5I16B

Crystal structure of human germline antibody ighv1-69/igkv3-11
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
213
Chain Sequence
EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 213
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i16B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i16B01
1KEML 4ZSOA 5DTFB 3LRHA 1BHGA 1SJEB 4XCNB 3V9FA 5M94B 4JG1H 4YZFE 1T5WA 1BFVL 2CDFA 2R2BB 3HUJA 4RMVA 4L4TD 4PTUB 4TVPL 2CDGB 4LIQH 5INDA 1UB5B 1C7TA 4UTAH 2HKFL 5DWUH 2H2PD 2R56H 1F90H 1JRHH 4BSVA 1RAMA 5CUSL 5F3BB 1A6ZB 4S10A 2R23B 5ADPH 3VXMA 3OF6A 1MCIA 2V9TA 1LO4H 1E27B 1LO0H 1V7MH 4KXZH 3TN0D 1ZTXH 1S78C 5DD6A 2XPGB 3G5ZA 5L2JA 3SKMB 1JI2A 1NUDA 4XHQA 2UYLB 3C8DA 1HYRC 2BZDA 3GBLA 3DBXA 5L6YH 2PXYB 3S36X 1NC2B 4PP1C 5HHNB 4I3SL 4P2RE 2OL3L 4MMZC 4GKOA 1TJIL 2OP4L 1A02N 1QSEE 2DF3A 3VFNB 4X0KB 1UJ3C 4I18C 4OUOA 3WNLA 1FO0A 3EO9L 4YHYC 5GZOD 2HLAA 4ODHL 4KKCC 1W0WA 2MPAL 2R29L 1NGQH 2ZUYA 4LNRB 4P5TD 4F7PA 3U0PB 4PGDA 4YQXL 5D96C 3NFNB 3U0WL 1WT5A 2F19L 3WSQL 3RVWC 4GRWE 4F3FB 4M1DH 5FM5M 2AK4B 5GRVK 3FB7A 1P69B 3RDTD 4YK4B 2VDLL 4ZS6C 4HUNB 4MS8D 1YNKH 5EOCH 2I5YL 3RUGE 1MHEA 2QQKH 5IFJA 1TCRA 1ZKAA 4RGMC 5KTEL 1CK0L 3IDJA 1G7MB 4HEPG 3RWHA 4M03A 4WJ5A 3RAJL 5CMAA 3LS4H 5E4EC 5F70A 5BRZB 1LEGA 2H9GB 2MSPA 3KPRD 4OQ1A 1QFUH 2VL5B 3NCJL 3NN8B 4WTXA 1V3KA 4R4ND 4YH6A 3OKOB 5EPMB 5FK9B 1S7TB 3MA7A 4P2OD 1I8IA 4HHAA 1A4JA 3MMEB 3OAYK 3EHBD 1XAUA 4HBQA 3RTQB 3BDYL 4P46A 4KI1A 5FA3B 5JHDE 3C5ZD 4G6AC 2NY5L 3O11A 1CICC 3DYPA 3VMNA 2PKDA 4AEEA 1E4KC 2P4AB 5HYJD 3KLAB 1L7TL 4XX1G 5I1GL 4WUUB 5KVGH 3AU1A 3ZT5A 4Z76A 1T89A 2A6IA 4LLVB 3OTTA 4JJ5B 1AXSB 3DYOA 4XPHH 1WFTA 4NRYB 1U8MA 2FWOA 2X05A 1WCBB 5DD3L 3BPNB 3PGFH 5FCUL 2DN7A 3PHOA 5E2UL 1UACL 5DQJA 4CDGC 2P5WA 2ZOLB 1ZHKB 2XQBH 3FHAA 1G7LB 1MFAH 4OV5A 1J0KA 1BQHG 1BIIB 3HE6C 3GSXA 4IIQB 5DVLA 5ALBL 4HJ0D 4XVTL 2W9EH 2D31B 1MI5D 1N3NB 4BZ2H 4GKZB 3PJSA 4DEPC 4LSVH 4G9DA 5KSBF 4S1SH 2JELH 1R5WB 4FZ8H 1IL1B 5I8KH 1HKFA 4PRHA 5DEZA 4M6NL 4Y89A 4WEUD 5C9JA 3L7EA 2OTPA 3ROOB 3SPVA 5EU3A 4U6HA 1BZ9A 4ZAKC 4UIKL 4TTDD 4KUZL 5CBAA 1OAUL 2P42B 1I3GH 4ZOBA 5J11C 3HLAA 4WW2A 3O6KH 3GDBA 2B7DT 3LS5L 1NMAL 1VFBB 4UT9H 5JA9A 4N8VB 2DYPA 2PW1B 4ODSH 5C8JB 2YA0A 4BZYA 1CE6A 4NZRL 1UENA 1ZOXA 2HA1A 4M3KB 1XGPB 2X1OA 1ZEAH 1FP5A 3UDWC 1EV2E 3GJFB 1FG9C 3WHXB 3MLWL 4EI6A 5IK3B 4Q6IC 4JFDE 2X70B 1ZAGA 1UKQA 4XNQA 5GRUL 3VRIB 2VC2L 4JRYE 5ADOH 4X6CF 2J3SA 2XKSA 2FH8A 3JTSA 1CFQA 4JZOA 4XP9H 3GMQA 1HXMB 3DUSA 3KLSA 5DUMH 4Z8FH 5DHYB 4I3RH 4OFDA 3T0EA 4ZXBA 5GGRY 3WO3B 5EA0L 4PJEF 1ERNA 3SDYH 4EDXB 1AGEB 1FORL 2GI7A 4LL9A 1WIPA 2PYFA 1IGCH 2HJFB 1FV1A 1AHWA 1FNSH 4L3ED 4F7CB 5J3HC 5IVXB 2VLKD 4C56E 4PRDB 5LAXB 4RWHA 2Y36L 3ARFA 2VLRB 1YEDA 2FEEI 1XF3A 3KR3L 4JO2L 1PKOA 1CU4L 2W0PA 2K1MA 2Z35A 4NQDE 2X6MA 3RRQA 1UWXK 3BZEA 1X4ZA 4UAOC 1WFOA 5L9DH 5E5UB 2YKLH 1J18A 4X98B 4HG4K 1T5XB 3MJ9H 4XPGH 5CKAA 5GGSY 3BWAB 5JUEL 4X7CC 5JPMA 3B2VL 3HHRB 5BZWB 2CGRH 5FO9A 4XVUC 5AD0B 4JB9H 1YA5A 5L2KB 4X7EC 2IGFL 1EAPA 3SCMC 3W5NA 2EYTA 3CZFB 2Z31B 5D5MB 5JOEA 4WWID 1HXYA 1MJ8L 2P45B 1I7ZA 3GGWA 3I02A 5ERWA 2XWBB 5AZ2L 4ERSH 2FIKB 1G9MC 4JFEE 2WLZA 5C0AD 4HIEA 1CGTA 3BHBA 4IRSB 3RWGB 5C0IA 1J0ZA 1OTSD 5IWLC 2Z8SA 3AROA 5K33A 3L5WB 4TRPH 3MJ6A 1QSFE 2DM2A 3BPLC 4QRUA 3GUTB 4GLRH 1UJ3A 2FX7L 3G6AB 1OCWH 4LNVA 4I18A 3IKCA 3HCVA 3MNWB 5K59E 5SWQA 3VRJB 1HHJB 5C1MB 3DLQR 3R8QA 1DUYB 2NX5D 4OGAC 1BBJB 5F7LB 3IETA 4Z7VF 4IMKC 1LO5A 1OQOA 4N9GB 3DUHA 5FCSH 5EUKB 1I1YB 1UCBH 4HK3N 4KQ4H 4P9HL 5D1XB 3BP5B 3T04D 2J4WH 3HMXA 3B9EA 2Q7YA 2EEDA 4HK0B 5EU7C 3VFWB 1UH4A 3OR6B 3AXLA 2O5ZH 1AD0A 4NN5C 2OMBA 4PIRF 1DQQB 5ANMA 1DLFL 1VGEH 4XMKH 4M61B 5CEXB 3LEYL 5D9SB 5ICZB 1F42A 3DWTA 2HTLC 1WC7A 1S7RB 1TZGH 1WZLA 1I9IH 2CH8A 4HGWA 4U33A 1RJLB 4HXAH 3N1QC 2G2RB 4UV4L 3QFJA 1S8DA 2Y4SA 4YHML 4AIOA 3L3HB 4YHNA 1NBZA 3VFUB 5IFAL 3VXOB 3ULUE 2C3VB 3WFCH 3LQZB 5LWYH 3OKYA 2WBWB 4D0BA 2IEPA 1SEQL 3L3IB 1CICA 5KSBA 3UYRH 4TN9A 3EO1A 5EZIL 4Y1AA 1WBXB 3FHQA 4JZJC 3W0WB 2DMCA 4R8WH 2AI0H 2H8PA 1EZVX 3AMKA 5IG7A 2GQHA 1FZJB 1X6NA 5DRWA 4KJWD 3UTOA 3ARGC 4HCRH 4DAGL 1QFWH 2X44D 5MHSD 1I8KB 2BVTA 1F6AB 1NCDL 1KG0B 4AMKH 4C83A 3OG4B 3LZFL 3R1GL 3KPLB 4YHLH 3WO4C 1TVBB 3HE6A 1VGKA 4MNGB 5E6IB 3SDCC 3PWNA 5IJKC 5DHVA 2IANB 3Q2CA 4HPYH 1VA9A 4Y88A 5FECA 1HSBB 4QGYA 1T4KA 1MHCB 2MJWA 4GJTB 3HRZA 4L8BB 2FGWL 1NGYB 4W81A 1ADQA 5CZVL 1P5UA 1H3PL 1U2HA 4X6CA 3V4PH 5T1DL 3CC5A 3HR5A 4JFFD 3WS3B 3QWOB 4XHJD 5D7LB 1A3LL 2Q87A 3H9SA 3C6LB 2L4OA 1FYHB 3IU3A 1ZLVK 4BFEA 4UINH 3WDJA 2EZ0C 4JFHE 4JRXE 4UQ3B 3TBWA 4ZAKA 3CCHA 3BH9A 5LCVL 2NW3A 2EDYA 3INUL 5FA4A 2PETA 4X6BB 2ENSA 3AS3A 4X8JB 1DCLA 1UWEL 1DVFD 5ETUA 3BGMA 1B4RA 4ONFH 1XR9B 2GYSA 2VDPL 3U7YH 2UWEF 1KLGA 5TDPB 4LLQB 4WTZG 5GSRB 1QLEH 3V2AR 4K3DH 2Y5TA 1ZS8B 4F37K 1R3KB 2R0KL 2BVQA 4N0YH 4YDKH 4G8IA 2FZ3A 5K9OA 1VHPA 2D3VA 3IFLL 1QTYT 4ZUWA 4DVBA 3BKJL 3DMMB 2HT2D 3UDWA 2ATKB 1WITA 2PYEA 2V7HB 2YN5A 3O3BB 4WU7B 2O61A 3FTGA 1QP1A 2D0GA 3FFCB 5JORA 1RFDH 4Q6IA 