOB 5I8EA 4XVTL 2EE3A 4ZD3H 1URLA 2E3VA 5TQ2H 3UZEA 2FR4B 5IEHA 3ZT7A 2IEPA 5SWZD 4ZMAT 2XZZA 4DN4L 4P5MB 4WTZG 4EDWL 5FB8B 1CG9A 2XRAL 2DL2A 1MCWM 1HEZA 4JY4A 1B9ZA 3BDXA 2F74A 3FQRB 3DMMD 4F2MB 1YYML 3NCYS 3ARDC 2D0FA 5H35A 4ZG1A 4OZFA 1U8QB 1D6EA 4KQ4L 5F1NB 5HHOD 3T0ED 3THML 3NIDF 4UAOC 4Y1AB 4FQIH 5CZXC 5HDQH 4EDWH 5BXFA 3M45A 4ODSH 4JE4B 2XRAH 3T77A 3NZ8A 1A1MB 2K9UA 5D7IF 3GBLA 5I1AA 1YYMH 1WTGT 4EI6B 5TFSL 1KEGL 4CAGA 5DJDA 3K80A 4G8FA 5D1ZD 6FABL 4L8SB 1JBJA 2IG2L 3T0DA 2D7NA 3EO1A 1S7QB 1LDPH 3L5WA 3MODH 2P49B 1INQA 4LSQL 1DQML 4ODHL 2VN4A 2GJZB 1NLDL 3SDAD 3FO1B 1ITCA 2R39A 2HRPL 4NSKA 3B2VL 1UQSA 3L7FB 4IRJA 3WIHA 3ARDB 4EI5D 1KEGH 1MHEA 2VLMD 5MEPB 6FABH 3DURB 3I6LD 3ZKQD 4MZ3A 5DDHB 5KSVB 2EEDA 4LSQH 4ODHH 1CD8A 4ORGA 4PP1D 3D2UA 1NLDH 2HRPH 2CDFB 3UPRA 1QHOA 4JDTL 3B2VH 4H25B 3QRGL 4QHKJ 1AGCA 3X3FL 1XF1A 4H1LB 1ULVA 5T33L 5I1KL 1T1XA 4C59B 3LVEA 2VIRA 2ZJSL 2WUCL 2NZ9C 5D1QD 1C1EL 3R1GL 3F7PC 4FMFA 1LD9A 5MP6L 5K9OB 3BEWB 4P4RB 3QRGH 3BDYL 3X3FH 3GKZA 3NIGE 3T2NL 1CS6A 1KCUL 3PQYD 4TOYL 4WDIB 5KG9A 1BF8A 3AS1A 5I1KH 1S9XB 1DVFA 1UEYA 3VD3A 2ZJSH 2WUCH 2AXGA 4JFFD 5A3ID 5FYJL 4UIMB 1C1EH 3R1GH 3AAZB 4O2FB 3LN4B 1EZVY 5CSBA 5F44A 4H26B 3WSQL 5DVNA 4W4NA 5C07B 3UYPA 1FNFA 2E7LA 1Y18B 3VG0L 2R15A 3S34L 1CICC 4P3DB 2WM0A 4W4OA 4TOYH 2VDQL 4QF1A 3L95A 3EJZD 4BH7A 1DUYB 3LMJL 2Z4QA 5KAQF 3Q3GB 4WHYH 2VLKE 3WSQH 2EIEA 3TBSB 4KC3B 4JGMA 2NX5B 3SE8L 3KPPA 5C0BD 1F4XL 2IH1A 5AAWA 5T3XE 1WZLA 2Y72A 3S34H 2X4SA 4GXVL 5JOPD 5AZ2L 3MC0A 2VABA 1P2CB 2VDQH 1EO7A 4PJCF 5C09B 5FUCE 1FL3B 2O26U 1SJEB 4NZJA 2I07A 3LMJH 1MFCL 3C5ZC 2BNQE 4JM2C 1VFAB 1VGEL 1IM3B 3CJJA 1MF2L 3NIFF 3P2TA 1QNZL 5D2NA 3SE8H 1Y0LB 1F4XH 2A6IA 1ZGLP 3TH4T 5MI0C 5AEAA 5AZ2H 3GJFK 4LPYA 5I1IL 3H7LA 3BQUA 5IKCA 1IC7L 1NBVL 2BVQA 1MFCH 3DYOA 4JM4L 2NR6D 2X70A 3QEQD 1RSFA 2VJXA 1B3JA 3KXFD 4GW4A 4KK6C 1T80A 1QNZH 3G5VB 5GGSY 5JIIA 4K7FA 4L9LB 4P5KA 1BFVH 3QNYA 1T2XA 3ZMRA 2H1PL 1BBJA 1RZJL 4HKZA 3RGHA 5I1IH 1WUNT 3PJSB 2DL9A 1IC7H 4OFPA 2AJUL 1XFPA 5DA0B 3C5ZB 3IDNA 1I8IB 4JM4H 1JPTH 12E8L 2WAHA 3MREA 4X8JB 3W9DA 1G7HA 3IT8D 2H32B 3UXFA 2H1PH 1MNUL 1RZJH 5FIEA 3B9VA 3KYKL 1GC1L 1P7QD 2VXSL 1HXYA 4AEFA 3VFPA 3DX9B 1CLYH 4F7PB 1MAKA 1JYWA 5BS0B 3MJ6A 5J6HA 4LSPL 12E8H 5HVHB 2K7PA 5I0ZA 1DBML 3T0WA 1IGTB 1U8JB 4WFEE 5TGBB 1OGAA 5D2LF 3I6KA 2DYPD 4X6DF 2F54B 1MNUH 3SDDC 4JVWA 4DAGL 1A7QL 3B43A 3SCMD 1GC1H 1FV1B 5FV2A 2VXSH 4HKXA 2HJLB 4H8WL 1DBJH 4HWNA 1B88A 1BQUA 2B4CC 3LH2L 4TNVF 1J05A 4LSPH 1DBMH 4L4JA 3GSUB 2AK4A 1CTOA 3SDXA 5I73C 3WD5L 1T1YB 1M7DA 1O0VA 3GSXB 4P5TB 4XNXH 1FG9C 1G7MA 3V8OA 3H6JA 5GGQL 1FFPA 5CP7B 4DAGH 1A7QH 4MXVE 4AQ1B 1YMHA 2RGSA 3KPNB 2H6PA 4DOHE 1OW0A 4H8WH 1MUJB 3F7VA 3LH2H 5D5ME 4E41E 2ATKA 2Z92B 4CVUA 1E6JL 1E28B 2XY1A 3OKLB 5C0IA 3FQTB 3MBEC 4WW2B 5H37G 4YGAB 1N3NB 1JF5A 5CSGA 3GMLA 2QKIA 4UB0L 3WD5H 3QHZH 3ROOB 3SDDB 5DD0L 4RGMC 3D3VB 5ESVB 2HLAB 1E6JH 4LIQE 1T89A 4ONHA 1FP5A 2RHEA 4HBCH 5FO7A 1CXFA 4UB0H 1PKQB 4XP1H 1SM3L 4JAMB 4IMLA 4NKDA 3WUWG 2ESVD 1Z2KA 3I75A 2OZ4A 4TVSa 2BVOB 5DD0H 4JJHA 1N8ZB 4PJDE 4IOSD 4R3SB 3U82B 3W11D 5KVGL 4EJ1C 4MNQB 4ZS7L 4OCXL 4F9LC 3VXMD 5DURD 4P59H 1GOFA 5A2KH 2EC8A 3H0TB 4OD3L 5C8JA 5EWIL 