5I16B

Crystal structure of human germline antibody ighv1-69/igkv3-11
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
213
Chain Sequence
EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 213
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i16B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i16B01
4AEEA 2FX9H 2Q8AH 3MLPA 3QAZC 1EA9C 4XP1L 1XH3A 1U8PA 4FA8A 1WC7A 3KLAA 1DN2A 4X9GA 5IB3B 3ZZ1A 2XFXB 1AGFA 1QBMH 3SQBA 4Y8DC 1BZ7B 1S5IL 1INEH 4AL8H 3BWAB 5FYLE 1BF8A 4OZ4B 3EFDL 4ZYKA 1EMTL 2YEZA 3VXPB 5DGQA 1XH3B 3V0VA 4ZS6D 1ZLSL 3V0AC 1WC7B 3KLAB 3VFSA 2A6KA 4FTVA 4HS6A 2O5XH 1J18A 4M1GL 4PLJC 2BVOA 2EIEA 1B9ZA 1OVZA 3QXWA 2YEZB 1KTRL 2NXZC 4G42B 3ARBD 1QVOA 4P2QE 4E41D 3SOBH 1UXSA 3VFSB 3VRLE 4LHUD 2V2TA 32C2B 1JPFB 1ZHNA 2BVOB 5HGDA 2Y06H 2HTKC 3I9GH 4EOWL 1A7RL 3MUGA 3OTTA 1P5UA 4HBCL 5I1AA 3VXME 3GSWA 2V2TB 2XNAB 1PSKH 2VLRA 3ARED 2Z0BA 3QUML 1GIGH 4MD5B 1YPZB 2ILLA 3QSKB 4G6FD 5BVPL 1IGFH 1NGZB 3A6CH 3C60D 2R69L 4XPAL 4BUGA 1DANU 4JVWA 3DUSA 3QIWA 1MNUH 1BQHG 4P46C 4HMDA 1L7IL 3P9MA 1JPTH 1BZQK 3L3JA 2X70B 2HKHH 3TBVA 3ARGB 1MCRA 1Z0NA 4JM2F 2L4OA 2Z93A 3RWIB 3GSQA 2UUDH 3KPMA 1T83A 4KVNL 4M7JL 3BP7A 4AZ8A 1LDSA 5KVGL 3CLFL 4FQ1H 1HQ4B 3TBVB 2D4DA 2Z93B 4DW2L 4CU6A 5D7KD 3GSQB 4Y1AE 3BZDA 4UINL 1ZE3C 1RSFA 3KPMB 5LCVL 2ICES 1A02N 1DFBH 1RZ7H 3FRPG 4JPWL 2P43B 2OMBA 2FJGA 3BP7B 2P5WA 1S7VB 4NM4L 3ME0A 3T0EE 3NCCB 4PYHA 4YXLL 3QXUA 2ITDB 1G6RH 4N5ED 1A6VL 1KJVB 1IC5H 4LPYA 4JY6A 2EEBA 4KRPC 2BNQB 4E42A 4ZD3H 2FJGB 2D3VA 3NCMA 4MXWH 5ISZA 4NO5A 4KKBC 1IAII 1MLBA 1YYML 1Z3GH 5E8DH 1PW3A 3MNVA 1J1XL 3MFGB 4JY6B 4MJ4A 5FK9A 3VGGA 4OZGE 3IDMA 4UB0H 2XZAH 5H35A 1B3JA 1XF1A 5E2UH 1MCOL 4L8DA 5ISZB 3F8UB 3VD9A 3BIBX 5T1LA 3QXDA 1YDPA 4IIQB 2F53E 2J6EL 2J88H 1K3ZA 4NC0B 1QLRB 3GSOB 3PWUA 5FK9B 4S0TD 3IDMB 4BK4A 5T3ZE 5DEGB 2ZUUA 4GW1B 3OAYH 4OCLC 4XPFL 4RMSA 4QWWD 1XGRB 4JDVA 3MRBB 1OWWA 3AAZB 3H6JA 3S5LA 3QFDA 4GKNB 5T1LB 5C0FA 2PYEE 3QXDB 4K7FB 4ZXBD 4JFDA 1D9KC 1RY7B 3T08A 4OB5L 1VKXB 3OQ3B 4HEPG 2X10A 3TN0A 5B38A 3CUPA 4W68A 1FGNL 5EORH 5ACZB 5BOPA 3P0YH 4LEXL 3QFDB 3S5LB 5T3XH 5C0FB 2AW2A 2FGZA 5TFSH 1LP9B 2YPLD 1RJYA 4HWEL 3CFCH 3W39B 2NCMA 1D5ZB 1MF2L 3H3PL 3WBDA 4Q6IA 3TN0B 3FFDB 5B38B 5D93B 4PJCF 3WE6A 3N50A 4LAQH 4C58B 3SGJA 1BEYL 5I6XC 3SKMA 2DMCA 4Y5VC 3LDBB 1DQJA 3O6LL 3X11A 3PGFL 1B0WA 4Q6IB 4OCRH 4PGCA 3WFHA 2ESVE 1HYSD 5FGBA 3TWCH 5FCUH 3C8DA 4OIAA 1RD6A 4JVUA 4YHNA 3RWDB 3O3DA 1QO3A 5KSBB 2AK1L 5CBEA 2DL2A 3ALPA 4UU9A 1WTGT 4PD4K 1K85A 2XTJC 3WFHB 4U0RC 1MFEH 4LFHG 2VITB 3MOBL 4F33A 4GRMA 4YHNB 1QO3B 5JHDD 5CBEB 4C59B 1Q94B 1NBYA 2CSPA 4L29A 4IDJH 4KUCD 3WDIA 1LEIA 3UROR 5DMIL 1JGVL 4WI7A 3SHSA 3IDIB 2PXYB 4NQEE 1VACA 5TDPA 3GSVB 1WCBB 4TTGA 2VXUH 5HY9B 3IKCA 4L29B 3IDUA 1LEIB 1OB1A 5FECA 1T6WA 3FN0H 3TPKA 4QRRA 3JV5A 4FXGB 4J6RL 3TF7C 1E4JA 5J1AB 4YAQA 4HWZB 3MREB 4XZUB 3JWNC 1HOCB 1EHXA 2AJSL 5D8JH 2XG4A 4JDTH 3FKUS 4CL7A 2BSTB 4JY4B 5DHVH 5CUSH 2IAND 2GIYA 1OB1B 4MLSA 5FECB 4NO3B 3V5HA 1AE6L 4NP4H 1PX3A 5EU7C 5JO5B 1Z6JT 3CFBA 1CLCA 1EEUA 2DQCH 3OF6A 2F5BH 4KDTA 5C0ND 1FSKB 4QYOB 4JRYE 1R5WB 4BFIA 5T33L 2XN9E 4BUHA 5KSVA 1UACH 4YHLL 4H25A 3ULVF 4FQCH 3W5MA 4YHZH 4Y4FB 3S36L 3TBYB 4W4NA 2JJSA 4NZTH 4MJ6B 1KCVL 2VYRE 2R0WH 5CILH 4N0YL 1JUFB 4H25B 3ZKND 1L9MA 2DD8L 2EDLA 5KVEH 3KPRD 3STLA 3QUXC 1YA5A 4EQ3A 4UQ2B 3VH8G 5IM7B 4R2GD 3MLWL 1MFCH 3D69A 3KPSE 2CR3A 1QRNA 1H3TA 4K23H 4HXBH 1ZANH 3T3ME 2ADFL 3CFEA 4LKXB 5K9OA 6FABL 3A6BH 3BESR 5AWNH 3PWLA 1UJ3B 3FO1B 3QEGH 4EQ2A 2RB8A 4QGYA 5T1DH 4LSUL 5A2LH 3P73A 4LRIA 5D7JD 3UYRL 3RWHB 3GMNB 2R23A 2YBRB 4ZUSA 4OLEA 2QSQA 3EBAA 5K33A 1T66D 3CFEB 1KACB 3HA0A 4HKZB 1JPST 4GKZB 2F9BT 3VWKB 4XNZB 4ZPVB 2NNAA 3QEQB 1D6EA 4J23A 4NCDA 4OIIH 5F7WC 4OQTA 4TRPL 1NC4B 1RULL 3F7PC 3IFNL 3IFOB 1OAZL 2NY2D 5TJWK 1FORL 1SYSA 4YHYB 3J8F7 4NZJA 3GMQA 2ZP0T 1XCQA 1XF5B 3IFLH 1A14L 4PRAA 2NNAB 3E3QE 1DL7L 4CVXA 2AJ3A 4CMHB 5TF0A 3L3GB 3UTQB 4LL9A 1QSEA 4U1SA 5D4QA 4KROD 2NX5D 4DGYH 2P42B 4WFHD 2O5ZL 3HG1D 5HGGS 3VFMB 1IFHL 3A67H 4QXWA 3GMQB 1XCQB 4L9LA 5DJ6B 3V5KA 4PRAB 4G7YL 4LHUG 4Y19D 2P5EE 1LP9F 4CVXB 4YX2H 1BAFH 5EUKA 3W0WB 4WUUA 1FNGB 2FX8H 4KV5F 4JVPA 1MFDH 1LO5A 3HTLX 3T65A 1GYAA 4QY8B 2V5MA 3V7AG 4I3RL 1Z9SA 1ED3A 2AQ1A 5EUKB 4HIEB 4WUUB 4XNXL 2DIBA 4G8GD 4LSSH 1F13A 3S6CA 1LO5B 2ARJQ 3GSRA 5CZVH 1BP3B 1GOFA 2YD6A 4YUEH 1Q72L 1CK0H 4P2OC 5D70L 1EGJH 4IOSD 1MAKA 1MCWW 3SGEH 2X4TA 4F9LA 3RPIA 3MXVH 3HUJE 4O4YH 1NCDH 4I2XB 4PREA 3QIBD 1J1OH 7FABH 1TVBB 3FT3A 4F7CA 3WV0A 4QKXB 4X6DA 1LVEA 4GQPH 5I1JL 2GUOA 3O8XC 1WT5A 2W1NA 1A6UH 3RA7H 3RPIB 2Q6WA 1MCWM 3O6FC 2ZJSH 4JPKL 2B5IB 1BJ1H 3MBXH 1UVQB 2BNRA 5SWQA 3WIHH 2JJWA 5CCKH 1S9KC 2EZ0D 4ODXB 3THML 1YJDC 4KRLB 2HT2C 3TESA 2E8YA 5GSVA 4WI4A 2NY3B 2X89D 2N56A 3QCUH 1IKFL 4G6JL 4JN2B 3OJ2C 4HCRL 5SWQB 2D7OA 4KUZL 3I6KA 1NCBL 3D18A 3VMPA 4GLRH 4Y4HA 4ELME 1T89A 3EIFA 3BKML 1AXTH 5HHXH 5CINH 2WWKT 3HR5A 3ESVF 2Q76A 2ARJA 2Y72A 3DETC 4LSTL 3C6LD 4OF8A 3LZFH 3KNBA 4Y4HB 1T0MA 3HI1B 1TCRA 3V7AE 