1MCIA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mciA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mciA02
4QXGL 3V6OE 4GW4B 1QSED 3L1OL 4ETQA 1IC7H 3W11D 4M8QB 5GRUL 1H0DB 3CZFA 3O0RH 2EIBA 3MCKB 4QHNB 3BKML 3HC4H 4HPYH 1ZVSB 1HXYB 5I66B 3RZCA 4OZFA 3MGTB 2N7BA 5DHVA 4YDLB 1A7QH 2Q7YA 5IJVA 4QT5B 4EXPX 3EYFB 4NNXA 1NFDE 3RY4A 5E6ID 1LHZA 2ZJSL 1NEZB 5DR5L 5KSBF 5T3ZH 1KJ2A 4G9FB 1KCUL 4A6YL 5DI8B 4HEME 1D9KC 5HYSA 4PJDE 4XI5C 3MOAL 5EB9A 5FM5O 1JN6B 4W4OA 1NAKL 1ORQB 2IQAA 3DVGB 4XPAL 1LK3L 4RBPK 4PRPA 4PJ7F 3LH2H 3D18A 3JSSA 2E7MA 4MCZA 1Q72H 4DAGL 3UXFA 1HSBA 2HP4A 2O93L 2NLJA 4HGKC 4RRPG 3RP1A 2R0ZL 2AXJA 5GRVK 1E4XH 3UJTL 4DFIA 4UNUA 5DJ8B 5I16B 4ENED 2O5XH 5K9KB 2VN7A 5AYUL 3ARTA 1AY1L 1UB6B 4PJ8D 1MCLA 5KSVA 3GI8L 1XT5A 4O4YL 2R39A 5J12C 2J8OA 2XY2A 3FQRB 3L6FA 1T2XA 4JANA 1YEEH 3X3GH 3V79C 4P2OB 5KVGH 4NZTL 5IMLB 4H20L 3MLVL 3SO3C 2X7LB 3NIDE 1AHWC 3HZVA 3S4SA 4TNWK 3UJJL 4UT6H 2R8SH 4I1NB 4Y5XA 4AH2A 4R2GD 4PY7B 4FQJL 8FABA 2IPUG 2XKSA 4YO0A 2ZCLL 4Z7QF 1FFNB 3FT4B 2EDHA 3E2HC 3TESA 4GG6B 1H8SA 3L3OB 4L3CA 4LIQH 4FXKA 1RZGA 2BC4A 3J8F7 5INCB 1H3TA 1MIML 1PKOA 4X6CB 4I13B 5HGGS 2BK8A 5LG1A 2V2WB 4Z7UF 2GAZB 4P2RE 2Y23A 3FMGL 2VABA 3KR3H 4GRLD 2CQVA 3QNYB 3WFDH 3T4YA 1TJHH 1EK3A 1ZA3B 1WICA 1MRCL 3BZDA 4U1IA 4FNLH 3IKCB 1T03H 5C7XL 4Y19E 3QFDB 3QDMD 5D1QD 1ODAA 4JRXE 1ES0A 3ARUA 4ZFOB 4GRWB 5IM7A 2APXA 3STZA 2IAMB 4M4PA 1XCTA 3TBWB 3S88L 3O81A 1WFTA 2Z35B 3B8YA 5SWZB 5GPRA 2HFEB 4ODWB 3HMWH 5ID1B 5J3HD 3BIKB 3EO1A 1I1YB 1I3VA 3H2WA 1BHGA 4P5KB 4NDMA 1OTUD 5I8KL 5DEZA 3QI9D 2CD0A 1HKFA 2F74A 3O4OB 4NO2B 2NTSP 5F96L 3VFWB 1W2KT 4RQQA 5ACLA 4NJ9L 5H94B 3RUGF 5EO0A 5JXAL 3TN0B 2X4SB 4NFCA 1NGXB 3IDNB 5GRYA 1P9MA 4R0LA 1J0KA 5BVPL 4LVOB 3X13A 5EO1B 2HT3D 5FOBA 2C3WA 3MRFA 3HAEG 2C1OA 2VDOH 1QR1B 1AJ7L 1BD2D 4JPIA 4HULB 2Q1EA 3RWIB 5EA0H 3BPNC 1QSFD 3MJ8B 1L7IL 4NWTL 1F11B 3T77A 3RWGB 2XQBL 3Q6GH 1T22A 4MA1B 5D1XD 3TVMC 1OM3L 1GYAA 1CR9L 3SKJH 2C7UB 3BD3A 4JO2L 2IGFH 2QKIA 3W9DA 1ZKAA 4FOMA 1PSKL 4K3HA 1NFKA 1NUFA 3P9LB 4P48A 5JIPA 2KBGA 2QEJA 1MAML 3KJ4B 2A77L 2JE8A 1MFEH 3QNZA 4K3DH 1OGAE 2Q3AA 5C0GB 5GRZA 2IF7A 2I60H 4LSRH 2HLFD 3VRIA 4ORGB 3QULB 1YEDB 3DJ9A 4NGHH 1BIIB 3GK8H 1NUGA 4XCYB 2PTVA 4JFFE 3RQ3A 3U30B 3RVUC 2BNRB 1F4WL 4HIEB 4KI5D 4EI6A 4PJ5D 1CCZA 1EHNA 4Z7NE 2FYYA 3UBXI 3KPNA 3BP4B 4H0HB 4PRBA 3B9EA 2JB5H 3N9GH 4I0KA 5IVXA 5FFLA 2VLRD 3VWJD 2BFVL 1CG9B 5LJYH 5JHDD 4M1DH 5H35B 4JRWA 4MVBC 1RUPL 3QIBC 3LD8C 1GOGA 3T8XA 4ERSL 1XH3B 3HPJB 4UB0L 3CCHA 2X1XR 3DO7A 3V5HB 3BPCA 5CGYD 4WI3A 4JR9L 2BSTA 8CGTA 5C71A 2J8HA 5E5MB 2GY7B 5TQ2H 1NUNB 5T5NF 2P7TA 4ORZC 5EUOF 2P43B 4PB0H 4RFOH 2XZCL 1AI1H 5C08E 1D5BB 1R24A 4H25A 3AMKA 3MXWH 5GSVB 4JFHE 5DJCA 4NHCL 4NQCE 4H1LB 1G7LB 3CFDA 5ID0A 5EOQH 1SJVA 3O6LH 3CX2A 2DTMH 1F90L 3WHE1 4EI5A 4N0YH 1FO0H 3FO9A 5IBTL 3L3IB 5TPWH 5ISZB 5E70A 3P73B 2BVOB 5KSAC 2EDNA 1TFHA 1VFBA 2X4UA 3DUSB 4Q9RH 1KIUA 3NTCL 3S36H 3BQUC 3G6AA 4H26B 3REWB 4KAQH 2ENYA 5HYJB 1VADA 2ATKA 3MV01 4ZODA 3KPSD 4NKMA 3QDJB 5DA0B 3MRLB 3HE7A 3DX8B 2OJEB 3DGGB 4U1KA 4E9LA 5K9JH 5ALCH 2P8LB 4XP6H 2J3SA 2B2XL 5DMKA 4XP1L 1CFNB 3ULUL 3HCVB 1MHCA 1XGRA 3N1GC 4XTRD 4O2FB 4PJCF 3U0PA 1MLCA 4Q0XH 2R1WB 1Z5LA 1AXSB 2DQIL 3BMVA 4PTTA 5J1AA 4I0PD 5E8OB 5TE6H 2FR4B 4N1EA 3VXRB 1Q1JL 3RVXD 4CW1B 1T5WB 1NCTA 4UMGA 4YR6B 1SYVB 3LS4H 3O3BB 4Y1AE 2ERJB 2Y06H 4RGND 3AROA 1M7IB 3O2VH 1N26A 3C08L 4GLRI 4P4KB 2MOVA 4LP5A 2DI7A 1V7NL 5C3LD 3DV6B 4KDTC 4PRIE 3UMTA 1EDQA 4G6FD 5GGVY 3FT2B 4N8VB 1EPFA 3BGMB 1MSPA 4PUBL 1LK2A 1TCRA 3ECBB 5IWLA 1NGYA 2QSTA 5JOPD 4JFEB 1G1CA 4WFFE 3MLPA 2RAMA 2XNAB 1NCWL 1JI1A 1UEMA 5LCVH 3UPRB 3ZKXC 4JFDE 5AUMA 3QEHA 3JV6B 1K2DA 4XPTH 5TDNA 3WUZA 1OD9A 4IRJA 5EU6D 5I1EH 4JKWA 5KVEH 1TQBB 1UH4A 1WFUA 1QNZH 4G7VL 3CLFH 4HKXB 5C09E 5CEYA 5TF1H 2YKLH 4E5XB 4BZ1H 1BJ1J 3P0YL 1CXHA 2WBJC 4X0KA 5C0BE 3OGCA 5CJXA 2AK1H 5DRZB 5CMAB 5HHOB 4QTHB 4QY8B 3PP4H 5HDLA 1MJJA 3HUJE 3OTTA 1UH3A 4OGYH 5HY9A 3L9RB 1IBGL 1PG7L 1T20A 5JHLH 4DZ8B 4UNVA 3OXRA 1UJ3C 3CVHB 4JPKH 1QHPA 4ONGH 4OZHB 5E4IA 1T5XA 1RVFH 2HJKB 4HC1A 4XNYL 4GQ9L 1UWGL 4GRMA 4JLRB 3DMMC 3EOTH 4P59H 4M3KB 4HFUL 4MJ2A 3QPQD 5EZOH 4UIKL 4K94H 1TNMA 3UJIH 2ICWJ 1EO5A 3GSNH 3VFPA 5ENWB 3T0DA 4WI7A 4UU9A 3FRPG 1H5BC 3GSVB 1A5FL 2W92A 4C83A 1U3HA 1ZEAL 1QEWB 3D0VA 5GIRB 3TYGL 5HYEA 3BZEB 4LSSH 1QFOA 4HAFA 4PRHD 2IANA 3DV4A 4FQIH 5F3BB 1R3HB 1BJ1H 1U8PA 1MHPH 2AJSH 2FB4L 5I1LB 4EVNB 1R3LB 2LFGA 5E2VH 1UVQA 4Y16A 1MCPL 1FGNH 2L4OA 2BNQB 4LQFH 1HHGA 5F7DA 1E4KA 1RHHB 4LGSB 4I4WA 1J1PL 1QBML 2CDFA 1A7OH 5GRJL 4OD1L 2VDNL 3ZTJH 1G0YR 1O7VA 1OP3K 4ZAKD 2AKRB 1ETZA 3OKOB 4WW1A 1YN6A 3WIIH 1C5CH 1G6RB 1VEOA 3VMPA 5SWSB 3LKOB 4HUVB 1EVTC 1AGDA 1S7TA 2AJYH 4ONOA 1IC5H 2FDBP 5GGQL 2G5BB 4GMSH 4ZYKA 4PRPB 2IG2H 4KKNA 3RKPA 2VDPL 2JF1A 4MA7H 2AV1B 2W1NA 3QXVA 2NY5C 4C56A 3WL9B 3T04D 3ROLB 2ED7A 4JVPA 5HDBE 2CR6A 4LNRB 4NQEB 5D1ZA 3IVKB 1IGMH 1IRAY 3CC5B 5MHSD 4LARH 1KBGH 4IJ3C 1MPAH 1OW0C 1IAOB 4LDLB 5C07A 