3KXFD 3BZ4B 3OJDA 4X7SH 5H2BB 4GG6B 4NZUH 4Y5VB 5C9KA 2AXHA 2IH3B 5MENE 2GW5A 5DYOA 4GW5A 1UCTA 3H7BA 5GJSH 1I1RA 3EYSL 5E94B 1EO5A 2HN7A 4YXKL 3EJZC 2ATPB 1MQKL 5EBGA 2Q8AL 4JLRB 1FFRA 4R3SB 5KSUB 1KB9K 5SX4H 3DVGA 3CXHJ 4KJQD 1CT8B 1K3ZA 4HQQH 5D1ZB 1J7VR 4U7KA 3WUWB 4S2SB 4JO3H 5AUMB 4IRJC 4J6RL 4HWEL 5C08A 4UV7L 4CMHB 3MLUH 5ENWB 2IQAA 4FQCL 1ITCA 5KAQF 1MUJA 1QVOA 5FO7A 4ELME 4JGMA 3TCLA 1CGYA 2NMSA 4IEFB 4J1UA 5EIIB 2BSRA 4XNYH 2BNRB 4N0CD 1GGBL 4HT1L 3TIEB 1GHFL 5TQ2L 1HYSD 3S6CA 4KDTC 4TUKH 3UTPD 2YMXL 2EIEA 4RZCB 4O2EA 4X80L 4TSAL 2BVPA 4NP4H 3QZWB 3C9NB 4Z7VA 1KJVB 1TTUA 4GBXD 2FR4B 5DD0L 1LMKA 1AR1D 1L6ZA 3TGXA 2J5LB 1QUNA 1KC5L 3X13B 2VAAB 4JO1H 4HIIB 3OWEA 3QUXA 1IAIL 1JNNL 1JFQH 3PQYB 4HG4J 3OAZH 4IOIB 8CGTA 3D18A 1JTTA 4ETYA 1M6OB 1VADA 1CXFA 4JHAH 2XFXB 4KI5E 2R2EA 3U36A 3VFGL 3KVQA 5T3ZE 5C2BL 1YN6B 4KDVA 5I66A 1F4WH 5IWLA 4NO2A 1X5AA 4Y4KD 4HZLA 5JW3L 4U0RB 4OM1L 4CADB 4YAQA 3ZDYF 3QRGH 1XGTA 1S7WA 2VLJB 1L6XA 3NH7L 5TPWH 1DDHA 1BF2A 4NN7B 3SE8H 2WWMD 4KKAD 5H37H 4R2GC 3RZCC 1BJ8A 4IMKA 1UKTA 3UTTA 3MRCB 1F02I 1JNHB 2E7CA 1A21A 1ZA3B 4CBPA 2B1AH 2FGZA 4S1RH 2AXFB 1DL7H 5HVHC 2R4SH 1FFOA 1DFBL 2G60L 3RWIB 3WXVL 1OGAE 4R26H 4I9WE 1RIVH 4TNVK 4HKJA 4UUJB 5FKPA 3SQOL 2JB5H 3QHFL 4K8RD 5C07E 3D3VD 4XT1C 1ZGLP 4RMTA 1T03H 2FJHB 1VCAA 4PB0L 3U6RA 4OLWL 4XXDA 4C4KO 5DUBA 1RUAH 1JF5A 5J1TC 3QHTC 3ZTNH 1AXTL 2X89D 3TC9A 2A83B 3QUZB 5AWNL 4ZTPL 4HV8A 1PQZA 1KTRL 1MEXL 1RIUH 5TJWK 2LU7A 4JZJA 4PJ8C 3RU8H 3SJVE 4EUPB 3S36L 1UM5L 4H0GA 1WZKA 3V4VL 4TUJB 4ZDHB 3EOAA 4W4NA 1WAAF 3ARGA 2ZG1A 4GMTL 1WZ1L 3KLHD 3NPSC 1F4YH 3MXVH 2NY0D 4P23D 3MRIA 1JGLL 3V4UH 2UWEA 4KTEL 4ZFGH 3PDOA 5JR1H 4PRNB 4B7IA 3BE1L 1INEH 3EOYG 3FT4A 4Q9RH 4YO0B 4LSRL 1G0DA 3J8F7 2APFA 5CILH 3HA0A 5I8OL 1GAFH 3SDCA 3V52H 3QAZC 2YPLB 2ZCKL 1HQ4A 5IJKA 1GC1H 4MXVE 4FQ2H 3VDCA 4H25B 4P2RB 5I74C 5C0EA 5DJ2A 2F5BH 3MREB 4OV6F 5I0ZA 3BXNB 3CLEH 2FSEB 1QSEB 1RULH 5DD5L 1VKXB 8FABB 4CVXB 3DV6B 4XPFH 3PP3H 4BH7B 5T5FH 5DFTA 1NFKA 4M1GL 4YDVA 4IOSD 4MQXC 1QSZA 3NABL 3JV5A 4QRQA 4WO4B 2MMXA 3LSOA 2XWJB 2ARJA 5HGDA 1YQVL 3RY4A 1IGFH 2UZIH 2CMRL 3F5WA 1A9EB 4O02H 4AH2B 5I75C 1S5HB 5JHDD 4UNUA 12E8L 4LOUC 2C1OB 4KMQA 5C0BB 1ZT4A 4HIJB 4L3CA 1A6WL 4M7ZC 4ODUB 3S35H 4R4FL 2FX8H 1MWAA 3EYFA 5A3IC 5ACLA 3S37H 4RAUB 3WFZA 1ZWIB 4UMGA 4PLKC 5A16A 2JB6B 2MKWA 4HJJH 5KVFH 2CKBH 1BZ7B 2DMKA 2ZPKH 4M3JA 2HH0H 3DV4B 5TGBB 2ZUTA 3O6FA 2G5RA 4LF3B 4GQ9H 1MJ7L 1OPGL 1NMBH 1A47A 3T2OA 2EDOA 3LDBC 1NGPH 4L8SA 4O51B 4PJAB 3VFPB 4WV1B 4DKFH 1A7PL 4JFZH 4KKNA 5FYLE 2HWZH 4MAYD 4U1GB 2NYYD 3GKWL 1MCPL 3ZZ1A 1JWUB 4PJXE 3T2QA 2DM3A 3HMXL 4IRJA 1J1PH 2QSCH 3N1PC 1ZVSB 4WY7H 3TT3H 2XTJE 2WBJB 5HI3D 1L9NA 4MCZA 2AEQL 4OIAA 4U7SA 2UVFA 1QHPA 2NY2D 4HWBH 4HMDA 3VG9C 5CHNA 1D5MB 4P99A 3T1FB 3WE6A 4F7EA 4BJLA 5D7SH 3PF2A 2OYPA 4LAQL 5CD5C 4HUXA 4Y8AA 2B2XH 4L4TA 3LV3B 4E41A 1CLCA 4XCCL 3S88H 4Q58C 5HHPB 3LKNA 1ZSDB 1JYVA 4YDIH 3EYOA 5F7WC 3VD5A 2N56A 4HGMA 3HI6H 1UZ8B 4NUGL 1S5IH 3NAAL 3CGTA 5EIQA 4POYA 4UTBL 2EYSB 3X17A 4MXQD 2AGJH 1SJXA 4D9LH 1K4CB 3BUTA 3GK8H 4AG4H 5I15L 1JHKL 4WFFE 1F00I 4D2NA 4JRYD 4KTYA 3V7MA 3RVTC 1XGRB 3GB7B 4I48B 4FQXD 3DO7A 5ALCH 2A9NL 1U8IB 2VZVA 3PWPE 3MRNB 4P3WA 2IBZY 5D2LA 4DWHA 2F8XC 5HGGS 5IBTL 5HHOE 1NCWL 3ULVD 1UXSA 3GMOA 1NCCL 2F58L 1IAIM 1IZKA 1I9EA 4FQ1L 4BFBD 2BX5A 1IFHL 3ZDZE 5C7XH 5GRWA 2EYRB 2BNQE 1I3VA 4JFDB 2IAMD 2VXQH 2APVA 4C56D 1DEEB 5EFIB 1E6OH 1ADQL 1RZIA 4LHUA 5FHBL 1FFNA 3BKCL 4HJGB 1JGDB 3IRPX 5IGXL 3VGGA 4QKXB 3MROA 2PCPA 5HYSG 5BS0A 1IM3A 3EDFA 2HAZA 3IU4H 4NQDD 4NC0B 1LO2L 4Y16D 2YS4A 3KPSB 1OQXA 3I6LD 1KJ2H 1D3CA 3A6CH 3L3OB 5FOJA 2OBGA 1D6EB 3LPFA 1K2DB 1U9KA 1XGUB 5E9DA 1A1NB 1IGYA 4Y5XB 5IT2L 5CSGA 3CMOH 1CS6A 2R9HD 4BK4A 4JFOA 2KQMA 3U2SA 5TQ0H 5I73B 2F54A 2J88H 4P5MA 4HKZB 3GSNA 3TH3T 1GGTA 2A6DA 1I7RA 1Q0YH 2OK0H 3C5ZA 5LGHH 1CTOA 5FYKD 1B3JA 2JIXB 1WEJH 4KK6C 2BY2A 3U4BH 2EIZA 4J7RA 2CO7B 3I3EA 4PJ8A 5T33H 2OR9H 4MQ7B 4JFED 2D2OA 1O5DT 5I1LB 4G8FB 5DRZB 3RX7A 5IW1B 1NFDB 4ZFOA 5CEZH 3RWCB 5T1LD 1U58A 2PN5A 5CZXD 3LKRB 1QSFD 3G6DH 4BFIA 2KQNA 4ZQKB 5KS9E 1G1YA 3MJ9A 3MRBA 3MLVH 1JYNA 2Q20A 4I0PC 3P4MA 2V5YA 4XCFL 5ESQA 3S4SB 3EOBA 3K80A 2I27N 1U8JA 2AQ2A 2PTVA 5C0CA 1FYTB 3SE9H 2I07B 1W72A 5TF1L 1YNTA 2GY7B 5C0FA 1MI5A 2A6JB 1KCLA 3QO1B 4FXLA 1IC5H 1N6UA 3D39B 1FGNH 4YBLC 1T0MA 2Y6SD 4JGUA 3HB3D 4TVPE 2OTUB 1CG9B 1A6UH 3ZKMD 4YHOL 1N2RB 4RISL 1CLOH 3QIBB 2PW2A 3N1GC 3O4LD 5HPMA 2COQA 5D7JC 4BKLB 3ZKQD 4NRZB 1U3HC 2R69H 1R3LB 4FTVE 4XBPA 4EDWH 4XPBH 4GXVL 3AGVA 3WIHA 5TDOA 1CZ8L 4F57L 1FRGH 5F1NA 4ZOAA 3STZB 5IFHL 3QHZL 1FVDA 2YC1A 2DQEH 4KHTL 2DD8H 4LHQB 2ED7A 4NNPL 3S3JA 4N5EC 1NGXA 4KTDL 4A2LA 1CF8L 4JKLA 4OKVB 1G9ML 5EBMB 1FN4B 5DLML 3LQMA 1NBYB 2V7NA 3MV9A 1Q38A 3C5SB 1MFBH 4PLJC 4PRIA 1MLCA 5KSAD 4WW1B 4ZNEE 1MCSA 2DJSA 2ITDB 4OD2A 1QFOA 3CLFH 2KL6A 1ZGLA 3BH8B 5B39G 2D7NA 3K4AA 4AEIL 1T1YB 2BDNL 5TH2B 3FMGL 3L6FA 4PJHB 5C70A 5C0DB 4FZEL 5IJVB 3QCTL 1IILE 4C58B 1SY6A 2C7UB 5DQ9A 3F65A 4P57B 5SWSB 3FQXB 