1SM3H 1OSZA 3RWEA 4F3FA 3HFML 1HH9A 1OP5H 3NBNA 1OAKH 3MV7E 3UJIL 1EFXA 2BX5A 3K1DA 4O9HL 4RGMB 5KVGH 2DQFB 5DGQA 4KTYA 2A77L 4IDLA 4XPTL 3C8KA 3QIBC 3UJTL 2MJWA 3PGCB 4OD3H 2ORBL 1TDQA 5LGJA 3T65A 1WIOA 1NGYA 4FQQB 2KQMA 4YPGB 3TC9A 4CN4A 2DDQH 2EYSA 3K46A 1IFHL 4MQTB 4DCQB 4O9HH 5C9KA 2NZIA 4M5YL 3F6LA 4GLRH 4XPTH 1YEEL 3UJTH 1TZHB 4E42B 2CUHA 1NBZA 1NC4A 4PRDA 3RWHB 1JGDB 1M4KA 3BH8A 4OZFH 1D7FA 4PJEB 1U93B 3RKDC 3MSPA 1IFHH 1D9KA 2LU7A 4N9GB 2ITCA 4HKBB 3QAZB 1UADC 3GEWB 1EDQA 4HV8B 4YGVA 4NWUL 3EYQC 3ARZA 3SE3C 3STZA 2W0FB 4WO4B 2XWTB 1XGPA 4JRYA 5EDXA 5FYLE 1QHPA 4IRSB 4X4ME 4KJWC 1S9VA 4C56B 1OGTB 4IS6B 3VWJC 2PXYA 4UV7L 3MLTB 4JFPB 4EN3C 3BPLC 3OAYK 4NWUH 3WIHH 2YA2A 5DMKA 1P4LA 3FKUS 3QYCA 4UNVA 3JV5A 1HSAB 4PJFA 3VI4E 4AG4L 4KTDL 1RHHA 5TF1H 4UV7H 1HYSC 1EEZB 2X10A 2YRLA 4HUKB 4OM1H 1JFQH 5C0AA 4DKFH 2XNAB 3MV9D 3LQZB 4G9FB 4DN3L 5CP3A 2ZCHL 1YNTA 3SKJH 3TVMA 1Z9SA 3VFMB 3D0LA 1MI5D 4FTVE 3L3GB 4AG4H 4KTDH 4CRPA 4GJTB 4QGYA 4KKAC 1DLHA 3SGKA 4PGEB 1OL0A 1BBDH 1JV5B 2DMBA 4DN3H 1QR1B 3AB0C 3T08A 3QDJA 2CXKA 5FECA 1TJIL 2SEBB 3U36A 1HHIB 4WU5B 4XZUA 3NFPA 1DJSA 3U9PH 2NLJA 4ZUVB 3D85D 4B7LA 4MLIA 3RZCB 4HIEB 1HI6A 1PFCA 2WBJB 4QHMA 3MJ9L 4FMKA 3R0NA 2HFFB 3MOQA 3O4OB 5H94B 5DZOA 3TPKA 4CDGC 1TJIH 3QJHB 4NQCB 4HUUA 5F7FA 1TLKA 2X4NB 2VZ3A 3CSPA 4M61A 5TDNB 4G3YL 2M8XA 2NY0B 4R0LA 4QRRE 3PGDA 3MJ9H 2M26A 1NQBA 4XVJL 3UTPE 1ZLWK 3VFRA 1XMWA 1MIML 4P46A 4UDUB 3DX8A 1YY9C 4G3YH 4D0BB 4K3HA 4PRHB 4HDIA 4P2QB 2EO1A 4NO0B 1WBYB 3TO4D 3IFOA 4D9QD 3B83A 5F9JB 1P7KB 2Q7YB 1FFNB 1A6TA 4KH2A 4XVJH 4LDLB 1M05B 3HAEB 5HYJA 3MCG1 4MYWB 3M1BA 3QUYC 2X4TA 4CJ0A 1MIMH 1C5DA 1OVZA 4U1KA 1JHLL 3VXUA 3LN5B 4DZ8A 1NGZA 5J9PB 3JWDC 3CX5K 1EGJA 2HTKD 2IALA 5SX5K 9CGTA 4PGCA 1X6LA 3C2SA 1WGOA 3NCYP 2WIIA 4X4YA 5CZVH 5IIEB 1T1ZA 4HCRL 5B21A 1NFDA 2DLFL 4XNQA 4PREA 2AV7A 1I85C 5CD5D 1JHLH 1MFDH 4U1JA 1CDGA 5HHMD 1FVCA 1VFUA 1UXWB 2NNAA 2APXA 2HTLC 2JK5A 4MSWB 3TN0A 5KANI 3NPZB 1NCWH 3K8LA 4HUMB 4MLSA 4KK8C 3MRCB 4HCRH 1NCCL 5HYSA 3S96A 2X4UB 3QUYB 1NEZB 1TVHA 1XGQA 1ZGLM 5EH1A 3HUJF 1IRAY 3CCHA 4LLQB 2H45A 3CVIL 5CFHA 3MRMA 3FTGA 2FO1A 1F3RB 3V6BR 1N6QH 5BOPA 3D69B 4FNLL 4YAQA 1NGQL 3ZT5A 2W92A 1BREA 3O8XB 5HVFB 3QDGE 3MRHB 4WV1C 4PLOB 1NCCH 4GRLA 4PRPD 2XQYK 3GMOB 4FXLA 1PG7X 2BNRD 4I4WA 1SBBA 2OL3B 1KB5A 2D0HA 2BSRA 1S8DB 4MX7A 5MERA 3CVIH 1HZHL 1M6OB 1R0AL 1GZQA 1DCLA 1ZT7A 4FNLH 1NGQH 4KROB 3IXTA 1AGDA 3MRGB 4WI4A 2JJWA 1G9ML 4LSTL 3T3PF 4GRMA 5T1MA 3MMEA 5D8JH 4OQ1A 5CHNB 3N9GL 1AKJB 1VADB 2I25N 3BP6A 2A74A 1R0AH 1RVFL 5IHZA 2DQHL 5IV2B 1LEIB 2CMRH 5ETUA 3DRQA 2C26A 3TCLA 3P9MB 2KPNA 1G9MH 5IB4A 3VA2C 4LSTH 1U36A 4F37K 2Q6WA 3AGVA 5D7IB 4PJ5E 4LAJH 1G0XA 3QP3A 3N9GH 4O58L 5GS3A 5IB1B 3B8SA 3VXQB 2H8PB 3WS3B 3CZFA 3JV6B 2DQHH 3S37L 1BVLB 2D0GA 4JY5L 2X42A 4J3OC 2L7JA 1JGUL 1F2QA 4NKOB 4AH2B 1B6DA 3MCKB 3IJYB 4JQVA 4K55A 3U0PB 3DMMC 4Y4HD 2E6PA 5GISL 3ZE2F 4O58H 3T0EC 5F7EL 4R2GD 1H15A 3LCYA 2ZSVB 4PRAA 2ZUYA 4XHQA 3KYMB 4ODVL 2WZPD 3K8KA 4JY5H 1JYVA 3EAKA 3ZE1E 5HDBE 2Y9RT 3IGAA 2ARJQ 1CR9H 5D1ZC 3F58L 5JPNB 4L29A 2W65A 4LCIL 1OF2A 5SWSB 1BQHG 1OP9A 3TBTA 2H26B 1S7WB 3FO0L 4UT6L 3SDAC 2CDGA 1ZXQA 5DHVH 1U3JA 1J0IA 3TESA 1FN4B 