2EZ0C

Crystal structure of the s107a/e148q/y445a mutant of ecclc, in complex with a fab fragment
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Ion-binding properties of the ClC chloride selectivity filter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 36
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ez0C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ez0C01
3U48A 5J56B 4XWOD 2B1HH 4RCAA 2ED7A 3MO1A 2P8MB 1IGYA 1VEOA 2OQJB 5HYIA 1HYSD 3HG1B 4Y4KA 1P1ZA 5EUKB 3QQ3B 1QSEB 4RAHA 5J9PB 5DJ2B 1K4CA 4X4MA 4HPYL 5MHSE 4LU5L 4WWKC 1CDGA 4JKKA 5CP7B 1MIEL 4L9DA 3MYJB 4XVTL 4YX2L 3V7AE 2VLMD 1MWAH 5D5MF 1KB5H 2GK0A 3HI6H 3E0GA 1TIUA 3BGFC 4ONOA 1DQJA 5IW6B 1R3KA 3WNKA 5EC2A 5L7XH 1NGYA 5SV3A 1Q0XH 3EDFA 1CK0L 4IOIA 5TFSH 1BREA 1XF5B 2Z31C 3N1GC 4KJYB 4WWKD 5ID0B 3MROB 5J6GB 5B38A 5T1MA 5K9JL 5HGHA 3U0PA 5DMKA 2Z4QA 2BOCB 1QYGL 2PYEE 5DMGC 3QG7H 2ZCKL 3I3EA 4RWYH 5J6HB 2A6JA 5CBAA 2R4SL 3QEHB 2EECA 4IOFC 3O6KL 1KTDA 2DQEL 4PGCB 1KN4L 2HFGH 3K2UL 1FRGL 4BFEA 2VXTL 1U93A 1YN6B 2Z31D 4JKPL 4XMLH 2DDQL 3GSVA 1WBYA 1JHLH 5E5MA 1YEEH 3BKJL 4QXUL 1X5XA 4ZUWB 2AAVA 3MRCB 2UWEA 3S36X 3JVGA 5DMGD 4ZXBA 5F7YC 3VH8A 2A6IB 1WCBB 4QHLB 2CQVA 3NZHL 3F12A 3RWHB 3I6KB 4XMPL 1K5NB 1NCBH 1AXTH 1EJOH 1OARL 1II4E 3PGFH 4LNRB 1QR1B 4ZNEA 5H35B 3LN4B 4P2CG 4Y88A 1LK2A 4A2LA 3K0WA 4S1RL 4Y5VB 1DTUA 1G7LA 3S35X 3VXRB 5I66B 1ZEAH 4G6JH 1NLDL 2YD7A 3DWTA 4E42B 4WHYG 3WJJC 1HN1A 1G7MB 1AGFB 1CWVA 1ES0B 5F7UA 1FVEA 2DRUA 1BD2D 4JZJB 5GZNC 3QIUB 4HAGA 3X11A 2D31A 3O6LH 4QCIA 2P5WA 3LKNB 2XA8H 5CJXC 3BO8B 2XNAA 4QOKB 5K9OA 1FZJA 1R5VB 4F33B 1F00I 1A14L 2I60H 5J11B 1A0QH 2DI8A 4LFHD 2QV2A 4HUVB 1YY9C 5D7SH 4ZFZA 5BVJB 1NC2D 4PRHE 6FABL 3O8XA 4RAVB 2XXCB 4CDGC 5GZND 4XX1E 4UIMA 3UDWA 4DCQB 3OKKB 3L95A 3WV0A 3BQUC 4ZUUA 4AK1A 3HNVL 3WUWB 4JJ5B 1U8HB 4JY6B 4DGIH 1YY9D 1JNLH 3MCKA 4CU7A 5I6XB 3MLVH 1KB9J 4IHOB 3S4SA 2VL4A 2QJDA 4WEBH 3T0EE 4W6YB 3BQUD 1ONQB 3SE9H 1SJEA 4J2XA 1T83A 3D2UD 3NTCH 4YO0A 3IDXL 4LPYA 2YPLB 3IAGC 1ADQH 2ATKB 1YPZA 2K3TA 4N90E 4MA1C 3SDYH 2XZAH 1KENL 1AD0B 1FN4A 1B6DA 2JF1A 3MA7B 3BE1H 4RMQA 3GI9H 4NUGL 1AGDA 7CGTA 3BGMB 4LSDA 3ARRA 4MB4A 3W9EB 3HNTL 5DUML 2BSED 2PTVA 3I6LE 4J3OC 4ODVH 3TNNA 1I7TA 4E5XA 3PGCA 4JDTL 1PZ5A 1C5DB 3ES6A 1MJJA 5ADOL 1JGUL 4ZS6C 3D5OF 3GMPA 5DRZA 5BV7H 3QNYB 3ZZ1A 4HD9A 4L8CA 2A77H 4M5YH 1QA9A 3BPOC 4R96A 3CUPA 3QIWB 2ADGA 3EOYG 5B22A 4PV9A 1QFWH 1AJ7H 3WN5A 3F6LA 5AWNL 5AYUH 5HHXL 3OGOE 2DQTL 5KSBE 3BIKA 2EIZA 4YC2B 4ZS6D 3UJIH 3BUTA 4JY4A 4WENB 1U58A 4WCYH 3W39B 2ZCHL 4Z7UA 2C5DC 1GAFH 2HJKA 2AJZA 3TYFA 4OKDA 3ZT6A 4I8DA 3V4UL 1N0LA 3LQZB 1JWSB 4OCNC 5DEFB 1F3DJ 5IT2H 1NUFA 1BGXH 4JZNB 4GUPB 3SDXB 2H8PB 1VENA 2N56A 4K8RD 3UYRH 1KC5H 4NKOA 5F9WC 1P4IH 2RBLA 4RISH 1SY6L 3T3PE 4P3DB 1DLHB 1JZ2A 3RZCA 1YNLL 4OCXH 2JJSC 1R24A 3X3GL 4TVPD 3BAEH 5ICXA 3T4YB 5M7QA 5FHBH 2KQNA 2B1HL 4QRQA 4E41E 4M9OA 3AC0A 5FK9B 4O51B 3QNZB 3C5ZA 3R06A 4GRMB 2W0FB 4FA8A 4PREB 3C2AH 1G0YR 5D6DC 4G8GE 1S78C 4LARH 3WDIA 4Z78B 3V4VH 2JIXB 2E7BA 1MWAL 1KB5L 1X5YA 3HI6L 5IGXH 4DOHB 4LCIH 1KF9B 4K3EH 5FYLE 2ENYA 5KSAB 3BZ4B 2XOTA 5I73B 3C8HA 5CIPA 4DKEH 2XN9E 2O5XH 5TFSL 1NMAH 1L6ZA 3IDJB 3PG2A 1KTRL 1CXKA 5TDPB 4MCZA 3CFKA 3SDXF 1EEYB 4JFXB 1ZANL 2V5YA 3QG7L 5B8CC 3QH3B 2XXMB 1UKQA 4RWYL 5DA4A 4ESKA 1GYAA 1CLYH 3NCCB 1AC6A 3BJLA 3TZVC 5LAXB 2HFGL 4EBQH 4P2RE 2X4RA 3VI3F 4XMLL 2WBKA 4X98A 3WNMA 1JHLL 1YEEL 3MV7E 2ZJSH 4M7LT 1CDUA 1L6XA 2YK1H 3QDME 4GAGH 2BVPA 2X5PA 3TZVD 4WUKH 5MERB 3TP4A 3D69B 1NCBL 3SKUD 1AXTL 1EJOL 1J1PL 3PGFL 2XY1A 4IRSB 1BZ9B 3IFNL 3SY0B 2H32A 4WU7A 5EOCH 5BRZE 1N5AB 4R7DA 3QUXA 3IJYB 3S9DB 4FXKB 1EA9C 1QBLH 2ZKHH 1ZEAL 4G6JL 4U1SA 3OKNA 3OL2A 1JBJA 5DEGA 2CGRH 4GAJH 3EBAA 4J3XA 2EH8H 3FO1A 4NKDA 2I60L 3MRRB 4X5XA 3NCEB 3VFGH 4Q74A 1ED3B 1A0QL 4U0QB 1KGCD 1U3ZA 5DR5H 5D7SL 3Q5OA 1R3IH 2CUMA 5CD3B 3TBYA 5F1NB 3WD5H 3OBAA 1D5IH 4RGOH 1H5BB 4PUBH 1ZA6B 4TNWK 5FDWB 4AIZA 4LLYA 1AHWB 1I7RA 2QR0A 4DGIL 5JHDB 1WWBX 1FCCA 1MCWW 1JNLL 3N1QC 3Q6GH 3PP3H 1GHFH 3VJ6B 4ZOAA 3CJJA 4PB9H 3MLVL 1D5XA 1X7QB 4WEBL 3LDBC 3SE9L 5D5MA 4RWHA 1LEGB 3NTCL 1E27A 2X41A 2IBBA 1ADQL 1QSFE 4TUOA 4JQXC 3WIFA 4V2CB 3SDYL 5T3XD 2XZAL 3N1MC 3QCVH 4G6MH 3BE1L 3GI9L 4WY7L 4D0DA 1BVKA 2VLKE 1SEBA 4TULH 2VQUA 4GJTB 4LPUA 2DIJA 5GHWH 4RMTA 3O2VH 4K94C 1I9EA 3U6RB 4ODVL 4BQCA 5HJ3A 4PGDA 3B2UC 4PJIB 2GFBA 2Y6SC 1RIHH 4NFDA 2I26N 3P9MA 3BUYB 5BS0D 3GSUA 5BV7L 2AXFB 1YECH 5MEQA 4U49A 2A77L 4ZUTA 1IAMA 4M5YL 5JPMA 1TQCC 4XB7A 5DQ9A 2XIDA 2DWEA 4OF8A 1WITA 1MRCH 2FLBT 3UTSA 4LNVA 5IFHH 3GM0A 1QFWL 4GRWH 1VFOA 2B2XH 2P8MA 3B2UD 3VA6A 1OGAD 2OQJA 5AYUL 5E7FA 3W11C 1N59B 1X5ZA 3UJIL 5ICYB 3QQ3A 1QSEA 4MSWB 1IM9D 4LGPB 4W70A 5J9PA 4WCYL 5DJ2A 3QHZH 1W72H 3LPFA 3VD7A 1GAFL 1PBYA 5ESQB 3CU1A 4NM4H 4P23A 2P7TB 5C0AA 4IJ3B 5IT2L 1BGXL 3VGGA 4XP1H 3V7MA 2OXGA 4B41A 5FOJA 5IW6A 2BERA 1KC5L 2LTQC 1P4IL 4RISL 5K9QI 1P53A 4FQXB 3I75B 5DD5H 9CGTA 2Z8VC 1OAXH 1A9BB 3O6MH 5DJYB 4OCXL 2H45A 4M8VA 4XAWL 1FFPB 2BOCA 3KJ6H 2VABA 2YUWA 1TVBA 5A2LH 