12E8L 1AH1A 3M17B 4FRWA 4N0CD 3HHRB 3GBLA 5F9JA 2NW3A 3UPAA 2BVUA 5GIRB 1PG7L 4XX1G 5EWIL 5ID1B 3KNBB 4IRSA 3MYZA 2EDRA 1I9IH 5TDOB 4ZQKB 4HX1A 4LLMB 1T0MB 4UT6L 5CJOL 1FPTH 3C8HA 3ZE2E 1CFTA 5EUOF 5HDBE 4FZEH 4WTXA 3T04D 1PDKA 1F58H 3AY4C 3GMOA 3OAUH 3S88H 4IRSB 4ZO8A 5D7IE 4EI6A 5J9PA 1FVDB 1EUUA 3QZWG 4HX1B 1WUNT 1NMBL 4HXAL 5LAXA 1W72L 4OCSH 3SDCD 4XVJH 1LO4L 3RUGA 4OKDA 4XMKL 1ZLVH 1T2JA 3DX8A 3O9WD 5CJXC 2E7LC 4LOUD 2MQ3A 1CFQB 4X8JB 5ETUB 4S10A 4D9RD 5J9PB 2F8VA 1XT5A 3OKKB 4J8RA 4TN9A 1SEQH 2W91A 4NCC1 4KTDH 5I75C 2YPKB 4ZTPL 3X14A 4EI5D 2UYLB 3RUGB 4OCMC 3B3IA 1N64H 2HFGL 2Z31B 1AO7E 1FHGA 5FM8A 3G08B 4K3GA 4I3GA 6CGTA 4XHJC 2OZ4L 3ZTJH 1OP3K 1JF5A 1WWCA 4PP1C 1RZJH 3VWJA 4YPJA 1NGXA 3X14B 2HJLB 3K0WA 1J1PH 5ITBL 1KLGA 1HKLL 3PV7A 3K2MC 1NFDE 4HULB 4U2ZA 4HPYL 2D7NA 3I6GA 1MCCA 1NBZB 4JKWA 3U4EB 1W0VB 2DI9A 2DIJA 3E6HA 1KSRA 4PJ9B 3HE7A 1YMMD 2NY4C 4WI9A 2E6JA 2DQIH 2HAZA 2HA1A 5JXAL 4Q74A 1KLGB 1MAJA 4I9WD 5ANMA 4UTAH 1JHKL 4Y5XA 5DK2A 5DO2D 3OXSB 4ZFOB 5BO1H 1FIGL 3QA3B 2A77L 3CVIL 5ADOH 1ZEAL 5LQBH 5DJZB 3U4AA 4KJWD 5JTWA 5E24E 2AJVL 1BFVL 2IPTL 5ALBL 1A64A 4HWBA 2DM4A 2NY0C 2FATH 5DQJB 1XZ0B 2J3SA 1CE6A 3RAJH 4XX1E 5ANMB 3DXAD 3EOBA 4M5YL 5E95B 3CLEH 1A3QA 2AI0L 1MWAH 4KK8D 1NC2D 1AKJD 4XVSL 1NGYA 4XWOD 3VG9B 1MLCB 1JP5A 3MJ8A 2A9ML 2F5AH 1YNLH 1P4IH 4PS4L 3WIIH 2NTFB 2GEEA 1UC6A 2HH0H 3TV3H 4HG4J 2VDKH 1KT2A 5IVZA 3BVNB 1NGYB 1DQTA 2FYYA 1QYGL 2R4SL 1SBBA 4PV9B 2V5YA 3VGAB 5SWSA 4CJ1A 4X7SL 1XCTA 2JIXD 4W4OA 4RISL 4UAOB 3O0RL 1YECH 5BV7B 4IDLA 2PKDA 5L2KA 1RU9H 1J9CT 3C08L 4NZUH 4ODSL 1N5YL 4D9QD 4HW6A 1S78C 3M8OL 2C5DC 4OCYH 1QG3A 3MRKB 5ILTL 1UZ6E 3IRZA 5L8LB 4Y4KD 4IRZH 5SWSB 1K4CA 1XCTB 2GSGB 4LCWD 1RV6X 5HVHB 4KJQD 3P9LB 4M6OL 4L8SA 4DVBA 3B5GA 5DRXA 1OCWH 3RJQB 3D5OF 4CBPA 1A1MA 3LH2L 1V5JA 2ZUVA 5C0NC 4TULL 2MFNA 5HVWA 3MV8E 1TZGL 4OD3L 4D3CL 4YQXL 4DVBB 4FG6D 5DRXB 3KPQA 3VXRD 4LVOC 3RHWK 1NGQH 4KVCL 1RVFL 4ZUWB 1C12B 4HBQA 1UZ8A 4JFQA 2H32A 5E70A 3GJEB 2Y7QA 1DLHA 1CGVA 5EIIA 3QIUC 4R2GC 2EYSA 4YHMH 4GBXD 4PUBH 4IJ3B 3QI9A 3B5TA 2CIIA 1UZ8B 1WIOA 4NPYA 5EC1B 4HZAA 1YNKL 5BZWA 3BE1L 1CF8H 3MRDA 1T3FB 1TTGA 4ODTL 5C09B 4XBGA 4FFWC 3BT2H 3CH1B 1TJGL 3BRFA 4JZJB 2HVKA 4XWGL 1IAOB 3MACL 3UBXB 2HT3D 3QI9B 2CIIB 3PL6D 3L5WA 4GRLA 4ETQB 3R1GH 2IANE 5CGMA 4HIHB 4M4RA 2FB4L 5IB2B 2MKWA 5C0RL 5A2FA 5DZOA 1HILA 4L4TB 4AENA 3B83A 3MLYL 3QG7H 4LGPB 5GISL 3C8KA 3QFJA 1Y18B 3BP4B 5FYJL 2AK4A 1XIWD 1A7QL 3L5WB 5LGJA 2VLMD 4XP4L 2GJ6D 2XY1A 4OGAC 4TOYH 2EH7L 3K4DA 4LKCA 4KHTH 3S4SA 4NDMA 4AENB 5HGBA 4XB8A 4KI5D 4XRCA 1EZVX 1C5DB 2AK4B 3DTXA 4WO4A 3RVXC 3TO4C 1OOAA 4L8CB 1KCSH 3U1SH 4OV6F 5F7EH 1NUFA 1MAMH 1XFPA 1MCHA 4LSQL 3S4SB 1BJMA 1OY3B 3GMLA 5TE6H 1K9TA 4NDMB 2E7HA 2DBLL 3KPRE 1T21A 3MOQA 4K8RL 5E6ID 5B4MC 2EH8L 3LY6A 3LKNA 4J4PD 4JY5H 2YPVL 3RWGB 1TPXC 3QHTC 4X7DC 1QD0A 5KVDH 4JFEA 5F1IA 4DFIA 5JQ6L 3E2HC 5I1IH 4JFYB 2CDGA 1AY1H 1ZOXA 1YEDB 3U0WH 3H9SE 2HTLD 2KL6A 2C3WA 3SEPA 1EJOL 3GMLB 1CFSB 5CP3A 5GGTH 1ACYL 4X5LA 1SYVA 3LKNB 3VXSB 3VG0L 5TE7H 4JFEB 3O41A 5H8DA 3MBED 4FQHA 1J0ZA 2CDGB 2Q86A 1AXSA 2XACC 3QUYD 5LJYH 1FO0L 2AXHA 3HNTL 3CCHB 1FVEB 3QDMB 1SYVB 4BFGA 5DEFA 3VD7A 4DGIL 3GKWL 5IFAL 4FZ8L 4JZNA 1KB9J 5KJRH 3CSBA 3L6FA 4M7LT 4FQHB 2ZG3A 1J7VR 3ZE0F 4DKFH 2Q86B 3LV3B 1AXSB 3ARYA 2VL5A 2Y07L 4LBEB 4U1IA 1SM3L 1RZKH 4EIZC 5JW5B 1NLDH 2APFA 5HYSG 4M8QA 4QXUH 5DEFB 4JZNB 5DVNA 4NBYB 3WNNA 1TZIB 5C86A 2X41A 3L6FB 3MUY1 4JKPL 4WFHE 1A22B 2VLLA 3G6JF 4P3DA 3U7AA 3H42H 4G43B 4M7LH 3HG1E 1U8QB 3N9GL 4JHAL 3LPWA 1F8TH 3NACH 3OKLA 4V2CB 1OTUC 4AH2A 5IV2A 3EJZD 5I18H 3INUH 4DFHA 1N6QH 4Y19E 5D72L 4CVZB 4Y16D 2XWJA 2VLRE 3BOVA 4WFED 1L7TH 3FRUB 2VLLB 3B9DA 3JVGA 4U3CA 1VFBB 2Y5TA 5L9DL 3IETB 1GL4B 3IF1A 5B21A 3NCFB 4HFUL 5I0DA 1AR1C 3EOAA 1IGTA 1CGYA 1U3HC 5DC0A 4CN4A 3U0TB 3MPCA 4PJ7F 4GMSH 2H6PB 5LWYL 2YD8A 4G8GE 5F88A 5IESL 1H3UA 1AI1L 4NNYB 2Y5TB 4G80A 1ZLUK 3MNWA 3EKCA 3EOAB 1IGTB 4PJGE 4QCIB 5GHWH 3BD3A 3LIZH 2M26A 1XR8B 1JWMA 1PY4A 2PYFB 2NY5H 3ESUF 4N0CC 3B9EA 3HAEG 1DEEA 4G80B 1YMHB 2V5RA 4OT1L 2LAAA 5E5MA 3GZKA 3IU4H 2G9HB 5DVMA 4DN4L 3U6RB 3MFFB 5FYKL 4EN3D 5MEPB 1XGQA 2EXYD 5DRZB 2V5SA 5D1ZD 1BD2B 4HK3N 1SY6H 5FM5O 3KS0J 1DEEB 4R97C 4P2RA 4PJAA 1MCDA 1MHPL 2BVPA 4PG2A 2JELL 3O2WL 1WEJH 1XGQB 3SDAD 2VXVH 3ECBB 4HLJA 4OM1L 1MJ7L 1HINH 4OLYH 4XVUD 4K94C 1LD9A 4RIRA 1CN4A 4OFKA 4P2RB 5C0CD 3DVGA 4YDLC 4E5XB 3DROB 2ZCHL 2EO1A 5IR1A 4JDZB 1FL5A 3RDTC 4YZFF 5D6DC 2YA2A 5IKCB 3QAZB 1LDPH 2BHUA 3SJVD 5HYIA 4RIRB 2D0FA 2CDFB 2R29L 1QNZL 2R9HD 1G6RA 3IAPA 2EIZB 2V17H 1JWSA 4O9HL 1JGLH 3KYMB 1BBJB 1FL5B 1OAUL 4M7ZB 3D85A 3GM8A 1PFCA 2VQ1B 5J7CC 4IOIB 3QWRD 1ETZB 5IUSA 1FZOA 4MAYC 2YMXL 3K81A 2A1WL 4WFGD 4PPTA 3BPNB 4AT6B 2NXZB 3SDYL 4M61A 3EYSH 1XGTA 1BX2A 1MVUA 5E8NB 5F70A 5AZEH 1FZJA 4JR9H 3FB6A 1CGUA 1FZOB 5EFIA 1RFDL 4GRWE 5FO9A 1SEBB 3QUZA 2C3VB 1MRCL 1FYTA 4MJ2A 2CLVA 3H7BA 4M61B 2VISA 2P44B 4BKLB 1XGTB 4NO2B 1KFAL 1MVUB 5BRZD 2CK2A 3TYFA 1IZJA 4YIQB 1FZJB 1QOKA 4GXVL 1A4KA 4FQJL 1WIPA 