1MCIA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mciA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mciA02
35C8L 5A2IH 4NUGL 4XI5C 5T1LD 3NZHH 3MV8E 2HJKA 3WNNA 2VZTA 4MJ6B 4AH2A 5EDXA 1D3CA 3SDCA 4D0BA 5DF0A 4YXKL 4O4YH 2DN7A 4XPFL 5D70H 4FFVC 3RVUD 1XZ0B 1MY7A 2OMBA 1CLOH 2FDBP 4YFDB 1MCIA 3GMQA 4Z0BL 3U1SH 2FJGA 1XEDA 2J8UA 2HLFD 2J12B 4I2XE 4L5FH 2FWOA 1MH5A 4JDVA 5DGQA 2HP4A 4F8QA 1ORSA 3F8UB 4NQSA 2Y5EA 1JBJA 4JKPL 2D31A 1K8DB 5I74B 5TE4L 4Z5RB 4OV5A 2XKSA 3O4LD 4C57C 4JFDE 3TLRA 5FYJU 1NKRA 4A2LA 3D25A 5FECA 3T77A 3LN4A 1KSRA 1BOGB 3BISA 1UXSB 4XAWL 2VLJB 3FT2B 1IAIM 5T5NF 2OS7A 1N8ZA 5HPMA 2P5EE 5L7XH 1SQ2N 3IF1A 3P11L 4FG6D 4N8VG 4X5WA 3IXTA 4WO4C 5M7QA 2BP3A 2P8MB 1DFBH 1BHGA 4RCAA 4RGND 2Y9RT 1QVOA 3G6JE 1HE7A 2FEDC 2BOCA 4C4KO 1T7ZA 3AC0A 1U3ZA 4TSCL 1RUKL 3KYAA 5JOEA 1ED3A 1M7DB 1A7OH 5IG7B 1JPFA 2W9LA 3DGGA 4F57L 3QXDA 4AEIL 1U8LA 3C2AH 5DFVC 3QPXH 2YOCA 5J06A 3BKMH 1MHEB 5EO1A 1OQXA 5C0BE 2IALB 4RDQF 4KKLC 1BQHB 3IFNL 3Q5YA 4QRRE 1JZ5A 4KZDH 4UTAL 5IB1A 3VGHA 2CPCA 2XICA 1JYNA 3BZ4A 4U1GC 2V17H 4DZ8A 3HZKA 3O6FB 3AU1B 4HIXH 4CBPA 3DVFA 1ZT7B 1EEYA 1GL4B 1GPOL 2I5YL 4N9OB 2D7TL 4NPYB 2PO6C 1A6VH 3UO1L 1QACA 2VO5A 4P4KA 2B20A 1MVFA 1I1YA 1HQ4A 2WBJB 1JF6A 4LNVA 4WUUE 5I9QC 3M45A 3KHOA 3MRFA 1U36A 3FT3A 5DEGB 1XCTA 5C07D 3BD4A 4JN1H 4R4BA 5K9QG 3QQ9D 4UT9H 1G9ML 2Z91A 5ICYB 2LQRA 4GMTL 3WDIA 4RMSA 3SO5A 3KWWB 3IDGB 2ZOKB 3MLTB 3WJJA 1Z5LB 1SJHB 1LP9E 5GRZA 3QWQB 1AGDA 3WFHB 1CIDA 4PJIE 3TIDA 1T1ZA 3KPPA 4HPYH 3NFPB 5EU3B 1ACYH 4K3JL 5J6HB 1RZIB 1NJ9A 4KY1H 5F3BA 2NY4C 3MLWL 3KPOA 4HS3B 5EC2A 2Q8BH 1Q0YL 1H3GA 3HZMA 5F88B 4PREB 4X99B 3HI5L 1I1RA 4ZUUB 4WIQA 3EBAA 3BT2H 1G6RB 3UJJH 4JDZB 3WFBL 5E9DE 3WHE0 3DBXA 5F7NC 5DXWA 3TV3H 3PF2A 4OCYH 3PABB 3JWOL 3D2UB 4M6MH 3W2DL 2J1KA 1U92A 2JCCE 4LSTH 1MI5D 1NAKL 4XP9H 1BIHA 2R2HB 4M3KB 5DD1L 3MYZA 4OCSL 3BGMA 3PQYD 1A21A 3DV6A 3R1GH 1RULH 3BDXA 4QTIH 1HCVA 4RFEB 3RGVC 1EO8H 3EDJA 2VDOH 1FG2B 4R26H 3QDJA 2V2TA 2OXHA 5D7JA 3T3PE 5D7SH 2HWZH 4UNUA 4ZG1A 1UYWL 1CL7L 2IPTH 5SWZD 4TTGA 3V5DB 1MJUL 1INDH 2IAMB 3K4ZA 1A64A 4AENA 1E4XI 1YEKL 3G6JF 2VB5A 4C83A 3P30H 1T5XB 1MLBB 4MVBD 1A3LL 1L7TL 3WFDH 3VDBA 4U6HB 2F5AL 1LK2B 2ITDB 5KW9L 3IDMA 4CDHA 5IR1B 3KJ6L 2Z8RA 2E9IA 4RAVB 5I1IH 3B2VH 4DAGH 1LO3L 4OGAD 1MFCH 3BSZL 4DQOH 3R4DA 5C0ND 4BELD 3CFCH 4XHJD 5B22A 5E2TH 3KNBA 5IROC 3O41B 3JSSA 3KYNB 3U0WL 4GRMB 2V5YA 3C60B 4X4MA 4R0LA 1S9WB 1FFNA 1DL7H 4EI6A 4GKSB 4ODUB 1JV5A 5FGCE 1BX2A 5D5MB 5CEYB 1NC4D 2W9DH 2IC2A 3FMGH 4BQ8A 4LLDB 4IMKA 1UJ3A 4JRXA 3VXUD 3EZJB 2DBJA 3QI9D 1REIA 4U0RB 3V4VL 4DTGL 5IW1B 2IMMA 1S9VA 2OR8A 4LLYB 3QUYA 2XTJE 1MCOH 1FQ9C 5C0GA 2VDQL 5F7EH 1MHPL 3ES6B 2C3WA 3FTGA 3KPNB 3M07A 2ERJB 2VDPL 4V1DD 1NLBL 2R4RL 3E0GA 4JPVH 1EMTH 5BRZE 3H9SA 3MODL 1G7QB 5TDNA 1ZA3B 1LP9F 3KXFE 3IRPX 4PJIF 2Z0BA 5GRJH 1VENA 1CTOA 2NXZB 5EUKB 1I8LA 3H42L 1R5IA 2HT4D 2WWKO 4Z6AT 4ZAKD 1T7XA 3FFCA 3IT8D 1HHKA 3QEQB 2JB5H 5GGRA 3BXNA 4ODHL 5KS9A 5C6PB 3RIFK 2XWTB 4H26B 1ZTXL 1E4JA 1KBGH 3VFVB 1DN0A 3P9LA 5HYJE 4PG9A 2K7PA 3HI1A 4B5EA 5I73B 2AJSL 3IJSB 3HS0B 1OP3K 2V2WA 4PJCE 3NOIA 3SE8L 1KB5H 3MRJA 3KYOB 1G0XA 1E4XH 4GMSL 4YHLL 2A73A 4K8RC 2NTFA 5I19H 1AQKH 4Y2DA 3P77B 2F53B 4RMRA 4DZBB 3T3PF 4I0PB 5FDWB 4F7TA 5SV4A 5B39A 1C5BL 1WEJH 3CLFH 4Z18A 1IGJB 1ZHBB 5GJTH 2I9LA 4HUWB 1BLNB 1JZ8A 2Z31A 5DMGC 2A1WH 2CQVA 4Y5XB 4FZ8H 4NKOA 4YUEH 4E5XA 3UTZB 2EZ0D 2NYYC 1IFHH 1IARB 5C08B 3REWB 2EICA 4CMMA 1K5NB 1RUQH 3CXDL 4ZFOA 3P4OA 1UWGL 1IGIL 2YC1A 3ARBC 3F58L 1DQLL 1GVIA 4OSUL 4G8EB 3NGBB 3QULB 5H2BA 2X4QA 3HA0A 4X6BA 5ESQA 2YWZA 3T0XA 3VXRD 2XPGB 1NGZB 4KVNH 1A4JA 1NKOA 5BS0A 4TRPL 1AR1C 3RA7L 1WWCA 2AK4D 2QSVA 3PL6C 3G5VA 4NGHH 1NCNA 5E2UL 1EFQA 2DI9A 1UZ8B 4LMQE 5IBLD 1MRDH 2F8OA 3T0ED 3TO4C 4XPHL 3C9NA 4XPGL 5DUBA 1T03H 1CFBA 3V6BR 1EEQA 4DEPC 4F7PA 2UZXB 5E8DL 2R1XA 2VLRE 1J12A 3IDUA 4JRYB 2C5DC 4MQXD 4A6YH 1FGVH 3CDCA 4L3ED 4QRTA 2C4FT 3G6DH 5DSCB 2OP4H 5BVPH 2PF6A 1QSFA 3H0TA 15C8L 1OOAA 1RIUH 5DR5L 4NQCA 2VAAA 2JJTC 4NZDA 3D39D 1RJYA 3VFNB 3O6LL 5SX5K 3WD5L 5IBUG 1J1PL 3HMXH 4LEOA 4X7EC 4MHHG 2WP3T 4O9HH 3MV8A 4RA0C 1J87A 3D85B 1RFDL 4XX1G 3QWOB 5K59F 5E99H 1QZ1A 4JFQB 3R8QA 4N90D 4KDTA 4NZTL 1OCWH 5DHVB 3T8XA 5D6CA 3VFTB 4JPWL 5IEHA 3OTTA 4P2QD 4HIJA 3IDIA 3SGJA 2AGJL 2DWEA 2IAND 4HCRH 3L7FA 5IW3A 5HYFA 1T20A 2FHFA 3ILPB 2XI9A 1FNGB 5IFHL 3MNZA 5F72S 4I2XA 4H5SA 3CFEA 3E6HA 4XMLL 1QLFA 5CZXC 1WLHA 5CP3A 1C5CH 2BOBB 5ESAA 4YK4C 5A2KH 4K3DL 2N7AA 2X05A 3GGWB 4R96A 4NJAH 4LLUA 4R3SB 3BKYH 4HDIA 1ZHKA 4JFDA 2D03H 3OR7A 3SKOB 5J6GB 4P48A 2P42B 4BSWA 1SEQL 3QSKB 4HJ0D 3ULSB 2NX5B 3KYMA 5FOBA 3CH1A 3MJ8A 2A77L 1QFWI 1R0AL 1FFQA 1P4BL 5DD3H 2DQUL 1T0MA 4YWGL 3TPUB 4JZJA 2P5EA 3QHZH 5F9OH 1UADC 4HMEA 3MUGB 4E41D 3PV6A 4KFZC 1PQZA 5C71A 2PCPB 4G6AD 3TYFB 3IDYB 3WFZA 4CJ1A 2BVOA 5CILH 3UYPA 3G6JA 3BQUC 1M7IB 2EC9T 4GFTB 4X8JB 2BJML 3MFFA 4W4NA 5CSBA 3TBTA 5IVZA 3BESR 4XC3L 3HCVB 1BBJA 3K81A 3AB0C 3UAJD 4JZNA 3QQ3B 5E2WL 6FABL 