4XPHH 3BAEL 3QWOA 3JUZA 1TFHA 1FO0B 1CXHA 1OM3L 5E9DB 5FHBL 4PJIF 4X8XA 1HI6B 4M8QA 3VXNB 3WFEH 4MAYC 3PQYB 1GCFA 4WUUD 5GSVB 1OW0A 1CBVL 1FVDB 1MI5E 2I9LB 1S9WB 5L8JB 3C2AL 4ZUWA 5DJ8A 4LARL 5IVXE 5GGVY 1WWCA 3KYKH 3O11A 3V4VL 1WCBA 4QHLA 2LAAA 3BOVA 5IESH 3RWHA 32C2B 4Y19B 3GSWA 3QDGE 5IGXL 4WI2A 4LCIL 1JNHB 1BFSA 2ERJB 3UTTA 4K3EL 3KAAA 4GXUM 4LNRA 1B0WA 4RBPK 5H35A 3LN4A 4OUUB 3F8UB 3RPKA 3MCLH 2P5EE 1MCIA 4Y5VA 2O5XL 4DKEL 1NMAL 3TJEH 3DVGB 5I66A 3VFRB 4NN5C 5ACMA 3B8SA 2GTWB 3QUZB 2ZNXA 3V8CA 5GGVH 4E42A 1AI1H 2FCBA 5KOVC 1AGFA 1ES0A 2EDYA 1SVZA 1FHGA 5DD3H 4PRBB 3QIUA 1CLYL 1YEGL 3LKNA 2VZTA 3DV4A 4EBQL 4QOKA 1KLUB 1U8NB 2WWMC 1R5VA 4F33A 5CZVH 1UJ3A 5GS1A 3P4LA 3E6HB 2ZJSL 4HUVA 4ENEC 2PXYA 5IQ7H 5BVJA 2YK1L 1KIRB 4GAGL 3V9FA 2PUQT 4RAVA 4PGEB 4TUKH 4LEXH 2C7UB 1ZE3C 4YZFE 1D9KB 4WUKL 1XGUB 5IHBA 1GOGA 2VLRB 4M62H 2X10A 1T1XB 2WWMD 1J0ZA 1IAKB 3WUWA 1X5JA 4JJ5A 4YK4C 1CE1H 5EOCL 3RWDA 3O3UN 3A67H 2J88H 4WI8A 4ENED 3FQXB 1QBLL 3RNQB 3VXMD 5K59E 2ZKHL 5HHMD 3NZ8B 1AE6H 3QWQB 5INDB 3PP4H 1F45A 4YWGH 1ONQA 5GS0C 2CGRL 5HYJD 4K8RH 4DZBB 4GAJL 1AY1H 1BJ1H 3TV3H 3BDXA 3TLRA 4NQDD 2ATKA 5FKPB 2AP2A 2EH8L 3EYQC 5SX5K 4KK9C 3KLAB 3VFGL 3HZYA 4YQXH 3BGMA 3V6ZB 5DR5L 3W5NA 4MGXA 3WIIH 1KB5B 1R3IL 2XG5A 3W9EA 4U1HA 3BN9D 3WD5L 5GS0D 2I24N 1D5IL 4RGOL 3VD5A 1UVQB 1X4YA 4PJXE 3U9UA 4MZ2A 1WT5A 4PUBL 3EYQD 4X7TA 5FB8B 1C5DA 4JRXE 4QRPE 4KK9D 3ULSA 1FNHA 4QWWC 3QNYA 2EDXA 1LO0H 1GL4B 1RJCA 1EAJA 1CL7H 5IB4A 5I75B 3Q48A 2GI7A 3Q6GL 1GHFL 1UZ8B 1HSAA 1J11A 1AP2A 3DSNA 1KG0A 2GJZA 3QIWA 4PB9L 5C0EA 5JQ6H 1M6OB 1I9JH 3ZDXF 1TXKA 5GJTH 4QKXB 1FNAA 1NCAH 3MJ9H 1QFWI 4ZS7H 4F37K 3AUVA 3RX8A 1MCBA 3CMGA 3H3BC 4QWWD 2Q76B 2MOVA 3QIBC 1MCFA 3FAWA 3W39A 4G6ML 1CFSB 1TPXC 1WZ1H 2PW2A 5A2JH 4TULL 3CZJA 1A6UH 2G5BA 4N9GB 3T3MF 1JWSA 5IMMB 1EFXD 1FGNH 1R3JB 2DIBA 5GHWL 4FNLL 5KS9E 1RY7B 4JZNA 3QUYB 4YHPB 4GUPA 3O2VL 3HA0A 2J8OA 4P49A 3BEVB 3LN9A 3QRGH 2O93L 3VI4E 1KIQB 4GLRH 1RIHL 1QPXA 2V7NA 4XCNA 1TVHA 3RL1B 2IBGA 2LE9A 2XWJA 3GJFK 4OLZH 1YECL 4P3DA 4HKJB 2CIIB 1DLHA 5CJOH 4OLEA 4ZUSA 3GKWH 2ITDA 3RVXC 1CG9B 1O7VA 1CDCA 1JWMB 1MRCL 1F4HA 1U8IB 3EHBC 4BKLA 5IFHL 4RX4A 5FK9A 4I9WD 2B2XL 4GMSH 2NZ9C 3D39E 1KPVA 2FX7H 4O51A 3HAEH 3VXSD 1A3LH 4GRMA 2W0FA 4PJHB 3QHZL 1W72L 4PREA 5GRXG 3RVXD 4UT6H 1IGTB 1T5WA 3GJEB 3CDCA 4NM4L 1MRDH 1VFUA 4LVNB 3U2SA 3EHBD 1WFTA 3DXAD 2JIXA 2DYPB 3NPSB 3OJVC 4HCRA 1GIGH 4XP1L 4Q2ZB 1PVHA 2NZ9D 4H26B 5HI5C 2IMNA 3UXFA 3BZ4A 3N1FC 4NQXB 4JO4H 4LFHG 4OI8A 1BQHA 1UT9A 1CDBA 5DJXB 5JA8B 4QTIH 2J8UE 5DD5L 2V6HA 3IDJA 3PXHA 1OAXL 4LBEB 3O6ML 5TDPA 5BQ7B 1Z5LB 5I1LA 3KJ6L 1U92B 1NUGA 1BVLB 4C83A 4XPHL 2VSDA 3ARBA 3ZTNH 3AS0A 1DEEB 3WFEL 5FEBA 1X4XA 3LS5H 1TDQA 4HKXA 3HG1E 4UMGA 2BNRB 1JCKA 1AO7B 3I85A 2OZ4H 4A6YB 3BJ91 3KYKL 5IBTH 3MMEB 2R1WB 1LQSR 4J3WA 2HN7A 1YNKH 3O4LB 5MERA 3D69A 4AY0A 4Y2DC 4PJHF 3QFJB 4IRSA 1UWXH 4BZ1H 3EO9H 3ISWA 4QTHA 3SY0A 2EYRB 1H8OA 3MCLL 3TJEL 1LHZA 4MZ3A 2QHLA 2XTJE 5D7IB 4JG1H 4JFQB 2Q86B 2QQLL 1XCQA 3MLUH 4L3CB 2PYEA 5GGVL 4NQCD 5L9DH 1AI1L 1Y18B 2HTKD 4PJ9B 2Z8WC 5I1GH 4LQFH 4Y2DD 5DD3L 4EUPA 1IL1B 1N7MH 2WZPD 4LHUD 1T1ZB 3FQRA 3MLTB 3PJSB 4HC1H 1IQDB 2OI9B 1WZKA 5BVPH 4FMFA 3DVIA 3UP1A 5CZVL 3KNBA 3MRRA 1ED3A 1X5GA 5IQ7L 1GGCH 1WAAE 4F9PC 3SGJC 1MCSA 3GNMH 1CR9H 4TUKL 3WNOA 5F1NA 1EDQA 2A74A 3HMXH 3K81A 5DJAB 2XV6B 3T8XB 1H5BA 4ZO8A 2YUXA 1S7SB 4M62L 4NT6B 1ZA6A 4OAWB 3TBWB 2O26U 1AHWA 4U1JB 4MQ7B 5JW4Q 2EH7H 1JL8A 3A67L 2J88L 5JHDA 2FDBP 4EQ3A 4U6XB 1KCUH 3VJ6A 1DBMH 3I3BA 3DROB 4CU6A 2IADB 4P2QD 1AE6L 1QSVA 4L1DA 3VFSB 2D9QB 3PP4L 4YWGL 4FFWD 3EYVB 2A1WH 5E4IA 5J1TC 5L88L 2OJEB 4K8RL 4WFGD 1AY1L 1EHAA 3TV3L 5LGJB 4OD2A 3MGAA 4PTUB 5EC1A 4UT9H 5D7IF 1FLRH 1MCNA 5EZIH 4YQXL 2YPVH 4LCCB 1CE6B 3WIIL 4BK5A 2HFTA 5I30H 1HCVA 3TO2B 3U6RA 5HGGS 3G5YA 4X4YA 4P4KB 2OM5A 4PJIA 2LU7A 3WS3B 5E2VH 1A5FH 4KJWC 3BUYA 3EGSB 4YHOH 4JRYD 3K3QA 5CKGA 1VEPA 1LO0L 4KGJA 3H9SB 1CL7L 4KDVA 3DX8B 2XZCH 3QAZC 3WNNA 1BJ8A 5JQ6L 4EVNB 5J06A 1AGEB 3T0EA 3BRGC 4XT1C 1EV2E 1CZ8H 1NCAL 3MJ9L 4I0PB 1MCLA 4ZS7L 2C3HA 4DVRH 1ZSDB 4KJWD 4V1DE 1N59A 2LAGB 2WLZA 4MSWA 5MENB 1OB1A 3LN5B 1ETZB 1WZ1L 3KHQA 4GKSB 1A6UL 3RFZC 2YUVA 2P7TA 1PG7W 4FS0A 2BNQB 1KBGH 5DFTA 4HG4J 2BRRH 4PS4H 5D2NB 5E00B 4WW1B 3VWKB 4RFEB 4YH6A 1OAZH 4M61B 2HT3C 5I2IA 2NXZC 2EDEA 1CD1B 4G8EB 1S9VA 4OLZL 4LVEA 3I75A 1P69B 3Q1SH 4OZGE 1A9BA 5CJOL 1Z9LA 3GKWL 1S7RB 1HE7A 2BY1A 4NOFA 1MCCA 4Z95H 4GBXC 3HE6B 3BFOA 5GGSB 1FFPA 4KMLB 3ZMRA 1J05B 3R4DA 3HAEG 2C3WA 1FO0A 4KKLC 4M7ZC 3CAFA 1HI6A 5C08D 4GMSL 2HT3D 3PQYA 2FX7L 5I1HH 2QHRH 1A3LL 3AREB 2I9LA 5I0DA 5D1QB 5L2JA 1XF4B 4MDJA 1TCRB 2DQDH 4FFZH 3Q5TA 4UT6L 4GBXD 4ZO9A 1TQBC 2UV3A 3KPPB 1MRDL 2IAMA 4KKLD 5GIRA 4Y19A 1GIGL 3L5XH 3HR6A 3T77B 3OKLB 5EZLB 1JNHA 5ESAA 1FFOB 2CMRH 3NOIA 2H2SC 4JO4L 3C2SA 2ARJB 3KLSA 4YHMH 4QTIL 5IHZB 4I3RH 3DVGA 3TBVB 1CICC 5C6PB 5GGTA 1I1YB 2Y4SA 3B4NA 4LLMB 2GTWA 3QUZA 3JBG7 2YRZA 5IK3B 1B0RB 1MCJA 2BOBB 5E95B 3ZTNL 1DP0A 3GSOA 4PRBA 5AZ2H 1LE5B 2H2SD 5EPMB 