2XRAL 1J87A 4H20H 4M1CC 1NAMA 2VQUA 5F7YC 5ESVB 4I77H 2VDRL 1KOAA 4JFHD 3MXWL 3EJYC 4JRXD 2VERN 5HGAA 1N5YL 4ODBD 4LU5H 1NKOA 2WUCH 2Z4QB 2QEJA 3CFDA 1CIUA 1EERB 1XIWA 3MTRA 4U7MA 5K93A 4M6AA 2OCFD 2NW2B 1I7TB 3F12B 1LK3L 3P0YH 1G7QB 3EFDL 3L7FB 4JM2B 1HEZA 3WUZA 4QHMA 4Z0XB 5D2NC 3PGCB 5HJ3B 3FOMA 4YXLH 2X4NB 1RJYB 4PJCA 2LABA 3QEHB 3MX0A 5ACZB 1J0IA 3IJHA 2A74A 1D9KD 1UFUA 2YOCA 4W68A 1J9CT 4QWWC 4JG1L 5F7MC 3RKDD 5MEND 2CKNA 3ZYJA 2PR4L 2OR7A 1NPUA 1BQSA 4YPGA 2PO6B 4F58H 3ZKXB 2XQYG 4OZIE 4UTAL 4G43A 3CFIC 3LMJH 5DWUL 2NXZB 1FE8L 4XGZA 4PR5B 4YFEA 5D8JH 3V6ZB 2DBLL 4N0UE 1BZ9B 3GNML 4WHTA 4DK3A 1XF4B 4XCEA 1LO4L 1V7ML 1LO0L 2P5EA 4G9FA 3RGVC 4FG6D 3QQ3A 1YPZF 3CDYA 4PJBE 2AK1H 3UBXG 5L6YL 4OFYA 3L1OL 3D48R 5B8CA 2H32H 1C08B 3IDGB 5L7XH 2F5AL 4X5WB 1YUHA 1ZMYA 4HKBB 5DK0A 4MJID 1T80A 1IGML 1UH2A 3QUMA 3MLTB 3FQUA 1HHIA 2RBLA 2DQIH 1INQB 4DN3H 2WUBL 4KKBC 3MLRH 1UZ6F 2EIBA 2NY1C 3QEQD 3VXTB 5JHLH 4M1DL 2DLTA 3IB4A 1JE6A 1CDIA 4LARH 2BHUA 4LRIC 2VXVL 1MWAL 4JEGB 4Y4FC 3WHE0 4K3JH 3IDIA 4FXKA 5EOCL 4RAVA 2ARWA 4PS4H 3WN5B 2GT9A 4GKSB 5IQ9B 1JGUH 1H9VA 4OLUH 5IMMA 3NCFB 3LS4L 5KOVC 5T3ZD 3BN9D 5CD3B 4K94H 2IH1B 2Z8WC 3DROB 5I1CL 3T2PA 5JOPE 3UTQB 5MP6H 4KPHH 1Q1JH 2WIIA 1MIML 3O45A 5HI5C 4TPRL 5DURD 4I0PA 5FHAH 1OARH 1BMGA 4MA1C 1HHKA 2XZCH 4NKDB 1BPVA 2EKSB 5E6YA 4X4YB 3P9MA 5HBBA 3KNBB 4PJIF 5D6DA 5KVGL 1P53A 3S35X 4IOFD 4MZ3A 1KJMB 4PY7A 1OGAD 2P44B 5JQHC 4ZUSA 4X6FB 3LN4B 5DR5H 4XPHL 3FO2B 2L7JA 3HAEH 5C09B 1J1XH 3VA6A 3LCYA 3PIQB 4XWGH 2NQCA 2MWCA 4JCLA 4MWFB 3PGFL 5IV2B 3PG2A 4LKCA 4P4KC 1OM3L 1UT9A 5BJTB 4IDLA 5D1QD 4O58H 4ZMAT 4OUUB 2WV3A 4PJGF 4MCYB 2DKSA 5D7JA 3KPQA 4V1DD 4E0RB 1MFAL 4UOJA 3SKOA 1U3HA 3MRDA 1YN7B 1IC4H 3OXRA 1M71B 2H1PH 1ULVA 5A2JH 4LCWD 5HHMB 4BZ2L 1IE5A 1Z9LA 4I2XE 2YD8A 2ESVB 2E3VA 4LSVL 4JO4H 3OHXA 1X5JA 3GSWB 3PWVB 5DSCB 3TYGH 2XN9E 5I8KL 1YMMD 3NIGE 1YEIH 1UM6L 2FHFA 5C07B 1G9EA 1ORSA 3VWJD 3ARDD 1UG9A 2APBA 2XKNB 3QCUH 4QRSB 2D7TL 1M7IA 2IWGA 3OKNA 4HKXB 3MYJA 4CRPA 4HFWB 3H3PH 5A2LH 1JHTA 1I3GL 1PLGL 2IPKB 3O6KL 5IB2B 3QPXH 5A2IH 1MAMH 1NMCB 1Q9WA 1T1ZA 4UT9L 3C87A 3LKPA 3HI5L 5CGYC 4ODSL 4BK5A 4YWGH 3SJVB 2NLJB 3KAAA 4PJ9C 2BXZA 5GS1C 5HI4D 1HI6B 1KELH 2UUDK 2YK1L 4NM4H 1N5AA 3LKQB 2V6HA 2H26B 1XCTA 2MTPA 5ADOL 4LFHG 5DMJB 1PYWA 1KBGH 2VE6B 4HBCH 1W0YT 4HK3J 4HDIA 5T3XL 1GOHA 3CPLA 5DUML 4Z8FL 1WFUA 4I3RL 1FC1A 4V2CB 1CBVH 4J8RB 4RNRA 3KPOA 3QIWA 3MJ7B 3LKSA 1U8OB 3SDYL 2GK0A 4DN4L 5D72H 5JW4Q 1JZ7A 5FF6B 5D7KD 1QRNA 1IGCL 1FNSL 3JWDH 1CFBA 1YPZA 5ISZD 3P0VH 3PHQA 5D2NA 2APTA 2UZYB 2YD7A 3ECBB 3G5YA 1B0GA 3BP6B 5H35A 5DRXA 5AYQA 4Z18A 3ARXA 4LVEA 4NKIH 3SHSA 1S7QB 2N7BA 4KJYA 3TZVD 3JVGC 1TZHB 4PJ5E 3MNVA 1ORQB 5E1AA 4ZFOL 4RAHA 4OZHB 3STLA 1KTDB 4YX2H 2YKLL 1J8HE 1C5BH 4P49A 2OSLB 3IS0X 3MJ9L 3PDGA 4X6DF 2BNUB 3CC5B 5E8DH 5D7IE 4PBXA 1Q8MA 3O6LH 4D3CL 5DJXB 4LFHD 4NFDA 5F44A 1TJGH 1KPRA 1Y0LB 1C5DB 2CGRL 4F2MB 3WIFA 4RGOH 3D69A 3OJ2C 4KK5C 1GGCH 4JB9L 5FYLD 3V6OC 4XVJH 3ROLB 1RV6X 2XY2A 4QEGA 1LEKA 4JHBA 1FPTH 5IBUB 4L4VA 1W72L 3RGVA 4QOKE 3F7YA 3V5HB 1YEFH 2OQJA 4OZFG 4CU8A 5F9JA 1K8DA 3DO3A 3HUJE 4POZC 4OCYH 3S5LG 3TO4B 3I6KA 3EJJX 1LP9A 1PSKH 4K7PH 5IVOA 3KHQA 3BESR 3UJTH 1FZOA 2FLBT 3BQUB 4TRPL 5F9DC 3TT1L 2VDOH 2AV1A 1FL6B 1AKJA 5LBSH 1RSFA 2BY0A 1OCWL 5EZOL 3CIQA 3QCVH 1IVLA 3IDMA 1X6LA 3QDMD 3QT2A 4DOHE 3C09C 3GJFH 4H1LA 1G7IB 4KRPB 3VXME 3WIHL 2YRZA 4PJXB 4UBDC 4PJIA 3ZE0F 2XTJB 3MBED 3BGAA 5CSZA 1UCBL 3ULVF 5K9KA 2R1YB 4LRIA 1P84K 3IFOA 5LQBL 1I4FA 4Y4FA 4ALAH 3P9WB 1VGEL 2CLVB 1RK1A 3MODH 4WFFD 3AB0B 1YEEL 3FO9A 4HWBA 5EOTA 1DLHA 4JPWH 2QHLA 2V17H 1QBLH 2BCKA 5B3JE 3S97C 3U9UB 4DQOL 1B6UA 5GGVH 3PWPD 3UPRA 1HWGB 3W0WD 2BK8A 3T08A 3VXSA 1RVFH 4WNQA 1L7IL 1JNLL 2KZ1B 1MF2L 4QO1A 5HHOD 1IM9A 1A7OL 3VWKC 2GCYB 3OPZH 4FFVC 2XXMB 3ARBD 4H0IA 1INDL 5LWYL 4GMSH 4RFEB 5DJCA 3NACH 5M95B 3SOBH 3GFUA 3T0DA 2B0SH 3UYRL 3BPOB 4OB5H 2BNQD 5DMIH 3HPJA 1KEGL 1CVRA 1SY6L 1ZLWH 4R8WL 2AI0L 4XCYA 2P8LA 4MNQB 3G08B 5EC2B 4XH2A 5F9AC 1KCKA 2A77H 1NAML 1PGRB 4HCRL 1SBSH 1QFWL 1NEZG 2GJ6B 2ZG3A 4KUCD 5CP3A 4P4KA 3O3AB 3SCMB 3GI8H 4OGXH 4XNMB 5BOPA 3I85A 4AMKL 9CGTA 3UTSD 3CX5K 4IMLA 1KIPB 2GJZB 4XP1H 1NGZA 4KVCL 1EBAA 1WTGT 3C6LD 4P48A 2FO4B 4PV8B 1RJZA 2P1YA 3L5XH 3T77A 5SV3A 2X9WA 3QUYC 3BP7B 5J89A 2BVUA 2PTTA 4GRLC 3PWUB 1P7QD 2QSTA 3DGGA 4U6VH 1I9JH 4LHJB 4KRNA 4HH8A 2NTSP 4NO0B 5I8CA 4HEME 1BFOB 1JPTL 3DARA 3HTLX 1JCKA 3HE7D 1JGEA 4M5YH 5EU6D 4ORGB 5BVJB 1XH3A 4LSPH 1S9KC 3C8HA 1LDSA 2YBRA 3DMMD 4P2QD 3QZWG 1CXLA 2V5SA 4Z7QF 3NZ8A 5F88B 4A2MA 2Q76B 3U7YL 2J8UF 4LCUA 2ZSWA 5J8OA 2P47B 1I3UA 2X40A 2C4FT 4K3DL 4ZODA 5I1AB 4PJFF 2X5PA 1JP5A 3LEXB 2VLLA 3KPTA 2F53A 4N68A 1MIEL 3DSNA 1T1XB 4F37F 3EYVB 4PRHE 3E2HC 1A6AB 2V2XA 1BWMA 1W0VB 1JZ3A 4NT6B 4O2FB 2Z8RA 4PJ9A 1T20B 5GS1A 2XNAB 3DRQB 1RFDL 3VG0H 1A3RL 4Y4HD 3CFEA 4HF5H 3B4NA 4X7SL 1T7ZA 4K3HA 2DLFL 1EHNA 3MUGB 5ICXB 4TVPD 1JTPA 3SDDB 3HC4H 4K94C 5GJSL 2X4SA 5B38G 4F8QA 1IEHA 4MX7B 4X6DA 4K23H 4LVOC 1N26A 5E4IA 4BQ6A 