5DJXB 5C0BA 2HMID 2MFNA 5E08H 4LHUG 1A14H 4QRRA 1G7LA 4G6MH 1DQQA 4TQEL 1A8JH 1T5WA 3GBNL 4Y4HD 3MA7A 1DVFB 1Q9KB 3IAQA 2R1YA 2MCG1 4KKAD 3QQ4B 2EE2A 4XWOC 5GHWH 4HK0B 1YY8A 3SDYH 5ENWA 3NA9H 1RHHA 2WNGA 1MQKL 4PJ7B 1NDMA 3ME0A 1U3HA 3P0YH 3SQBA 5L2KE 4WUUA 4WGWB 4HUUB 1WF5A 5HYSG 4NNXA 3T4YB 3RWFA 1ZWIA 4PBXA 1EFXD 2X4OA 1CDYA 2EXYD 4K7FB 5FHAH 4HJGB 1IRAY 3EYUH 1F45A 1PJ9A 3NTCH 3RHWF 4I4WA 4LCCC 3QIBD 3SBWC 4KHXL 1B0GB 2D7PA 3BYYA 1E4KA 3SJVE 1E4WL 4KK5D 3B83A 1J1OL 4FQHA 1HKLH 1LP9A 1TNNA 4R90L 5K9KB 3MUJA 3I6LD 4O58H 4PJIA 3BEWB 3HLAA 1YEDA 5M95B 3X3GL 4Y4FD 4IOIB 4JFOB 4BSVA 3C6SA 3QEUB 5JW4R 5DJAA 3N9GH 3HNSH 4JY5H 4HC1L 5T33H 1VADB 3IFOB 4PJ9B 1YYLL 3S7GA 3UROR 4MXVE 5DT1L 2F74A 4MXWH 4AYFA 5IMMB 5E9DA 4U33A 5E6YA 1M05A 2M1KA 1QFWH 3B8YA 4KKCD 2K9UA 3ZE0F 4L8CA 2MPAH 1MRCH 5D5ME 2JCCA 3BDYL 2CLZA 2QSCL 3KPQB 4KZEL 7CGTA 1I4FB 1HXMA 3SDAB 3UCRA 1KIUA 1JZ4A 1R3IL 3AFLA 1VFAB 3ZDYE 2E8ZA 3HE6D 5HVWA 3NPSB 5MEQB 4JRWA 1GGBL 2VQUA 3OAUL 5ISZB 3G9AB 2LU4A 5KN5A 3NAAL 5EIVA 4X83A 3QH3A 2H3NB 2EDFA 4PJHB 4YHML 3ZYIA 4K94H 4JB9L 3B6SA 4MD0B 2HVKB 5MP6H 4KK9C 1CGYA 2GJ6D 5GGSB 1W0WB 5C09E 1F4YH 2B5IC 5E8PB 2JKXA 2F54E 1O0VA 1OAXH 5I66B 4MB4A 1DJSA 3QXAA 5I6XC 2GITA 4GQPH 2IBGA 4U2ZA 4LFHD 4XPAL 5DFTA 4AG4H 1QR1B 5F6HJ 4UQ3A 5LGHH 3CZJA 5CUSH 1DQML 2B0SH 1XF2A 2DKUA 4NQVB 4HD9A 2R8SH 1CLZL 4HCRA 4F15C 1UKSA 2VLKD 3EYSL 2XRAL 5GGQL 4OFYD 2H1PH 2GQHA 1P4LA 4JO2L 1S7WB 3GSQB 3QUXA 3C08L 3MR9B 4P9MH 4ZOCA 4NNYA 5CJXC 1J18A 4MA1C 2IPKB 2YK1H 1MREH 1NBYB 2FECL 3W0WB 5J3HC 3GEWB 3BH8B 3P4LA 4S11A 1LDPL 1FYTB 4NC1E 3L1OH 3BUYB 5TF1H 3OV6A 2O5ZH 4GKOA 3L5XH 5GRXG 3C5JA 4HFWB 1S3KL 3IFLH 1KIPA 3HFMH 1HSAB 2X4PA 4YAQA 3AXLA 1XGTB 1UM5L 5BRZA 3T0BA 3N0PB 4NYLB 5JXED 2JJUA 1F4AA 4YDVA 3KXFA 5SV3A 4M7LH 1RY7B 3LKSA 4KROC 4OLZH 4WO4B 3PWPB 1T22B 1T6VN 4BH7A 1ZANL 1D5ZA 1UCBH 4ZUSB 4YO0A 1GC1H 3QYCA 4J3TA 4XVSL 4F7EA 4JPIA 5KSVA 4MNHB 2B8OT 2HG5B 2KUTA 5AD0B 3CX2A 3C6LD 5ITBH 5HHQB 4Z7WE 4LPWA 5FHBH 4W68A 3NACH 5J1AB 2YPLB 3V0WL 5HYJA 3ZTJG 4AL8H 3PGDB 4BQCA 1CXIA 5ETUB 1S7VA 5C0DA 3WSQL 1OT1A 1XR8B 4I48A 1YEFH 4PJCA 1VFBA 5E1AB 4XAKD 3OJDA 1MQ8A 4U1GB 1VDGA 4XVJL 1RK1B 1ZT4A 3BN9D 3ZDYF 1BM3H 2BK8A 2OXGA 2PO6B 4HUKB 5ITFA 3RX5A 2RGSA 3L7EA 3HR5B 1K4DA 3STZA 5FF6B 5FKPA 1OAZL 1QPPA 4XMPL 5GISH 3MUZ1 5I9QB 3L3KB 4FP8L 4YNYA 1AXTH 1KXVC 4ISVA 1P1ZB 4P57A 2JB6B 4PJ5D 2DQGL 1JNNL 1GAFH 1I9JH 5HDOA 5A3ID 4W70A 5HTSA 1D7FA 4KGJA 4P5KA 5I17A 5JPMB 4Y5VC 4FN0A 1INEL 3G08B 4HX1B 2H26B 1JHLH 4E42B 5I30L 4S1DC 2OQJB 2BNQE 1NEUA 3ROOA 4OLVH 5B3JE 4PGEA 1R24B 2ZCLH 1FNLA 1MFEL 4YEFA 1CLYH 4YDIL 1DLHA 2DTSA 4NO3B 4OZFG 4ZS7H 3GSRA 1A7RH 1QO3A 4Z7UB 4Z5RA 4X6CF 1LD9A 2C7UA 3SDDD 1HILB 1ADQL 2AEIT 3CFDA 3GIVB 5DLMH 2DQIL 4LK4A 1FV1B 2VLRA 1R3HB 3VRJB 4I0CC 1UXSA 2QSTA 4OCXH 4DGYL 3FO9B 4OI8A 1MVUB 2I60H 3KPRB 3VXQA 2XNAB 4GG6B 4WNQB 5FB8B 25C8H 1T1XB 1JWSB 3MBEC 5DJCB 2AAVA 3I75B 4R2GD 4H25B 4FQQB 2OR9L 2ZUTA 5I16B 3MGOB 4WTZG 1NQBA 2VABA 5IF0B 3LKNB 3LB6D 4LARL 2I26N 4NQDB 5IG7A 2DD8L 1ORQA 4G5ZL 4P3DB 4I3RH 4JZOB 3N1FC 1AY1H 4MA7H 5L0QC 3HC4L 2VZ3A 3V5HA 3N06B 4FNLH 2X4UB 4UI2A 4L4VD 3TZVA 3P9MA 4F2MA 3QEHB 1EJOH 2IALA 3RWCB 2A9MH 4AK1A 2FIRT 1BQHA 1KT2A 4M6OH 3IDXH 4XC1L 2CIKB 3OR6B 4KRMB 4JANB 5EC1A 1E27B 3ARDD 1UXWB 3AU1A 4WWID 4OKDA 3TJHC 1JWMA 3CSPA 4PGZA 3L3JB 2XV6B 3RP1A 1J0YA 3ROLB 2HTLD 2WLYA 1A1OB 2FIKA 1F8TL 1G7PA 2WBJA 3O4LE 1QNZL 3AAZB 4PV8A 4Y5YC 1AKJD 1KIRB 3KPMA 3FQWB 1N0XH 1VFMA 1X5IA 3WS3B 3LQAH 1IAII 2DF3A 1XGUB 5C0EA 5ICYA 2H6PA 4I3SH 4MNGE 3KWWA 3V6OC 2UYLB 3DHMA 5EOQL 4ZXBC 2ZOKA 3MLTA 1S9XB 1Z5LA 3ZDZE 1KCRH 3GSNH 5TGBA 4NWTL 5B4MC 3VXNB 4JAMA 4QWWC 4RGNE 1NUNB 1FRGL 3WFHA 3OF6D 3OB0K 4HZLA 4HUVB 2EDNA 4IOSD 5EU3A 2BVQB 5J6HA 3OXSB 3FZUC 1A7NL 4PLJC 1NSNH 2XG5A 4PS4H 1HEZB 2QQKH 4CNIB 1FO0L 1QA9A 4HQQH 1PY9A 4ORZC 5B3JF 4UV4H 4KMLB 5F88A 2HTKD 1YEIH 2BMKB 5A16B 2Z8WC 3LV3A 3L5WB 3G04B 5CHNA 2PR4L 4DVRH 1DE4A 4RMTA 3VH8B 1JTPA 4D0CB 5JXAH 3GRWH 4GW4A 4M4PA 5DJDB 4S1SH 5MERB 1P7QD 5LJYH 3TT1L 4D0DB 4MMXC 5IMLB 3K2UL 1IGMH 4X7CC 5JO5A 5CWSB 4JM2C 4OCNC 4PJFB 5AYUL 5CD3B 4RFEA 5L2KA 1VB9A 5FA4A 1FG2A 5GRUL 1YMHB 5EOCJ 1Y6NR 2P8LA 1K85A 3PP3H 1SVZA 4L4JA 3S3SA 4RWYL 3HC3H 3RDTD 4PJGF 1IBGH 3BGFB 1PY4A 3AREB 4U3CA 5JZ7C 2WWMD 5ALCH 4PJHE 5IHZB 1I1CA 3HPLA 4NT6B 5J1TC 3SJVA 1I7RB 1MLBA 3DTXA 4U6HA 2VXTH 2ITDA 4LASH 5ICZB 5E6ID 2HRLA 1CU4H 1F6FB 1D9KD 1NGXA 4K2UL 2D4FA 3LZFL 2JIXD 4QCIA 4I3GA 4LAQH 5HVHC 4HKBA 2VZVA 3I9GL 1G7IB 1WITA 3S37X 3ARBB 3QIWD 3KLDA 4K7PH 5IQ9B 3O41A 3LMJH 3HB3D 1PG7L 2L7JA 5F71A 1CXKA 1P5UA 1U0QA 4NQEB 4BYHA 5I1GH 4ODTH 2HAZA 4M9PA 4KKBC 4LSQL 1IAIH 4GKSA 4ODUA 4HEPG 4PD4J 1NEZA 1TVHB 5D5MA 4WW2F 4QXTA 3MJ9A 3PL6B 4HLJA 4LLDA 2VRAA 2Q76B 1OD7A 4KI5C 1WVZA 3N1QC 1MI5E 3TO4B 5GS1B 4U1JB 3HG1B 3GSXA 3EOBB 3TVMD 3VWKC 3PQYE 3HE7C 3MOBH 4P9HH 3JZ7A 3MLZL 4DEPB 3I50L 5CJQL 2HFEB 2Z9TA 1J05B 1C1EL 1LDSA 5A40E 4JG1H 5SWZE 4ZNCD 3VXOA 3B5TA 4RMWA 4X7FC 3RNKB 2VXSH 2WUCL 