1F6AB 2XA8H 4OI7A 2CXGA 1MCWM 2IQ9L 2P8PB 3W9EA 4L8BB 4O2EB 5DQ9A 1A7NL 4WU5B 3UZQA 3MV7B 1R5WA 3OGOE 1HILA 1MI5E 1E28B 1Z3GL 4OQ1A 1U8MB 4K3EH 1TZIB 1T7VA 3G08B 1JNHB 4PP2A 1I8MB 1KEML 4BQ6A 3GMQB 4ZQKA 5C0IB 1I85C 3HZVB 4A2MA 5F88B 1NLBL 4BH7B 3VMNA 5I2IB 2EKSB 2Q76A 3QO1B 5JO5A 1AKJA 1F5WA 3N50A 4M6MH 4ONFL 4FQ2H 1AGEA 2PETA 3EFDH 5ALBH 1RJYA 1WUNT 5IHBA 3WN5C 4LF3A 2VLME 2K9UA 1J8HD 2MCG1 2NY1B 3LSOA 1YECH 4PGEB 4YHNA 5AZEL 3U36B 4LHUB 1I1CA 5TJWK 2ICWA 4OKVA 3DURB 4QHLA 1FIGL 3G5YA 2EDYA 2ZUVA 5HI5D 3RTQB 2PTUA 4FTVB 5D7SL 3TBSB 3HNSH 3PL6B 1SBSL 2D2OA 3ZKQD 4YHYB 1IGTB 3RZCD 4XXCC 5FYKH 2D03H 4S1QL 5DD0H 5C2BL 2RCSL 4UV7L 1FJ1A 5BXFB 3DSFH 4M93C 3AS3A 5CJQL 2V17H 3WHE0 2X4QB 2RR3A 4UTAL 3JV0A 4DW2L 4N0UE 5I1KL 1WC7A 1B4JH 1QFUH 2NXZB 3P2TA 4ODUA 3QO0A 4XNUL 5JZ7D 2BXZA 2GJ6E 2X4RB 3QXAA 4OFVA 5E8PA 4UT9L 5IVXF 4R9HA 4HWEH 3ARZA 2D7OA 3MGOA 2DIAA 4DGVL 4OTXH 1MH5B 5CILL 1FH5H 3W5NA 1VESA 3F6IA 1YEGH 4FP8L 3MLZH 1CDHA 4PJAB 3HNVH 4S0TD 3KPQB 1G7MB 4TVPD 4NC2B 3IAPA 3OG4B 2EEDA 3MRFB 2F54A 2H26B 1P1ZB 3PF2A 4YX2L 4KMTH 1IQDB 1CDYA 2NCMA 2OP4L 3UAJC 2DLGA 5F8QC 2X44D 1J5OH 1CFQA 5CBEB 5EOTA 3DBXA 1CIUA 1KPUB 3DX6B 2VXVL 3OBAA 4P23B 5D4QA 3JVGA 5FA3A 3O3DA 4ODXB 2Y07L 4PJGA 2VERN 3TBVA 1UACH 2FO1A 4YHPB 4GJTB 4TSCH 3H3PL 2DQTL 1I9JH 2F9BT 2CKNA 1BVZA 1T04B 2C4FT 4KRMB 3EFFA 3MJ9A 5EU5A 3BP5A 5CJOH 5TF0A 4Z78B 3GSWB 1E4XI 4LSUL 4NOFA 4L4TB 1OCWH 2IBGA 2B1HH 2QQKL 1IQWL 1EAPA 4WTZA 4M6OL 3U6RA 4NUJB 4E42B 3QT2A 4S2SB 1P7QD 5JA9A 5T3ZD 4X80L 4U1NB 2OL3B 3FCTA 4PJFA 4NKQB 1N6QL 4N5ED 1HXMA 4R4ND 3SCMB 1YPZE 4F3FB 4JM2F 4PR5B 3I3BA 3QR2A 2H2PC 5L2KE 2J5LC 1EO7A 3SJVA 3LQAH 4AIZB 3F5WB 5CIPB 1AQDA 3GMRA 3MRRA 3IFNH 4NNYA 3DO7B 1KLUB 4OB5H 2OSLA 2BSTB 1DBAH 2G9HA 4ZSOE 1FNFA 1GXEA 4KTEL 2VE6A 1ZTXH 2X4PA 3HE6A 4ZXBB 5LWYH 1KCRL 5EC2B 1HYRC 3C5SB 4BKLA 3R1GL 4LOUD 4KK5D 1R24B 3QG7L 4H25B 1DQLH 3PJSA 4KV5E 1UM6H 4IMLA 3TZVC 3RGVA 2NX5B 4XC3H 4U1MA 1OTSC 3ES6A 2W60A 1CF8L 5GRWA 4P2OC 2BDNH 5BVJA 2VXUL 3FO9B 3HMXA 5D5MA 3WE6B 2QBWA 4GT7A 4HXAL 3OX8B 3KLAA 2WQ8A 2YA0A 3PGDB 2DM7A 3PDDA 1I7TA 4DKEL 4WI2A 3O9WB 3BPOC 4XVUC 3MRCA 2O61B 2NR6C 3WD5H 3DRQA 5C9KA 1KELL 4KTDL 1I3GH 4PJXF 1R5VB 3WV0A 4OCSL 3M45A 4X6DB 1F2XK 3SKNA 2A6IB 3GKWL 5BW7A 1CLZH 4GMTH 5CBAB 1BMGA 5JPNB 4XNMB 3TFKC 1KPRB 3PHSA 1SM3H 5IMOA 3IFOA 5EBMA 1Z5LB 4Z0BH 4AL8L 5ITBL 5HPMA 2C1PA 4MA3B 5J9PB 3QQ3B 5A3IC 3BWAA 1DDHA 2P24A 3EO9H 5E56A 5EORL 3IT8D 1TVHA 4WHDA 1U8HB 3CFJB 4R8WH 3QXDA 4QRRB 3TYFB 32C2A 4TUOB 4ZNEA 4QXGH 5T5FH 3L1OH 4W6WB 1UZ8B 3BE1L 2AXFB 1BEYH 5GRUH 2VITB 2YEZA 1PYWB 4NRXA 1KULA 3B5GA 3MRIA 4KJWD 1FVDB 2ARJQ 1KLFA 3ARBC 3C60B 3JWOC 4HWUA 1ZLVH 3LN4A 4JFZL 2HWZH 2NQCA 3V4PL 1B2WL 4HQQL 4HIIA 2A9NH 2ZJSH 1QLFB 3UTSD 1U8IB 3O4OC 4ZUSB 4TNVK 1DQDH 4P2CG 3HB3C 3ZSSA 2VIRB 1KCUH 2IH3A 5AUMB 2OTWB 4NQXA 4A6YH 1BFTA 3G5XB 1K8DA 3NAAH 3GZKA 3BEVA 3H3BC 5DLML 5TDNB 3FT3B 4CDGC 1NAKH 3BT2L 4MNQE 3JV5A 3ILQC 5CEYB 4XPAH 2X9XA 1K4DA 2Z92A 5ICXA 1QO3A 4U6YB 3T0EB 2Y4SA 5EH1A 1I3RB 1Z9OA 5D2LA 1TCMA 1R3KA 4OV5A 5HHNA 3VXMB 3NN8A 1GPOL 5FYLL 2VLJA 4QOKE 3T3PE 4RX4D 2R0ZH 3GMPA 4EI5D 3UJTH 4RA0C 4F33B 1LILA 2DQGH 4MA1C 3OXRB 2X89A 3WXWH 4RFEA 3ARGC 1R5IB 5AYUH 1A6TB 4GG8B 1AY1H 4OGZA 4ZPVB 1JRHH 4PLOB 4RGMC 4ELKA 3GI8H 4O4YH 1MWAL 1XIWC 4D0DB 4UDTA 1MCJA 2NYYD 3VRJA 1F4YL 2OLDA 1IAII 3D25B 3DOSA 4NQDD 1SEQH 4UU9B 1MCOL 2R2BA 3PWJA 4MAYB 3HE7D 4NZTH 5FGBA 5ISZE 4H20H 4PLKC 3D39B 3VXQB 4MCYB 2AK4E 1ZHKB 2Z8RA 2VDQL 3BD4A 3DIFB 5FXCH 3FFDA 2X40A 4HIJA 5B3JE 3RA7L 3HI1B 4BSVA 4ZFZA 2Q8BL 1JPFA 4X9GA 1HWHB 4KKAD 1U8PB 5T1KA 1ERNA 4FQJH 2HJLA 1IL1B 3T65A 5CD5D 2A6KA 5GHWH 4Y16B 5BRZA 1CXIA 4QO1A 4AENA 3EIFA 5EU4B 5DJAB 4HS8H 2ZG2A 1N7ML 5B8CB 1JFQH 5GZND 3TJHC 4Z9KB 4JY4A 3ZZ1A 4F9LA 4OBRA 4X6FB 5F7UA 1EFXA 4ODTL 4PG2C 1N8ZA 1ITCA 2H3NA 1RJLA 4MB5A 4MHHI 3Q5YA 1ETZB 2W9EL 4JHAL 4FG6C 1A9BA 2X70B 1MLBB 5B4MD 3SE4C 5D7KD 4WRLA 5KSUB 3G6JB 2B1AL 2EE6A 2YR3A 5C7XH 2WBKA 1F02I 1TETL 2CMRL 2VB5A 4BFIA 1F6LL 3UTQB 4PREB 4WUUE 5I30L 2VDKH 1DUZA 4L29B 4GXVL 5GS0C 1E6OH 3ZKND 1FZKA 2DBLH 3CMOL 4XWGL 5DTFA 2R1YA 3JWDL 2KDGA 4X4YA 1JPGA 3QJFA 4IRJD 2FX7H 4DN3H 5MENA 2I5YL 5IQ7L 1EO8L 4OCLC 3T2QA 3PDOA 5EFIA 1RIUL 5I8CA 1TDQA 2BRRL 4EUPB 4LHQB 4YEEA 5CKGA 3RPKA 3ZKMD 1A6UH 4F7PA 4I2XB 1MJ8L 1NJ9A 3KPTA 4Z18A 1EXUA 3V0VA 4M43L 5F96H 2VL5A 4TPRL 1JWSA 2YD4A 1I1FB 1BBDL 3H9SB 5IMMB 4I5BA 4NN7C 4Q9QL 5FUCE 5K9OA 5FUOL 3BAEH 3FB7B 1QFWI 1MCNA 5I9QB 5BVPH 5KS9A 4ODVL 3NCFB 5CEZE 1WT5C 3N1MC 3QIWA 5F1IA 1BQHA 4J4PC 2D31A 4X6BA 4OAWA 5T1LB 1ZT1A 3N85L 4I18C 3FQTB 1FNAA 4OSUH 1RULH 5IFAL 1N5YL 1A1NA 1YMHA 2XQBH 2I9LA 3RKDC 2W0LA 2K7QA 1OM3H 1A6ZA 1W0WA 1F3DH 4I3RL 2IAND 5L8JB 4Y2DA 3LKSB 3LY6A 1NQBA 1Q9WB 3I6KB 1Z6JT 3GIZL 2GIYA 1PSKH 1A9EA 5EOCL 1BGXH 1GZPA 4XPFL 1KJVA 2J8UB 1I7RA 3RIAF 3MUY1 3L7EA 3D69A 1JNLH 3FAXA 3LEVL 3OJMB 3GRWH 5HVFB 1MREH 1IAKA 4TULH 3H0TB 4PP1C 1LO4L 1F4WH 2MMXA 2PYEE 3WS6C 1UXSA 2YMXL 1OSPL 2UWEE 1NFDF 1L9NA 2NTFA 