4OZGF 1SBBA 2C1PB 1DP0A 1PKQA 3MGOB 4FTVD 1MRDH 2A2QT 3GO1H 4OLVH 3WNNA 4KKLC 2ZCLL 1ES0B 1JMXA 2FB4L 4JO3L 3WDHA 1U92A 3VXUE 3EFFA 3WFEH 3D85D 3T3PF 4EBQH 4EI5D 1DQJB 2ZCHH 1IGJB 1YEKH 2DLGA 1T2QH 2XXCB 4LASH 4Z0BH 1NCNA 3T0EE 4TUKL 1TNNA 4XBGB 2WIMA 5L8JB 1FJ1B 1TJHL 3AUVA 4JQXA 4NP4L 3OKLA 5I16A 5FDYA 3MFFB 1NLBH 4LCCC 5HGHA 5JOFB 1OD7A 1DQDH 4APQB 3UJJH 2X4RB 4NOFA 4P4RB 4XMPL 5CEYA 4XRCA 2Q8BH 3WNPA 5TE6H 1E4WH 3KS0J 1HKLL 3TA3C 3V6OA 3OB0K 3IXTB 5DJZB 5DK3A 3O8XD 4HUUB 4JHAL 1CDHA 5JMRA 3D1MC 5C0ND 2OMNA 5F89B 4Z77A 3R06A 4U1LA 3SKNB 4X9FA 4RCAA 3SN6N 2CLRB 4QT5B 3I75A 3P4NB 5IKCA 5IQ7H 1RZ8B 1CD0A 2NY4D 4OI7A 1KCRL 1ZHLA 5TFSL 4YK4C 2A38A 2ICWB 1KB5H 2VISA 3HPLB 3U0TB 3VE0B 2HFEA 3MV7D 2DWDB 2BY1A 4FQHA 4ENEC 1P4BL 5DMKB 4M8QB 5GZOC 4M6OL 2B1AL 4DCQB 3WFBH 2BMKB 2E7MA 3OKEA 4S1RL 3GSOB 1DL7L 4JPVL 1NCAH 1C5CH 4DFHA 2IG2L 5ECJE 3PDDA 4NO3A 3H0TB 1TIUA 1DZBA 1C16B 4TNVF 4BSJA 3QUZD 5DEGA 4DZBB 4MS8C 4P59H 4MQSB 3V0WH 4YNYB 1T03L 3T65A 3EAKA 4NQCA 3LB6C 5KANI 3VFVB 3MUHL 1SYSB 5F7NC 3W2DL 2HP4A 5EO9B 3VWKA 2YD9A 3QFDA 1QQDA 5DJAA 1I3RA 3AREB 5TE7H 3TFKD 3JWDC 3OKDA 4F15B 3DHJA 3AFLA 5HYQB 1JWSA 3MRHA 3DX8B 4P2OC 2ITCA 1N64L 1SJVA 1RIUL 2NNAB 3EHBC 4X7TB 3ZE2F 5L8LB 4LLUA 3MGAA 2DQFB 3F8UB 4R7DA 3B9VA 3MOAH 1TQCB 4X8XA 3MO1B 4IIQC 4YHKH 1JPGB 4K71C 4UT6H 1PFCA 1EEUA 1G0XA 4PTTB 1U91A 5E5MA 1QLFA 1F4YL 4KROD 3MV8E 3C8KB 1NLDH 2GHWB 3WLBB 4N0UB 5JR1L 2VZOA 3N50A 1INEL 5F7DB 1EFXA 4HS6A 4FMKA 4HAGA 5KSBE 1TXKA 2CR3A 1GAFL 3L3JA 4M43H 5IB5B 3V52L 4Y1AE 3VXRA 4JY4A 5J56B 3QUYA 1R24B 4KC3B 4L9LC 4ETQB 3CX5J 3DTXB 4PJDF 3V79C 4GRLA 1CR9H 2F5BL 3OKMB 4QRPB 5GGUB 1P4LB 1QFWM 2H32A 4R0LB 2YWYA 4YEEA 3RZCB 3FONA 4MDIA 5T5FL 5JW4M 1VPOL 3Q6GH 3QUKA 5JOPD 1JUFA 1AD9B 1IGFL 4HS3B 4YDJB 3HG1E 5FV1L 4M7JH 3ZT6A 1J5OH 1P9MC 3I6GA 3FCTA 1UQSB 2FL5B 4LKXA 3VXQA 4X6CE 2LTQB 4TVSa 4LCIH 3S35L 1I8LA 2FX8L 4M48H 4NQED 2G5BB 3HZKA 1IGIH 3H9SE 4U0QB 4F7MB 1GCFA 3KPPB 5LGJB 1P1ZB 5KVFL 1KN4H 4LMQE 4GAFB 5GGTH 5F6HI 1UWGH 2HH0L 3CVHA 2J6EA 5JXAL 4PJEE 1T7VA 1J8KA 3VH8A 5DJYB 5L88H 3QDGA 3FQNA 2VDNH 4WTWA 3GBMH 3BSZH 4PRPD 5DTFA 4DKFL 4JFZL 4J3UA 4XCNA 1GIGH 1HILB 2XG5A 2HWZL 3SDAD 4AENB 3NPSB 2R2BA 2PYEE 4P9MH 1XGYH 4QHNB 1JZ4A 1AO7E 3IT8D 2E9IA 4PTUA 1OSZB 4JKKA 2CDGA 4WY7L 3UXFA 1UB5A 1AY1L 1RZFH 3D2UD 2XN9D 2B8OT 1OTUD 5IBLC 1JZ2A 4HWBL 5F3BA 3QAZB 1A6ZA 5D7SL 2R23A 3GSRB 2JJSC 2GJJA 3V0AC 1E27A 1MFCH 5EBWB 2B2XL 2XPGA 2Z31C 3SKMA 5IVXF 2UYLA 4PLNC 1MLBB 4YDIL 1XCQB 2PXYA 4I2XB 1NC2A 1OTTD 5HHNA 3HI6L 4RX4D 4IRSC 5C08E 3H9HB 3VFNA 4D94A 4JDVB 1EZVY 4M93B 4J12A 4BZ1H 4X0KA 2NPLX 4X9BA 4JN1L 3X11B 4AG4L 4DK6A 4FNLL 1ITBB 1IEAB 2MNUA 4GRWH 5ALCL 4YJZL 5CJ8A 3U0PA 5DK2B 1II4E 4YE4H 3JZ7A 3NFNA 2R1WB 4Z7VE 2ILLA 5D1XC 4F3FA 2BERA 2A1WH 2AK4A 2UZXB 1A1OB 4GS7C 4NHCH 2I60L 1A0QH 1CFNB 4JDTL 3VCLB 4FS0A 5DO2C 3S4SG 3NCBB 3BGFB 3FRUB 5D5MF 4WU5B 5JIHA 1G7MA 3VGDA 5CINH 5BRZA 2H9GA 1Q94B 4QHUB 5IB1B 4JKWA 5IW6B 2VL5A 3NN8A 1NUGA 3OKOA 5EPMA 5FK9A 1S7TA 1H8NA 5EULV 1RZJC 3MMEA 4NKOB 3IU4L 4WWKD 1TCMA 3RTQA 5FA3A 3UO1H 1FL5B 1FLTX 2WBKA 5KVEH 4Z7OE 3G6JF 2NXYB 4WUUA 4NCC1 1X7QB 4XPTH 3QIUB 3LIZH 3TJHD 1G6RH 5IMLB 4LLVA 4JJ5A 1AXSA 2Q7NA 2J88L 4K3EL 1B0RB 4NRYA 1Q0YL 1WCBA 4UZGA 2NY3B 3CFDB 2P8PB 3U4BL 4PJ5B 3MACH 2ZOLA 2OR9L 1ZHKA 4BQBA 3X12B 1G7LA 4X7DC 3MOBL 3RVVC 1J8HB 4ZUVB 1BIIA 2HJKB 1FBIL 3ILQC 2XKUA 4IIQA 5E6IC 4XP5L 4B41A 1BJ1H 5CEZL 1JF1B 2A6KB 2HT3C 5DD1H 2D31A 1UWXH 5I6XB 3N85H 1N3NA 3ZHKA 3MLVL 2QADD 3BOVA 4GKZA 5D71L 2H3NB 4M5ZH 2D4FA 1UVQA 1R5WA 2KDGA 1IL1A 2IMNA 3VXMD 3OF6D 1I7UA 2IALB 4OLZH 5T5NG 4QOKB 5BV7H 1EHAA 3QIBD 3SE9L 3QI9C 5A43C 2F15A 3EDKA 4L9LA 5GISH 1VFAB 3MUJA 1AQKH 1Z2KA 1S7SB 1X3DA 3QP3A 4TNWK 1N0XH 1BD2B 3GMRB 3BPCB 5E1HB 1FGNL 1JZ6A 2ZZUT 1TQBC 4FQJL 4P0DA 1A6UL 1H8OA 2ICES 1VFBA 2UWEE 4N8VA 2NTFB 3LN5B 2GITB 2PW1A 3QQ9C 5FUCE 5C8JA 5AZEL 5F7HA 1A3QA 1QPXA 2WSKA 3O2VH 1XGPA 3DXAB 3NTCH 3GJFA 3WHXA 5DS8B 2EEAA 5IK3A 3PL6B 4KUCF 4EDWL 3N9GL 1YEGH 2X70A 1FRGL 4Y5VC 3VRIA 4W6WB 4WFEE 1FGVL 2ARJQ 1P9MA 5F96H 2DD8L 2IJ0C 4ODTH 1HXMA 2EE2A 4CVZB 2I9LB 1MHPH 3FN0H 5DHYA 5E5RB 3TPUB 1HNFA 2IFGA 5E6ZA 1EJOH 4U1SB 4XC3L 5GGQH 1MH5B 2W1NA 2CRIA 5CLTA 4EDXA 1AGEA 5D1ZC 5E7FA 5J1AB 2HJFA 2MKLC 4NRXB 3VGFA 3L95B 1F4XH 2BHYA 4F7CA 5IVXA 4P46D 1D5XB 4PRDA 5LAXA 1OL0A 4M7LT 1ZLSL 2WMPA 3ALWA 4CMHC 2VLRA 4JFPB 3CH1B 1Y18B 2O26U 5SWZB 1T1WB 1KIUA 4CMMB 1NBQA 4XB8A 4GG6F 2ZUXA 3TV3L 4G8GB 4HFUH 4GFTB 4X98A 3OAUL 5E2WH 1T5XA 3HZYB 5TE4L 3F58L 3IJSB 4H20L 3BWAA 3MRMB 4HS8L 1Z3GH 2J5LC 4Q9BA 4BYHA 4XVSH 5BZWA 2P5WD 4BA8A 3MYZA 5AD0A 2JJSA 3JSSA 5L2KA 2WUCL 3H7LA 2KH2B 1YZZA 3CZFA 2Z31A 5D5MA 2OR8A 1PW3A 5FDWB 4NYLB 4YBLB 3MFGB 3OB8A 3P0YL 2DQJL 1VDGA 5E2VH 1JN6B 4QRRB 2XWBA 2VOTA 3BYYA 3UEZA 2FIKA 5F97E 1LK2B 2UY7A 4IRSA 3RWGA 4AIZB 1NAKL 5IVNA 2BFVH 1IAII 3L5WA 4PRHD 4GBXC 5EUOF 4OF3A 2DB8A 4U0RC 3GUTA 2AJZB 2GY5A 1I1AB 1H3XA 3G6AA 4R96B 1T22B 1JHLH 1B4JH 1TETH 2WP3O 3MNWA 5J06A 3VRJA 3ZDYE 1HHJA 4XZUB 1BGXH 1DUYA 3ZDXF 