4HH9A 5IBTH 4EI5C 2QQKH 3KHQA 3MRBB 1IEHA 1ZLUK 5IMMB 4M93C 1WLHA 2HN7B 1YA5A 1GPOL 1MQKL 1DQJB 2FEEI 1PBYA 2AEIT 3EBAA 2I60H 1KPRA 4UT6H 1JZ6A 2VLKA 1UZ8B 4F7CB 5HGBB 3AMLA 3ARWA 3GMQA 5F9WC 4IRJD 1ZWIB 1MQKH 3EJYD 4PGDB 5ESAA 1ZLVH 4LFHD 2APBA 5D1QC 2BNQA 1BEYL 4FQHA 3VFUB 4LLDB 4G8EA 1I7UB 2NY6D 3KPMA 2CLRB 1JGLL 3D2UD 3WL9B 3DECA 4KY1H 1NBQA 2ITDA 2J6EL 4M93B 1EXUA 1WCBB 4YXHL 5C6TL 4Y88A 4XBPA 1ITBB 2D03L 4JHWH 5C2BL 5A3IC 4Z7VF 1FH5H 5JUEL 1VA9A 4LPCA 4PJCB 5AAMA 1BEYH 3P4NB 2VN7A 4ZFOB 1U95A 1RUQL 1BLNA 1UWXH 2BSSB 1JGLH 3KYOB 2NY1D 3RHWK 1DP0A 3I9GL 2EH8L 3HPLB 3QWOA 4A6YB 2J6EH 4YXHH 3WFDL 3SKNB 2D03H 1GGBL 4MNHA 3EJZC 5E8DL 1OAYH 1FFOB 3KPOA 3MRDA 3QZWG 1I9EA 5JUEH 1J1PL 3OKEA 4LEOA 1NAKL 3K81A 2IAMB 1XGTA 2YA1A 1P1ZB 3MRFB 4KPHL 4R6UA 1RUQH 3Q0HA 1DVFD 4M4RA 4ZPTA 4XI5D 3MTRA 4Z7NF 2GTWA 1U92B 3ZKXC 3I9GH 2VL5A 1TQCB 2EH8H 2EDTA 1LMKA 5MEOB 1LNUB 3PQYB 1D5BB 1U2CA 5DC4B 3WFDH 3BI9X 1QLEH 1GGBH 4P57B 3P0YL 3KGRA 5B4MD 1XF5A 4Y0GA 2QQLL 1NAKH 1R3LA 4IBLT 3G08A 4KPHH 1FC1A 1W72L 1QACA 1WIPA 4WFHE 4O4YL 3PWVB 3CXDL 4K9EC 5DJ8B 4JDVB 4PRIE 3ULVL 5JPMA 3RVWC 4Q9CA 4HWBL 3P0YH 1E4KA 1YN6A 1MWAL 2NR6C 1U41A 2QQLH 1KIQB 2C3HA 4PRBB 1KCKA 1W72H 4JKLA 2FX8H 4O4YH 1K85A 5C0EA 5TE7L 1SYSA 2JB6B 2XN9E 2AQ3A 2R0KL 5B39A 3ULVH 5D2LB 1FAIL 3SO3B 1T6VN 1KT2B 2VRAA 4XHJD 2NY4D 5IWLA 4OGZA 3NZHL 5GRVK 5D5MA 1REIA 4E41A 1BJMA 5BRZD 2X4QB 2B0SL 4Y5VA 1U8KA 5BQ7B 3BQUD 5GGRY 5FYJU 3JVGA 5TE7H 3GB7B 3KYNA 1U8IB 2JJTC 4H0HB 2R0KH 1PGRB 2CQVA 3T8XA 2C3VB 4LNRB 3ZKSD 1EAPB 1FAIH 4NCC1 5CINH 4D2NA 5LGHL 5IBLC 4ZXBD 1ZLVK 3FZUD 3GSVB 4QRUA 5E2UH 3O2DL 4XRCA 3NCJL 1A47A 3LIZL 4Y1AE 4HIJA 3E2HC 3GIZL 3VI3F 4ZNCD 4X7TA 4S0SD 4KI5C 4QLRA 3VJ6A 3SCMC 1BVKA 4PJDA 3GHEL 1UEMA 1ND0A 4WRLA 4ZUUB 3O2DH 3LIZH 1G0DA 5DSCB 1MCBA 1NAMA 5I1EH 3TJHD 3F12B 1J86A 4U1MA 2F5AH 1OGAD 3BIAX 5JNYB 2VWEC 3MV7A 1I7ZA 1D5MA 2ATPB 3O3DA 1RZGB 2ADIA 3GHEH 3R06A 4LKCA 4Y5YC 4FZ8L 1BJ1H 1LE9A 4RAHA 1UJ3A 1N0XL 4U6XA 3T09A 1XF4B 1FNLA 43C9A 1B0RA 2AK4D 1FL5B 3MUY1 1KULA 3MNZB 1Z5LB 3IRZA 3O3UN 4ZFFA 3IDIA 5GS1B 4Q0XL 3QPQC 4FZ8H 3ROLA 4NGHL 5ICYA 5B38G 1WBXB 2VH5L 3SY0B 1N0XH 4G6FB 4OF0A 1AH1A 4RA3A 1XIWA 4HT1L 4HUNB 3MV01 1V05A 3M17B 3GJEA 1M7IB 1NANH 3E3QE 3SKMB 1CK0L 4ODUB 4FQPA 2NXYB 3W11C 1TZGL 1JRHH 4Y5YB 4EQ2A 3TZVD 4NGHH 3LRHA 4NNPH 5DVOA 3WJJC 3NPSB 1WITA 4NNYB 3HMXA 3PXHA 1JHKH 4PY7A 4WFGE 1U3HB 1R5VA 2YD1A 4TN9A 2FB4H 3RGVA 4X9IA 1EJOL 2FWOB 3HB3D 1CK0H 2W0LA 2YWZA 1DN0B 4X4MA 3RVTD 5FGBA 1TZGH 1FE8H 3QUXA 5EFIB 5BVJB 5C07E 5I16A 1XCTB 1C8PA 4UOW0 1IGYB 1RUKH 1ZHLA 1NKRA 4S2SB 2GJ6B 3KHOA 1M71A 1CL7I 2ZG1A 4JGJA 3W5MA 1C12B 2GY7B 3HC4L 2FEEL 5IW6B 3DVFA 5FHBL 1JPSL 5FA4A 3U30C 3FT4A 5IUSA 4CN6A 3MGAA 3BO8B 2G75B 2NX5E 3UDWC 1MHHA 2VXQL 2ZG3A 4ETQB 4YHYB 1CGXA 5E8NA 1EFXD 3PWNB 4MMZC 4JFXA 5J7CC 5C09E 4HSQA 3WFHB 1ZT4A 5D93C 3BAEL 3L3KB 4BSVB 4FTVA 3HS0A 3OGOE 3OGCB 2VITA 1G84A 4CUCA 2QL1A 4P0DA 2X41A 1KELL 3MACL 2P42B 3FFDB 3UTZB 3LEYL 4PJGF 4YWGL 5EC2A 4OLVL 4GW5B 3VFNA 3G5ZA 5EUKA 3MLVL 5IQ7L 3GSQA 3BAEH 1VDGA 4TSBL 2DKUA 2QSTA 5I1GL 5MHSD 1NC4D 1NDGB 3RHWF 5L2KB 1HH6B 4HFWA 3MACH 2DM2A 3LEYH 3NACL 2PO6A 5I1CL 2CR3A 4Z7UE 1D9KD 5IVOA 1S7RB 4M48H 