5C8JA 3HKFA 5F6HI 3CFDA 2BJMH 3TZVA 1BM3H 5JMRA 2CLVB 3H7BB 3FTGA 2K9UA 5CIPH 2YA1A 1MRDL 4FXLA 5IG7B 3FQTB 1HSBB 1RIHH 3H3BC 1A4KB 1DVFD 4YDKL 4P46B 2LU7A 5E1AA 5C8JB 5IBUG 1KLUB 3CZFB 3PQYA 4UMGA 1V7ML 5I19L 4QOKA 5DC4B 3LMJL 3RVTC 3PUCA 5F9OH 3IVKA 5I30H 3K4AA 3WJLC 1I9RH 4ZDHB 4G7VH 3RU8H 1GGBL 2I26N 4HUWA 3QJHA 4XI5D 3RWFB 1JMXA 5E1AB 2PO6C 4GQ9L 1BPVA 4QHNB 4Z95H 5J3HC 3VJ6A 5KSAA 2BSSA 2VXQL 4ZOAA 4B7IA 3JV4A 1RUQL 3IVKB 3CMOL 4ZS7H 4K07A 4C56A 1YMME 3QJHB 4O00A 5GS2H 4XP9H 5JPNB 2BSSB 2R2EA 2O93L 2APWA 4OJFL 3JV4B 1WFOA 4V1DA 2WSKA 4DAGL 4KRPB 3DSNA 1JYXA 3S35X 4C56B 3X13B 4JKKA 3ULUF 1JRHI 2R2EB 1UWEH 3DXAE 4U49A 1INQB 3QHFL 5C08D 5IVXA 3FB8A 1HHJA 4LDEB 5JHLL 3BW9A 3MJ9L 3N85H 1RZFH 3TIEA 5FF6A 4K71C 4K2UH 1FNEB 3BGMA 1FIEA 3F5WB 4KK6C 4F9PA 4OM0H 4OLUH 5ALCL 4F58H 1IGCL 1A6WH 4G6KL 3OAZK 3QPQD 5IVXB 1OTSD 1CFNB 4C4KO 1HHJB 4ODUA 3MRHA 3DV4B 4MAUH 4UV7L 3BW9B 1NCCH 4FQQA 5IHZB 5AD0B 2VDLL 1CDJA 4MJ5A 4UNTA 1I3GL 1JZ4A 1EZVY 4PJFB 4PJEF 3CDGA 4JFZL 4H20H 3ROOB 2F8OA 1FNAA 4XXDA 5DHVA 1I4FB 4LPVA 2G2RB 4OBRA 1O0VA 3MRHB 4QHUB 2DQGH 1CTNA 3VD4A 4FQQB 2OR9L 2LE9A 4LCWE 4LLQB 2BSRA 3UJJH 4OQ1A 3BJ91 3EYUL 5IGXL 5C2BH 5FA4A 1AGEA 5DFVC 1VENA 1KJ2H 2EEDA 5DHVB 3MLTA 2AQ2A 2WBWB 2DQHH 1CDYA 3IDNA 1OSPH 3ZT6A 2MCPH 2BSRB 4MA1C 3DI2B 3F58L 4U3HA 1I9JH 2JJTA 2WBJA 3QQ9C 3JWOH 2WLZA 4KI5C 3WKML 2CK0L 3EJYC 5I6XB 2FD6H 5TQ2H 4G6AD 3NCBB 1BVZA 4X6CB 4IRJD 4Y5VB 4QXTB 3IDNB 1TETH 2X7LB 3FOLA 4RAVA 2BDNH 2V9QA 1FC1A 2X4SA 1FFOB 4P59H 4OGZA 4ZAKA 2F54B 3TVMD 4B41A 1FFRA 1AGBA 4O5LL 5IBTL 4MQXC 4B53A 1BQUA 1JL8A 3FOLB 4RAVB 3WD5H 1MPAH 5C6TH 1ADQA 3F7YA 2XTJB 5C2UB 4U0RB 1JFQH 3BQUA 2FLBT 3BP5B 5IMMA 1R3KA 1GGCL 2ZCLH 3KYNA 1NFIA 3QUYC 3C2SA 2G5BB 1AFVH 4Z77B 4JRXD 4PJIE 4KKLC 5C07A 4KZEL 4KZDH 5IMMB 1JI1A 3QUKB 3S9DB 5DUBA 5FO8B 3PWVA 4PLOB 5DUPH 3E6FA 4MNGE 5E9DB 1NFIB 1EFXD 1J11A 3U7YL 1CICD 4PP2A 2DQEH 5DD5H 3UTTE 3IFPB 3REWA 1DQLH 5C07B 9CGTA 3RBGA 4I3SH 3DMMC 5HXMA 1DBJL 2VLKA 4NC1E 1IMHC 5DUBB 2I9TB 2YD4A 4ONFH 1NL0L 2PCPA 3WS6C 4XTRC 3E6FB 4Z5RB 1VCAA 1E4XH 4JQVA 3REWB 4J3VA 1KEGL 5E2WH 3MRNB 1DDHB 2ZSVA 1MJ8L 4QRTA 4OZFB 4PTTA 5B39A 1S7TA 3K74B 4UT9H 2OTWA 3MNZB 4OLVL 4X7TA 3L3OA 1FFNB 4WU7A 4JM4H 3VDBA 1XF4B 3QUXA 1OPGH 5IQ9A 3ETBF 5J8OA 2R1XB 4RMQA 1XF3B 4R3SB 4Z7NF 1MCBA 2X4PA 4G9FD 5F7FA 5CSBA 1RJLA 4XP6L 2BNRE 5FKAA 1SJHA 3KXFA 2ZKHL 4KTYA 1EGJA 1G6VK 4EBQH 3QUXB 2CXKA 1EO8H 1FNSL 3X3GL 5ACLA 4JM2D 3BH8A 1WGOA 5FYJD 4JB9L 2X4PB 4FFYL 4RDQF 3IJHB 3P2TA 4JHZA 1CD9B 4UT7H 3BEWA 5DR5L 1P7KA 4U6VL 5KANI 2EXYC 2ZUXA 1T7WA 1RIUH 2WK2A 1P7QA 2J8UE 3BH8B 3GSNH 2HKFL 4OCWH 2XRAL 1INDH 2KUTA 1OAXL 3BZ4B 1KPVA 2APXA 4F7MA 2BOBB 2LAGB 1IEAA 3BEWB 3WIHA 1GC1C 3NZ8A 2D4FA 5E99H 2FGWH 5EIQA 3QDGD 3C5ZD 4RZCB 4HMEA 2J5LC 1G7HB 3O3AA 3MV7E 2WZPD 3ZKQD 1JYVA 4WFEE 3B9KD 4PJFF 3ZDXF 4XCCL 4WCYL 3LN4A 5DMYA 1FNLA 1YUHA 3T0BA 4KHXL 1IGJA 1Z2KA 1EBAA 5D71L 1VEMA 3MV9D 4QXGL 2FR4A 5D2NA 5FA3A 5FDWB 4V2BA 1IKNA 5F7HA 3L5XL 5ENWB 4M7KH 4I0PD 1NGWB 2RCSL 5DHYA 3W9EB 4HFWA 1DBBH 1UT9A 3LN4B 2HJKA 4P23D 2HLFC 4MWFB 1IGJB 1CG9A 1YEGH 1ZVHA 2ORBH 3SDDC 3WFCH 3CXHJ 3Q6FB 5FA3B 4X9FA 3KPOB 2AJYL 4YHPA 5TF1L 4OCNC 4F37F 5BMFH 1A6ZA 3DPBA 3LVEA 1J8HA 4LHQB 5DHYB 4JO2L 1KOAA 2HJKB 1I7TB 1MIMH 5MERB 3GMMA 1RURL 4X6CF 3CXDL 2NTSP 4PJXF 1AP2A 4KQ4L 2OCFD 4Y2DC 4RRPA 3QEHB 1LE9B 4GG6A 4WU5A 2HFFA 2KPNA 3SCMD 5IIEA 3C2AH 2AEQL 3SGDI 1M7IA 3MQIA 3E3QC 5DK0B 2DKSA 5HDOA 5CD5D 3GMMB 3AMLA 1AJ7H 2ZUYA 3ARFC 3ZDZE 1EXUA 3HLAB 3PHQA 4WU5B 1VSCA 1HHGA 4Z7VB 5C0CE 5DJYA 4LIQL 3SO5A 2QQLL 5MP6L 2BMKA 1KEMH 3WIFA 4NJ9L 4P3CL 3O8XB 3PHQB 5E6ZA 3SJVE 3P11H 3AU1A 3O6FB 4OLXH 1VDGA 3BXNB 3MV11 1T2QL 5GRXG 2GTWB 5D1QC 4TUKH 3DLQR 5CLTA 2C4FT 2YR3A 3WIFB 4OZHE 1Y6KR 3VRJB 3ARDA 3QNYA 1F6LL 3PIQA 1LO0H 3MRGB 4ODVL 5KTEH 2GSIA 4P4KA 5TQ0L 3V6ZA 2ZPKL 1GOHA 4YDJA 3SE3C 4JCMA 2GCYA 4XP5H 3GBMH 1A7BA 1MCEA 3QRGH 4QT5B 2IAMC 3PIQB 3ZHLA 4APQC 5T5FL 2V7HB 2OX5A 1WFUA 3MA7B 4P4KB 1YY9D 4BSVB 3K3QA 4YDJB 3WUWA 4L4VA 3DUUB 4QTIL 4DZ8A 1PJ9A 1KELL 2GCYB 3GIZL 4LPUA 1I1FA 3NAAL 4CVWA 3O45A 4MNQB 4NHCH 3RZWA 5ACMA 4EDWL 1U8KA 5ADPL 5BW7C 1MWAA 2NYYC 3QISA 1WFNA 3R8QA 5EN2A 4L4VB 5HYJA 4DZ8B 3E0GA 1I1FB 2HG5B 4HGWA 1I8KB 4XAWL 1HXYB 5K9JH 4HIXH 1OAKH 1U8KB 3F12A 4K3DL 5E2VL 3EHBC 4AIXA 2H3NA 1KTDA 3MZTA 3ZYZA 1R0AL 1TVHA 4AMKH 3ARGD 1UCBH 3BUTA 2EECA 4LMQE 3STBA 4HGWB 4L3EA 1RHFA 1KCRH 2LFGA 4XPBL 3GJFH 4JPVL 2XZQL 4OUUB 3F12B 3PP3K 3RL1A 2GT9A 2HMID 2H3NB 3KHQA 3RTQA 3ULVD 2OP4H 1MIEL 4KWUA 4CRPA 2NY7H 4NQXA 4U1HB 2IH1A 1PLGL 3CC5B 3K4ZA 1RZIB 3DHJA 5J89A 3B6SA 4PJHF 4L1HA 1WJ3A 3JXAA 3RL1B 5LKNA 2X4UA 3TFKC 3TCLA 4KAQH 2Q8BH 1WBXA 4KPHH 3JV0A 3PWNA 5IFJB 2R0LL 3B6SB 1KCUL 5EOTA 2WNGA 1I7ZA 1CVSC 2XKNA 3CSYA 2BNQD 3A6OA 5JPMB 4HS3A 2X4UB 1L0YA 5BV7L 4NKOA 3W11D 2BY0A 5GJTL 4G3YH 3QDJA 4IMLA 4FP8H 1WBXB 1JK8B 2OL3B 1JPGA 1S7UB 1W0WA 1MCPH 3PWPA 1R3IL 1HIML 3NIDE 4QHKJ 3PGDA 5CHNB 5D5MF 3TNNA 3MCLL 3TYGH 3FONA 3KJ4C 4JFHD 3OMZA 5HI5D 5BS0A 2NY4B 4D0DA 1MUJA 