1BBJA 5T1KB 2DM7A 3GMPB 4L4TE 4N9GA 2B5IC 4E41E 3UAJD 1OWWA 5EUKA 3WD5H 1I1YA 1ZLVH 5FUOL 5J0BA 5D1XA 3BP5A 3F7VB 4HK0A 3VFWA 4JY5L 1Q9KB 3OR6A 5D8JL 1F3DH 2RCSL 4L29B 1DQQA 4HPOH 4A6YH 4Y4KC 2AEPH 3QQ4B 3WNOA 1OWRM 2NY6D 4M4PA 4DGYH 5CEXA 3GIVB 1E4XH 5D9SA 5ICZA 4QXTB 1GZQA 1S7RA 1KLUB 1UXWB 1OOAA 1RJLA 3FB8B 3NBNA 1K4DB 2G2RA 2ZG2A 2AK1L 3ULUH 2PF6A 4QTIL 3L3HA 4YHIB 2W07A 3VFUA 1F11B 3VXOA 2C3VA 3LQZA 2E8YA 3LAFA 7CGTA 3T0ED 4ZXBD 4Y2DB 4ONGL 3L3IA 3SKJH 1I1FB 4QYOB 3QISA 5DGQA 3T8XA 4PGCB 1DN0B 1WBXA 1AE6H 1K6QH 4OD3H 3W0WA 2XA8L 4CJ1A 4DN3L 1OAYH 2CPCA 4I4WB 3MLRL 3VXUB 1FZJA 4M8VA 5EG6C 3SDXB 3QPQC 2W0KA 2HFFB 3B9KB 4N5UA 3ARFD 4PGEB 3U1SH 4G6JL 1I8KA 5AAMA 1F6AA 5DZOA 1WAAE 1RQ5A 1KG0A 4TSBH 3KPLA 5T3XE 1D5ZB 1TVBA 1ZHNB 4OLUL 4GKNB 3RGHA 5GIRB 4J3TA 3CVHL 1AC6A 3VXPB 1AGBB 4K94L 3KPRE 3R0NA 4HC1H 4MNGA 5E9DE 5E6IA 2X4OB 1U41A 5ID1B 5EWIH 5F1SA 4S1QL 2IANA 3RIAK 3A6BL 1HSBA 5AG8A 1MHCA 1P7HL 4M7KL 1NGYA 2F54E 4FP8L 2EXYC 4OZ4B 3CAFA 5B3NA 1TITA 5FHAL 3KLHC 3QWOA 2XZCL 4P23C 5D7LA 4ONHB 1X5LA 3C6LA 4ZPTA 1CXIA 2ADGB 2QLVB 4TUOB 4UQ3A 4OLXH 4UB0H 4WO4C 3DJ9A 3O2DH 3SO3B 1D6VH 1FZMB 4MYWB 4D8PB 4X6BA 4PP1D 3MNZB 4X8JA 2RAMA 1JBJA 5DR5L 1J1XL 3MBXH 1XR9A 4MAUL 3CSYB 3FN9A 4TOYL 2BRRL 5TDPA 4XBEH 4LLQA 5GSRA 1LEKB 4L4VB 1ZS8A 1R3KA 5IESH 4LQFH 2GUOB 2OQJB 4KKCD 4O58L 2G9HB 3V8OA 3AC0A 1ZANL 1CLYH 3DMMA 2ATKA 4WUKH 2V7HA 4CJ0A 3O3BA 4WU7A 3L3GB 3FFCA 2CKBB 1LDPH 1QACA 3BZ4A 3IFPB 5C0CE 4GG6A 5H2BA 3VFOB 4Y5VA 3RVWD 4H8WH 1BFTA 2IH3A 5FAAA 1MI5E 3WLWC 5K9JH 3MCLL 3K8MA 5E94A 3UTZB 4NJ9H 2AV7B 3V6BR 2LFGA 4RMUA 5JW4R 1T04B 2ATPA 3B83A 4FN0A 4JLRA 4R3SA 5EORH 1YEIL 5KSUA 3WNKA 1ZXQA 3T4YB 4WV1C 3QFJD 3DX9B 1CT8A 2Z91B 3QCUL 1B9ZA 5D1ZA 1BX2B 3RJDA 1A22B 4U1GC 3WUWA 4S2SA 5AUMA 1U3YA 4OI9A 3BJ91 5MEOB 4BQCA 2WBJC 4G6AD 1EO7A 2X1XR 1EPFA 1RZGB 5ENWA 2ICEB 1CICD 3WKNA 1NC4B 3FL7A 4Y1AD 3TVMB 1FC2D 5EZLB 5FGCB 4LPVA 5EIIA 2BNRA 4NQXB 3V5KB 4MB5A 3TIEA 3IJYB 2EDBA 3QG7L 1KELL 5F1KC 1OT2A 4EN3B 4J4PC 2HKHL 4XPAL 1JPFB 4RZCA 4W6YB 4CVUA 3FT3B 2OXHA 3UCRA 4NWUH 4H0HB 3C9NA 1KJVA 2FR4A 4L8DB 1IAOB 3MV8B 1KBGL 4M7LH 1MCNA 3OGCB 3AS0A 4O2CB 1F13A 1VEMA 1JL8A 2P46B 3X13A 2VAAA 4PJAF 4HIIA 1AGCA 1F3RB 3PQYA 5TF0A 4IOIA 4NNXB 3HE6D 2PTUA 1M6OA 5E95B 6CGTA 4OF6A 4PG9B 4XMLH 4OCNC 5T3ZH 4WHCA 4XXCC 2C3HA 1K3IA 1LO3H 1S7UB 2XFXA 5D72L 3TH4T 3HNVH 4CKVX 1OT1A 4N0RA 4PD4K 4OKDA 3JWDL 2DIBA 2G75B 1YN6A 4JFQB 4L5FH 3IYLW 3ZE1F 3IAPA 3NCYS 3ZYOA 2CQVA 4CADA 3BIBX 5AEAA 3H9SD 4RWYL 4QXGH 1CGSH 3G5XB 4PUBH 3GM0A 2YA1A 2VLJA 4XC1H 4ZAKD 2JCCA 3T77B 2MCG1 1JK8B 3ZTJG 2EDNA 4G80B 5DC9B 3HG1B 4LRNH 1FDLL 2AABH 4PY8J 3NOIA 3MRCA 4KQ3H 5ITFB 1JNHA 1RUKH 4EOWH 1ZA3A 2AXFA 1U6AL 3RWIA 2AJVL 2W0FB 1TJGL 2AJSH 5E8PB 4PJCE 4RGOL 1GGCL 1KJ2B 3LQAH 4XVJL 4UUJA 1CLZL 1BECA 2PYED 2ZUWA 5GS3A 3VU2A 43CAA 4UU9B 2C9AA 1YEFL 2DBJA 3NZ8B 1KCUH 2FJHA 1N6VA 3HMWH 4G6FB 3K4ZA 1NL0H 1Q0XL 4LLDB 5GXBB 4PJEB 1Y6MR 3BAEH 1SMOA 5C0AE 2E6JA 1IT9H 3UJTL 2YXMA 3C60B 2VDOL 4JHZA 2YD2A 2ZNXA 5EC1B 2A83A 3D6GA 1HHGB 1T7XA 1KLFA 1JI1A 2ICWJ 3IDXH 4M9OA 1HINH 4EUPA 2NX5E 2P5EE 1AO7B 1OLZA 4G9FE 3O9WB 5J3HD 2C26A 3DX6B 4TUJA 4ZDHA 1XZ0B 1KFAH 1X44A 3BEVB 5E56A 3VW3H 2FJFB 3CUPB 2GAZB 5KVDH 3RWEB 1MVUB 2HMID 4LLMB 1CL7H 4JCMA 4ALAL 2YD1A 3M1BB 3MODL 3BD5A 1ONQB 7FABH 4PRNA 5C0GB 3DRTB 4LEOB 4YO0A 1QBLL 3VMOA 3ORJA 4JREC 5GGVL 3HS0B 1SM3H 5EDXA 2YPLA 1RVFL 2X1WL 3UP1A 5HTSA 3SGKA 4O4YH 4H25A 4LDOB 2W92A 4P2RA 3THML 1IEBB 3OPZL 3MREA 4I5BB 3BXNA 4MD0B 4XVUD 3AAZB 2FSEA 1QSEA 3QUXD 5ESAB 1BEYH 1CDCA 1VKXA 2X2YA 2V2TB 8FABA 3SOBL 1E6JH 4CVXA 3DV6A 4KGLA 2FCBA 4JVUA 4OB5L 4BH7A 3UZEA 5DMIL 3W11D 1RHFA 2C4XA 4UOW1 1RZ7H 4RGNE 3TIDB 3C08H 1DBKH 4WO4A 1GZPB 2XWJA 1NFDF 3MLSL 4FQQB 4XNXH 5FYJU 4I3GA 3KYNB 2HFGH 4UIMB 3BKMH 1A9EA 4HW6A 4ZD3L 4AH2A 1S5HA 2DOCA 2FEDC 1PD6A 1SBSL 5L0QC 3VJ6B 5MHSE 1WBYA 2C1OA 3CFCH 3GI8L 4OGXL 4NM8H 3LEVL 5C0BA 4HIJA 4Q9CA 1J86A 4NZTH 2Y6SC 4OGAD 4ODUA 4NQTA 4NO0D 2APXA 3GMMB 2ADFH 4RAUA 4IS6B 3UTTD 4MB4A 3DUUB 1ZWIA 3L5XL 1P5VA 2BOCB 4Y19B 4FRWA 3S7GA 2JB6A 3H9ZA 1BZ7A 4MMXC 1JJUA 3U82B 3T0XA 3DV4A 5TGBA 2DTMH 4LF3A 1MFEH 2BC4B 4JANB 5J6GB 1CDGA 5I1HH 4Z9KB 4Z7WB 3ULUC 1I9JL 1MELA 4IRZL 5DQDL 2R1XB 1BAFH 2HTLD 2VKWA 5FYLH 4O51A 2WM0A 4PJAA 1MFDH 4FQHB 3VFPA 3BIKB 4WV1A 5F71A 1U8PB 3OZ9H 1OAZH 4AZ8A 1CFTB 4G3YL 1N59B 5KZCB 1ZVSA 4X4ME 5C86A 1DBMH 2WBJA 3P73B 4ODXB 4NFBA 2Y5EA 1BQLH 4Z5RB 2E7LC 5BVPH 5F1IB 1MRFH 4MLIA 1D5MA 3T1FA 1Q72H 1RU9L 1AXIB 2DQTL 1T3FB 1YNLH 3KDMB 4J4PA 4NO5B 1KCVH 1PZ5B 4NWTH 3LV3A 4DVRL 1G9NH 3O2WH 5E7BA 1RZJL 3ARGD 4PYHA 5HHPA 1KN2H 1ZSDA 3HC4L 3CSPA 4JM2C 2CR6A 1F58H 4K23L 3WL9B 3ZYZA 1UZ8A 1YY8B 2EYSA 1QYGH 3IXAB 4QHLB 1IKNC 1MY5A 1K4CA 5HDQH 3SDCD 1MRDL 3GO1L 3LH2H 2X4QB 4XXCA 3WYRA 1DQLH 2Y25A 5AYUH 3SGEI 1XGRA 2XICA 3GB7A 1ROWA 4I48A 5F9WB 4OZFH 1RY7B 2ADIB 3GSQB 4NIKB 2PO6C 3MLPA 3W9DB 1BBDH 1EEZB 3B6SB 4EBQL 4DFIA 1MCLA 3NZHH 1RK0B 2ZCHL 5DA0B 1YEKL 1N6QL 2NXZC 3OXSB 2P24B 4N1HB 2EZ0D 3MV01 1MHHB 1T2QL 