5FHAH 3D2UA 3PWNA 4P4RB 5FHBL 5BJTA 2BFVH 1S7QB 3ZDYE 1ZT4B 3O6KL 3MNZB 1E4JA 2WWMC 1RZFL 3L3JB 4PJDF 5IROC 3VXSE 4EQ2A 1RUPH 2OXGA 3CH8A 5FUCC 2L0DA 2VLKD 5BZWA 3U4EA 4ERSH 4S0SD 4RFNB 5FEBA 1NANH 2X4NB 4G8GB 2EXWD 4JR9H 3IXTA 2R23B 3HNTL 1TZGL 2EIZA 3KLDA 4LCWB 1ZA6A 3K2UL 3BZFB 3QQ9C 1EV2E 3S98A 4ALAL 2AABL 2XZCH 4E0RA 5FK9A 1A6AB 4PV9A 5HI3D 4AJ0A 2A83A 5D1ZD 1U58A 4NHCH 3VG9B 2HT2D 2XIDA 5DRXA 1MNUL 1JE6A 1RU9H 3GBNL 3ZSTA 1SY6L 1BFVL 4D0CA 4OF7A 2ICWI 4S11A 5IBTH 1DLHB 3RL1A 5F7KC 4WY7L 4E41E 1BVKB 2H9GA 5J89A 3O4LA 3O3DB 2PW2A 5IB2B 3O3AB 4PJGB 1PKQB 2BSED 4Z7WA 3NTCH 2LAAA 1JPSL 1T1YB 4PV8A 1RZJL 4O51A 1JGDB 1JMXA 2A6JA 1DQQB 4O5LH 3O45B 2JELL 4YGVA 3HPLB 2LABA 2YSSA 1IEHA 1NFIA 4PJEE 2GSIA 2P1YA 3C8HA 3HI5L 4XPBH 4NBZB 4XP1H 1LEKB 1J86A 5GGVL 1MUJB 4MJIE 2QSVA 2EDEA 2V9RA 1UZ6E 4R26H 3WS3B 2UYLB 2DQIH 2IBBA 3QFJA 5DFTA 4CADA 4WUKL 4ZOCA 3FRUA 5DVMA 1S7RB 2W0FB 4OZGB 1FDLL 4XMPL 3V4UL 4CU7A 1RUMH 3BN9C 4F37F 5INDA 2E7LC 1BJMA 2VR9A 1H15B 4Y4HA 1EHXA 1FE8L 3BSZL 1SEBB 1S5IL 3BPLC 5FCUL 5BS0A 3QXUA 1BD2B 1V7NH 2OSLB 4LCCC 3R8BB 2KL6A 4BZ2H 4HGMA 5I1DA 3GEWB 3G5VB 5IJKC 3V5DB 4J3XA 4PUBH 2C3VB 4BKLB 4AMKH 3MRDB 4NYLA 5CWSB 1NCWH 3NA9L 4JKMA 3M8OL 1N6VA 3OG6B 3RX8A 4KQ4H 2OX5A 5D7LA 4G9DB 4P9ML 2HH0H 1LO5A 4IOIB 1U3ZA 2WNGA 1GAFL 2JCCE 3U1SH 1RI8A 1N64L 3PQYB 1DSFH 4G7VH 5BVJB 2UZIL 1KCLA 5B3NA 4RCAA 2Q8AL 4ONHA 3RWFA 1XGQB 1NL0H 4D3CH 2EH7L 2F54D 4I3GA 3WFBL 4PJ7B 1I7TB 5EIVA 4KGJA 4WU7A 4MJ5A 1YEJH 4XBPA 3RY5A 5L2JB 1FNEA 3A0OA 5D6CA 3OHXB 4AG4L 3CFBA 4POUB 5C0NC 1YJDC 4QCIA 3RDTB 4YDIH 5GGUB 4JG1H 4RGOL 2VXSH 4K8RC 3HC0A 1NDGA 1CLYL 4UNTA 4XNYH 1KOAA 3SQOH 2ESVA 4GQ9H 4NSKA 4AYFA 5D7IA 3S35L 1FN4B 3Q5TA 4LBEB 4UIKH 1B0GB 2MCPL 1QLEL 1FYTA 5AD0A 5BV7B 3O2DH 1A5FH 5D96C 2BSRB 1ZEAH 3VH8G 2RIKA 3TYGH 1H3PL 5FYKD 4NQSB 4R3SA 4YHYC 2IH1A 1KN4L 3NZ8A 1AIFB 2PYFB 4OJFH 5D72H 3CUPA 1ZVYA 1U93A 1UKSA 3QUXB 4PJBE 3W0WA 4Z7NF 2FB4H 2FSEB 4S1DD 3MRPA 1MCPH 5ANME 1T1ZA 1ZS8B 4TRPH 3WNMA 4L4TE 4CVXB 4ELME 5F7YC 1T6VN 3BP7B 3SJVD 2NY5L 4WHYH 1EVUA 3ARDB 5CHNB 1GC1H 1U8LB 4DN4L 5K93A 5C0EA 1QBMH 2VDNH 4YWGL 4OF3A 4NZRL 4NFBA 1T0PB 2X1PA 1X5GA 1BZQK 3V5KA 3VXTB 2Q6WB 1U6AL 1VERA 3PWPE 3V6FA 4Z7UB 3JXAA 3WUWA 2IH3B 3HE6D 1NAML 2JB6A 3KPSB 2D0FA 5ICYB 3IB4A 2FO4B 2MKLC 1OWRM 1U92B 4OV6F 5AWNL 2Z92B 2GHWB 3QDAA 1JHLL 5C0AA 3AB0B 3QEGH 3VFRB 5TE7L 1S9WA 4K23H 4XX1E 1IM3A 1NSNH 4U1LA 2ZNWA 1ED3B 2BX5A 1N2RA 4I0PB 2AQ3A 4P2QB 5TQ0L 4P23C 3KPPA 1HZHH 3UEZA 2YD6A 4JPVL 2X4OA 3WMSA 1KIRB 5FO8B 5DEFA 1JGVL 2PO6B 2IQ9H 3U7YH 1AR2A 2CSPA 2GUOA 2PR4H 1EIBA 1A7NH 3VGBA 2Z31B 4HF5H 2BVYA 2R69L 1RIHL 4NKOB 4MWFA 1QRNA 1Z3GH 4DCQB 3WNOA 4YXLL 4KUCD 1VACB 4OFYA 4LLYA 4F7TA 2FJFB 5GGTH 3AUVA 3RVVD 1UXWA 2FBJL 3NFPB 4N9GA 1S7XB 5F89B 3QG6A 1T83A 3T0VA 3SCMC 5FYJL 4ONFH 5DD1L 5GSRA 3SKOA 3GSQA 1LVEA 4D9RD 1QQDA 3D6GA 3UPCA 1ZOXA 2Z4QB 2YOCA 5KZCD 4Z7OF 2YPLE 3O11B 2R2EB 3D3VE 4FQ1H 1U8NA 4OD2B 2V9QA 1NC2A 3VFNB 1XGUA 2MNUA 4JZJA 3RVWC 2W0KA 2AVGA 1SYSB 3PWUA 1JGEB 1FIGH 1F58L 3SGJA 3I75B 4F58L 4PRAB 3VE0B 1SBSH 3MRKB 5KBNC 1NEZG 4GKNA 4GUPA 3TH3T 3DXAE 4S1QH 3C5ZC 4BFIB 1A6WH 3WEXA 5C6PB 4UV7H 5EBWB 1Y0LB 2JLLA 4NJAH 3U0TB 3IDGB 5CJQH 3BISA 3S3SA 1U2HA 3CGTA 5DURB 1NCBL 1ZHNB 4WHCA 3SDAC 4DW2H 4N8CL 1MFDL 4YIQB 3HR5B 1OVZA 2YPVH 4U49A 2HA1A 4NO5B 2KZWA 2R2HB 4GXUN 4MQ7B 3KPRA 1CK0L 5DMGC 1CLOL 3V0VB 3GIVB 3H3KA 3NH7L 1F2QA 2VLJD 4HHAB 4CVWA 1IGFH 1KGCD 4WWKC 4ZUUA 4FQLH 5BQ7B 1KB5B 3MLRL 2Y5EA 2OTUB 3A6BL 1JF5A 2X89D 4FP8H 5EUOB 1Z2KA 1N5AA 3SQBA 4Y5YC 1K8IB 4XH2A 5IQ9A 1UCTA 2ICEA 5C0RL 5E8NA 4P46B 3RRQA 2OP4H 5I1JL 2YUVA 3DRTA 2ATPB 2APTA 2VXVH 1KIPB 4LCUB 4J2XA 4K7FB 1JK8A 5IB4B 3T3ME 4TUJA 4LSDA 3UDWC 3H3PH 5FGCB 4HMCA 3BDYH 5DDHA 4AIXA 3FFCD 2AJVL 4AK1A 3GJFB 5T1KD 3STLA 1PQZA 3MX0A 5BRZD 3ZKSD 1KJ3H 1IILE 1DVFD 2EYSA 5KTEL 1JP5A 1KJMB 1IQWH 2Y72A 3U79A 4NO0D 3KXFA 3C6LC 1I8IB 2P44B 3C60C 5DVNA 1LP9E 2CLZA 2YPKA 4HLJA 4JO4L 4KJYB 1EFXD 3ARFA 3BHBB 4Z7WF 4WHYG 4X80H 5EN2B 5CP7A 1N6QH 1FZOA 4O2CA 3NFSH 5C0CA 4PJCB 2FBOJ 3Q6FA 1Q0YL 2DQFB 4UUJA 4LSQH 3L95A 2APFA 3F8UB 1LQSR 3BDXA 3S96B 2DLEA 4HJGA 4LHJB 3VGHA 2XTLA 2BNUA 4H8WL 4IEFB 4G43A 4DVBB 2JJUA 1ZK9A 5JQ6H 4OZIE 1P5UA 4P99A 4QHUA 4LEOA 2YC1A 5JPMA 5MI0B 1T89C 2WUCL 2IPTL 3OR7A 2FWOB 2G60H 2L7UA 4RAUB 3TIDB 3MREB 1ZWIB 4KTEH 3TO4B 1I1AA 3HC3L 5MEND 1C5DB 4N0CC 1EJOL 4Y7MA 3QSKB 4LMQE 3R1GH 1QTYT 3AAZA 2UVEA 4XHJD 2ADFH 3QG7H 1KUMA 1S9VA 3FQUA 5LAXB 4AQ1B 35C8L 5D9SA 4I9WD 3QNXB 4EN3C 3CFEA 5H2BA 2HKFL 2OYPA 3KNBA 1PLGL 1CF8H 4AEIH 2Q20A 2BCKA 3DTXB 4MAYC 1C1EL 2XFXA 2VXUH 4ZDHB 2CO6B 3L5IA 1PZ5A 3K4DA 5SV3A 1A1OA 5DUML 4RMVA 2NY0C 3O4LB 1T4KB 2PW2B 3LQZB 2KH2B 1ZLWH 2WLYA 3QIWD 4HCRH 4DKEH 1ZHLA 2A6JB 2F8VA 1IGIL 5I1IH 4ZFOL 4YGVB 1QSEE 3GSOB 2A38A 3B9KA 4WDIA 4OCSH 2JIXA 3WHXB 2GK0B 1H3WM 4CKVX 5B8CC 2BRQA 1UWEL 3GKWH 3CXDL 1YNLH 4Y2DD 4Y8DC 4FHBD 3SE3C 1CE1L 1F4XL 3AREB 4KKCC 4MYWB 3DNKA 4PS4H 3MRJB 2CK2A 2K7PA 2P5WA 1UC6A 3NCJL 1XZ0A 2BVPB 5TDOA 