2FJHA 5IQ7H 1MJUL 5ISZB 1MLBA 4TSBH 4Q58C 3OKMA 5I1GH 2R1WB 2VLLA 2G2RB 3VXNB 4JRYD 4JEGB 4QRRA 2W0PA 4F33A 3MXWL 5DA4A 3NACH 5I1CH 1OT1A 3JTTB 1RZKL 3CC5A 2PXYD 5CLWA 1VKXA 1MJUH 5I2IB 1B4JL 5BS0E 4YE4L 4HJJL 3V52H 3BEVA 1IEBA 5JHDB 1CGUA 4LLMA 4M3KB 2PTVA 5E99L 4YHKL 4ZO9A 4ZOAA 5CBEB 3MXWH 4J1UA 3U2SB 4OCLC 4NDMA 2F54E 3VGDA 2NXZD 5ILTH 2EEAA 4ONGL 2V9TA 1RZKH 4OV6F 1BFOB 2HFTA 3I6GA 1B4JH 5C0AD 1SMAA 4HJJH 1LO5B 2OMNA 1TZIA 3TVMD 1W2KT 4YHKH 2I9TA 1U8OB 1F02I 2HVKB 5DRXA 3QEUB 4ZAKA 4FFYL 3EDDA 3UTOA 5DVMA 3DGCR 4NN5B 1VPOL 4NPYA 5F89B 5KOMC 3QDJD 3WJLC 1CIUA 5L6YL 3BUYB 2OLDA 3OJMB 5JW4N 2D7OA 1H5BC 3TO2A 1R3HA 5FDWA 1CXIA 3OX8A 3QIUA 5KSBF 1T0NA 3TBYA 1FNAA 4NRZB 4R97C 4Z76B 4LHUA 5AUMA 3PNWB 3D3VE 2AXJA 3D18A 2HVJA 1QFWL 4EQ3A 3G5YB 1HSBB 3FQUA 5LG1A 1GCFA 5L6YH 3T0AA 3TO4C 1JZ3A 1PKQE 4UIKH 2PNDA 5EBWA 4FXGB 1G7QB 1HHGA 3V0WL 1MLCA 3QDGA 4HJGB 5K9KA 3QCUL 5DD3L 1VFBB 4M6AA 4YDVA 2NY7L 2X4PA 4WUKL 1SJHB 2ZPKH 1SHMA 4MNQE 1R3KB 1QEWA 4DZBA 1QFWH 3GSNL 4JG0H 4QXWA 4PG9B 1UFUA 3L3JA 3QA3B 2HTKC 4P46D 1K8IA 3IDUA 1JNJA 1FJ1B 3V0WH 5F1IB 5KW9L 3QCUH 5DD3H 5IG7B 1T1WB 2NY7H 3UCRA 4HX1A 1HOCA 5BMFL 3QDHA 3ULUL 2MCPH 5CD5C 4PGZA 3GSNH 4CMHC 5HYJD 3WDHA 5T3ZE 4HLZG 5DWUL 5LCVH 4N0FB 2DB8A 3MRIB 1X5KA 1QBBA 4FZEL 3VXUD 1IBGH 3ARBA 4L9DA 4NFCA 4UQ2B 4H20L 3DO7B 5E1HB 3ESVF 3MA9L 3QXAA 1ES0B 1XAUA 5BMFH 1YUHB 4PJ5A 3ULUH 2BRRH 1FQ9C 1JNNL 3AM8A 4N68A 3VGAC 4G42B 1P9MC 5KAQG 4Y16B 4ZOCA 1ZVHA 1LO0H 3B8YA 1EAJA 4PJEE 4FZEH 4FA8A 1L0YA 1T5XB 4HS3A 2YZ1A 3L3IA 4ZFGH 1CD1B 3LKNB 3TN0D 4XMPH 5F9OH 4HWZA 2IC2A 4YDLC 4BSWB 1RY7B 4XCFH 1JNNH 2JIXA 1I8KB 5EIVA 3IVKA 4OKVB 4QCIB 2DRUA 3ULVF 3PHSA 5DUBA 4KUZL 2WP3O 5D9SB 4K7PL 1RPQA 3D5OF 5SWQB 4X7FC 3S37X 3INUL 1F4WL 4Y2DC 4U1GC 3C60B 4C56E 1NBYB 5F8RC 4CU7A 2YBRA 4EZMA 3EDKA 1I7TB 4X7EC 3GK8H 2C4FU 2EDBA 2G5BB 4PGBA 4GRLD 1S5IL 1CL7L 1NC2A 4HHAA 4KUZH 4K7PH 3B9KB 3INUH 1MJJA 2J12B 3FO9A 1EVTC 5KSAB 4MJ5A 3L3DB 4G6AD 5DFTA 1A6AB 5AWNH 1U3ZA 3MRNB 1N5YL 4WEBL 2FJGB 4JFEB 2ED9A 4G9FE 4WNQB 1S5IH 4C57C 3R4DA 3PHOA 3T4YA 2GEEA 3L5XL 1GXEA 4LCUA 4Y2DB 1U91B 3Q6FB 4Y4HC 2J4WL 4NZTL 2ENSA 4WW1A 3VD5A 3QO1A 3BDBA 2GAZB 4WEBH 3ZO0A 1N5YH 4NKIL 3MUZ1 4QHNA 4R2GC 3PV6B 4S1QL 1JP5A 3WLWD 32C2B 3EYFA 5DQJB 1OLZA 2HJFB 2P8MA 3G5XA 1RU9L 4YDIL 1FRGL 4OI8A 1AO7B 1MSPA 3LEVL 3OR7B 2J4WH 4X0KA 4Y19B 4NZTH 4XBGB 5IB2B 3T3ME 2A38A 3BD5A 3MRLB 3MGTB 1PYWB 2ZOLA 3GO1L 1AP2B 4NO3A 4Q2ZA 4S1QH 4BZ2L 1Z3GL 2BMKA 2CGRH 1KLUB 4NQCE 2P5WB 1MCLA 2OI9B 3MO1A 2O5XL 3QPXL 1Q0XL 3GSOA 1RU9H 3DUUA 5GRUL 5GZOD 1WJ3A 1VGKA 3LEVH 2AGJH 5JLZA 1MFBL 4MA8L 2R2CA 2NW2B 2BOBA 3GO1H 2CDEB 3UAJD 2ZG2A 3LPWA 1Z3GH 4NN7B 3QFDB 1XF3A 1L7TL 2UWEF 1P84J 2IPKB 3QPXH 5GRUH 3OJDB 3PIQA 4U0RC 4Z7VB 4RFNC 4KRPD 4PRHE 2X1OA 4P2QE 4JHZA 1MFBH 4MA8H 3N1GC 2OJEB 3F7RA 3IDJA 2J88L 4GAYA 4O2CA 4F7TA 4IRJC 5DI8A 1WBZB 2PW1A 3EJYC 1TITA 3ZE0F 1BHGA 4X9GA 1J88A 1L7TH 2DIJA 1IARB 4U33A 4WY7L 1S9WB 5CD3A 3VGHA 1VFMA 3NMEA 5C0GA 3BSZL 4OV5A 2NY6C 4G6KH 1LP9F 2Y7QB 2E6JA 3WFEH 1T6WA 2VLKD 5C0JB 1KJ2L 5I1AB 3GNML 5T3XD 5DJDB 2R2EB 1MHPL 1BQLL 2XPGB 3KR3H 4WY7H 4NT6A 4U0RB 5DJ6A 3BSZH 4HG4K 2EDJA 4K3EL 4LSUL 3RFZC 2XN9A 2BNQD 1EVUA 5EU7E 1KJ2H 