4O5LH 3BAEH 4NM4H 5C09A 3RU8L 2X6MA 5EUKA 3VGEA 4WW1B 4ZNEE 2HT3C 2VDLL 2F54A 1GYAA 1F4HA 1A6ZB 2EH7H 4Q6IC 5FM8A 4ONHB 2VUOA 2YMXH 3CCHA 4LSPL 4U1SB 2XKNB 1EZVY 2HKFL 4H26A 4MS8D 3VFVA 3DI2B 1Z0MA 1XIWD 2Y5TA 4UOJA 3IJSA 1FDLH 3M8OL 2X4TA 4J4PA 3V6ZB 5B39G 1EERB 3ZKND 5JIPA 4YXHL 3VFUA 5T5NG 3N1GC 4R4NC 4YK4B 3QEGL 1CE1H 3O8XC 3SGDI 2F8VA 1YMMB 2CDEA 1S5HA 3VXUE 3S88H 1ZGLP 1IGJA 2ZJSL 2LVEA 3SE9H 1BLNA 5JMOC 5F7FA 2CDGB 3OPZL 4LCWD 1S78C 1N59B 1ZGLM 2VDMH 3UTZA 2AEPH 5DVOA 1QQDA 5EBWB 3REWA 4MZ3A 3S34L 2O5YL 2YZ1A 4V1DE 4UILH 3ULVD 4KRLB 4Z76B 1IAKA 3I3BA 4RDQG 4LQFH 1KC5L 5I15H 1N5YH 4ETQA 5FYKL 2LU3A 4PGJA 1MF2H 5FYLH 4XBPB 3BQUB 4TVPL 3GSNA 1FZKA 4NO0A 1N26A 5JW3L 3MLRH 4BA8A 4YE4H 2NY0C 3LPFA 1JYWA 1NGZA 4ODSL 3FB6B 4O2FB 5CIPH 4P23A 2RCSH 3AB0B 4Z7WA 1BZ7A 1A2YB 3VGAC 2D0GA 2AJZA 4OF6A 4P4RA 2GK0B 4HMCA 1MHHB 1Z9LA 1KEMH 1UZ8A 4PTUA 2VDNH 5T1MB 4OQTA 3VI4E 2XT1B 1Y0LB 2YD1A 5I1EL 1WZKA 1FNEB 1FN4A 4PY8J 3DMMB 2ZUSA 4S1RL 2CXKA 4XCCL 1HHJB 4PRIB 3FQNB 3V8CA 4MNQB 4YHOL 4BJLA 1OAUH 5J7CC 4HJJL 4MAYD 4NJ9L 3MFGB 1CF8H 5B38B 3KPRE 3V6FB 4RISL 1P2CA 3G6AA 4QHUB 4GG6E 1ZHNB 1UZ6E 3NN8B 5T3XD 4OLYL 2E9BA 2VE6A 1OGTB 3EYQC 5KSUB 2ZUQC 1K8IA 3MXWL 2E7LA 4HS8L 4S1QH 3V4PL 2ESVD 3D18A 1JWUB 3OG4B 4LCCB 3QWOA 4JFFB 5E6ZA 4QT5B 4U1MA 1S9KC 3ESVF 5DHVA 1AHWA 2C3HA 3B2UC 1RMFH 3GMNB 3F6IA 5AZEL 8FABB 4PGDB 3ILPA 3H2WA 2RIKA 5F7YC 5DJ6A 1H9VA 3VXRE 2BNQA 3RTQC 3SGDH 4PBWD 3X14B 3CFBB 3HKFA 3LEXA 1S8DA 2WUBL 4WWKD 2APVA 1FO0B 4XPBH 2AK4E 4GAYA 1TLKA 4OT1H 3DGCR 1KN4L 4R3SA 3T0EE 3OKOB 3IDJB 4KJQD 4CW1A 2AXGB 1I8IB 4IMLA 1O7SA 1U8KB 3INUL 5EFIB 5EORL 1AXIB 2DAVA 4HUXB 1IC5L 3C8KA 1HH9B 1KNOB 3QB7C 3KPSB 4DKFL 2FR4B 2PCPA 2ATKB 1M71B 3HAEH 2PXYA 4WI5A 5T1KD 1F90L 4I77L 2G60L 1QP1A 4OM1L 4X8JA 1RURL 3D39E 3W9EB 1F02I 2AEQH 4M1DL 3RVWC 1C8PA 3S36L 3GSOB 2XFXB 3TBSB 1CFSA 1V3LA 4J6RL 4UT7L 3MLXH 3EO0B 1S7TB 3MV9B 2MQ0A 2GTZB 5DJXA 4OD3H 2UWEB 2QADD 4XP5L 4XCYA 4P2QE 3QFDA 5KTEL 4QHKJ 1FZOA 2H32A 4F9LC 3RWJA 3U2SA 4IS6A 3TJEL 2BXZA 5EU5B 4OBSA 5GGTH 1Q9KA 3VI4F 1TZHA 5C92A 3QHFL 4G80B 1AO7D 1DBAL 3TYGH 3VE0A 3O0RL 4WW2A 2AJYH 4F15B 1F13A 1U42A 4ZOEA 3O4LA 3I2CL 3LN5B 2KQNA 1OQOA 1X5KA 4ZD3L 3T4AB 3T4YA 4JHWL 1UZ6F 1TIUA 2B2XL 1TDQA 3EO1B 4FFZH 1CYGA 4K7FA 4MA1B 5H37H 3AS1A 4MNGA 2ADIB 2ZUWA 2QQLL 4HWBH 1YC8A 3G5YB 2GUOB 4ODWB 5DEZA 3Q6FA 3QDGD 3PHQB 3KLSA 3BEWA 2W0FB 4DUXA 4IOIA 4JFOA 4P49A 4O02L 4KTDH 2EYTB 5I8EA 5EA0L 1A9EB 3JVGC 4KROB 1KN2L 4R4FL 4MA8H 4PJ9A 3VWJD 1UACL 5TDPA 4FFYL 2N4IA 1PZUB 3MCLH 3QDMD 1W8NA 3SGEI 1NAMH 1NMAH 2DM7A 4Y4KC 2Y7QA 2RBLA 1I9IH 1V3MA 1ZS8A 1CFQA 2KDGA 3MRNA 4S0TD 1Q72L 3KPQA 2ZNXA 1I4FA 5L6YH 1PFCA 1RUAL 3BO8B 5JHDD 1FSKB 5IMKA 1CFTB 2L0DA 5KZCD 5KG9B 4MD4A 4PYGA 5JNYA 3L5HA 3BI9X 4FQLH 1J1XH 1WZ1L 2GSIA 4HWEH 3EYFB 3PWLB 2O61B 1VKXB 4PJHA 3OQ3B 4U1KB 1B2WH 2NPLX 1S9YA 3BZFB 4MD0A 2HVKA 3ZT5A 4X9IA 1MJJA 4JFEB 1W0WA 5E03A 4ODVL 4V2BA 4U1HB 5DC0A 5BO1L 1IGTB 4M8VA 5GS0C 1U8MA 1ZMYA 2P43B 3B3IA 3E3QE 3EOTH 5JPNA 1MWAH 4JVWA 1YNKH 2UVFA 1MIEH 4R6UA 4BFIA 1K3IA 5EIQA 4Y5VB 1N2RA 3RBSA 5ERWA 3V52L 4KJYA 5KVGH 4N8VB 5CEXB 1UEYA 4AEHH 2NMSA 4FXLA 5C0AD 4JY4A 3MYJA 1AGBB 1CDCA 2NY4D 3PGCA 2RFXB 2Y07H 4S0SD 2FX8L 1MI5A 2W65B 2YKLH 4XTRD 3OGOE 2AJXH 5IB4B 3GZKA 1KFAH 1RUMH 1UWXH 5I18L 3PQYA 3PIQB 5ID1B 4PJXF 2LTQC 3BUYA 4POYA 5D1QC 2EIZB 5MI0C 5A2LH 3H7BA 5E0QA 3G9VA 3LDBC 4G43A 1HSAA 1KV3A 5ECJE 1DUYB 1ND0B 5SWZA 5J8OA 4NYLA 1U3JA 1LNUB 4X4XB 4CADA 5AAWA 1ULVA 3IKCA 3RGVD 3ARFD 4FQXC 5H35B 1T22A 3I6GA 3Q5TA 4J3VA 3MBEB 2GJ6E 4ZNEA 5ADPH 1DBJL 3SGEH 4UIMA 4IDJL 5KVMC 4IRSD 1TNMA 4GG8A 2HG5A 4LLVB 5GIRB 5JOPD 3GHEL 2R0ZH 2X4RB 3MV7D 2YZ8A 3GIZL 5HHQA 2V5MA 1MAJA 5L0QB 3SDCC 4OIIL 3GMPB 4XH2A 5GJSL 2Z4QB 4KXZH 2FBJH 5D7KD 1BEYL 2QV2A 3CJJA 5EULV 2DIJA 4LSVL 1EO5A 1FZMB 2QKIB 3Q1SH 2VLKE 4WUKH 5GS2D 3VFSA 2MCPH 3RWEB 1BFSA 4KQ3H 4HWZA 3LEVH 3C5ZD 3MRLA 3A0OA 4LLMB 1KTDB 3CDYA 4MNQE 3THMH 4AQOA 5BV7B 3VXUA 1IM9B 5H94B 5E8EB 4JO3L 3CGTA 2DQDH 1MCQA 4JREC 4GO6B 4Y5YB 3QUML 3HHRB 1J0ZA 1LO4L 4MQ7B 4U7KA 2OJZH 3VXPB 5DUPH 4V1DA 3FONB 5D1ZD 4H20H 3OJ2C 2JB6A 3MRQA 4J3UA 4NN6C 3VD5A 5C0JB 1RZKC 4HPOL 1D5XB 3HI6L 4LVOC 4ZXBB 4JHAL 3JTTB 3TT3H 4JM4L 5JPMA 5E1HB 3DROB 1I3GH 3LQMA 3NCYP 5C0CD 2AVGA 3JTSB 4HX1A 4U2YA 3O3AA 2C1PA 5IJVA 3QRGH 4F7CB 1NUFA 2AV7B 2A6IA 5D8JL 1B4JH 3CMOH 2IQAB 2VXQH 5KVEL 4ELMF 1YNTB 2IBZX 4X0KB 2O5XH 2XKUA 3RWDA 3KHQA 3H7LA 1HILA 1SMAA 2VDKH 4M5ZH 1I7ZB 3GIVA 5F8QC 2VH5L 4XAKE 2ED7A 4TSBH 1FV1A 3VRJA 3UEZA 2YEZB 1U2CA 1XCQA 4P4KC 2FH6A 2C4FU 2VZUA 3N85L 1CDUA 2DQEL 4HZAA 3KPRA 5IBTL 2V9TA 3OAZK 3KPSE 3QFJB 4GG6A 4KTYA 1F4XL 3K4DA 5FCSH 4ELKB 3UTPD 1NGQH 4MLIA 4HF5H 5IV2B 2C3XA 3I75A 4H25A 4FQQA 3QPQC 4K8RD 5IHUH 2VISB 2VR9A 3I6KA 1LE9B 3MGOA 4I5BA 5DA0B 1Z3GL 2GY7B 1H3PL 5IF0A 3OL2A 1YN7B 3WJJC 4UT6H 3CLEH 4PJ5E 2DICA 2X4UA 3PHOB 4X8XA 3MV9E 1IQWH 2BC4A 1J8HD 2A6JA 2GCYA 2AABH 3A6CL 3RWCA 4YIQA 2NYYD 5E7FA 3E6FB 1VGKA 3OR6A 3VXRA 3IU4L 5FKAB 1QSEB 1F11B 