2DLEA 2YD4A 3LMJL 4X5LA 4KRPD 1KLUA 1FFQA 2J3SA 1U8NA 4WWKB 2FATH 1CICD 1TENA 1K8IB 4G8GA 2IANE 1XGTB 2OZ4L 3GJFA 1MHCB 5F7HA 3EO0B 5IBTL 3TN0C 4GG8B 2C7UA 1T03H 4K9EC 3BGFB 1YNKL 4Z7OF 1D9KA 3VFWB 4DOHE 3L9RA 1XFPA 4M4PA 1XGUA 2EDQA 1RUKH 5IF0B 1T1XA 2Z31B 4OFPA 3QQ4B 3EO9L 2NW3B 3CH1B 3ULUE 4L4VD 2XN9A 1EO5A 2RCSH 1Q0YH 4OZHB 3GIZH 3QO1B 3FQXA 3MRHB 1UC6A 3TN0D 4JG1L 3NZ8A 2WLYA 2GSGB 3MLUL 5D1ZC 4N0UE 3SGEH 4XCCH 3CMOL 5L9DL 1A6VH 2E9IA 1KEMH 1VFMA 2IPUG 4LQFL 5I1GL 1N7ML 4DZBA 2B1AH 3O9WC 4HC1L 3F62A 2AXGB 4Z8FH 1ZHNB 1KJ2B 3KLAA 2WIIB 1F8TH 1VFBB 1G7QA 5IW1B 3V6ZA 4F80A 1GGCL 3QDMA 5D1ZD 2EIDA 2ZSWB 1I3UA 1X5HA 3GNML 1CR9L 1BD2B 4UQ3B 1W8OA 2EO9A 4H5SB 5C0BE 4JDVA 1UVQA 5FYJH 2ESVD 3O9WD 1GGTA 5FB8A 2E7LC 3OWEA 3AROA 5EN2B 1UJTA 2EH7L 5B39G 3TA3A 1NC2B 1CL7I 2MKWA 5GGRB 1DBML 2E9WA 3VG0H 3MNZB 1HNGA 3IFOB 3QDJD 2V2XB 3BH8A 1NC4D 1J7VR 2A1WL 1H0DB 1WGOA 2APWA 2R56H 3QI9C 4OZHF 2Q76A 1PYWA 4AT6B 2X44D 1LP9E 1EGJH 4UT9L 2VLJA 1FLRL 1CFSA 4LKXB 2YPVL 3TT3H 4N9GA 5IMMA 5FYKD 3NGBB 5I30L 1CLOH 1R3JA 1N0XH 4HGWB 4OGXH 3BQUB 3TVMA 4IMKA 4Z7VB 5F1IB 3D2UB 2DQHL 4ODBD 3QI9D 4ODSH 1CIUA 1OF2B 4Y5YA 5E2VL 4S1DC 3RL1A 2HRPH 1A5FL 4GLRI 2D7NA 3ARZA 4YHOL 5EU6D 2VDKH 4HKJA 5HYFA 2F74B 2CIIA 4PLOB 2ZSVB 2XZCL 1YEIH 3UBXA 3P73B 1JWMA 1D5BB 1RULH 2XWTB 3BT2H 2X4TA 2QSCH 3MRKA 4I2XB 1CZ8L 2OS7A 4HFUH 2XQYK 4S1DD 4DVRL 4GS7C 1FG2B 2ATPA 4KHXH 3RWJA 4PJHA 2YD3A 1OHQA 2VLKA 5DGQA 4GT7A 2YUZA 5JXAH 3QXAA 1JGDA 4KK8D 3RVTC 4UDTB 3RGVA 4FFVC 1U8OB 2AK4D 4W6WB 1KBGL 5DMJB 3NBNA 2CLRB 1TTFA 4WU5B 2BRRL 4OBSA 1MFDH 4H26A 4PS4L 1FCGA 2YXMA 1OAZL 3QXVA 3FN0H 1OAUH 3REWA 4NQED 2BVYA 3MLWH 5DJXA 5ACZA 3Q1SL 3BPOB 4Y4FA 3RVTD 2COQA 3V6BR 1A7PH 4LBEA 4NRYB 1UYWH 5CEXB 4FFVD 5BQ7A 3P0YH 1Z5LA 3HUJB 4YHZH 2OTWB 4Z95L 3GK8H 1UGNA 1BVLA 2Q3ZA 4Z7VF 3TYGH 4EEEA 4ZTOH 1UM5H 1LO2H 1B4JH 2D0HA 1DEEA 3IJSB 4KRLB 2I07A 2X1OA 1CGUA 1AQDB 3RVVC 5I1HL 2QHRL 2BNRA 2BCKA 3KG5A 2DQDL 5F3HB 4FFZL 4NRXB 4U1NB 3MACH 5JW3H 4A6YA 3S5LG 1V7NH 2R1WA 5IKCA 1KLFA 2C1OB 1EO8H 4M1DH 3L5XL 4G6FD 1MLBA 1MEXH 3RVVD 2CMRL 5F9WB 4AIXA 3QFJA 3B9KC 1EHLH 3RTQC 2EYRA 3O3DB 5DJDB 5BZDB 4YHML 5E70A 3ZKMC 1N26A 4I3RL 3FT2B 4F7CB 2NY6C 5D7IA 5FM8A 4JFQA 3FB8B 5EO0B 3SO3C 1QHOA 4ZFGH 1ZLVK 1Y18A 3RZWA 4PJ9A 3STZB 3RKPA 1IL1A 5AZ2L 3WNLA 4TSBH 2F8OA 3MJ6A 1T1ZA 3B9KD 4Z7QE 3RTQD 3PJSA 1IQDA 2C26A 1LNUB 2W0LA 3EYFB 1QHPA 1T66C 2FATL 1I1AB 3HUJF 2Y1VA 2NY6D 5EBLA 4CN6A 4HT1H 3NFPB 4WFED 5CEYB 2Q6WB 5IHUH 2JLLA 1T03L 1H3VA 2GY5A 5HHPB 4PJEB 5DJAA 1VEMA 3T8XA 2J5LB 5FUOH 1G0XA 1S7SA 1RUKL 4N1HB 4X9FA 1T66D 2DS4A 3OAZK 3TBWA 1PD6A 3G6AB 2RCSL 4U1JA 1Q0YL 4MQ7A 4PG2C 3JVGC 2RB8A 3GIZL 4QGTA 4U6XA 2DM3A 1DQMH 2HLFC 2Y5TA 1OP3H 2AS5M 4Y89A 3NCYS 3RKDC 2NZIA 3KPSE 1T89C 4XCCL 2EYSA 3U79A 3VFSA 3TZVB 1A6VL 1KEML 3EYVA 1IARB 4LKCB 3HAEB 2OJEA 2DQCH 2B1AL 4Z7WE 4TSCH 2DQUH 4PTUA 2WV3A 3HKFA 4Z8FL 4S2SB 2HLFD 3UZQA 1F8TL 4K07A 3RKDD 4LCCA 1CE6A 1SYVA 2DLGA 4MJ2A 4F7EA 3TO2A 2HJLB 4R4NC 2QL1A 4MQXC 4P4KA 5FYJL 3C6SB 4DQOH 5JORA 2MKLC 2XFXA 4LIQH 3WS3A 2E9JA 4S0TD 4MVBC 1JZ7A 3EGSA 2FH6A 2HH0H 2Q7NA 4IIQC 1OL0A 3H9SA 3BPNC 3OSKA 4MMXC 3FT3B 3WDHA 5AAMA 3UDWC 4PJEF 3VG0L 4R4ND 3MJ7B 2NX5D 3BI9X 3RVWC 2R56L 3EDKA 5JDJA 2E9BA 5MENA 3LN5A 1S7UA 1EGJL 1AXIB 1DE4B 4MCYB 5DS8B 1HOCA 1M71B 3TT3L 4FTVD 4GKSA 3WIHA 5L2KE 4JO1H 1CLOL 4NCC1 1N0XL 4R97C 4OGXL 4LHJB 1P4LA 5D2NA 3RVWD 4RFEA 4LPTA 4KI5C 1TZGH 4CAGA 1XZ0B 3G5ZA 3U4EB 4JLRA 2HRPL 3QZWG 4G8EA 3L1OH 3D0LB 5F9JB 1F4XH 4OF0A 4M7LH 5DUBA 2VDKL 4OV5A 1S7RA 2HT2C 1YEIL 1YEJH 3HE6A 5GGSA 3LDBB 2BFVH 5I17B 1FDLH 3BT2L 2XZZA 1XGQB 1FAIH 1Q94B 3F7YA 4OFVA 1EHXA 4KI5D 2ICCA 5EO9B 4HFUL 5JMOC 4EZMA 3DGCR 4PJFE 3TIDB 5BS0B 5KW9H 1G6RB 3AREA 3VGHA 4KHXL 4NM8H 1XF4A 1V05A 3P4MB 1P5UA 1TCRA 2YR3A 1IEHA 2HT2D 3U4AA 5F7MC 3SE4C 5JXAL 2WUCH 1FE8H 2W65B 5JUEL 1IT9H 3KPPA 4LHUG 3WN5C 4B50A 2JCCE 1KLGB 4M3KB 1XT5A 4NBXB 4BZ2H 4ONGH 1OGAB 1AGBA 1MFDL 2ICWI 4JFDD 1FFOA 5GRVK 4HDIB 3FN0L 1ZA3B 1OAUL 2MTPA 3PNWB 1IM9B 4O58H 4U0RC 5FUZH 2ARJA 4LSPH 3MLWL 4R90H 2VQ1B 4Z18A 1BEYH 5IHZA 2BHYA 1I1YA 1UYWL 4LLMA 3P0YL 5FAAA 4YHZL 2VDMH 3GK8L 1YQ2A 4DGYH 4PY8I 3TYGL 5CEZD 2F53D 1B0RA 5IK3A 2BOBA 4ZTOL 1UM5L 1LO2L 3V0VA 1B4JL 1DSFH 4KV5F 4C56E 4KVNH 1LE5A 2VDPH 5EPMA 3ZHLA 1INQA 4Q9QH 2VAAA 4XRCA 1H8SA 2CJUH 4Y8AA 5FO8B 4XNQA 1C7TA 1MCWM 1XF2A 5F88A 3KYOA 1YEHH 2IPKB 5ADPH 4XNZC 3GMRB 4JCMA 1K8IA 2QQKH 1XGTA 2E7MA 3SPVA 3DURB 4ZOEA 3MACL 1NMBH 5JW3L 1KACB 1MHCA 2W60B 3EO0A 5F96H 2VR4A 1FC1A 1V7NL 1CIDA 4DN3H 2VKWA 3VFWA 1EO8L 4M1DL 4ZNCD 1CTOA 1MEXL 5BOZG 2LTQB 4WUUB 2XTLA 4KKNA 5IF0A 4P2OC 1EHLL 5CFHA 2Z31A 4D9RD 2NW3A 4WVRA 1IEBB 2J8UA 3E3QC 4OZHA 4D94A 4D9LH 4HWUA 3PDOB 1AXSA 3B5HA 4CVUA 3QO1A 1C16B 2CKBB 4ZFFB 2UZIH 1A7RH 4LCYB 3VFOB 2GSGA 4PRPE 4PY7B 2ZUYA 4ZFGL 3SGEI 1CQKA 3C5ZD 4HUUB 4PRNB 3TBSB 5C0IB 4OZFB 4TSBL 3PWVB 4P2OD 3NCJH 1B3JA 3IDMB 1P7QD 2BK8A 1BM3H 1EZVX 1J5OH 2AXGA 1AO7E 2D3VA 3T04D 1KJ2A 1A4JB 2WIIA 5ISZE 4HT1L 1VFBA 5IW1A 3MBEC 4MD4B 2ZSWA 3UTPD 5IHUL 