3JV4A 4ISVB 4LSVH 3GNMH 1G7IA 1GIGL 1MHPH 5IMOA 3VG9C 1H3GA 3ARGB 3BWUC 1DVFC 4QNPE 3IKKA 2X5PA 1J1XH 4ORGB 2FEDD 4K3EH 1EIBA 5FKAB 4LSUH 2FDBP 4PJ7F 2VR4A 4P5MA 4XPBL 1UCTA 1E4WH 5LAXA 3UPRB 5FB8A 4NKQB 4DGVL 4U1LB 2E7LC 3CH8A 1GVIA 1GOGA 3QULB 1KSRA 5B4MC 3QDMB 5ICZA 2NY3D 3FQRA 5E7FA 4F2MA 4W4OC 2X89A 5FYKE 1U8QA 5F1NA 2VIRB 3P11L 1S7SB 1QFWM 5HGAB 4Y1AA 2R2HB 2WBWB 3MRRB 4XPBH 1F45A 3QWQB 4DGVH 4MWFB 1U8PB 3ET9F 1A1MA 4OI7A 4G8IB 1RJZB 3VG9B 1J12A 1P4BL 2VC2L 1DVFB 3RBSA 3HZMB 1GRWA 3P11H 4L8SA 4N8VG 2AXGB 1S7QA 4D9LL 3MXVL 2ZUXA 4MQXD 4QXTB 3NIDE 4WFED 2GJZA 5JW5B 2YD5A 5D2NC 2AEPL 3FO1A 4BK4A 4OD1H 3H42H 2NY4C 4RMQA 4MDJB 3L7FA 1FG2B 3ARDA 2BY1A 1I9RL 5D7IE 3WIIL 1P4BH 2VC2H 5T5FL 3BQUC 5BZDB 4PY8I 5MEPA 3DURA 1T04B 1TCMA 3CDFA 3L5JA 3AUVA 2MPAL 5DDHA 5KSVA 4PLKC 5F1KC 1JGEB 3O45B 1Z9LA 2AEPH 4PJAF 2Q86B 3MR9B 2CDFA 1FLTX 1RZ7L 1NPUA 3FZUC 2VABB 4H25A 1I9RH 3Q6GH 3WIIH 2EZ0D 4H1LA 5HD8D 5HPMB 3RKPA 3BD4A 1FZMB 5C7XL 4E41D 2MPAH 4RAVB 5HDOA 2AS5M 1B2WL 1I8LA 1MCPL 1WWWX 1FNSH 1FFRA 5I75C 3T0XA 4XMKL 1IC4L 1KN4L 1RZ7H 5K9OA 2NY5C 3BEWA 3RDTB 4P4RA 4EUPB 4ZFZB 2D7QA 5CUSL 3BQUB 1T2QL 3CH1A 2AXHA 2E27H 4NCDA 4WDIA 3ZTJH 5K9QG 2X70B 1S9XA 2IWGA 5SWSE 4GKZB 3NGBB 4Z0XB 4GW4B 4UIMA 3VFVA 4XX1E 3AAZA 4O2FA 3LN4A 4H26A 2HYMA 4XMKH 1KN4H 4PJ9B 4Z5RB 2EIZB 5C07A 4NQUA 1Y18A 5CUSH 3C09B 1Q9WB 1AXSB 4YO0B 1TNNA 1T2QH 4KKLD 3QQ9D 3EOAB 1YEDB 3T1FB 4X80L 1DUYA 1T7VA 4LMQI 4ESKA 5GXBB 3Q3GA 1Q8MA 1Q38A 1CZ8H 3TBSA 2NX5A 2X9YA 4OF3A 4JFQB 2F9BT 3MV7D 2QADB 3SE9L 5H37H 1OW0C 5EIQA 5IESL 1P2CA 4QXUH 1K2DB 4ZYKB 2JE8A 4LVNC 5C09A 1S78D 1SJEA 5E5RB 2EICA 1NGXB 4MAUL 1VFAA 1IM3A 1G9MC 5EU6B 3U9UB 1Y0LA 4K07A 1KG0B 1GGUA 3SE9H 3OTTA 2BDNL 1N4XL 2VUYA 4NBZB 5DHXB 1U3YA 4LVHB 1UWEL 1T89C 4XP4L 2IBGA 3HB3C 4PJCE 1NFIB 1XIWD 3RVTC 3ULUF 1GGIL 1YYLL 4EDXB 3G5VA 1S7XB 2HKHL 4L9LA 4UOJA 4Z7UA 2UZXB 3NIFE 1IQWH 1N4XH 3TA3B 3K4ZA 2JJUA 2WMPA 4LVNB 1HIML 2VNCA 4JRXA 4XP4H 2DM4A 1MIEL 1I8IA 3GMLB 2QBWA 2HH0L 4X8JA 1YYLH 4DEPC 3RGVD 1TFHA 4XNYL 2DMKA 5FYLD 2HKHH 2DM7A 2H32A 3DI2B 3MUGB 2RCSL 5IMKB 1BX2B 1LK3H 2DQCL 3QUXD 4FABL 5GS0D 5T1LB 3DX9A 4F7PA 5BS0A 1I4FB 1MIEH 3FONB 1IGTA 2GT9B 3UPCA 5TGBA 5IB5B 4XNYH 2X7LB 5DRWB 3DARA 5E7BA 2RCSH 2F54A 5DRZB 4OCRL 4FABH 4Y7MA 1DBKL 1FV1A 2HJLA 4DQOH 1W0WB 1YC8A 4MXQC 2YC1B 5F8QC 1OSZB 3GSUA 2YN5A 4FTVD 2DF3A 4I9WE 1T1YA 3GSXA 4P5TA 1D9KC 1KCRL 5CP7A 5D2LE 1DQLL 3HG1B 3LDBC 4OCRH 1KCSL 1DBKH 1FLRL 3KPNA 4S1RL 3F7YB 4KV5F 3HE7B 2Z92A 4BQBA 3OKLA 1E28A 3QIWB 3FQTA 2FYYB 4WW2A 3TV3L 1GOHA 3ZSSA 1KOAA 1N3NA 5DHVB 3VFSB 3DXAB 1J0ZA 1C5BL 1QSFE 3D87B 3ROOA 2VTFA 2R4SL 1KCRH 3DTXB 1DQLH 3VD4A 1KCSH 4NC0B 2PXYC 1FLRH 2EDLA 1NUGA 2PO6D 5D1XB 5IP4A 1JF6A 5DGRA 3D3VA 5ESVA 4PD4K 4NFBA 1Y6NR 4L5FL 3TV3H 5I6XC 5F3BB 1PKQA 1FO0A 3AU1B 4OT1L 3UBXG 1WT5A 4JAMA 2NXZC 2R4SH 5I15L 1OSPL 4QRRD 3WMSA 1N8ZA 3GI9H 4R3SA 1NCUA 2JF1A 2EXWD 4MNQA 2PYFB 4PJBF 4R4ND 1H3WM 1G1YA 4L5FH 5E8OB 3STLB 3V6OC 3WNKA 3UTPD 3H0TA 4FFVD 4U2ZA 3OKOB 5DC0A 3RIFK 1JWSB 2CKBL 4M7ZB 1QRNB 4EKXA 4LVOB 4K94L 4AT6B 2FGWL 1OSPH 3SGKC 3MQIA 2YMXH 2X1XR 3BZEB 1AHWB 2DQFA 4XMLH 3TF7C 4KK9D 5I6XB 3PGCA 1ROWA 4P2RB 4FQQA 5BVPH 2CKBH 5F7DB 1YNLL 4YFEA 