2OL3A 4JANA 4YDKH 1E27A 4GBXD 1XF1A 4F58H 5HVHB 3QCVL 2CK2A 2BZDA 4XNYL 4QRSA 1KYOK 4QLRA 2AK4A 3HTLX 3L3JA 4Z0XB 1A4KA 1IM3A 3WIFA 3ROLA 1MRFL 1YEGH 5EU6B 3T0EA 3GMRB 1MCDA 1NL0L 4XP6H 1A1OA 3D5OF 1QBLL 4BK4A 3AAZA 5I8KL 4HXAL 2BHUA 1AR1D 1KIRA 2FO4B 3DI3B 3FKUS 2DLEA 3DV4B 1UFUA 3BE1L 4J3WA 3WS3A 4QRPB 4HBCH 2P5WB 1UA6L 2WAHA 4PRDB 5FK9B 4OTXH 4ZFGH 4D3CH 2UYLA 3WFCH 3VMOA 5D7JC 3HE7B 5I8CB 5IEKB 4WFED 4M7JH 3O45B 4NRYA 2EC9U 1G7JB 2NY2C 3VXNA 3QCUL 3D39A 4JGJA 5DURB 4BM7A 3DIFB 4ZPVA 4WI2A 1F4WL 2WIIA 1C08B 1RZ7L 5KOMC 1FFOA 1N3NA 4P2CG 3WIHA 1RZJH 3LQZB 4CNIA 4P3CL 1TZIB 2H2SC 4L4VE 1TETH 4P2QA 2FX9H 4WDIB 2E9WA 3EFDL 5F9WC 3FQXA 2JE8A 3L5WA 1IJ9A 5TJWK 2YXFA 3VH8A 5F93C 1L7IL 1ZE3C 2OSLA 2NY3D 2CGRH 4FXGB 4D0DA 1SY6H 3EGSA 5D2LB 5HHOD 4R0LC 3TA3D 5I8OL 2IG2H 2VUYA 3FO2A 1UCTA 2LVCA 4MCZB 5KAQF 5CKGA 1ZLVK 1YMHA 4P5TD 3BPNC 2JJWA 4XVTH 2VWEC 3VXMD 1EXUB 4IMKC 1UJ3C 5TDOB 5HD8D 1BQLH 5DJ8A 4DCQB 4P2YA 3O8XB 1FP5A 3AREA 4LEXL 3UTSD 5IOPB 3QUYC 2XN9D 2Y36H 5TQ2L 1I7RA 1C5DB 2BSED 3TCLA 3ZE2F 5DEFB 3VD7A 1I7TB 2R69L 3SOBL 1U91A 3LKRA 2RR3A 5E2JA 1D6EA 2Q87A 1YEHL 1OGAB 2QHRL 3SPVB 4M8QB 1CD8A 3QJHB 5FYJD 2NY1D 3RAJH 1OPGL 1NEZG 3O2VH 2Q6WB 2EDOA 2J3SA 5FYKE 3ULUD 1NGPH 4EDXB 4P2RD 2IH1A 1I8MA 1BFOB 1LEIB 2NY0B 4U1NB 1A6AA 4O51B 3B9DA 4JHZA 1AD9B 3CFIC 3VGAB 3WXWH 4Y4HA 1UM6H 5EBLA 4E0RB 1YN6B 3O2DL 3GI8L 3MRGB 3P4MA 3SDXB 2Q76A 3ZKMC 4X6DE 5JUEH 3KG5A 5TE7H 3DETC 1JZ3A 3BPLC 5GS1A 4DN3L 5DRXA 3SQOL 2V7HA 5KANI 2IQ9L 2AKRA 2ICWB 3BIAX 4RMVA 5JR1H 3VA2C 3KLAA 4Y2DC 1T7YA 5ANMB 1R5VB 4EOWH 4RAUB 1EFXA 5J89A 2J8HA 2ZCHH 3VW3H 1K9TA 2Z31C 2HT2C 4PB0L 3QIBA 3MACH 3H9HB 1BAFL 3OZ9L 3WXVL 1MCWW 3K8LA 2DQCL 4HH9A 4WW1A 3QUMB 1BVLA 4I9WD 1ETZB 2ZUQB 4PB9L 2E27H 1S5IH 1SYSB 4ONHA 1B0WA 1ZKAA 4Y4FA 4CU7A 2V5RA 5LWYH 4MJID 4LU5H 1WCQA 3D48R 5DDHB 4KDWA 3KYKH 1U8QB 1EVUA 3U4EA 2OBGA 2IADB 3U7WL 3V6ZA 3MX0A 3RTQB 2XA8H 3UZVB 3NH7L 4JG0H 2C3VA 4LPXA 4JR9L 5AEAA 4NKDA 4FHBD 3VJ6B 5INCB 5ESVB 1VERA 4U4BA 3TN0D 3U0TA 1DSFL 2GJJA 3GO1L 4URTB 3WHXA 3S9DB 4XP1L 1ADQA 5DJYA 4R7NB 3HE6A 1QLEH 2VLMD 3BRGC 4AT6A 2HJLA 2VXVL 2X5PA 4NHUB 4LHUB 4OZGB 4BQ9A 1N59A 3IJHB 5BOZG 4QXUL 1Q0XL 2E5EA 3G5XB 5DHYB 3UZEA 5EBWA 5IVXF 1BZ9B 1HXYA 1IZKA 1JPTH 3PXHA 1V8HA 4Z76A 4PGCB 3Q6GH 3V6OE 3VRLE 4FTVB 1HZHH 2YRLA 3LKQB 2GJ6A 1NFIB 3FB8A 3T3MF 2APFA 3TFKC 5DYOA 5EWIL 5EIIB 2YHGA 1DTUA 1F58H 2CLRB 5ID0A 4O2FA 4KDTC 5HYSB 3IVKA 3S4SA 2EYSB 1A2YA 4KK9D 2MKLC 5T1DL 3SGJC 2GK0A 1F6LL 1GIGH 5IM7B 5DTFB 1UWEH 1UENA 3W11C 2B1HH 2R4SH 3QXVA 2VLKA 4X6DF 3EYOA 4OFYA 3B9VA 3DMMA 3BRDA 1XGRA 1ZEAH 4F8TA 4LOUC 5F9AC 4X6FB 5L2JB 3FQNA 1NCAL 4MNQA 2R2EB 1FJ1A 1EO7A 1I7UA 2YA1A 3GB7B 1V05A 1FZJB 4ETYA 1NFDB 3V6FA 1U8IB 3MZGB 4AIZB 3NN8A 3EJZD 5DK0B 4Y16D 1CWVA 2FYYA 2YSSB 3LY6A 1JHTA 1CQKA 3MV01 3AS0A 1FLRL 4JZJC 3DXAD 3L95B 4APQD 1U6AL 4GKZB 5DD5L 4PUBL 4LCCA 5JXEA 3UPCA 2DQTL 2AQ3A 1IQDA 4LGRB 4OCWH 3ULVE 4WI6A 5D7IE 5EOCH 1P9MA 3GMNA 4G6FB 3MXVL 5E4EC 2H8PA 2RB8A 4PGDA 5CJOL 3R0NA 3HN3A 4PBVC 2PW2B 2AV1B 4HKJA 3PDGA 1N7ML 4G9DA 3C8HA 3RVXC 1QBML 2GEEA 5KSAD 5EG6C 2PNDA 3GJEA 3L3HB 4XPTL 2NY5C 3V95A 4YXKH 1OTSD 4DKAA 1MNUL 1KXQE 3OKOA 5EU6E 3IDJA 3O3DB 1W72H 1I8IA 3FB7A 5HVFB 1U8KA 4Y4KB 2G5BB 3NFNB 4G8FB 4X7SL 1LO2L 4GW5B 4QRPE 3K1KC 2FX7L 3IETB 1RJZB 1KGCE 1U3HC 3BP4B 4CN4A 4Y2OA 3KPSA 1NC2B 3AROA 3DX6A 5JQ6H 2FR4A 4FZEL 2NY7L 4UBDC 5T3XE 2B7DT 1U58B 3DVNB 3LS4H 2W60B 2ARJB 3T1WA 3W9EA 2DLGA 1RIHL 3BPOC 4ZMAT 1E4KC 3RBGA 2XFXA 3MBXL 3BW9B 4PJ5A 4F7MB 4X9HA 5IB5A 1XGQB 3EO0A 3EO9H 3MV9A 4KH2A 2GTZA 4LRNL 1EEUA 3LN9A 4WV1A 2A74B 4PJDE 4PY8I 3NZHL 1C16B 4GOSA 3S5LG 2IPUK 2R0KL 4TSCH 1JGEB 2SEBB 4N0RA 3NCCB 5FM4A 4TUJB 4MYWB 5HHMD 3MRKA 2EKSA 4O4YL 1KCVH 5BMFH 5D70L 3QA3B 4XBGB 1A7PH 1BVKA 1CLOL 3ARSA 5AG9A 2OX5A 3U1SL 5L8KB 4OZIB 2AJ3A 4QRQA 2XYCA 4X80L 3U46B 4L5FL 3DURB 3SDDA 5LKNA 2ITCA 4MDJB 2GT9B 43C9A 4CKVX 3W39A 1KCKA 3T4AA 1HI6A 4GKNB 2HFTA 2E6JA 3MUHL 4U6TA 4JFYA 1CK0H 1B6UA 4Z7OF 4X5XB 4QY8B 4J3OC 4ZUWA 3TO2A 3BP7A 2GUOA 2PTVA 2V9QA 5DRZA 3PHQA 4J8RB 3OKNB 4P59L 5GGVY 1G9MH 5D7IF 3RPIB 5L7XL 4FXKB 1NBVL 5GZOC 2DWDB 4Q6YA 1JNHB 1HHIB 4FQXB 4QF1B 2R9HD 5GQBA 1A5FL 2XWJA 4L4VA 3MROB 3VI3E 5B8CA 1W0VB 1FE8H 4PYHA 1MSPA 1A7OL 2HJKB 4N1CA 4D9LH 1YNLH 1H3WM 2Z35B 5IKCA 3C2AL 1D6VH 1PYWA 4AH2B 4CAGA 3HUJE 4C4KT 3QPXL 3SDCB 3SE3A 3QUZA 5ACLA 2HVJA 4R97C 3SDXE 3GMQB 4KZDL 5F7LB 1AO7E 2ZUYA 3JUYA 4KRNA 1KLFA 4XNXH 2C4XA 6CGTA 4LSSL 1I1AD 1MH5B 5E8NB 1EVTC 2V17L 3QUXC 5ALBL 4KWUA 4HIXL 4JKLA 2B1AL 4NQSB 1B88A 3LCYA 4IEFB 2D31B 4PJ7F 1A6VL 4OV5B 3G5ZA 5DD1H 3VDAA 1MAKA 3D25B 5FECB 4X4YA 2FRGP 4PD4K 4JREB 4OZFB 3T77B 4U1HA 1XAUA 4UT9L 1HOCB 4M43L 1QG3A 1UYWH 1N8ZB 2DDQH 3S37L 5HPMB 3OF6A 3ALXA 3IF1B 1CICC 4X5WB 4PJ8B 5I1JL 1PSKL 3GSVA 1EX0A 4NN6B 1YEKH 1XT5A 4LVOB 4WJ5B 4HGWB 5C7XH 2QJDA 5BXFB 1L7TH 2BOCB 5K9JL 1Z0NA 5KW9H 4HPYL 5JMRA 1WK0A 1UH3A 1ED3B 1ACYL 2XA3A 1JPFB 4ZTOH 3DGGB 4PLOB 3FCTB 3QXDB 1LO3H 1U8LB 4KY1L 4PLJD 2NXYB 