1A6ZB 3MRGA 1BD2A 4UQ3A 3B43A 3P77B 1HWGB 5E0QA 4QYOB 5FUOL 25C8H 4K7PY 3FKUS 3CPLB 3D85D 3LKRB 4NN6C 3C5SB 4X4XA 2WWKT 3SJVE 3MRNB 5EN2A 1HXMA 4NKIH 3BKCH 3FO2A 1Q72H 5E2TH 3DUSB 3WJJA 5GGRA 4EOWH 1AR2A 2C3VB 4LVOC 4RMRA 3MNZA 3IFOA 3PV7A 2V2XA 2ICEB 2X4PB 5CJXA 3SE3A 3KLHC 2CKNA 3ARDC 2DQCL 2UZXB 3QNXB 4TSCL 2VSCA 2DQUL 4K7PH 4AT6A 1VCAA 2F19H 3R1GH 4XPBH 1D6VH 3VXMB 5IB5B 3C6LC 5DXWA 4I3GA 5HHMB 5JNYA 1Z6JT 2XRAH 1B0GB 2F5BL 5FM4A 1MJUH 3U30C 1W2KT 3BQUA 5F70A 3S5LB 2CH8A 5DJ6A 5HYJB 4Z7VA 3ARDD 3D2UA 4XBEH 4L5FH 4JO2H 4DQOL 4NQDB 4YK4B 1OF2A 1CLCA 4LIQL 3DTXA 3GSRB 2X4QB 3ARGC 1MPAH 1EHNA 1YDPB 4AJ0A 2WQ8A 2HH0L 3C6LD 1CD8A 3U82B 3FQTB 3K46A 2ZSVA 3IKCB 1WICA 3P73A 2JJVA 4NDMB 3PF2A 1D5BA 3FN3A 4X9HA 2WMPA 4JM2C 5KAQF 1BLNB 4I2XA 2VE6B 5FKAB 3NFSH 3OAYK 4TTDC 4E0RA 3ARGD 3HN3A 1JE6A 1A02N 5IFJB 3EOTH 5E4EC 1MVFA 1ZHKB 2YD9A 4IMLB 4WO4C 4UDTA 4F2MB 1U8OA 4HS6B 4JM2D 5I8KH 5JOEA 4JKWA 4ZSOB 5HYEA 2H3NB 4TTDD 5JTWA 3M1BA 5E2WH 5E1AA 1ZHBA 3UJJH 1TZGL 3VFMB 4ODUB 5C9JA 3L1OL 1F4XL 2IQAA 4XVSH 4M7LL 1K3IA 4NRYA 5CEXA 1EFXB 3HUJA 2OTWA 1YEJL 1TVDA 1XMWA 2BFVL 1BFOA 3ARTA 1FDLL 3IAPA 1VFAB 1G7IA 4GXVH 1FAIL 5HGBB 3IJSA 4QHNB 1U8JA 1AQDA 4QY8B 5GRJH 5KW9L 4JHWH 1TPXB 4JRWA 4R26H 5F3HA 4NIKB 5EO1B 1P7HL 1FE8L 2WUCL 3MRLA 1IT9L 2DM4A 2BMKB 3I9GH 4P46C 5SWSD 5EDXA 4LDEB 5JR1H 2C1OA 1XR9A 2F54E 1T0NB 4ONGL 1U8MB 3H9ZA 1NEZG 4NNYA 4ONFH 3VXSB 3PWNA 1JZ8A 4BSVB 4WFFD 4O58L 4F8TA 1ZT4B 4RGND 5FUZL 4LSPL 4OI7A 1DVFC 2DQGH 3AXLB 3O3DA 4YFDB 5DJDA 3MV8E 3FQNB 1UM6H 4R90L 4CMHC 1BEYL 2JJSA 3FT2A 3UTSD 4PJ5E 2HYMA 3RX7A 5FO7B 3DXAB 3FB8A 5EO0A 2VDML 4UBDC 4DGYL 2K9UA 3MODH 5BW7A 3STZA 1NQBA 1DSFL 5FUCC 2F8XC 4KVNL 2VDPL 2BXZA 4L3EE 4Q9QL 1I1FB 2CJUL 2HKFH 3MJ8B 1DVFD 1LNUA 2E27H 3EYFA 1YEHL 4P23D 5D6DA 5TGBB 5ADPL 4LAQH 5C0AD 5C2BH 1L0XA 1REIA 2EE9A 2QQKL 2WK2A 4GKZB 3NFPA 1NMBL 1T20B 3S88H 1FNEA 2Q6WA 5F96L 3QHTC 2P8PA 1G1CA 3NA4A 4DN3L 4U1IB 1Q9KA 4QNPE 5HHPA 4JGJA 5J1AB 4KZDL 4PJEA 3H3KA 4DFHA 2Q87A 4NRZB 4PGBB 4L9LA 1OW0C 4U05A 3MRJA 3RIAK 3B3IB 4JVPA 3MLPA 5E8NB 4LCWA 1NDMA 1L7TH 3G6AA 3E8UH 4D9LL 4RNRA 3RX5A 3QZWB 1BZQK 5DSCA 4KTEH 4X80H 4EQ2A 1J9CT 5B8CA 2UZIL 1A7RL 2Z9TA 4HX1B 4KKBC 2FJFB 4PJ7E 3RAJH 5I74C 1INEL 3TZVA 5JA9A 3QISA 4LKCA 4X7CC 2VITB 1F4YH 3NCJL 3MOQA 4H1LH 3S3JA 1BM3L 1J5OL 2NTFA 2FH8A 2XPGB 4ODTH 3T09A 2CDEB 4JZOB 3S34H 3UTTD 4NQCB 4EJ1C 4CGTA 4Y2DB 4DK6A 4LHUB 1ZT7B 3C6SA 5DHXB 25C8L 3ZYJA 2CRYA 2V2WB 2CR3A 4JG0H 2Y7QB 3ZE2E 1GGYA 4NKIL 1Q1JH 4TYUA 1B6UA 3EOAB 3BKCL 5E2TL 1Q72L 3FT3A 3IFPB 3SGKC 3EJJX 4EOWL 1FFNB 1C7SA 4B7LA 4GRWE 4YXHH 4CDHA 3MJ7A 4U3CA 1UB5B 4DKDC 3GHEH 5EIVA 2W9DH 4OQTA 2AJYH 1N3NA 2ZUSA 3HB3C 2PXYD 5E2UH 3QR2A 4K7PL 4U6YB 1F3JB 2F19L 3R1GL 4N1CA 4XPBL 1D6VL 2AV1B 1ACYH 2NY5C 1DE4A 2VB5A 4MCYA 5DS8A 1M71A 5DJCA 1Z9OA 3TH4T 2ZP0T 3DECA 3L3GB 3VFTA 2GJ6E 2XRAL 4KU1A 4P2QB 3JV0A 1MJUL 5HDBF 3KXFE 1JIBA 5EU4B 5C0BA 3KDMB 5J0BA 4L8DA 1T21B 4M03A 3BN3B 1FVCB 4J12A 4NKQB 4L5FL 4XBEL 4JO2L 2EXWC 3HB3D 3JV4A 1XZ0A 2YEZA 3O3EB 1YMMD 3CK0H 1WJ3A 3U4EA 1NGPH 3TPKA 1MPAL 4OUOA 5F9JA 4DAGH 2ZOKA 4FQ2L 1PY9A 5DQJB 1R3HB 3INUH 5I17A 3F5WA 1XGQA 4G6KH 5E5RB 3BZDA 3N0PB 1Q94A 1VGKB 2ED8A 4HLZH 2EXWD 5EO9A 4JQXA 3NFSL 1MJ8H 2VWEC 1JF1A 3L5HA 1G6RA 5SWZD 4JRYB 5J57B 1LP9A 3P4MA 3GM8A 3EOTL 2BNUA 3MC0A 4R0LA 4JDZB 3JTSA 5I8KL 1KLGA 1G9NC 1OGAA 2EIEA 5E2WL 3WJLC 1T80A 4U3XA 1IM9A 2LU3A 1KJVB 3SDDC 1KIUA 3MUY1 4XVSL 2VQ1A 3O45B 3RBGA 5EOCJ 1DJSA 5FA4B 5EOTB 5B3NA 4JFFD 4KPHH 3G5VB 3CZFB 4NWTH 3OF6D 1HQRA 4GXVL 3RHWK 5IV2B 2VN4A 4NFCA 5CIPH 5EZJA 3SDDD 1VHPA 4UINL 5FO8A 2ZZUT 5CHNB 5GRJL 5T3ZH 4JHWL 1K2DB 4R26L 1JPST 4D0BB 1QBBA 1GVIA 2NY1C 1CDJA 3IAQA 3I9GL 1MCQA 4IRJC 4NBZB 4Y2OA 2XKNB 5JR1L 4UT7L 1A4KB 5C08B 4MNGB 4ONFL 3VH8G 4DEPC 1AD9B 4WIQA 5HTSA 4MXQD 4KMTH 4C59B 1KT2B 3KPTA 5SWQB 1IEBA 3FHQA 1IBGH 4IDJH 1FSKC 3O2WL 4Q0XH 4GBXB 1UM6L 4YLQT 4YHYC 4Q6YA 2VTFA 1C16A 2CKBA 3F7VB 5I19H 3CD4A 4ZFFA 4LCYA 3IB4A 4OZIE 1ODAA 4NC1E 4PY7A 2QQQA 3MODL 1DBAL 4MAYA 3UTQB 2FBJL 4PRNA 3TBSA 4HHAB 4F8QA 4OZFA 3X17A 3ZDYE 2HKFL 3BP7B 3IDMA 3V95A 2E27L 1JN6B 5D6CB 1MH5B 5HHQB 5C2BL 4LAQL 3VRLE 4I1NB 3D25B 3W82A 1R3LB 2W1NA 2FR4B 4TNVF 1HK6A 1WZLA 1I7UB 4MD4A 3S88L 3QPXH 1QRNA 5F3BB 2NPLX 1A6ZA 2YC1B 3C8KB 5CBEB 1WFUA 5E99L 2O61B 5EFIB 4FOMA 2Q8AH 3LQAH 3PWPE 5FV1L 2VZVA 4KRPB 4OCSH 4NZDA 3LKRA 2B7DT 2DMBA 1CICB 1PQZB 2AEPH 1L7TL 3E8UL 3MZTA 3RI5F 4EKXA 1D6EA 3ARBD 1JPGB 1EEQA 3DUSA 4KTEL 4X80L 2C3VA 2B4CC 4QRTB 1ZT1A 2VOTA 2R2CA 3VWJC 1X5FA 5C09E 3RAJL 3B8YA 1C8PA 2ICEA 2J8HA 3MRFB 4IOSD 4NKMA 3SE8H 4AEHH 5MHSD 5ECJE 2AEWA 5DRXA 3QNXA 1F4YL 4P5KB 3S4SG 3UPRA 2ZCLH 4L4VB 4OD1H 3ZDZE 1CGYA 2EDNA 5D96C 4ODTL 5D2LE 1NGXB 3VXMA 5IB5A 5D9SB 4BFGA 3TN0B 3WXWH 2BSRB 1DN2A 2P8LB 3S34L 1B0GA 3VWJD 4UIKH 3OJ2C 2VZUA 4G43B 4ZTPH 1RIVL 1V8HA 3C09B 4X8JB 1FIGH 3KPLA 1LWRA 1KN2H 2X4QA 1G9EA 1NEZB 3L3HB 4JG0L 1YDPA 1KJMB 3VD4A 2DQFB 4LCUB 2PYED 2ITCB 3FQTA 4M5ZH 5D1ZB 1NGWB 3K7UA 1EEZA 5TH2B 4YGAB 3BPLC 1TJHH 4JN2B 4YXHL 3GHEL 