4IMLB 3S37H 4PRHA 5ISZD 1AD0A 2H2SC 4HWUA 3CJJA 4M43H 5HGHB 1YQVH 1JPGB 2VQTA 1W0WB 4QRPE 4K9EL 4OSUH 1AGDA 1RUMH 4PR5A 4XMPL 3PWPB 1I1AA 1LWRA 3NCYS 2XI9A 1SQ2N 3PGCA 4PJDA 5KAQF 1MUJB 3SN6N 4ZOBA 5E2TL 5E8OB 1YEFH 1SMAA 5KG9A 5T1LD 1AGDB 2OMNA 1U2HA 4PR5B 2DTSA 3NABH 5C0GA 1I1AB 1M6OB 4Y8AA 1KN4H 3DX6B 4PJDB 3PGCB 1P1ZB 1DE4A 5KVMC 2W65A 4HMCA 2JB5L 3RY6C 1S7SA 3ZDYE 2GY5A 4RSVA 5CJQH 5J11C 5C0GB 2R0ZL 4HG4K 2DWDB 4PY8I 4AJ0A 1CGXA 2COQA 4G9DA 3LEYL 2VAAB 3V6OE 1REIA 1CICC 1IGYA 1GHFL 3HI6H 1TTUA 1FVCB 4P5TC 1RUAH 4S2SB 3HC4L 3TA3D 1ACZA 5AZ2H 3FO0L 3T2QA 1H15B 2VLJA 3DURB 1IGYB 1M71A 2IH3B 5I8OL 2DTML 3VFWB 3LS5H 2C26A 1QFWH 3CH8A 1TQBC 4MS8D 4JO3H 2ADJA 4F57L 2EYRA 4TTDC 1U8LB 4JN1H 4WUKL 5L2JB 4OZIB 5GGTA 3EYVB 4LVOB 4F7PA 1Q1JH 4XXCA 5FUZL 2Z35B 1UM6L 3OJDB 5I1CL 3MJGX 1VFAB 2A83A 4UTBH 2O26U 4PFEA 2ADJB 1NAMH 3RI5F 2EYRB 2D0GA 2GJJA 2ZNWA 2R39A 2XY2A 4H88H 1U36A 2ADIA 4F7PB 2PXYD 4HAGA 2X4RA 5A3ID 3QIUB 4JRXE 4N9GA 3BPCB 3D39E 1JTOA 3NGBC 1RK0A 4KKCD 4MMXC 1TTFA 2VDPL 1OWRM 4AEHH 4AEIH 3KJ6L 2BNUA 4RFNC 5DUML 3LPFA 4OAWB 2X09A 5GRJH 1I9EA 3TH4T 1RK0B 3MR9A 5L6YH 1GCFA 4M6ML 2X4QA 4GO6B 5HHMB 2YK1H 2DI7A 4FNLH 2PW1B 2XZCL 5F9AC 1NCAH 4WI6A 4BH8A 4JFFA 3H0TA 3DX7B 4K8RC 4Q6YA 3TO2A 1IGMH 2GHWB 2X4OA 3O3BB 4G6MH 5KS9B 5JW3H 5D7LD 1BQSA 2X4QB 4MHHI 5IROC 4P9HL 2EE2A 4Q7DA 4A2LA 1GGIL 2APTA 4JFOA 2EDKA 1QUNA 3LKSB 3NH7H 4LU5H 4Y4FD 2Z8RA 1X4XA 2YD1A 3WNLA 1A4JB 3MXWH 4Z7UB 2J4WL 3TO4B 1G9NC 4BA8A 4YFLI 3WFEH 3ZYJA 2KDGA 4G9FE 5DQDL 3EAKA 4JFOB 4N8CH 3MYJB 5IW6A 1LMKA 4PJ7A 1QBBA 1NLBH 3RWEA 2GITB 1NEZA 2OR8A 2Z92B 1INEL 4NBZB 1C16A 5C0BA 1MHHA 1QRKA 4R4NC 5DD6B 1TPXB 1X5YA 4AL8L 2Q3ZA 1ZS8A 4KMTH 1O7VA 5DLMH 3ZTNH 3E2HB 4LSRH 3EUUA 4WW2C 1WZMA 3RWEB 1OF2B 1NEZB 3CMGA 2YN5A 1SY6A 1C16B 4X4ZA 3V52H 4LQFL 1ZS8B 1IVLA 3O11B 2MOVA 4NRZA 4X4XB 4IOFC 3VWKD 2GY7B 2DIAA 2PN5A 3O3EA 3QEQD 5E8EB 4WEBH 2JCCA 3RGVA 2IGFL 4XNYL 1NC4D 4GUPA 3IDGA 4E0RB 4KDVA 4PRDB 1WBZB 3QNZA 2VDNL 2H1PH 1MI5A 1GAFH 3O3EB 1CT8B 1PSKL 1OGAA 1RZGB 2I9LB 3MV9E 4GUPB 5CEXB 1UWGH 2V6HA 4KUCF 3IDGB 4X83A 4W81A 3EYQD 1CD8A 4O2EB 3QNZB 3WLBB 3GB7A 3N1FC 1T20A 3A6CL 3VXUD 4R0LC 2A6DB 3G5XA 3JTSA 3FT4A 3W0WD 5DJDA 1MNUL 4RX4A 1F02I 1NCWH 1QBLL 4HC1H 4HDIB 4PB9H 4ETYA 1MFBH 1JPTL 3OV6A 5CD3B 1A9BA 4NYLA 4L9DA 2YXFA 4P2CG 5FCSH 4AY0A 1ZA3B 4DZBA 1F11A 2FJFA 5ICYA 3G5XB 2EYTA 4OFYD 3FT4B 1U8HB 3HZMA 1CXEA 2W0FB 4WUUD 1U3HB 5DVOA 3GGWA 1T1ZA 2IQ9L 4FQ1L 3BAEH 3CFJB 3T8XA 4FQ2H 1QQDB 4NGHH 4PJ5A 1RZ7L 5H2BB 5C0AA 2DQDH 2MCG1 3GGWB 4JAMB 3QJFA 4RNRB 5HI3C 3T0WA 1K8DA 1JTTA 5CEYA 4M9PA 4OZIF 3HCVB 2BXYA 1WBYB 1IC5L 3VXTA 4MSWA 2XG5A 3V4PH 4ZD3L 1NCTA 3JV6B 5CIPA 1GZPB 5I8CB 4PJCE 5BJTA 2VJXA 3D2UA 2EE9A 2EIDA 4KH2A 2DI8A 2DYPA 5CKAA 2HT4D 3LHPH 2YD3A 3OKOA 3VXTB 3QWQB 4R97B 4PRPE 5ICXA 3KYKH 3QIWC 4N8VA 1KIPB 2HLAA 3WXVH 2NY3D 4R7NB 5KW9H 4KY1H 3V4UH 2XYCA 1CGWA 5GGUA 5EU6A 5HHNA 1ORSB 3GHEL 3OXRB 3LB6C 3PG2A 4H1LA 1T83C 5ICXB 4PBXA 3RNKB 1J0JA 1SBSL 3RDTB 4PLNC 3RZCA 4ZODA 3GHBL 5F9DC 2DKUA 1N0XH 1F4XH 4TVPL 2KH2B 2NW2B 5EU6B 5INCB 3MGOA 5CP7A 4G8EA 1JF1A 5CSGA 3UCRA 4H1LB 4UOW0 1KC5H 4GAJH 1SHMA 1OAQH 2VR5A 4KKAC 4CN6A 1M7DA 4U4BA 3UYOD 1UXWB 4PBVC 1ZVSA 2C4XA 1HHHB 4DUXA 4MAYB 3MGOB 2XQBL 5CP7B 1H3PH 5I76A 1JYNA 2ICWA 4JJ5A 4JREC 3HS0B 4U1NA 2B39A 4Q9RH 1M7DB 3BZEA 2FH6A 2RIKA 1ZVSB 2VZSA 1VFOA 2VQUA 2Y1VA 4XBPB 2XXCB 3O4LA 2R2CA 3AB0C 4U6XA 5I2IA 4JJ5B 5DRWB 3RY4A 1ZV5A 4MLIA 4OCRL 3WMSA 5D9SA 3BRDA 2NMSA 4YXHL 3DGGB 5IB1A 5B39G 4AM0A 4GAFB 3BZEB 5FCUL 4YHIA 2DF3A 3ULVE 1A6AA 1K2DA 4MCZA 5IEHB 3ARSA 3NZHL 3WSQH 2AV1A 2G60L 1F4AA 4P2QA 3LKRB 1PZ5B 2O61A 4OV5B 4RMUA 4PLKD 3M45A 4CMMB 5IB1B 2X1QA 1UA6H 4NQCB 3GIVA 3KAAA 5D1XA 4RMRA 1A6AB 1KJ2A 2Z31D 1TITA 2PO6A 5I1EL 2OR7A 4IDJL 1G7MA 2X1PA 4I0CC 5D6CA 5ICZB 2O61B 3ZKMD 3AS1A 2M1KA 3TN0C 3VXMA 1K6QL 2BNQE 4BZ2H 1VESA 2ZNXA 3V8OA 3CDYA 5D1XB 4N0UB 4NQTA 1ZLUH 3QG6B 1U8JA 2PO6B 4CKVX 4WHTB 5D6CB 1IM3A 2NR6C 3MRJB 4PJ9D 2P8LA 4HJJH 4O58L 5F1OB 3T1FB 3VXMB 4JFHE 3TBSA 4KJPD 5FHAH 5D8JL 3SGJC 2ATKA 1U8JB 1MREH 3JWDH 1LO2H 1AXIB 3VCLA 8FABA 5HYQA 3GK8L 1HEZA 2VXSH 1CFVL 3WXWL 1OSZB 4LLYA 3LQAC 3TBSB 4NIKB 2DQCL 3NPZB 3UJIH 2VZVA 4LDOB 4JFPA 4RGNE 4YEEA 2VLKE 1Y6NR 2W0KA 1CDGA 3DV6B 3MCKA 4PJBB 5HYQB 4UOW1 1HEZB 4Y1AA 3MLUL 4ISVB 4ORGB 4PJCB 4ZNEE 3S34H 3UJTH 3QCTL 3ZKSD 5F3BA 1G7PA 3IDXL 1A1OB 3U4BL 5JDJA 2R0WL 5KSUB 4K71B 1QSVA 3L3DB 2QSVA 4F80A 3T0EA 3TNMA 2Y23A 3TBWB 1LP9E 2DM3A 3G5YA 5KVEL 2B4CC 5F3BB 1FZKA 3IDYC 2QV2A 4KV5E 4MDIB 3GI8L 4NHUA 4BZ1H 1B4JL 3GSXA 1MFCL 3I3BA 1RPQA 3T0EB 1QFUL 4P99A 2FZ3A 4ZFZB 1ZANL 5E4IA 5SWSD 1JZ6A 4OD2B 4FXKA 1YZZA 3A6BL 1A7PH 1QBAA 3X12A 5LGHH 3DX9A 5TE4H 1KJMA 4NHUB 4OZGA 1ADQL 3GSXB 4P0DA 1R3LB 4XP1H 3NFSL 1JGDA 4MA7H 3FAXA 4RWHA 2I5YH 4GRWH 1GPOH 1S5IH 4HUMB 2F53A 5CJ8A 4MD0A 3WN5A 5KSBE 3X12B 4LCYB 1KJMB 4OZGB 3EFDH 5I73B 3FB7B 1EMTH 3MRLB 3HAEH 1UH3A 4NM8L 1GOGA 1KJ3L 1JGDB 4KDTC 3MRCA 2KQNA 3LKQB 2GK0B 5I16A 2PYEA 4M1GH 1IC4L 3WN5B 1T04A 1JPSL 2AEWA 1BQHA 