3OJMB 1P7QA 4X6DA 1CDGA 3BT2L 5IB1B 4NC0B 3BZ4B 4DZ8B 3TV3L 4OUUB 3HZKB 3IFPA 4H0GA 4OCYL 5T3XH 5ID1A 1W72A 2EIZA 2AEWA 4XP9L 3HAEG 3WJLA 2PW1A 3H3PL 3EFFB 4P4KB 3RDTA 4POZC 3R1GL 1I1YB 1EGJA 1RULL 4KV5E 1LNUA 4QTIL 2VDOL 3LH2H 4JM2D 4DTGH 1FL6A 4R26L 3FT3B 3EHBD 5CEZD 1N6QH 4L8BB 2HWZL 4LIQE 5D7SL 4R4BB 5E00A 3ZYOA 1LHZA 5E6IA 2VDQH 1INDL 2Z91B 4M9OA 1QHOA 2VDPH 2X9XA 5GIRA 4Q9RL 2HRPH 3MODH 3P30L 1CE6A 2PETA 3VI3F 1XF5A 3WFDL 3QNZB 4AEEA 3QIWA 4NO5A 2EKJA 1T1ZB 1T4KB 2BVTA 3KPPB 1XF3B 3B2VL 3HUJF 4DAGL 2Z92A 1MFCL 3KPLA 4DQOL 1FZMA 1EHLH 1AXSA 3DYOA 5F3BB 5J11C 3QG7H 3CFCL 5CCKH 3KPOB 4BZ2H 5C0AE 5E2TL 4F80A 1P6AB 5EC2B 2QQQA 4LDOB 3RWEA 4ODHH 5I74C 1LE5B 5LXGH 1KTDA 1VFUA 3MOAH 5KJRH 5H94A 2AJSH 1DL7L 2VL4A 5H37G 3DBXB 2R0WH 3TVMA 5JTWA 2OJEA 2W9DL 3FMGL 4Q7DA 4MQ7A 2V2XA 3BGMB 5F9DC 3DV6B 3FOLA 1KTLB 3S35X 4XT1C 3V6OA 3VWKD 5BZWB 1MCOL 4H88H 4XWGL 3BJLA 5F7EL 3DROA 3IDNA 2NY2B 4JPVL 2AK1H 3RJQB 5GZNC 3JTSA 1C12A 4C83B 2Q86B 5JOPE 1WQVT 5GRJL 3RKPA 4NFCA 1MCHA 3B5GA 3TZVC 1FGNL 1UWGH 3IDMB 1DQLH 4H0IA 5HPOA 1YNTA 2HFFA 2HT3D 1VACA 3WKNA 4X0KA 1SYVA 4KJPC 1XIWA 5D7KE 5F9WB 1YQ2A 5I1LA 1I7ZA 3BX7C 4TRPH 1KBGL 2WWKT 5HJ3B 1SJEB 4HH8A 3QXWA 2YEZA 4NHCH 1WBZA 1UEMA 2AXFB 1FPTL 4R0LB 1FFNB 4EI6B 5EUOB 4XPHH 3O9WC 1KB5L 1JV5B 4M1GL 4XPGH 1BX2B 4PRPD 3JWDC 3BP5A 4UOW1 1D5BA 4KV5F 3VG0H 4R4ND 4CU8A 4EN3B 3C09C 1AQKL 1UJ3B 4JRXB 5I19L 3DSNA 3VFGH 3AVEA 1WEJL 5GJTL 5EU4A 4RX4D 4ZO9A 3QUYB 1TFHA 3OKLB 2A1WL 5C0GB 3GNMH 5D7IA 5DR5H 1AFVL 3NCJH 2OZ4A 4FQJH 2CDFA 2P7TA 2XTLA 3H9SB 4G7YL 1RUQL 3E6FA 1WZMA 4ACPA 2ZPKL 2QQNH 3EKCA 2A0LD 5I1HL 5CP7A 5CZVH 3HNTH 4PJBF 1R5IB 4RWHA 1FC2D 5IT2H 1GC1C 4Z0XA 4OFPA 2CRYA 3FFCB 2BCKA 5EU6A 4KVNL 1HHKB 3HZVB 5GGRB 1UB6A 3BXNB 4H1LA 5KS9B 4ZO7A 4IRJD 2GFBA 4NGHL 1DN0B 3P9LB 4BQ6A 3RNQA 4PG9B 2OK0H 3UJIH 4Y1AB 4Z7UF 3HI1B 1MRDL 4G8GD 4LLQA 4QRPA 1QKZH 2V2WB 4PRDA 3BPLB 5E5RB 1T03L 2J2ZA 1YC7A 2X42A 4MAYA 4ZOAA 1BP3B 4JDTH 3MRJB 4OI7A 4LIQH 1PX3A 3D87B 4TYUA 5IEKA 4TNWF 1QTYT 3U79A 3O45A 4XGZA 3UTPE 1ROWA 1G7JA 1TTFA 4Y2DB 2AQ1A 3CPLA 3KR3H 3DIFA 1OL0A 4F7TB 3G6DL 4QHNB 5B39B 5T3ZE 1R0AH 2DQUH 5DFWH 2X10A 1RIUL 2Z31B 3H6JA 3LHPL 4JPKH 4E5XB 2PYED 2X89D 3A67L 4Z7QE 1J8HE 4KTEH 2WV3A 4AIXA 4PJDA 4WDIA 5HGGS 3P4OB 4GRLB 4HK3N 5E99L 2YC1B 5SWSD 3U48A 1OCWL 2IBBA 5H2BB 2X4QB 4FXGA 5C86A 3B2UD 6FABH 4MB3A 4JKKA 4HCRL 5ESQB 1RUPH 4WWKA 3MTRA 1MAMH 4LPCA 4B50A 1UM4H 2AQ2A 4LRIA 1A4JB 3L6FB 5BS0B 4KRPB 1C5CL 2NR6C 2Y6SC 3K3QA 5DJZA 5LBSL 3G5VB 5F8RC 3DSFL 4QOKE 4NJAL 3WNKA 3C9NB 5DZNA 4YBQC 4JLRA 2FEEL 5A2JH 1MQKH 4W4OA 1CG9B 1A22B 4F7PB 5JORB 5HHNB 2ERJC 5E5UB 1T21A 4U6XB 3BWAA 4XNZC 4HIHA 3QHZL 5F9OL 3KGRA 1QSFB 3H0TB 4M8QA 1FNAA 3W5MA 4WU7A 3U4BH 4QHMA 5CZKA 2NXZC 3SO3C 3BP6B 1RJYB 4HHAA 1BJ8A 1E4WH 3ARTA 1J1OH 3JBG7 4LEOB 5AYQA 1BFOA 4FQPA 1LQSR 3MV8B 1WIOA 4NN5C 3X3GH 3QDAA 3HUJA 4JVUA 5D6CB 5IEHB 5GS2H 4PR5A 4HIJB 2BY0A 3IDIB 1A1MA 4CMHC 4HC1H 2DWEB 2V5TA 2BSRA 5E08L 3SDXA 1T20B 4ZODA 1A14L 1LEGA 4J4PC 1AO7A 3MNZB 3H3KA 5HBBA 7FABH 1ONQA 3RZCC 4H5SB 3CFEB 5HHOE 3E6HB 1QLFB 4N5UA 4JJ5B 5IGXL 1F5WA 4G8IA 5ESAB 2A6KA 2W07A 5GHWL 2CJUH 3O3EA 1R5VA 3SDYL 3VXME 4RAUA 3NA9L 4LLUB 4PJFF 3LRGA 4HDIB 4G42B 1ZHKB 4JFDB 4KZEH 3P0YL 3OR7B 4NC1C 2NW2A 3UTSE 4XVUC 1R3IH 4RFNC 3CH1B 3MJ8B 2W1NA 3OAUH 5FO9A 1ETZA 3NA4A 1T0MB 3FT4A 3NTCL 5CS7A 4JZJB 1MFBH 1ZAGA 1I75A 3PV6B 4Z7QF 1KG0B 4UDUA 4QNPF 4JB9H 4KUCD 2BVOB 1HKLL 4MQSB 5FYJE 4MGXA 5FCUL 1CR9L 3G6JB 4LP5A 2G5RA 3MFFB 4HXBL 3GSUB 3TBTB 4O58L 5E4EB 4UV7L 2WZPD 1SJVA 3VWJA 1U8QA 4QTHA 1BJ1J 3ULUE 4P23C 4Y19B 2R39A 2IADA 4CVXA 2YWYA 3B9KD 3N9GL 3MMEB 3HNSL 5T33L 2I07A 1RSFA 1N6UA 2IGFH 4QRRB 5INCA 1YPZE 4JQXA 1T5WB 1X5FA 4S2SA 5MEND 2X9WA 2CKBH 1QFWL 12E8H 1DUZA 3EYSH 2XRAH 5GGQH 2UVEA 3IAGC 3MA7B 5IIEA 2MPAL 4ENED 2R1YB 3WFEL 4ORGA 4LHUA 5DO2D 3IJHA 3C08H 1YY8B 1EIBA 5ENWB 4K8RH 1RHHB 2DB8A 2IH3A 2OM5A 1NDMB 3R0MA 1U3HB 4WFGD 1KENH 1KB5B 3IRZA 1S7XA 3S4SG 1ZWIB 1NFIA 4LFHG 4UB0H 3WIIH 1H3TA 4JQVA 4M1CC 5CD5C 4I9WE 4G6KL 1JYVA 4K94L 3BPOB 5FM5M 4RBPH 1JYXA 3PNWA 1AHWC 1AD0A 1B6DA 4FQHB 1F4YL 1LP9B 3FHAA 3T09A 4MJIE 4NN7B 4PJIB 1OAXL 1QFPA 5IM7A 1PGRB 3HLAB 2C9AA 4BSVB 3C6SB 5DJAB 1WBXA 5GS0D 4AG4L 3VGDA 5C0AA 2DQJH 5KBNC 3MPCA 5LGHL 5CUSL 2B0SL 1H8NA 1PLGH 5DQDL 3V0WH 4X6FA 2Q1EA 2F74B 1KIQA 2L7UA 1PG7X 4FFWC 4WU5A 1TCMA 4LSUL 1T2XA 3GB7A 1UH4A 5E9DB 1M05B 2F9BT 1U8IA 5EUOE 2H1PL 3ZZ1A 2MOVA 3ZKQD 3JWDL 2ATPB 1JPSH 5HGBA 3JWOC 3GMMA 5CBEA 1ZA6A 2YSSA 2JCCB 5IFJA 4IBLT 4P9ML 2JK5B 4OF5A 4XVJH 1MREL 3GKZA 4ZO8A 2JJSA 1KEGH 3EJYD 1WCBA 1LVEA 3L1OL 5C2BH 4P9HC 2O5ZL 2PXYC 3L5XL 4AMKL 1M4KA 5CINL 3TF7C 1OAZH 3QNYB 5D1QD 3ARFA 3IFLL 3V4UH 5JW5A 1HQRA 1ZHLB 5KN5B 1BD2D 3VFWA 2UZYB 3QH3B 2XG4A 3GM0A 4IRSA 1H8SA 1BJMA 5INDA 4M7LL 1G7MB 4OLZL 3V0VB 3RIAF 3ULUF 1JNNH 5BJTB 1UCBL 1GC1L 3FQTB 3QXAB 2YBRB 2X7LA 1CIUA 4XB8A 1INEH 2HLFC 2GITB 2EDBA 5ITBL 1JGDA 5FHBL 4Y8AA 2D3VA 5F7UA 1YPZF 1FORH 2OLDA 2VL5A 4KK8D 4G8FA 4AL8L 4Y1AE 1MIMH 