1BLNA 2ESVB 3O9WB 1FYTE 2VE6A 5FKAA 3MA9L 2W9DL 2AJYL 2CXKA 5E2UL 4WDIA 2A73B 3FZUC 1MVUB 5IFJA 1CFNA 1H15B 1ACYL 1ZHKA 3IGAA 3L6FB 4IMLA 4AM0A 4UI2A 4F2MA 3HRZB 5C0CA 4HS6A 1TNMA 3QDJB 1QR4A 1NC4B 5DD0H 2H3NA 5CEZL 2R15A 3HI5H 3VFMA 4ODUA 3CK0L 1IVLA 3PUCA 3IXAB 4ZDHA 2G75B 2ZUQC 4DAGL 5IP4A 3L5IA 4DJMA 3DI2B 4HLZG 2AQ2A 1EFXA 3INUL 4ZAKC 2XYCA 1HQ4A 5HHOA 1Z2KA 1VFAA 3GIVA 4G6KL 4OCLC 4ELKB 1VGEH 3QI9B 1TCMA 2X89D 1SHMA 2BDNH 3QIBA 5JIKA 4URTB 5HYQB 3VXTB 5EU6B 4LLVB 4PRHD 3O3AB 1QP1A 1CN4A 1CDYA 5BMFH 4JY5H 4X99A 3NIGE 5HD8C 2E6JA 3CFJB 2VDQH 2OX5A 2VYRE 4ZAKD 2BMKA 2CDGB 3RL2B 1YQVH 1T0NA 3RWCA 1C08B 2C4FU 4TPRH 1U8MA 2PTUA 4PJGE 1JYNA 4APQC 2ED9A 1NAKH 3LKSB 4TUJA 1S3KH 5ANMB 4BQBA 1OTSC 1ZT4A 4U7KA 3OKOB 3RY5A 3T0ED 1KV3A 3IDIB 1S7WA 4M1CC 2APFA 2WBJA 5ICZA 5CLTA 2AK4B 3ELAT 3DXAA 4O2EB 1WVZA 1JPFB 2HFFA 4KPHL 3OR7B 2HFEB 4N90D 3ALWA 3MGTA 4NWTL 4APQD 3FT4B 4GS7B 1F11B 4TVSa 3B9VA 43C9A 1OTSD 1I1FA 3PP3K 3MJ8A 4X0KB 2A6DB 5T3ZL 4CRPA 4F7MA 5TGBA 1NFDE 2KBGA 4M1CD 3I6LD 3LEYH 4FABH 5AD0B 4K71C 4XP6H 4MNQE 3O41B 4NUJB 3VDCA 4I4WB 3WFDH 2Z92A 2BVOB 4WV1C 4KHTL 4NRZA 4PGBA 3KYNA 3B3IA 2HVKB 1UQSB 2H41A 5K33A 4KMTL 1RZKH 5T1LD 4IDJL 3V6FB 4DZ8B 4Q0XL 2Z93B 3KWWA 3QZWA 1WBXA 5FYJU 5I19L 1U8PB 1DANU 2FJFA 4G6FB 4PJCE 1MHPH 1S9XB 2Z91B 3C60A 2RFXB 2UY7A 3VXQA 5JO5B 2IFGA 3ULVD 1TJGH 2R2BB 4QHKI 4AQ1B 1WC7B 4LSSH 2HG5A 2IAMD 3HC4H 3VW3H 5JIHA 1WISA 2CDEA 1IC4H 4JZOA 3GUTA 3QPXL 3U83A 2FHBA 2PYFA 2H26B 3S98A 5HYSA 3U7YH 4Y2DA 3IDYC 2PCPB 3ZYZA 4LHUA 4V2BA 2Q8AL 3B9KB 3RTQB 1E0OB 4AL8H 4OCSL 2V2WA 5GGUB 3K8KA 3OPZH 2DLFL 2Y7QA 2AEPL 4MJIE 2NY6B 2CDFB 5DZLA 2VERN 1JWUB 2GK0B 3SO3B 2OLDA 4OBRA 1BX2B 3IFPA 3I3DA 4UNVA 1R3KB 1NGYB 4IOIB 5LGKA 1URLA 3MRDA 4PPTA 4AEHL 4G8GD 3U0PB 5DMKB 3EIFA 2ZCLL 3A0OA 4AG4H 4OD1L 4U6YA 1X6LA 4F15C 5C07A 1T0PB 2AV1A 4F9PA 1BPVA 3BSZH 4FFYH 3WXWL 3L3GA 4G3YH 3Q5YA 1KTDB 5FYLD 4UIKL 1YUHA 1PG7H 1IGCH 1U93B 4ZTPL 3ZE0E 5JOFA 5EU4A 3CSPA 3K1KC 3GSVB 1WBYB 1HXYA 1ITBB 2XN9D 5HY9B 1FIGL 1PDKA 2I25N 2WP3O 2UWEB 3O3EA 4NYLB 1KN2L 3L3IA 3SJVA 4AZ8A 2GAZB 2CO7B 3BP5B 3MPCA 3VH8B 5IROC 3F12B 1EBPA 1CS6A 2QTEA 2FB4H 4M5ZL 5DQJA 5L0QC 1NCCH 1R3HA 3TH3T 4J3SA 1FC2D 5ACLA 2YXFA 3FQUB 1IMHC 5KANI 4P2RD 1TJHL 3SOBH 2OXHA 5TF1H 1XCTB 1Z9MA 3H7BA 5EULV 3MV7D 2H9GB 4ERSH 3RDTC 4LK4A 3TA3C 3EKCA 3MRIB 3QDMD 2HVJB 3MUJA 1OQOA 3CIQA 3X11B 4KDWA 5HXMA 5M95B 4TN9A 4JDZA 2XNAB 1E4KC 5DD0L 5DWUH 5HYJE 5BRZD 5A3IC 3OMZA 4HV8A 3BP6A 3RDTD 1RZIA 3RJDA 3HI5L 3TA3D 1KUMA 4ZFZB 2VAJA 5BXFA 1KJVA 3LEXA 4NP4H 3BPNB 1CVSC 1JZ4A 4BSWA 2AABH 4FTVB 4HCRH 1MFAH 1ZLWH 3TVMC 3KPRE 1T04B 1DN0B 3G5VA 2F9BT 1ITCA 3CZFA 4HF5H 3IF1B 4NO3B 5A3ID 5IV2A 3KPQA 3RA7L 2VXQH 5HHNA 1VGEL 2UWEF 3VXPA 2YRPA 3WDJA 2P43B 4QHUA 2VLJD 2BDNL 3BWAA 5IEHA 5CHNA 1K2DA 4C55A 3S4SB 5IVNA 4JY5L 4ZFOB 3TVMD 4D0BA 1WIPA 4R97B 1FGVH 4JN1H 4YO0B 1YQVL 1YPZB 1OT2A 1A4KA 4ZSOE 5C08A 4ELME 4Q9RH 4TPRL 1F3DH 4HK3N 4P9HC 3SDCC 1A7BA 4MNGA 2ZUWA 2DJ4A 1X5IA 4KUZH 1NAKL 1AD9A 3I84A 1S3KL 1D5ZA 1KT2A 3H6JA 2OJZL 2E7HA 4GBXA 3JWNC 3RGVC 2J2ZA 3MXVL 3TNNB 2FO1A 4E5XB 3F7VA 4BQ8A 1SJXA 1LDPH 3NIDF 3ARSA 1QSFD 1QLRA 5LG1A 3WO3B 3ZTJH 3SDCD 3E6FA 3HR5A 3UTQA 1UADC 3GMPB 4JFDB 5DRZB 5IWLC 4HHAA 4L8CB 2VLKD 3BP7A 4Y4FC 1QEWA 3V2AR 3Q6FB 5D6CA 1MH5A 3RGVD 2VZSA 4WI5A 1N6UA 3SDAC 2XY2A 1X5KA 2MNUA 3D25A 3PHSA 4CADB 5C3LD 3LEYL 4FABL 3WN5B 3BISA 3BIKB 3WFDL 2F53B 3TFKC 1UH3A 5FYJE 1VSCA 4JY4B 5TPWH 1U58B 2O61A 5EFIA 4M43H 1ZK9A 1UCTA 3F58H 5KN5A 4Z7UB 2EDHA 4U0RB 2BZDA 4Y4FD 2AJZB 2EICA 5C0FB 1G9MH 1I3RA 3SDAD 1ZMYA 1H3TA 1CICA 1RZKL 1PQZA 4XCEA 3DX6B 2W0PA 1M7DB 3GSXB 3WUWG 1JPGA 1YPZF 2L4OA 1SQ2N 1SEQH 2J1KA 1NCWH 4QRTA 4KI5F 3TFKD 3G6JB 3MLYH 5F8RC 1CFBA 1MHPL 1W0VB 2Z8RA 5KVMC 2BVTA 5DVLA 5CGTA 4TOYH 4L3EA 3E1F1 2E8YA 2EE2A 3H3PH 3H0TA 1TJGL 3TM6A 4X6DA 3S3SA 1TETH 4LSSL 1IGMH 4BUHA 3V0WL 3ALXA 3HC4L 5ICXB 3VW3L 3W2DH 2HRLA 5D9SA 3W5MA 4MHHG 2VDOH 2P8LA 4PTTB 1IC4L 1IJ9A 2NY3D 3QA3B 5DMIH 1T2QH 5IVOA 3HC0A 3C5ZB 3U7YL 1JNNH 4JGMA 4P2OB 2X2YA 3VFPB 4AMKH 4AL8L 4RBPH 1P7QB 1KJ3H 5CJQH 3L3HA 3BKYH 3G5XA 3OPZL 2DQFA 1RI8A 4QGYA 1UZ6E 5D1ZA 1UH2A 4LOUC 5TH2A 5A2KH 5IFAL 1FG9C 4RSVA 5C0ND 4JN2A 4Z7UF 1MI5D 4YNYA 3ARUA 5HDBE 2ESVA 3O9WA 2V7HA 2RAMA 1M1SA 3D85B 5INCB 3CDFA 4PYGA 4MCZB 1MQKH 4PJAE 4AG4L 1XF3A 2A73A 4NO5B 5EIIA 4C57C 1MVUA 1H15A 5I1DA 1BBJA 2NW2B 3FFDA 3QDGD 3L6FA 1PZUB 3G6JF 3BSZL 4FFYL 4LOUD 3HRZA 3BZEB 4NQCE 3W9DB 3VGBA 3VGEA 2CRZA 2UVEA 1NC4A 1IGCL 1J8KA 2P5ED 2E7LA 4NN6B 5LXGH 2BY0A 2ICWJ 1NFIA 3IXAA 4BFBD 4H20H 4UOJA 3G9AB 2FB4L 1NCCL 1FNGB 1UWXK 2PETA 4JR9H 2F15A 3ARDB 2H32B 5TF1L 3SOBL 4PY8J 4ELKA 3QI9A 2FEEI 3RU8H 4X9BA 3EO1B 3T0AA 4ERSL 5HYQA 4XPAH 4Y16C 3VXTA 2W92A 4LLVA 3C6LB 4U1SB 3OKNB 3R8BB 5EBWA 5C86A 4G8FB 5DEGB 3W0WA 3CFJA 1MFNA 2VUYA 1FO0H 3U30B 3D0VA 4P2QE 3RL2A 1U8LA 1OTTC 3L7EB 3N9GH 3GMMA 4X7SL 3GSNA 5DWUL 1C08A 4AIOA 3ARGB 1QFWM 3WNPA 5ANMA 2RQ8A 2FWOB 3ULVH 2YPKB 2OMBA 4NP4L 5EUOE 1S5IH 3OKOA 2AABL 4HCRL 1MFAL 4J3TA 2AK4A 1BQHG 1OTTD 