4K94H 5JW4R 4YPGA 4HD9A 3BP5B 3FRPG 5E0QA 5EG6C 4DCQA 2EE9A 3PWUB 4KDTA 1KXVC 4K3JL 3RL2B 3D1MC 4NO2B 4ZAKD 5KN5A 3REVB 3VXPB 1TZHA 4E42A 3RWHA 1JGDA 1UWGL 1QRKA 2LV4A 4PJEA 4ERSL 1U93A 3S5LB 4R0LC 4JRWA 1CVSC 1A6PA 1OCWL 1JGVH 4LGSB 4HKBA 4N9GA 3UROR 4Z7WF 4K3JH 3S4SG 3QIUD 1GJIA 3TEUA 5IW1B 1WZMA 1Q1JL 3MLRL 4NKMB 2DJSA 2LTQC 2AV1B 4LHUD 2OQJB 2W0FA 4WO4A 4XVUD 2XWTA 4P46C 1UWGH 4XZUB 3NFPB 1DSFL 3RRQA 3GSRB 4ERSH 4NRXB 4Q9RL 1F42A 1N6UA 2R1YB 4IRSA 3CMOH 1OCWH 3MGOA 4IS6A 3FMGL 5DFVD 3QDGD 1HWHB 3MLTA 5J8OA 3MLRH 1W72B 4JHBA 3HHRB 5F7UA 2VE6B 2GJ6E 1UB5B 1IQDB 4R8WH 3JZ7A 1N6VA 4KHTL 4M8VA 1HSAA 4QRSA 4JKPL 5JHLL 3KDMA 5E08L 1CBVL 3RWFB 4TPRL 2IPTL 1MWAB 2LFGA 3FMGH 2DN7A 1SVCP 2XNAA 4G9FA 1UENA 3RWDB 3DX8B 3BZFA 1CGWA 4H1LH 3VFMA 1ZOXA 4NM4H 4KHTH 3L3GA 4XCYA 4JKPH 5JHLH 3IFOB 2YA0A 3TN0C 5E08H 5FAAA 2IPTH 5CEZL 3IFLH 3ARBD 2DLEA 4ZTPL 1JV5A 3M1BB 4KK5D 1QR1A 3WDJA 2V17L 4PJ5D 1PSKH 2SEBA 1HHIA 4WU5A 4GBXB 2D2OA 2IALB 1TPXC 4ZUVA 2VSCA 3RZCA 3A6BL 4HIEA 5CEZH 2WBJA 3TBVB 5HGDB 4U0QB 4ZTPH 3W9EB 4PLJD 2HFFA 4GRLC 1IT9H 3JUYA 5H94A 1HXMB 4TULH 1WVZA 3QJHA 5HHPB 5ISZE 4NQCA 4POZD 1WIUA 2JIXD 5FOBB 3EKCA 3VMOA 1P53A 2LU4A 1AI1L 1J10A 4A2MA 3GMRB 2X4NA 5TDNA 3QXTA 3H9ZA 3N1FC 2VLJB 4G6AC 3A6BH 3A6OA 4ZDHA 3OG4B 3GI8H 1AXTL 4APQB 4HQQL 5D7SL 3V4PH 2W60A 3NN8B 8CGTA 3J7HA 1S3KL 5IHUH 3ZYOA 2YZ8A 3MRMB 5B3NA 5ANMB 4UDUA 3I50L 1NC2D 4XCCL 4WWKB 5E2TH 4GUPA 3L7EB 4KWUA 5JHDE 2XQYG 4D0BA 4PRHA 1QSEB 4P2QA 3BKCL 4NO0A 1WBYA 1AXTH 2AK1H 5F9JA 4HQQH 1P7KA 2Q7YA 4B53A 4HIXH 3HAEA 3WLWC 1W8NA 1S3KH 2BSRB 4X83A 4PUBL 3I50H 4XCCH 3Q2CA 4NUGL 2UWEB 3LN5A 4LU5L 1WCQA 3BKCH 4M62L 3RU8L 5FM8A 1ZSDB 4GXUN 4JQVC 1C5CH 5IIEA 3WNOA 4ZPVB 4XWGL 2IBZX 3LN9A 4XPFL 3OBAA 3FB8B 1A1NB 1FGNL 5CILL 4YIQB 1RK0B 6CGTA 2EYTB 1G7PA 5GZOC 4NUGH 3AXLB 4W70A 2GYSA 5D6CB 4EXKA 4LU5H 2OJZL 1UXWA 2O5ZL 2Y25A 4PLNC 4M62H 1JL8A 4MSWA 4LGRB 5IB4B 3UAJC 2Q6WB 1QSVA 1JWMB 4XWGH 2H32H 3MRCA 1XGUB 2X4UA 5FA3B 5EIIB 1AFVH 1FGNH 5FYJE 4PS4L 1TJHL 4JREB 3CZFB 1I1AB 4LLQA 1I7RB 3ZDXF 4KRPC 1F58H 2OJZH 4O02L 3D6GA 2XY2A 1SYVB 3D69A 4RRPG 1A6VL 3O8XA 5K33A 3C5JB 3KG5A 3MRHA 3ILPB 5DRNA 3GMOA 1DEEA 2FIKB 5HJ3B 4CW1A 1MEXL 1S8DA 4PP2B 3RIFF 4RNRB 1CFQB 1M6OA 4O02H 4I2XE 3SPVB 5EOCJ 1EERB 4N8CL 1BAFL 2JB5H 1A6VH 4PJ7B 3IGAB 1MCWW 3HNSH 1PLGL 5KVMC 1ZMYA 1K4CB 3CDGA 4OQTA 4TNWF 1H8OA 1MEXH 1RJYB 5F7WC 4OF7A 5FUCC 1AKJA 1I9JL 1FFQA 4OLZH 3U79A 5J6GB 4OFYA 3MX0A 1LEIA 1F2XK 4N8CH 4WFHD 1BAFH 7FABL 1WWAX 2P48B 2OR9L 1KCLA 3P9MA 3EZJB 1CLCA 3BE1L 4JB9L 4PRID 3GMMB 3L9RB 3KLAB 5E4EB 5GS2H 3MLUL 5I76B 5D7IA 3T0VA 3PABB 3T3PE 5IB1A 2FEDC 3VXQA 1I9JH 2H8PA 4TTGA 4PY8J 4KMTH 1UKSA 3JV6A 3S36H 3HI6L 1YN7B 1BVLA 1DN2A 4OZ4B 2OR9H 1FO0H 2XWBB 4GS7B 4NKOA 4OLYL 2ARJB 2XN9D 3MCKA 3IJYA 4JB9H 3U0PA 1CIDA 3QQNA 2NY3C 3P73B 3VGGA 4X8XA 3MLUH 4UBDD 3VH8B 1R3JA 2DQIH 1V8HA 3QI9B 5DJAB 2ZSVA 3HI6H 3VRJB 2VLRB 1QYGH 5C6PB 3OHXB 1ERNA 4KVNL 2ZOKB 4P9HL 4OLYH 4LLWB 4LOUD 1EXUB 4S1DD 3RJQB 2FL5B 4PJAB 1F5WA 3B4NA 5F3HB 5JPNA 1H8NA 1MCHA 3SGJA 3ZE2E 5TE6L 2X89D 2R8SL 2H2PD 5SWSA 1HNGA 4PYHA 4MQXC 1U95B 5IEKB 1BLNB 2H26A 1D3CA 1S7WA 5DTFB 3DROB 1Q9LB 2E9BA 2FGZA 1K6QL 4P9HH 4Y1AD 2Q8BL 3ZHKA 