3NIFE 4PP2A 4WW2C 1OW0A 4GW5A 4R97B 3C5ZA 1A9BA 1YEFL 3C87A 1NC2A 1P4LB 4W81A 1PG7W 2GTWA 3MREB 5FGCB 5IP4A 2DI7A 1BREA 1Z6JT 4NQTA 4NNYB 4UINH 2I25N 4UQ2A 5FO8A 5DC9B 3IJYB 3DVNA 2HFGH 2W60A 1OSPH 3DXAE 5D1ZA 4FG6C 1ZVHA 2G75A 5GISL 5FYJH 4GRWE 3C5JB 5F44A 4JE4B 4FQ2L 1NBZB 2CRZA 4RGNC 1KIPB 1IMHC 4JN2A 2X4PB 4YAQB 3AXLB 4I18A 3ULUH 1GJIA 2F5BH 5AWNH 2DOCA 5HDQH 4JQIH 2UUDK 1EHXA 4YDVB 3KXFB 1HWGB 1CICB 1JGEA 1DDHA 1GAFL 3LKSB 4OJFL 2DD8H 4G5ZH 5F21B 3TIEB 4BH7B 2FSEB 4PJ9C 1D5ZB 1CN4A 1H5BA 4XBGA 4F7EB 4JPIB 5KSVB 1JHLL 2E8YA 2X1QA 4XC1H 4OLVL 3TNNA 4CVWA 1OP5K 3DURA 2ZCLL 5F1NA 2DYPD 3MJ9L 3GBML 4ZPTA 3RVVC 1CLYL 3ARVA 5HYJB 1Z2KA 1EAPA 1IEBB 4ZS7L 1S7VB 1A7RL 2VAJA 4OGYL 1QUNA 2OI9B 3KLHC 4I48B 4M48H 2OYPA 4YH6A 1KJVB 1VFBB 3QR2A 3OJDB 3MRHA 3MJ7B 4X5XA 2ZG3A 1CBVH 3LSOA 5I2IA 1ZT4B 3RX7A 4KUZL 3QQ9C 4J8RA 4YHZL 4OCXL 1L9MA 2PN5A 5EZOH 5ITFB 2I60L 5T5FH 3TWCL 3L7EB 1K4DB 3STZB 4M7KH 5FKPB 3DPBA 4X9GA 1HHIA 25C8L 4FQXA 3CVIH 4YNYB 4WHTA 1CDIA 4ISVB 3WO3B 1F3DH 3MROA 2DTMH 2EEDA 1J8HA 4P57B 2KKQA 4NWTH 1W0VA 3F7QA 1IAOA 1JL8A 5KANG 5HSFA 4I3RL 3X11A 1AY1L 2Z35A 4MA7L 4FNLL 2VQTA 4P5KB 5I17B 4B7LA 4GBXA 2UWEF 2HH0H 1N64H 5HDLA 4ERSH 3D6GA 5F7HA 3BVNA 1EJOL 1EHAA 2A9ML 5HHME 3ARRA 4M61B 4M6OL 3IDXL 5EBMA 3ROOB 5E8NA 4PGEB 3NIFF 4RFOH 3MNWB 5J11B 1DLHB 5F97E 1OY3B 3SCMD 2D4DA 3WL9A 3GSRB 1M1SA 4QOKA 1Q9OA 1QO3B 3QIUD 2WIMA 2EE3A 1LD9B 5BVJB 2C7UB 1OTTD 4KC3B 3K2UH 5FDYA 2XZQH 3CFDB 4PRHD 1IGYA 4HWUA 4N9GA 5HI3D 4P46D 4OZFA 1N0XL 5SWQB 4PRBA 2VLRB 1ITBB 2D0HA 4GRWF 1HOCA 4I3SL 2P48B 3VXQB 3HNVL 3CDFA 3OKYA 4PJ8A 4LBEA 3ZSTA 3LS5L 3D3VB 1KF9B 3QDJD 4WJ5A 5D7JD 4HGWA 3GSNL 5BXFA 5F7WC 3GUTA 5F7MC 2VABB 3U9PL 2CK0L 2OCFD 1ORQB 4OGAC 4Y19E 1K4CB 2VSDA 3FCTA 4KJWD 1NSNL 3V5HB 3S36X 4PS4L 2QQKL 1GGCH 4XHJC 3TZVB 5FYLD 3P9MB 4F2MB 4HQQL 3MQIA 1KT2B 4UV4L 1KOAA 4OQTL 4WTZA 1YEIL 4BZ1H 2F58L 5BW7C 2A38A 4TTDD 2I9TA 3VXSD 4HIIA 1CT8B 4L9LB 5EC1B 5HHOA 3TA3A 4OUUA 3GRWL 1ZSDA 2CSPA 4S1SL 3DRTA 3TBWA 1JWMB 4P5TA 3VXMA 4RRPA 4ZFZA 3EFFA 3ISWA 1DQTA 2FIKB 1G7PB 2JELH 4GRWH 4P5MA 1EV2E 3BPCA 3O9WB 3QISA 4PV8B 3UTSA 4EQ2A 3KPMB 3NFSL 4L8BA 2P1YA 4Z8FH 1PKQE 5CJQH 3HC3L 3VXTA 1ZOXA 1IBGL 3C09B 2BNUA 5C0EB 1GCFA 2H6PB 1HYRC 3GHBH 5ALCL 3CX5J 1X7QA 2FNBA 2YUWA 3U6RA 2CO6B 2CH8A 2YPKA 3QNZA 4LASL 2WUCH 1N0LA 5TGBB 1CU4L 4JAMB 3L3OB 4G9FB 2HT4C 4HZLB 1T4KA 1XF3A 4ZAKC 1AGCB 4LGSB 4HG4J 2F19L 3X3FH 3F12B 1FH5L 1W8OA 2PTTA 1CS6A 1ZK9A 4OAWA 2MHAA 4K7PL 2HLAA 1QA9B 1ZLWH 1LE5A 2HKFH 4WTXA 1YPZA 4BFGA 5I1GL 3DX9A 1HIMH 2N7BA 4ODTL 1X5AA 3LV3B 3FN0H 5HYQA 5CHNB 1IAIL 1DE4B 3E2HC 5I1KH 4RNRA 1EH9A 2BRRL 4GW4B 1MFDH 4X98B 4YDLC 3IAPA 3UMTA 5B21A 1JFQH 4MLSA 2X2YA 5TQ0L 5IFAH 3QEGH 1FNSL 3FO0H 5JO5B 3J8F7 5L2KB 1R3JA 1KTLA 3WEXB 4QRUB 3F7YB 5FA4B 4P9HL 3MOBL 1K2DA 5BZWA 4FQCH 2P8LB 3TESA 3QXUA 2ZJSH 5CEZE 2EZ0C 4JG1L 4OFIA 3VMNA 3HPLB 3SJVB 3D0VA 2Q86A 4O5LL 3BAEL 4DN4H 4NM4L 1IC7H 3K4AA 5DK3A 2DM3A 3DTXB 3K74B 3QT2A 1KC5H 4MJIA 3VFPB 5TPWL 1NGXB 4OB5L 2F8XC 3PWJA 2EH7L 4QCIB 1U8JB 4TVPH 5GGVH 3PWVA 2YMXL 4HKBB 4Z77B 2HJFA 3BMVA 3UPRA 5HJ3A 1SJEA 4U6VL 1UG9A 5DZLA 5IBLC 4PRNB 3T0EC 3HMWH 1FDLL 2AXFA 3CIQA 3RY5A 1WFTA 3TN0A 2G2RA 2X1WL 4CU6A 5EUOA 4Z7VE 1NEZB 4QXTB 4XBEL 2DMCA 4EN3A 5I0ZA 4MQXC 4YX2H 3ZE1F 3S88L 4YHOH 3HZYA 4OLEA 3GSXB 2ZZUT 4HJJH 1X4XA 4NJ9H 1BFVH 3SE9L 4RISH 2Y72A 3OKLA 2Y06H 4NZRL 2VDML 2BHYA 5DJ0A 3VXOB 1LO5A 4XNZB 5DVNA 4UILL 5D1XB 4QXGH 2VN7A 5J12B 4LQFL 4NQCD 5I15L 1N5YL 5C09B 1XGYH 4H1LG 3SO3B 2F54B 3EYVA 1OAYH 5K59E 4YHKH 3MLRL 2GAZA 2OTWB 5AZEH 1WUNT 2RCSL 3CCHB 3HZVA 4NN5B 4NZUH 4LPTA 4LCUB 2MMXA 1VGEL 5F96L 1I3VA 3IKKA 4Y1AA 4CMHB 2WUBH 1RHFA 2Y5TB 2VDNL 2X70A 1JUFA 1BQUA 3VFRB 32C2A 2X4TB 3F6LA 1UVQA 3RZCB 4IIQA 5E5MB 3OMZA 3VFUB 4HJ0C 4X6CB 1WTLA 4PRPE 5I0DA 4Y16A 5IJKA 1GZQA 3BGFC 3AREC 5EORH 2CDEB 1OAUL 1S5HB 3DRQB 3SE4A 4JM2F 1JN6A 4QHNA 1CF8L 4C56D 2K3TA 5EN2A 3DXAA 2EECA 4WEBH 4APQA 1FFRA 1K6QH 4G6AC 4N5ED 4U05A 4RFNB 3ZL4H 2NNAA 1NCCH 1QQDB 4TPRL 4UU9B 4S1QL 2G60H 1RURH 2P5ED 4JFXA 3Q3GB 2NW3B 1IAKB 4GRLA 3UAJC 4KQ4H 3S36H 2BFVH 4WRLA 3KJ4C 4ETQB 1WTGT 4DW2H 5I76B 1PEZA 1RMFL 1UJTA 4O2CA 5KSAA 3Q2CA 2HMIC 3GSNB 1FZKB 3B8SA 4NO0B 3ELAT 4XP5H 3UXFA 1A3QA 4P23B 4GS7C 3L6FA 4JHBA 4Z7WB 4OD2B 1BZ7B 1KELH 1LMKA 4Y4HC 4EZMA 3BZEB 3PDOA 2AJZB 3TJEH 4L9DA 2NCMA 3UJTH 4P4RB 3RVXD 3F5WA 4OZHF 5C0BD 4KKAC 4U7MA 4XPBL 4PTUB 4Z7VF 3CAFA 4OT1L 2D7NA 2ORBL 1EPFA 5GS1C 1DBAH 4G8GE 4RGOH 1GHFH 2VITA 1AP2A 1FN4B 1CG9A 4F37F 2BNRD 5CEZH 5JORA 2YD7A 5HHNA 4XMKH 2C3GA 2EXYC 4U6XA 1P2CB 4K9EH 3G6AB 1MFAL 3QIBC 4WUUD 2EDLA 1DLFH 3D3VE 3JWNC 4TSAH 3JV6A 2DI8A 4KK5C 3BP6A 1G9NH 2VE6B 4AJ0A 1T0NA 4JFHE 1CGTA 1K8IB 3OSKA 4B41A 1ES0B 1RIVL 3VFOB 3D18B 3F62A 2PYEE 4J1UA 4Y4FC 3MGAA 1KCSH 3P0GB 3E3QC 5L9DH 3MLXL 1JNJA 4U1MB 1AHWB 2W92A 5SWSE 1WWBX 5MHSD 4N1HB 1QRND 4R4FH 4POUB 1AGFB 5C9KA 5FUCE 3M1BB 1UACH 5JDSA 3W9DB 5DJ6B 2BNQB 5CBAA 1MJ7H 4KKCC 1Q94A 4JJ5A 2AJVL 3LEXB 1S8DB 4NP4L 1DBKH 4GAYB 