4O2EA 4JM2B 5IB2A 1JPFA 3OR7A 5F6HI 2HFEA 3D3VE 4HF5L 5E94A 4LLYB 1I7RB 3FT4A 3RPIB 5I1JH 4X0KA 4NQEA 2XWBB 1GC1H 5E4EB 5FGCB 5GGTH 2YN3A 4LSVH 3BZFA 1MHEB 5AD0A 4ETQB 4OIBA 5HHXH 1ZGLB 1FGVL 3O41A 3BWUC 4JN1L 4F57L 4UZGA 4CJ1A 1PFCA 4I4WA 3GMQB 4JRXD 2BVOA 3GZKA 1IZJA 4Q9RL 2A2QT 4JPVH 3V7AG 4D0DB 1SEBB 4KUZL 4OM1H 3UC0H 2HVKA 4KQ4H 1K8DA 1UQSA 3P9LA 4PJDE 3FB5B 4Y1AE 3V6FA 3V0AC 4DZ8A 5EA0H 3ZTJG 1NBYB 3L7FB 5SWSB 2FECL 1ZOXA 4FZEH 1N64H 3PWLA 3FTGB 1S9XA 3GSUB 1QRKA 5MEQB 4L3AA 1X5AA 2RFXA 4ZUTB 1YNLH 3QEQE 2R2BA 5DQ9B 4RGNB 2DWEB 1WC7A 3X3GH 4EUPG 2MJWA 5IBLC 3UTSB 1CFTB 4JM2F 5T1DH 1YJDC 1KPUA 5C0DA 2H26A 4D9QE 2PCPA 1F4WH 1LK3H 5TPWL 3B9KA 4LIQE 4M43L 4X6FA 4B53A 3F58L 3RTQA 1DQDH 1DVFB 4MHHI 3CFEA 1G9ML 4P23B 5GGUA 5C0AB 5IBLD 4QHMA 2CDFA 2P42B 1JWUA 4LGRB 3DHJA 4PJBE 4HWZA 3KPNA 1BX2A 4QLRA 3ZLQC 1JF5A 3K4AA 2EXYC 2DWDA 3D39D 4OZIA 1SEQL 1NCWL 2X70A 4PB0H 1NPUA 4BQ9A 3MLYL 5T5FH 1U42A 2YD6A 5CJBA 4ZOBA 4PJ8C 3LOWA 4TOYL 4EI5C 1FL6B 1ZWIB 1N8ZA 3H3PL 3AY4A 1JI2A 1TETL 2VABB 1IGML 1TVBB 3QWOB 3HE7C 5IMOA 1ZANH 3W2DL 4OQ1A 5LQBH 5C7XH 2IQ9H 3CFBB 3MLRH 4M8QB 3C08L 2VDOL 3MLZH 5DMIL 1T2QL 1FL5A 5JOPE 1JNNL 4PJ8D 4Z7NE 4EI5D 2FLRT 5HY9A 1T5XB 5FECA 5E6IC 2KQMA 1HEZA 4AMKL 5DJ8B 1KJ3L 2W9EH 4NYLA 5CJQL 4PG2A 2GAZA 3O11B 3HE7D 3BKYL 3BP5A 3TIEB 1PX3A 1X5LA 2QKIA 2ORBL 1BJMA 3DI3B 3GSWB 4IOFD 1T89A 2MCPH 3UTTB 5I74B 1J1PH 5EWIH 3HG1D 3FQUA 3IFNH 1B9ZA 1V3MA 3S7GA 1XCTA 5A1AA 5E6ID 2V5TA 2YA0A 2H9GA 3MRIA 1MQKL 4WWID 2HVJA 2XTJC 5D2LA 5GSRA 5DC9B 1KCRH 4N8VB 3TESA 3EZ8A 1A7NH 5JHLL 5KSVB 3VMPA 3VXUE 1H3XA 4HMEA 3SE3C 3DV4B 3V6OE 2F8VA 3MXWH 2NX5A 3I02A 4AEIH 3OGCB 2DB8A 3Q2CA 5GS2H 1UJ3B 5GS1B 4EXKA 5LXGL 2PXYB 1PKQB 2XTJD 4IIQA 3ROLB 2YD1A 4J4PC 3DUUB 4H20L 5E56A 4UOW0 4FTVA 3U4BH 3LKPB 4DVBB 2R23B 4LSUH 1WK0A 2YWYA 1T04A 3DX7B 1DN0A 4JR9L 3IF1A 4NO3A 4GW1B 2DLHA 3RWDB 3RU8L 3SQBA 1YMMB 7FABH 2FHFA 4KQ3H 1NANH 3WFZA 4XH2A 4XPAL 3KPOA 2HMIC 2AEQH 4D3CH 4ZFOA 2X40A 1FO0L 5IIEA 4X5WA 4PRIE 4JFEA 1J0YA 2BC4A 3N9GL 5IUSA 4WY7H 3HZYB 5F9OH 5J13C 2HMID 1MFCL 5SWZB 3L5JA 5J11C 1OGTB 3ULVL 3OJDB 4IEFB 5T1KD 4A6YH 4U1HB 4CL7A 3ZYIA 4X6CE 3UYPA 5JLZB 1L9NA 1S5IL 4LLQA 1WBZB 2C4XA 1UENA 3U9UB 2P45B 3FB6B 1J8HE 1UXWB 3LH2H 3MSPA 4R4FH 4JHZA 4XP9H 1RZJH 4X7TB 4OM0H 4R7NB 4GG6E 5A43C 3ULSB 4JFDA 1IAIM 2IH3A 5IB4B 5I1JL 1HSAB 5D7KE 1AP2B 1KG0B 1AC0A 2GJZB 2OZ4A 1GC1L 3SE4A 3Q6FA 5GGTL 3VFUB 5C0EB 1A21A 4LSVL 3HZKB 1MNUH 3EAKA 4CADA 4PIRF 4L4JA 2EKSA 2B8OT 4JFFB 1HINL 3NIFF 4HUXA 4XC1H 5CZKA 2F53A 3PE9A 2KKQA 4H25B 3V52L 4P57B 4JPVL 1P2CB 2PW2B 4OM1L 3SDDB 3UC0L 4OFYD 2G5BB 4KQ4L 5C0FA 2VDLH 1OY3B 1BIIB 4L4TE 1HWHB 5ITFA 5KJRH 1AIFA 2CUIA 3DX6A 3WEXA 1BHGA 1DQLH 3PHQB 4GRLC 5EA0L 5B3JF 3CVHB 1M7IA 4PRDA 1M7DA 3GSXA 3P11H 3TBTA 1XH3B 3UZEA 3X3FH 3G6JA 2V7NB 4FZEL 1TVHB 1N64L 4HKBA 4V1DD 4WGWB 1J12A 2XWJB 4XCNB 1A8JH 4P3CH 1W0VA 4YEFA 3RIFK 4ZUSB 2ITDB 1EMTH 3BHBA 3JWOH 4XAWH 1LILA 4OD3H 2X05A 1GZQA 4GRLD 1IKFH 4DUVA 1OM3H 3H7LA 4JANA 4BKLB 4G9FE 1BF2A 3LZFH 4YHIA 2APBA 4YHNA 5D7LE 1OP5H 2CD0A 5BW7C 1KPVB 3HMXA 4PTTA 5T1DL 3QA3A 3QFDA 3PGDB 2W0KA 1W8NA 5I8OH 4TRPH 1CBVH 4MMZC 3PWUB 1F4WL 4DEPB 1LK3L 5I1AB 2V9QA 4P2OA 4M7JL 4R3SA 1DQDL 1T5WB 3VFPA 2D7QA 1FZOB 1P7QA 1KTLB 4JO3H 1FSKB 4KFZC 3JV5A 4YHYB 3CDYA 3U2SB 2F58H 5AYQA 1A2YB 3CX5J 3MV9E 4H8WH 4KAQH 5DZNA 4PB0L 3GMLA 4L9LC 3UPAA 3WLBB 2RIKA 5T5FL 5T5NG 1BQHB 2AJSH 2JB6B 1K85A 1ZAGA 2NNAA 1S78D 3D85A 5INCA 4D8PB 1AKJA 4YUEH 2GSIB 5I1LB 5I1IL 3GFUA 4NO5A 1YY8B 4C83B 4P5MB 5CILH 3MBEA 4XI5C 5LQBL 3AM8C 2NW2A 5C7XL 3ARBB 4ZMAT 5IMKA 2IQ9L 3MLRL 4JPWL 4WRLA 1IKNC 1YEGH 1N5YH 4X4ZA 3KYMA 4JFPB 3BZEA 4HKXB 3MLZL 3JXAA 4LASH 3W9DA 1JFQH 2O5ZH 4LCWD 4U6HB 4X4ME 1YEDB 3O6FC 2N1KA 2W9EL 3IFLH 3WKNA 5GGSY 4XI5D 1JPSH 3WIHH 1MOEA 3DARA 2HN7B 5C8JA 1F2XK 2MCPL 4N5UA 4MXVE 3VWJB 1HNFA 1FNGA 5EWIL 5IVZB 4QTHB 2DIAA 4MX7A 3ARDA 4TNWF 5DK0A 1I75A 5KSAC 3UBXG 3O6FD 3FQWB 4OLVH 3ULUC 1DQTA 3P4NA 4J3VA 4XZUB 2IAND 3EO1A 2EC9U 5MP6H 2LQRA 1F5WA 5D96B 1XCQB 3C6LA 1HYRC 2ZG2A 2PYEB 3MOBH 5SX4H 1KCRL 4LLUB 1I4FA 4G8FA 4EUPB 1A1OB 1KB9K 1A7NL 2VNCA 5E8EB 1M4KA 5DEZA 3FQRB 2ZPKH 4MLSA 4XXCA 3L7EA 3MXWL 4GSDH 3ULUD 4EIZC 4AEIL 1RFDH 2YA1A 1CFVH 1F02I 3KNBB 2FX8H 4Z5RB 2BY3A 3ARGA 3WHXB 2FWOA 2UWEE 5EU3B 2YPKA 4J8RA 4L29A 2A74B 1RZ8B 2R4RH 2XZQH 4YAQA 1MUJB 3U4BL 3UMTA 5I16B 3BPLB 3H2WA 4LSUL 1MAJA 3U9PH 2DL9A 4JM2A 4ZNEE 2AQ1A 5HBBA 4WJ5B 2BSTA 2VISA 4PR5A 4U1GC 3U7WH 3RPIA 7FABL 1G1YA 4HKZB 4KQ3L 2HKHL 2XWBA 2AEQL 3BDYH 4D3CL 1T7VA 4WO4A 5B4MC 1MHEA 4ETQA 5AG9A 5C0BD 1ZGLA 2ICWA 2P5WE 4OD2B 3GMQA 5FCSH 5EC1B 2V9TA 2FIKB 1LO3L 2NR6C 4XHQA 4JKMA 1S5HB 1UM4H 5F9OL 3FCTA 3G9VA 4PRHB 2ZUQB 1JF6A 3DO7B 5H94A 4YEEA 3FB5A 4B5EA 4A6YL 4FNLH 5B4MD 5GPRA 4UB0H 1NBYA 3G5YB 4R0LC 3F65A 3L7FA 4X4YB 2FX9H 5SWSA 3LH2L 4K3GA 4R4FL 4XP9L 1E4JA 1RZJL 4OM0L 1V3JA 3FTGA 4LRNH 3WFCH 3T0XA 3JWDC 3CFCH 1Y0LA 3BPCB 4X6EB 1YEFH 3OHXB 1WTGT 1A6PA 4D0CB 2XI9A 3MUZ1 3T0EB 1CFTA 1MNUL 1AR1C 4P46A 3PHOB 1CD0A 4RMUA 1P6AB 2Y6SD 