4K7PY 1RIHL 1FN4A 1ZV5A 4CDHA 3MRBA 4D9RE 5I0DA 3CPLB 5E24E 4JFEE 2QR0B 3TH3T 5IMMA 1E4KC 2HN7A 5TE6H 2R8SH 1NEZG 4URTB 1F97A 3X3GL 1MCOL 2Q8BH 1UZ8A 4BKLA 1RIHH 4F7CA 1FVDB 3DLQR 5HGBA 2WWMD 5TF0A 5IWLC 1R3LB 4QRTB 1ZWIA 3ARDD 4PGDA 4Y5VC 1DR9A 3X3GH 3JVGC 1MCOH 4JO4L 4HS6A 1HE7A 1OTUD 4KJQD 3VFUA 5CZXD 5BZWB 4LLDA 5CMAA 1AO7E 1I7UA 4NNXB 2Z31B 2CLRA 4Y19E 1YQ2A 3WL9A 3MROB 3JWOC 4XAWL 3O11B 3IFPB 3P9LB 3CFCL 2HJKB 2DOCA 1WCBA 3SDYH 4OGXL 1RIVL 4L8DB 2J8HA 3F5WA 3H9YA 2XWJB 2P5WE 1SYSB 4JO4H 4PJCA 4O5LL 3P4NA 4ZFOA 5I1JL 4TQEH 2AJVL 4WCYL 1CXEA 1T83A 2BSSA 3OR6B 1SBSL 4XNUL 3LSOB 2EKSB 1LILA 3GSNB 3G6DH 4XAWH 3HPLA 2XTLA 3RA7L 4A6YA 3CFCH 4KKLC 3BGFB 3QQ9C 4OGXH 3SKNA 2EXYD 1UACH 3SQOL 1OM3L 1FFOA 4QOKB 4KZEH 1RI8A 3B9DA 3GBNL 2MQ0A 2IAMA 4O5LH 1N64H 2IQ9L 1P1ZA 3MRFA 4WFGD 5I1JH 1JNHB 2AJVH 4Z7VE 4WCYH 1TIUA 4R96B 5IOPB 3UTTB 1EBAA 1U92A 3RA7H 3FB5A 5MEOA 3K2UL 1LNUA 1QPXA 1IC1A 1WWBX 3PHQB 3TIDB 5C07D 3RX8A 1G9EA 1S78C 1FNGB 4P57A 3PP3K 1OM3H 3SQOH 1EO8L 1UJ3C 2HFEA 3GBNH 43CAB 4X7TB 3FB6B 3PWVA 4I3SH 5IJVB 4V1DB 1X5ZA 5DJ8A 1DBBL 4JDVA 3ZLQC 4PJDB 3G04B 3K2UH 3VFOB 4Z7NE 2ZUVA 2BK8A 2NX5D 1MAML 4OFKA 3ZYJA 1L6XA 4HAGA 1TJGL 4OSUL 3SGDH 1KIQA 1NCNA 2ADFL 1XIWC 2B20A 8FABB 5J89A 5C09D 3CNKA 5JMRA 2JB6A 2VXUL 4HAFA 1DBBH 2FBOJ 4YQXL 3C6SB 4OCMC 5D2LA 3AREC 3VFGH 1KT2A 2EYRA 1EHAA 3TYFB 4UT7L 1LO4L 2BHUA 5DO2D 4UTAL 2EH7H 4OSUH 5KVFL 1AIFB 4MA3B 1BIHA 2X4QA 2ADFH 3V5DB 1DANU 5DQDL 3RGVC 4UI2A 4KZDL 1U8IA 2VXUH 5F88B 1QSFA 5FGBC 2C3VA 4LNRA 2UV3A 1EAPA 4QHLB 3QUXC 4QHKI 1UCBL 1ZEAH 5EBMB 5D96B 3BGMB 1MVUB 5GS0C 4UT7H 1LO4H 3QDME 4UTAH 3IDYC 5LVEA 2Y4SA 4Z77B 4UDTB 3MRPB 3GJEB 3A6CL 4KZDH 3C5ZD 5EO9B 3AREB 1KJMB 3FOMB 1UCBH 4U1NB 3V7AE 1FDLL 1GH7A 1T21B 4CU6A 1ZLSL 4X6CF 4ZUUA 3QT2A 4UT9L 4NQDB 1D5IL 5BS0D 1FSKB 3F12A 3DYMA 1A3LL 4X6BA 5I16B 5JNYA 4L4TB 3VI3E 2ATPA 5FGSA 3NCMA 1RZGA 1FDLH 1KPVB 5KANG 2F54D 1CU4H 4MA7L 4QXGL 5F6IC 1ZLSH 3RI5K 5A1AA 3RWIA 2I5YL 2D9QB 1XF4A 2LAGB 2XG5A 1TTFA 4NC2B 4EBQL 3IB4A 4IEFB 1C08B 1WEJH 2IADB 1FL5A 3OPZL 2EDHA 2PO6C 1Z5LA 4P5TD 2Y5TB 1TQBB 4BM7A 4MA7H 5GS1A 4QXGH 1HILB 2DWEB 5FCUL 4XXDB 3VXSB 1WBXA 2WIMA 3SY0A 2I5YH 4F7MB 1U8LB 3M17A 2NQCA 1M7IA 5EO0B 4EBQH 3SKMA 4ODUA 4WEUD 3H7BB 3OPZH 4GAGL 1JZ4A 3KPTA 2EXWC 3LS5L 2FZ3B 4Y5YA 4R4NC 3BRFA 5FCUH 2VZSA 4NNYA 1X9QA 4IJ3B 4OQTH 2DBLL 1U3HA 3D3VD 4FFVC 4L3EB 4K3GA 2XA3A 3UYOD 2FWOA 2BP3A 4HZAA 4LPVA 1DN0A 2YD8A 4GAGH 35C8L 5EFIA 3LS5H 1B0GB 1XCTA 1BOGB 4KK9C 5J13C 4S2SA 2GJ6A 1UG9A 2DBLH 4MNQD 4YHLH 1C12A 1S7TB 4XVSH 5ERWB 3LKRA 4I0KA 3TNNB 5IW6A 3QXUA 1X5JA 2EDFA 1KJ2B 4JO3L 4LDOB 3BO8A 2P24B 2G75A 2Z93B 5CIPH 3CLFL 4ZAKC 3QNZB 3RPIB 4ETQA 3WKNA 2ZUWA 1JJUA 3PWNA 5ENWB 3WFHA 4BSVA 3L3KA 4Z7OF 4IIQB 1FZJB 5T3ZD 1RFDL 2PYEB 4KUCF 3OGCA 5JZ7C 1CDBA 1KBGL 5CJ5A 5EU6E 4OCWL 3QIUC 4NDMB 5A2FA 3FFDA 4JPWL 3CLFH 2VZ1A 3UTZA 1IILE 2ZKHH 3F8UB 5J13B 3I6GB 4GW5A 2W1NA 2DQEL 2IFFL 2W38A 1QR4A 4WI7A 4RX4A 3K2MC 3NCBB 4NC1E 5GGVH 1YJDL 2ZSWB 4Q6IB 1NDGA 4LRIA 1HH6A 2VXVL 1KBGH 3D9AL 4KAQL 4OCWH 2O61B 5DFVC 4JPWH 5KBNC 2XFXB 3HR5B 1S7RA 2DQEH 2IFFH 4NPYB 3SGEI 5ISZA 5JXEA 4KMLB 2VSDA 2R1WA 4X4ZA 4UQ3B 3VXNA 4WO4D 2VXVH 1T5WB 1S5HB 4KAQH 3OX8B 