4WGWB 3DETC 3DSFH 1JV5B 1S9XB 5HXMA 3M8OH 3B9AA 4R6UA 3UTPE 3VGEA 1D9KC 2EYRA 4JFDA 3T2NL 1DEEA 4S0SD 3TBVB 5EFIA 3Q1SH 3RKDC 1NLBL 2H32B 1QRNE 4MA7L 1LHZA 4HJGA 1JRHI 1JGDA 2X4UB 1YPZE 3PE9A 4X9IA 1E4WL 5D2NE 4LLWB 2DI7A 2OI9B 4JM4L 3KPSA 4J3OC 5ITBH 4KXZI 4LVNB 3L3OA 1D6EA 4PY8I 5CIPH 1ZV5A 1K2DA 3TWCH 3IFNL 1XGUA 3TBYB 15C8H 1J11A 4Y5XA 2VQTA 1HSAB 1RIHH 3O6FD 5JIKA 1DBJL 2VXTH 1G0YR 3EJZD 5IQ7L 4HKZA 4YLQT 2RGSA 5B4MD 1UZ6E 2JIXA 4HLZG 2SEBB 3RHWK 4OCRL 1GGIH 1BM3H 3IAQA 3N1MC 3O0RL 3QXWA 4MQ7A 4HIHB 3JV4B 3EYUH 4IRJD 5I1LA 4G8FA 5DRZA 4HUVA 1A9BB 5IW1A 1NFDA 3RWCA 1WIUA 3VH8B 3ZL4L 3LKRA 4ZQKA 1C5CL 3X3FL 1ZVYA 32C2B 3RNQA 1KTLB 2CJUH 2ICWI 3IDNB 4KK8D 3S4SA 4B53A 1NFIB 3B9DA 4P59L 4LHUG 4E41D 4RDQG 3V0WL 2DTSA 3D3VE 4LPXA 4KI5C 1FYTA 2I07A 2IADB 2CSPA 2QQQA 1QBBA 1IKFH 3GSVB 3HAEB 5HVGB 3PNWB 4TVPH 2XIDA 3HRPA 4PJIE 2A6JA 3QO1A 2FO1A 3D39A 4IBLT 5TE7L 2HG5B 2V5RA 4NC2B 2FD6L 1IRAY 2OTUA 1CG9A 3O41B 2AS5M 4FXGB 4JDZB 3C2AH 5E99L 1QA9B 4ZG1A 1N2RA 5HY9B 3QIBA 4LEXL 4LCCB 1MJJB 2WAHA 2QQNH 4BKLA 5IHBA 4NRZA 1GVIA 1R3JB 1R3LA 3MOAL 4PJGE 4B50A 25C8L 3VXSE 3PP3K 3TA3B 2CDEB 2VZTA 3VDBA 3STZA 1S9YB 4KVNL 2YEZB 1UJTA 1NLDL 5E2TH 1TJIH 2OP4H 4OF0A 2R8SH 5GHWL 3BISA 5I2IB 4R2GD 4AQOA 2CRYA 3TN0B 4OQTH 4M43L 3EO9H 4OKVA 2Z9TA 5EBMA 4ODHH 1FN4A 1NBYA 5FYJL 4LHUD 3VFMB 3C5SA 4ODVH 1CGXA 3QJFB 4WW1A 3RVXC 4YQXH 5KW9H 5BS0D 1S3KL 3P4OB 3R8BB 3U0WH 2ITDA 2F19H 2ICCA 2LU4A 2ZJSL 3BH8A 5T3XD 3X14B 5BZDB 1NMCC 4N1EA 2VDLH 1V05A 2VABB 3B43A 2FRGP 2I5YH 1T1YA 4MZ2A 5E9DD 5TH2A 2WINB 1F4HA 1VACB 2VR4A 4P5TB 3UMTA 4LAJH 2XZQH 4PJHA 3N1FC 5C0DA 3RAJH 5IJVA 3MLYL 2F54D 5F7UA 2C7UA 2CLZB 1KACB 1U8LB 1A7RL 2RIKA 4P57A 3FQXA 5SWSA 1J5OL 2E7LA 3RDTB 5ESVA 1XF1A 3BDYH 2FLRT 4PJ8D 4F80A 4M48L 2R39A 1IGIL 2VUYA 3SE3C 2Z4QA 5D4QA 3KPRB 4WI5A 1L7TH 2NW2A 5I1GH 1I7TA 3P30L 1S9WB 3F12A 3PWLB 1UWGL 1G7QA 3V8CA 4EQ2A 3L7FA 4JM2A 3F7RA 4P2OB 1M05B 4Z0XA 4OSUH 3PGCA 5HJ3A 1Z9MA 2X4NA 1KXVC 1RJYA 5DD3H 5FCUH 3QEHA 1EDQA 4HUWB 4PJ7B 5ACZA 4H26B 3H42L 1IKNA 3KPMB 2F53E 3E6FB 5C0CD 1A1MB 2AEIT 3SGJC 1UGNA 5HYJB 5I71B 1JZ5A 1GIGL 5ACMA 4K71B 2AJYL 2BSSB 1XGYL 3MQIA 2PO6A 3WS6C 4UDUB 1UVQB 3NIFF 4XVTH 1D7FA 4NJAL 3P40A 2O93L 2AVGA 4PR5A 1TDQA 1I7UB 3PHSA 3FO0H 3ESVF 1Z0NA 4X6DE 4MQXD 3V6ZA 3L3KB 2HVJB 3FO1B 2DLIA 1HHHB 4L9LB 1XF4A 4M6NH 1S7VB 4G7VH 1MFCL 4LLAA 4J3XA 1IC7H 4KH2A 4UIKH 4LOUD 1OAUH 2UY6A 4JQIL 1C08A 5JDSB 5JTWA 3VFTB 3IDGA 4Z7UB 5FIEA 1UB6B 3TO4C 1H15B 4X5WA 4WEMB 3V0VB 1FG2B 2F8VA 3BIAX 3BQUC 1WV7T 3LS5H 4HKBA 1NMAH 5A3ID 2OXGA 3I9GH 4OZHF 2BVOB 3MLTA 2YD4A 1EXUB 3MV9D 4NZRH 4YGAB 4KRPC 4PRID 3ZSTA 1INQA 2XT1B 3G9AB 3MLWH 5I1DB 3CXHK 2XTJC 5GRUH 2VC2H 1EJ6A 3VXTA 4NKQB 4GLRI 2A1WL 3ZE0E 2UV3A 3B2UC 4NHCL 3ULVE 4AQ1B 3WN5A 3U9PH 3AB0C 2OJZL 4NPYB 3FQWB 4GKSA 3SY0B 5IQ9A 2K9UA 4U49A 1R5IB 4G6MH 5CINL 1LE9B 3AS2A 1JNJA 5CD3A 5GRXG 1BQHB 1FLRL 5EA0H 2IH1A 5DDHB 4DKDC 3DROA 5D6CB 3QB7C 2YUZA 4KJPC 4WEBH 3UTQA 1G9NC 3FFDB 4X5LA 3MBEC 4S1DC 3UO1L 4AL8L 2L7UA 3I6LE 3BEWB 4NKDA 1XIWD 2EKSA 3BPOC 5KVEL 2FJGB 4ELKB 4X4YA 3QWRA 3UJIH 3KNBA 1YECH 3RL1B 2LV4A 1KGCE 1KJMA 4L3EB 4XP4H 1HZHH 3LN4A 4OIIH 2VLKB 3FO2A 4X6FA 4HWUA 5C09A 3PIQA 3QH3B 4GUPB 4D9QE 5JUEH 4MWFA 5IV2A 5FYKE 5CP7B 4L9DA 5DEFB 4NUJB 5BJTA 5ELIA 4PGBB 1Z0MA 3UC0L 3MACL 4OUUA 3RVTD 4CVWA 4ZS7L 4MCYA 4E0RA 1RURL 3VXNB 1YN7A 1WUNT 1J88A 1URLA 5C0RH 5EU4B 3B3IB 4AEFA 5E08H 1M71A 4NGHH 5F9OH 1O0VA 1QFWI 4AK1A 3NGBC 5DD1L 3WFHB 3K1KC 3HFML 3MRKB 3NVQA 3VGHA 4OCWH 2GTZB 3WFDL 5I30L 3PWJB 2XYCA 2ESVA 4M5ZL 3GSWA 3PWVA 5DSCA 2P5ED 2HRLA 2FX7H 3GI9H 4ZYKB 4OLZL 4G9FD 2I9TB 5C07A 2DAVA 2LAGB 4D0DB 4WI3A 2XKNA 1PG7H 4OAWA 4OFYD 5GISL 4QRSA 4RMSA 1WWCA 4GS7B 5C0AB 4HKXA 1N0XL 4HFWA 2IPKA 4OT1L 4TNWF 5IB2A 5DA4A 4Z7QE 2H45A 2W0LA 1GZQB 2FATH 1H3VA 2J8UE 3S3SA 4WVRA 4GO6B 1KJ3L 3N06B 2UVEA 4NC1E 2DWEB 4BUGA 3LEYH 4PJFE 4YUEL 2NLJA 3SJVA 4HSQA 2NX5B 1KSRA 3O2VL 1EEYB 3O4LE 2AJUL 5JXEC 4UOW0 1HI6A 1X4YA 3LKQA 4ZNCD 5DC4B 2W91A 2H26A 3VD4A 4L8CB 4Z7OF 1BWWA 4AIXA 3SDDC 2VE6A 2EH7L 1A2YB 4KK6D 2Z93B 4ODTL 1WBZB 5EU5B 3T8XB 4GAJL 1E4KA 1MHPL 4RGND 3BD3A 3GJEB 3EZ8A 1NEUA 1FNGB 3SE3A 4UILH 5H37G 4HD9A 1EJOL 2VDML 1MCQA 3ES6B 4GT7A 4JHWH 4J8RA 4OZGE 5EZIH 3EYQC 3MJ7A 1U8OA 5ICYB 3CU1A 3BDBA 5FF6A 2J1KA 4JG0H 1PBYA 4I0PD 4KMLB 3LVEA 3ECBA 3BP6A 4ONOA 4CNIB 3D0LB 4BQ9A 5SX4I 1S7QA 5I18L 1NCDH 3FQTB 4S0TD 3T3PE 2B1HH 5GJTL 3SGJA 5DJDB 1TZHA 3LZFH 3L5HA 4K7FB 1ORQA 2XOTA 1HCVA 6FABH 1DUZB 3A67H 2HJLB 2J12B 3BMVA 4OZHA 1KTDA 2I26N 3P11H 3WS6A 2OSLA 5IB4B 2F9BT 1KCSL 2BNUA 4APQC 1Z3GL 3VFSB 5DJXA 2VITB 1PG7W 4BH8B 2NZIA 4ZPTB 4EZMA 1XEDA 1Y0LA 1C5DA 4F2MA 3QI9B 3KJ6L 5IEHB 5D7JD 3QDGE 3ROLA 1MREL 1A3LH 1U3HD 3KPNA 4MA3B 5EO0B 5HGBA 2ZSVB 3V5HA 2K3TA 1EEQA 5E2VL 3GIZL 5LCVH 1TQBB 2CIIB 3IDYC 2I24N 1ZHBB 3TO4A 2BFVL 4N5ED 3BQUA 4LCYB 4JFFB 3FN3A 1MJUH 35C8H 1FL6A 2JTDA 2R0KH 3CDFA 4OCSL 1B4JL 1KB5B 1TETL 2OX5A 4OCMC 5ILTH 1G7IA 1BGXL 3IFLH 2ZP0T 4JY6B 4PLJD 3BKJH 1WF5A 4PRBB 4PJXA 2H6PB 1DVFB 4OM0L 