3AVEA 3O8XA 1YYLL 4OCYL 2H2SC 3KS0H 4NRYB 5TGBA 3MR9B 1HINL 3HAEB 2XWBB 1A4JB 1B0WA 3ZO0A 1AGFA 3MV9B 5EORH 5E6ZA 4F7EB 1HKLL 4XVTH 1FNGB 5ETUA 3B83A 4WW2C 4XGZA 2OCFD 4LP4A 4YDVB 1CTOA 1Z9SA 5I15L 5LBSL 1VKXA 1S7WA 3D2UD 4S1RL 3BE1H 4HUUA 4XPGL 5J4MA 3AS0A 4H88L 1H9VA 4OQTL 1KENH 1MVUB 4WWID 2DLFL 3NCCB 3INUL 5HD8C 1OQXA 4QRTA 5I71C 4UQ2A 3UTTA 2QADB 4C55A 3DVFA 2R9HD 4PGCB 4I3SL 5B39B 1WWBX 1MVFA 4Y4FB 3L5WB 2NY7L 2FZ3B 3RBSA 1R0AH 3VFMA 4U0QB 2VXTL 4RBPH 2NY2B 4G5ZH 3QDGA 5D71L 4KQ3L 3W11C 3NMEA 4JGMA 1T7YA 5I9QC 4RZCB 2Y7QB 1FFRA 1HE7A 1HI6B 1Q9LA 3UZEA 1YA5A 1UFUA 5JW3H 3MXVL 2PCPA 2A0LD 4H5SB 3IXAA 1MAJA 4YQXL 1KYOJ 3BP6A 5E6IC 3JTTB 3BXNB 2JK5B 4DJMA 1G7HB 5D6CB 2R4SL 1K85A 1JHKH 5ILTL 2VZVA 2FX9H 5ICZB 3AXLA 1FNLA 3FTGA 4FQXA 5IV2A 4L1HA 1MWAH 2FJGA 4L8DA 4HKZB 3ZE2E 1F4YH 4HKBA 1MOEA 2L7JA 2W9DL 3T0WA 1CT8B 4RDQG 4WI8A 3C9NB 5I17B 1JPTL 4RA3A 1YJDH 2VDQH 4IIQA 4LL9A 4UIMA 3CPLB 1NBQA 4R3SB 4K8RH 3QDME 1XGPA 2Q8BH 1F42A 2B4CL 2VSCA 1PG7W 2D4DA 4GW1A 3TBTA 3G5ZB 1F4HA 4PJ8C 2Z9TA 4GSDH 4OGAD 3GO1L 5JDSA 1YPZF 1ORSB 3CD4A 4BFEA 4NM8H 3N1PC 4X4ME 2F5BL 5I76A 5DO2C 2PXYA 4U6XA 1T1XA 1T21B 4PJHF 5HGHB 2XTJB 1KPVA 4ODTH 4Y4HD 4N8VG 3U7AA 1A3QA 2VAAA 2XV6B 1IM9B 1I8KB 3UTZB 5BS0D 5JW5B 4YE4L 5L88L 2W9EH 4OZGE 3X12A 3GSRA 4R2GC 3FONB 3MRGB 1ZHBA 2B1AH 3HZMB 3PWVB 5DVLA 2XN9B 1S7VB 2CKBA 1TETH 2CMRH 5DQJA 4X7FC 7FABL 5HHXL 4NRZA 4Q6YA 4GXVH 4JAMB 1AHWA 2XACC 4KV5F 1M7XA 5EZLA 3CMOH 1W72A 1BD2E 3FKUS 5ESVA 3SDXA 1EUUA 5D7LD 3JWDH 2YBRA 5T3XL 3RWDA 2NW3B 1QSFE 3ALWA 1AXIB 1FORL 4KHXH 4IS6A 1XR9A 1QLRB 2I5YH 1EO8H 4IRSB 1J0YA 5EOCJ 5ABDE 2EDJA 1X5YA 2BRRH 1G9NH 1MWAA 1EUTA 3LKPA 4L3EA 5HHMD 1BZ7A 2X6MA 2DJ4A 3VFOB 1MJ7L 1AFVL 1I9IL 3DX9A 5KSBE 1BBDH 3QUMH 2J12B 4X7SL 3R4DA 3SDYL 4ZFGL 5GZOD 5MEQB 4Q9QH 5FUOH 1L0QA 1S7UB 1WAAA 5DK2A 5J3HC 4F7CA 4KI5E 1MFAL 4PJ5E 4PJ7E 1XF3B 1DANT 3N85H 3IS1X 1FYTD 1CICB 4OCXL 3QI9C 2F53B 5I6XB 5DSCA 4Z77A 1D5ZB 1WJ3A 2VLRE 2VZ3A 5DK0A 1MEXL 3RNQB 5JHDE 1BOYA 2FX8H 3IDIB 4JDTL 3D1MC 3UC0L 3GIZH 5EOCH 5F7LB 4XPFH 4OLVL 4UQ3B 3W0WD 2CDEA 3ULSA 1U95B 4TUKH 5CGMA 1NC2B 3EJJX 1YMMB 4RNRB 2DAVA 4D8PB 1G84A 4M6NH 5E2TL 1UGNA 3BUYB 5MP6H 5HXMA 5ADOH 2H32B 4MXWL 3RPIB 4U1SA 5JUEH 1LO4H 5FV2A 4ISVA 5D1XC 3TWCL 1SVZA 4NN6B 5LGHL 3IGAA 2YMXH 3CVHL 3RJQB 1GZQA 1OSPH 3LKNB 5F70A 1LE5B 4FMFA 3WEXB 1IAIM 3E6HA 3RWCA 2DYPA 2W65B 3CFCL 3V7MA 4UDUB 4V1DB 1DN0B 3SKMA 5TDPB 1NKRA 4KRPD 4Z7QE 1RZFH 4JM2B 2HLFC 3TVMA 1MHEB 1BQSA 2N1KA 1LD9A 1CE6B 4OGXL 4XCEA 3LV3A 3QDHA 5M7QA 4KI5C 4JCLA 1PX3A 3HNTH 5C0AD 4ZFFB 2FL5B 1TZGH 1QBBA 3REVA 4B53A 5JMRA 3K2UH 4YHML 3KPSE 3ZYJA 4U7MA 3MRHB 1HHJA 3VWJC 3Q2CA 4JEGB 1G7JA 1GL4B 3IJYB 4L4VA 5J13C 1MNUH 1N5AB 3MRBB 4JGUA 3WIHL 1FFPB 3GKZA 1MRDL 2WIIA 4P57A 4DGYL 1HHIB 4F57L 2R1XB 2Y36L 1SY6H 5CGYC 5E94B 5E6YA 1RZ7L 3DRTB 1OAYL 1BFVH 3HA0A 4NP4L 2DWEB 3SBWA 4WY7H 3LRGA 1QRND 4Z7VA 1G6RL 2VLLA 4OFYD 3QIBA 4LSPL 5DJZA 3NIFF 4GAGL 5IMKA 5HHVL 1V8HA 1FVEA 4HIHB 4QRUA 1XAUA 3L3GB 4DUXA 3GSXB 1RJZA 4RGNE 4CVUA 1KCVH 4YBLB 3PUCA 4MA8L 5TE4L 3BW9A 3BWUC 1FO0B 2CRIA 4F2MB 2ZSVA 3RUGE 4Q6IB 3HI5H 4G42B 1DBJL 4LHUG 1DQJB 3VFTA 9CGTA 4PJXB 4RDQF 5ESAA 1EERB 5JOPE 4J3OC 4K2UH 2IFFH 5B22A 2VISB 5CP7B 3QIUD 5F44A 1TVBB 2GSGB 4LPVA 3EW3B 2QQLL 1FDLH 1FG2B 1RZKC 4LKXA 4PJIA 1EAJA 5EU6E 4XMPH 1QFWM 3V4UH 1J05A 2BOCA 5KSAA 2DKMA 5DS8B 5HJ3A 1TMCB 2HVKA 2MSPA 4WCYH 4ZNCD 3FO1B 1FE8H 3QCUH 1QOKA 3BQUA 4OD3L 3BSZH 1S5IH 3MYJA 5F1OB 3FL7A 4HWZA 5JPMB 5MEPA 5FCUH 3AB0C 4NO3A 5EBLB 4XTRC 3OR7B 2ORBL 4XBGA 4JKPH 2F5AL 2Q7NA 1WTLA 1MF2H 2UZXB 4JRYA 3ZMRA 1IE5A 3EAKA 4TQEH 3KHOA 4I0PC 4LQ1A 5B38G 1TZHB 3RVXC 4JQXA 4DGIL 5IT2L 4PJ9A 3T1FB 4YPJA 5E08H 1SY6A 3V95A 2A6DA 3M8OH 2PO6C 1E6JH 3KPRD 1D6EA 4P9MH 1TPXC 3GJEA 2Z31C 3GMMB 4OCMC 2ZZUT 4ZUTB 4KH2A 1DTUA 1GAFH 1XF5B 4J6RH 1J1XL 1N64H 3QUZB 1J7VR 2Q8AH 1FZJB 1KG0B 4PRHE 5D2NB 5E2JA 3KWWB 3BKYH 4X4ZA 3U9UB 3Q3GA 1SJHB 2EXYC 3WFBH 4NQCA 1WBXA 4MB4A 4FFYL 3BIBX 3MFFA 4XNXL 4WV1A 4LAQH 3DARA 4NCC2 3S5LG 4RGOH 5DRWB 3V0WH 1ZGLB 4OIBA 4DVRL 3P4LA 2RFXB 2HYMA 3FZUD 3PG2A 1E27A 4OLEA 4LVHC 5C2UB 5F1NA 1CD1A 1AGCA 1QLEH 2HKHL 4N8PA 1EEZA 2P5WB 3SGEH 5HGDB 1YEKH 4P5TA 3VXUD 5DUBA 1H3PH 3TT3H 3HFMH 2IJ0C 1JWMA 2PW1B 5M94B 1KN4H 3KXFD 2VDLH 2WBJA 3LKQA 2HT4C 3M1BB 2FCBA 2VDML 1YY9D 3ARFD 4U4BA 3D85A 3K0WA 3HR6A 3EOAB 1O0VA 4G7YL 3QUYB 5GGRY 4XGZB 3QZWA 3VGAC 1J87A 5C0CD 2CK0L 1KC5L 5CCKL 5EU3A 2EIEA 3W39B 4KK6D 4QOKD 2ADGA 5K9QI 3ZDYF 3FAWA 2HLAA 4H0IA 2V7HA 3MLYH 3CVIL 2B5IC 4X83A 3FOLB 4DN4H 5KN5B 4U1JB 5MHSE 4YWGH 4XX1G 3HG1D 4NIKB 1G6VK 4XAWL 2VQUA 5AG8A 1DR9A 1I75A 3VJ6A 1I1AD 1NAMH 2ZG1A 3SN6N 3LCYA 3JV4A 1OTTD 3QDGB 5MEOA 2LU7A 2LVEA 3L3HB 4GAYA 1C5BL 2EH8L 3EHBC 1YDPB 1MJUH 1JHLH 3V6ZB 3OV6A 5E0QA 5FF6B 3OPZH 5TE7H 2DRUA 4GOSA 5CEXA 3P11L 4ZAKC 2X2YA 3BP6B 4XRCB 2OL3L 2NY4D 4N0FB 2P5EB 3ESVF 4OF6A 2WV3A 3OF6A 1D5IH 4NWUL 1RV6X 1AXTL 3QQ4B 4ZOBA 1CYGA 4HPOL 1J8HE 2UUDK 1VB9A 3L3DB 43C9A 1XMWA 3GNML 3TH4T 5IHUH 