4EVNA 3PL6B 3LRGA 4IRSD 4YHZL 2DLTA 4QRPB 5E5MA 4C56D 4OIAA 3JTTA 3OB0K 1JZ2A 3PWJB 1F8TL 1AY1L 1GGYA 4U6VH 5I2IA 1NL0H 3RY4A 5SX4I 2ZUUA 4Z9KB 4E9LA 1GGCL 5JHDA 3DX6B 3VCLA 1Q0YH 2BC4B 4PRNB 3ARBC 5CBEA 1XR9B 4YDVB 3U2SA 1WFTA 3BPNC 4KK5C 4YHZH 4FOMA 2OSLB 1BFOA 2OTWB 3BISA 3AM8C 1F8TH 1AY1H 5DYOB 1K8DA 2CXGA 2DLGA 4G9FD 1ZS8B 2W9DL 1LO5A 3NIGF 4Z7QF 5GHWL 4HZLB 4YJZL 5MENB 2ERJB 4AMKL 4P2OB 2HVKA 4PLJC 5DEZA 4QTHB 3QEUA 3HG1E 4HX1B 2GK0B 5JW4M 5K9QI 1K5NB 4NN6B 4I8DA 5JTWA 5I74C 15C8H 4POZC 1CGYA 3CXHK 1L0XA 2BJML 4I3GA 3SDCB 5F89A 4I18B 5GHWH 3VW3H 2UY7A 3BUYA 1JCKA 1HQRB 5EZIH 5I9QB 2Y23A 3DXAE 4AMKH 2ARWA 2J1KA 2A1WH 2HMID 5IF0B 3RZCD 4NRZA 4O2EB 4P4KB 4ZSOB 2YUXA 2AERT 2WBJD 1MH5B 4Z76A 3PNWA 2BJMH 5DS8A 3G5YA 5BO1L 3TP4A 4NQCD 3L5HA 4YX2L 3WHXB 1EMTL 1EV2E 1JHTA 4LEXL 4NRYB 4FXGA 1G7QA 2BVYA 5EU3B 1XGYL 2VQ1A 2NY0D 4HJGA 1VFBA 2OX5A 4YFDB 2VYRE 4XGZB 5KSBE 1RZFL 2WBKA 1SJHA 1R3KA 5CGYD 3WBDA 5BO1H 4PG9A 5BV7L 3A67L 4RZCB 4YX2H 1EMTH 3VWKB 3QA3A 4I2XA 5I19L 2IGFL 4LEXH 3PE9A 1QRNE 1FJ1A 2BZDA 4AQOA 1XGYH 3C6LB 5F1IA 4PRHD 4P2QD 4NO0D 5IG7A 3K7UA 1T1WA 1BD2B 2PTTB 1IGIL 3RI5F 2FHFA 5EORL 3TWCL 2ZUQB 3WUWB 3DUSB 4OF8A 4Y4KA 2XACC 3FQNB 5DVKA 1WV7T 5CAYB 1P6AB 5BV7H 5KZCB 5HYIA 3A67H 2YXMA 2O93L 1A22B 4RGNB 4N0FA 3FO9B 4BUGA 5EO1B 3MRIA 4OLUL 4P2RE 1H3XA 3K1KC 1YECL 3SBWA 2BRQA 1X5HA 2E9WA 3KPLA 4KMQA 4UQ2A 1IGIH 4DKDC 5EORH 5HGHB 3DO7A 4Y4FC 1HN1A 1AXIB 2AAVA 2JELL 1YEKL 1YUHA 3V6OE 1IGML 1RUML 3T4YB 5JIKA 3FB7B 4Y16A 2Y1VA 3B9AA 3IKCB 4TSCL 4ONFL 4M1DL 3MRJB 2WANA 5CEYB 3FN9A 3OAZK 5DC9B 5CSZB 1YECH 2JKXA 1T5XA 4JFYB 1CD1A 2O5YL 3LKNA 3HC3L 1HQ4B 2JELH 1FYTB 1EFQA 3B5HA 4BSWA 2J8UF 1I8KA 4OKVA 4QCIA 3QUYD 3RWCA 1S7UB 4X9FA 2FH6A 1E4JA 3L3HB 4TSCH 1RAMA 2R29H 4ONFH 4P2CG 3KAAA 5D9SA 3KPQB 2Y07L 5SWQA 4JQXA 2EE2A 2V2TB 4GG8B 5FO9B 3LS4L 1U2HA 3C60A 2O5YH 1NBYA 3HC3H 4XCNB 4Y4FB 1I7TA 3O8XD 3BIBX 3BKJL 2MCG1 3REWB 2G5BA 2LU3A 4KXZI 1ZTXL 4NHCL 2VERN 2N1KA 3QO0B 3GSOB 5FYKD 2HG5A 3B9KA 3ULVE 3CXHJ 2VLME 5DJ0B 3MOAL 3I6LE 3LS4H 5KSAA 3L3DA 4JG1L 4KROD 4WHTA 1A6AA 2DS4A 2DQJL 1AQKH 1JPGB 3BKJH 2FJGA 4JFEA 1ZTXH 4WNQA 4NHCH 4BSJA 5EB9A 3TFKD 4XP5L 3L6FB 1T7XA 3CUPB 1AKJD 4HMDA 4WHYG 3T04D 3FCTB 4WHCA 3MOAH 4OFYD 3UPAA 4JG1H 4QKXB 3ZKND 4UBDC 4OZIB 2DQJH 5JORB 4HIIB 2GAZA 3V5HB 3LV3B 3U7YL 1VENA 4XP5H 2FECI 2DM3A 2Z8RA 32C2A 5DQJA 2I9LB 3DSFL 4TRPL 5IW3A 2GW5A 4YHNB 4A2LA 3I3EA 1AO7A 3OR7A 4LOUC 4S1DC 4Y19A 3IU3B 4XBGA 5IB2A 4MJIB 3MRLA 3MGTA 1PYWA 5E6ZA 3UJJL 4HPYH 4P3CH 3KVQA 5I8KL 2H2PC 5J1TC 1OPGL 3BP7A 4Q9QL 3U7YH 5JOEA 1KLUA 1BZ9B 3DSFH 4RSVA 2P5WA 4Z78A 4IDJL 2R0ZL 4WTXA 1L7IL 4QTIL 4TRPH 5D7LB 3PUCA 3VRIB 3B6SB 2VLJE 4QWWC 4HKJB 3OWEA 3TCXA 4KJPD 3UJJH 2CDEA 1HKLL 3CK0L 1PG7L 3TM6A 1OPGH 3S35L 4Q9QH 1HWGB 3QFDA 2CKBB 2E9IA 3E8UL 4L8SC 4IDJH 5ANME 2IPKA 1YDPB 1L7IH 4K2UL 3OJDA 4D8PB 3P30L 5SWSD 4Z7VA 4OCYL 4J23A 5LAXB 3LHPH 4PFEA 1QSEE 1FHGA 1LO2L 2E7BA 3MJ8B 4MS8C 2WWMC 3BT2L 2OJEA 2ENYA 3O2WH 1U8HB 4MQ7B 5ICZB 4YK4C 3CK0H 1HKLH 4XVTH 1PG7H 1II4E 2DTML 1WBZA 4I0PB 1J7VR 5HGGS 3E8UH 5ID1B 1S9WA 1OTUC 4KJQC 4DN4H 4OCYH 2UWEE 4TUJB 4XCEB 3WO4B 1L0QA 2Y7QA 3BT2H 5C0JA 1KPUB 3LD8B 3TT1L 1WICA 2NY2B 3PWPB 2DTMH