3QDJB 5J6HB 1F5WA 1Z9OA 2R1YA 2CLVA 1I8MB 2AEPL 1FO0H 1S7XB 4NQVB 4DGYL 5IP4A 2Q8AH 1E4XL 2IPTL 1RUMH 1K5NB 3UPCA 1FVCB 2A0LC 3U9UA 3KXFB 5IVZB 2X7LB 3UYPA 3OX8B 1H3UA 2E9BA 3ULUL 3OSKA 4M1CD 3FB6B 3T0VA 4W6XB 4Q2ZB 3VFRB 1NCBH 2GCYA 2OZ4A 1KPVB 3EJYD 1V8HA 2AQ1A 4HWEH 3AREC 3OMZA 4UV7H 4KMTH 1K9TA 4RFEA 2AQ3A 4FQIH 4F15C 3ZLQC 4MJIE 4FQCH 3SKJL 3QIWD 1EMTH 1Z5LB 5DJ6B 1AE6L 1K6QL 1AQDB 2GFBB 1DBAL 3Q3GB 1GHFH 1QRND 5TQ2H 1DJSA 2YMXH 4MNQA 2R0WL 3G08A 3ZE2E 5EC2A 1MCFA 4W70A 4OLYL 1TQCC 4MSWB 4WDIB 4CN4A 3HC0B 1AGCB 5JIPA 3QEQE 5F93C 1OAQL 2GJ6A 3O3AA 3SCMA 4H1LG 1JPST 4QWWD 1ODAA 4XNMA 4TSBL 3TFKC 5FGBC 1JNNH 3NIDF 1KIPA 2GJZA 4QCIB 4FFZL 3C6SB 3ZO0A 1X5ZA 2MCPH 3E3QC 1HE7A 2FO4A 4PV8A 2E7HA 5EWIL 5F7FA 1KXTB 4GBXB 3VFGH 3BP7A 3QXAB 3PWUA 1WFNA 3RIAF 5F7EH 2JCCB 4PJDE 5BXFB 4R0LC 5JW3H 2GSIB 1KNOB 4WI7A 4OM1H 1OGTB 3O3EB 4L4VD 1VEPA 4G6KL 4NO0A 3GBNH 2B4CH 3HZVB 3RGVD 5IHZB 1BFOA 2B5IB 3NH7H 5C6PB 4IHOB 1ZA6B 1EUTA 4ORGA 4UB0L 5BVJA 3O2DL 1A8JH 2E9JA 5FXCH 1VEOA 3JXAA 4K55A 3I50L 5F88A 4Y4KB 4EQ3A 2Q76A 1YDPB 1AKJD 2VZ1A 1BLNB 1DFBH 5I1AA 4BSWB 43CAB 4LQFL 4OD1H 3LEXA 4WHDA 2BVEA 2LTQC 1T1XA 1CCZA 2NCMA 3EYVA 1A6AA 2VN4A 4MD4B 1W0VA 1A7BA 4NT6A 4O2FA 1CLYL 2VH5H 1MQ8A 1T20A 3C2SA 1FZKB 4V1DE 4WUKL 3QHFH 4KKBD 2XNAA 5D2LF 3DRQA 1LDPL 1B2WH 2NY1D 1C12B 4OLWH 3MUGA 2W65B 2RJMA 5ICXA 4O9HL 3SDDA 4LCWE 3EIFA 4Y4FD 5K9JL 1CDUA 4MX7A 2NZ9C 3TF7C 4Z7NF 4JAMB 3KGRA 4NJ9L 3BT2L 1YMME 2C1PA 3GRWH 5EORL 5I1KH 5AWNH 4FFWC 2P7TB 4QNPF 4ZTPH 5FM8A 5JZ7C 4RDQF 3MGOA 3W81A 3D3VB 5GGVY 1FNEB 3DECA 3VXSD 1ES0A 1NJ9B 1UM5H 3S36H 3E8UL 3V4VH 4ZFZB 1IM9D 4YC2B 3ILPB 1IGTB 1NDMB 4JN2B 3LKOB 3CD4A 3S34H 5HI5D 5BMFL 3MLXL 4GMTH 1WZ1H 5JPNB 1DQJA 1IGJA 1J1OL 1JGLH 1X9QA 5INCA 1QKZH 4KTEH 3TM6A 1KULA 3J7HA 1CFVH 3BE1H 1MAKA 3EDDA 4LSRH 4RIRB 2VDQH 5IHUL 1ED3B 5I8OH 4PPTA 4XBGA 4PJGB 1FJ1A 3CK0L 3QEGH 2ZCKH 2D4DA 4X99A 4X83A 5JOFA 3MFFA 4APQA 4P4KD 1JGVL 2NY0B 2X4RA 4P4RA 4P23B 1BFSA 5IVXE 5I1IH 1TVHB 2PUQT 3EUUA 5FO8B 4YBHA 1KV3A 1FFQA 1PEWA 2R15A 2VLRE 3IXTA 5DJZA 1A6VL 3QSKB 4M93C 1UKSA 2X4PB 4HUUA 4RBPH 1OP5H 1LO3L 4GRWB 4OQTA 3HNVL 1UYWL 5D7KE 1YQVH 5F89A 3U4EB 5GS0H 1P6FA 3SKNA 1WBYB 2CMRH 4KV5F 3U4AA 5ISZE 5IMOB 4L5FL 3RUGB 4POUB 3I2CL 2CLRA 4QT5A 3P4NA 12E8H 1RZ8A 2JJTC 2MQ0A 3QJHB 5E8EB 4NKMB 4PUBL 2Q6WB 1TPXB 3K81A 2ICWA 4XC1L 4QXUH 1A6WH 3BGFC 3OKKB 4FQPA 4YFLI 3HPLA 3U0TA 3K3QA 3UX9B 4NDMA 3VE0A 1HOCB 2DWDA 2AJXH 5D5ME 5DMKA 4M8QA 2RFXB 2EECA 4EOWL 4DCQA 5JHDB 4DW2L 2BMKA 2HRPL 1JF6A 3GSOA 1U3JA 3GJFK 1WWAX 1OY3B 1MJ7H 2AJSL 2F53D 3GMLB 3VA2C 5KSVB 1DN2A 3H0TA 2VWEC 4PJ9D 5GS2D 1C16A 3BFOA 5HD8C 2ZOKB 5CJOH 4DZBA 4ZTOH 4YNYA 3DPBA 2NXYC 4QY8B 3HMWL 4XWOC 1G6RB 3VFVA 4ZUUB 3BJLA 3DIFB 3GEWB 3QIUC 1SYSA 1DSFL 3BAEL 3G6JE 1PEZA 5CEZD 1IT9L 5EO9A 5HYIA 3UPAA 3JV6B 3AREA 3O3DA 4U1MB 5HYQA 4KDTA 2NY3C 4ISVB 2R0ZH 3DX8A 3MLZL 2NNAA 5IR1B 3QDME 4X7TA 3IDXL 3RVUC 4XAWH 3TBTB 2DQFA 3G5VB 4MAYB 4QRTB 3BP4B 1KF9B 2M26A 4LAQH 2RQ8A 2YD5A 3BUYB 1BQUA 1FIGH 1KFAL 1P6AB 3MO1A 4XCCH 5I76B 1JPGA 3VW3L 2ERJB 1GXEA 2APWA 3CVIL 4PTTA 1JYWA 3SKUD 1PG7X 3TJHC 2NY2B 5I6XC 1MCJA 3C8KA 4NUGH 1ZLWK 4DGVL 3WLBA 1BOGB 4N0UA 4UTBH 5FGBA 7FABL 5F7DA 4TQEL 5BV7B 1XF5B 3ARTA 4MA8H 3LOWA 5I15H 5IB5A 3SGDH 3IVKB 1SM3L 1NCTA 2VR5A 4C59B 3W0WE 4BUHA 4O5LH 1R24A 4ETQA 2Q1EA 3DTXA 4OTXH 4O4YL 2A9NH 3CFKA 4N90D 1OSPH 3OKMA 2E9WA 1U8QB 4KK5D 1VB9A 4QRPA 5GGUA 1P4LA 5CS7A 1JPSH 1BEYL 4R0LA 4U4BA 1BF8A 3RZCA 1NCWH 1NCCH 2EDHA 5L8KB 2VXUL 4D0CB 2VIRB 2VLMD 1IFHH 3C08L 1DBKL 4JRYB 4POZD 1MRCH 4PJCF 5DHVH 4FQXB 1AD9A 4HS3A 4YDJA 2VN7A 5C6TH 4RA3A 4DUXA 2HFGL 3PL6C 5JNYB 1ADQH 2GSGB 1H5BB 2IANE 3BKCH 1KENL 5IEKB 1UQSA 5MERB 2FL5A 3DVNB 3UTSE 4XTRC 4D9RE 1V3MA 2AJ3B 4P3DB 1YY9C 2G5BA 1FNLA 2YA2A 3NPZB 5D7LE 1K85A 1KGCD 5HHXH 1AFVL 4P5KB 2IAMB 4F7MA 1ZE3C 3KPPA 4C56B 5LGJA 5DMGC 1P1ZA 4GW1B 1ZT1B 1FNAA 4D9QD 3C5JB 2AAVA 2DTML 2EO1A 2WZPD 3O4OB 1MFEL 4JVWA 4U3HA 1VESA 1WT5C 3K2UL 4NQDB 1IAKB 1NGWB 5BW7C 4Y16B 4MD5B 1BAFL 5DJYA 4ZPVB 4CUCA 1MFDL 4UQ2B 4HUVB 4R7NB 2EXWC 4NQCD 4WI2A 5EU6E 1HILA 5GGRB 1QSVA 4FFYL 4AENA 5J9PB 4QHNA 3FFCE 2EE9A 4P2QE 4P3CH 3VWKD 4F7TA 3RNQB 1OSZA 3TYFA 5SX5K 4AEHL 1O7VA 3IS1X 4GG6E 2EDKA 1CWVA 1Q9LB 3MRGB 5F21B 3MCKB 5BVPL 4LGSB 4JREB 1Q72L 1QR4A 4KY1H 4GAGH 2DQDH 3GSRA 2ZNWA 1YNLL 4JFEB 5EB9A 1YMHB 1KCVL 5EBWA 3I84A 1G9NL 3O2WL 1H3WM 4E5XB 1FL3B 3ZTJH 5T1LB 2OZ4L 4KDWA 1MLBA 1QSFB 5TF1H 2D7QA 5B21A 1XCQA 4I2XA 1E0OB 5FGRA 5GGSB 4E9LA 5HYSB 1EFXD 3H9HA 1QYGL 4JDVA 3D0VB 1I1AC 5HDQL 3VXRD 3LH2L 3X11A 4YHOH 4R4BB 2DQHL 5EUOE 2ADJB 4KAQH 2BNRE 3QUYD 3VD7A 1DQLL 5AYUL 2B4CC 3N0PB 2M2DA 5L0QB 3EOTH 4GRLD 1IEAA 3TBSB 3BD4A 4G8EB 4WFGE 3BVNB 3VH8G 5DK2A 3RJQB 3ZDXE 1BBDL 1OAXL 2QHRH 2E27L 3KLDA 1YEJH 2R1WA 3NZHL 2JJTA 4X4XB 3QHZH 1J05B 3MGTB 3L5JA 1A1OA 2J8UB 4A6YB 4KHTH 1CFNA 3VCLA 3MRLB 1ZLUK 4NNPH 4LSQL 4ZUTB 4PJFB 3DSFL 3FRUA 3O4LB 1PZUB 4WU5A 3QG6B 4G5ZL 1CN4A 1CF8H 1QFPA 1G9MH 1CFSB 5DLMH 1Q94A 4QHUA 1J0HA 3TNNB 5IB1A 5IW6A 3HAEG 