2BY2A 4GW5B 4XC1L 2YSSB 1YPZE 3GI8H 4APQB 4ELMA 1OB1B 5C2UB 3HZMB 1DVFA 2MQ3A 2NY2C 1KJ2H 2K7QA 4K2UH 1DQQB 2VDLL 5GGRY 5KJRL 1AR1D 3UEZA 1IAIH 1DQLL 5EBMB 4YE4H 3P11L 4J7RA 3CX5K 5IBUG 3W11D 4PRAA 3X3FL 5DUPH 5I2IB 1S9VB 4P3CL 1CVRA 2NY2D 1FL6A 1ZWIA 3OXSA 1EMTL 3JWOL 1H3GA 3DMMC 3REVB 4KXZH 4OD3L 5T1LB 2ADFH 1A22B 1MRFH 4GMTH 1IKFL 4K71B 4CN1A 4KTDH 4X6BA 2BHZA 4U1LB 2HTLC 4YGVB 2FL5A 3CFBA 3DJ9A 3LZFL 1PY4A 4WV1B 5I8OL 1SBBA 4TRPL 5KVEH 1DDHB 3N85H 1FP5A 3ORJA 5L2JB 4XCYB 4MDJB 1RK0B 1T5XA 4Z7UE 3DMMD 2D0FA 3R0NA 4JO3L 3BD4A 5LWYH 3EYSH 4B0MM 2NYYC 1JRHH 2IAMB 4R2GC 2F58L 4FHBD 3TIEA 2GCYB 5GIRB 1UEYA 4H8WL 3BGAA 4MAYD 5ESAB 1PX4A 4KAQL 2Q7YA 2G2RA 2VZOA 1ZVYA 5MEOA 3D1MC 2X6MA 3NAAH 2AJSL 5L6YH 3E2HC 4I13B 1OAKL 2NYYD 3PABB 4R2GD 1EGJA 4YUEL 5EZOH 2QQLH 3V8OA 4HUMB 4YJZL 1QBAA 4TSAH 4JPIA 2AV7B 5CILL 1SMAA 1QRND 3MR9B 4NHCH 4N8VA 3GSOB 4C54A 2Y23A 3QEUA 1JHTB 1G7HA 5KSVA 1N5YL 3IDYB 3WO4C 3QWRD 4LASL 4LSRH 3GEWB 1JFQL 1EO7A 2O5ZL 2D03H 2N7BA 3OGCA 4OLXH 2EDLA 4G8GB 3DVFA 3GJFB 4QXTA 2CIKB 4HH9B 1PKQA 3IFLL 3ROLA 2C3XA 4LPWA 1RAMA 1JPSL 3WIHL 3SGKA 3DUUA 4W68A 1EVUA 4JFHE 3LKPA 5BJTB 4DVBA 2R23A 4TQEL 1BMGA 3L9RB 5TQ2H 4MWFB 4G7VH 3DX7A 2W91A 3S97C 4NHUA 4FXGB 3CXHJ 3ULVF 3BRDA 2XN9B 3DUHA 4GW1A 3S37X 4OLVL 2ZUTA 3LV3B 1Z0NA 1J1OH 1I8LC 1YMMA 5T3ZE 4XC3H 4F15B 5MP6L 4PJAA 2QQNH 1NANI 2DI7A 1J1XH 3MOBL 4NJAH 3FL7A 5L88H 4WTZA 4JQVA 1HH9B 2ZPKL 3T3PF 4F37F 2R2EB 4P2RB 2A83A 4GSDL 1RFDL 1CFVL 3MV7B 2FX8L 1O0VA 1G7QB 5SWZA 3QDMB 1OGTA 4HULB 3BYTA 3OJDA 5ID1B 1IQWH 3KPSD 3QEGL 4UQ2A 5DHVA 5L0QB 4TVPH 5JLZA 2XZQL 2R4RL 1FNSH 3ZKNC 4DW2L 1WBZA 3QCUH 4JDVB 1I7ZB 3FB6A 3U9PL 1UXWA 5CSZA 1GH7A 1JTOA 3CNKA 4R7NA 4AEFA 3KYAA 5BRZB 2BSSA 2BJMH 3BDBA 4XNUH 2P24A 4FN0A 3U7WL 3TA3B 1OCWH 5A40E 3LY6A 1MQ8A 3VFUA 2P48B 5C0CD 3OKEB 3BDYL 1NDGB 4M6AA 3HZKA 4Y4HC 3ZKND 4QHKJ 3BH8B 4GH7B 3AFLA 1A3QA 3M17B 2AJVL 4P2YA 4PLNC 4JFFA 3TC9A 2SEBB 1JNJA 1INDH 3P2TA 4WFHE 3RWGB 3OF6A 4RMWA 4Q6IC 1WFOA 1EZVY 1PYWB 4QRRE 3WJLA 2YD5A 3QUMB 4H25A 3TJHC 4P57A 5MI0C 4BH8A 1U95B 2VLJB 1P2CA 1VADA 3SDDA 4XHJC 1UM4L 2DBLH 4MDIB 1BIIA 4Y4HD 5EUOA 4UB0L 3PHQA 3TVMB 3CVHA 5HHOD 3EYUH 4MA7H 3EOBA 2FX9L 3GMNB 1XH3A 4IRZH 2XQYG 3UZVB 1UWGH 4ACPA 4UAOB 4RA0C 2X9XA 4Y5YB 3FRUA 1BAFH 3TJHD 3QIBD 3DGGB 3ZKSD 4LRNL 3WFCL 3MV01 4XHJD 3CFCL 3DV6B 3BIBX 1YEFL 3CFDB 3UBXB 5GQBA 5L2KD 3B9AA 4NSKB 2WBJC 3WKMH 5CP3A 3TO4C 4IRJA 2Q1EA 2X4TB 3MRKB 2X9YA 5D5ME 3GBMH 3PGDA 1QSFB 3CSYA 5JW5B 1U3JA 4HW6A 2ATPB 3GI8L 3RWJB 3PWUA 5T5NF 5I1AA 3HFMH 3FFCE 2VLKB 3QXAB 1JGDB 1ORQB 1FZOA 1KJ2L 1KTLA 4K2UL 3RGVB 2WBJD 2MSPA 5FHAH 3TO4D 4POYA 2GEEA 1IAIL 5DURD 1A2YA 3L3DA 4BELD 4YE4L 3QUYC 4QXWA 2G60H 3WLBA 3MQIA 5DUPL 3REWB 3RUGA 2JB6A 3GSQB 2V5MA 5ACZB 3T2OA 4Y4FB 2DTSA 3BP4A 5C70A 3QEQA 3NCBB 5DA0B 5F8QC 4D8PA 4K7FB 3SDAB 4RGNE 1OWRM 4I77H 2GSIA 4JFZH 5F7WC 2ADFL 3QUKB 4QO1A 1MRFL 1YY8A 4GMTL 4P5MA 4KTDL 1NAMB 5HI5D 5I1KH 3GB7A 1A1NA 2I07B 3LMJH 4JFPA 3C60C 4ZPVB 5KVEL 2BCKB 1RZGA 3N85L 1QSEE 4OQTH 1JYVA 4MA8H 4U6HA 1YEDA 1KFAH 3CFIC 4XAKD 4K7PX 5LGHH 2PO6A 5LWYL 2L7UA 3EYSL 3MLXH 1JRHL 1CCZA 5C0AE 2Y06H 5IKCB 4Y8DC 2Y25A 3HTLX 2NY3B 3WFBH 4OZ4A 1MLBB 3VWJA 1OT1A 3C60D 4C56D 2AJXH 5IVZA 4H0IA 3NAAL 3DIFA 5L6YL 4MNHB 3FQWA 5T3XH 4M4RA 4XZUA 3DBXA 3CXHK 2OSLA 1F4AA 4MJ6B 4RGMC 1WCQA 3U0TB 5I1CH 1MFEH 5EZOL 3JV6B 1QVOB 2ADIB 4TSAL 3CMOH 4KK5C 1FYHB 4NHCL 1PW3A 4LLUA 1A1OA 5SX4I 5CCKH 5E8EA 2UYLA 1MAMH 3AGVA 2EEBA 1MI5B 2Z8SA 4LSRL 4GOSA 1BVZA 2D03L 5DVMA 4OLXL 1G6RH 4Z5RA 5EBLB 3BMWA 1HHKB 3MNVB 3WHXA 1UA6H 4R4BA 1ZKAA 1CLZH 2J6EA 5EU3A 2JTDA 4KK5D 4PRPD 1XR8A 3QDGB 1RZ8A 4K94H 1MUJA 3V5DA 4KUCD 5I16A 5TQ2L 4G7VL 1S7XB 3PWJB 4WJ5A 3AB0C 3TEUA 5BV7C 2P5EB 5IBUB 1EK3A 2GW5A 2EDFA 5C07D 3VXRE 1RUAH 5ISZD 1J1OL 2V5RA 4HKZA 2Y5TB 4XC3L 4I48B 5F1SA 2QQNL 1QQDA 2EYSB 4Q58C 1J1XL 4RMVA 1T6WA 4HWNA 4NJAL 5FIEA 1FLTX 4OFKA 4FQCH 4YPGA 4UTBH 1JK8B 4QOKE 5HVHC 4J6RH 3SJVD 2FIKA 3QQ9C 2OI9C 2X89A 1JZ6A 1T4KB 3NFNA 3IDNB 1S5HA 5C0GA 1SYVB 4PRHA 3DO7A 3MLSH 1RJYB 5IB1B 1IQWL 4F7EB 3TPUB 4TVPL 1P4BH 1IC7H 2D7PA 2EDBA 3IJHA 1FNSL 5C71A 4ZAKA 1OTUC 2DQHH 3QCUL 5JORB 5EB9A 2XFXB 3RP1A 1BZ7B 3QQ9D 4NQSB 3TH2T 3AU1A 2BJML 4HGKC 1DUZA 4XNUL 1KCKA 4X6EA 4XGZB 3BPCA 2CRMA 1OCWL 4MJ5B 2RR3A 3OHXA 1RQ5A 2JELL 2NTSP 5DJ0B 4D0CA 2CKBH 2G5RA 2DLTA 2P4AB 1OTUD 2X1WL 1FZMB 2D9CA 3PHOA 3O81A 1KULA 2JE8A 4RIRA 1X3DA 4GW5A 4YXLH 1P9MC 2YPLE 1INDL 2YSSA 3U36A 4OZFH 4APQA 3HZMA 1IAOB 1S7UB 5ETUB 1MIMH 1HOCB 5DTFB 1ZS8B 1AQKH 1DQQA 2DBLL 1LGVA 3STLA 1PJ9A 2OR8A 5EBMA 4CMMB 1T22B 2VR5A 1IAII 3EYUL 1P4LB 3LSOA 4MA7L 4PJXB 2E6PA 4IRZL 3VCLA 1UWGL 4FG6C 2RGSA 3EDJA 1LVEA 4P4RB 4JRXB 1BAFL 3G5ZB 1E6OH 4JLRB 3IT8D 5DUBB 1JGEB 4NFBA 3BKMH 1CGVA 5AZEH 4OV5B 5TE7H 1ULVA 3REVA 5T1LA 3MRBA 5E08H 1OD7A 4XBPB 4KXZI 4J1UA 3SQOH 3WKML 4U1LA 2WNGA 5HPMB 4YGVA 3F7YB 4FG6D 4LLAA 5EH1A 3B6SB 5KSBA 3GBML 2NXZD 4I0PC 3HPJB 2GT9B 4WV1A 1DDHA 5K59F 4XCYA 3HFML 1JGLH 1MSPA 1RK0A 4HJGB 1GXEA 5GRVL 5EU7E 1M7XA 1AGCB 5I18L 1KNOB 2N4IA 