3TYGL 4V2CB 1HINL 3ZE0E 5I1CH 2AJYL 4G42A 5GRYA 4CW1B 3K7UA 1RUAH 4IMLB 3OAYH 3HE6C 1JJUA 5FO7B 5C6TH 4YQXH 1KUMA 4Z95L 4FFZL 1T2QH 3I3DA 4OLWH 4YZFE 1F6AA 3C8KB 4K3GA 4PJGB 4G6JH 1KG0A 5HI5D 4HWBL 4BUHA 2PXYB 5F89A 5EZIL 2CMRL 2XXMB 1X5LA 3GSUA 3LEYH 4G9FE 4ODVH 4MQTB 1T1YA 3MNVA 1WAAF 4L1DA 4IHOA 4Y19A 1CFSB 4EXPX 3MMEA 4HMDA 3ZT7A 5C1MB 3C2SA 1RZJC 4GXUM 2HKHL 1VEMA 1ZLUH 2ZNWA 3TP4A 4MA8L 1A7QH 2EIDA 3TEUA 4XCYB 3QFDB 2EDWA 3ARGD 4NBXB 4XNUH 5F7DB 1FZOB 2H32B 2ZSWA 3V7MA 3V52H 1X4YA 3MCLL 3RWJB 2MQ3A 4IS6B 3U2SB 3RUGE 3DMMC 1NMAL 4MXQD 1TZHB 1EA9C 4KHTL 5IMOA 4EIZC 3D1MC 2Q7YA 3VE0B 4HUNB 3S5LB 4WW2B 5L6YL 4R7DA 4JO1H 3O4LB 4P2OD 3EW3B 3S3JA 4KMTL 1KB5A 3QUXD 4DUVA 1AI1H 4FQLL 1J1XL 1PKQA 4HWEL 4Q2ZA 2VIRA 3NIGF 4LCIH 5FUZH 3A6BH 4MNGB 2UZIH 4ZSOE 3VCLA 5JXEC 1B2WL 1KLGA 1OHQA 5AUMB 3CK0H 1J5OL 2XTJD 4L4TD 4OZ4A 1P9MC 5E2VL 4YXLL 3Q6FB 1RZFH 2VDRL 4RGNB 3UBXI 2FZ3A 4XNQB 5L88L 1Z9SA 5BRZD 1T89A 2J4WH 1G6VK 4IDJH 2OL3L 4HKZB 5I8EB 2BVYA 2I27N 2VOTA 3MSPA 3EOTL 1MJ8L 1MWAL 1YNKL 1FAKT 4OFKA 4OIIH 3U7YH 3UTTD 5KVGL 5TDPB 5C3TA 4AEHL 3OHXA 1BEYH 2NY6D 5CIPB 3OX8B 5MENE 2ATPA 2Y7QB 2YUVA 5BQ7B 2X4SB 3QNXA 3J7HA 2P47B 3BN9C 1ZS8B 2Y07L 1CFQB 3MRNB 3EUUA 2JK5A 1N5AB 1I3RA 1QSVA 3S35L 5HHPB 2AJXL 1KFAL 1RUML 4FQ1H 5IMKB 3LIZH 1UB5B 4YZFF 4MD4B 4OZGF 5JNYB 5EPMB 1Q1JH 2A2QT 3SGKA 3QNYA 1MEXH 2PUQT 3VD9A 2GSIB 5C07B 1A7BA 1ZHLA 5DRNB 4EI5D 5D9SA 1LO4H 4A6YA 3EZ8A 4NSKA 4POZD 1J0KA 1S9YB 1G7MA 4NNPH 5D7LD 3WIHL 3V0VA 1QR4A 1U8OA 1MJJB 5A3IC 1TCRB 3KS0J 5HY9A 3HI6H 5BJTA 4JHAH 3MGTA 5ADPL 1RZGA 4JM4H 4WV1C 4D9RD 3FQTA 3HMXA 2QHLA 2YBRA 2R0ZL 4HIEB 1C7TA 1U8MB 4WEMB 1X5YA 3S96A 3B3IB 5J13C 5JPNB 1ZLUK 3OKDB 1DBMH 4BFIB 3NCEB 3RUGF 1N2RB 4EDWH 2FBJL 5ERWB 4PJAF 1KJ2H 4KJYB 1PD6A 2R23A 3C5SA 4M03A 5DHXB 4EKXA 2M2DA 5AAMA 3SDDC 4JY4B 4UNVA 4Z7VA 1YJDC 3MYJB 3Q1SL 5F6IC 3MREA 2FB4H 4WUKL 2Z8VC 1I9RL 4U3XA 3PGCB 4X6CE 4KQ3L 3JV5A 1D5MA 3IJYA 1MI5B 1FBIH 4NDMB 1NFDF 5IQ7H 3WN5A 2FHCA 3PQYB 4OFVA 1G1CA 3MA9L 2XZAH 2DQDL 5IBTH 4GAGH 3DO7B 2C26A 1FL5A 1NBZA 3H7BB 4JCMA 4R2GC 4G43B 5EZLA 2VLJD 3TH3T 5SWZB 2OJZL 5DUPL 4CADB 2YD6A 4CRPA 3LB6C 4KUCF 3IKCB 5DWUH 5K93A 1CICA 1Z3GH 3BKJH 1H3PH 3O6MH 4ZYKB 3I6GB 1J11A 3HAEB 3TIEA 2FSEA 2KL6A 2R2BA 5JLZA 1I3GL 4EIGB 5B8CC 1CGSL 4PPTA 4UIMB 1R3KA 2IFFL 3MLYH 3A6CH 4GG8B 4L3CA 3P40A 1J0IA 5GZND 1NGYB 3QRGL 3IU4H 3SE3C 3ARDC 4FABH 1WFUA 1B4JL 3CMOL 3QUZC 2VXQL 4XH2B 1R3LB 1C7SA 4TN9A 1IEBA 3LKOA 4Q97A 3AY4A 2O5XL 1E28B 1FSKC 4KJPD 1BJ1H 2HTLC 4M6AA 4PY7A 5FXCH 1YQVL 2VDKL 1KJVA 4M5ZL 4X6EA 1WBYB 4YR6B 3MJ7A 3RWIB 3VFSB 3O6FD 4PRPA 5I8KH 4TSBL 4HWZB 3T0WA 1NC4B 3MRLB 1CDHA 1NCBL 2FD6H 1MCPH 3I84A 3UTOA 3VXUB 2FJHB 5JOFA 3QI9B 1UA6H 1OLLA 2WBJD 3LRSA 3DUSA 3RHWK 1CQYA 1NGQL 4HF5L 3FN9A 1CLCA 3V7AG 2ADFH 3IXAB 5IHUL 1IL1B 1IKNA 4V1DB 3QCUH 3MRQB 1FL3A 3UYRH 4LNRA 4M7LT 4UT6L 1F4WH 4NKQB 5J57B 3ZHKA 5KVFH 2EH8H 1IQWL 4K71C 4OIBA 5C0RH 1B0RA 5GS3A 3L9RA 4M61A 2DLTA 1TVDA 4ZFFA 2V5SA 4ONGH 3O3AB 1ZT1B 2WMPA 4ZAKB 4HLZH 1D5IL 3UC0H 4YDKL 2C1PB 1NMBH 5DMKA 5IJVB 5CGMA 2J88H 2A6IB 4J3XA 3MNWA 1J0HA 1LWRA 1PZ5B 3V9FA 3VGBA 1L7IH 4IRJA 3GK8H 4GQ9L 3RWDB 1YEGL 4G8GA 5BVJA 3RFZC 4GW1A 4WI3A 4XP6L 4OLUL 3E2HB 4BFEA 2LU7A 3MJGX 2EXWD 3D2UD 5SWQA 3WJLC 4IOFD 3DJ9A 4YDLB 4C59B 1XCQB 3B9AA 3DVGA 4HBCL 5IESH 3RDTC 4YPJA 4LVNC 1NCDH 4OTXL 1A6PA 2WWMC 2XY1A 4D8PA 1F00I 3LVEA 4ZFGL 4D3CL 2X4NA 4OCLC 3WFCL 4PJGE 3D3VA 2CLVB 3HRZB 1YECH 3MRIA 4M7JL 2IBZY 5E6IC 4UIKH 2R69H 3UP1A 3I6KB 4I5BB 2PYEA 2X89A 2IAMD 1S7RB 5FUOH 1K4CA 3L3DA 3SKMA 3AMLA 3D69A 5GS0H 1RZJL 3QIWC 3K8MA 2BC4B 5SWSA 2A6JB 1OPGH 2GCYB 4KK6D 4X7TA 2HN7A 4YIQB 4ZUTA 4JJHA 2FX9L 3WNLA 3RWHB 1VGKB 4RRPG 2R0LH 3VXRB 3WLWD 2OL3B 1CT8A 4L9LA 4ZUVA 3GSWA 2EDJA 4QRSB 2MQCA 2GSGB 1MWAB 2AK4B 3QBTB 1FVDA 3KDMB 2J8UF 5BV7C 1A4KB 1IM3B 3WIFB 3O2DH 3GI8H 3T0EB 1KJ2A 2FO1A 3C60D 2IG2L 2X40A 4GLRI 2BSTA 1PDKA 3TVMC 3O9WA 3MV11 4PRHE 4XVTL 1HK6A 2NR6D 2XQYG 4YGVA 2OMNA 1BQLL 5CSZA 4U1LA 4K55A 3PG2A 4L3EB 4N0CD 3UBXA 1R5WA 5DJ2A 1NCUA 4JFZH 4PP1D 4JO4H 4NRYB 4GAJL 1BAFH 3OZ9H 3L3OA 4WFFD 3D39B 4G9FA 1IT9L 3JXAA 1FHGA 4ZPVB 2DL9A 5EOTB 1AGCA 5GSRA 4RIRB 2WIIB 3WNOA 1TJHH 3F12A 2XXCB 1GH7A 1FFOB 1N3NB 3QUKA 3RAJL 4KVCH 4HAGA 3O2VL 2W9EH 3VMPA 2NXZD 2BRQA 4XNMA 1TZGH 1NGPL 4P2QB 5FYLE 1DCLA 1OD9A 4WTWA 1XIWC 2IANB 1T80A 2BDNL 3FQXB 4QO1A 4U49A 1OSZA 5J1SC 4NM8H 4LPVA 3QEQD 3RUGA 3VXSE 3ZKNC 1E0OB 2OSLB 2YD9A 4MAUL 3WXWL 3LPWA 1UM6L 3DX8A 4X98A 1T66D 5JUEL 1SM3H 3EGSB 4JR9H 1FLTX 3RKDC 3WUWA 2YR3A 3FO2B 2E9JA 4J4PD 5F3HA 3EOAA 3WEXA 1A3RH 3MLUH 4QRUA 3F7YA 1UC6A 4XP1H 2DBLL 1RVFH 4NWUL 3O6KH 5C07E 3CU7A 3UYOD 5DJ8B 3B43A 2UY6A 2VXVH 4EOWL 4L8SA 3FO1A 2F53D 2ZCHL 1OTUD 4ZSOA 4I0PD 5SX4I 3GMLA 3ULVC 1CXHA 1H3UA 3MACL 1RZKH 3TCLB 1TQBC 3MLVL 2D7QA 4E41B 2DRUA 1DANT 3VFPA 1B3JA 1RI8A 1U91B 3V5KB 2X44D 3LKRB 1QEWA 3EDKA 4LP4A 3BKCH 4YPGB 5C08D 1D6EB 1U8JA 2E27L 1S5IL 4H8WH 3ZTNH 4F33A 5HHVH 3B9KA 4Z77A 5LWYL 3KJ4B 1LK3H 1HHHA 4GLRH 