4J1UB 2JJSC 4JHWL 4HJGA 1L0XA 1E6OH 1UWXK 4DKEL 4W70A 5HD8D 3MRCB 4M93C 3G5VB 3IXTA 4TUJA 5EZOL 3VFTA 5I16B 3A67L 2PYEB 1IJ9A 3MRQA 3FFCD 3EFFA 1BAFL 4GAGL 5C09D 5M94B 4U6TA 4EOWH 5D2NE 3EYOA 3QO1B 3GSNA 4D8PA 1JGUL 2B7DT 3HPJA 3R4DA 2FEDD 4HBCH 4YDVA 3VFTB 1KXVC 2X2YA 1X5KA 4L3CA 3BPLB 4OBSA 2ED7A 3FRPA 3RL2B 4Z7WF 4D0BA 5BVPH 1AGCB 3OGCA 4XGZB 3RBSA 4JJHA 3IB4A 5D2LB 2R69H 4L4TD 4XPAH 3GSNB 4D8PB 2DB8A 4L3CB 4LRIC 5I0ZA 3FQUA 1J8HE 3OKNB 1L7IH 5CZVL 5D7LE 1IC7L 3WS6A 4GG8A 1CK0L 5TPWH 3SPVA 5EU5B 1DBAH 3TH3T 2ESVB 4KVNH 4MDJB 4JCLA 4Y0GA 1QLEH 3IT8D 2LTQC 4O4YL 3DMMB 4M7JH 5JNYB 5KVGH 4WTZG 7FABL 4GG8B 1XMWA 4P4RA 1G7LB 3GNML 3OPZH 3SPVB 4DW2H 5EZJA 5LCVH 5FAAA 4UINH 5EUOE 3WKNA 3NIFF 3LN9A 2VZ3A 5DD3L 4LLWA 4NQEA 3WLWC 2RGSA 4C83A 4JPWH 4YH6A 4PRIA 2VZ1A 1A6PA 1T5XA 5CGYC 4L9LC 4NQVB 5CCKL 2X42A 5GS1A 5TGBA 5IQ7L 1LE5A 1A6VH 3QDAA 4YC2C 1IQDA 5I1LA 5I66B 2NLJB 4U1KB 3AM8A 3VXSD 4NQEB 2Z8WC 3OAZH 4HUVB 4JFED 2CD0A 3KDMA 4ODHL 4QRSB 4EUPG 3NIGF 4XH2A 2X1WL 3BRGC 4D9LH 5TGBB 4MB5A 1H8NA 5T5NG 4LGSB 3QDMD 1J1XH 1H0DA 3QEQE 2RBLA 3ILPB 3VXQB 5CINL 2GJZA 5IHUL 1ORQA 5FXCH 4XH2B 4JRYA 4LEOA 1QZ1A 2XN9A 1UM4H 2F15A 1P4LB 3TIDA 4MD4A 1J8KA 1S7QB 2J6EH 3BUYA 1IEHA 2MPAH 2LQRA 4F9LC 2GJZB 5E0QA 1RIVL 2I27N 2XN9B 2C1OA 1JHTA 1I9IL 3VXUE 2NXYB 1F3DJ 1LEGB 4OB5H 1FPTL 1MEXH 3W0WE 1WT5C 4NQDA 4YEFA 5BQ7A 2J5LB 3T4YA 1EV2E 1TZHB 3KPSA 5EZLA 4GW5B 5M95B 4LEXH 3S88L 2Y6SD 4Z7QF 5HYJE 2LV4A 3BIKB 2HFEB 3GMRB 3ZE1E 4ZFFA 3IRPX 4OCSL 4ENEC 1MF2H 3H3PH 4GSDH 5BQ7B 1C5CH 3T4YB 1JNNL 3KPSB 4PJIF 1IT9H 5EZLB 2N4IA 3BEVB 2Z91B 1EHNA 1BEYH 2DQFA 1SEQL 1D5MB 4L3EE 4ZFFB 3SDDB 4G5ZH 2AJUH 2VABA 3O6LH 4KFZC 1YJDL 3PGFH 1VEOA 4Y4HC 1T89C 1T7ZA 1N64L 3CXHK 1X5HA 5C7XL 3MLXH 2B1AL 3H7LA 3T0AA 2YSSA 3VRIB 4KRMB 5MENB 5ESAB 2C1PB 4UZGA 4I2XE 1CLYH 2J2ZA 1RZJL 4KI5F 1AHWA 2AK1H 2VABB 4P57A 4FFVC 1SVZA 5FB8A 4ZPTA 1BD2D 1CQKA 3RKDC 4MJIB 2IJ0C 5IBLC 5CJBA 4Y2DB 2VIRB 4MCYB 3EGSA 3QP3A 3MOBH 4PRNA 1S9VA 4IRSC 1AHWB 2FEEI 1D5BA 2DQIL 2P5EA 3RIFK 5FB8B 4ZPTB 4G8FB 4PG9A 5DMIH 1JGVH 4JQXA 3ARFB 1EO7A 1U92A 3QQ4B 5BO1L 3SO3C 1XGPA 4HH9B 5ADOL 5LQBL 2OTUA 1QSFB 4P2RD 4PRNB 1U8NA 2R15A 3BI9X 1PD6A 5D7SH 1V3KA 2FO4B 2M8XA 4OCXH 2P5EB 4KC3B 2VO5A 3MUHL 3SKOB 4PG9B 5BS0E 4H8WH 3WUZA 4PRHE 4J6RH 5JXEC 2PTTA 3I6LE 4ELKB 4I8DA 1XGPB 4LCCC 3BZFA 1GSMA 5D2LF 1TLKA 3CGTA 3OL2A 3ET9F 2AJSH 3IS0X 3VH8A 5MEOA 1MY7A 1Q8MA 5I1KH 1YNLL 5D1QB 1VB9A 4U2YA 1S7WA 2VXTL 5JLZA 2BCKB 3QRFM 1KPRB 3I75B 2HH0L 3TV3L 2IAMA 4PLJD 3HUJA 4WWKA 1NANI 5J56B 2D7QA 3VH8B 5MEOB 2VSDA 3VWJC 2NXZD 3ES6A 4F7TB 3F65A 4YHLH 2ATPA 3DYOA 2BZDA 2EDTA 4XCNA 2IAMB 3H3KA 5CZKA 3S36H 4APQB 4OCYL 3HUJB 2QLVB 1KCVH 4I18A 1X7QA 3ILQC 2HTKD 1IGIL 1X6LA 2L0DA 3SQOL 1OCWL 3HE7C 2DD8H 5IW1A 2B8OT 3IS1X 4TNWK 5IB5B 2YD2A 2OL3L 4Y5XC 2K7PA 3BGFC 4NFCA 2QEJA 3QXTA 3MLWH 3OZ9L 3OR6A 4LSVL 4UDTA 3VG9C 1J87A 2ZUWA 1BF2A 1J05A 5IW1B 2ADFH 2R1YA 4MXVF 5KBNC 1NUGA 1UQSA 3ARBA 4KJYA 2V9TA 4ELMA 2CIKB 4P46D 4LNVA 4LHUA 4OFIA 4TVPD 3OKMB 3QB7C 2UWEF 3QHZL 2X6MA 1HQRA 1Q0XL 2Q7YA 4HKJB 4LSUH 1I85A 3FCTA 5I9QB 3V5DB 4GS7C 1J05B 3SDXB 2R1YB 4UAOC 2WUCH 5DFWH 4M1CC 5BV7C 2E27H 1E4WL 1PKOA 4H26A 4ELMB 4DEPC 4S0SD 4TUOB 1P2CB 4HKXA 2ZOKA 4ERSL 5K59F 4TRPH 1RULH 3AREA 3IFNH 1OAZH 1CF8L 1P9MA 3ZYIA 5CAYB 1FORH 4W4OC 2DOCA 3C60A 3CVHB 4HJ0C 1AQDB 1QSZA 4HKXB 4FABL 2FRGP 2QQNH 4X4MA 5GS3A 2I25N 3R1GL 2O5ZH 1IFHH 4IMKA 4L8SC 2CRZA 1C1EL 1KPUB 2RQ8A 5D7IA 4KRPD 2GFBA 4G7YH 3Q5YA 3AXLB 1VGKB 3ZE0E 1ZWIB 1NAMA 4KKBD 5H94B 5ITFA 5SWZD 1R5IA 1QA9B 4KQ3H 1E4KC 4FFZL 5D7IB 1KENL 4KHTL 4HWNA 2IALA 3UBXG 2GFBB 4I3RH 4XCFH 4CAGA 4LCIH 4ZO6A 3G6JE 3PE9A 4XNXH 3L7EA 3IJSB 2CXGA 2AERT 1KCSL 3MODL 1AO7A 2MQCA 2QHLA 4YPGB 2CJUL 4XMLH 5DYOA 3MV01 1VEPA 2IALB 2XXMB 1QEWA 1KXTB 3EO1A 4F15C 4NQSA 5D70H 4JY5L 3O2DL 3QI9C 1NFDA 3K7UA 4TSCH 1AO7B 3PNWB 1AY1L 3BYTA 4CADB 1N5AA 2AKRA 1D9KD 2MSPA 3MLSL 1QEWB 2Q87A 3WDJA 1U8IA 3EO0A 3MGAA 1HH6B 3HMWL 4X5WA 5JOFA 3G6AA 1NFDB 1KNOB 1AIFB 2YC1B 4GRLC 5J11B 1N5AB 1HXMA 2AKRB 2G75B 1IM9B 4WI5A 4JPKH 1FAIH 3OKYA 1RJZB 1UGNA 4DKDC 1BVLA 3O4OC 4HLZG 4QF1B 1OLZA 4DKFL 4P5TB 3D0LA 3LPGA 1IKFH 4G6JH 4ZXBA 2Z8VC 2PR4H 4KUZH 1NLDL 4NKIL 4IEFB 2R56L 4QXUL 3UC0L 4UDUB 1U93A 2IC2A 1BVLB 2V9RA 4WO4C 4NRXB 1S5HA 4LCUA 3CPLA 1RQ5A 2ZWLT 2BOCA 2F54D 1TQBB 3KPPA 3QZWA 4M7LL 4YXKL 1OGTB 3BKMH 3D0LB 1F8TL 1ZMYA 3RVWC 3UTSE 2FIRT 1MI5E 1S3KH 3FFCE 4ZUTA 3SY0A 4TSBL 1N6QL 4LSTH 2YHGA 3LKPA 4XCEA 2XTJD 1BGXH 1U95A 5C09E 1S5HB 1UM5L 3GSUB 3VE0B 5HDQL 1L7TL 3KPPB 3VFGL 4DQOL 12E8H 3CX2A 3BKJH 1JHLL 4I5BB 2YRPA 2GTZA 1S9XB 3OKDA 4QHKI 4YZFE 5JORB 3PP3H 4ZUTB 3SY0B 1PG7H 3LKPB 5EWIH 4GMSL 5ESQB 5IJVA 4L4TE 4UT6H 1B90A 1Q9WB 2BSED 1HK6A 2C7UB 3UPCA 3MV8A 1F5WA 3OKDB 3IAQA 5E9DD 1BIIA 3NIDF 1PVHA 4NWTH 3PHOA 5IJVB 1NMBH 3F6LA 3P30L 1W72H 3RX8A 3OR7A 1LO4H 1NEUA 2CO6B 3MV8B 4XMKH 1EEZA 2I07A 5ESVB 4NKQB 5CS7A 4PJ5E 5TH2A 4CW1A 2JK5A 2WBKA 3DO7B 3F7VA 3DHMA 1SY6L 4HC1A 4GW4A 3REVA 4JGMA 3BH9A 1ZSDB 1JMZA 2HFGH 1A6TB 