1TMCB 5TF0A 5KS9B 2GCYA 4ZPTA 1JRHI 5FHAL 3RBSA 1SYSB 4ZYKA 3SDXE 1NCUA 4P59H 1AGBB 4YFEA 1TZHA 2G60L 3VWKC 1U2CA 1C5BH 1F6LL 1I3VA 2C4FT 4OCWH 3VI3E 3PABA 4I77L 2ADJA 4JFZL 5HPOA 1NL0L 2AV7A 4PJXF 4E41A 3MR9A 4BM7A 1EAPB 2F54D 4G6AC 3AAZB 3V0VB 5I1KL 5GS0H 3D39B 1JHTA 4WI7A 1INQB 1OSPH 2VAAB 4XRCB 4EN3C 1V3KA 4KKAC 1MFBH 1WV7T 4XNQB 1XF2B 5F88B 3KYOB 4OQTL 4MA8L 4LLWB 3MV8D 1KFAL 2X42A 5TDNA 5D1QC 3SPVB 4OFDA 3TT1H 5IQ9A 5LGHL 2CIKA 4HH9A 4PJ5D 1OQXA 1P7KB 3LPWA 3ET9F 3MLXL 3CC5B 3UROR 1BECA 1EX0A 2Y06L 3GDBA 5I15H 4G6AD 2O5YL 3MBXH 5HGAB 3RJQB 5BJTA 4EN3D 3ZO0A 3WFBL 4KKAD 4MWFA 5EIQA 2AJXL 1FNFA 4L3ED 2BVUA 4BUGA 4PJ8B 4FXGA 4EI5B 4CVWA 2D4DA 2J8UB 5F6HJ 1AXSB 2A0LC 5T3XL 1RPQA 1RZ7H 3LV3A 3FRPA 5KS9F 5I1CL 3HE7B 2GTZB 1MFEL 3P30H 4NQVA 3WSQH 3KS0H 3A6CH 4LSTH 4NNXA 5FGSA 3QXDA 1OOAA 5D1XC 3VI4F 3D9AH 4FZ8H 4X83A 2JJWA 2AI0H 5CCKL 1HH9A 1MAML 1DANT 2R2EA 4P2RA 1D3CA 2FEDC 4DWHA 5E6IB 2A0LD 3MV7A 1G6RL 4XB8A 1JP5A 1UA6L 3AMLA 1CLZL 5IROA 2WSKA 2ZNWA 5DLMH 4C4KO 5ID1A 3GKZA 5D1XD 3MRGB 3VD3A 3PDGA 4BH7A 4K94L 2B0SH 3VDBA 1I7ZA 2CLZB 2FEDD 4G8IB 1RK1A 5F9DC 4X4XB 2CO6B 4N0RA 5BRZA 3TWCH 3F7QA 1HXMB 3RDTA 3JWDL 1F13A 1RUAL 4M7KL 1D7FA 3FO2B 3TCLB 2XTJB 2AXJA 2WINB 4QT5B 2NCMA 1TLKA 3OKEA 1NDGA 3ROOB 2IG2H 4FQCL 3M17A 2SEBA 1E4KA 4L8BA 4UTBL 1IILE 2J8UF 3RWGA 4J6RL 3QUMA 1DBJH 4OLWL 1QD0A 1U95A 5JNYB 2YS4A 2MWCA 2W38A 3MLSL 4MDIA 3MTRA 1NH6A 1P4BL 1J0HA 1IC7L 5DJ6B 4OF5A 4BZYA 1WSST 4NCDA 3GMNA 4U1MB 3S6CA 4HG4K 1PGRB 3DTXB 3DGGA 4N0CC 1NCTA 4Z6AT 1EEUA 1WTLA 4WI6A 4F9LC 3CH8A 5JHDE 3DV6A 5IB3B 3CFDA 4KROC 3JZ7A 3W0WD 3IU4H 5C92A 5T1KB 3KJ4C 2GJ6D 1YYMH 3HNSL 2CKBL 4NSKA 1A1MB 3KXFD 4OZFG 4XMKH 4IS6B 2WAHA 4MA1B 1GRWA 3OG4B 4E0RB 4N0CD 4WEUD 4YXLL 1QSFA 3T65B 5JW5A 3SDCA 4POZC 1FBIH 5CWSB 4PP1C 5J13B 1MCKA 5J89A 5ENWA 3FJTA 1MIML 4KROD 4UV4H 4HXBH 1ORQA 5JUEH 4M3JA 2PKDA 1AQKL 2YZ1A 3OB0K 4N0YH 3RRQA 3DX9A 3CCHB 4P5TA 4P9ML 3NGBC 5KAQG 3M1BB 5E1AB 1ZHBB 1YEKH 4PJIE 4POZD 2PW1B 2BXYA 5IWLA 3ARFC 3LS4H 4P99A 4PP1D 1E6OL 5C9JB 1RUQH 1C5CH 1GZPB 3GSQA 3HC3H 2IQAB 4G9DB 5CS7A 4Y5XC 1WAAF 3BKML 4H1LA 12E8H 5AZEL 5TE7L 4K7FA 3SDAA 4JREC 2PR4H 4HFWB 3QUKA 5E08L 3EW3B 4KGLA 1BFOB 3SQOL 1NAMA 2M2DA 1F97A 1G7IB 1HKFA 4F7TA 1U8JB 2DJSA 3ARFD 4V1DB 3G6DL 2BX5A 4ZPVA 3LIZH 4RAUA 1JGLL 3HHRB 3IYLW 2DMKA 3MRLB 1JZ3A 2IALB 4AENB 4GRLB 3O0RH 1XR9B 4WW2C 4HUNB 4U4BA 3ZE1F 4P59L 5JXEC 2UVFA 4NNYB 1G7PA 2NQCA 3PWNB 1VPOH 5I76B 2ZUXA 1C5BL 4YR6A 5K9KA 4OZGB 4MNHA 2MQCA 4OCWL 1UB6B 2AGJH 3V4PH 3U0TA 4MJ6A 1R5WB 1TNNA 3JV6A 1QVOA 2ADIA 4CW1A 2Z35A 3ARXA 5JXED 4NC1C 5E9DE 2VXVH 5GS0L 2DD8H 4K8RC 4OFIA 4R6UA 2R8SH 3PQYE 1HHGB 1OSPL 2BVEA 2DKUA 1MFBL 3BXNB 4UUJB 4KJPC 1MI5A 5JDSA 1U41A 3ZKMD 4W81A 4YXKH 3AY4C 4F58H 4YBLC 3SKOB 4KVCH 3ILPB 3ULVE 1HHKA 3MNVA 4O02H 3TT1L 5IVXA 1FNEB 5IHLB 2R2HA 3MRQB 2P8PB 2YA2A 5I15L 2QADC 3QDGA 1Q9KB 3MBXL 3NACH 4Y19E 4ONHB 4L9LB 4NZTH 3MRJB 4HUKB 4JAMA 4KJPD 1S7XA 4X9IA 1L7IH 4Z77B 3PWJA 4LCWB 2P5EA 1NDMB 2FIRT 2APTA 4RNRB 2C3GA 1RZ7L 4OGYH 3Q0HA 5DSCB 4LQ1A 3P30L 4I48A 1MREH 2E5EA 5B8CB 3P9WB 3WSQL 2QADD 2VZ1A 5T33H 3A6CL 4LSTL 4S1SH 3D9AL 4FZ8L 2AI0L 4AYFA 3PWPD 3IDGB 1BQUA 1JK8A 3FOMA 4OZGF 3VFVB 1IGJA 3O6FB 2NTFB 2AKRA 2IANB 4M00A 1T4KA 3IDNA 3C5JA 1I1AC 1H8NA 1T3FA 5D72H 5BZWB 5DLML 2F5BH 4CUCA 1RJYA 5IB1A 5K9QG 3TPUA 4XNMA 3ZT5A 2IBZY 5C09D 2JK5B 2B0SL 3ZDXE 4NNPH 1XGPA 1KSRA 4LPVA 1RJLB 2VLRE 2X09A 5L7XL 1PAMA 1Q0XL 2J5LC 3LPGA 1BZ7A 1HDMB 4NQSA 1Y6NR 2Y36H 1A7OH 3TWCL 4KC3B 3JTTB 4Y16A 1EUTA 1I1AD 1U91A 4XGZA 2OL3B 4MJ5A 1YN7A 4N0UB 5DD6B 5DJ0A 2GK2A 1ZGLP 3T3ME 4MQXD 3PXJA 1FZMA 4D2NA 2IG2L 3PL6C 1N3NB 4MVBD 2B5IC 4Z76B 4UNTA 1DBJL 1IAOA 2GQHA 5ETUA 3LKQB 2X4OB 3DVNA 5DJCB 4DFIA 5DTFA 1ZS8A 4Q9CA 3VFTB 3HPLB 2ILLA 1TTGA 1SJHB 4EDWH 3GMOB 1Q9OB 1UKTA 1CTNA 4CMMA 1T22A 5C0BB 3PL6D 5EBGA 4L8DB 4WNQA 4PJXA 1FYTD 1E28B 3JV4B 2YEZB 4U1GB 4P4RA 4JRXA 4QRPA 2YHGA 4LF3B 1JGEA 2ZOKB 3MUHL 2I9TA 4M6OH 1DLFH 3IU4L 2BHUA 2GIYA 1YYML 4XBPA 3RNKA 3WUZA 3F5WB 1N4XH 1Z0MA 4XMKL 4JFED 5HPMA 5I71C 1E6JH 3O6LL 3ULUF 1BOGB 3B6SA 3BVNB 2XA8L 1JF1B 2KPNA 3HPJA 2GT9A 4DUWA 4FQPA 4QRRA 1LP9B 1FBIL 1E4XH 2VUOA 2VLJE 4HJGA 2BNUB 2NXYC 4UV4L 1AGCA 4HXBL 5HYSG 3RQ3A 1RZFH 1KNOA 4N0YL 4G7YH 4R0LB 5KS9A 4K9EH 3JTSB 1Y6MR 3QG6A 3LHPH 1SYSA 1JZ5A 5F71A 1YEKL 4KK6C 1IC5H 3LS4L 3MX0A 1RUQL 1C5CL 3HC3L 1TQCB 5KVFH 2NXYD 4O9HH 4YHLH 3RY6C 5F9AC 1JVKA 4CKVX 2BVQB 12E8L 1YMHB 1A47A 2WUBH 1ZLWK 1NMCC 5E8OB 2PR4L 3G08B 1LO4H 3GO1H 3L5WB 1EAPA 1HQRB 1RHHB 3AAZA 5DFVC 4GAYB 3V5KA 3D39A 5F7DB 4KK6D 1RU9H 4JPKH 4LSQH 1S9YA 4HGMA 4HS8H 5EZJB 3LIZL 3T0WA 2JJTC 5LVEA 5DK3A 1Q38A 2IFFH 4PJHE 4CU8A 2NY2B 3FFCA 3MV11 4LLWA 5FCUH 1U8QA 1P7KA 1OWWA 15C8H 3QQNA 3LQMA 3CC5A 3O0RL 1VACA 1BIHA 4U3HA 4H0GA 1IEAA 5DFVD 1T0MB 4PD4J 4KZDH 5HGAA 4LRIC 4MQTB 1PG7X 2X9WA 1LP9F 4ZQKA 1VPOL 4PJ8A 4EI5A 1RURH 3DMMB 1RUPH 1XGRB 2AGJL 1S8DB 2XKSA 3V4PL 3HE7A 2GTZA 2D7OA 4MNQD 5FYKH 1INEH 4MAYB 3WBDA 5B21A 1AJ7L 3BEWB 2VXVL 2A38A 2DD8L 5FGBC 2R8SL 4WGVB 3HG1A