4G3YH 1G0XA 5FO7B 4XP4L 2XA3A 4WENB 5HYQA 2R69H 3HUJA 5D6DC 3O41B 1NBZB 2JIXD 4FZ8L 2IPUK 2MKWA 4YXLH 4JY5L 1D9KB 1JTPA 1BBJB 4R4FL 4GFTB 3TPUB 5IFHL 4TN9A 5LXGH 4UIMB 1XCQA 3PDGA 4WUUD 2FJHA 4YBHA 1EEYB 1I8LC 1OY3B 1CGWA 4AT6B 1UZ6F 3NPSC 1IGYB 4XP5L 2ITDB 2DDQL 5FYJH 5DMIL 5F9DC 4TNWF 1BFOB 3MJ7A 1OT2A 1T3FA 5JDSB 3O8XD 4J3TA 3UYRH 1NC4A 3QEUA 2VQ1A 4LLQB 4U1HB 3FO2A 4ZUVA 4QYOA 4GH7B 5GJTH 2DQCH 1OW0A 3MV8D 1RK0B 1NAMA 4M6AA 3R8QA 5J12B 1L0YA 1F58H 4OLWL 2E9BA 3BVNA 3BD5A 1S7SA 4F58H 1SBBA 2WANA 1LEIA 1NDMA 2HFGL 3IDYC 1YQVH 3UTTD 3VFVA 1GOFA 3SO3B 2CKBB 3BH9A 4N9OB 2XZAH 1T0MA 3H42H 1XF4A 5JIHA 4EEEA 1G0DA 1I85A 4TVPE 2X4TA 3HTLX 5EZLB 2UVFA 1W72B 1NFDB 4YNYA 4HZLB 1G7QA 1NCBH 2YBRB 3E6FB 4N90D 1AGBA 4BZYA 4HIXL 2EEBA 2JCCF 5KOMC 3BJLA 4U6TA 1PEWA 3WN5A 5HI5C 4JVUA 1GIGH 1MFDH 5J1TC 1P6FA 4PJDB 1RZIA 2SEBA 1X5KA 1JPST 1VEPA 3GMOA 4QRQA 3RZCC 1BZ7B 5JIIA 2APBA 1Y18B 1CK0H 1I7UA 4LLAA 3NH7H 5H8DA 3DX9B 1A7RL 3TLRA 5C0DB 3P9MA 1IAIL 3QEQD 4PGBA 2BY2A 3MLRH 5E8EB 5EPMB 1RPQA 4HUMB 1WZLA 5KAQF 1INQB 1WEJL 5CFHA 5KVFL 4FQXD 4GBXB 4P9HL 3P4NA 4W4OC 5T3ZE 3VCLB 2X1OA 5JZ7C 4Z5RB 1QFHA 4HLZG 3MPCA 3GI9L 5IFJB 4RAVB 4YDJB 3LRSA 4HKJA 1WZKA 4K71B 3IJHA 1OAUH 4U31A 2R2CA 4M61A 4M5ZH 2W91A 4WHTA 3VXNB 1MFBH 3R06A 1RUAL 4PJBF 4MD4B 3EJZD 5EC1A 4I48B 4XZUA 2ZCHH 5IB5A 3TIEB 4OZ4A 2MQ3A 5DZLA 3KYNB 5KTEH 2Y9RT 4NC1E 4KVNL 4AM0A 5A16A 4JDVA 1HNFA 2PXYD 3EO0A 4ZTOH 2VUOA 3U82B 4ISVB 4JO4H 2QR0A 4MXVE 3TCLB 4Y4FC 4JN1H 3FQNA 3BPNB 3E6HB 1Q0YH 4BQ8A 4Y5XC 4P2RB 4ZTPH 1TIUA 5DVKA 3MLWL 3WIFA 4X4XB 3B9AA 1Q8MA 4H8WH 3GMNB 3KDMA 4X99B 5E9DA 4WO4A 4DZBA 3HHRB 3TVMB 5F9JA 3CDCA 1DQTA 2CLVA 3WDJA 3ZTNH 2HJFA 4C4KO 12E8L 5FYLD 4Y19B 1Q9OA 1U8QA 1L9MA 2F8OA 2WUCH 2IPTH 4JRXB 4X6EB 5IGXH 1T0NB 3MOBH 4GW4A 3QH3B 4AQOA 2BY3A 5DFVD 4M8QA 5IR1B 2DMCA 4N5EC 4LIQE 4PJIF 5IG7B 4R4NC 1RIVH 4KWUA 5L6YH 3MCKA 4QHNA 5GJSH 1ZVSA 5E1HB 1CFVL 2AQ1A 3BUTA 1HXYA 5I66A 35C8H 3MGTA 2OQJB 4L3ED 4R96A 2AJ3A 1II4E 1DN2A 4QT5A 4Z0XB 2WM0A 2FH8A 4F15C 5KZCB 3EYFA 3HS0B 2V5RA 1NEZA 2HKFH 1ONQB 1PLGH 1VGEL 5DI8A 1X44A 3SDCB 3GUTB 1A7PL 3FN9A 3WFHB 5DUMH 4P3DA 1JN6A 1TVDA 1ORQA 2BSSB 1OT1A 3DVGA 3F7YB 5CD3B 1KACB 4HUWB 5IMKB 4I8DA 4LOUC 4WGVB 4U2ZA 1GGIL 2NPLX 4KK5C 2EC8A 4TYUA 3FQXB 1RJZB 3G6DL 1IGIH 4S1SH 2X5PA 4Q9CA 4GRWH 2XI9A 5IVXE 1I9RL 2EYRB 2DIBA 3ULVL 1X5AA 3V2AR 5DJ8A 5I16A 4HK0B 1UWEH 5K9KA 3NCYS 4OLXH 3TT1H 2E3VA 4M7KL 1UB6A 3SPVB 3UTSE 1YC8A 4PY8J 3NCJH 1IT9H 1MHHB 2DMBA 3UTOA 5JIKA 1YYLH 4OCYH 1OGAB 4P2OA 1DQMH 1HINH 5IMLA 1JL8A 1K6QH 1UQSB 1J05B 5KSAB 3B6SA 4HK3N 4NCDA 3WO3B 2X7LA 1HKLH 4JFFB 1S9YB 3EGSB 5I15H 5LBSH 3NVQA 4PY7A 4XPGH 2DYPD 3WJJA 2YUXA 1OGTB 2NZ9C 1P4IH 1FFNA 3FT4A 4WFGD 2DLFH 4GG6A 4OLYH 1FBIL 4M1CD 3L3OA 2BVQB 4CVZB 5DK3A 4K3JL 5E99H 3RNKB 1TNNA 4I3SH 1I4FA 4X6CA 4YHIB 2V2WA 1U91A 2NY7H 4YFLI 2GAZA 3O6ML 1PVHA 3DSNA 2VXTH 3QNYA 4NQDE 1NMBH 5D71H 3KPOB 2ZUQB 3S37L 1K5NB 3IKCA 1DVFB 2F58L 5E2UL 1JGUH 3QFDA 4L4VD 3Q1SL 4KJWC 5C08B 4NO0B 3MXVH 4ZFOA 5BMFL 2IAMA 4YQXH 1C16B 3TBWA 4A6YB 3O3EB 1B90A 1A0QL 2Z35A 1NMCB 1KIQB 5ILTH 2HFEA 4ODWA 1J12A 4MZ3A 5ID1A 3TBYB 3BIKA 2NNAA 1I1YA 4HUKB 3QIBD 1P53A 3T3MF 4P5KA 1Q38A 4J3VA 5CUSL 4EBQL 4JHZA 1CD1B 4NO2A 1PX4A 5HGBB 5A2LH 2YD7A 3ZKXB 2W9DH 3DPBA 5H94A 2QSCH 3TN0A 5ADPL 2X4SA 1NGXA 2ED8A 3IDNA 5D7KE 4EI5C 2X05A 3M17B 3BI9X 1LP9F 5GISL 5EO1A 2B4CH 4J1UB 1QR1A 1B3JA 1X7QB 2VC2L 2W07A 4OQTA 3OQ3B 2CR3A 4HK3J 4Y2OA 3RWIA 4QXTB 2X09A 4LGRB 4GLRH 3I84A 4MDIB 4H1LH 5EU3B 3ARYA 2NYYC 4LEXL 4DUWA 3RWGA 2CIIB 4APQD 3ROOB 4PJXE 4JM2C 1UJ3B 4LSVL 3PABA 3ARGA 2C7UA 1S3KL 4KTYA 5GRXG 3M07A 3WJLC 1J11A 4JZNB 3BKJL 2XKNB 3P3YA 3BQUD 4Y1AB 3DMMB 1NCDL 2LQRA 4C59B 4L3AA 4OUOA 5L88H 3KLSA 5C0GA 4KKAC 5CD5C 5KG9B 1H5BB 4ORGA 3QULA 4JRYD 3JTSA 3S34L 1DLFL 1YEDA 1QA9B 4HD9A 4PRIB 1BIIA 3JV4B 4XCYA 7FABH 3QWOB 1D7FA 5HHXH 2DJUA 2BNRA 4KK9C 4PJ9D 3VRLF 5E2WL 3OR6A 2DQHL 3BP4A 3BYTA 2ZWLT 4ZUWB 5JTWA 4XMKH 1ZXQA 1FORH 1N3NA 3SDDD 1CG9A 4JFDB 4LASL 1U8JB 5DC0A 1VFAB 5H35A 4JGJA 3MFGB 4G6JL 5B4MC 5C0FA 3P30L 2IANE 1IGJB 3MSPA 3HPJA 5C09B 3D3VD 3FB8B 2D0HA 4PG2A 5C0BB 3V5HA 5I18L 4X9HA 5KJRL 1AFVH 5HGAA 4JM4L 5E5MA 3R0MA 4XVSL 1KV3A 3PWLA 3SDYH 3SOBH 2MQCA 4RWHA 1G7PB 5EU7E 3WYRA 5EULV 4IRJC 1KTDB 5I19L 1D5BA 1C08B 3C09C 5GSVA 2YHGA 1MFAH 2O5YH 2YWYA 4Z76B 4H1LA 3MBED 1G7LA 2G75B 3LS5H 1GGYA 5CJXC 3ZKMC 4ZD3H 1AO7D 3BKCH 2BOBB 4R4BB 2FLRT 4P5TD 4QRPD 1MEXH 1D6VL 4YUEL 5HI4D 3L3IA 5ISZA 4JFXB 3GHEL 3P73A 2BVOA 2FD6H 2VQ1B 2VLKE 2WBJD 4GKSB 3DUSA 4OLVH 4LLDB 4M7ZB 3UTPD 4LCYB 3MRMB 3HMXL 3WLBB 4H26A 5BZDB 3REWA 1AR1D 4OI9A 5HYJA 2XQYG 1G9ML 3QJHA 1RURH 4ZS7H 3QDJA 3MRLA 3MUZ1 4MXWH 4NZJA 1JWUB 3DX8A 2OJEA 3DGGA 2OK0L 1NDMB 2WZPD 1UYWH 3K8MA 3TWCH 2P8LA 5LGHH 3CVHH 3UCRA 1CFNA 1RZ8B 3EYOB 4F8TA 4FZEL 1VGKB 2EC9U 1I7ZB 4O2FA 5FDWB 3PIQB 1FNSL 4J4PA 4UZGA 3VH8B 2R1WA 2EDWA 1AXSA 4ZMAT 2GTZB 5E8OA 2FR4A 4NKIH 1FL3B 3VXRA 3ARPA 1JTTA 5CINH 2DICA 1HYSD 3WBDA 1T5WA 1ZGLP 1HWGB 5EU7C 5BV7L 