1WWWX 3WXWL 4WHYG 2F74B 3V95A 2EDWA 5FYJE 1F3JA 5FB8B 4N0FB 1OD9A 1EGJH 3WEXB 4EIZC 4PV9A 4NKOA 4OBSA 5A2KH 2XZAH 1FL5A 1F8TL 1OP9A 4CDHA 4Y2DC 4AEIH 2BDNH 2IFFH 4OZGB 3TWCL 1CVSC 4R97B 5I19H 15C8L 3ET9F 4OFIA 1TFHA 2NY6C 5EIVA 4NZJA 2Y7QB 1RIHL 1X7QA 5KSAB 3QIUA 4J23A 3SE4C 4JPKL 5IMLA 3ZKND 2VXTL 1ZK9A 1QLRB 4HCRA 5MEPB 1B0RA 2XRAH 3B9KC 2Z8VC 3ZHDA 2OTWB 3QDGD 2YZ1A 4U1KB 4XNUH 5H94B 2P8PA 4PP2B 3MXWH 4PJ5A 4KKLD 3RHWF 2CIKB 1N5YH 4F9PC 2YD6A 3X12A 3D25B 3MV7E 1J8HA 5GRZA 4ZUVA 1AP2B 5C3TA 2HJKA 4OF8A 1S9VB 4WRLA 1GC1C 1LK3H 3EFDH 3QXDB 5D7IA 1JF1A 2A6KA 1CI5A 3VD3A 3FKUS 1W8OA 2CUMA 5MEQB 5DUPL 5FOBB 3MR9B 2EH8H 5M7QA 2H3NA 4JRXB 3W82A 1DEDA 3ARFC 4F9LC 4X6EB 3FB5B 2IALA 3O6MH 4QOKA 4LIQL 1BJMA 1TMCB 1IARB 1R3HB 1AI1H 1E28B 3MZGB 3SDXF 2PR4H 1IKFL 2MHAB 3SO3C 2PXYD 1VFAA 1NC2D 1L0YA 1S7SA 2R56L 1F90L 1JRHL 4FA8A 4OGYH 1BD2A 3IGAB 4Q0XH 1V7NH 1YJDH 3GMRA 3TA3D 3BPCA 2DQCH 5GS0C 1FE8H 5ADPL 4MJ2A 1MCDA 4JPIB 5B39B 1ZTXL 1D9KB 3C2AL 2DBLH 1RMFH 2NTFA 3AMLA 2GITA 2IBBA 3LN5A 2H2SD 3GNMH 3QNXB 5J12C 5ID0B 5MENB 3FOLB 3L3DB 2QQNL 5E2JA 3M17B 3RNKB 3DXAA 5DS8A 3DYMA 1C8PA 1U3ZA 3PL6A 4LLYB 2YPLE 4Z95H 3L1OH 2AK4D 4U1HB 1D5BB 1CTNA 2F5AH 3RY6C 2X9XA 3MRQB 5E2TL 2R8SL 2A9MH 4PB9H 4CVZA 2I9LA 5IM7B 1NGQL 3TPUA 1IGMH 1KIQB 3MUY1 4OQTL 4ENED 5BRZD 1FVEB 4U1SA 1GOFA 1MH5A 4X7FC 4I0KA 3TJEH 3TNMB 4X5XB 4ODVL 5DZLA 2WUBH 5J1AA 3KYOB 4NRXA 4FHBD 5KW9L 3L95A 4ELMB 3KWWB 1CE1H 1HCFX 1YNKL 3RTQD 1R0AH 1D5XA 2QQKL 5BW7A 1X5HA 3KJ4C 4TULH 4MJIB 3VRLF 2VXVH 4JFPA 1OP3K 1MWAH 3CH1A 1Y18A 5EO1B 5SWZA 5C0BE 2EC9T 1T1WA 3TVMC 1QFUL 3LB6D 1LP9F 4WUUD 4CMMA 2XZQL 5FGSA 2P8MB 4EN3C 3RBSA 3A0OA 4G8GA 3SQBA 1OB1B 5I1CH 3QEQB 3HZYA 3IJSA 43C9B 1QNZH 4N8VG 4NCDA 3MRMA 1MIMH 5DI8B 3RY5A 3CMGA 2QBWA 4TPRH 1CIDA 4NQEE 4PJAE 1DE4B 3S37X 3V6FB 4UI2A 2DI8A 2J2ZA 5FDWA 5IF0A 2DQGH 4NYLA 5IIEB 1JN6A 4QRRA 3UBXB 1OAKH 1LK2A 4OSUL 4PJDB 2AEWA 4AIZA 3QNYB 5DURB 5J57B 2XQBL 2AJZA 1OM3H 1I1AA 2JE8A 1LE5B 2VSCA 3AVEA 4R96A 4PRPE 3ZE1E 1T22A 3MRRB 3GMNB 3OR7B 4GRMB 4XZUA 2KBGA 1ZT7B 2W9EL 3VGAC 4HX1B 3NFPB 1OGAB 3GMPA 1EO8H 5T1KA 3NA9H 4S1SL 2JELL 3FZUC 4FZ8L 5DJ0B 3MRPB 4YBQC 5FKAB 1U8HB 4RA0C 3F7VA 2XACC 3F7PC 3FO0L 5I9QB 1Q9KA 5IMKB 4MNHB 4L29A 4KK9C 5D1QB 3QEUB 3QQ4A 1AC0A 3CDGB 4HLZH 1B6DA 4OAWB 3GIVA 2DM4A 4V1DB 5DJ8B 4QXTA 4G7VL 1UM6H 3MZTA 4YFLF 4JFYB 3TCXA 3BO8B 1KLUA 1UXWA 2W9DH 3FB8A 4UNTA 1IC7L 1K4DA 1I75A 2QSVA 3CH8A 2D7TH 1X4XA 4LCWB 1U36A 2M8XA 4FABH 4M4RA 4YHPB 4U1JB 4YHIA 4B5EA 1PLGH 1F11A 1G7HB 3C60C 1YMMB 2R0LH 3RWJB 2X09A 3D87B 4Y2DA 3RKPA 1ZEAL 3I9GL 2Z92B 1WK0A 3HI5H 1I1FA 4M62H 4QYOA 4PGCA 4JZNB 1R5VB 1DN0A 3GRWA 3VWJB 3ARDB 4NCC2 4C4KT 1UM4H 3SE4A 2YK1H 5JO5B 3O9WC 4I4WA 4XP9L 3VXUA 4LSSH 3SDXA 3ALPA 1B88A 5K9QG 2HFFA 3B9KA 3WIIH 2VLRD 4NHUB 4PGEA 2NR6C 4TSCH 2VO5A 4WFHE 5T3XH 4RQQB 1LVEA 1YC7A 2HFTA 3U9PL 3KPSE 2N4IA 4F9PA 1D5ZA 1ZHNA 4G6ML 3REVB 4GKNA 5GIRA 5T1MB 2EKJA 1AGBA 2EDFA 3VXPA 2X4OA 4DN4H 5ID1A 3GM8A 5IBLD 2NY7H 2ZKHH 4WEBL 3GSNH 1MPAH 1WJ3A 2O5XH 2WWKO 4YXHH 1CD1B 2X4TB 1GGYA 4OZ4A 3E6HB 2K7PA 4F9LA 5L2KD 4YEFA 3EGSB 5I1JH 2A73B 2HMIC 4ONHA 5L9DL 1CDJA 5CFHA 2IF7A 2Z31D 2DI9A 5E70A 2HVKB 2ADGA 4ODWB 3UJIL 4XPGL 2EDDA 4TUOA 1YECL 4CW1B 3CU7A 1FZMA 4D8PA 3MNZA 4WI9A 4IRSD 4XP4L 1HZHL 4OIIL 5ISZB 1NFDE 2EDQA 4PREB 3CSYA 1NDGB 5CWSB 4D3CH 4YDLB 3KPNB 4ZSOE 2AKRB 4HWNA 3HI1B 3TZVB 5HGBB 2GUOA 3L9RB 3QUXC 2G9HA 4U6XB 2DQUH 1W72H 4ERSL 4KHXH 1ACZA 3T1WA 2EDEA 3L3GA 1HQRB 3W11C 2CKBA 3M45A 2LU3A 5C0RL 3IFPA 1FYTE 1JWMB 5E08L 3VFOA 5D1XD 4NGHL 5F9OL 1Z6JT 5I17A 2CK0H 1NBVH 2YWZA 3LRGA 1A5FH 4OCWL 3RY6A 3G04B 4HWZB 4LBEB 3D39E 5DO2D 4F33B 5HDBF 5C71A 3UTZA 3TT1H 2AV7A 1T04A 3GI9L 5EZOH 4AM0B 3HN3A 4EVNB 3NCYP 4ZOCA 5HHVH 3T4YA 2BJMH 4I13B 3DX9A 1V3LA 1R3IH 2Z91A 4KQ4L 3WIHH 1BX2A 1PG7L 2J4WL 2FX9H 3G6JB 1SYVB 2O5ZL 4MDJB 1AGDB 4HAFA 5K9QI 4XMKL 5MEOA 2V9QA 4WI8A 1RZGA 2FATL 5LQBH 1TZGL 2ICEA 1I9IL 3JWNC 2E8ZA 1NC4A 4HXAL 1PY4A 1LNUB 2R2HB 4GG8B 3QDMB 3TVMA 5EZLA 1YEEH 3W39B 4NQXA 3TEUA 3V5KA 3IJYA 4DQOH 5GZNC 4EN3A 4M00A 1JPFA 2Q86B 3MBEB 2W60B 3WFCL 3FT3A 2IC2A 4Z7WF 2MOVA 1G7JB 5I1EH 1L7IH 1JNLH 4L8DA 1IAOA 1MF2H 3MV8A 1A7OH 3OGCA 4O2CA 1INDH 4LVHB 2BSTB 3RVVD 5E00B 4UILL 3U30C 4NNXA 1XFPA 1RZKH 4JRWA 2O5YH 4G42B 3ILQD 4JHWL 4J2XA 3PWPB 5E6ID 4PG9A 1KEGH 3HNTH 1SY6H 1S7UA 2HLFC 2HT3D 2IAND 4PJHE 4OZFB 4I1NB 1RI8A 5HHOB 5F9WC 2G75A 1GYAA 3IDUA 4JFQA 4JG0L 1NAMH 2HT4C 3DX7B 3BWUC 3S5LB 3ARBB 4DZ8B 1NSNH 4D9RD 5SWSE 3RL2B 4YHLL 5D7LD 2Y1VA 1YJDC 2BNQB 3PABA 2B1HL 3BZFB 3G5XA 1MCCA 3QI9D 1MCBA 5E8NB 5FUCC 3WUWG 2KKQA 6FABL 4JFXB 5C0JB 3A67L 4UDTB 4HPYL 3NGBB 4KVCH 4XI5C 1JK8A 2YR3A 4G80A 3P11L 1PY9A 1VSCA 3HG1A 5DMYA 2N7AA 4PBVC 5ITFA 2YSSB 3V4PL 3GHEH 3IF1B 2QR0B 4Z6AT 1W8NA 1GGUA 2W0FA 5CBEB 5E8PA 3QQ9D 2QKIB 2YN3A 4MVBC 3Q6FB 4UINL 3UTSB 5LVEA 2OI9C 2P5WE 1KJ2A 1MCHA 2IPUK 3U7AA 5CIPB 3FRPA 1A14H 1JPTH 3FFCD 4LVNC 4UU9A 2HTKD 3QA3B 4ONFL 3RZWA 2DDQH 5IB3B 1T7WA 1QLEL 1BVLB 1SEBB 4LLDA 1T21B 4PJEA 1P7QB 4J3VA 4N0YL