5FEBA 2IH1B 3KYKL 1I8MB 4PRNA 1V7MH 1BVZA 1A6AB 2ENSA 2K7QA 5FA3B 2R29H 4MCYA 1YJDL 4GS7B 2XA8L 3EIFA 4YDJB 1XF4B 4JG0L 4KAQL 5MENA 3Q5OA 4OUOA 3BEVA 4Y4HB 1OM3H 5DQJB 5EBLB 4K3HA 3T2PA 4RQQB 3P4MB 1NDGA 2DM2A 5DRXB 4MAYC 1CDBA 3CU1A 1BGXL 2V7HB 2AKRB 5C8JB 5CAYB 3KLAB 4LSDA 4N0YH 4NKIL 2ZKHH 1QYGL 4JRYD 1EFXB 4M6NH 2VZSA 4N0UE 5HGDB 1JPTL 3GJFH 3VG9B 5CGYD 4N8CH 5D1XA 1JGUL 2CUHA 3Q6GL 3QIBB 5HI4D 1HZHL 4FRWA 3MC0A 2CXGA 4OF8A 3PGFL 1I1FA 2RHEA 3QO0B 4HH9B 1JF5A 1BVLB 1MCWM 4FOMA 3QCTL 8CGTA 1HYSC 3MXVH 2OTWA 1F58L 4XHQA 5D2NE 5I1AA 1M6OA 2FL5A 5CD5D 1MUJB 3D85D 4Y4FB 3F7VB 5DD6A 4LCUA 4DKEH 3RY4A 1N7MH 1H15A 5LQBL 1GIGL 4WWKC 3U4EB 1LILA 3FQRB 4LRIC 3VFRA 3OKEA 3ARXA 3GM8A 2ZUXA 2B1HL 4G7VL 4KJQC 4NKMA 3RZCA 1MNUH 4YGAB 5E5MA 3UZQA 2C3VB 1RV6X 3I3EA 4X6CA 5SX4H 1XH3B 4OGXH 1ZEAL 5DI8A 5IVNA 4NKDB 4X7SH 2V6HA 3U0TB 3DRQA 3WHXB 4W4OC 1S7QA 1JCKA 5DJYB 3HE6B 1ZLSL 4AT6B 2HJLB 3PP3K 2NX5D 1A6WH 3L3GA 5CMAB 1F3JA 3O3UN 4UU9A 1HXYB 3Q3GA 2NW3A 4MX7A 3O3BA 3U0PB 3MBXH 4WHYH 2YD3A 5I76A 5EOCL 3O2WH 1JRHL 2VERN 3L3IA 2GJ6B 4J3SA 3FB8B 5J9PB 2QADC 1IKFL 5DYOB 3FOMA 1YEEH 3TBVB 4GSDH 4YBLC 5ID0B 5F7KC 2BSSB 2E7HA 2ADJB 4OD2A 3IVKB 4PLKC 3S4SB 2R0KH 3BZEA 1U41A 3CSYB 4KPHH 1E6OH 4OCRL 4M5YH 5JHLH 3UDWA 2W59A 3FRUA 2COQA 5KS9F 1A0QH 1Y18A 2VLKB 1W72L 3EYOB 4X80H 2B4CH 1AE6H 4NCC1 1DVFD 1MCNA 1XGRB 3GRWA 1S7UA 1LO0H 3AUVA 1I8KB 3K0WA 1FJ1B 1CZ8H 5LCVL 1I7UB 1EGJL 4M7ZB 2NZ9D 5JQ6L 5DMJB 4GUPB 4J7RA 4KGLA 4C56E 3E1F1 2FYYB 5JW4Q 5D93C 2DL2A 1JF1A 1JHTB 4JGUA 5JDJA 3LS4L 3JV4A 4FQIH 5TH2A 1ES0A 3BH9A 3VFOA 3REVA 3GJFK 4PRAB 4P59H 4GXUN 2P4AB 1IQDB 3SHSA 4C58B 4EUPH 1NBVH 3LOWA 3DVIA 3EO9L 4EVNA 2VLLA 3IS0X 2DLFH 2H8PB 4WFHD 3VWJC 2QTEA 1A5FH 4MWFB 1AGFA 3M1BA 5ICXA 3W9DA 4OM0L 1HSBA 1T3FB 4HKJB 5HYIA 4G9DB 1FIGL 3C6LB 4YHIA 2MSPA 1I3UA 3GJEB 1U3YA 2DYPA 2L4OA 3HRPA 1KCVL 3GI9L 4PJ9D 1PKOA 3P9WB 5BMFL 4YFLI 1A7PL 5BV7L 4JQXC 4ZTPL 3D0LA 3TH4T 1I85A 3WKML 3X13A 1RZ8A 3FB7B 4LSSH 3ILQD 1CFVL 1TVBB 2VNCA 3RIFF 5DD0L 5ALBH 4WY7H 4OF3A 5FO7A 3RVVD 3CD4A 1GZPA 1URLA 2BNRE 2B1AH 2DS4A 4R9HA 5EH1A 43CAA 5C2UB 1CK0L 3KLHD 3SDAD 1II4E 3DX6B 4L3EE 3NIDE 3C8DA 4PJGA 4UUJA 4CN6A 1V7NH 1YUHB 2XZCL 5ISZD 4JQVC 3GMOA 4M93C 4UTBL 4M43H 3Q0HA 3GJFA 3S37H 5T1LA 4PJ5B 2N1KA 5IB5B 5I1JH 1PSKH 4J2XA 3BWUC 4N90E 3U36A 1BIIA 1YDPA 4YHPB 2AERT 2YD5A 1TJIH 1BF8A 4XRCA 4WV1B 4YFLF 5K9JH 5MHSE 1FE8L 3AMKA 5F7DA 2IANE 3GBLA 1QRNE 3K80A 2AJUL 4D9LL 1YNLL 2AXHA 3CX5K 4XI5D 4L29A 1P69B 1D6VL 5JQHC 3U30C 2ICEB 4MSWA 5J13B 5I75B 1VESA 2EKSB 3MRKB 1BVKB 3SCMA 1TJGH 4FFVD 2AJ3B 3S5LA 4QRQB 4Z7NE 4XTRC 4XNXL 4HG4K 3QIUA 2GW5A 3T65A 1OP3H 3SDDB 1P7KA 3O4OC 4HT1H 5F6IB 3VGFA 2ITCB 1EK3A 43C9B 5GGSY 3W39B 4PRHA 2PYFB 2IEPA 1YZZA 4L8DA 1HI6B 4P46A 5I1DA 2JJSC 4NUJA 4PJXE 4JFYB 1I9EA 3H3PH 3W0WD 3IU3A 2AI0H 3ULVL 1FYTD 1MCEA 5AUMA 2FLBT 4ZUWB 3TO2B 3ARFC 3BP7B 1QOKA 4E41E 2OZ4L 5EO0A 5DRZB 5KVDH 1QFOA 4R2GB 1JI2A 4XNQA 4IRSC 2DDQL 1WISA 4HKZA 1IAMA 5MEOB 2DLHA 4WO4D 4Q9RH 3PWPD 5CKAA 5C7XL 5HYEA 2XWJB 4L4VB 4P99A 1KTRL 3BYTA 5B8CB 2FEDD 5F9JA 1TTGA 1EEZB 3R06A 3RZWA 3RL1B 4ZTOL 5IKCB 3VXSA 1PYWB 2X41A 5CIPA 4PJEE 3ECBA 3OX8A 5CP3H 3ARDB 3BZDA 2YPLD 2X4SA 3QUZB 5DFVD 5BQ7A 2FHBA 1OW0C 2HVJB 3C5ZC 1N5AA 4KKLD 3OWEA 5HHPA 4QEGA 5E24E 1T7WA 4KXZI 4NOBA 1UB5A 5T3XL 5EPMA 4D94A 1AKJB 1CCZA 1BMGA 2KZ1B 4E9LA 5C07A 2GYSA 3NIDF 2WINA 5DRNA 1RQ5A 1P7HL 3ZHLA 2PO6D 3G5ZB 5ADOL 2QBWA 1NLDH 2P46B 5D1ZC 4HGMA 1N4XH 3LH2L 1VCAA 5IVXB 3GKWH 4X4YB 4DVBB 1N6QL 1TCRA 4Y0GA 4I18C 4L4TE 4XWGH 1FG9C 3ZYZA 5SX5H 4PFEA 3JV0A 3I6LE 4XCNA 4N1EA 2J6EH 3MRRA 1MHCA 2HRPL 3GSVB 4HIEA 2EDYA 5FGRA 1SEBA 4EUPA 4K3EL 1H5BC 3OKDA 1U8HA 4TNVF 5BZDB 2FCBA 1FGNH 4K71B 1Q9LA 2NY5H 3U9UA 2BVUA 4NBZB 3UTTE 4GT7A 4ELME 1EHLL 3QG7L 5CCKL 4BZ2L 1J9CT 5HGAA 4Z7NF 2XOTA 4Y89A 3EDFA 1P7QB 1Q8MA 4I8DA 4X6DB 5LXGL 1JHKH 3MOAL 4NDMA 5E8OA 1XGPB 5KJRL 5DS8A 3H9ZA 1FPTH 1OVZA 3IFPB 2JCCF 2R0WL 1DQJB 1W72B 4YHYC 3DO7A 4M1GH 3VFMA 4HBQA 3P0VH 4QYOA 2PW1B 5KSBE 1HNGA 3RDTB 3F65A 4N0UA 3FB5A 4LVNB 1GXEA 3KPRD 1FL6B 4Q9BA 4AM0B 5ILTL 4ZYKA 3L5IA 5D7LE 4H88L 3HAEA 4XZUB 4BZYA 1OARH 3PJSA 1MCBA 5E00B 2EDKA 5E6IB 2AK1L 1AFVH 2FEEI 1CGWA 1D9KB 4WCYH 2JTDA 4D9RE 5D2NA 4NQDD 4K23H 4G7YH 2JIXB 4JFPB 1U8PA 1CE6B 1NGYA 4GBXC 1XF5B 2UV3A 2ZPKH 1DEEA 4ODBD 2EDRA 3QIWB 1R3LA 3CVHH 4NO5B 5I1HH 4PJEF 4BH8B 2Z92B 1E28A 3KPLB 2C1OB 5BW7A 2ZUUA 3O81A 1AXSB 2WBKA 5EB9A 5DK2B 1WBYA 2E7BA 5EO9A 4YR6A 3RWIA 5DMYA 2ADGA 1WT5A 2YUZA 3IGAA 3K46A 5GGTA 1MCFA 1NC4A 1V3KA 1PAMA 4NHCL 2KH2B 1SBBA 2IF7A 3BD3A 1FVEA 1CDJA 2FJHA 5DVMA 3QI9A 3RWGA 3D9AH 1ZGLB 1HHGA 3TVMB 1YYMH 3MRPA 5C9JA 5E94A 4LSRH 2OJEB 4XP4H 3MCKA 1SMOA 3VG0L 4JVPA 3IXAA 3RL2A 1IL1A 2V2XB 3FOLB 3VFGL 2XY2A 5AZ2H 2VLJE 3H3BC 4PJ8C 5C0FA 1CGVA 3N50A 3R8BB 3GNML 5MEPA 4HWBA 1WFOA 4W6YB 4Q0XH 3NCJL 3T08A 2NQCA 4FQJL 3IDNB 4XB7A 2MKWA 3LHPH 1E6JH 1JZ2A 2WQRA 3A67H 1CFNB 1ZT1A 4ZAKA 1C12B 4U6YA 5GRVL 2QQNL 1B9ZA 4FA8A 2NXYC 1OAQH 2E7MA 2NY3C 5CZVL 1PZ5A