3VD3A 4YR6A 1SYVA 3O3BA 1NLDL 4M9OA 4HXBH 4OGXH 1QBLH 3KLHD 4P4KA 1ZAGA 2GW5A 5DJDB 3I9GH 3IU4L 3DV6A 3OKEB 5F1SA 3V52L 3N06B 1OAKH 1EZVX 3FT2A 4N8VA 4X5WB 3BGMA 3PGCB 4ZO6A 3ECBA 5LQBH 3WS6A 1UKQA 3WIHH 4JFEA 3STBA 5C6WH 3CLEH 1MRDH 2XNAA 2EYTB 1YYML 3UPRA 1KLGB 4OZFH 2Y36H 1ADQL 2EXWC 3MGAA 2XWTB 5DHVH 4M93B 1YEFH 1DE4B 3JV6A 4NP4H 3V4VH 3K74B 4M1GL 3FN0H 4W81A 4JY6B 5IROA 3ZYIA 1KJ2H 4HKXA 3IJHB 3ZDXE 4E5XA 4LSPH 1KF9B 3T2NH 1MI5B 5HHVH 5HI3C 2QV2A 4DKFL 5DRZA 5CMAA 2DKSA 2A9ML 2JKXA 3QHFH 5HHOA 4JFPB 2HT2C 3QUYC 4K94C 4QTHA 4QY8A 4M8VA 4PG9B 4MA8H 4XZUB 3L9RA 4DZ8A 5F9OH 1NC4D 3QHZL 3CVHA 5T33L 1P4BL 4AM0B 4OZHA 1BWMA 1A3RH 2HJKA 3GM0A 1G7IB 1FIEA 4HFWB 1BREA 3W5MA 5F97E 4JLRA 2MWCA 3LKRB 3K80A 1NCAL 2QQLH 1I9EA 5ENWA 4NZUL 1RUKL 3GSVA 1LO3L 3CDGB 3VWKB 4WJ5B 4YGAB 3U7WL 5GIRA 3MZTA 4K9EC 1BOGB 3KDMB 5EZIH 4BUHA 1BM3L 1M7DA 5F3BA 1Q94B 2I26N 1R3HA 4XVJL 2HJFB 4OD3H 4YHOL 4EVNA 2F54E 1X3DA 1R3LA 5I1LA 4UINH 1OAXL 2ORBH 1BPVA 2F5AH 2BNQA 2A74B 3I02B 3EOBB 2J4WL 3WIHA 5EZJB 4Q97A 4DGIH 1D3CA 1RHHA 3WSQH 5IT2H 3U9PH 4N0UB 4R96B 2AJ3B 2RQ8A 2MPAL 2FECI 3B5TA 5T5NG 2IADB 2AKRA 3OKOA 2MFNA 1G6RA 2GJ6B 3VA6A 1J1XH 2CRMA 5SWSA 3LKOA 4ESKA 2VXQL 3B3IB 5MERB 4HUVA 2J5LB 3CDFA 5FYKE 5CZXD 3MUHL 3UP1A 4P3DB 1I3UA 2G5BA 1A6VH 4KI5F 5FYJD 4HUXB 1W0VB 4AIOA 4YDKH 2WUBL 1F13A 3BEWA 2AV1A 4PJFE 5F9WB 1IEAB 4XC1H 3WL9A 1PDKA 5IJKA 4DWHA 4KROB 3ROLA 1DBBL 3GB7A 2OI9B 5DRNB 2NY6D 3SJVE 3A6OA 4LNRA 4NQEA 3IVKA 4L5FL 3CC5A 1M4KA 1FSKC 1HH9A 1IAOA 3OJDB 4GRWF 3NFNB 1F6AA 3VI3E 3SE9L 3TZVB 4YHLH 3AS1A 4RISH 2P8PA 5T1DH 1XGTB 4L8BA 5DJ6B 4O2EA 4JO1L 4WU5A 3MV7A 4OCWH 3V6OC 3ISWA 2WP3T 1CFTB 4PJEA 1E28A 3DO3A 1U8MA 1TZIA 3G08A 4HGWA 1J9CT 1A3LL 1JNHA 1LO2L 3ME0A 2OJZH 1I8MA 3JVGC 1KB5L 5J06A 3B6SB 2VDMH 2EECA 4R7NB 1MCIA 4NT6B 3GMQA 2YXFA 3I50L 4G7YH 5C0IA 1WQVT 5F88A 4AEHH 4BH7A 5CCKH 5I2IA 1I1RA 2EKSA 3QO1A 5GS1B 3BPOB 2GT9B 3RWJB 1TTGA 2VYRE 5SWQB 1ZLSL 2XICA 1YPZB 5GS3A 2O5ZL 2Z8SA 1CD8A 5E9DD 1CGSH 4WO4D 5L2KB 4NHUA 3QWQB 3MLXL 4OFPA 4PGEA 1KYOK 4WI9A 1I4FB 3U36A 4LHUA 2WP3O 4M7LL 1U91B 2OM5A 1IC4L 2QHRL 3DURA 3GDBA 3TA3D 3WKMH 1UA6L 2GTWB 4PYHA 3RTQA 5C0JB 4TNVF 2R4RL 1AC0A 4FTVA 4G6AD 4MNGB 4ZSOB 3TBSA 3PL6A 1IGTA 2VWEE 4GBXC 1AE6H 1WWCA 2YK1H 2GITB 5BXFA 5E00B 1XFPA 4G9FD 1NGPH 4P3CL 2OL3H 3C5JB 2X4QA 5E5UB 2UV3A 3DWTA 1FYHB 1PD6A 4K71C 4D9RE 1N59B 1PEZA 1UM4H 3V8CA 4HPOH 2NNAB 3ARBB 5IKCA 1FP5A 3GNMH 4IDLA 2YWZA 5B38A 2X4RA 4ZNEE 4XP4H 5A2JH 3L3KB 3RWHB 1OAZH 2V5MA 4OIIL 5IEKA 4FZ8H 1MH5A 4L9LC 4R4FH 1EGJL 2AXGB 4U0RC 4PJAA 2WWKT 3C8DA 3KPQA 5DC9B 3MLUL 4V2CB 1G7MA 4LLMB 4KGLA 2H26A 1P1ZA 3NIGE 1IQDA 2ZUYA 2DDQH 3I6GB 1OTSD 5KVDL 3RL2B 2GK2A 5EO9A 5CBEA 5JDJA 1KPUA 3DX6A 4X7TB 1CXEA 4P23A 1TQCC 2OR9L 4KZDL 4ODXA 3PABB 3ARGB 5DF0A 4YHPA 2VWEC 3X11B 3EYSH 1CGUA 5BW7C 3S5LA 4RGMB 1SJXA 1QFPA 1RFDL 3JZ7A 5D2LE 1T04A 1YC7A 1XIWB 4U6VH 4BQBA 3RVVC 3BN3B 3T4AB 4OLWH 3KPMB 4Z78A 2VLJE 3GSWA 4G6KH 1KGCE 5B39G 2HFGH 4L4TA 3LQAC 5I0ZA 3JTSB 1WSST 4ELMA 3ESUF 1KT2B 1YUHB 3F7VB 3S4SG 5DT1L 4NUJA 4E42A 4S2SA 4R7DB 1NGWB 4NKDB 2Z93A 2DLIA 1QP1A 2OL3A 4FFZH 3OR6B 2NY3B 4U1NA 5EIIB 1MRFL 4H0GA 3SCMA 4N0RA 4F3FA 4PR5A 4HIXH 1N3NB 1Q0XH 1FVCB 3CSGA 3SDCC 4AIZA 3U0WH 4UILH 3F5WA 5C0FB 5CJ8A 1F8TH 5CIPA 3MA9L 4MNQB 2IAMD 1KLUA 4UOW1 3DHJA 3PXJA 1AP2B 3FFCE 3IETB 4KRNA 1DL7L 4S10A 5HGAB 5IVZB 2AI0L 2AAVA 4I77L 1A7RH 4Y0GA 3TM6A 1IAIH 5BRZE 5FUZL 3RJDA 1X6NA 5SWZD 3PWLB 4ZXBA 5EUKB 4QOKB 5EC2A 2C4FU 4QHKJ 1P6AB 1BAFL 3C5SA 2EC9T 2OZ4L 3OMZA 3IFLL 4BFGA 2C3HA 3VG0L 4YHKL 1CFSB 2NX5A 3MTRA 5FA4B 3GI9H 4UI2A 4PY8I 4FMKA 3TN0D 3RHWK 5ELIA 5SV4A 1IC7L 4CMMB 4LRNL 2XZQH 3WE6A 4XP9L 2AGJL 3ILQD 2ICCA 3K81A 2AK4B 2X41A 3OX8A 3ZHKA 2LV4A 1RUAH 4LKCB 2VZOA 3PGDA 1GGCL 1XR8B 2V2XB 3VW3H 3O9WA 2O61A 3LDBB 1X5IA 3QJHB 4WWKA 2FHCA 3MRNB 4KVNH 1R5VA 5MENE 1QYGL 4NN7B 1MAKA 3O6FB 4D9LL 4X6DA 2NY4B 3QHTC 5DD3L 3IRPX 2A6IA 4IOSD 1V3MA 5CBAA 5JPNA 4XNMA 3VXPB 1XF2B 1F00I 4I9WE 1KPRA 1O7SA 4HC1H 5KOVC 4MNHB 3OAYK 1YNKL 2WW8A 4I18B 3MMEB 4JJ5B 3W2DH 4MA3A 5J9PA 1TJGL 2ZUQC 5HPOA 3QQ3A 3LPWA 1DVFC 4POYA 4LLVB 3UDWA 2R0KL 4Z7OE 2BNRD 1U8HA 3BGFC 3DVNB 3CFJA 2O5XL 4QHMB 4QRRA 3TYFA 4WUUB 4TUOA 5H37H 1JVKA 2N4IA 1UZ8A 2AXFA 3IJSB 2VITA 2ZOKB 4N1CA 1NMCC 1PYWA 5DUPL 4ODSH 2H8PA 4XBEH 5J57B 3X3GL 1FVDA 1CFVH 3TJHD 5F93C 5KVGL 5L8KB 3C60A 1QFWH 3L5JA 2P47B 5DVOA 5IW3A 4HDIB 2EO9A 3DHMA 1QLFA 5DJXB 1U8IA 2BHYA 1Y6KR 4ZUSA 5I74C 3TEUA 3VDCA 2VIRA 4UT6L 2R8SL 2OTWA 3G5XA 2YA2A 4MQTB 2DM2A 4GXUM 3FT3A 4CN6A 1A7PH 5J11C 2CO7B 3A67H 4M5YH 2BMKB 3OKNB 2AXHA 3SEPA 4U6YA 3QP3A 1GGIH 2D7MA 3T0EA 1I3RA 3OXSB 1KB9J 5FB8B 3G6DH 3BDBA 2AEQL 3VXMA 1IFHL 5C1MB 4K7PL 2GJZB 3ILPB 3BOVA 3ULVH 2CUMA 1P4LB 2BVEA 2XRAL 4F33A 4LSTH 4OFDA 1S8DB 4HH8A 2DS4A 3WFDL 1R5IA 1A6TA 4FNLL 4GG8A 4LPWA 4ZPVA 1T03L 4EUPH 1M05B 4X5LA 4D0DA 5HYJD 2ZPKH 1OLLA 1TLKA 3OKDB 3DYOA 3D25A 1YNTB 3QDJD 4MAYA 5LKNA 3VXQA 3D39A 4MCYA 1ZHKA 4BSWB 3DIFA 3UZVB 2VDRL 5DHYB 5CZVL 1WTGT 