5F7DB 4LLUA 2DLTA 2WIIB 5F44A 2IBZX 4EVNA 2OZ4H 4P5MB 3JBG7 3BH9B 3I50H 1ITCA 1ZT7A 3JVGC 3FQRA 4HUUA 5ITBH 2EC8A 1HKLH 2VZTA 43CAA 4J3SA 1N8ZA 4HPYH 3OB8A 5ID0A 2IANA 1J0IA 3HNVL 5IMLB 5CMAB 3QUXD 4S1DC 4U6HA 3U79A 4NBXB 1UENA 3QDME 1ZT7B 3HC3L 4HUUB 5DTFA 3FO9A 3HMXH 2ARWA 4PY7B 4LPTA 3L3KA 1JNHA 3C9NA 1FIGH 4A6YB 5HHQA 4ACPA 2IANB 1ZK9A 1ZT4B 2AJVH 3ORJA 3BJLA 1KIRB 4PRBA 4PGDA 3N0PB 2WINA 5FUCE 3TJEH 2W9DL 3D3VB 3L3KB 4M5YH 2AI0H 4NUGL 2HWZL 4YFLF 3DVIA 3UMTA 1EDQA 3FHQA 4XVSH 4DUWA 1UEMA 5KZCB 4J2XA 4ZO7A 5IEKA 4KXZH 4JG1H 3G9AB 1YN7B 4JR9L 1G7QA 4PGDB 4U1GC 3QEUA 3KPRA 4EXPX 2A9MH 1A1NB 2P7TA 43C9B 3VW3H 1YYLL 3DNKA 5DMGC 4NUJB 4PG2C 1LK2A 3H9SA 4R0LA 1QYGH 5IEKB 5INDA 2P8MA 5E00A 2DLGA 2VUYA 1JRHL 3ULUE 3D25A 2IPKA 3MJ7A 4OD1L 1BOGA 4RGOH 3C08H 3O4LE 4ODSH 5MEQA 1BM3L 1QR1A 1T1YB 1I7RA 3M8OH 2GAZB 1LK2B 3H9SB 4R0LB 5D7JA 5E00B 4M7ZC 3IJYA 2IPKB 1U8PB 4JO1L 4MA3A 4M6OH 4XPGH 4MXQC 5F7MC 3QULA 1BOGB 1MRFL 1AGFB 4FN0A 5J6HA 1B0GA 4K94L 5CKGA 5MEQB 3LH2H 1YY8A 3SE9H 5M7QA 5FOBA 4ZYKB 3BN9C 3BPNC 1MHEA 5I30L 1G84A 1I9RL 3IJYB 4R96A 1HKFA 4YQXH 4PJEE 4D3CH 5GGRY 3RU8L 3V0VB 4UI2A 5GGQL 3FZUC 3BWUC 2A6KB 4FTVB 4HS6B 5J6HB 3MLRH 3C6SA 4LQ1A 1B0GB 5HGAA 2H2PC 5CSZA 1F4HA 1RVFH 3HG1A 5F7KC 1MHEB 4QRQA 1QVOB 4R96B 4P2OD 1UXSB 4BFEA 4Y19A 2DMKA 3C6SB 4UBDC 1OLLA 4Q97A 1ES0A 1ZHNB 3QUZC 5HGAB 1YEEL 5CSZB 1LO3L 5HGDB 3SE4A 3DRQA 4N90D 1BFSA 1K5NA 3MUGB 3DUHA 5I1AB 3BE1H 1YN6A 3GSWB 4Y19B 4XC3L 3DVFA 2VLRB 5GXBB 3O8XD 3MUZ1 3NA9H 1CVRA 1ES0B 4G8GA 3NN8A 1TJGH 2QADC 3O6FD 3O3UN 3TZVC 4YNYA 5C6PB 1JYWA 2B0SH 2EDEA 4XPHH 4RFOH 2FBOJ 4PJGA 3N85L 1RZFL 1MJUL 4K2UL 3DUSB 3QIWB 4HUKB 2FX7H 2HT2D 2FB4H 4F58L 5C0RH 3P9MB 1A6WL 4R8WH 2QKIA 3L3JB 3MLYH 5FYLL 1A3RL 3O81A 1CL7H 4RDQG 1BVKA 4XP4H 1MVFA 4PJGB 3QIBA 2EH7H 1SJEA 3T09A 3C5JA 5IOPA 1JTPA 4H20L 4P4KD 3KPLA 5KSAC 2MHAA 3VFVA 4CVUA 1CXFA 2H26A 2DQGL 3DETD 4LSPL 3UJJL 4MNQD 5CBAA 4OF5A 3WS3A 5DS8A 3C5JB 2P5WB 1HWHB 3FB5A 1ZGLA 1U8MA 3BDBA 1A7NL 4DVRH 4L4VD 5CFHA 2YPVH 2X89A 5HYSA 1RJCA 1P84J 4J3TA 1QFOA 1HYRC 4JREB 4AIOA 4E42B 5B8CA 2N7BA 1I9JL 5CZXC 3FB5B 3N06B 5E8PA 2QTEA 3KWWA 4HUXA 4NO5B 3EOTH 1GVIA 2CUIA 2FD6L 2I60L 5TQ2L 1MLBB 2OS7A 4O02H 2P8PA 4TVPE 5HI4C 5HYSB 3MNVB 3AB0B 1YEJL 1OTTC 1QHOA 5F7LB 1PYWA 2BDNL 5H35B 3BIAX 3C6LA 3FN3A 1FO0H 4L8DB 1M1SA 4F9PC 3T2NL 3KWWB 3MA9H 1AQKH 4WW2F 1A7OL 4YE4L 3WHXA 1ZHKA 4DGIH 3GKWH 5IMKA 1YDPB 4FZ8H 5F1KC 3PWUB 4ZOEA 3WD5L 5JOPD 1MQKL 5C6TL 3RGHA 4Z7NE 1SM3H 1EJ6A 4JDVB 4P49A 4NKDA 3L7FA 3WHXB 1ZHKB 1Q38A 5IMKB 4BJLA 1Q0YL 1MSPA 5HYFA 4JFDB 4XHJD 3J7HA 2ED8A 1CXHA 1WFTA 1AFVL 4PP1D 4UOJA 4JHAH 1TJHH 3HAEA 3LRHA 5DJ8A 4KZDL 3CUPB 3RVVC 3SDCA 4GRWB 3GMPA 5KN5A 1RJYB 1WCQA 3O9WA 1RMFL 2DQEL 5SWZE 2NY4D 2WBJC 2JJTC 4I3SL 5HJ3A 4RMVA 2F58L 3WE6B 4EI5A 5FYJU 3GMPB 5KN5B 3GRWL 3PWPD 3SKMB 5LWYH 3KLSA 5FUOH 4PJ8C 4RAUA 1DQJB 1E4XL 3X11B 3AGVA 3UTZA 2NY0D 4MA8L 4HQQL 4PGCB 5E5RB 1WWBX 2CRMA 3KS0H 4ZAKC 4PJFE 3ZDXE 3AS3A 4XT1C 4UT9L 3O3DB 1CXIA 3IGAA 3V8CA 1I1AD 2MTPA 1KUMA 4UU9B 3CK0L 4OT1H 1CS6A 5T3ZL 5SX4H 4ZUVA 4DWHA 1OPGL 3CIQA 5AYUL 1YMMA 3MTRA 4F37K 3BQUC 5F1SA 4F33B 4GRMB 4PRIE 1Z5LA 3IGAB 4D94A 3EYFA 2IBZY 2OI9C 5FIEA 1NBYB 3EO9L 1J86A 1UYWL 4FOMA 2CKBH 4DGVL 3IDYB 1YPZF 1MHPH 2R2HA 4JEGB 3O2WH 4YBQD 4OZFG 1CIDA 1YMMB 1I8IA 1JZ5A 1VACB 2P1YA 4I48A 4OM1H 5TDPB 1S78D 4HPOL 2RJMA 1HN1A 3DXAA 3IKCB 1VFUA 4UT7L 1NC2A 1AKJA 4X6CE 4QRRB 4PJXE 1F4YH 1RIUL 4ZNCD 3GSNL 4YAQB 1WVZA 5DXWA 1FL6A 4RGNC 3VI4F 4OCWL 3OJMB 3OG4B 1INDL 1HE7A 1G9MC 4HHAA 4L4JA 2F54E 5BZDA 2R29H 1QNZH 4AIZA 4JQVC 5DFTA 3JSSA 3V5HB 4O9HH 1N26A 3QPXH 2ZCKH 3LQZA 1FL6B 3RQ3A 2JIXA 3CFBB 2XTJE 4Q2ZA 4OKVA 2Z9TA 3Q5OA 3ULVH 4BFIB 5KSVB 1LK3L 2YMXH 1G7IA 4Z18A 3L1OH 2A1WH 4Y4KA 1JCKA 3LQZB 4LCWA 4ESKA 3VGFA 1VGEH 3QIUD 4NQDE 1FBIH 5F7YC 4M93B 2VN4A 4AEFA 1RZ8A 3TJHC 3Q2CA 3GM0A 3AMKA 3SKNA 3WFCL 5E9DE 5IF0A 2J6EA 3STLB 1MRCH 3LAFA 5BMFL 2FWOA 4FFWD 3D69B 3W9DA 4L5FL 5HHMD 1QRNB 1RZ8B 4GXVH 3WL9A 2WP3T 4FQJH 3SKNB 1P5VA 5K9OB 5EBWA 1B2WL 1HH9A 1MCNA 3PWLB 2X4NA 4OGXH 2DAVA 1ZHBA 1MRDH 4FS0A 1LGVA 5EU7E 3P73B 2WWKO 2WWMC 4GBXA 4PGBA 2R23B 3FMGL 4YDKH 4ZUSB 4OGAD 3FQXA 4AYFA 3LD8B 4I77L 5EBWB 4J12A 1V7MH 5FYKU 5I19H 3LMJH 3BKYH 1D6EB 2IFFL 5KAQG 3GJFK 2QJDA 1PG7W 1QFHA 2LTQB 3RVXD 1PX4A 1GGBH 3TO4D 4Z7OF 4FMFA 3MOAL 5F7NC 1SYSB 3P3YA 1G9MH 3FQXB 4GQ9H 3PL6A 2DQTL 2VXQH 3PDOA 1GC1L 5D2NC 2AJ3B 1KEML 4JPIA 4LSDA 1IKNC 4PJIA 5B4MD 1QSEB 4U1SB 3CMOH 1WISA 5GSRA 4DK6A 1JZ8A 1TENA 4OLXL 5L0QB 3UTPD 1H3GA 5IMOA 3IXAA 1XIWA 1BMGA 4MNGA 4L9LB 3V5KB 2GJ6A 3UTTA 4YC2B 2AXFA 4DAGH 2OYPA 2JE8A 5KTEL 2AP2A 2E6PA 2WQ8A 3LSOA 4PJHE 3T65B 1KGCD 5GS0C 4MNGB 2A9NL 3OG6B 1MCSA 2QHRH 3TPUA 1D5IH 3QHFH 1ED3B 4MQ7A 3UTTB 4ZUUA 2EXWC 5KSBF 1Q9OA 2J12B 3MJ9H 3ISWA 4WDIA 3VFPA 5E6IA 4J4PA 1FDLH 2C3HA 3GSRB 3U9PL 5HVFB 1IGCH 3V7MA 4G6KH 1FL3A 5A40E 1DCLA 4NHCL 3ZL4L 1HZHL 2X4TB 1N7ML 1Q9OB 4UV7H 2ADGA 5GGSY 1NBVL 4F7EA 2VDLH 3EZ8A 5E6IB 4ONGH 1EAPA 5D5ME 3LN5A 4IHOA 4PREB 1FL3B 3MBEA 1OTUD 