4X7EC 1FG9C 5F3HB 3HI1A 1M7DB 5T3XD 2CLRB 4Y2DC 2FEDC 4J4PD 2PYEB 1EBAA 5L8LB 1T2QH 1AH1A 1U42A 1IL1A 3RX7A 1CFBA 2UWEB 4KUZL 1E4WL 4FXGB 5IEHB 3VXRD 3GM8A 5EU4A 5DJAA 1FBIH 2IFGA 5B8CA 1OSZB 3WFZA 4UOJA 4K3JH 2P42B 3RU8L 4OF8A 3VXSB 5IK3A 4K9EH 4X6FA 4Z7WE 4OZIA 4HBCH 4YXKL 3O6MH 3K1KC 2V5YA 3FO0H 4P4KD 4WIQA 5LGJA 1CQKA 3WXVH 2X70A 1MLBA 3RFZC 3S37H 5KSUA 2OR8A 3G6JA 1L6ZA 2F58H 3QYCA 5E2UH 3Q6GL 1RK1A 2BJMH 4OIAA 3WFCH 3UTQA 4PREA 4JFED 3AM8C 4WW2A 4L29A 5BMFH 2IGFL 2XPGB 3VFUB 1ULVA 4CJ1A 2R9HC 3TF7C 1Q9KB 4YBQD 3BEWB 5FYKU 3BPLB 4U6HB 1S9XB 5TFSH 3CMGA 1EMTH 1VFUA 4LCCB 1P84J 2AEPL 5CSZB 3RY6C 2I60L 3GB7B 3QPXL 3DVIA 5C6TH 4EUPA 4E41B 4NGHL 3GK8L 4HJJL 4M7ZC 5CUSH 1CS6A 4EBQH 5HHOD 4I2XA 5F7EL 1HH9B 4BA8A 3E8UL 5BS0E 2A0LC 2J1KA 1I1FA 1KTKE 3CDYA 3H9SA 4HMEA 5IMMA 3KYOB 5DEGA 2JB5L 5ADPH 5ESQB 3N9GL 4CNIA 4PJEB 3FB7A 1VFOA 4HGWB 4ZOAA 3ZYZA 4TOYL 4MXVF 1IAMA 2VC2H 2EKJA 4DK6A 5T1LA 3BH8B 2MHAB 4MJIB 3MLSL 3FQTA 5BOZG 5I1CL 5D7LE 3IS0X 4JN2B 2I07B 1WZMA 5EDXA 4XPHL 1HQ4B 5TQ2L 4GW5B 5IOPA 1C7SA 3LKSA 1YN7B 1Q9WA 3I6KA 4RFOL 2ZOLB 3WNPA 4NHUB 1AI1L 5HHME 2J8UA 1M6OB 3MXWL 3MNVB 1RHFA 1NCDH 4UOW0 5BOPA 4W4NA 2D7TH 1OP5H 1WWWX 1DLFH 5D96B 4PLJD 2BNQD 5H37G 5A43C 1CI5A 1J1OL 3O6LL 3MJ9H 5M95B 2DTML 3H0TA 4HZAA 4X9IA 1FO0L 4B41A 5IUSA 2K1MA 5J6GB 2WINA 4FQHB 1OB1B 4NC0B 5D7IE 1H3GA 2E9JA 4Q9RL 1DEEB 1D5MB 4P4RA 4PJ8A 3S36L 1FYTE 5KANG 1D5XB 4NQUA 1S7QA 4KAQL 3TGXA 1ZT4A 5FO9B 3MNZA 1MY7A 4G6JH 3L3JA 2JCCB 4LLUB 3A6CH 5K9JL 1L7TH 2X4NA 4G8GA 4HS3A 5HYIA 1RSFA 5I18H 1IGCL 4PRPD 3W0WE 5IKCB 4WGWB 1CVRA 4JM4H 4UT7L 2R23A 2AJZB 1WIOA 5B38B 3WNNA 4XVSH 2CGRL 4LCWA 2ITCB 3BZFA 5HSFA 3WDIA 2V7NB 5IEKB 2CIKA 5TE6L 3MQIA 2IMNA 1A6AA 3MC0A 4NQED 2H1PH 4RMRA 1JZ3A 5IBUB 2Y06L 2F19H 3QUMB 1KFAL 1RY7B 3LAFA 4QRSB 1SMOA 4DKDC 3BO8B 1VPOL 3MV7D 5J7CC 3VWKC 4YUEH 1QPXA 1DLHA 5EO9B 5JXEA 4PIRF 3LIZH 3GHEH 1BVKA 5A2IH 5GZOC 2IALB 2F8XC 3THML 3O3AA 5IB2A 2C3XA 1PKQA 2N56A 3F7RA 2HN7B 1ACZA 2WBWB 3HMXH 4YK4C 1T1YA 4MSWB 3S5LB 2CDGB 1JGDA 4PJBB 1DQQA 3MACL 5C0AE 1SVCP 1G9MH 3O45A 5L9DL 4Y88A 3HPLA 4JZOB 5IIEB 2E8YA 4IOFC 5CZKA 2P8MB 3B8SA 5ANMB 2BY0A 3VGEA 4XPTL 4ELMB 1GSMA 3D87B 5KVEL 1BZ9B 2NY1D 1LEKA 1MUJA 5EIQA 1JHTB 2Y5TB 5TF1L 4BZ1L 1WISA 4LHUD 2Z93B 3WS3A 5D7JB 2UYLA 1NKOA 4DOHE 2GY5A 1S7RA 2W0FA 3HLAB 3PWPB 4OZGA 4KU1A 3ZTJG 3RTQD 4FTVD 1VHPA 1NUDA 5BV7H 4OGYL 3PL6D 1QRNE 3QA3A 1FFOB 5JHLL 2EZ0C 1XGYH 3N1QC 5DMJB 2R56H 4PJHE 4JPKL 1FL5B 1H15A 1RVFL 4HMDA 1PG7X 1SEBA 4PRNB 4J7RA 5F9WC 1BD2A 4DTGL 3EOTL 4P59L 3GGWB 2EE3A 5EZOL 4MNGE 3NGBC 4K94L 3UJIL 1MCRA 3G5VA 4KROC 1BX2B 3V5DA 2OI9C 4KK8D 2HFFB 4KRPC 3F12B 2C3VA 4X98B 1X9QA 1X5LA 2Z91B 3FOMB 3MRDA 4LSSL 2XY1A 4JDZB 3C5ZB 2NXZD 3P4OB 5CWSA 5CLTA 4FQIL 1YYMH 5HVGB 5DD5L 4G9DA 2AJSL 5KSBA 4IOIA 3IDJA 1V3LA 1DZBA 3SDAB 3PQYA 5IBLC 1FGNL 2BP3A 4LQFL 1XGQA 2YRZA 4IMKC 1VSCA 4DKFH 3G9VA 2A9MH 5DYOB 2FGZA 2YUZA 3H9YA 4HJ0D 4JFQB 5ERWB 4PJ7A 1A7OL 5GS1C 3MROB 5L2JA 25C8H 2PNDA 3OHXA 3RDTA 4WWKB 3BESR 3QHZH 43CAB 5CSGA 3WIIL 2ZUTA 1C5CL 3SDDB 5GGUA 4P23D 2DKUA 2YN3A 4MJ4A 5FKAB 3CNKA 2AJYL 1IC5L 2ID5A 3GFUA 2B8OT 2FNBA 4Y5YB 1FN4A 2YPLB 2IBZX 4LBEA 1B0GA 3D3VB 4GMSL 5T1MB 4FFVD 3KPRE 1RD6A 1RUKH 2ARJB 1N0LA 1LO3H 4MA7L 2BSRA 1T83C 4OUUB 2PTTB 1FLRL 4NQSA 1CDGA 4R6UA 1GC1C 1Z0MA 1AIFA 2PYFA 4XVJH 3QUXA 2R29L 3DXAB 1IGML 4LPTA 1CU4L 2FSEA 2HVJB 3K46A 4LARL 1MPAL 1DUYB 1OAXH 3MBEB 5F7HA 1ZS8A 3QIUC 4ETYA 1AO7B 4CVXA 4G8EB 2J4WH 3BP7A 3SGJC 2H8PB 3ARDA 3BKMH 3X14B 3QXTA 5CHNA 5EBGA 1X4ZA 1ZV5A 4LCIL 1U8LA 3C6LB 4GS7B 1ADQA 1J0JA 4Y4KB 1U8KB 4R97C 5K33A 3RVWD 3VXTA 2Q6WA 4Z7UA 2E5EA 5DR5H 1ZE3C 1F3JB 4AEFA 4ZXBD 3VXUE 3KPSA 5ICYA 2A73B 3MOAH 1UH2A 2FO4A 2XXMB 3MNWB 4LFHD 4FQ2L 4TVSa 3EFDL 5ALBL 3KXFE 5J6HB 2HAZA 1U92A 1LK3H 4O58L 1KXVC 2NX5D 4C57C 3VD7A 3CXHJ 4LPCA 2CKBL 1YECL 3VFRA 5C0CE 4DAGH 5I1AB 3RZWA 3IF1B 5JORB 1ED3A 2M1KA 1W72L 4I0PA 4P2QA 2RBLA 3CH1B 4KKBD 4L5FH 3HNSL 1KIRA 5FO8A 2OBGA 3F6LA 2BHUA 2Y6SD 1C12B 1R3JB 1P2CB 4FN0A 3T2PA 3LB6D 2PO6A 4PTUB 3HG1E 3O9WD 3ULVF 2WMPA 4EN3B 5DD0L 5TH2B 2Z31A 2FEEL 2QTEA 3WNLA 5E1AB 3EYVB 2VMFA 4JFYB 4NKOA 2V17L 4DCQA 1VACA 3MLVH 1A3LH 2E7BA 3C2AL 3NIFE 2NY0B 2FJFA 4Q74A 2EDFA 3OB0H 5JNYB 2XOTA 3I50H 3ETBF 1S5HB 3FB6B 4KDVA 1LP9B 3UJJH 3FZUC 1B4JL 1ZMYA 2NY3C 2CJUL 3NFPA 5CLWA 4DKAA 1QFUL 1S7XA 5F89A 4D0BA 1FLTX 1OQOA 4WFED 2ZCLH 1TTUA 3EKCA 3ARQA 5D70L 3MV11 4HWEL 4L8CB 2Z4QA 4OTXL 3EDEA 5C86A 1YEGL 3O11A 2R2EA 5IK3B 3MLZL 1MIMH 3S6CA 1FGVL 4OD2A 3VFNA 4QRRD 3ZT5A 1YY9C 1SYSA 3ARFC 1JGEA 4F80A 1IC4H 4OZIB 3FMGH 5LGJB 1ZLUK 1S78D 1R6VA 3I75A 4PRAA 4KK6C 3VE0A 4MDJB 1MRCH 3MRKA 1J5OL 4XWOD 1LEGB 4MX7B 1QPPA 4QHKI 1RK1B 2N7AA 4HX1B 5FM4A 5IW6A 1LWRA 4WW2B 5EBWA 1Y0LA 1UACL 3U0TA 5GGRA 3IDGA 4TSCL 4MJ6B 3S88H 2VUYA 4WEUD 3NPZB 1U8OB 2UUDH 2NMSA 1ZHNA 3CSYB 2OXHA 1HOCB 1UENA 5CJOL 1I1AC 2HG5A 2NXYD 3ZDXF 5I71B 1OTTC 4YIQA 1OCWL 4PRHA 3HR5A 2B1HL 3T0ED 4NO5A 3RIFK 5I8KH 2KKQA 2R2HA 3MV8E 4MQ7A 2JJSC 3VXMD 