4Y5YA 3FT3B 2YUWA 4HIXL 5F9WB 4BELD 4F7CB 2B2XH 2VR9A 3U0PA 5JIIA 4X6DB 1QLFA 2GUOB 4HK0A 4P5KA 2IADA 4Y88A 4F7EB 3LN5B 4IHOB 3EYUH 2Q6WB 5IGXH 1WAAF 4HUNB 2D2OA 2AV7A 1BZ9A 2BNRB 1KCRL 1RZJC 3Q3GA 3U0PB 1AR1D 1UWXH 3BFOA 4O2CA 1U3HD 4RX4D 3ARDC 4HK0B 2Z4QA 4E41E 1DSFH 2KQMA 2J8UA 5GSVB 3GBNL 4P4KC 1CFBA 1DLFL 3F58H 5E1HB 3L3IA 1NSNL 3WKMH 4X4YA 1WLHA 2YZ8A 2CK0H 3I6KB 3O6KL 1CD0A 2C9AA 2E9JA 3A0OA 3RJDA 3D18B 1E27A 3T0DA 2Z4QB 4KAQL 2J8UB 2A6JA 4KPHL 3SGEI 4S1RL 3L3IB 4Y16A 1JI2A 3MV7A 3HR5B 2Q76B 1PBYA 2ARJB 5GS0H 3E8UL 2X40A 4N90E 3U9UA 4O5LH 1CR9L 1E27B 4QTHA 4G3YL 4XNQA 1U3JA 3C5SA 4M03A 1TCRB 2PW2A 3LRSA 4HT1L 4HS8L 3F7RA 3MV7B 2B1HH 1EPFA 1MCPL 5F9JB 1ERNA 2NW3B 4X4ME 4PY8J 1UKSA 3BISA 5FO7A 2VC2L 4TPRL 3V79C 4XNQB 4XBEH 2PW2B 2VTFA 2NPLX 2DMBA 1CFTB 3ARUA 4YLQT 1CDUA 5JXEA 3KLHC 4KZEH 3S3JA 2SEBA 4X80H 3GMOB 4LCCA 3RI5K 3SO3B 1T0NA 1A0QL 4J7RA 4OFDA 4EI6B 5D7KE 3RFZC 3RDTD 5LAXB 3RTQC 4EN3A 1TMCB 1YEFL 1BQLL 1AR2A 1ZTXL 5D1ZA 2SEBB 3DX8B 4LCCB 4GLRI 5EU6D 5SV3A 1KG0A 1MCKA 5J1TC 4WFFD 1NL0H 4J8RB 1IBGL 2A6IA 4EJ1C 4MNQE 3CFIC 3SDAA 3B3IB 3NCJH 1KEGH 3V4VL 4CDHA 4MAYD 2BHZA 1HHKA 1KG0B 4DUVA 1MJ8H 4YR6A 5TDNA 5C0CA 3VWJB 4F3FA 3UX9B 3CVHL 4OLVH 1NGXB 4UIKL 3ZO0A 3DIFA 4RAHA 2EKSA 4OGYH 2CPCA 3SJVA 4YR6B 3I6GB 3TT3L 4LASL 3B9AA 5C0CB 2EC9T 3E6HB 4XPTL 1D6VL 4XP6H 2XTLA 3HE7B 3VFRA 3UP1A 3LS5L 4HIIA 4M62L 5FDYA 4OZHA 3VFOA 3ZE1F 1KN2L 3RIAF 4Y5XB 5DK2B 3QWRA 3BGFB 5FYLD 3AS2A 1I1AC 4FFYH 5C0JA 2DL9A 1DUZA 4NO0D 3MROA 5FGRA 3VFRB 3JUZA 4KI1A 4NQCD 2EDXA 1OT2A 5DR5H 4U1LA 4K7PY 4U6VH 1CE6B 1CD1A 1CLOL 3BSZH 3EOBB 1NAML 4UTBL 1R24A 3NFNA 1N59A 2HKFH 35C8H 2ITCA 5T1KA 2XOTA 2YPLE 3RVTD 5BVJA 4GS7B 3MJ8B 1JZ2A 5J6GA 4YBQC 4DEPB 1R24B 4BZYA 4LLAA 1KT2B 2PO6D 4X6FA 3HI5H 3QYCA 4HEME 1PY9A 5IVZB 3DSFH 5J3HD 2FYYB 2YKLH 3EOYG 5T1KB 4AEIL 2AABL 5T5NF 5BVJB 4YBLC 3T1WA 5E94A 2ED9A 3VXMD 4XCCH 4Q9QL 3HC0A 1BBDL 5L2KB 4FQXC 4EUPH 5D71H 4X6FB 1T1XA 3L5XH 4FNLL 4RQQA 1NMAH 4GXUN 1F4WL 3NFPA 1K4CB 1S9WA 2RCSH 3BPOB 4L8SB 1E4KA 3RIFF 1EK3A 3AROA 2CLZA 4S1QL 1A1MB 5TF1H 2AJYH 3UZVB 3W5NA 3TH2T 4RQQB 4M48H 4H5SA 1S9WB 1QR4A 5JA9A 4LU5L 5JHDE 3U48A 3QCVH 4RCAA 3KPQB 1NKRA 4Z6AT 1XF2A 1J5OH 4FQLH 4XXCC 3MRPA 1ZA6A 4LLDA 5C0DA 4KK6D 4HV8A 4KQ4H 3V95A 4JFQB 2H32B 4R26L 1FZMA 3RVUC 3AFLA 1X5AA 3S35L 2AXGA 1NLBL 4WWID 5F89A 2VDRL 2AEQH 4NZRH 2Y7QB 1DLHB 3PWJA 1XF2B 5EIIB 5FOJA 4X0KA 4F15B 4JRWA 3OJVC 5C0DB 2EYSB 5EO0A 1W72A 1IQWL 3T0ED 4HV8B 1SJXA 4BQBA 4NPYB 1FZMB 5BZWB 1G9EA 2GI7A 2AXGB 3Q1SL 5F93C 3MRDB 1DJSA 2E6QA 1RZKC 3DARA 4LVHC 4XBGB 3QXVA 5EOQH 2HVKB 3HFMH 5DFVD 1I8LA 3HRZA 3MGTA 2E9BA 4QRPA 4P3CH 1PKQA 2QQKH 3WNMA 4GRLB 4X98A 2EC9U 2IWGA 4LK4A 1KBGL 4Z78A 1T2QH 4AG4L 2OZ4A 4TNWF 2OXGA 1UJTA 1HILB 3PHSA 5I15L 4OZIE 25C8L 2DN7A 3QQ9D 3C8KB 3WHE0 3QFJB 3HRZB 3O4OB 4QRPB 5LGJB 3EJYD 5EC2A 1T4KA 4X98B 3L3HA 1GAFL 3RUGF 4EIGB 5F21B 4LKCB 1YEIL 2ZPKH 4K3EH 4NSKA 5EPMA 3K8LA 5T3ZD 3D9AL 1BECA 1DZBA 4LDLB 5F3HA 2W0PA 5HGBB 4XRCB 3T3PF 1U9KA 3DTXB 4WO4B 2GW5A 4Y7MA 1X44A 2PYED 5T5FH 3HMXA 3L3HB 4PGEA 3MRIA 4MQXD 1F6AA 3V6OA 5HBBA 3AS0A 1EHAA 4QTIH 1NCWL 4PB9L 4RWYH 1T21B 1MFBL 2NY5C 1A9EA 4EDWH 5ADPH 1T5WA 4M1DL 5F1IB 1G9NL 4YK4C 2YUZA 5F96H 3VDAA 5LXGL 1WZKA 4S1SL 3U36A 4IRJA 2K3TA 1JNLH 2XWTA 4XAWH 4KKLD 3LEVL 3FQWA 1A9EB 1F2QA 4K3DH 3O41B 5E2VH 3QR2A 5HHVL 4FQ2L 5I71C 4A6YL 1GZQA 3TVMA 2BHYA 4MVBC 3L9RA 3RGVC 5A43C 2ESVD 1D7FA 1IC1A 1NJ9A 3FQWB 3BMVA 2N1KA 4YDIL 4H0IA 2XZQH 3DMMD 1T80A 4C57C 2ZZUT 4X7FC 4Q0XL 2NX5E 4Z7UE 1MIEH 2EEAA 4XTRD 2WMPA 1U8OA 1PLGH 2VL5B 5DSCA 4U1IB 5DJCA 1IL1A 4NNPL 4DN3H 4KMLB 1KIUA 4TYUA 4M8QB 4JRXA 3LHPL 2APBA 1P4BL 3P0VH 3D39A 4X9IA 4P3DB 4LP5A 1U8OB 2PNDA 5IFHL 4AH2B 5IV2B 3OKLB 3UTPE 3WFBH 2FHBA 2AEPL 1IL1B 5GZNC 4G8IA 1JNJA 4NQED 3VXNA 3F7QA 2XWJB 4WJ5A 3PDDA 3V4UL 5GJTH 3D39B 1LEKA 2ZSWA 4ZO9A 1EX0A 2W9LA 2CMRH 3IF1B 1XR9A 1RUPH 3RWCA 1DBMH 1HIMH 3MCLH 4G8IB 3VXNB 1N0XL 5DT1L 3WHE1 2V7NA 1F4XL 5F88B 3S37X 2ZSWB 4Y89A 3KLDA 1MQ8A 1JN6A 4UNUA 1KC5L 4K9EH 3MNWB 4XMPH 3IAGC 5KOMC 1MOEA 1JWMB 1LNUA 3H9ZA 4LVNC 3H9YA 1H3PL 5E2TH 1JN6B 5E5MB 3PJSA 1TXKA 4G9FA 2NXYD 4N1EA 4KK9C 4BSWA 2FSEA 3DVNA 3PF2A 1JWUA 3L95A 4U1GB 1NPUA 2H41A 5DJAA 3DOSA 1VPOH 2P46B 4JM2A 5BCAA 3R06A 2M2DA 3VU2A 2CGRH 2H8PA 4PJAB 2BVPB 2R0ZH 4BSWB 1M05A 5C3TA 2FSEB 3P0GB 2CLRA 1CDHA 4K7PH 5DMKA 3R0NA 5DJAB 1OAYH 3W2DH 1LD9B 2QR0A 3DVGB 2RFXA 2H8PB 3WSQL 3IU3A 4LARH 4A2MA 3HZYA 5DC9B 2HLFD 3SDDD 1UA6L 5IR1B 5DJ0A 3RZCC 3HC4H 1I3RA 5JDSA 5I8KH 5H37G 3K1DA 5J06A 1BIHA 3C5ZA 3QDGA 5I8OH 3KPNA 4XC1H 1KLFA 2QR0B 5MEND 2DM2A 1G6RB 5JIKA 4CNIA 4KGLA 4Z0XA 3GUTA 1JWSB 4F57H 3AVEA 3B9KA 1B6DA 4BH7A 1L0QA 2VH5L 3D85B 3TT1L 1I3RB 5JDSB 4PB0L 3FAWA 4MJID 5A2IH 1ODAA 3C5ZB 3MV9A 5K9QI 4P48A 2VNCA 3P9WB 4Y2DD 5AAMA 5FUZH 3OX8A 1UM6H 5I1CH 2HFTA 4Z0XB 3P4OA 4WV1A 3GUTB 3SKJL 2O5YH 4I0PA 4HJJL 3DBXA 3ULUC 3B2UC 1DQMH 4P23A 1BX2B 5FHAL 3S7GA 1FO0A 4WY7L 3ARFD 3FB6B 3MRRA 4JO4H 2W9EH 5EFIB 1I1YA 1MREL 3QO0A 2EE6A 3JWDL 1A2YA 3L5IA 