1DCLA 3GIVA 3LDBC 4HHAA 5IHZB 2ADIA 4GAJL 4NJ9H 3OAUL 1JYVA 2JJVA 5BQ7A 1U36A 1KB5A 4JB9L 1TJIL 5DEGB 1QSEB 1NGZB 2OTUA 3OKYA 5JXAH 4CNIB 3O6FC 2NY4C 4WFHD 1CXKA 5EUOA 5I8OL 4MS8D 3L7FB 1IKNA 3UTTE 3LEXB 1K8IA 3KYMB 2V2TA 4HV8B 1AJ7H 4P46A 3VD5A 2G2RB 3I6LD 5JW4M 2DQJL 1L7IH 3MA7B 4NWTH 4OB5L 5E6IB 2ATPA 4MAYD 3BYYA 3KVQA 4N90E 1DBAL 1U3HD 2ED9A 1KIPA 3D39D 2A2QT 2OR9H 4LCUA 4K7FA 3VFSB 1ZTXL 5IB4A 1GGBL 3DUHA 1CR9H 5IOPB 4JO2H 4L8SB 4RRPA 1RFDH 1SQ2N 3UX9B 3GJFA 1MAMH 3AU1B 2A77H 1DQLL 3BZ4B 1UM6L 4P2YA 4Y16D 4LPUA 5D6DA 3QEQE 5LVEA 4YFEA 1KJMA 3K3QA 5DT1H 5IB3B 1I8IA 2BDNL 4PJGF 4KJYA 4KDWA 3J7HA 3BHBA 4KKCD 5EN2A 2WINB 5AG9A 4LRIC 5IVOA 1CQYA 1MRFH 4PJCA 3MLTA 4PJ8B 5DFWH 2DQFA 3S96A 2H2SD 1JF6A 1LO0L 1YY8B 3QCTL 4G8FB 2IC2A 4DVBA 2PF6A 5J1SC 1BF2A 3HAEH 1J0ZA 4JG0L 2VRAA 1DP0A 4UB0H 3TO2B 4HS3B 4KVCL 4MLIA 3U46B 3ULVD 2FWOA 2AI0H 4RAUA 4PJFF 3TIDA 3MREA 1OF2B 1ZWIA 3TO4A 1EGJA 4R2GB 4K3GA 4C56D 1C5DA 4Z0BL 2JTDA 2GCYB 1SMAA 1BAFH 2CH8A 4JKKA 2CIKB 1ZANL 3IFLH 15C8L 4OCRL 3I2CL 5LAXA 3SY0B 1G9EA 1J18A 3GBLA 3QNXA 4RMQA 5E7FA 1ZSDB 5C07D 3VI3F 3PNWB 1SJEB 4R8WL 1JI2A 3H9SD 4JPWL 5D8JL 1F90H 5T5FL 3DTXA 4ZDHA 4LRNH 1BEYL 2BERA 4GRLB 1WZ1L 4XP9H 3TA3B 2AGJH 3H9HB 3G04B 5J8OA 4EDXB 1U3JA 5ITFB 1C7TA 1T4KA 3LQZA 1GGCH 4J23A 4FQXC 3L5HA 5FYLE 3QDMB 4NPYB 5D1QB 1K4CB 2HWZL 5T1LD 2DWDB 1P7KB 3OZ9L 3SDXE 2LTQC 2A9NL 3GSOA 4FQQB 1AKJD 5JA8B 1DQDL 2X9YA 3WHXA 1QYGH 4D9LH 1A14L 2GK0A 3MUGB 5DD3H 5FCSH 3NAAL 4XNZB 5D5MF 3MJ6A 1BQHG 1GCFA 2GI7A 2B2XH 4IIQC 4BM7A 4HSQA 3ULUH 4L3EE 3AREA 3MRJA 4DEPC 4OF0A 1YNKH 4HG4J 4Z95L 2UZYB 3BRGC 1AQKL 3EJZC 4LVEA 1LE9B 2YD2A 3QI9B 2BVPA 3IFPA 5C8JB 2QSQA 1TJGH 4NRYA 1Q1JH 3FQWA 3MR9A 3HAEA 2XWBA 1HCFX 1A4JA 2YD3A 3CAFA 3OKKA 1WAAE 3QA3B 4KUCF 3TC9A 3MV9A 1CGVA 2R0KH 2DQGL 4F7EA 4BELD 3H7BA 3WXWL 4TSBL 2PXYC 1FNGA 2WAHA 4Q2ZB 2VZUA 4NBYB 4YDVA 1HSAA 1JRHL 3C08H 1YQ2A 4W6YB 1PY9A 1XF1A 2OZ4A 2QQNL 4XT1C 5DUPH 1MVUA 1A7BA 1QSFB 1SEQL 5DO2D 1L4IA 3HKFA 5D1XB 4G8GD 4PGCA 5B39A 2ADJB 1UB5B 4Y4FA 1BECA 3L5WA 2DQUL 2FZ3A 4LCWD 4XXDB 3PV6B 5KSBB 5GHWL 1BLNB 3IDJB 5DFVC 4WI6A 4UBDC 5HHPB 2MTPA 4RZCA 4HS8L 3P0YH 2Y7QA 1HI6A 1JFQL 3LMJL 4JREC 3VDBA 3S97C 2P48B 3DX7B 1G1YA 5GGSB 4XNQB 1P7QA 2AEQH 4H5SA 1IFHH 4K7PH 4QF1B 3NIGF 4PJ5B 3EJYD 5DJ0A 1CBVL 1B6UA 3JTTA 3BXNA 1PW3A 3QAZC 2JK5A 5L0QB 1X6LA 2XRAH 1G7HA 1IBGH 1PG7H 4MMXC 4OM1L 2ZCKL 2KPNA 3P77B 5JXED 4WFGE 5ICZA 2VLRB 3VWJB 5JHDB 5E03A 1LNUB 1UWGH 2CPCA 5J13B 1RJCA 3GHBL 1FZMB 5SX4I 3S9DB 4M7LT 4WEBL 1J88A 3MRQB 3I3DA 4HKZA 4HFUH 5IF0B 5D2LF 2VDKL 3NACL 1CXLA 1E6OL 5DJYB 3WLWD 2DBLL 4YPGB 1JV5B 1CT8A 3DECA 3C9NA 5I17A 4GKZB 4YH6A 2Q86B 2IPKB 2FX7L 2VDRH 3CPLA 3QISA 4DN3L 5CZVH 4U3XA 4L4VE 2EEAA 3UBXB 3G5ZA 1A6UL 4KUZH 1E4WH 1X5HA 4U1GB 5JLZB 1X4XA 1KTLB 4NQVB 5JOFA 1ORSA 2IWGA 3B9DA 3O2WL 1OHQA 4Z7VE 3RU8H 3RWEB 1T21A 5HGHA 1FL6B 3BAEL 4MD0B 1J1PH 3IRZA 4MD5B 5GRJH 4OD1H 4YXKH 3IAGC 2E27L 1IM9A 3JWDC 1I8KA 3UTZA 5FECB 5JW5A 3FONA 3MRGA 4FRWA 4PRDA 2XWJB 3HZYB 5D93C 3NZHL 4OSUL 1RULL 1G9NC 3HZMA 3PWVA 2XN9A 1S7VA 3VGDA 2H32H 4M1CC 4JQIL 3V7AE 5GGQH 1NMAL 4JAMA 3RGVD 2VDPH 1BGXL 2HMIC 5I0DA 2AEPH 2NW3A 1YEHL 1QLRA 1JNLL 4IRSA 4PJIE 3GRWL 3PQYD 3QPXH 1X5XA 1MREL 2DJSA 4HJJH 4TULL 1GGTA 3VFOA 5F7EH 2I25N 4A2LA 1A1MB 3E8UH 5IW1B 4RGNB 1TPXB 1JYWA 5FHAL 3RDTD 5MEQA 4ZPTB 4JRYE 5ACZB 1B0RB 1S7UA 1ND0B 3F58L 3RUGB 3SBWC 4G6FB 1GH7A 3K4ZA 1T7WA 4TOYH 5HHQB 4MZ2A 1KEMH 2I9TB 1XF3A 2J7LA 4BYHA 5D7JC 1NLBH 3MLSH 1CICA 4K07A 3SHSA 2F53A 5I1CH 4D0BB 3UTSA 5HBBA 1D5ZA 5AAWA 1UT9A 4XPHH 2FIKB 1HEZB 1NBYB 2RB8A 3C6SB 4P3WA 3RNQA 3IDIA 3U2SB 5EU6B 4BJLA 4M62L 4UQ3A 5KS9F 3QUXD 4LVHB 1U95A 5AZEH 1YMMA 4RNRA 3OKMB 4D8PA 2FECL 4OT1L 1RU9L 3BUYA 5IESL 1J1OH 2H32A 1A2YB 4RX4A 5CP3H 5D7SH 3RPIA 3SGDI 3ARDD 4APQC 3IDMB 1GOHA 1FPTL 4J8RA 3FRPA 3LKNA 3CSPA 1LE5A 1QR4A 5C2BH 5IW6B 1MCFA 1U41A 2RCSH 2W65A 1BVLB 1T2JA 5GGRB 1AO7E 3VGAB 1KXTB 4UDUA 1TXKA 1DN0A 4V1DA 4O5LL 5DGQA 5I1GL 5TDPA 4QRPE 4NQDA 1DBKL 4UTAH 4JM2A 1DANU 2QQQA 5DWUL 1MHEA 1Z9LA 4KZEL 2B5IB 2HG5B 2EDTA 3WJLA 4XPBL 1HH6B 5I1KH 4HT1L 4JQXC 1CE6A 4PRHB 1IGCH 4XNUH 3UTPE 2C5DC 4UT7H 3WUWG 4ZFFA 4PJ9C 2FL5A 2NW2A 2CGRH 1QVOB 4R26L 5F6HI 4HH9B 4UT9H 2GQHA 2ADIB 4DGVH 3MRHA 4X7DC 3SDDC 5CILH 4P2QD 2FHBA 3QQNA 3C8KA 3CFKB 1MY5A 3UYPA 3IJYA 3LOWA 2B20A 3MRBA 1FV1B 1RUML 1RZJC 1FFPA 1OOAA 1HHIA 1DEDA 2PO6D 2V2TB 2BVTA 1KFAH 2R1XA 4YX2H 2D9CA 2ZUSA 4JQVA 5CS7A 3VU2A 2Z31D 5E94A 1VPOH 3D9AL 4Y5VB 4ZAKB 2VH5L 2DWEA 3KPLA 1ZT7B 4WV1C 2AERT 4BZ2L 2Y07H 4JHBA 3THMH 4B50A 1HHKB 2XG4A 5AEAA 4MXQD 4PGDB 5IB1B 1HK6A 3NOIA 4HIHA 1UADC 2EXYD 2DBJA 3L3GA 2DQTH 4KJQD 4P5MB 1CDCA 3GSXA 4M7JL 4AMKL 2WSKA 3MACH 5L9DH 5E8DL 4TTDD 3MBEC 3PXHA 5CP3A 3VDAA 3QUKB 1FO0A 4KQ4L 4F2MA 2ZSWB 2W9LA 1WBZB 4LSUH 2Z8WC 4Q6IA 4ACPA 2HH0L 2OTPA 4G42A 4P5TC 5FDYA 1DQJA 4RWYL 4PJXA 2QQKH 4X8XA 5HI4C 3U1SL 4M6OH 1DSFL 4GS7C 3PHOB 4Y4KC 4OF5A 3BX7C 1M71B 1NL0L 2VISA 1TVBA 4D3CL 2XT1B 2GSGA 5C3TA 3NPSB 1MCBA 1AR1C