1QSFD 3HZKA 5FO9B 1DQDL 3QUZB 3RKPA 5E08H 2VXSL 1FH5L 1FYTB 4X7CC 2P5ED 2VISB 3VFUA 4HLZH 4D9RE 3TYFB 2CKNA 2DBJA 4HF5L 3MRRB 4ZTOH 5DUMH 5C92A 2D03L 1CCZA 5EZIL 2QADB 3CFDB 3ZT5A 1WITA 3Q6GL 3TZVB 3KR3H 4I4WA 4M6MH 3FTGB 3SCMA 3VFUB 5B3NA 1DBKL 4WFFE 5D1QD 1B0RA 2XZCH 4N1HB 5D1XC 2A74A 5FM4A 3PQYB 4QOKB 4I4WB 4DJMA 3B9VA 3X3FL 1B0RB 4P9HH 3F6IA 4UUJA 4PJCA 5ECJE 2DQJL 1KCKA 3LS4H 2EIBA 3JWOC 2IAMD 4NN7C 2NY1C 4APQD 4HUWB 4OI7A 2A74B 2Y5EA 5IB3A 4Z7WE 4I9WE 3VJ6B 5KSAB 1BZ7A 4JGJA 3FQNA 3ARZA 4PRPA 1EHLH 1NMCC 3BWAA 5LGHL 4DTGL 4OZ4A 5HPOA 4UUJB 2ZG2A 5DQDH 3VXPA 3AUVA 5AEAA 5GRVL 4MA7L 2I5YL 2YZ1A 1FG2A 2NYYD 2D7TL 2AJXH 1GPOL 3FQNB 4PRPB 4YBHA 4V1DB 2E5EA 4G42A 1P84K 4GMTH 3ULUH 2BRRH 1FGVL 3EHBD 4NQCE 2A0LC 4FQIH 5KANG 1FG2B 3T4AA 32C2A 5GJSH 1JPFA 5DWUL 4LQFH 2C3GA 3FB8B 3FOMA 5JR1L 3EW3B 3NIFE 2CKBA 3LQAL 3O2VH 1E6OL 3TIEB 2DQUL 5FF6B 4KK5C 3BGMB 1H5BA 4XB7A 3GKZA 2XNAA 3T4AB 3T0EC 2IGFH 4XNYH 4H0HB 4N0UE 1FC2D 4MD5A 4D9QE 1YPZA 3FOMB 4MQTB 1RUKH 2VDNH 2CKBB 4ODUB 1NGZA 4ONOA 4MJ5B 1H5BB 3TFKD 2Y36H 1IAIH 3CDGB 2YS4A 3NIGE 2NQCA 3FL7A 4URTB 4XXDB 5CWSA 2X70A 2N7AA 1II4E 5JQHC 3ARGA 1W8NA 4U1JA 2B4CL 5EG6C 3WNOA 3RWIA 1TJIL 5I73C 2R4RH 5LBSH 3TC9A 1CBVL 1C5BL 1MJJA 3ALXA 4PJAF 2DJSA 1WICA 3VXRE 5FA4B 2D31A 1IEBA 1AGEB 1UFUA 1NAKL 1QBLH 5IT2L 3MLTB 5HDLA 4GFTB 5CWSB 3U30B 5TPWL 1HQ4A 2UZXB 2VDOL 3WN5C 4PJ8A 4PJBE 4U1JB 4OF0A 3BDYL 1DBAL 2V5TA 1MJJB 3BKCL 2ICWI 2VR4A 1QLEL 2WBJB 2D31B 1IEBB 2H2SD 1CDBA 1S7VA 2IQ9H 5JUEH 4PJ8B 2ITDA 3OPZL 3LKOA 3MRFA 2UZIL 1KJVA 5GGRA 3UDWA 1OD9A 2BNQA 3U7WL 2X4SB 1YEHL 1DQQA 3CU1A 4Z7QE 1AO7D 3BPLC 4ZAKB 1Y0LA 3P77A 1AGBB 3LKOB 3MRFB 5GGRB 3MO1A 5F8QC 2XKSA 3F7YB 2WV3A 1HCFX 1DQQB 2IBGA 3BQUB 2ZUTA 1R3KB 1Y0LB 3P77B 4D9LL 2AGJH 2OK0L 3KYNB 1IM9D 2VLME 2OI9B 4IIQA 3MO1B 2GJ6E 1QLRA 3GSOA 2FCBA 2BFVL 3VGBA 1A8JH 2K7QA 5DEGA 3WEXA 4GW1A 4CGTA 2EDBA 1VERA 1WWWX 2GKIA 1XGRA 3MRBA 4P5TD 4KI5E 1UM4L 3AAZA 3PWVB 4GKNA 5GRZA 1MFAL 3T2OA 4K7FA 2R8SH 1FLRL 4PP2B 4L1DA 3GHEH 15C8L 3GI9L 4PIRF 4ZNEA 1VKXA 3DJ9A 2MPAL 3WEXB 1ZKAA 3ARVA 5HHOD 1SBSH 4RGNB 4KTEH 5ACZA 2VLKB 3GHBH 2FEEL 4NT6A 4WHYG 4TTDD 2PCPB 2XKUA 1LP9A 4TVPH 3VGDA 2F19L 3W39A 2OJEA 1MEXL 1D5ZA 2VRAA 1EVTC 1T22A 4OQTL 3FFDA 1CGSL 2ZSVB 5DD1H 4NT6B 4QRTB 4P9ML 4PTTB 5B39B 1S7TB 3DRTA 4GH7B 2OTWB 4M4PA 4MB3A 5GS1C 4X7TB 2XQBH 3L3OB 4WU7B 3D87B 2OJEB 3TA3A 3AM8C 1T22B 4GSDL 5IQ9B 1C5CL 1Z0MA 2BRQA 5D2LE 3MJ9A 4ZG1A 4BQ6A 1IT9L 3F62A 2WUBH 1S7XA 3EZJB 1CYGA 3DRTB 1RJLB 3O6MH 5FKAB 1SJHB 3RWJA 3KXFB 3RWDA 2VWEE 3GO1L 5KSBA 4G5ZL 2AJUL 2E3VA 5IW3A 3TA3B 1T03L 1P6AB 3P4LA 1F97A 4IBLT 4ZFGL 3MLXL 4YXHH 1X5GA 4CDGC 1D5XA 1S7XB 1UADC 2VITA 3MV8D 4M6AA 4PTUA 1H3VA 1W8OA 1CLYL 3RWJB 3T0VA 2XWBA 2NXYC 1Q94A 1P7KB 5DD0L 5DEZA 1G1CA 3NZHH 5IVXF 2G60H 1P7QB 1E4XI 1F90L 4K8RD 2IG2H 3IDIA 4RBPK 3WFDH 1D5XB 2PXYA 2Y4SA 4PTUB 3GSVA 1WCBA 5FGCE 1KPVB 3QBTB 4F7MB 2XWBB 1IEAB 5HY9A 5I1EH 1CU4L 3NZ8B 1CZ8L 5IP4A 4FXGA 1WAAA 2D7PA 5J1AA 4HWZA 1K6QH 4UV4L 3MREA 4XZUA 3O3AB 5GGVY 3WO3B 1HOCA 3WDHA 5D7SL 4POZC 4DK3A 4OCXL 2BSTA 4JY4A 4MXVE 3HE6C 1YNTA 1YUHB 4I0KA 5I17A 1JIBA 2HYMA 4NO3A 5CEZL 4H8WL 2FR4B 4RFEA 5D2NB 4O58H 3V6BR 2UWEE 5JO5A 3LQMA 4R4ND 2BY2A 2NY6C 4LF3A 4HFWB 4QYOA 5D7LA 3SBWC 1R5WA 5I1KL 1YNTB 4Y2OA 5I17B 2MKLC 1CG9B 2XA8H 4RFEB 3GK8H 5EA0L 1CFVH 4YHPB 3WXWH 4Y4FA 3RPKA 3TBYA 5K59E 1L4IA 1A6ZB 4MJ6A 1RK1A 3D3VD 1J8HB 1FE8H 1Q9KA 4LF3B 5D7LB 1P69B 3Q0HA 3VMNA 1AHWC 3PP4L 1I3VA 1GJIA 4R90L 1JUFA 5L88L 5KZCD 5KVFH 4IOFD 2QL1A 2CO7B 3MLUH 5EUOA 2NZ9D 2EICA 3QCTH 1AP2B 3IDXH 4UQ2A 3U4BH 1RK1B 5IM7A 2BK8A 2AXJA 1Q9KB 1NGPL 4GG6B 1CI5A 1DR9A 1TNMA 2HFFB 4WTWA 5IIEB 2BVEA 4YHOL 3EDJA 1M7IB 1Z9MA 3B8SA 4LKXA 5EUOB 4JQXC 2UZYB 3VGHA 4N0RA 3ARPA 1EXUB 3GI8H 1UJ3A 3FO1A 3I84A 4QNPE 1B4JH 2FL5A 1HHGB 5AUMA 3ZMRA 3S3PA 4U0QB 1QFUH 3H9SD 5DJYB 3GMNA 1CLZH 3RWHA 1YQ2A 2YBRA 2JF1A 4GXUM 3MLZH 4HKZA 4GKZA 2BMKB 3VWKA 2WIMA 4ZPVA 4O2FA 4TQEL 3QEQA 1ADQH 2VDMH 1NC4A 2FL5B 5AUMB 3V2AR 3IFOA 2DLIA 3NFSH 1V3LA 3AU1B 3V0WH 1V7NL 5MENE 3I2CH 3DO3A 4LGRB 4POUB 1CQYA 2WUCL 2AJZA 5FYKD 2E27L 1XF5A 4WFGE 3VDCA 4O2FB 4XNUH 3ARDB 3QNYB 4FTVD 3L3GA 4MJIE 3UTQA 2GSIB 3HB3D 4WWKC 1A5FL 4NM8H 3V6ZB 1KJ3H 3UAJC 3VFMA 1OARL 3FHAA 3GDBA 4JHBA 2BP3A 1CXKA 1PQZA 2AJZB 4R7DA 2YD5A 3VXUA 5GZOC 1YEKL 1IC4H 5DJ6A 1JPSH 5HI3D 3W0WA 4JHWH 3UPRA 5BRZE 1A3LL 1FNGA 1FP5A 2QQNL 4I18C 4DKEH 1R6VA 4S11A 1QSFE 5EZOH 3WUWB 4QY8A 4OZFH 1PQZB 2EDHA 4R7DB 3VXUB 3O45B 2CDEA 4OFYA 4GAGH 2VLRD 4HIEA 4XVTL 4WTZA 3UPRB 4ZS6C 1XEDA 1CIUA 1MWAB 5EU4A 2XZZA 3VI3F 1JGUH 5EN2B 4GAYA 4KQ3L 2LABA 3NTCL 5HYJB 5I9QC 4OLZH 2VL4A 2PF6A 1X5IA 4RGMB 4XCFL 3ARBC 2CDEB 1OP9A 4X5XA 3QIWD 4LCIL 4NOFA 4HKBA 1KTDB 4OI9A 3T77A 5EU4B 1TVHB 4GAYB 1RI8A 1I85C 4XMLL 3LB6D 4I2XA 2CRIA 4HWBL 4L3EB 3HZVA 4MHHG 2ID5A 1IC7H 4O51A 4X5XB 1TVBA 5JIPA 3LCYA 3ZLQC 4HKBB 2GT9B 4EUPA 2BVQA 3RTQB 3T77B 1RHHA 4TSCL 1NFKA 3AREC 4NQXB 2IH1B 4OTXH 5I74C 1P9MC 1JGEA 2CUMA 4MX7A 2WQRA 1T7XA 3HZVB 1UVQA 4O51B 3C60C 4F8QA 4EUPB